4DCTA

Crystal structure of b. subtilis enga in complex with half-occupacy gdp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
432
structure length
401
Chain Sequence
KPVVAIVGRPNVGKSTIFNIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
total genus 116
structure length 401
sequence length 432
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dctA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dctA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dctA01
1BOFA 1P2VA 3SBEA 3RRNA 2QGZA 5JJIA 1K8RA 4NCNA 1JALA 3V00A 4Q9HA 3VR5A 1XJQA 3NG1A 4US0R 5JJLA 3QBTA 2YOHA 2FE4A 3NDPA 5AUNB 1N6RA 1KNXA 4EPYA 4RZ2A 3DHWC 3CJEA 2ORWA 4PQFA 2FU5C 4YMSA 3GLIA 4NHOA 1E2FA 4PO8A 3AH8A 4EPWA 2GCPA 1BYIA 4QBIA 3U4QA 3HYRA 1KIMA 3K09A 4P33A 2E9SA 4MRNA 3T15A 2JASA 2XXAB 1R8QA 4GT1A 1WXQA 4JI7C 4JLNA 5FTNA 2FWRA 4BGDA 1E6CA 2GZAA 1II8A 4RZUA 2O8EB 2X77A 4ABYA 2ZI4A 2PT7G 3M1IA 2REOA 4RD1A 4LJ7A 2GK6A 1IHUA 1R0YA 5J47A 1JB1A 421PA 1E0JA 2WAYA 1GNRA 3IILA 1KHTA 2CVFA 2FMXA 3K0FA 4NYMQ 2AR7A 1G3UA 5D3QA 1COWA 1OH5A 3GJ0A 2BMFA 4LFAC 4F92B 2N46A 2VHJA 4DB4A 2D3WA 3J81D 3UKDA 2D7VA 1E94E 4A6XA 4M1YA 2O0KA 3VR2A 1NLYA 3G5UA 3KFVA 1AS2A 2QQEA 2JJ1A 1X8KA 5EUQB 2ZU6A 4MRSA 4B47A 2I1VB 5SZJA 2FJUA 4PPFA 5L8VA 1IN6A 3THXA 5B30A 4FWTA 1ESNA 4ZIRA 1NY6A 2HYDA 3OIYA 1P62B 1DG1G 1N0UA 2CCKA 2O0HA 4LK2A 2GAOA 3ZDQA 3E2IA 2WWYA 3TVDA 1DO0A 1F6BA 3IQXA 3KKMA 3U3MA 4AY2A 2B7CA 3WNDA 5EQTA 2ZJZA 4JYAC 2ZAMA 1GKIA 2YYZA 2QZ4A 4I1UA 4V0KA 5FUVA 3H84A 1R5OA 3PCRB 3QUSA 1TEVA 2VHUA 4WZ6A 2PL3A 4MH0R 1R10A 4UQOA 3IIKA 2DWOA 4PAMA 5EXXA 1E2EA 2W6IA 3DDCA 1VMAA 2HF9A 4TN1A 1FFHA 1UPTA 1T3SA 2X2FA 4TMTA 3QKUA 3EIEA 4OHVA 1M7GA 1FOEB 1VG1A 3IIJA 4OYHA 1E96A 5BXQC 3PENA 4A4DA 1OIXA 4JL6A 4HZUA 5EE0A 2HLDD 1UKYA 1XEXB 4Q01A 3SYLA 4CYMA 3SQWA 3E5HA 1OIVA 3PEVA 1R4AA 4N0EA 3KB1A 3FHOA 1MABA 1RRFA 2QM7A 2ZI3A 2K5UA 4QM7A 1GSIA 1R5NA 4HDCA 4BE7B 1W7AA 3PG5A 3TLXA 4AK9A 1VHTA 1P5ZB 2DCUA 4HAYA 3RHFA 2ZVPX 2C2HA 5JI2E 5LDDC 1DAEA 1LF5A 2OZEA 2OUKA 1GL9B 4IVQA 3S1AA 4Q1DA 5CYOA 1CF4A 2CLSA 2QP3A 3ZLJA 3W6PA 2PEZA 4RY2A 4DV4C 5JMTA 1U99A 4KFRA 4LPSA 1KO5A 1OXSC 4Q1CA 2X8AA 2Z43A 2ZRLA 4BEJA 2ZRHA 3BJIC 4Q7LA 1OB5A 3SJCA 4L9WA 4BFWA 3DKPA 3PQCA 4RFSB 3Q8XB 1CRPA 4A8JA 4CW7A 3UANA 4IDPA 1IBMC 3LXRA 2BIFA 4RFSA 3K70D 1ZNZA 3MG9A 4B3BA 2HT1A 5GJBA 4AKHA 3K1JA 3R8CA 3B85A 5FOWA 3CRVA 2OCPA 3RS4A 3QY0A 1G3QA 1RJ9B 1QVAA 5EE1A 2OXCA 3DMDA 4KLZA 4RZXA 1AGPA 1XWIA 3B1YA 4UNSA 1GAJA 1GRNA 3KQHA 2ZRPA 4TSFA 3X2SA 4KBGA 4NL4H 2DBYA 2J87A 4Q9JA 2E8EA 3QENA 5EE9A 2UUCC 4Q00A 1KK1A 1JI0A 2ZXUA 2O8CB 2CDNA 2R8RA 4TT3A 4X8MA 5UKDA 4URVR 4BFTA 2MMGA 3I32A 2DB3A 4A0HA 2NTYC 2ZI6A 4WVFA 2XTMA 4G1UC 4ZKEA 2EVWX 1OE0A 2G6BA 4AI6A 3B5JA 2CK3A 1BKDR 2H18A 4HLQB 1HTWA 1E9FA 1HYQA 1NN0A 2ZSAA 3BFKA 3VAAA 4AYTA 2W6JD 4MDEA 4M1TA 1OH7A 5K8TA 2FFHA 1FNMA 3ZS8A 4NXNC 2QMHA 3GLHB 1NVWQ 1FZQA 3L0SA 2BBOA 1UBCA 1SZPA 3LVRE 1GRRA 2QI9C 1X6VA 4JLAA 5JI3E 2P6RA 3EZ6A 1FUKA 4AD8A 2CL7X 4CT4B 3AF6A 5K8IA 1Q1EA 1XXHA 3VR6A 3MLEA 1CTQA 4KYUA 2FDCA 3NBYC 4UNPA 4IOMA 3ADBA 3EPLA 5F9HA 4NDZA 2KBFA 3D6TB 3MSXA 1RE0A 4BFSA 3LO5A 4D0NA 1T0HB 1JPJA 2BEKA 3CPJB 3CIOA 1SVWA 4RCYA 2VEDA 2OBMA 2YWFA 3C5CA 4C7OB 3MMPA 4IXMA 3WBKA 4Q48A 2JAQA 3QI2A 2WSSA 2GJKA 2MSDB 4MGZR 1DVRA 3CNLA 2ONFA 4BQSA 4EAQA 4GP6A 1H8ED 5CLQA 5LBIA 4DDWA 4LZZA 3T1QA 1VCOA 4ZCIA 2IXFA 1LY1A 4E07A 2WMNB 3DM5A 4HLUA 4NKRA 4GDFA 4DV7C 2P5TB 1D9ZA 1XB2A 1J7KA 4PX9A 3I8XA 5DH9A 3IEVA 2QL8A 4JKYA 4M9QA 4UJ3A 3SC3A 8OHMA 1KK0A 4EFNA 1I4TD 1Q3TA 1I2MA 3SBDA 2PJRA 2J41A 3SYNA 1H65A 1D2NA 4MKHA 5IK2A 3CRMA 3EWSA 4CIDA 3LW8A 2IF2A 1X8JA 4FMDB 3EERA 3PR1A 4FW9A 4FCWA 4LRWA 3R7WA 3VTKA 4DV0C 1OXXK 4NMMA 4B2IA 5DYGA 4OI0A 1NRJB 1ZBDA 5A4JA 3EPJA 1SXJE 4TL8A 1W36C 2VYFA 4K0KC 4QHYA 3JVVA 1NN5A 1UEJA 1N33C 1T8UA 3FGNA 3TRFA 4ZDKA 3CF0A 2ANCA 3RWMB 5C4MA 4I1VA 2ZRIA 3QPUA 4XVQA 5FPSA 3I07A 2VRWA 4IEEA 3LQRA 2LKCA 3TVTA 4A0FA 1XEWY 3PUYA 3LV8A 2BJOA 1MO4A 2FPMA 4DIEA 3P27A 1Z07A 4TMVA 4LYJA 5LB4A 4OX9C 3SFZA 5HCIA 2ZEJA 2BM1A 3HDTA 2J1LA 3JZMA 4MA4A 2GK7A 2RGBA 4Q7MB 2W58A 4NBSA 4LI0A 2GXAA 4DLXA 4Q9LA 2UU9C 1T3LA 1SXJD 3ICQB 1VYTA 2A30A 4G5GA 5EP4A 5LMNC 4JLDA 2WAXA 1WB9A 3DOEA 2D2EA 2CXCA 3B1WA 3KQUA 3THWB 5G3ZA 2OESA 5G53C 2YNMA 4IJMA 4LHWA 2BCGY 1R0ZA 2C5LA 3V4RA 4JVNA 2C99A 5DHFA 3RNLA 4IRUB 4EFMA 5FBVB 4BZQA 1XTQA 1NVVQ 2QUZA 2I3BA 5SZIA 3H2YA 5KTYA 1II8B 4LF6C 1W46A 4BZPA 3LFUA 4OL0A 1BMFD 2ZRJA 2RKOA 1US8A 3O47A 4AIIA 1N6LA 3PVSA 3AGPA 5CYPA 1DS6A 4IFBA 1U94A 1ELOA 3VNUA 2AWOA 3KJGA 4LBZA 1FX0B 1Q21A 4LHXA 1P73A 4I81A 1YJ5A 4CEIA 3FKQA 4AG6A 2JCSA 1H8HA 2IA5A 1G5PA 1OFHA 2RGNA 3BAFA 1MRNA 4YC7A 3HU1A 2Q3FA 4HLCA 3SE0A 5HPYB 4IVRA 5FL3A 1W1WA 1EESA 4U7DA 2ZI7A 4MUBA 5GJWC 4CGZA 2EYQA 3ND8A 1JJVA 2AFIE 3EIQA 1KY2A 3VHXA 4KI0A 1NKSA 4DR4C 1R6BX 4GRAA 4MYUA 4KHPC 2OFOA 2VF8A 1J8YF 4AG5A 4C0SA 3U2QA 3ZZ0A 1K0RA 1G4AE 1KJZA 4KVGA 1JPNA 4BFYA 2VP5A 1P60A 4D80A 4BLQA 4EPTA 1OXUA 4MKFA 1QHHA 4V03A 2Q9BA 3K0AA 1SULA 1ZM2A 2QTVB 3I8SA 3FPAA 1SHKA 4QHSA 2AL7A 4OI2A 4DDTA 1E0AA 2CXXA 2ERXA 1CR0A 1WA5A 821PA 3KTAA 3K0CA 2GF0A 4D6PA 3RWOA 5EXSA 4LDJA 1BS1A 1RKBA 4JSTA 1KI6B 2GZHA 1E79A 1VYUA 2PH1A 3W3ZB 5TB5A 2Q0HA 4WAUA 1C4OA 1S9DA 2OAP1 1Q3HA 3K9NA 1E4YA 3NC1C 2FOLA 4TYQA 1Z22A 2ZJOA 4JIMA 4JYBA 4DUZC 4QJ5A 3HWSA 2ATXA 3KXLA 1KDRA 1D8TA 4WZAE 4M9XA 4MTNA 4K46A 2FGJA 4OBEA 1M6NA 4KBFA 1II9A 4L8GA 1O87A 1Z6GA 3T5DA 1N0WA 3D7MA 4M53A 1YR7A 2OBLA 4QBFA 3L8ZA 2AKYA 1TF2A 1KI9A 1NIJA 1S0UA 1JNYA 3BH7A 3Q5DA 2WOOA 4H1VA 4D4JA 4N3NA 1HT2E 3LX8A 1Q22A 3KDSE 1VHLA 3GFOA 1E2QA 2ZR7A 1OXTA 1UF9A 1XTKA 2FFBA 3ETLA 4NH0A 2RGXA 4TLCA 1KI4A 2XTZA 4CT5A 1KKLA 4W7SA 3IPYA 4DCUA 1COWD 1YR8A 3CZQA 3TR0A 1MOZA 2QROA 1W0JD 5EXPA 4LGMA 2PCJA 3MUFA 2QY9A 4JL5A 1G9XA 5FI1B 2ZYWX 4EJSC 4TYYA 2OCYC 1CRQA 4B3CA 3BB4A 1EFRA 3WP0A 2BM0A 3BERA 3CB4A 2F43A 4IFEA 4L16A 1TQDA 4B43A 4D82A 1NKTA 4A82A 1JAHA 3C4JA 4MITA 3AF1A 3KUCA 1OB2A 3B13B 1NG9A 3GJ8A 3O8BA 4KFSA 2VQFC 1G17A 4US1R 1M7HA 1JR3E 1RIFA 2XEXA 4YONB 1U0HC 1XTRA 1ZNYA 2EWWA 3X1WA 4CZ2A 4TYWA 4NOZA 4JI4C 1K5GA 2OAQ1 1GP2A 1L2TA 4B48A 1OT3A 1AKEA 3EARA 1XTSA 1IBRA 2HEIA 2PEYA 3AVPA 4K8OA 1G3RA 2VLIA 4NCKA 2R6DA 4LBWA 1MO6A 4NYJR 3U60B 3AF0A 2HHHC 1S1MA 4X62C 5JJKA 5EE3A 1YR9A 2ONKA 4DEYA 3ND9A 1ZD9A 2CL0X 1Z6TA 1E9EA 3MWJA 4FD2A 2PZFA 3WXMA 1FMJA 4F93B 4KVAA 5FBQB 2I1QA 3WHLA 2XGJA 1UAAA 2MSEB 3RYTC 4A92A 2OT3B 4OQFA 4PSAA 4C3ZA 1Z83A 3CRW1 1XPOA 3SOPA 3TAHA 1W44A 2YC2C 4M4SA 2FF7A 2NO1A 2V9PA 1QWIA 3LLUA 2BVNA 3PV0A 4F4IA 3M4YA 4YMUA 3K9LA 2MSCB 4S35A 4BLRA 2ZS8A 1R5BA 3U61B 1XD2A 4W5WA 4YMTA 1YRAA 1ETUA 2GEUA 3NBZC 3QOFA 1OFUX 2A5JA 3H0KA 1IN8A 4F91B 3B60A 3OE7A 2J9RA 4LFCC 1HUQA 4A2QA 4OJQA 2NO6A 2UXDC 2JLQA 1ZNXA 3SHFA 4Z54A 5B58C 1J8MF 1XBTA 3I73A 3C7KA 2QTHA 3TQFA 1PV4A 1ONBA 2WWIA 4MRRA 1ZMXA 2W6JA 4EUNA 2QRNA 4FIDA 2WJVA 3AVYA 4G0NA 3U7HB 2GAAA 1Z2AA 1G8PA 2D06A 2C96A 4Q4HA 4OJKA 4HDOB 2EGTA 5L3VA 3T12A 1XU4A 4EJSB 1YZNA 2WV9A 3GJ4A 5C46F 4QJ3A 4B3MC 1Z0AA 3A4MA 2UXBC 4L15A 5IT9D 2YOFA 2QRZA 3VU9B 2NMVA 3TIFA 1E2HA 3LBIA 1T8TA 4Q9IA 1NL3A 5B2ZA 1XDBA 2Z4SA 2W0SA 3A58B 4M1SA 4YMWA 3B78A 3T5GA 1D2EA 3AV0B 4DSUA 1U8YA 2JATA 5JRJA 2EFEB 2V3CC 3X1ZA 4Q47A 4TSFD 1N5JA 3CNNA 5H8WA 2I4IA 2PCLA 2A5YB 2VHCA 4KITB 4PHHA 2VBCA 1B0UA 1G18A 3QPWA 1HY3A 2Z83A 1T9HA 1AS0A 1WDTA 2GBLA 2P6UA 2F55A 2IYXA 4LSGA 1VKJA 4YHHC 2XNDD 3LXXA 4LC1A 2W2TA 2QPOA 2BCJQ 2QL6A 2OFWA 2QE7A 4JLMA 4EDHA 3PUZA 1AIPA 4R7ZA 3ZVNA 1XXHE 1YRBA 1M8PA 4Q4AB 3GFPA 3EA5A 4DB2A 3J80D 2IYUA 4B3SC 1FP6A 1YZQA 2CK3D 2JA1A 5L3QB 1A7JA 4HUQB 2ATVA 1AJEA 3TBKA 4D0LB 4ZI3A 3F0TA 3UPUA 1Z6XA 2F1JA 3BWDD 3OIWA 1IJFA 2PN2A 1UDXA 3KX2A 4JSYA 4E22A 5BN3A 5JECA 1NBME 3AKYA 3BXZA 3ASYA 5KUTA 2XXAA 1JBKA 2NO9A 2ODBA 4URUR 4ZPXA 5J5CA 4BFZA 3GLIB 4JBWA 3OFND 4PXAA 1XMOC 2AWNA 4D26A 1EFUA 4JS0A 2WM9B 2JIZA 4TQUS 1Z6AA 1E9SA 2R6CA 3WYGA 1Z5ZA 2FFAA 3A36A 3EC1A 4TMWA 4WXPA 1Q57A 2DWQA 5E4FA 5GJCA 1D5CA 221PA 3TW8B 3W8NA 4D2IA 1RPZA 1JOSA 1IOZA 3U5ZB 2XOKD 1I2DA 4B3DA 1GM5A 1XTJA 3BK7A 1E99A 4HI0E 1CP2A 4HAUA 5B64A 3DO6A 4A36A 2WSMA 1U81A 3QF7A 1V43A 1YZUA 2JLZA 2KZFA 4CEIB 5CDFA 3WMGA 2RH5A 2FA9A 3CBQA 1N0VC 3HJNA 4LWZA 5FUWA 4Q9KA 1NLFA 3T1VA 2QSZA 5KSOA 1HE1C 4LHZA 3BB1A 1KI1A 3AGQA 3PUXA 1U0LA 3LBNA 2O8BA 1O3YA 4ZIRB 4OKSA 3QXHA 2FZ4A 3IO5A 1NNEA 1IN5A 5G40A 5B57C 4X8HA 2O8BB 1N6HA 1XP8A 3BGWA 2FGKA 2ORVA 3CONA 1YR6A 2W2XA 4NCHA 4FXPA 4V02A 1XNRC 1G8HA 1WP9A 3THOA 4A9AA 1XFAA 1MT0A 3CPHA 2GJSA 4OQXA 1XMQC 4OQLA 3TK1A 1N6IA 3QEJA 1S9HA 2QAGA 4GKKC 1RZ3A 4W9MC 3RS3A 3FFBA 2NO0A 4LBYA 1RRCA 3EXAA 4BSZA 2DYJA 2IYQA 1S3GA 2OPLB 1EK0A 3MWLA 4B3TC 4JMPA 3GLGA 3AKCA 1E69A 5BR8C 1ZJ6A 2R65A 3OEED 3TUJC 3DKVA 2J0QA 3GKUA 1DAKA 2OEPA 3L82B 2QP9X 4QM6A 1GRQA 5DHAA 3H4MA 3NWJA 1ZIOA 3VQTA 3K0SA 3F3YA 4DSNA 3UG7A 2RGEA 3IO3A 1MH1A 4ON9A 4Z1MD 2WKRA 3AVWA 1HNZC 4XWOA 4H1UA 3VX3A 5LD2B 1T5IA 2YCBA 1MABB 1MO5A 2E1RA 2GXSA 2ZJ8A 3FMIA 2F3TA 3OEEA 1UEIA 4C4PA 3K09C 3AQ4A 4JLKA 2RGCA 1XMVA 1W36B 3A1VA 4Q1EA 1HV8A 3B2EA 4D4KA 4OHYA 3S1AB 4YXWD 3TQCA 2P5SA 4NP6A 4NYIR 1W49A 3AF2A 4MRVA 5FBWB 4Z1MA 4QGFA 1E1QD 1PUIA 1XMIA 2WWXA 3ZD7A 3BS4A 2SHKA 5TV2A 1NN1A 2BEJA 1IXSB 2Q6TA 2CCGA 4P4SA 4Q03A 2ZITA 4O2RA 2AHOA 3HR8A 3HU3A 3AF5A 1SKYE 1WRBA 1TQ6A 1VG8A 2G83A 1YU9A 5FBLB 2HLDA 2VIIA 5C18A 3I5YA 3GCGA 3ZQ6A 4XTRA 5FOTA 2E7GA 1T3HA 5HZKA 2IS6A 2BMDA 4TLBA 1RJ9A 3G82C 3BH0A 4JVLA 4WA7A 1IONA 1TUIA 2O5VA 1VYVA 3CH4B 1XEWX 4B6EA 3RSLA 3PIRA 4DLSA 4JVMA 4NCJA 5JFGA 3BORA 1E9BA 1LS1A 3M0EA 3VR4A 3NHBA 4AYWA 5CITA 3CRRA 1JXOA 2D4HA 1VCIA 3MWKA 1TTTA 3DEFA 2ZSBA 4TZ0A 4KSCA 3E70C 5DI3A 1FTSA 1FUUA 4LJ8A 1QHGA 5A5GA 4B75A 1GVNB 2CLCX 2CJWB 1ZUNB 4OK5A 3P4XA 4G01B 3GPLA 1G41A 2FNAA 1DELA 2VP0A 2GBLC 2IL1A 1ZC3A 4FMCF 2XAUA 5CK4A 2OSBA 2OV2A 1N25A 1LQLA 4DLUA 3W34A 2GDJA 2ERYA 3LD9A 4M8NE 4RJLA 4NU0A 3HU2A 4B3FX 2IS2A 1AA9A 3QE0A 1IXZA 2QSYA 4BRWA 1N5IA 4MGKR 5HTKA 4A0RA 4B2LA 5BWMA 2LKDA 4WOPA 5C2JB 2ZYTX 3LW7A 1KJWA 1NJGA 2Y8EA 4DCNA 2IHBA 1D6JA 1ML8A 3MJRA 3K9HA 3FMPB 2OBNA 1VG9B 1XX6A 4QJ4A 1USPA 3WMEA 3BRWD 3TE6A 3OESA 2QNRA 4LC0A 2ZU0C 4Q1BA 1KDPA 4W5JA 4HDQB 5JSZA 1CJVC 2WVJA 2JLRA 3B1VA 3Q9LA 3NHAA 5DN6A 2WTUA 2HXYA 2YKGA 3OE7D 1FNNA 4FINA 2IEYA 2VP4A 2VHQA 4Q18A 4NCIA 1R0XA 2WKPA 4BLSA 4DLVA 2ZRCA 1SXJC 1U8ZA 2D2FA 2GCNA 1RYFA 3HYTA 2Q3MA 4JJZA 3CRQA 3SDZA 4ZCMA 1G6HA 2QMOA 4LUCA 4TTRA 3I92A 2UUAC 3RC8A 1PUJA 1W0JA 3LLMA 1UBGA 4TLDA 5CB6A 2EFCB 4A0GA 3B1XA 4LF9C 4I1SA 3SNHA 2XNDA 1S3SA 4TMZA 2ZSEA 4EPRA 4ERNA 1KDTA 5E95A 1R7RA 2C9OA 6Q21A 1L4UA 3CO5A 1LS6A 5J4VA 1CJMA 4RD0A 2WJGA 5GADl 3RDPA 1HH4A 3PJRA 1KJYA 1TMKA 5KNBA 1E98A 2G1KA 4JLVA 3LVQE 1NP6A 2H5EA 2YWGA 4NE2A 5AJZA 4GL2A 3N2EA 4ARZA 5FI0B 1WMSA 1SQ5A 4XWKA 2J45A 1U90A 2WSSD 5LD2C 4ZCLA 1OW3B 4M0LA 3U3JA 4X65C 4R2IA 521PA 2AXPA 1M2OB 3MRSA 4G5OA 1CKEA 2RGNC 1SVSA 4PAOA 1DTSA 4M21A 2BDTA 3QG1A 2OLJA 2V1UA 2KE5A 2NIPA 3CR8A 4B2PA 5BN5A 4BFUA 1BYUA 1Y3AA 1MR3F 3LX5A 1IXRC 4UJ5A 5EE5B 1OKKA 2XOKA 4Z51A 2WBLC 4TQAA 4A2WA 4PTLA 2GVDC 1F2UA 5AUPB 2UUBC 5CM8B 3VR3A 3OTOC 5G41A 4LYAA 3TKLA 4N0DA 4CEHA 1XMSA 1GUAA 2N42A 4P3YA 2HJVA 5FUYA 3PUWA 5E3HA 2WKQA 2CL6X 1Z63A 2HT6A 4YMVA 4FI3C 4LF5C 3MGCA 1CR4A 2CHVA 1TADA 1L8QA 1LFDB 4Y0VA 2A2ZA 4LJ9A 3A6PC 2J5XA 2XITA 1OHHA 3B9QA 5FOVA 3IHLA 2LCFA 1P2UA 2ZE5A 4CRWB 1Q0UA 1NY5A 4QNRA 3T06B 3U44B 4DR7C 4LJ6A 1KGDA 1GNPA 2G88A 2ZRMA 4IW3B 1DO2A 4ZKDA 1XNJA 5FPKA 3WNCA 2ZANA 3QXXA 1E2JA 2BHRA 3VHLB 4PANA 1CXZA 1GFIA 1SXJA 4Q4LA 3I3SR 1KO7A 3NH6A 4XIGS 3N5CA 1Q44A 3FKSA 3AVOA 1HT1E 4RKEA 2P65A 4MYHA 1LB1B 3WMFA 3THXB 4G5RA 2ZJ2A 5E7IA 3QQ5A 3C8UA 3NH9A 1R0WA 4NPHA 2ZE7A 1WBDA 4DV6C 1G64A 2C78A 3N70A 1P4SA 2JEOA 1QVRA 1MKYA 1J90A 1MRSA 1VCNA 4PC7A 721PA 2GNOA 1GIAA 3BB3A 4DLYA 5IF9A 5KU1A 3CUEF 2ZJAA 4YDSA 2F1HA 2UVQA 2IYSA 3EG5A 4Y0AA 2OILA 3GMTA 3P4YA 1NBMD 3T1HC 1XXHB 1JAIA 1K5DA 3I61A 1KZGB 5AR1A 2FEOA 3L0IB 1KI8A 2C77A 2IHYA 4B3XA 4ZDJA 4HB4A 4IKEA 4ESHA 2WWWA 1IY0A 4V0ME 5AJYA 1FW6A 4RSGA 4O2LA 2V7QA 4US2R 4HB0A 3UIEA 3KKQA 4GSYA 3T1YC 3GLFB 2VH5R 2FEMA 2GZDA 1OYWA 2D74A 5DYIA 1XZQA 2ZSDA 3GEEA 3WYAA 2OPLA 3DM9B 2P2LA 2Q21A 3EA0A 3W90A 4QBGB 1E4VA 3BC1A 3KTAB 1NSTA 4PSVA 5L3SA 1AS3A 2ZUCA 2VL7A 4HB3A 1W5TA 1X8LA 4NYMR 1KI6A 4XSHA 1OIWA 1JEEA 2FSHA 3QVVA 3AVVA 1Z2CA 1W4AA 3VU9A 3LH5A 1Z06A 2DYKA 3BH6A 3R7WB 3QXCA 2DFKB 5KNDA 1XPRA 3HP1A 3BFXA 4DLRA 2PMDA 2ZETA 4C0BA 3DZDA 621PA 2ZSFA 4POAA 1P7CA 5AJWA 3LNCA 3B82A 2KSQA 2CHQA 4PHTA 2AD5A 1F60A 3DZ8A 1QHIA 3U6BA 1R2QA 1KTVA 1I4LD 1Y63A 2GKSA 3QF4B 3KQKA 4MGIR 3KJEA 1HR0C 2RMKA 4DBLC 2OCAA 1IBKC 2XZLA 1N5KA 2QU8A 1S4QA 1Z47A 1KKGA 1U98A 1E0KA 3FHCB 4TLAA 3AF4A 5KPJA 4LFBC 2IWRA 2QEQA 4D4MA 1E3MA 1EGAA 5HCNA 2WJIA 4QOSA 4KLNA 2V6IA 3WP1B 1LV7A 4D81A 4CEJB 4UXIA 3OZXA 2JJ1D 5FPTA 5DLQC 3OAAA 4HAWA 4GPTA 2FX3A 4HB2A 5FOXA 2ZPTX 2BJVA 4E03A 1IM2A 2CEAA 4URZR 2IWHA 1EFTA 1N6OA 2AKAB 1OLOA 1HEIA 4PPGA 1Q20A 4DSOA 2XZOA 2PZGA 1BO6A 1NVVR 4FMCB 4LX0A 4MKGA 1PLLA 2C8VA 2ZRNA 1GKUB 2QP4A 2XJ9A 2YOGA 3CF2A 3M6AA 2P6NA 1J5EC 2AXNA 2RGAA 2CJWA 4P4TA 2UXCC 4URYR 1TU3A 1I94C 4OHWA 1QRAA 2WIBA 1G8FA 2J3EA 4LF4C 4LHYA 4DV5C 2ZE8A 5C4GB 4BEBA 3RS0A 1IY1A 3QKSB 3JZAA 2RGDA 4O0MA 5KSYA 4KO8A 3FHTA 5KSZA 5FFMA 1IQPA 3THYB 1W4BA 3SS8A 2O8DB 2IK8A 4DKXA 5HKKD 2PMKA 1UDWA 2WWHA 4K81B 4BZXA 1EFRD 2AK2A 1Z6YA 1JJ7A 2JDIA 2R62A 2B8TA 2VP9A 3EZ9A 2H8KA 2R44A 3KKOA 1TU4A 2RAPA 2HV8A 5AWFC 4LPKA 3FFAA 1Q1QA 1VIYA 1CBUA 4O25A 1P2TA 4D0GA 1VPLA 5M04A 2XR1A 2KBEA 1Z3IX 4OI4A 1A82A 1N2FA 2ZR9A 1KDOA 2AD1A 4M2LA 4NONA 5HKKA 1TUEA 3ZD6A 4NXMC 5DE3A 3HR7A 2J7KA 4OK6A 4B76A 1QHHB 1EFHA 2HXSA 3AVQA 1U9IC 4MH4A 1KMHA 2JDID 3OF5A 3I1FA 4IDNA 4JI3C 1DADA 4UNNA 2BC9A 4R98A 3RS2A 2FFQA 2IT1A 2BKEA 2ZI9A 5JLJA 4M22A 2ZRBA 3B9PA 3B7GA 3WBJA 4XX2A 1E2GA 5EP3A 4IEIA 2G9NA 1ZM7A 4DCVA 4KCGA 4IDQA 3RRYA 2G77B 1XCGB 4ESVA 4RD6A 5KPDA 4EQ6B 1HE8B 3DMNA 5KO2A 2A5GA 3CX6A 1JR3A 3FDIA 2OCBA 3E1SA 1AM4D 2ZRFA 1B23P 1ZB9A 3J81k 4G3XA 1SKYB 4AWXA 3U44A 3QG5A 5JBQA 1JQJC 2V55B 2QT1A 3K9GA 4BFXA 4CEHB 1KOFA 1UKKA 2ZI5A 1V5WA 4XOIA 3TSZA 5DI9A 4O3MA 3NIBA 2YJTD 4W5HA 5DSZA 2CNWA 4JT4A 4B44A 4WZBE 1NF3A 1E1RD 1XMJA 3BFVA 3PEWA 1DOAA 2ODEA 2EQBA 1GILA 2GF9A 3C14C 1TL7C 3GJ7A 4I99A 4TT3D 3KZ1E 3CX8A 1U9IA 3T35A 4B32A 1JXMA 3ZIAD 2WWFA 2J46A 4BWYA 3ZVRA 4JVSB 1KK3A 1OH8A 3QKRA 4TQ9A 3WHKA 4C0QC 2FSIA 3VNVA 2KI5A 3GJ3A 4GMDA 2Q9CA 5TDHA 4ZV4A 4HUQA 5J4HA 3CF6R 3RANA 4KV9A 4RKFA 4OQNA 1OJLA 1EX6A 4WBSA 5EXTA 5H68A 2PT7A 3EW9A 4GOXA 2JLXA 4Q4AA 3R9XA 3L8YA 2H7VA 2J0VA 3R9WA 5J4YA 2NZ8A 4Q7KA 2WJJA 2Z0MA 4U00A 3H86A 4XD7D 3LUSA 1FP7A 4EPVA 4FWIB 2QM8A 5IT5A 4HUTA 1KI3A 1Z28A 4YDHB 2KWIA 1XZPA 5JRZA 2J7PA 2CE2X 2RCNA 3CX7A 3KJIA 1BH2A 3FWYA 2R6AA 1A5TA 2IUUA 1RC8A 4LF7C 3GQBA 1W2GA 3OIUA 2ZYVX 1PLKA 1LNZA 3ZZUA 4DT1A 1J2JA 2E8CA 2ATWA 1OKKD 1UJ2A 4AQYC 1G7SA 5AK0A 5KNCA 4NYJQ 2B21A 4DT1B 2QAJA 1ZRHA 3NC0C 3PEYA 4GZMA 2O8CA 5HE8A 1Z29A 3QNUA 3HPRA 2ZVQX 4UKDA 4HEJA 1SXJB 2J59A 2N1BA 4URWR 5EJEA 3P20A 4B73A 5JCZA 3NTUA 3MD0A 2BV3A 5D3MB 2Q3HA 4KHZA 2C04A 3EZ7A 1W48A 2A9KA 5JZVA 3IGFA 4LYFA 1G7CA 5K8UA 2JJ8A 3Q85A 2EFHB 4B71A 5GJVC 3A4NA 1QDEA 4GBMA 3KQLA 3QXJA 1YZTA 1RRGA 3JVUA 3EX7C 1QF9A 2IUSA 3NEJA 3ASZA 4OK3A 2ZQ5A 3GLHA 2O8FB 2KJQA 1XD2B 4DV3C 4B3RC 1MV5A 2GEVA 1R8SA 5J4LA 5KDDA 4UNQA 4JZKA 1D9XA 1SHZA 3CH5A 1P75A 2WWGA 1TPZA 2O8FA 3W6OA 1Q1BA 2ONJA 5TMPA 4KAXA 4TMKA 3AF3A 3C5HA 2R9VA 2J0UA 4V0OA 2ZAOA 1UADA 1GDDA 2A5DA 2E87A 3SZRA 1LTQA 3IDQA 3U7GA 5AUOB 4M9SA 4DR3C 1W4RA 2RB4A 4DLZA 3EPHA 3I4LA 3C41J 2EWVA 4DUGA 5JSZB 4JL8A 2HDNB 4LV8B 4L4UA 3CLVA 2E5LC 1T0JB 3QKTA 1NBMA 3SJAA 4ZO4A 4EPXA 2H16A 2HCJB 3RC3A 1KKMA 1NYEA 1YZLA 1E2MA 4N1AA 4P31A 4L9SA 3OHMA 1C1YA 5CJ2A 5CLLA 3L0PA 4QGAA 1SGWA 1ZUHA 3QXSA 2ZS7A 2JMPA 3PXGA 3VR1A 1FQJA 1WQ1R 3TSWA 5KHOC 3GEIA 1CU1A 4E09A 2A7QA 1PA4A 3Q72A 4LBVA 5F3WB 3DOFA 3IEUA 1QHSA 4DIDA 4QXAA 1Z08A 1NMZA 4HAVA 2VPPA 3EASA 4HLUC 3QIAA 5CDFE 4PC3A 3UMFA 3Q7PA 4JI0C 2IUTA 1DG3A 2OHFA 4A8JB 3RAPR 2XJ4A 2P3SA 3QF4A 1CJUC 4NYIQ 2GETA 3TNFA 1H8HD 4WW0A 3TH5A 2FSFA 3IBGA 2DR3A 4IDOA 4DXAA 1N6PA 1NI3A 2VHTA 5FBRB 4PZYA 4TZ6A 1N6KA 4I1OA 3T1OA 2F43B 1CJKC 1KZ7B 1PVOA 3VKWA 3O8DA 2GHIA 5AJXA 1D2MA 2YINC 2ASEA 3FKSD 1NG1A 2DFTA 3SFVA 2YC4C 2YVUA 3VFDA 3CWQA 4AKIA 3BIFA 4PHGA 3LY5A 4BUJA 3U6KA 1TNDA 1E9DA 1TX4B 1I4DD 3NBFA 2XB4A 4GNKA 1S8FA 4QNMA 5BYKA 4X64C 2Z4RA 3KKPA 1OH6A 4Q02A 2QQ0A 4OHZA 2IBMA 4V0MA 4DUYC 4HSEA 2HUPA 2C9CA 5J40A 2ECKA 4IOKA 4C0JA 4Z8YA 2NGRA 3AKEA 3IPXA 1CS4C 1M34E 3CM0A 4TYNA 3LWNA 3ZVMA 3OIVA 1KAGA 1QG4A 2L0XA 3V9PA 3I5XA 3U4QB 4KFUA 4LJ4A 3FYHA 3SHWA 3T61A 1TEXA 3QBVA 4JBYA 4YXWA 5KDOA 3X1YA 1ZM9A 3PITA 1E9AA 2NO7A 4IOJA 1E1QA 2YHSA 4DRZA 121PA 1G3IA 1SVKA 2OO7A 2GEDA 4P0TA 4RD4A 4UXHA 1IN7A 2ZM6C 5DI3B 5AJVB 1KI2A 4JLBA 1BIFA 4GFDA 3UWOA 4JI8C 5FUXA 1X1RA 2ZIAA 1Z8FA 5FTJA 3KXKA 5LMUC 2EW1A 4HAZA 2R6FA 3RS7A 3G0HA 1G19A 3EC2A 1JEDA 4DZZA 2CE7A 2O8DA 4KXFB 2IS1A 1ODFA 2OXRA 3W9YA 5DN6D 2AK3A 1G291 1L7VC 3VX4A 2FN4A 2GCOA 1UBEA 4MRPA 4PSKA 1VIAA 1ZINA 3GJXC 3MJHA 2QA5A 1L2FA 1HURA 1DARA 2ANBA 3FMOB 4B34A 4GOJA 4ITRC 2GCOB 1HH2P 2PBRA 1Z0IA 4Q1AA 2A78A 2ZRDA 5FPHA 2F7SA 2XX3A 4F4CA 4HYYA 3P26A 2ZUDA 2ZR0A 2ZJYA 2X1VA 2YWEA 1JR3D 4V0LA 1G7RA 5SZHB 3GD7A 1IN4A 3Q3JB 3CR7A 4AC9A 5CM9C 3B8HA 2CBZA 1WH9A 5FOUA 3X1DA 2AN9A 4QGGA 2PX0A 1A2KC 4TMXA 1QZXA 2BBSA 2TMKA 2REXB 3B1ZA 1LW7A 1SVMA 3KFXA 3L2OB 1QHXA 2ZREA 1IBLC 1AK2A 2DY1A 3ADKA 3SJBA 4PFSA 1N32C 3AVUA 2XZPA 4LYHA 4ZDWA 1G5TA 1HA3A 3ICEA 1S2MA 2QTFA 3GEHA 1E1RA 4TYPA 1FL9A 2J0SA 4CEJA 4C2UA 3CWZA 4I4LA 1TAGA 4WIAA 3P32A 1UKZA 2G3YA 3KUDA 2NPIA 3JAMD 4RCZA 2IEZA 4H9GA 3IIMA 4XSGA 4QBHA 3RS5A 4ASUD 5HR5A 2IXGA 1G7TA 2IYYA 3IBYA 1W4CA 2BJWA 4HZUB 2ZS9A 1XEXA 4DCSA 4FN5A 2ZUBA 4Q19A 1DAHA 4JLOA 1XCPA 5LB2A 3SN6A 2F9LA 4RVCA 3ZS9A 4BASA 3PUVA 3REFA 4TTPA 3ADDA 3D3QA 1OPXA 2H17A 4ARZB 4YQFA 4ZI2A 4BPBA 4MYTA 2QBYB 3L0OA 4GKJC 1RFLA 2WJHA 3EAQA 1GZSA 2QMEA 4DV1C 4M1KA 4PR0A 3W5JA 1PJRA 1ZAKA 3SU8A 5CB8A 2IYVA 3CNOA 2ZYUX 3HPQA 2G0NA 2C03A 5KYKA 3FB4A 1OFIA 1UKEA 1L4YA 2ZE6A 2PLRA 1AGRA 3A1SA 2OM2A 4JV5C 4FMBB 5DISB 3A4LA 3KJHA 1F2UB 1T91A 1GTVA 1E2DA 4DVGA 1KO1A 5FR1A 3KL4A 4B33A 2QPTA 2KB0A 1E2PA 2GXQA 1XJCA 2F4VC 5L3RA 1FMLA 3LBHA 4GMXA 4TLEA 3K53A 1GKYA 4U5XA 1G21E 1F48A 1TQ4A 2JJ2A 4PO1A 1G8YA 4F4JA 3ZJYA 2WHXA 5GVRA 3AM1A 1VDZA 2NQ2C 4LJYA 3SYKA 1ZP6A 3LAWA 4DC9A 3AVXA 1AKYA 3BOSA 5D3MA 3KKNA 1X86B 1ZCAA 2H1LA 5CIQA 1EWQA 2EFDB 1VTKA 2OG2A 3A1TA 3EIHA 4QKQA 2NOAA 3GJ5A 2YZ2A 4DLWA 1E2IA 1E2NA 2PJZA 4Q66C 1E9RA 4FCVA 1M74A 1N2CE 1P3JA 3WY9A 1CJTC 3QVUA 2F9MA 5TY0A 2Z6VA 4BLPA 5IK2D 1U0JA 3SQXA 4Q5IA 3W3AA 3N2IA 1YE8A 3TGPA 3NBXX 4J0QA 1F3OA 2DWPA 5ELXA 4OI1A 4F7WA 2V7QD 3U7FB 2FH5B 4DJTA 4R9UC 3THYA 4TL7A 3V4FA 4KU4A 3W5IA 4QGHA 2IYWA 4DUGD 3OFNA 1YHNA 1N34C 3FOZA 2C98A 3L43A 3O8CA 2FV8A 4ILEA 1A2BA 2JLYA 3I62A 1WBBA 4F38A 4LV6A 4MDFA 1NLZA 4HZIA 4QL3A 5F2EA 3NVAA 1G3MA 3LQQA 2AFHE 2PX3A 5IHPA 3BE4A 5EZ5A 2NPFA 1USPB 5BYJA 2G0TA 2QPAA 2MMCA 3LDAA 2Z5FA 2XSZD 4LCBA 4IXNA 3FTQA 2IC5A 1P6XA 4NTZA 4EFLA 3TAUA 4P4UA 1CR1A 4PC1A 1KAOA 3K8YA 3OEHA 3U7EB 1SVIA 1N36C 2V4ZA 4KODA 1NMXA 1NSFA 4EJSA 1A4RA 3U3RA 1N5LA 3U3OA 2ZM5A 1P9NA 2VSXA 1ZNWA 1K6MA 2VF7A 4G5SA 2B92A 4MUAA 1M7BA 4A8JC 2LWIA 4X8LA 4C0LA 4LY6A 4PHFA 4KFTA 5FTMA 3RRMA 2GXUA 3SEAA 1XF9A 2BOVA 2R2AA 5E7JA 5KSPA 3TMKA 1JR6A 2HCBA 2XSZA 1H8EA 2IYRA 4RZ3A 4JI6C 1KYIA 1VG0B 2OE2A 1ZU5A 2X2EA 2YWHA 3WRYC 2FSGA 4PZZA 3TJZA 3CPEA 4LOAA 3NDBB 3AP2A 1DE0A 4UXJA 3K0CC 4PPNA 1RVDA 1UBFA 2WPDA 1MO3A 2BBTA 3D31A 4GP7A 4PZLA 4E5UA 1BMFA 2XTNA 1KSFX 1Z0JA 2P0EA 2F1IA 1M1YE 2RHMA 2ZRKA 3OAAD 5BN4A 3QJYA 3P1JA 5K8LA 4LV5B 2DFNA 2F1RA 2VP2A 1F2TB 5BQ5A 3RSOA 2G1JA 1ZUIA 4RFVA 2GVZC 2QG6A 1EFCA 4DCTA 3A37A 3AP1A 4ACAA 2JLVA 4QFMA 5TARA 4AYXA 2XNSA 3A1WA 1CIPA 1HNWC 1OSNA 4DR5C 2W0MA 3C16C 3KB2A 2R6GA 3K70C 2CCJA 5IWAC 4DEXA 1E79D 2PT5A 4PO9A 1OF1A 1DEKA 1UFQA 3THWA 2VSOA 3SI7A 1OFTA 4ACBA 2QENA 2HYIC 1ANKA 1TQ2A 4B3GA 2C95A 5SZKB 4PQRA 1YVDA 5JS7A 1W47A 1G5RA 3Q5EA 5KDLA 1EG7A 4TL6A 3ADCA 3RABA 4C0HA 5JS8A 4Z8XA 1G20E 1S1CA 1YQTA 2O8EA 4JI2C 5HE9A 3QEOA 2WOJA 2QMUA 1RYHA 3AUYA 1T4GA 4P32A 1U2RA 1ZW6A 4D4LA 1II0A 1FX0A 1GWNA 3VMFA 4KSBA 1KO4A 4JJKA 2UZIR 1NJFA 2QN6A 1UKVY 4MGYR 3NKVA 4JKIA 5HZHA 4LHVA 1LF0A 1YZGA 1TF7A 4LJAA 5EUMA 4EIWA 5EZ6B 1C9KA 2BWJA 2IS4A 3QPVA 2FPKA 3K0FB 3DL0A 1AN0A 2IF0A 1W0KA 1JECA 2ZRGA 5JEDA 3A8TA 3NXSA 2JLSA 2VSFA 3WNBA 4B74A 4DR6C 1G4UR 1Q1ZA 1GNQA 2V1XA 1SKQA 2BKUA 1AQYA 1ZD1A 2F6RA 4M1MA 2VO1A 2DHRA 4RD2A 4C7OA 2W6ID 2EYUA 4RD3A 4XJXA 3TUIC 5JHGB 4D25A 4BFVA 1XCMA 1F5NA 1Z0KA 1NN3A 1LVGA 1U8AA 2FG5A 2VP6A 4FMDF 1W0KD 1ZYUA 1TF5A 3AUXA 4DHEA 5LPNA 2IW3A 4BLOA 2IYZA 2D7CA 4GZLA 3X1XA 2F3RA 2GILA 4ASUA 5FOSA 2O0JA 3K0AB 2GJ8A 3ECCA 5A2QD 1Z0FA 3UMRA 3GFTA 5P21A 1KMHB 3UG6A 2QAGB 2D7DA 2VQEC 1W5SA 4Q21A 3H1TA 4GI7A 3O8RA 1G16A 3EZFA 4C9BA 1E2KA 4JLPA 5H70A 5FL7D 4YLGA 2CNWD 1J70A 1E32A 2V8OA 4Q1FA 4PC2A 3R9IA 5DGXA 1G6OA 3REGA 1DAMA 3DVLA 1T5LA 1QHYA 3GLGB 4TTQA 3UATA 2PZEA 2B8WA 2A3RA 3WYFA 3ZIAA 1DPFA 5TXGA 4EQ6A 2BMEA 3R20A 4R2HA 5JWOA 3ZYCA 1W36D 2CMKA 4TL9A 2IXEA 5L3SB 3UK6A 4HATA 3F5FA 1J99A 4C0AC 2BMJA 1KK2A 4WXRA 1Z0DA 1CLUA 2XB2A 4Q4JB 3ONWA 4DV2C 3RLFA 3WRXC 5H1YA 1AZSC 1XRJA 3RRZA 2B6HA 2ZTSA 3AKDA 5FL7A 5FTKA 4Q4JA 3GLFE 2JLUA 3T34A 4GOKA 1KY3A 1S96A 3Q7QA 1PLJA 1ZM3A 4X8OA 4B6FA 1KSHA 2IYLD 4FCTA 1P9WA 3EZ2A 3CKLA 1HQYE 3SR0A 3ZGXA 1KI7A 2V6JA 2QT0A 3LRPA 2QBYA 1ZC4A 3BBPA 1HNXC 1G8GA 2W2VA 1VLAA 1P2SA 1RRPA 3QKRB 4JYCA 2VA8A 4BECA 2BBWA 1VCMA 3F8TA 2ORIA 4IHQA 1OV4A 1JQLB 5JHHB 4QG7A 4M1OA 1XPUA 3AP3A 2NZJA 1SVOA 2CHGA 1N6NA 4A6PA 2CY1A 1CR2A 2C9YA 5IDVA 4BRUA 4X66C 1EWRA 1UM8A 3ZQJA 4JI5C 4L5BA 4P4SB 4KYIB 1AQUA 4U02A 1GITA 2GJAA 1WE2A 5AUQA 4JT2A 2ZROA 2NG1A 2Q9AA 1DAIA 1GG2A 1GL7A 3MAAC 3MCAA 5JWHA 5J4KA 5JWRA 2UZ3A 2ZJBA 2E8FA 1US8B 4URXR 1NVUQ 1XD9A 3IKJA 2OFXA 2P67A 2GWHA 2WJYA 4G5QA 4Q7JB 3T1TA 2GESA 3VKGA 5F98A 1P9RA 1XTIA 4XTCS 5DNYB 1ZD8A 2H57A 3C15C 3KQNA 3A1UA 1DAGA 3MWYW 4M9ZA 2REBA 4C2TA 2QAGC 3I72A 4LJ5A 1IAQA 3ZVLA 4B35A 2A5FA 1ESMA 1NVXQ 3AEZA 5KOYA 4PAQA 2ASBA 3UMSA 1XD8A 4DLTA 3TR5A 2CVHA 1QG2A 3EPKA 4DDVA 3MFYA 5JCPA 2QE7D 3TW4A 4V0NA 4R71A 2ODNA 3FVQA 2YV5A 3UWKA 3LA6A 1N3BA 1FPMA 1X1SA 2QORA 5EP1A 4JBXA 3VKHA 4JI1C 1XNQC 4PQYA 5JEEA 2FZLA 2ZRAA 1Q12A 3IUYA 4CVNA 1WCV1 4YY3C 1AZTA 2X19A 3GJ6A 2JLWA 4DR2C 3TSOA 1FTNA 4A2PA 1KO8A 2JJ2D 3QKSA 3ZH9B 1X3SA 3GLIE 1T6NA 1KSGA 1NIPA 4KJZA 4JLJA 3GLHE 4EKDA 4QRHA 4IVPA 4DWJA 3UXMA 1FJGC 2J7PD 3R8FA 5ANRB 3DPUA 4DR1C 3GLGE 2GRJA 2WIAA 4LF8C 2QGNA 3IHWA 4BLTA 5BW8A 1G1MA 3IQWA 2GTPA 1GOTA 1ZM4A 3AB3A 5DO9A 2IYTA 4HAXA 2D62A 1OHHD 2WICA 5FPYA 3NEYA 3FMFA 1EX7A 4C0KA 4TWZA 4AKGA 4OQMA 2HJGA 1QBKC 2DFLA 3SJZA 2IX3A 4NZYA 4Q4HB 3GLFA 1CULC 2RGGA 2OLKA 2J0UB 3TUZC 1ZCBA 5CK5A 2ZJ5A 2H92A 1EXMA 3PEUA 3CZPA 5GVSA 1PZNA 4II7A 1YKSA 3KXIA 3BD9A 1IY2A 3W6NA 1HQCA 5C1BA 4M1WA 1CEEA 4CF7A 1GL6A 2B7BA 5CIWA 1E9CA 2ODWA 1OXVA 1A1VA 4XH9B 1ZVQA 4MKIA 4DDUA 4CDGA 1YZKA 1ZIPA 2FPLA 2RHDA 2UKDA 2O52A 2EFGA 4HLDA 4XD7A 4QC2A 4PPQA 5F9FA 1IJEA 1OYYA 1XJ0A 5A0FA 5E7MA 3W8RA 3ZZTA 3K70B 1W2HA 2W83A 3OEHD 4OHXA 3RVBA 1KMQA 4A1FA 4MYCA 5G3YA 3K0EA 1P72A 1DAFA 2HF8A 2PLFA 5CJPA 5TVKA 4XVUA 2AX4A 1ZB8A 1F2TA 2JIZD 2W00A 1KNQA 3AVTA 4QHTA 3B6EA 2CLDX 4DSTA 3CW2A 1QHNA 2EU8A 5IRCD 4A15A 3EWAA 4IDHA 4S2EA 4XWAA 5FLXD 4C30A 1E2LA 2WMOB 3GP8A 1VECA 2VTKA 1DBSA 2GJ9A 2JGNA 2WZQA 4MQBA 4ZDIA 5EP2A 4AURA 3PFIA 3FE2A 4AKEA 5DIFA 1P61B 2GA8A 5FTLA 1RW4A 2DPXA 4XVRA 1SVLA 1WF3A 2VQSA 5L3QA 1FQKA 1XEFA 3QSYA 4IOLA 3D8BA 1NMYA 2V54A 5FH9A 1E0SA 1KSJA 2WPDD 5FR2A 3U3KA 4UNRA 1ZU4A 4PC6A
chains in the Genus database with same CATH superfamily
2H4XA 3BM5A 3RRNA 2WVHA 4J1TC 1V3VA 3Q3GE 4NCNA 4YK7A 4C06A 4Q9HA 3VR5A 1Q11A 1XJQA 3NG1A 4US0R 5FLXA 4I55B 1N6RA 3NBMA 1KNXA 4RZ2A 3RC2A 5BSFA 3GXOA 4K5QA 3GLIA 4NHOA 1E2FA 1K63A 1NZDA 2A1UA 2COKA 2G72A 2V98A 2XDAA 3D8RA 5E9WA 1SCQA 2GCPA 2Q62A 4ZEOA 3HYRA 1KIMA 1LTHR 3K09A 4P33A 5BOSB 4FJ2A 3NHWA 5C8DA 3Q40A 1WXQA 5FTNA 4BGDA 3UAZA 5F52A 1II8A 4RZUA 2Q99A 3OFJA 4ABYA 1SPXA 3HI6A 4RD1A 3BGOS 2BUAA 1UDRA 2RHJA 4KTVA 3ENNA 1LWOA 1YA4A 5J47A 4IWYA 1GNRA 3F46A 4ZJZA 2AJLI 1IUOA 1QTIA 1JHQA 1YZYA 2CVFA 1S5PA 2E37A 2FMXA 3X1MA 3JASA 4IILA 2AR7A 1G3UA 3HJTA 5D3QA 1WUKS 4YDQA 5EHIA 5BSHA 4F92B 1USWA 3C5VA 3K8OE 3PDIB 1W52X 4PGMA 1E7YA 4U2EA 3UKDA 4ZI7A 3WHIA 3ZKAA 1VMIA 1I01A 3TFOA 1X38A 4RH0A 1NLYA 5FBKA 3K5WA 5I9MA 2O23A 3HFRA 4FB4A 1DIOB 5A5DA 3AEKA 4FSHA 3L8MA 2P2QA 2CXPA 4V0RA 2QYSA 2ZU6A 4X1YB 5EUQB 5IFLA 4FDMA 4HMPA 4B47A 1TJPB 4I5DA 2QAIA 4DW8A 4PPFA 3NYIA 1X1CA 5IVIA 4JD5A 5BT9A 3PF9A 5L8VA 4AG3A 4ALMA 3THXA 3EGIA 4FWTA 3AESB 1P7LA 1I9GA 1K8XB 1I7LA 1NY6A 1RBQA 1RRVA 1ZJ5A 2QX4A 3BWYA 1P62B 4UUQA 4LK2A 1RLMA 3MT0A 3RIEA 5E4JA 1ZA1A 3DKIA 3ZDQA 4MEAA 1RDFA 3PKZA 5JUWA 4L9AA 3IJEB 4MR9A 2X8WA 3IQXA 2B99A 1YKGA 1UFOA 2B7CA 3WNDA 1RCTE 2C9BA 2J0EA 3QV2A 3F6EX 1GKIA 3GR0A 3KAPA 4FBLA 1XRBA 4OY3A 4U6SA 1E4EB 1S2OA 2XB9A 3H84A 1XROA 3NXKA 2J9FB 1O96A 1OX6A 1TEVA 1UUFA 1U4OA 3K1AB 3QUSA 1B6TA 4IV5A 4YMLA 3RYFB 1J2TA 3ESAA 4PAMA 1BVHA 1VB5A 4LTMA 2E3JA 5LQSA 2HF9A 3TQOA 2RH8A 3UFXB 2Z95A 1MOQA 5CA1B 2F4VB 3I08A 1NNEA 2N0SA 1UR5A 5CNMA 4EENA 5EKUA 1S2LA 5HJ5A 2PWBA 3U31A 2Y76A 4KOEC 1BH6A 1YS1X 3VU0A 3WJ7A 5IAGA 4MVJA 1M7GA 3PDWA 1SBQA 1FOEB 3IIJA 2X9QA 5H68A 3PENA 1F1JA 4A4DA 3IP6A 2EKZA 1T3GA 2PX5A 1J21A 1R6AA 1YAJA 4WINA 5FAXA 1KBZA 4RGBA 2ZI3A 4TSRA 5ESWA 5TPWA 3ZZ1A 1OFUA 3KJQA 5DYTA 1BG6A 4MR8B 3K70C 3G8YA 3JW8A 3HKBB 4GMGA 4LOLA 4HDCA 1HLFA 3F6SA 4R40A 1G9SA 1U2TA 1VHTA 2VRBA 4A8TA 4CM4A 1XNQB 4HAYA 3RHFA 4G97A 5LKAA 2A1IA 1P19A 2FOIA 5JI2E 1ISHA 2OZEA 1GL9B 3GUVA 3LYLA 1HE4A 4S3MA 5CYOA 2CLSA 3ROGA 2R86A 4X91A 1M1ZA 2QP3A 3ZLJA 3JVDA 1DC6A 1OWMA 3VR0A 5CFLA 1W94A 3TNDA 1UPXA 2N1MA 2WP8J 3F5MA 2ADMA 3EUEA 4FR0A 4CMAA 4TPSB 4N4AA 4D92A 4YRBA 1KO5A 1OXSC 1Y7PA 2FR8A 2ABWA 4Q1CA 2Z43A 2QZJA 2ZRLA 5A3SA 4BX2A 4KWIA 4WN3A 4R41A 3W4IA 3K9QO 4BCAA 3E22A 4I3GA 3SO4A 2H07A 4U7GA 4I5GA 4A8JA 4IMJB 3OOEA 2VOEA 3KAQA 3DZJA 1U6JA 3F8WA 1Y80A 1CQIB 4ZYWA 4BNLA 1HOTA 1CY0A 3AY7A 4RFSA 2BKLA 3MG9A 4OUDB 2VJPA 4CU2A 3C8ZA 3SBOA 5T4EA 2BI4A 5FOWA 4FEEA 2D1RA 5EE1A 1WXHA 2OXCA 4KLZA 2SCUB 3UUEA 2AZXA 1XWIA 1DQSA 2BFBA 1E20A 5EIAA 1SCJA 4NL4H 2O3TA 3RJZA 2D5BA 1RYYA 1C81A 3ACCA 3MSCA 1ZEMA 2E8EA 2DLNA 2G7MC 5FNZA 5EE9A 3PWZA 5FNVA 4WEQA 1I10A 3O1JC 2COUA 1UP4A 4FFDA 1LC3A 4HH0A 4LRTB 4ND3A 3SXUA 4B6PA 2VXBA 1FJ2A 2F4NA 1NQWA 4ZC8A 2O4UX 3AERB 4N12A 2BFOA 3A4YA 5B3JC 3PNBA 4TT3A 5UKDA 3OC0A 3WIDA 1RQ7A 4NZ9A 5B12A 4DG8A 3OE5A 4R01A 4ZHQB 3DZKA 4WVFA 5A3QA 2XTMA 5AK4A 2QTTA 2O7SA 2L18A 4S2UA 1W2WB 1EVZA 2IGTA 2G6BA 3ISVA 4AI6A 2E6UX 3L7LA 2CK3A 3WB1A 2PUCA 1EDBA 3EGXA 2X6TA 5SY4A 1D1PA 2BPOA 1NN0A 2ZSAA 4XM2A 4Z0TA 4BYMA 2W6JD 3HBLA 1OH7A 1I3CA 4OYYA 2PXXA 1QQTA 1RXSA 1QIEA 2FFHA 1FNMA 5EWMB 5B1HA 1A3CA 3BILA 3GGCA 2HL6A 2NU9A 3SQDA 3L0SA 2CJPA 2QB5A 2XDWA 4JLAA 2DPGA 3ZDEA 4P0PB 2HW8A 2ZYIA 2PGIA 4MVJE 3WLJA 4CT4B 5G1NA 3LOUA 1XXHA 3MLEA 5FQOA 3IRVA 4HMQA 4J1TA 1QHFA 1MX1A 4KYUA 5DBIA 1K3UB 3NBYC 4EKYA 3EPLA 3W7VA 1WQ3A 3I6QA 2VHVA 4BP1A 3MSXA 1QCDA 1PEDA 3O73A 4ZK2A 3L4KA 3UB2A 2EWMA 4BQOA 2E49A 1GN9A 2XMPA 3CPJB 3N2ZB 3STWA 4GKVA 3C5CA 2HPAA 3D3WB 5EPOA 3RVJA 4Q24A 4C7OB 3MMPA 4MUYA 2GM4A 3W7BA 1NMSA 4LQLA 1E1KA 2W71A 2AI2A 2MSDB 1UQUA 4BQSA 4GW3A 4JITA 4DDWA 2NXWA 2ZT5A 5AW5A 4MWSA 4LZZA 3I52A 2OQVA 2YCLA 1VBKA 4HLUA 3VTFA 1IHOA 1UKAA 2C0PA 4HF7A 2P5TB 1X1AA 1XB2A 1J7KA 5DHUA 3SSAA 1ZIXA 3LLVA 2IPNA 3C3CA 3NI2A 4M9UA 2QL8A 2BFFA 1BX3A 1I2MA 1RBMA 2PJRA 3BRSA 3JAWB 3JQPA 3SYNA 3ZE6A 3ZKWB 5LOVB 1D2NA 4MKHA 1BDJA 2PUGA 2CSXA 1FA9A 1Y3BE 3LW8A 4GOOD 2IF2A 3K0KA 4RF5A 1J20A 1E3EA 2BELA 1Y5IA 2XTJA 1GARA 4FMDB 4RIIA 3PR1A 3CSDA 1LGYA 3VTKA 1OXXK 4NMMA 4YJHB 2I6FA 3DDHA 4H17A 5ENVA 4OI0A 4HC4A 4AZ3B 3JQCA 4H7EA 3HXMA 4K0KC 3RYIA 1JMKC 1NN5A 1SBZA 1N33C 1T8UA 1RXCA 3OEWA 4X63A 2JZNA 3B6ZA 4TUYA 1T1SA 4I2NA 4UEJA 1PR4A 3TRFA 2ZP1A 4Z4GA 3ABRB 5LMUB 1CUVA 2ZRIA 2GYYA 3HYSA 4YP6A 2VRWA 5J5VA 4BLTA 4RY9A 2LKCA 2PTGA 3LV8A 2FPMA 2ZB2A 3P27A 1PJ4A 1Z07A 2IHTA 2WABA 3E2MA 1BHJA 2YICA 2QSUA 3Q7RA 3GNQA 1ACMA 5CCBA 2H0QA 1L7XA 2FW7A 1GUBA 3VR5H 2I8AA 4J2TA 4X20B 3BSFA 1P2BA 2RGBA 4Q7MB 1GCOA 2V5VA 2ZB7A 2ZIGA 3E05A 4IJ5A 1IQUA 4NMLA 2XMRA 4Q9LA 4AJJA 1T3LA 2WLSA 2X58A 2XNCA 4G0VA 4YAJA 1SXJD 5LL6P 2A30A 4FHEA 5IJ9B 2P9FA 2I4LA 1P81A 1PNOA 1K97A 4FOOA 1ATIA 1T43A 4U2DA 3QTLA 2IOHA 3EY9A 1NXWA 1PFWA 5G3ZA 3GPCA 1GUDA 1Y0BA 2OESA 3FUTA 4IJMA 2QVZX 3PDJA 4LHWA 2KYRA 4JVNA 6CHYA 4PAWA 3RNLA 4P86A 3LC2O 5AE3A 2QUZA 4H77A 2Z8YA 4JC0A 4PN3A 3BIXA 1SQ6A 4PVCA 2PS9A 5JRDS 3GCZA 3L7DA 1M6EX 2Q49A 1TD1A 2LW7A 3Q87B 1NJ5A 1SUIA 1W46A 3B6IA 1D6MA 3LFUA 4ND4A 4BZPA 5CD1A 2ZRJA 3F4LA 2DJIA 5BOSA 3IL2A 2RKOA 1U0NA 1N1EA 3GDGA 3MUEA 3PVSA 4FILA 1PWYE 4PYKA 5IVDA 2CN1A 2PPVA 1U94A 1ELOA 3A70A 4FZJA 5F7OA 5FDFA 3VNUA 1XYVA 3WK5A 1Q21A 2VDQB 5EMMA 5EHZA 5F4ZA 5FEUA 4CEIA 2JCSA 4HTFA 2OZKA 3KTFA 3OLXA 1FDRA 1I9CA 2D59A 2Q3FA 2YQ4A 2C5BA 2VUSA 1LX6A 4RSRA 3SE0A 1EAMA 3WL4A 5HPYB 5HNKA 1BDIA 2CXOA 3V4LA 2DLDA 1UK6A 2IZZA 5JC8A 1EESA 2ZI7A 3EAGA 4LECA 4N41A 5EXEA 5TLSA 3ZDXB 2AFIE 1FYEA 2ZQYA 1P45A 1KY2A 2W2LA 1A9ZA 1WHTA 5ALUA 1NKSA 4GRAA 4FPXA 4WFJA 3VMMA 4BP9A 3MJ4A 3UEBA 3RV3A 4PLPA 3NHJA 1QZTA 4LDNA 3AI2A 3ZW9A 2VDKB 3IVCA 4QUBA 4LVNA 1XEAA 4TS3A 5DASA 3U2QA 5K4GA 5AOCA 1G4AE 3UHJA 4RTKA 4BFYA 3JZDA 4IS3A 1P60A 4D80A 4WLFA 2XQFA 4OFWA 2I3GA 4PG8A 1JL3A 2H1SA 4KYTA 4V03A 4XFJA 4LDPA 3W2FA 3WGMA 4D6XA 2E4WA 4LZPA 2A9OA 1SULA 4Z4HA 4F9EA 5FWYB 1M1UA 3ND7A 4MICA 1KDYA 1EX1A 4HZGA 3OLWA 1DINA 1ZM2A 4FTFA 3A0RB 5MFPA 3ITNA 3ZDRA 1J39A 3BHIA 3EDCA 3MELA 4JGGA 4OI2A 2P35A 1E0AA 4PY2A 2O5RA 3NFRA 1K0FA 1YJBA 1UOQA 3EXEB 3ITKA 2VS1A 3I2JA 4MGHA 1H2BA 3T0GA 3A6EA 5CTJA 5KAPA 2D5IA 3L6BA 4LNAA 3KTAA 2Q6OA 3DVSX 3K0CA 1RYMA 2BMAA 3HGMA 3EBPA 4FJ0A 5B58T 1HDZA 3RWOA 2HF2A 2QUIA 2X7HA 1UQTA 3WK8A 1EIZA 2GZHA 2RC6A 3W3ZB 1W9HA 1LI4A 3P5BA 4XUGB 4DQVA 5KVQA 3WLMA 2HA2A 3QYJA 4D9BA 3BYZA 1C4OA 1GPDG 1S9DA 1Q3HA 3COSA 4N5HX 3SZMA 3TQSA 3ZLBA 1O0BA 2FQXA 5AJUA 1A95A 3HTXA 1ZVJA 3ABQB 3KXLA 3O2JA 1KDRA 4TRNA 2QNIA 4J03A 1UJMA 4M9XA 2JIPA 4AO7A 2BGWA 3S1SA 2FN7A 4BNVA 2AFRA 4L7IA 2IOQA 1AQLA 1GZDA 3CH6A 2A1TR 3DGFC 1Y6JA 3I9KA 2JAXA 4HGOA 4MWBA 5CVEA 5EZYB 3HKBA 5IVKA 3D7MA 1JQAA 4HQLA 3EG9B 4M53A 2OBLA 4A03A 5U9CA 1KAMA 3VZCA 3EC7A 3NM4A 2IDMA 5BW4A 1NIJA 4ZMBA 3II6X 4O63O 2XGMA 3UMGA 1Q0RA 2FRVA 1Z26A 3LDHA 4D4JA 4EO4A 1ODTC 4N3NA 1RHRA 3N07A 3KDSE 3GFOA 4NOJA 1E2QA 2B1GA 1OXTA 2HK6A 4QQ8A 2B36A 1B8VA 3HCBA 2ZUUA 2RGXA 4BC7A 1KI4A 1U0RA 1Z7EA 1DWQA 3KZVA 4W7SA 4CT5A 5ADZA 1BJRE 3CZQA 1OA1A 2ECOA 1WW3A 2QK4A 2XYRA 4B7CA 2FB9A 1DXYA 3B3GA 3UWSA 2PCJA 3W6UA 3TD9A 1Y3FE 4BNKA 4JL5A 1VJCA 4Z3OA 1JPUA 1G9XA 2JJMA 2ZYWX 5FI1B 1KR2A 3G3EA 1NU6A 5CB4F 3T52A 3WP0A 4A8PA 1KORA 2F67A 2I1WA 2YH2A 2VNJA 1FUGA 2P9GA 2V59A 3DBLB 3EGDB 3O4GA 2ZUSA 4IFEA 4M0CA 4WDRA 4B43A 4D82A 4GGOA 4MITA 3OP4A 1UAGA 2OGSA 4IMIB 5DX8A 1MB3A 3B13B 3NO4A 4PROC 3GJ8A 3O8BA 4JROA 4MEJA 5T8KC 5CFPA 1U7PA 1XDWA 2VQFC 4US1R 4ARUA 1JR3E 1RIFA 3TSAA 1U0HC 4R8SA 3X1WA 2EWWA 3DMGA 1LDBA 1YV9A 4NOZA 2HBYA 3QLVC 4FX2A 4REQA 4B48A 3U44A 4NSNA 1OAOA 3AVPA 5AIAA 1IPEA 1CUUA 2MR6A 4CV3A 1IQRA 2R6DA 1JFTA 3AF0A 3WB9A 3JRWA 4RWZA 4YAFA 3IVMA 1YQXA 4X62C 3WGUA 4HCJA 3QOXA 4QFCA 4DEYA 3BE5A 2GFIA 1B3RA 4EARA 2D1SA 1XR3A 2ZULA 3D7KA 4BVJA 1BU5A 1E9EA 1NNLA 1Z6TA 3KR2A 3MWJA 2PZFA 3VRHA 4M0UA 5JTTA 3GH1A 4HN4B 4KVAA 4RSHA 3WHLA 3UHPA 5JAMA 3OZTA 5TX7A 3WV5A 2OT3B 4JJ4A 1TLFA 3CO0S 4OQFA 1HSZA 1JQKA 2POCA 2OSVA 3DZIA 1Y3CE 3E2PA 3F9RA 1UBNA 5AM3A 3AXTA 1C3EA 1H4TA 2O1SA 2EGHA 2NO1A 3T3NA 1QWIA 3T38A 2RJOA 1GDTA 4EB0A 1CVIA 3DLAA 4BLRA 2QVBA 1YKFA 2ZS8A 3WLEA 3HKEB 4YMTA 1YRAA 1UPAA 4PRKA 5MN4A 4FNOA 1JJBA 4YV7A 2GD6A 3B60A 4E5MA 5EMNA 3R2JA 4OJQA 2A0WA 1KYZA 2AVDA 3KWMA 3M6MD 3MRTA 1IM5A 2UXDC 4JNCA 2FDRA 1J8MF 2GKGA 3I9LA 3I73A 1KU6A 2RE8A 3RARA 3MS4A 1MX9A 3OCZA 1PV4A 1VE7A 2WWIA 2J5BA 1NQTA 2W6JA 2ZYSA 3MPOA 1IXYA 4AM8A 5J3JA 1T9AA 1KVUA 1Z5GA 1GGVA 1T4CA 4OF4A 4EW1A 2R1UA 2MMAB 4I36A 5LNK1 2GAAA 3FF1A 3I12A 1P4RA 2YQZA 2GN0A 3NWPA 4LG1A 3D1LA 4MHSA 3RUHA 1Z2AA 4CR6A 1G8PA 2C42A 5B7NA 2GOYA 5BUSA 2YV3A 1P0QA 3ROKA 5IPFA 4UMDA 1MJNA 4Z7NB 5KYNA 1EQAA 3MF4A 4HDOB 5JSUA 1K27A 5L3VA 3TLZA 5JH7B 1TIPA 3GT0A 1K7CA 4LNHA 2A94A 1FYWA 4QJ3A 4OMDA 2V97A 1ZHHA 1OPRA 2UXBC 1M33A 1UOEA 1YQEA 2HIMA 3BMQA 3QWIA 4TM8A 2V6BA 1NHWA 3OQPA 4BQQA 1VJTA 4K2AA 2P9HA 4D45A 1PZXA 5A9RA 4YCMA 1JWLA 3JAWA 3P2YA 3TIFA 2YWCA 3R8XA 4AROA 4CF3A 3G23A 3L1UA 1XDBA 5DCUA 3V3TA 3G1WA 4Y3UA 5I7UA 1C0EA 2W0SA 3MJFA 2HA5A 4M1SA 4RLHA 2HNBA 4ZICA 1SO8A 3SNKA 4I4TB 3GGOA 4YUXA 2JATA 2O8NA 4F5WA 1AURA 4TSFD 1XRCA 1N5JA 2IV3A 4P36A 4Y2TA 3ZWBA 2IH5A 2VHCA 3ZY6A 4I4TF 4F7DA 3KRTA 4CBVA 1D2AA 4C6SA 1U2SA 2W8ZA 1IJKA 1VL1A 1QNLA 3A4VA 2GJ4A 2BT4A 4YHHC 2XZTA 4LC1A 3UXHA 1MCZA 2X7JA 4Y2GA 4M0MA 1KYYA 1U2ZA 2R1TB 3AY6A 1UBOS 2QE7A 3NGLA 4ZOCA 3V34A 4EDHA 3DE4X 5BVGB 3GRCA 1XXHE 3FPLA 4KLRA 4XGQA 4ZEMA 5BSGA 1W5EA 2X5KO 3EFHA 4DM3A 2C0CA 2XWSA 4EP1A 4DB2A 4G0XA 2VJNA 1IATA 2IYUA 2CK3D 5L3QB 4FZ3A 1J1UA 3FZYA 2OYCA 4YACA 4W5TA 5CTAA 4B1FA 3OQMA 1Y48E 3IMFA 1TYZA 2ZKIA 3SHOA 1J5XA 3HGTA 4G41A 2A0XA 1FNSA 5EPEA 1ADCA 2OZPA 2NAPA 3OPMA 4PNZA 5AJHA 5DW0A 4F56A 5HK9A 4QPCA 1QF7A 1UDXA 2O4CA 3D0KA 2MT9A 4E22A 1Y1TA 4JB2A 3AKYA 3CIFA 5KUTA 2XXAA 1JBKA 4K86A 2XMCA 3P9RA 3Q3HA 2NO9A 2ODBA 4O8ZA 2SKEA 3S8EA 3O9VA 3GLIB 1FE8A 1MQSA 2FOXA 3OHPA 1EGMB 5KYTA 4H1WA 2WKSA 2C4WA 2N47A 1R27A 3R41A 2WD8A 3MM4A 2JIZA 4GU5A 4JS0A 3TFWA 3IP8A 5DM60 4BPBA 4G9BA 4OHUA 4G0MA 1VPVA 4WXPA 1OFVA 4TZTA 1D5CA 3C45A 3TW8B 5TQ2B 4ZAZA 4RS4A 3ZI4A 1ONNA 2JLCA 4D2IA 1RPZA 2FP4B 1I2DA 4B3DA 4N7JA 1XTJA 3BK7A 3CVVA 2R00A 1D4OA 5ALPA 4HAUA 2RHRA 2WU0A 5C51B 2UZ1A 3B9RA 4A36A 4YMGA 4HYQA 5KQMA 5CRIA 3KEMA 2Y3IA 4P4LA 4KIUA 1D0VA 5CB0A 3QF7A 3F4BA 1C3VA 2JLZA 1EX9A 3DNFA 1RZRA 3LCRA 4AFNA 1AQJA 2WSBA 3U1BA 4E51A 4F11A 5DWDA 2ZYRA 4LWZA 4DILA 5FUWA 5F7XA 3IP1A 2QSZA 1MB0A 1NF9A 1IHPA 3E6AA 2B4AA 4ER6A 1KI1A 3AGQA 3CNHA 3RQSA 2GN9A 3PUXA 3MZ0A 2IQ5A 1TCAA 2O8BA 2AX3A 4OKSA 4MDYA 1HLGA 1QP0A 5T5QA 3FPCA 4GE0A 1IN5A 3UCEA 1CUEA 1TCCA 1TTQB 3HM2A 3ACBA 2OOSA 3CONA 4IWXA 3JQ7B 1E1DA 2EERA 4MVJI 2D8AA 5DBFA 2QG9A 1ABFA 4FXPA 1YFKA 3A7EA 1UC4B 4V02A 5CNJA 3RSSA 1H0KA 3C48A 2XF2A 2X3YA 4A9AA 3THOA 2Q28A 3CPHA 4YO7A 5AOAA 4BMYA 4YHHB 1QGDA 2AG0A 3JATA 1QANA 3VR4H 1TMGE 3QEJA 4E94A 4Z49A 3ULKA 1WUTA 4GKKC 1GT6A 3V1LA 1RZ3A 3RNOA 4YAGA 1ZL2A 4M7WA 4W9MC 3FSJX 4HXYA 3CZ4A 3RS3A 4K9DA 4NNJA 2HNKA 4J4BA 3O92A 3FFBA 1ZH4A 1T5DX 2NO0A 3PLRA 3S4YA 4HPVA 1N57A 1PU2A 1XCJA 1TYDE 1ZOOA 3EXAA 1G55A 4BGUA 2IUYA 3SZLA 1RTTA 3GLGA 1ORIA 3OEED 5A4MS 5JADA 3BULA 2P7IA 4IDEA 3DKVA 2J0QA 4FI3F 1F51E 4MQUA 3MYRA 2ZK7A 2YW2A 2Y6VA 3QKWA 2NZWA 1GRQA 3LTEA 4MRMB 3H4MA 3K0SA 1Q0ZA 1J25A 3CX4A 4JCCA 5AO9A 3KL2A 1TCVA 4ON9A 2PFGA 2OXTA 2O6LA 2V7VA 3FVVA 3HUEA 3NAMA 3IXQA 2AYYA 2EOAA 4ZEXA 3DHEA 4P4GA 3STTA 3ZNOA 3SVZA 3Q4GA 4X93A 1EE2A 2IODA 2I6QA 5B5SA 1AUPA 1T5IA 1RQNA 2E1RA 1ESDA 1FTYA 1NUUA 4O4IA 3O4JA 1ODIA 2QTBA 5CFNA 4JDPA 1EGHA 2LD4A 3T3PB 3CUUA 1TD9A 2TMDA 2BY4A 4KGVA 3RYIB 4Q1EA 4ZV9A 2K7FA 3NVKI 3LQFA 1VJ0A 1EAYA 1NJ1A 5CB4B 1E6EA 2A9VA 1WPRA 3PGVA 2C29D 3KKLA 1Y1RA 4IF6A 4XRRA 1W49A 1P5JA 2HRBA 3BGIA 2VDLB 1DJOA 3DBVO 4J07A 4R3NA 5ALOA 4YWHA 1DC7A 3H5LA 4ETWA 4IGKA 1H0RA 3F7TA 3R5JA 4GECA 4LRSB 5DK4A 4UCFA 3T9BA 4BMNA 5JSFA 3BS4A 3ER8A 4OQQA 3QUTA 5J2TF 3B89A 3KELA 1IXSB 3I3OA 4Q03A 3WO0A 1CUGA 1T2FA 2AHOA 3HR8A 4LSWA 1FJXA 1PG4A 4X20A 3HU3A 1AQIA 1WRBA 2YXPX 4V3CA 5SYAA 3CEHA 4WKGA 2ZTHA 5KYYB 1VG8A 5GPBA 1U9JA 2H1CA 2H2GA 4CG2A 1T0UA 3QBDA 5FBLB 5FBHA 1UIMA 2HLDA 2VIIA 3UWPA 3HN7A 3ZQ6A 4XTRA 3LNTA 4BN0A 3NGMA 2R751 3P2KA 2BMDA 4KO1S 2IBTA 1KJJA 3I0ZA 2YZMA 1PSWA 1S3IA 3C3JA 4HNVA 3BH0A 3BJMA 4JVLA 4WA7A 1U7HA 5AHKA 3EGDA 2DUJA 1TUIA 3B3FA 2WZCA 5KINB 1XEWX 4RULA 3MK31 4Y67A 4B6EA 3WLLA 5D6NA 3A25A 4JYMA 3WQQA 4E6PA 4LWPA 2QD2A 4KXUA 2GZ3A 3F73A 3JZIA 2FMIA 2HTFA 4NY1A 3K4PA 2DTEA 3NHBA 5CNKA 3WSVA 3WO1A 5CITA 2D4HA 2UVDA 4FFPA 1VCIA 2VG8A 2WVGA 2Z2ZA 1T0IA 3GIWA 3OQHA 4ZVUA 3RASA 4EELA 3VR6D 4U7TB 3WV4A 3M6LA 4DTCA 2JAOA 1NW8A 3L18A 5C0OE 4D5EA 1AUQA 5A5GA 5BYAA 1GVNB 3WBFA 1YBMA 3ZNQA 5LQCA 5KC8A 3SK0A 3BT7A 4BTVA 1G41A 2FNAA 1DELA 1PVVA 3DC2A 1QIKA 2GBLC 2NZXA 5M7EA 1ZC3A 4JGBA 4MMZB 2Q7OE 2OSBA 1N25A 4X9XA 4UHDA 4D5GA 4FU0A 4NU0A 2IS2A 13PKA 3L5KA 1YOVA 3FHJA 2F8SA 3UA3A 2QSYA 4PZEA 3UJ9A 1N5IA 4I19A 1OI4A 5HTKA 1YS9A 2BFMA 1SBHA 1T25A 5H02A 1KZHA 4GF5A 4LQCA 3DNPA 5HBRA 3LW7A 4L9RA 3GZNA 4WNAB 3UFBA 1I3KA 1SOVA 1XXLA 1MG0A 4CM8B 2Y8EA 1RAEA 3PHLA 1HRKA 2EQAA 1IHYA 3FPSA 3EVAA 1T1IA 3QELB 5JH7F 4KR7A 5AW2A 2QZ9A 2NQTA 3HC7A 4I1IA 4J1QA 3BF8A 1RWMA 1K0UA 4YH1A 4MS4A 2OBNA 4XXHA 1XX6A 1KHHA 4LFBB 3SZGA 1IY9A 1JHZA 1BOOA 3FSEA 3GNTA 4L02A 3HBNA 3PNSA 5EAIA 1QXSA 1FRVA 2OBYA 3OESA 2FPRA 2Y1OA 2QNRA 3MGKA 4LC0A 3AEUB 2ZU0C 3ZHSA 5M5BA 2IOFK 3H9EO 4HD8A 1W5FA 3IUBA 4KQ9A 2CDAA 3D3WA 2FSSA 2VJDA 3YASA 4QSMA 2BFFB 2JLRA 1YL7A 3IS3A 3DOCA 3Q9LA 3DJYA 4PFKA 2WUGA 2WTUA 1KQPA 1GG8A 3LKDA 3KETA 1FNNA 1DKQA 4L07A 2VHQA 1Y1QA 4NCIA 1T5HX 2W70A 5KU7A 1Y7IA 1GU7A 1K68A 1VL2A 2GARA 4JJZA 3KAJA 2DQKA 1PR6A 4IO1A 3WJ1A 1Q95A 3DLIA 3QFFA 3ISJA 2H3EA 5CLFA 5A62A 1KAEA 5DMXA 2NT3A 3PPWA 2HREA 5DHRA 5EJAA 1WX1A 3UPDA 3LQ2A 5LZ8A 2P0AA 5REQA 1JHPA 1YONA 3N2GB 4I1SA 4A0GA 1FJGB 1S3SA 1YAHA 5CH8A 5BWOA 3A3NA 3MCWA 1RM0A 4HLNA 5JNRA 1R7RA 5DV9A 5D5HA 4G37A 1A71A 1LS6A 1QK3A 5GADl 2JLBA 1SMKA 2WTBA 4EF6A 1BGWA 6PFKA 1T4BA 4UUOA 1K8ZB 3DKRA 4FZRA 2ES4A 5HKOA 2C1EA 5KNBA 2P2CA 2RHLA 3VV2A 4NE2A 4KOAA 4ARZA 1AHHA 1WKBA 5HF9A 4PGFA 1R8YA 1U90A 2C5AA 1PP4A 2WSSD 3ZU3A 4IMRA 4ZCLA 5FFNA 4M0LA 5LVAA 2YWXA 2C3YA 4ZYTA 2C5HA 1TDJA 4M49A 3HVJA 2AXPA 3LUFA 3FPKA 4G5OA 4PZPA 3INTA 2RARA 4EGCB 2CJXA 2WHQA 2XMQA 3RR2A 1O08A 1SC6A 2BDTA 2I7TA 3BIJA 2WSLA 5DK6A 3TX2A 4D9EA 1U63A 1J8DA 4K9PA 3B6MA 3DBIA 4G4SP 3BXHA 2D5LA 2HGZA 2LNDA 2WA1A 1I1NA 1RZUA 3ORHA 2OV8A 4YLYA 3GLKA 3ILHA 5AK6A 1UBLS 5HUJA 1IXRC 1O9HA 2WBLC 4DNFA 4TQAA 4A2WA 2BSXA 1F2UA 3ZE8A 5AUPB 2VSNA 1Y9EA 5G41A 3MUOA 1U8XX 2I7XA 4XEUA 1I51A 3PX3A 3KYCB 4LWOA 4OGWA 2NSHA 4R2KA 3JARA 5AVVA 4RVOA 5JBNA 5TQ0A 1T2CA 4MA0A 4MLDA 4FI3C 2UYHA 2OKCA 1CR4A 2ONZA 1U8FO 3HDVA 4R68A 2MINA 5E2IA 2AJCA 4QO8A 1K1EA 5FA6A 1IIBA 5IM5A 5LIRA 3A10A 2A2ZA 3OVMA 4HUJA 4MPPA 4R1SA 2HBRA 6ABPA 2J5XA 2XITA 2Z5VA 4YJ3A 1OHHA 5ECYA 4D42A 3PC8C 5FOVA 5CLGA 5CFMA 1I8TA 1WHSA 2H54A 2LCFA 2ZE5A 4FYJA 1MPXA 3DAPA 5FEMA 4AWBA 1Q0UA 1NNI1 2QI9F 3FFTA 1NYQA 4Y9SA 5IKEA 4QNRA 4P80A 3KOMA 3G2NA 3AHFA 2ZRMA 1B42A 2G88A 1N9GA 1RC1A 1NAHA 4B8YA 4UBKA 3B3AA 1EB8A 1M0EA 2FW0A 1DX6A 3D2BA 3E23A 3DW3X 3H6KA 5E38A 1E2JA 4CL3A 3AEKB 5FPKA 4HNSA 1JR2A 1JT9A 2VQ3A 4N5IX 3RBVA 1CXZA 4FK8A 3KU4A 1JKJB 1QAOA 4N3CA 5IBQA 3NH6A 4XIGS 3RBXA 5KYVA 3N05A 3N5CA 1L1FA 3Q8LA 3RGGA 2ORYA 4ZZIA 1ZGZA 3QQ5A 3C8UA 3ZWWA 4KXWA 4FFWA 1R0WA 4PXYA 2ZE7A 1G64A 3N70A 2C78A 4ZVVA 721PA 1VCNA 2GNOA 3H8JA 1JZQA 2I33A 4RABA 2DRIA 3FCOA 5DXJA 2BTOA 3HJCA 4WK2B 4Y0AA 5KJEA 2YYSA 2OILA 2QXUA 1CS0B 1U1EA 5LR6A 4TMFA 3PEFA 3B5EA 4ARVA 4Y18A 1JAIA 5ENZA 3EBLA 3I61A 1IMJA 5AR1A 2FEOA 3ESQA 3L0IB 4TVSA 3PHCA 4BAZA 1KI8A 1N2SA 3SC2B 3UA4A 1G8SA 4ZDJA 2ZDHA 3MIZA 3AMVA 4HB4A 1U2PA 4IKEA 1WEHA 5IX8A 1J5EB 2PQ0A 3M89A 3OZGA 4HRXA 4V0ME 2KQUA 5AJYA 3ZXIA 5C8XA 5T8KA 1K7XB 3TCNA 1RE1A 3PKJA 4I9GA 3UIEA 5BPHA 3T1YC 3GLFB 1NYTA 1AE1A 4PCAA 1KE2A 4V1CA 3ZHVA 1HG0A 1KC1A 1A5BB 1USGA 3WYAA 1EVYA 3LKBA 3JD1A 2C20A 1H4QA 3T4EA 1NQVA 1SC3A 4LIPD 3VR2D 1JFFB 4PRLA 3KTAB 3ZCXA 4OYCA 1NSTA 3AM4A 2PE5A 3A1FA 1QO0A 2H1FA 1AS3A 2VL7A 4HB3A 3ILYA 4XSHA 3TO5A 3VBEA 3D3NA 2ODTX 4GXRA 4UBJA 2BGLA 2E48A 4UE2A 4WXMA 1W4AA 4IS2A 3IUJA 2Q8PA 3DE0X 3FIJA 4ZALA 1YE5A 4HQRA 4UREA 5JYDA 4HXEB 1TAHA 3C3XA 4XPZA 3MINB 4P9NA 5ESDA 1U7TA 3R7WB 3EG9A 3NCTA 4RHEA 4BJ6A 1YIOA 3HCRA 3OT1B 3KXPA 5J2TB 5EESA 3VZPA 2XY4A 3HP1A 4BZZA 1SBCA 1ZJWA 4MWOA 2EGGA 1P7CA 5AJWA 5IM4F 3DBOB 4B6OA 2CHQA 2AF4C 2B8NA 1B15A 2JIOA 1GCAA 4PHTA 4DBZA 2EHDA 1F60A 1XAHA 1QHIA 1AOXA 2X6RA 1AT1A 3GFVA 4KIFA 5IT4A 1HNZB 4XDHA 1NPDA 4MGIR 3H04A 4UU1A 3SXJA 1PEKE 1YBFA 4OGLA 3L1KA 3PGKA 3O38A 4QLOA 2XZLA 2M5HA 1S4QA 5A5FA 4X7BA 2JGEA 2A84A 1Z47A 1U98A 1CNEA 3CEPB 1E0KA 4B6GA 2QX7A 4CI0B 5JQGA 2D2VA 2VPTA 3DMTA 3PC4A 4F04A 1JTVA 2FSPA 5HCNA