4DCTA

Crystal structure of b. subtilis enga in complex with half-occupacy gdp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
432
structure length
401
Chain Sequence
b'KPVVAIVGRPNVGKSTIFNIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN ENGA
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 116
structure length 401
sequence length 432
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dctA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dctA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dctA01
2A30A 4PZZA 2ZRHA 2FF7A 2J59A 2QEQA 2H5EA 2ORVA 1ZAKA 4HUQB 4L16A 2OXRA 1J7KA 3HPRA 1IBLC 2B8TA 3B1WA 1P7CA 1TU4A 3SHWA 5JS7A 1QHGA 3OEHA 1AM4D 5FOUA 1LS6A 2GZDA 3T1YC 4L8GA 3D8BA 5FPHA 2OSBA 3REFA 4CZ2A 1KZ7B 2O8BB 3GP8A 4A92A 3T5DA 4O0MA 4WW0A 3AV0B 4U02A 1ESNA 2ZI6A 1XPRA 4HYYA 1R5BA 1FUUA 3AF2A 5L3QB 4KODA 1LS1A 3LW7A 2GCNA 1OJLA 1FNNA 3U6KA 1KDRA 1E0SA 3FOZA 3F0TA 3O8DA 3VFDA 1QG4A 4LPKA 4I1OA 4JLNA 3SYNA 4YY3C 5DN6A 2ZRKA 3N2EA 3KFVA 2JLWA 1XEWX 1KI1A 4JLPA 4M1KA 5E4FA 2PX0A 3OIVA 4URWR 1Q0UA 3HWSA 2IWHA 1RE0A 4MKHA 1Z29A 2VIIA 3WNBA 1SKQA 1GL9B 5KDLA 3A4MA 4JI8C 2WMNB 5EZ6B 1K0RA 1KAOA 1P6XA 5DHAA 5GJBA 1E98A 3WBJA 3ZDQA 4NCHA 2ZRJA 3TAUA 4KLZA 4DSOA 4DV2C 2J0SA 2ZYTX 3GLHB 1YZNA 4PAOA 2QSZA 1NVXQ 4JKIA 4WZ6A 1BS1A 4ZKEA 2NO1A 1W36B 2VH5R 3BK7A 3FHOA 4Q9KA 4BQSA 2VHQA 1FPMA 4WXPA 1LQLA 4TTPA 5H1YA 2B7BA 4GOKA 1RC8A 4PO8A 1Z08A 4DV4C 3DEFA 4GOJA 2W2XA 1QHIA 3CLVA 4AWXA 3A6PC 1VKJA 1G7CA 1OB2A 1G41A 1P9RA 1ZM3A 4CEJA 4ZDWA 2GEUA 1QG2A 2HT6A 3H4MA 1WA5A 1Z47A 3DL0A 4YMVA 5CB6A 1PLLA 2YOGA 2QG6A 1S1CA 1HR0C 3KQLA 2Q0HA 3ICQB 4UNSA 1UKVY 1NNEA 3TIFA 4TL7A 4BFSA 3WMGA 4PTLA 2D7VA 4RY2A 4K0KC 2CL0X 1TEXA 1NYEA 2ZQ5A 1Q1QA 1XD9A 3CW2A 4KSCA 2RGDA 3VR2A 1IBKC 2O8CA 2F3TA 1QVAA 4TYQA 3SJAA 1GSIA 3P32A 4PZLA 3ZVMA 4C2TA 1UKKA 1DAEA 2CEAA 1G4AE 3LQRA 3Q8XB 3E2IA 4JLAA 4KYUA 1UKYA 2BM1A 2WICA 1XXHE 1W0KA 2W0MA 3RAPR 3UG7A 4A2WA 3OTOC 5JMTA 4ASUA 1SKYE 3AVPA 3ZD6A 4EPWA 5CITA 1E79D 2OM2A 1GKYA 4I81A 2FFAA 1G6OA 2GAAA 4D4JA 1N33C 3RRMA 1D9ZA 3KXKA 2F6RA 4C2UA 5D3MA 1RW4A 1N5IA 1JBKA 3MMPA 4TT3D 1NJGA 2C9CA 3NTUA 2H16A 3KJEA 2XB2A 4F4CA 2AWOA 4AKHA 4TSFA 3RLFA 4KITB 2GHIA 1Q22A 2FSGA 3ONWA 1TTTA 4JMPA 2GCPA 4DBLC 4E5UA 1VLAA 3K9NA 3HYTA 4C9BA 4XWOA 2QBYB 1Q20A 1XB2A 4RD6A 4Q4JA 4Q4HB 2A5YB 1GILA 4LYHA 3NC0C 3AKYA 4LBVA 1R0YA 2AR7A 1XDBA 4MYTA 4IDNA 1NKTA 3U3RA 3IHWA 2JJ8A 2OESA 4Q9IA 3ADCA 2QBYA 2V3CC 2GK6A 4IXNA 4IDHA 4OHXA 1Z3IX 1BOFA 1WRBA 4H1UA 4ZCIA 4LDJA 4KI0A 2ZUDA 2XNDD 4KJZA 5E3HA 1N34C 2VLIA 2EW1A 3C16C 1HNXC 2V1XA 3QEJA 4JYCA 3VX4A 3U7HB 1NRJB 3MAAC 3QEOA 1X1SA 1SZPA 4JLDA 3DHWC 2WWWA 1XTIA 1T0JB 1XNQC 3PEUA 1Z5ZA 3UPUA 1IN4A 1W44A 4JVMA 2A5FA 2LKDA 3LW8A 2F9MA 2Q6TA 2HUPA 2ZTSA 1U8AA 3EPLA 5L3SB 3AKCA 3K9HA 2WVJA 3GLFE 2DB3A 4FMCF 4BFUA 4ZI2A 1K8RA 2ZSAA 3T15A 2CY1A 3PCRB 1G3UA 4TZ0A 3WP0A 3FGNA 2OUKA 3R7WB 4LJ4A 1P4SA 2R9VA 5IT9D 3MD0A 4P4SB 3VKGA 2IXEA 3U3JA 2KBFA 4DHEA 1WBDA 5J5CA 1KK0A 3LWNA 5BN5A 3PR1A 1E2MA 4K46A 2C03A 3KXIA 2X19A 3C14C 2QSYA 2HXSA 5EP3A 4P32A 4QM6A 5DI3B 3R7WA 1HUQA 1E2JA 3PG5A 4P4SA 2IK8A 2OBNA 3QSYA 1WE2A 1OHHD 3J80D 1NLYA 3AF4A 4BWYA 2HJVA 2C04A 4NYMQ 3JVVA 1YZTA 1OE0A 4TYPA 2XITA 2ORWA 4DZZA 4Z8YA 3QBVA 4LFAC 2WOOA 2GZHA 4B33A 2WTUA 5HR5A 4QNRA 3X1YA 2K5UA 4KAXA 2C2HA 3B13B 4PANA 1TU3A 2CE7A 4LBYA 4JLVA 1II0A 3UMFA 5KHOC 1JJVA 5KU1A 5LMUC 1T91A 1E2FA 2IYYA 2R2AA 2JATA 2ZS8A 5KSPA 2WPDA 1T4GA 2V7QD 4ZI3A 1G6HA 1XTKA 2EFDB 2ZUBA 3RANA 2X1VA 3I62A 4YQFA 1U9IA 3EPJA 5JSZB 5J47A 2CBZA 4FCTA 4XD7D 1Q1ZA 2EVWX 4YMTA 1W0JA 2IHYA 3MWYW 2CK3D 3W3AA 3IEUA 5JJKA 1NG1A 3IPYA 1EK0A 3CR7A 3FB4A 1XEWY 4DXAA 4DT1B 4D4MA 2CNWA 3U7GA 2KBEA 2F1HA 5F9HA 2NG1A 4GI7A 3EZFA 5JSZA 4B3FX 4G0NA 5ELXA 221PA 4EKDA 3MGCA 1N32C 3AF1A 4LUCA 5J4VA 2CLDX 2HV8A 4JLBA 3QG1A 5IK2A 4C0QC 1PA4A 4Z54A 2YOHA 2HCJB 2JJ1D 1TQ4A 3QF4B 2ZJOA 3EG5A 4GP7A 1KI6B 4FCWA 1QZXA 1Z83A 4NCKA 3TUZC 4OQMA 2BDTA 2VEDA 3IHLA 3LAWA 5CK4A 3GLGA 4UXIA 4JL8A 3K53A 2RHMA 4QGAA 3AVVA 3CH4B 2UUCC 1VG1A 2HLDA 2OHFA 4UXJA 5ANRB 2QL6A 4AG6A 1OIWA 4X65C 1TNDA 1XCMA 3FHTA 2C99A 2F1IA 2BCJQ 4EPVA 2ORIA 4HSEA 2ATWA 3PVSA 3L0IB 4G5RA 3V4FA 3LVRE 4Y0AA 3TK1A 3K9LA 4YMWA 2AD1A 2CDNA 1UBFA 3OFND 1KY2A 4BLQA 5KNCA 2F43B 3BH0A 1MR3F 3A8TA 3QBTA 3IIJA 4KVAA 3VU9B 2KZFA 3BWDD 3SBDA 3CX7A 5DSZA 5JWHA 4RJLA 4TWZA 1QHHB 4DDWA 4QJ4A 4ARZB 2D7DA 1FUKA 3O47A 5KTYA 2Z4RA 1E2LA 2ZRGA 3A1TA 4QOSA 4LCBA 1W36D 1DOAA 4WAUA 4F7WA 1P2SA 2F4VC 4PC2A 4D2IA 2YCBA 4NZYA 4Q1AA 1P2TA 1KIMA 1N6RA 3PUZA 2EQBA 2KE5A 2G9NA 5IRCD 4ARZA 5SZHB 3CKLA 5E7MA 2WAYA 1NN3A 2W6IA 2X2EA 4D4LA 2AHOA 3VX3A 4B47A 4OJQA 1HH2P 3Q3JB 4NKRA 1P3JA 4I1SA 4V0MA 4K8OA 3WXMA 3EAQA 4A4DA 4M8NE 3Q7QA 2QTFA 3KXLA 1W0KD 3TSWA 1KHTA 4ASUD 3GJ0A 4MYUA 4C0JA 4M1WA 4LYAA 4C4PA 4PSAA 4Q47A 5G3YA 1NLZA 1E4VA 3K9GA 3BIFA 2BVNA 4G5OA 2GF9A 4QHTA 2QT0A 2W00A 2ZREA 1CR2A 1XJQA 3FFAA 4OHVA 5AUNB 3QXHA 4M9ZA 3VMFA 3RS5A 2IC5A 4IVPA 5AJWA 5FUWA 3LV8A 3W6NA 4DCNA 1N6IA 5C1BA 4PR0A 2PJZA 3LLMA 4WOPA 3DKVA 1G3QA 1F2TB 3CWZA 3PUWA 1AKYA 5EUMA 4B3XA 3IEVA 4LZZA 2XTZA 4Q00A 1SVKA 1HNWC 2WKRA 3BORA 1MABB 5B64A 2ZXUA 2EFGA 1F48A 1T5IA 3J81D 2EFHB 3KX2A 5DNYB 3VR4A 4PAMA 3CIOA 2YKGA 2DFKB 4B75A 3SU8A 2VBCA 3ZIAD 2OILA 4IJMA 3GEEA 2A3RA 5EXSA 2FEOA 1W5SA 4GMDA 3DOEA 3AVQA 4HAYA 1WB9A 2YJTD 2E1RA 2KJQA 3B1YA 3C8UA 4FMDB 4EPXA 3W6PA 4DR1C 1XZPA 4OQXA 4FINA 4KVGA 1JR3E 2FOLA 5G40A 421PA 2IWRA 1RIFA 1J70A 4QGHA 2QPOA 4XOIA 4XSHA 4DIEA 4M9QA 1GNRA 1IN7A 2Z0MA 3VR6A 1UDXA 2ZSDA 3TNFA 3ZGXA 1FP6A 1ZIOA 2GJ8A 2P0EA 3IIMA 4NTZA 4TQAA 3VNVA 5FBRB 1GWNA 1SVIA 4OQNA 5JWRA 2V54A 1GL6A 4DLRA 4PHGA 4XH9B 4X8OA 4BFVA 3NIBA 1OFHA 3MLEA 1Z07A 2VL7A 3A1UA 1D2EA 4MGZR 3PJRA 2R6DA 5H68A 1DAKA 2OO7A 1KK2A 1CJUC 1EGAA 1USPA 2VHTA 3F5FA 4WIAA 3CPHA 5GJWC 2PH1A 2IF0A 1TADA 5E7JA 4ESVA 1NKSA 4EJSB 3NEYA 3RRYA 3W3ZB 2E9SA 4XTRA 4EDHA 4Q1EA 3JVUA 3SFVA 3U61B 1XJCA 1ZB9A 4JVNA 3X1DA 4DSTA 2BOVA 2NO0A 2QE7D 2ZU6A 2G6BA 3EWSA 4B35A 4YHHC 2XZPA 3B9QA 3GJ3A 2XJ4A 2JLYA 1MO6A 4IEEA 3BD9A 3OIUA 3TAHA 4A2QA 3QNUA 4IRUB 3QG5A 4RD4A 1J2JA 1MT0A 3L82B 4WZBE 1II8A 3CX8A 4PPQA 3WMFA 2OAQ1 1YVDA 2RGAA 1SXJE 4I1UA 3O8CA 2ZS7A 4DLVA 4ZPXA 2DCUA 1DG1G 3GLIB 4PC1A 3ETLA 2J0QA 5JECA 4MRRA 1CR0A 1OIVA 2FG5A 3Q5EA 5EQTA 1ZM2A 2QT1A 1T3LA 5CK5A 2VP9A 1ZC4A 1BMFD 5KSZA 2ATVA 1RKBA 3B5JA 4XTCS 1G17A 3NH6A 4M2LA 1CIPA 3U60B 3C15C 4DLTA 1RPZA 4QBHA 2IUSA 2WPDD 5F98A 2NMVA 3GEIA 2AXPA 4QJ3A 1CLUA 2IYRA 1EX6A 1ZM9A 1KZGB 1ZBDA 1R8SA 4JBWA 2OG2A 2B92A 3GJ5A 2QP9X 5L8VA 3AVTA 4WVFA 4U00A 3UKDA 4QNMA 1OSNA 2NZJA 1HE1C 4TT3A 1AJEA 5FOVA 1NN1A 2QRNA 2IYWA 5CB8A 1CTQA 3OEED 5KDOA 2YZ2A 4MITA 2D74A 3HPQA 5B30A 2QORA 3EZ2A 4DLWA 3A1WA 3WRXC 4Q48A 1DAIA 1GTVA 4NMMA 2W0SA 3I1FA 2OCBA 1Y3AA 2QUZA 2OXCA 4JI2C 1S2MA 1J5EC 1RVDA 4AQYC 1WQ1R 2GKSA 1GRRA 3W8RA 3JZAA 1GL7A 4HLQB 4N1AA 4PXAA 4QKQA 1YR6A 1WH9A 3CM0A 2DYJA 2OV2A 1ZD1A 1DPFA 3FHCB 5TV2A 3IQXA 2XXAB 3VHLB 3SEAA 5FPYA 1FL9A 2AKYA 4BASA 4D25A 4RD0A 3I61A 1Q57A 1AZSC 1TQ6A 4BEBA 4DWJA 2WKQA 2W83A 5FLXD 5EP4A 2VHUA 2XTNA 2XSZD 2VQFC 4WA7A 3SJZA 1LB1B 2G0TA 3CPEA 4PO9A 5CM8B 1AK2A 3TMKA 2ZR0A 2ZRMA 2REXB 3B1VA 1HE8B 2NO9A 4EPTA 3CZPA 3RWMB 4B2LA 4A2PA 1NN0A 3WNDA 1C9KA 2CVFA 4H9GA 2REOA 1KJWA 4P4UA 4NOZA 4MGYR 1PUJA 1GFIA 5K8LA 2RMKA 2FE4A 3AEZA 4Q21A 1Z6TA 2WMOB 3SI7A 2JLQA 4LV6A 1KSFX 1XTJA 1DO0A 4MDEA 2YNMA 1YR9A 5LPNA 1UAAA 1H8HD 1QVRA 3LXRA 4KCGA 1P5ZB 4FW9A 4DLSA 2O8FA 5JWOA 2EYQA 2V4ZA 1ZNWA 1MRNA 1HNZC 1E0KA 2JJ2D 4RD2A 2BBWA 4NONA 4HAVA 5GJVC 1DADA 1AZTA 1W4CA 2UZIR 2WSMA 2ZPTX 3B85A 4C0LA 4GDFA 2ZI9A 2LWIA 2H1LA 3KL4A 1X86B 4MKIA 3WHLA 4O25A 1NBME 1ZNYA 1I94C 4NCIA 4B3CA 1FMJA 1OHHA 1YZGA 3BE4A 1W4RA 4LF4C 4X8HA 4ZCLA 1E9RA 3IO5A 2QM7A 1A2KC 1E99A 1F60A 3BFXA 3QKRB 2QGZA 1JOSA 2PN2A 4GRAA 5FOSA 2CMKA 2UKDA 1IONA 2FWRA 4B3MC 5HTKA 5K8IA 4OX9C 5FBVB 3FKSD 3QVVA 5IHPA 5DI9A 2Q3MA 1YHNA 2L0XA 5CDFE 3WY9A 3K0AB 4AKEA 2PX3A 4FXPA 3TKLA 3A58B 3TVTA 4V03A 4IDQA 3TR5A 3O8RA 4DDVA 1U0HC 2V7QA 2VP6A 1KKMA 2YYZA 4M9XA 5SZIA 2PJRA 2JLRA 4RZUA 4JLMA 2IUTA 3B6EA 4GT1A 1W49A 5KOYA 1W2GA 3KFXA 2WWXA 4MGIR 4X64C 4XD7A 1OXUA 1FJGC 1D6JA 1XXHB 2V6IA 2CK3A 3M4YA 3TW8B 3H2YA 3K0AA 3SZRA 1QHNA 3E70C 4F93B 4HUQA 1PZNA 1UBCA 1E96A 4P4TA 3B1ZA 5JCPA 2C98A 2QAGB 2BMEA 3AKEA 1ZM7A 2N1BA 4LJ9A 4UNRA 4IOMA 1E1QD 3CRQA 4RKEA 2RH5A 4X8LA 1CJMA 2WAXA 1G8PA 3BH7A 3W9YA 1KTVA 1ZIPA 2QTVB 3FMOB 3AP2A 3EC1A 3IBGA 2JLXA 3U7EB 4D26A 4BZXA 3HJNA 2QAGA 3G5UA 3A36A 2JJ1A 2GWHA 5L3QA 5GADl 1B23P 1CXZA 3AH8A 3AF3A 4B2PA 4AYWA 2CJWB 1XD2B 3UXMA 1OH6A 2QAGC 2ZAMA 4DVGA 2ZJYA 4V0NA 1RRFA 4NYJR 1EFUA 4NU0A 5HKKD 1E2QA 3QI2A 3GD7A 1N0WA 3ZVNA 4Z8XA 1HY3A 1VECA 4JKYA 2W6JA 3I5YA 1QWIA 3IKJA 2CJWA 1XD2A 2C77A 4B43A 3W6OA 4F38A 2VP2A 1K5GA 3LVQE 3N70A 4N0DA 3IDQA 4ERNA 4LF7C 4TN1A 1IY0A 4B34A 2BEJA 3OFNA 3BJIC 5E95A 2ZSFA 3TLXA 1CF4A 3F3YA 3AM1A 1U0LA 1KYIA 3OAAD 121PA 1KJZA 2ZM6C 1X8LA 4AD8A 4A0FA 1G16A 3GLHA 4Q19A 1OLOA 1KO8A 1X8JA 2R6FA 5KYKA 4Q1FA 1NVVR 5BN4A 5DO9A 1KI3A 4MUAA 5FTJA 3WP1B 4D0NA 3FE2A 1U0JA 1TL7C 4HLUC 1SULA 2J3EA 4RCZA 2PT5A 1N6KA 2PT7A 2WJHA 1W36C 2CXCA 1QRAA 1Z6XA 5TVKA 2EU8A 4LPSA 2RGBA 1X6VA 2PT7G 2FPKA 3DKPA 4P3YA 4DV0C 4HLCA 3I3SR 3I07A 2GAOA 2AD5A 1R10A 3DZ8A 1QHYA 1XNJA 2C5LA 5KNDA 2BWJA 3AP3A 3GLFB 4GMXA 4OI1A 5JJLA 5LB4A 1FQJA 1T3HA 2H17A 4O2LA 2ODBA 2CVHA 4UNQA 2BKUA 1DELA 1FTNA 1U98A 4RZXA 4BRUA 5LB2A 2IS2A 1PLJA 2WIBA 4XWAA 5DHFA 3L0OA 4IVRA 1FNMA 2LKCA 3DO6A 3JZMA 5HE9A 3FPAA 4IFBA 2Q3HA 1KDTA 2VTKA 3K8YA 1O3YA 4RFSB 1GITA 1TMKA 1GOTA 1KKGA 2FJUA 4YC7A 4A8JB 2OPLB 1XP8A 1G8GA 4TTQA 5FI1B 2D4HA 2J5XA 4GNKA 4QGGA 4RFSA 3TVDA 1M8PA 3FKQA 4E22A 2JAQA 2GZAA 2WWIA 3VKWA 3B2EA 1Q44A 4DEYA 2WJJA 4ZIRB 5KSYA 1PVOA 2RB4A 2XTMA 4OKSA 4GKJC 3ZIAA 3IIKA 4BE7B 1VHLA 4MUBA 2ZRCA 1XX6A 5LD2B 4IVQA 1Z22A 2ODEA 721PA 2OFWA 3FTQA 4BSZA 1CP2A 2ZITA 3VAAA 1JXOA 2PCLA 5UKDA 4Q4HA 2QQEA 4JLKA 2IL1A 3OESA 2YHSA 1KO5A 1NMZA 1BH2A 1VTKA 2O8DB 2QNRA 3WRYC 3IBYA 4TLCA 2PL3A 4JI6C 3K0EA 3U44B 2H7VA 1V5WA 3AF6A 4HAWA 3MWJA 2YWHA 1ZMXA 4DR5C 1OXXK 4R98A 2GA8A 2VQEC 3DM9B 4HI0E 5DYIA 4NE2A 5LD2C 4MQBA 4DUYC 2ZEJA 3QIAA 3BFKA 1WP9A 5DGXA 1YE8A 4LGMA 3L43A 1IHUA 1VCIA 3NDPA 4RCYA 3T5GA 2CCGA 2A5JA 4II7A 1GNPA 2RGEA 1IXZA 1N25A 2NO7A 2UU9C 2QPAA 3UANA 4JLOA 4TMXA 1DEKA 4DUGD 1T5LA 4AY2A 1M7GA 1T3SA 1S1MA 3GFTA 5BN3A 1S96A 4HDOB 3K0SA 1G20E 3DDCA 1Z0DA 5A0FA 1JXMA 1W48A 5L3SA 3BERA 1HT2E 4KBGA 2QE7A 3IPXA 2D2FA 2GF0A 2ZVQX 2BEKA 1AS2A 2ODNA 4C0AC 4I1VA 1R0XA 1DG3A 2WBLC 2GJKA 4PC7A 1Z06A 2OAP1 1XMQC 4TQ9A 4LJ7A 4LWZA 5M04A 3B60A 5CIQA 1KAGA 3W5JA 1YRAA 5JEEA 3VNUA 2FSIA 1N6NA 1H65A 4B3SC 4W5JA 3V4RA 3CUEF 1D2NA 1J8MF 1VCNA 3QXXA 1P2VA 4ILEA 5TB5A 4DR3C 2ZRPA 4AURA 1A7JA 1KDOA 2G83A 2XZOA 1ZYUA 3D6TB 5HE8A 1CKEA 1LFDB 1P61B 2NIPA 3KDSE 5EE0A 2O5VA 5J4HA 1Z0AA 5DI3A 2NZ8A 3BB1A 4RD1A 4R71A 4DCTA 1R5OA 1RYFA 1SVLA 1OXTA 4JV5C 1BMFA 4HB0A 3VR3A 1XPOA 1E2NA 4A36A 3VKHA 3L8ZA 4JVLA 1E4YA 5CLLA 4XVUA 1QBKC 4E09A 4BLPA 1F3OA 2C78A 2E8EA 1JEEA 5FTNA 1Z2CA 3WYAA 4XX2A 4M1SA 1ZUNB 1WMSA 1EWQA 4B6FA 3T1HC 5CJPA 4DLXA 4PPNA 2EFEB 3CRRA 1SVWA 4KSBA 2V8OA 1W4BA 1YR8A 4M9SA 5FUYA 5L3RA 1A1VA 1G5PA 3T12A 1U8ZA 3THWB 4HZIA 4DSNA 1E2IA 4GSYA 5BR8C 1R7RA 3SQWA 1NVUQ 1OH8A 2FPMA 2IS1A 3OEEA 3VHXA 2C9YA 3BFVA 3VQTA 4Q5IA 2MSCB 1KK1A 2RCNA 3REGA 2JLZA 1GKUB 1Z28A 5EP1A 1UEJA 4MYCA 3C5CA 3THWA 1M1YE 4L9WA 5EE3A 4DT1A 1DBSA 5FL7A 1OFIA 3R9WA 4X62C 3CF6R 4YDHB 1OYWA 5AUPB 1CS4C 1E94E 1W4AA 5D3QA 2XB4A 4YXWA 3T1OA 3KUDA 3KQKA 4GL2A 3THYB 1NLFA 4GZLA 1TEVA 3BBPA 4AIIA 1BYIA 2WHXA 1US8B 1KDPA 1EFTA 3Q72A 4JL6A 5EJEA 2XX3A 1CJTC 3GCGA 3DOFA 5IWAC 3QF4A 5FR2A 2D2EA 2W6JD 3IUYA 4DV5C 1KI6A 4G5SA 2GDJA 2Q9AA 4QBIA 1KNXA 3RHFA 1ZU5A 3W90A 4QC2A 3RS3A 1YKSA 2J87A 2XSZA 3WBKA 1OFTA 4RZ3A 3QE0A 4KV9A 1VCMA 1US8A 4H1VA 2BMDA 2IS4A 4GKKC 2QA5A 1Z0FA 4LJ8A 5FI0B 2ZRDA 2FGKA 3W34A 3PITA 4PC6A 2ZIAA 3CJEA 3P4XA 3GPLA 4QXAA 3QOFA 1DTSA 4FD2A 1TUEA 1XEXB 1MKYA 2PLFA 4MRNA 3I32A 2HT1A 1C1YA 4DV7C 2GEDA 3T34A 3LUSA 1LTQA 3EXAA 3LFUA 1XCGB 3T06B 2BJWA 4UKDA 2F43A 2ZU0C 4CDGA 3VU9A 4D80A 3RSOA 2Z43A 1ZM4A 1H8HA 4FMCB 1QHHA 2JIZD 4B76A 4D81A 5AK0A 1UBGA 2V55B 4C7OB 2UXDC 4AYTA 4B74A 4NCJA 1N0UA 1CBUA 3P4YA 4LHYA 4OI0A 2MSEB 2JJ2A 1HT1E 3TR0A 4YDSA 5C4MA 4W9MC 2QP4A 3P26A 1ML8A 1F5NA 3THOA 3VTKA 3EPKA 1XU4A 3IGFA 5TXGA 4JI0C 4W5WA 2QTHA 2W58A 2NPIA 2VP5A 2KSQA 2IS6A 4Q1BA 1OYYA 5HPYB 4C7OA 3CH5A 4EFLA 1TF7A 1IQPA 2H92A 1HQYE 3PQCA 4FWTA 3W8NA 2FMXA 4LX0A 2HYIC 2VP4A 4V0OA 3U3OA 3LXXA 1U2RA 3GEHA 2UUBC 4LSGA 1D2MA 3R8CA 2JEOA 3DVLA 1TQ2A 6Q21A 3D7MA 4N3NA 1COWD 3QF7A 1E1RA 4S35A 4Q66C 3EERA 1XNRC 3U6BA 5JEDA 1TF2A 4CYMA 2A5GA 3FKSA 3F8TA 2FEMA 1U99A 3NKVA 4QHSA 1E3MA 3BH6A 5FPTA 3TSOA 5FUVA 5BXQC 1XCPA 4FWIB 4NBSA 1KMHB 3QKTA 3UWKA 1S3GA 3EWAA 2RAPA 2FA9A 3BXZA 5SZKB 4POAA 1DARA 4X66C 1GKIA 1OW3B 4M1YA 3LBHA 1F2TA 2ZETA 2DHRA 3KQUA 3KJIA 1O87A 3GLGE 1EFRD 1N2FA 1E9CA 1KI7A 2QN6A 1T9HA 1NG9A 4HAXA 1MABA 1KMHA 3GQBA 2OBMA 3TBKA 4A6XA 4LC0A 4AYXA 1E1QA 3SYKA 4EIWA 5JZVA 1S0UA 2O0HA 3B7GA 4B3TC 4AK9A 3DPUA 4Q7KA 5F3WB 1AQUA 3EZ6A 2B6HA 1LF5A 1KKLA 4K81B 4KFSA 5J4LA 3ASYA 3KJHA 4P0TA 4NPHA 1M7HA 2IEZA 1G8HA 1E9FA 2QMOA 3A1VA 4BLOA 2Q3FA 4F91B 4NYIR 3LX5A 5CYPA 4IDPA 1F2UB 3PFIA 5GJCA 4LY6A 1ELOA 2ASEA 3A1SA 4LHZA 2GEVA 5FTLA 5HKKA 1HH4A 1ZD9A 3WMEA 5FBLB 4DEXA 1P2UA 2JMPA 1G4UR 3ZLJA 3PEYA 8OHMA 4RSGA 3KJGA 521PA 2WWHA 1F2UA 4YLGA 4AKIA 3SNHA 4IKEA 4OJKA 3HU1A 4BZPA 3PIRA 5JJIA 1L4YA 1E6CA 1T0HB 1Q12A 4EAQA 2GXUA 1KO1A 3K0FB 3IQWA 4M0LA 4V0ME 1A4RA 2ZI5A 3H84A 2BCGY 3RVBA 4JJZA 4KFUA 1T6NA 2REBA 2WIAA 3OAAA 4V0LA 3SYLA 4TL8A 4D0LB 3FVQA 2WSSD 4KLNA 2C8VA 1CU1A 1MO5A 2Z83A 1ZJ6A 3B1XA 4LOAA 1T8UA 4ABYA 3M0EA 2O52A 4EJSA 1EX7A 3AF0A 1ZVQA 4XVRA 5KPDA 1OXVA 2WJVA 3K0FA 4BZQA 1VMAA 1YJ5A 2BMFA 2OT3B 2GJSA 4TLBA 2ZRAA 2EWWA 3ND8A 4DB4A 1ODFA 4EJSC 1Z6YA 2ZR9A 1NP6A 2YWFA 4JLJA 2GRJA 3E5HA 4OK6A 1N5KA 1E2DA 1IAQA 1XZQA 4W7SA 3EA5A 4ZV4A 3U5ZB 3Q85A 1W5TA 2I1QA 4HAZA 4MRVA 1NJFA 3LQQA 2BIFA 1FZQA 3MFYA 2SHKA 3LDAA 4DV3C 4IFEA 3U4QB 1UBEA 3LX8A 3JAMD 1XBTA 3I4LA 2D06A 5DLQC 5FBQB 3GLIA 4LYJA 3AKDA 2ZJ5A 2HXYA 3EIEA 3KB2A 4TMWA 1MV5A 1P75A 3HP1A 1PJRA 4I4LA 2ZE7A 1E32A 2GCOB 5B2ZA 3U3KA 2JLVA 1OFUX 1G1MA 2RHDA 3U4QA 1E9BA 3LBNA 3MRSA 3NHAA 2IXFA 4GFDA 4MYHA 4Q4LA 1GDDA 2F3RA 4G5GA 4G5QA 4EPRA 3ZD7A 3UG6A 2R6GA 3P27A 2G88A 3M6AA 3HDTA 3RABA 3UMSA 2P6RA 1KSHA 3O8BA 4V0KA 1SVMA 2YWGA 4M4SA 5AR1A 1L7VC 1S9HA 3BB4A 2QZ4A 3FMFA 4WBSA 4B3DA 2PEYA 4LHXA 4IOJA 2OCAA 3EC2A 4ZDIA 2E7GA 2BMJA 2R6CA 4EPYA 2ZI3A 1XMVA 3W5IA 2ZAOA 3CONA 2G77B 2GILA 4HDCA 5E7IA 2CCJA 2NO6A 1VIYA 5FL7D 4FI3C 3PENA 1P9WA 1VG9B 3AVUA 3B82A 4NHOA 3CO5A 4E03A 1GM5A 5P21A 2VSOA 2JDID 4P31A 4YXWD 3H86A 1PLKA 5LBIA 2R8RA 2ZJ2A 3C5HA 3V00A 2PEZA 4U7DA 5EP2A 1AN0A 4DKXA 4JS0A 2V1UA 4EFMA 5C46F 2GVZC 1Z2AA 3DM5A 3UMRA 4GBMA 5EUQB 5JHGB 1FTSA 2ZSBA 2ZYWX 3PEVA 4WZAE 3ND9A 4URUR 4US2R 2CL7X 3MUFA 2VF7A 3RSLA 4A0HA 1EG7A 2R65A 3K1JA 4A9AA 2UUAC 2XXAA 1FX0B 4UNPA 1QF9A 2YINC 1HA3A 1E9DA 3CPJB 5KSOA 1R0ZA 1RRCA 4X8MA 4Q7LA 2ZS9A 1E9EA 2IUUA 2ZSEA 5A2QD 5JCZA 1M6NA 3BS4A 3D3QA 1E69A 3CF0A 4JL5A 1JR3D 4PPGA 3RS0A 5FTMA 1XJ0A 3ZYCA 2ZUCA 1FX0A 3I73A 4DUGA 4V02A 5KO2A 1D9XA 1IN8A 5JS8A 3ZS8A 3U7FB 1X3SA 1WCV1 2O8EB 4DCUA 4A6PA 4OQLA 2FDCA 3RS4A 3SHFA 1N5LA 1YZUA 3TSZA 4YONB 3ZH9B 3IILA 4W5HA 5BYJA 3X1WA 3CRW1 1SHKA 4Q9LA 1AIPA 2CLSA 1G18A 2XEXA 4Q1DA 1N0VC 3RC3A 3MWKA 4OI2A 1OH7A 3B78A 4O3MA 2ZJZA 1GRQA 1Y63A 2FSHA 4DR2C 2XAUA 4QGFA 4Q9JA 5BW8A 3ICEA 3CBQA 1G21E 4CEIB 2J45A 3S1AB 4PZYA 1E2EA 3R9XA 2J46A 2P65A 5BYKA 3FFBA 5FUXA 2ZJAA 4TLAA 2ZI7A 3QVUA 1L4UA 1GP2A 3OE7D 3FDIA 4FN5A 4QM7A 1E1RD 2HDNB 4JYAC 1IBRA 4MRSA 2ZJBA 4R2HA 4DUZC 1XPUA 2NOAA 5JI3E 1G8YA 3NBFA 4US1R 5FPKA 2B21A 4CEIA 5GVSA 3SDZA 2OLJA 3HR8A 4OHYA 3DMDA 4DCSA 4TL6A 1R8QA 3PEWA 2UVQA 3GFOA 1ONBA 2WJIA 3LY5A 5AUQA 3QKRA 2HF8A 4US0R 5J40A 1M34E 4EQ6B 2B8WA 4PHHA 5J4YA 3MSXA 4I99A 5H70A 2DFTA 3OZXA 1SXJD 2WWYA 1BIFA 1G5RA 3OIWA 1MH1A 3I72A 4GPTA 1ZCBA 2QP3A 1M7BA 4IEIA 3SBEA 1Q3HA 2HYDA 5JI2E 3SJCA 1SKYB 1ZUIA 4LJ5A 4BFYA 1S4QA 1ZCAA 2ZRIA 4DB2A 4RD3A 4EQ6A 4JI7C 2Z5FA 3CF2A 3UK6A 1G9XA 1SVSA 5FOTA 1EESA 4BUJA 4AG5A 1VCOA 3GFPA 2O0KA 3PUYA 1KI4A 1XXHA 1V43A 5CLQA 2XNSA 4J0QA 3EPHA 3EARA 4DLYA 4HUTA 2ZE5A 4PAQA 5G53C 4LJ6A 1KJYA 5EE1A 1UJ2A 3EX7C 4C0SA 3VR5A 1U81A 2PBRA 2ATXA 2AWNA 2C96A 1R5NA 1KSJA 2DWPA 2X2FA 5FL3A 1QHSA 1RYHA 2JLSA 2WJGA 2QMUA 1W46A 4LHVA 4HB3A 4PHTA 4JSTA 3FWYA 5C2JB 3QQ5A 5EZ5A 4ACBA 1IY2A 3A4LA 2EFCB 2RGCA 3HU2A 4JYBA 4ON9A 1VYUA 4HATA 3R8FA 5AJXA 2VQSA 4C0HA 1OKKA 4Q7JB 3MJHA 2ZE8A 4E07A 4GOXA 3QPWA 2VYFA 3GJ4A 4M53A 1ZB8A 1P73A 4M1TA 3WYFA 5JLJA 1DAHA 1ETUA 4QL3A 2Z6VA 4LBZA 4TLEA 4JI1C 4MRPA 3AP1A 4KU4A 1J99A 1OH5A 2H8KA 2QI9C 4MH0R 4HLUA 4JVSB 3KKQA 4OL0A 1GZSA 1OIXA 3GJ7A 2ZROA 5BQ5A 4PO1A 2A7QA 1R4AA 4CVNA 3QY0A 1X1RA 4UXHA 4PSVA 3T61A 1NY6A 2ZYUX 5G41A 2JIZA 4KFRA 4DDUA 4CEJB 4BFWA 4TMKA 3SN6A 2J7PD 3FYHA 1VDZA 2VPPA 2J41A 2QQ0A 2IYZA 1I2MA 4NYJQ 4IDOA 1E0JA 3U2QA 4DC9A 2FSFA 4OBEA 2E87A 2ONFA 3Q9LA 1HEIA 1XTQA 2PMDA 4CIDA 1HURA 2E5LC 3LRPA 5AJZA 4QBFA 2VSXA 3AF5A 2MMGA 3ZQ6A 3ZZTA 5FR1A 2IBMA 4DV1C 4D0GA 2DWOA 5K8UA 2O8CB 4HDQB 2QENA 5K8TA 1OPXA 4G1UC 4HB2A 1BKDR 2AFHE 2Q21A 4RVCA 3ADBA 1NY5A 2Q9CA 3GLFA 1M2OB 5HCIA 1AS0A 4D4KA 1UF9A 1AS3A 1COWA 1XTRA 3QPVA 4Z1MA 3NHBA 2QM8A 2P67A 2YOFA 1JQJC 3BOSA 4M1MA 4DR7C 4KHPC 2GTPA 1AGPA 1MO3A 1EFHA 1NVVQ 2TMKA 2G1JA 5D3MB 4P33A 3ZQJA 4NXMC 3TQFA 3G0HA 3UWOA 5AUOB 3A37A 5EXTA 1WF3A 5KNBA 2WZQA 3TW4A 2FZ4A 2UXCC 2P5TB 4NXNC 1IM2A 3RWOA 5TY0A 1FOEB 2F7SA 2AX4A 1I2DA 2GESA 1UKZA 1NBMD 2C9OA 4JIMA 3ZJYA 3BC1A 1Z0IA 2OPLA 4LF5C 5DIFA 4A8JA 2ANCA 4UQOA 5B57C 3CNNA 2BHRA 1EFRA 4MKGA 4OQFA 1KI9A 3CX6A 4LBWA 1JECA 1ESMA 4D6PA 4A8JC 1ZC3A 4MGKR 4DJTA 2IXGA 3AGPA 4Q4JB 2FX3A 1R6BX 1GVNB 3AVOA 1UKEA 1D5CA 4F92B 3TJZA 1E2HA 1RJ9B 1VIAA 2Y8EA 4ZIRA 3DMNA 3CRVA 1XF9A 2ZI4A 1S9DA 5B58C 1KO4A 1OB5A 4KO8A 5F9FA 5FOWA 3KB1A 2XGJA 4EFNA 5TARA 1ANKA 1Z6GA 2DY1A 2WOJA 2BC9A 1YZLA 2WWGA 5CJ2A 3R9IA 3WHKA 3EZ7A 4QBGB 2GK7A 2JA1A 1A82A 3Q7PA 2IEYA 3NBXX 1KGDA 2IA5A 4XSGA 1JAHA 1N5JA 4QG7A 1TF5A 5DH9A 1L8QA 4HZUB 1RJ9A 2VO1A 3EZ9A 2E8CA 1NMYA 4KFTA 4Q18A 3GLHE 4DLUA 3ZZUA 2IYUA 2O8DA 4PQYA 4UJ5A 3MJRA 3AVXA 4LV5B 3T35A 3U44A 2J0UB 3Q5DA 4TMTA 2X77A 2YV5A 2ZYVX 4HZUA 1VYTA 1XEFA 3NG1A 1G7RA 3QPUA 3C41J 1TUIA 4DCVA 4ZCMA 4MKFA 4HB4A 3I92A 3RS7A 1IN6A 4QRHA 2J0UA 3SOPA 4CRWB 2UXBC 2ERYA 1SHZA 4NYMR 2PZFA 3GJXC 1T8TA 4G3XA 4PPFA 3AGQA 2BJOA 4LK2A 1OV4A 2DPXA 2WSSA 1QDEA 2GBLA 3KZ1E 2P6NA 4A82A 4JJKA 4TYYA 1UEIA 2CE2X 1BO6A 5TMPA 3TGPA 2A2ZA 4LFCC 2GBLC 3PUVA 2VRWA 4BECA 3T1TA 3AUYA 1JPNA 1YR7A 1XMIA 1E9AA 1J8YF 1NL3A 5A5GA 4A15A 5LDDC 4BFXA 2HEIA 1CJVC 3FMIA 2PMKA 1I4DD 2YC4C 1H8ED 2GXAA 1D8TA 2YWEA 3ZS9A 3K09A 1NSTA 2JGNA 2AFIE 2GETA 1CULC 1JAIA 3OIYA 2E8FA 1XFAA 3KQHA 3LA6A 3K09C 1G291 1AGRA 4LF8C 4B73A 1FMLA 2IYTA 1E2PA 4JSYA 3HYRA 1IBMC 4DLZA 2ECKA 3TUJC 3UIEA 1HV8A 4PX9A 2XOKD 3EW9A 2ZJ8A 4XVQA 1YZKA 4BPBA 1VPLA 3N5CA 4BLRA 2G3YA 4NP6A 3CB4A 1SGWA 2GJAA 4B3BA 1U94A 1KK3A 2YVUA 3U3MA 4LFBC 1YU9A 4JI5C 4LF9C 3KKPA 1JJ7A 4JZKA 1K5DA 1YRBA 3MWLA 1LVGA 3PV0A 4UJ3A 4D82A 5DISB 4EUNA 4LC1A 2PZGA 3K70B 3WNCA 1NIPA 3A4NA 1JQLB 1N36C 5JRZA 1NI3A 1U8YA 3CNLA 4HEJA 2PZEA 4KHZA 2W2TA 4UNNA 1W2HA 621PA 3TQCA 1OT3A 4MA4A 5EE9A 3AUXA 2NPFA 1KMQA 1ZNZA 1HQCA 4Q1CA 4LRWA 2DBYA 2FV8A 1XRJA 1VG8A 1DS6A 3BRWD 2ODWA 1FQKA 3KUCA 5JRJA 1LNZA 1RRPA 2GXQA 1E2GA 3OEHD 1MO4A 4L9SA 4IW3B 3TE6A 5AWFC 4A0RA 2Z4SA 4B3RC 1GNQA 1AQYA 3X2SA 1U9IC 4Q7MB 4AC9A 1SVOA 2BBOA 2ONKA 1JPJA 5EXPA 2C95A 2EYUA 4FMDF 1NIJA 2JDIA 4JT2A 3X1ZA 3K70C 4S2EA 5G3ZA 2H57A 1XTSA 2EGTA 1DAMA 1U90A 2AKAB 3AQ4A 2BKEA 1TQDA 1J90A 4XWKA 1S3SA 3GLGB 4ZDJA 1I4LD 3E1SA 3QXJA 3R20A 2AXNA 2ZE6A 2XZLA 4OYHA 5DN6D 1JALA 2ZRFA 3ECCA 4IHQA 1HTWA 4XJXA 3THYA 2QRZA 3P20A 4KBFA 2FFQA 1OKKD 1GAJA 4LYFA 1JNYA 4OHWA 2FN4A 2ONJA 1FW6A 4GP6A 4DSUA 4RZ2A 2ZRNA 1GIAA 2HHHC 1EFCA 3I8SA 4BRWA 1FP7A 2J9RA 3GJ6A 1LF0A 2QL8A 2WWFA 1DAFA 3IO3A 1AKEA 1JR3A 2GJ9A 2ZRLA 4FMBB 5IT5A 3LLUA 2KWIA 2DWQA 4DIDA 4B3GA 1KO7A 4L15A 2XJ9A 4YMUA 4BFTA 3LNCA 1M74A 1XEXA 4AI6A 1Z0JA 2IX3A 1KY3A 3GJ8A 3I8XA 2J1LA 1MOZA 4PQFA 3MCAA 1B0UA 2N46A 3H0KA 4QHYA 4Y0VA 4C3ZA 4DDTA 5JFGA 4Z51A 4CW7A 3NBZC 5KDDA 1RFLA 2JCSA 1VYVA 2P2LA 1JB1A 1G5TA 5L3VA 3EIHA 3RYTC 5IDVA 2F55A 4OK5A 1G3MA 5KPJA 4CGZA 2FGJA 2WV9A 2P5SA 4B71A 3RNLA 2AN9A 4B2IA 3OE7A 4DR6C 1L2TA 4A1FA 4PQRA 1DVRA 4Z1MD 3QXCA 1OF1A 1OXSC 2OBLA 2DFNA 1LV7A 1RRGA 2WKPA 1NSFA 3LH5A 1SXJB 2FFHA 2F1RA 2VHCA 4ACAA 5EE5B 3D31A 1KOFA 2GVDC 1GRNA 1C4OA 3QKSB 4FCVA 2OLKA 2FU5C 5FOXA 1KI8A 3BAFA 2JASA 1UPTA 3SJBA 1G3RA 2KI5A 2B7CA 2FZLA 2NTYC 2CHQA 2VA8A 1ZD8A 3SFZA 2DFLA 3J81k 2IHBA 2HF9A 4DR4C 1SXJA 2FFBA 2I1VB 5CM9C 2XR1A 3CWQA 4LV8B 4R2IA 5BWMA 3KTAB 3VR1A 3KKNA 5H8WA 3QKSA 1Q3TA 1SXJC 2O8BA 1CJKC 2CLCX 2D62A 1TPZA 1L2FA 4PSKA 4TSFD 4TZ6A 1F6BA 5DYGA 4M22A 2CL6X 4AKGA 2A78A 2QY9A 3FMPB 4JT4A 2QPTA 3HU3A 3KTAA 2G0NA 3PUXA 1G3IA 2AK2A 2ZR7A 3NH9A 4KXFB 4LF6C 3CNOA 5EXXA 1FFHA 3CZQA 3OF5A 3SC3A 5FTKA 2ANBA 2IYQA 4JBYA 1NVWQ 1Z8FA 2VP0A 1KNQA 3QJYA 1ZNXA 4TYNA 1Q1EA 2OCYC 5FBWB 1NN5A 4G01B 1IXSB 1N6HA 2GXSA 2F1JA 2JLUA 5DE3A 1P60A 1X8KA 3ADKA 2ASBA 5FFMA 4B6EA 5F2EA 5TDHA 2RGXA 2BV3A 1DAGA 4BLSA 4OI4A 5C18A 1ZW6A 3NXSA 1II9A 3AVYA 2NQ2C 2CXXA 2QAJA 5LMNC 1VG0B 3SS8A 3ZVLA 1HYQA 1CR4A 2IYXA 1NMXA 2V9PA 4PC3A 4MTNA 3CR8A 1USPB 3NEJA 1UADA 4L5BA 3EA0A 4URYR 5C4GB 4ESHA 1ZP6A 4ZDKA 1JI0A 5HCNA 3C7KA 2ZRBA 3B8HA 2FH5B 4HLDA 1N3BA 2QMEA 3H1TA 1XMSA 3T1VA 3DZDA 1XD8A 2IYVA 2MSDB 1IN5A 2RGGA 3B9PA 2IW3A 2IF2A 3QUSA 4YMSA 4TL9A 4RKFA 2V6JA 1ZUHA 3QXSA 1AA9A 2FPLA 4URXR 1LW7A 3I5XA 4URZR 1W1WA 3PXGA 3L8YA 4N0EA 4R7ZA 2EWVA 2W2VA 1NF3A 4ZKDA 4HAUA 4NYIQ 5GVRA 4C30A 1EWRA 2QU8A 3QENA 2J7PA 1II8B 2CHGA 1IY1A 2A9KA 5A4JA 2VSFA 3QKUA 3SR0A 4NH0A 1E0AA 3L0SA 2D3WA 2BJVA 4ITRC 4R9UC 1Z6AA 3P1JA 2IYSA 2UZ3A 2RGNA 4IXMA 1Q1BA 2OE2A 1MRSA 4B32A 4JI4C 4M21A 3RDPA 4Q4AB 1G64A 2RGNC 2AK3A 3LO5A 4RFVA 1QHXA 1JEDA 2OZEA 2P3SA 2G1KA 4PFSA 4URVR 5FH9A 1P9NA 2OFXA 3WYGA 1CEEA 1XMOC 4TTRA 4TYWA 1IOZA 4Q4AA 2KB0A 2WM9B 4B48A 1YZQA 2WJYA 2BBTA 4TLDA 2GCOA 4F4IA 1DO2A 2R44A 2FNAA 4LJAA 4CT5A 4TMZA 1S8FA 3RC8A 4QJ5A 3M1IA 4CT4B 1G8FA 1CR1A 3NVAA 1E79A 5JBQA 2HCBA 2A5DA 4KYIB 4CEHB 4Q03A 3LD9A 3N2IA 2OEPA 1NBMA 1UFQA 1KSGA 5SZJA 2IT1A 3K70D 1W0JD 4MH4A 4CF7A 4U5XA 2HJGA 3NC1C 4JI3C 2P6UA 1YQTA 2H18A 3SQXA 3KQNA 2I3BA 1SQ5A 4CEHA 1N2CE 2CNWD 3TUIC 3BGWA 4BEJA 2DYKA 1TX4B 2ZM5A 1ZINA 1W7AA 3HR7A 2QGNA 1P62B 4LI0A 4BFZA 5CDFA 1R2QA 1A2BA 2LCFA 2J0VA 2PCJA 3UATA 1Z0KA 4Q01A 5IK2D 3ZZ0A 2X8AA 2QROA 3AB3A 4M1OA 3T1QA 2NGRA 5AJVB 3MG9A 4LHWA 4PHFA 4TQUS 3L2OB 4C0KA 4NL4H 2N42A 3KKOA 4A0GA 4NDZA 3NDBB 2J7KA 2D7CA 3NBYC 2HLDD 1XMJA 1BYUA 4QFMA 2AL7A 2IYLD 821PA 5FPSA 2XNDA 2CHVA 4NCNA 1N6LA 2BM0A 3X1XA 3BB3A 1G7TA 1G19A 2R6AA 1P72A 4FIDA 4MDFA 1UDWA 1GUAA 3EIQA 3RRNA 1JR6A 1N6PA 1TAGA 2OFOA 3CRMA 3G82C 1WXQA 4OHZA 4BGDA 5J4KA 3RS2A 1E2KA 1PUIA 5JHHB 2MMCA 3LBIA 2YC2C 1KI2A 3RRZA 3TH5A 3ADDA 4JBXA 2O8FB 3GLIE 2BBSA 1IJFA 1RZ3A 2DR3A 2O8EA 1XWIA 5CYOA 3SE0A 4DRZA 1ZU4A 4C0BA 4Q9HA 1CRQA 1CRPA 1UM8A 1N6OA 1E9SA 2ERXA 3GKUA 1WDTA 5HZKA 2W6ID 4IOLA 1H8EA 1Z63A 2QMHA 2R62A 2PLRA 2GNOA 4DV6C 2O0JA 1Q21A 2VHJA 4O2RA 4WXRA 4XIGS 5IF9A 2OCPA 5CIWA 3THXB 4LJYA 1R0WA 3S1AA 1PV4A 1I4TD 1A5TA 3L0PA 5AJYA 4B44A 5KUTA 3KKMA 3AVWA 4IOKA 2CCKA 4TMVA 1DE0A 2ZVPX 3K0CA 5HZHA 4OK3A 2I4IA 2ZANA 1LY1A 3ASZA 2XOKA 3GMTA 1W47A 3THXA 1G7SA 1IXRC 3K0CC 3EASA 1EXMA 2F9LA 3NWJA 4F4JA 1WBBA 3ZVRA 1ZRHA 3C4JA 4GZMA 2VF8A 3V9PA 4BLTA 2RKOA 1IJEA 1K6MA 1VHTA 4Q02A 4ZO4A 4L4UA 2Q9BA 1GG2A 3OHMA 3TRFA
chains in the Genus database with same CATH superfamily
2A30A 3BD6A 3R3UA 2ZRHA 2ARKA 3D4BA 1Z56C 2ORVA 3ZY3A 3TLBA 1OFVA 1HG0A 5E1MA 1QK5A 1WXWA 2FQYA 3A11A 4YJFA 5EI5A 2DUMA 3B1WA 3ED1A 5I7VA 2D1TA 3TLCA 2QE6A 1XZMA 1JLKA 1QBGA 5JS7A 4YY3B 5FOUA 4AZVA 4HNVA 2CBXA 1UINA 5FPHA 2OSBA 4CHTA 3EH2A 5IH7A 1JHPA 3ROMA 2B0JA 2JFGA 4PGHA 3T5DA 5EJIA 3L92A 1YOVA 1Z18A 4WW0A 3AV0B 5D00A 3I8OA 2V3VA 4P3OA 4ZRNA 1IPFA 1R5BA 1FUUA 3AF2A 3BXPA 4C4AA 2ILVA 1LS1A 1JXQA 3LW7A 3N0XA 3EEIA 3LI2A 4G1VA 4LA4A 4ZO9A 4JI8B 1E7SA 3HL4A 4OF4A 3L4BC 1W25A 3U6KA 2J30A 3JYNA 3KIPA 4ZANA 3CVXA 1MXCA 2O5EA 1Z73A 2WFLB 4L3WA 4AY6A 1W34A 5E6RA 4I1OA 2C5HA 1SHJA 3B38A 3LOQA 4JLNA 5DN6A 1PEDA 1PZMA 3I5AA 1T8RA 2VJCA 3VR6D 5I7OA 2I62A 2JLCA 4OVKA 3T7IA 1QE3A 5E4FA 3FBGA 1KHHA 3C7TA 1GNLA 1RE0A 5EFZA 1YDFA 1DIRA 1M6WA 1FEZA 1JBEA 3ZXIA 3JPWA 1ZH4A 1F9AA 1SBHA 2NVWA 3DYVA 5AVKA 3AU8A 4CMJA 5KKNB 5KOHB 4DV4B 1G8JA 2WKWA 1U2DC 2H3EA 3CLUD 4RK6A 4PNPA 5DHAA 5TPZA 2HM7A 3ON5A 5A04A 4NCHA 5TMDA 1V60A 3OMWA 4GMKA 1MMFB 2JJYA 5FYDA 3TAUA 2Q7XA 2ZQYA 2JFYA 3CNHA 3QVLA 1H93A 1YZNA 2RHRA 2QSZA 4PTYA 1JRLA 1KXJA 3C70A 2QVBA 3PPXA 4O5OA 4WZ6A 5F1PA 4F1JA 2ZUEA 2Q6OA 4PZEA 4NNPA 1W36B 4NZMA 4PG8A 3IAS1 3WB9A 3BICA 2EWMA 4XW2A 4Y2PA 1FPMA 1X2BA 3PD1A 5ADZA 3SSMA 5DM1A 2BH9A 3WXBA 1DOHA 1B8PA 3IESA 1YULA 3K72B 4GOJA 1YASA 3CLVA 3I2FA 4MPDA 4QT4A 4FGJA 2HB6A 4ED9A 4A6EA 3CR3C 3C6QA 1RSZA 1E5QA 2PUAA 1ZM3A 2PMBA 1LTHR 2BGWA 4YPFA 3W9UA 1TK9A 4MV6A 4ZDWA 4P84A 1QG2A 4RL6A 1HSOA 1E5TA 5FHRA 1PLLA 4A10A 4L0QA 4LMAA 2QG6A 3JV7A 3WLRA 1P1JA 3KWFA 3OLWA 3BMOA 2C29D 3A9RA 3AR4A 4IHJB 4FEEA 4L27A 4P58A 3G0CA 5B53A 4HDAA 3WMGA 4HVLA 2ZYDA 4JBNA 4FMPA 3WSTA 1BFUA 2ZQ5A 1XD9A 1KETA 5AMXA 5BQXA 3QFFA 5HUHA 1IBKC 4QYXA 4ZI7F 4Z0PA 3AW9A 3PROC 1NULA 1GSIA 3KQPA 4I9UA 3VTZA 3WLEA 4B6QA 4C2TA 1DAEA 1WBJB 2CEAA 2H0AA 2O48X 1J06A 3E2IA 5E4JA 2OYRA 2WT4A 4A2WA 5KVCA 2GARA 1SKYE 1UMDB 2XHZA 2PVPA 3AVPA 5AI6A 5HFNA 1DJLA 5CITA 1F1JA 1K8YB 1VI5A 2SKEA 1JWAB 1Z0ZA 4IFTA 3RRMA 4BO5A 4J0GA 3GYGA 3UT5A 1WAMA 2X7HA 2GZ3A 5H81A 4R1LA 4O29A 3QA9A 3WIBA 4C2UA 4P08A 3MFQA 4J4HA 3MT9A 1EFLA 3EBOA 1Q0SA 3NRBA 2C9CA 3OM9A 5DCYA 2WILA 1G0NA 1NOKA 2LP4Y 3ETEA 3LCRA 1QJCA 3NTUA 1Y9EA 3PD0A 3MGKA 2R96A 4JA2A 4KO1S 3ECSA 3EFOA 3U1BA 3HUEA 3LPAA 2YMMA 2NM0A 1Q22A 5GAJA 2FSGA 3UGKA 3IR6A 2VTBA 2A86A 4MUFA 3C3BA 1O95C 3A9SA 1L5LA 4K05A 4HJRA 4DBLC 3Q0IA 3GEGA 1N34B 3FI0A 2QBYB 3PA6A 1I24A 1XB2A 2X6TA 3DAHA 2MU1A 3HRIA 1CX9B 1X87A 3OPYB 1XDUA 1GILA 4LYHA 4AJLA 4M38A 3VYUB 4YJKA 1NRXA 4G9EA 5CX1B 1THTA 1V3TA 4W7IA 3UT6A 1BRMA 1QJ4A 1Y7LA 1U9ZA 4MYTA 1T3GA 4D5GA 1NKTA 2Z2KA 2IVZA 5DVZA 4Q9IA 3WGGA 3NRCA 5JY6A 3OE5A 4N3BA 2V3CC 2GHRA 3ZD8A 4J2HA 2GK6A 3DOJA 3L8DA 2HXGA 4IDHA 3GA7A 2ASVA 4GUDA 5FJJA 5HS6A 1S01A 3D6JA 3NUQA 4ENWA 1YE5A 5AVOA 4KI0A 5E3HA 4DDHA 4ZMBA 5LZ5A 3EEYA 3C16C 3QYJA 3TFQA 4OP1A 1HNXC 1OAAA 2RC6A 4JYCA 3CV3A 3H65A 2JFNA 1ZK4A 3C1OA 3PE6A 1XVIA 4OYYA 1CEYA 5B1HA 3T4XA 1RAFA 2ZYGA 3LP8A 3QEOA 3RHSA 3RO7A 2FRDC 3VZSA 2HK7A 3PUIA 4DSAA 4QEDA 2I33A 1EWTA 1O9HA 1V3UA 1M75A 3G68A 1IN4A 2X86A 1FTQA 1Z5NA 2C20A 4FZJA 3UAVA 4AJNA 1PNOA 4P4LA 2PKXA 5ALUA 3LY7A 1R15A 4H2DA 2J9ZB 3L93A 3EPLA 4WXEA 2CV1A 4I2NA 2UYOA 1NW3A 1UIMA 3D02A 1X0XA 5AKYA 4NQRA 4U2DA 1TKCA 5TNXA 4BFUA 3ZJUA 3CGGA 2JJQA 3F6CA 1HC7A 2LD4A 2ZJ7A 1JILA 1HORA 1G3UA 3PCRB 4TXNA 3UOGA 3WP0A 3WYBA 4A27A 5B3JC 1XS3A 1YMVA 3OHSX 4IGEA 3GVIA 2ZAYA 4LRYA 1P4SA 4KG7A 4P4SB 3O5AA 5K8VA 4WSOA 3TOXA 3T7EA 2RH8A 3VV3A 2DBVO 4JC8A 3RVOA 4DHEA 5J5CA 3V4OA 3ZWPA 2BY4A 3LWNA 5BN5A 3FW1A 4PICA 1SPXA 1VE1A 3LQKA 5LZ9A 1H4SA 2X22A 3HGQA 3C14C 2WTBA 3D6MA 1CUXA 4RADA 3RU7A 4C07A 3EX7C 1EVQA 3CT6A 5DI3B 1HUQA 1SNYA 5LMUB 3PG5A 3QV2A 5CFPA 2IK8A 3EXFA 4R40A 3QSYA 2WIJA 1VB5A 5JPIA 1S7GA 1NLYA 4BWYA 2PS0A 3KHSA 2C5SA 2H1CA 2G72A 3SK0A 3MIIA 4NYMQ 3G1UA 1YZTA 4QXRA 4X60A 1UMCA 3UKOA 4TYPA 2HQ1A 2XITA 5EXDA 2EQ5A 2AMYA 4R2MA 1AO3A 3RCBA 4EFKA 5IJ0B 4NQZA 3HJGA 3H2BA 3V8QA 5HR5A 2K5UA 3B13B 3CUWA 3FUTA 4OBWA 2ZWAA 2CE7A 3G2OA 2AN1A 4PANA 3S8EA 4ZVTA 5KHOC 1JJVA 3H5NA 3JWHA 4K9QA 1XA0A 2R2AA 3TSYA 2WTAA 5B7GA 1KQ3A 1YBMA 4WFKA 3A25A 5AHKA 4K86A 2P9YA 2V7QD 1T6ZA 1JIVA 3KFLA 3WRVA 4CT0A 2ZUBA 2GN8A 1TIKA 3TO5A 5K0EA 1EQUA 1HDYA 3ASVA 3IMEA 4F4FA 4MWBA 5CFOA 4GF5A 3EPJA 3DUFA 3PNMA 4XD7D 3UVEA 1XE3A 4U2KA 4J1NA 1AN9A 1OAKA 1W0JA 3QNMA 2WWTA 3C6XA 5JASA 3G8BA 1VJ0A 5CCXA 3ZJ4A 3DV2A 1NG1A 1WO8A 5CT9A 1LQUA 3FB4A 1ZN9A 4KXMA 3U4CA 1LZLA 3O9ZA 1RYMA 3WYDA 1P7VA 1UL1X 2W6CX 3V7UA 4P53A 4B6RA 4BB9A 5F21A 5THQA 4GI7A 5KQGA 4DA4A 2QTBA 3L6RA 1GGVA 1JVNA 2ZUWA 3BE6A 1U02A 2ZAGA 4Z4IA 1NW9B 1D2RA 1PNQA 4MQFB 2WNIA 4N6OA 1WP4A 3SEQA 4DMCA 5J4VA 2HV8A 3QG1A 3ZDAA 1JQKA 1N2EA 1WDMA 4G67A 4X1OA 4Z54A 1WD5A 1F8UA 4GICA 2OCGA 1DEXA 2ZKLA 3O4FA 1CQZA 1GR0A 2ZOSA 3CZAA 4GP7A 4H3VA 1PYGA 3QLJA 4FCWA 4HR7A 5FBHA 4OQMA 3DMPA 3CEJA 4RTQA 3GLGA 3DCJA 3PGXA 4JL8A 4TRRA 4KQFA 2VJPA 3TGWA 3ONVA 1C4WA 2UUCC 1OZ0A 2Y1GA 3EMBA 4BKQA 5ICMA 4KFCA 3S8MA 2NUTA 4RENA 5JD6A 4KLRA 5ANRB 2QHXA 3ZHVA 2EF0A 4X65C 4C4SA 1XCMA 4BZZA 2XUFA 3V3TA 1C80A 1YS7A 1R8YA 3E7DA 4IGAA 1YJ8A 3DG9A 4GE3A 3SC2A 5FLXA 4Y30A 4BP1A 3V4FA 2IQ5A 5C5IA 1XRCA 3K9LA 2AD1A 3OFND 4BLQA 4BX8A 4OA8A 2F43B 3VO2A 1MR3F 3A8TA 4NU8X 1NUAA 4YNBA 4KVAA 3VU9B 3LRXA 3CX7A 3LU1A 3PL1A 5DT2A 1QHHB 4IV8A 5JY1A 4Z2YA 4DA9A 4W5TA 5BNTA 1I3NA 4IXTA 1E2LA 2ZRGA 2CVPA 5KWIA 3G49A 3NJRA 1YR3A 3T3EA 1VE7A 1W36D 3TX2A 3P2MA 3FR7A 3REQB 4NCAA 3DE0X 2WW8A 1ESDA 5JQGF 3G2NA 1E3LA 5A3QA 2EL9A 1C9YA 1K3UB 1A9OA 1KIMA 1TC2A 1A88A 2D0DA 1ZCFA 2H2WA 2XUHA 3K4PA 3O4VA 1ODTC 2G9NA 4BNHA 1R50A 1E3QA 1ULTA 5BRJA 1P31A 2W6IA 2X2EA 4C29A 4UDYX 3FG9A 1YS4A 4L0MA 1F20A 2AHOA 3QVKA 5ENZA 3JZFA 2G8NA 5HIKA 4NKRA 3ZN2A 4CLOB 3V1KA 1B93A 4K8OA 2AMFA 1RHJA 4XZ3A 1D1SA 3A6DA 5I7AA 3RSGA 3QE9Y 1JAZA 4OQ4A 3BWEA 5D5PA 1TUBA 1BEUB 2YV1A 2Q4EA 3KPUA 3MYYA 4LXGA 4W99A 2OHGA 1C3JA 2QQFA 1ID1A 3I2HA 1V7CA 2PH5A 1WLYA 1W5AA 1QQ5A 2ETVA 4V39A 2ZYIA 5ENDA 3WL5A 4BNXA 1HNWB 1NLZA 2R0QC 1E4VA 1BEZA 4DXHA 3BIFA 4BC9A 4FFBB 2WVGA 3MD9A 2EZ8A 3IH5A 4O2BB 3QP9A 3R3HA 1TZBA 1WX1A 2W00A 3FFAA 3PP8A 4OHVA 1GVHA 4WRRA 2X0NA 5JPCA 3MGAA 2IC5A 1IC6A 4ZRDA 3ZWYA 3VZQA 2Z9CA 4GH5A 1SKBA 5L4SA 4PR0A 1DI0A 2PJZA 2V3WA 4G9GA 3PUWA 4TTAA 1F2TB 4ZYTA 1SZDA 2GZ2A 3QFTA 1L7BA 3QE2A 4TM7A 3PQEA 4OLHA 1G6KA 4R41A 3ZHYA 3LQFA 4FDLA 4UVGA 5BYAA 1MABB 3BMQB 5KYYB 4JX9A 3RFUA 3RB8A 1SG9A 1SXQA 1F48A 1T5IA 3A27A 3J81D 2EFHB 4RZSA 1AURA 4EJMA 4HNTA 5IAOA 2WA1A 1JEYB 1XAGA 4KRFA 3JD3A 4PAMA 2O1WA 2G1AA 2Y1WA 1JDZA 1ULZA 4B75A 4BMNA 5AVWA 2YKGA 3SU8A 2DT8A 3PI6A 3C8ZA 3C3XA 4H60A 3RKSA 3ZIAD 3KSBC 4ZO6A 3DB2A 3WZLA 2RBGA 1DKMA 2P3QA 1QDLB 1X7HA 4FYXA 4P5EA 3AVQA 4X1IA 1WB9A 3VR0A 1LCIA 3B1YA 1NYRA 4FMDB 3MCZA 4QOHA 2C0PA 3O03A 4EPXA 4OQXA 1NU6A 2P2JA 4D9HA 4CETA 5G40A 1V45E 5JAIA 3TGLA 3V2IA 1YCDA 2RD2A 2Z9BA 2QAIA 2H3HA 4YX9A 1RI2A 4XOIA 4ER5A 3M8KA 3T7KA 2ZPAA 1ID8A 1N2CB 1IN7A 3M6FA 2Z0MA 3TEMA 1YBVA 3OT1B 2ZTHA 3NJ4A 4REQB 4R05A 4XX0B 3GELA 5H0IA 1QQ6A 4HBZA 1X8XA 1SVIA 2OGUA 4EI7A 4FEGA 5JO0A 1NUHA 4XH9B 4PIPA 1JI3A 4LVCA 3NIBA 4BFVA 1OFHA 1NSYA 3MB5A 2HGSA 2PFSA 1M10A 2P9HA 3A1UA 3KAPA 1VE3A 1DINA 3K0KA 2W22A 3KZXA 3LRTA 3E2PA 5BPHA 5H68A 2ICAA 5C31A 1CJUC 1EGAA 3NT2A 1SCQA 4GGPA 4WKBA 3F5FA 4WIAA 5H9VA 4YAKA 3CLUC 3QKWA 4PZAA 1GNTA 1NKSA 1OYOA 2OO5C 4EJSB 3FDZB 3UT0A 3HKBB 3AK4A 4EYQA 4HGNA 1HO3A 3U61B 3O9MA 1AGNA 1ZB9A 3COYA 3EH1A 4FYKA 4F11A 3EWSA 3JVIA 1QGZA 4L9AA 1S2GA 1JE1A 3GJ3A 5F64A 2XJ4A 1WOMA 2Z3WA 3I6IA 2JLYA 4EYSA 5LU9A 1MO6A 2PGIA 5IBQA 4AQDA 4XIIA 3ZEAA 2QW0X 4IRUB 2OOSA 3UV6A 5I3ZA 2HFJA 3TRIA 2FB9A 4QQ8A 1A7UA 3DTVB 3L82B 1FFSA 5KNCH 3CX8A 2OAQ1 1YVDA 2G82A 1MA3A 5B7NA 3RBAA 5JJBA 1SU4A 4I8IA 1JTFA 3O8CA 1DGQA 1UODA 4DLVA 4MRMB 1YZ3A 1OI4A 2DCUA 2ACEA 3UUFA 5IMSA 3A3PA 1Z68A 2I03A 5CD9A 1XZFA 5CPFA 4X6LA 1SQGA 1CR0A 2QT1A 3IKTA 1MZPA 1G21B 4JHLA 4CLDA 2H00A 2WLTA 3RYCA 1BMFD 5KSZA 4ZOBA 1RKBA 3RJMA 2A9VA 1O94A 3KOXA 3OZVA 1OPRA 3NH6A 3ELUA 5BV2P 1CIPA 1L6IA 4R69A 3L3BA 4MW1A 1QC5B 4XYMA 1U2GC 4EI9A 2NMVA 1CUUA 3SQLA 1W19A 2IYRA 5AKEA 1PL0A 1EX6A 1GO2A 1KZGB 1XHEA 2X2PA 4EGJA 3GJ5A 4OP3A 2LCIA 2LTAA 4OHCA 1UDBA 5EZSA 4WVFA 5C8YB 4QATA 4UVHA 5HM8A 1OSNA 2NZJA 2XBMA 4RQUA 4LZJA 3C6MA 5FOVA 2C54A 2NADA 5CB8A 2XMDA 4RORA 3QEAZ 1XALA 2CNNA 5KDOA 2YZ2A 4MITA 1C30B 2HIGA 4K1LA 3VPHA 5B30A 1QU2A 1M1UA 3UEBA 1Q5PA 4C04A 2VN8A 3DOIA 1A96A 1REQB 1E6EA 1AC5A 1ZXXA 4AZWA 3I1FA 4QYTA 3CUYA 1WCJA 4EH1A 1GYQA 2GEJA 1Y3AA 4NV1A 1I3KA 3U9TA 2QUZA 2UYGA 3A2MA 3O1HB 2OXCA 2VWHA 4TT8A 3E6AA 5T4HA 4JI2C 3OFSA 1VKHA 1SC4A 2X13A 3N5KA 2H0RA 5BNZA 2YIDA 4G85A 3ZR4B 1PW5A 2H1FA 4IDBA 3TB6A 3CM0A 4XQ9A 3S2UA 2UYCA 2IDJA 3RRJA 1NPDA 2OBXA 1TJ3A 4PRYA 1PKXA 1B8NA 2O8NA 1YA8A 4RAQA 1IM5A 4RD0A 3I61A 2FSVA 1XP5A 3L7LA 1JDJA 3ZK9A 2WKQA 1H2WA 3IP7A 2W83A 4ZGGA 4UDXX 1XQXA 1O0BA 3I9V6 3OWXA 4WA7A 2HA5A 1YL5A 1LB1B 1GPNA 4W1PA 1NV8A 1YQXA 3ENVA 3KZVA 3N7AA 3PKZA 3ZHRA 1Y5MA 5KYNA 3ZTYA 3F67A 1HE8B 4AP6A 3IUBA 4JZYA 1QXSA 1A9QA 3IDFA 2R6R1 4GUAA 1K3TA 5E3JA 1X9GA 3L7NA 3O8LA 4H9GA 5COQA 3RUDA 3PQ5A 5D5HA 1KJWA 5BV0A 3S70A 2A92A 1PUJA 1U8FO 3WVNA 5K8LA 2KPOA 1GPAA 2FE4A 1WPXA 2GYYA 4DGSA 1Y5NA 4ID3A 4HK4A 4LV6A 2QN3A 4PCUA 1C50A 4HH1A 3W04A 2FUNB 5KB3A 1YR9A 5LPNA 1UAAA 1TK2A 1H8HD 1KZYC 3LXRA 4KCGA 3ANTA 3WDLA 3PTAA 4GSKA 3E8MA 3FNEA 1RJWA 1T5TA 3ICWA 4IJ5A 3AMVA 4X63A 3IV9A 4MA0A 4KRXA 1H9BA 1MRNA 1HNZC 2O57A 1E0KA 2PANA 1MIOA 3NGXA 4J6EA 3C3EA 4X90A 2X5OA 4TN5A 3O4JA 1WM1A 4GOMD 5GJVC 1DADA 4DCOA 4FFVA 2PA0A 1IY8A 2VS1A 3B85A 4BMYA 2Y71A 1UUFA 2P2YA 1K7CA 2I4RA 3KL4A 3GARA 3Q3CA 1ZNYA 2YRFA 1I94C 1E2UA 1UH5A 1EFPA 1FMJA 1MXFA 4I6GA 1S5PA 3H2JA 3LG2A 4BP3A 1MVOA 2WD7B 1Z0UA 2QUAA 4ZCLA 2J5BA 2HK8A 2PKCA 1E9RA 3IO5A 3BFXA 1A2KC 4GRAA 1VMIA 1WR8A 1Y7PA 2QGZA 3INRA 2I3ZA 1P1FA 5C0OE 4X64B 1UM9B 1CV2A 1SD2A 2CMKA 1JG6A 5K4HA 1N3IA 5AM1A 5FBVB 4R1SA 2AFHB 1XA4A 1N2XA 1MOPA 3D8RA 4MWOA 4ZTBA 3TZCA 1YHNA 2L0XA 3LQ2A 1EFVB 1PV1A 1HF3A 2EEZA 2XCRB 3KZCA 1MXAA 3UMYA 3OJWA 3TTTA 3PT5A 4YJDA 1HZJA 1E6UA 3O8RA 4YRTA 3IT0A 3P2JA 2WE8A 1R0SA 2VP6A 3PICA 1SUDA 2PJRA 5TQ0A 3B6EA 5CP8A 4UOZA 5IM4A 3KFXA 3KP1A 1ITZA 2BONA 2COKA 2LE0A 5IAKA 4MW6A 3JQGA 3PJGA 1GAQA 2BZ1A 2YZ7A 3EZGA 2V6IA 5JCJA 2CK3A 1YQWA 3EMDA 4F93B 2OBBA 1QHNA 1T0PA 4XUDA 5CA0B 4KIJA 1AKVA 4N0MA 4QAQA 3HKEB 1UBCA 1YKGA 2IY8A 4CKWB 2XMCA 1EBFA 2RB5A 4K1XA 5C9ZA 3HY6A 2QDKA 3KR9A 1ZM7A 5KYVA 1G55A 2ET6A 2N1BA 4LJ9A 5F52A 1IWBB 3TLGB 3IR7A 3QX7A 4Y7CA 1RLTA 4RKEA 3OWHA 4Z0HO 1CCWA 1IDOA 4ZV7A 3FGPA 2O8BA 2QTVB 2JLXA 1TTHA 1J2EA 3F6SA 1PDVA 3MXOA 1QFYA 2C00A 1CD5A 2QAGA 3G5UA 3AHHA 3A36A 4QXPA 4YPOA 1RTKA 2VK4A 3F6RA 3BZUA 4QELA 4AYWA 3N3AC 5HMLA 1RBYA 1Z35A 5ALVA 5T3UA 1OH6A 1IPHA 1ZW1A 5ALNA 1FTGA 1T6BY 4ZQCB 3WHPA 4JI1B 3UJ8A 3ZWOA 4NYJR 3MNFA 5KOJA 5DHTA 1UP6A 3WO1A 3PJEA 3GD7A 1M6XC 2J4FA 1QQAA 3ZVNA 2A5LA 3I5YA 5IEBA 1S3FA 1XD2A 3ZY2A 2C77A 4G97A 5LL6P 4GOLD 4JU9A 1K5GA 5G02A 4Y1RA 2WU0A 3LVQE 1WQ4A 2ZB2A 4N0DA 2VCHA 1JA1A 1TW2A 1V16B 2PKRA 1R9GA 3EG9B 1AKRA 2ESRA 1A8UA 4MW7A 5JC1A 2EFJA 4RLSA 2ZSFA 4ODIA 4YRDA 2I6TA 1JS1X 3DE7X 1KYIA 1OX6A 2ISQA 1X8LA 2PO5A 5G0TA 1PE0A 2WEKA 4RK1A 3T7DA 4AD8A 3A3OA 3BXFA 1OLOA 1RJGA 4RTPA 1X38A 2O0LA 3QYPA 4QEKA 5KYKA 4P83A 3HB4X 4FGUA 6PFKA 1IWPB 4Y18A 1KI3A 5DO9A 3WP1B 2QTWB 3FE2A 4WI1A 1HFEL 3GW8A 5D87A 3R7AA 1HEYA 1E8DA 1SULA 1YHYA 2J3EA 2PT5A 1YI0A 2YJNA 1O6BA 2IOFK 2PT7A 2WJHA 3CA8A 4G2NA 1E5XA 4OU4A 1W36C 1QRAA 4HNAA 1EXNA 1NV9A 2RGBA 1X6VA 3FYUA 1ULBA 3UN1A 2JBAA 1XZIA 4E7OA 4HLCA 2J3QA 3OBBA 2GAOA 2VNIA 2AD5A 2VNJA 3DTVD 3HDVA 4GMFA 1U0GA 1QHYA 1VGVA 1XNJA 2D2XA 3AP3A 1I32A 4AUEA 1CWUA 3ZCVA 3WL4A 3R23A 5TC4A 3V4VB 3QUTA 4EG0A 5JCOC 1LWOA 5K8CA 4P82A 1TZKA 1SG6A 2VPXA 4R4JA 1UZMA 1JV2B 1HFKA 1S2IA 4WNIA 5AOCA 2BKUA 1DX6A 4RZXA 4L8YA 1P91A 2IS2A 1PLJA 1PAUA 4NXNB 4PYIA 5DHFA 5LFAA 5E9AA 3SD7A 4IFBA 3OX3A 3G9XA 4RFSB 2JANA 1JHZA 2NV0A 2IHKA 1GOTA 3QFSA 4ILKA 4ZAYA 4G5FA 1KKUA 3MWEA 5JMWA 4NK4A 2IZ0A 1HE3A 2O7QA 3DWEX 1MNQA 2RIRA 1TM5E 2IUFA 4OGLA 3TOCA 3KEQA 1G8GA 1T2EA 2JI8A 4HX5A 4GBJA 5ECGC 1RE1A 2VF4X 4QGGA 4O4JF 1NUUA 1VIVA 1H4TA 3EUWA 1LRJA 5B1IA 2JAQA 4IJWA 4JI6B 3KVNA 4DY4A 4MUJA 1QIFA 2WJJA 4HQ6A 4TKVB 2OLEA 2GT1A 1W8DA 2RB4A 1Q0ZA 2XTMA 3EHEA 2XMPA 3ZCSA 4K3VA 1B73A 4OB7A 3NATA 3RUFA 4BE7B 4EL5A 1BW9A 4OFZA 4UAJA 4BBPA 4PZPA 1XRNA 4IVQA 4Y2UA 2J6BA 5LP6B 3F74A 4MVJD 3FTQA 3IQFA 3VAAA 4D42A 1HTTA 2V4UA 1GPYA 1JXOA 4U7JA 1Q7BA 1MB4A 1Z38A 2VJQA 3L7MA 3OESA 3VSDA 2RI6A 1KO5A 3LKZA 1VTKA 2QNRA 3WRYC 4NEGA 4DR3B 5EOVA 2PUVA 2CDCA 2BEUB 4KN5A 4B79A 3C0KA 1U6JA 3IQIX 2JHAA 2CNDA 1T1JA 2YWHA 4DR5C 1X2EA 3AB8A 5CX4A 5DYIA 3F6YA 3MA0A 2ACKA 2WTXA 3WL3A 4RETA 4MQBA 2C2BA 4PGFA 4COKA 1RBMA 3Q3VA 1EH5A 4YJ2B 3HBMA 4OV6B 4HY3A 3WBFA 1RD4A 2X3YA 5HKBA 1YE8A 4LGMA 3L43A 4D9JA 1X39A 1RMTA 3DF7A 3HGMA 4RCYA 2R7MA 2G1PA 1HOTA 4HPJB 2DKFA 2O2HA 3LY8A 1JBQA 2PROA 2JGDB 3SSNA 2ZSJA 1N25A 3ETOA 2NO7A 2CFSA 2QPAA 3HZOA 3KALA 1DEKA 2VNSA 4JLOA 4TYMA 5J58A 2P02A 1ZGZA 3DT6A 3OI7A 1T3SA 4L6CA 1KYVA 1S1MA 4BKOA 4MCHA 3GFTA 2VHEA 1D3AA 3HI4A 1ODJA 1LDNA 4XB2A 5TQVA 1S96A 3VUFA 1DL5A 1YB5A 3ZJ5A 4AF6A 5BSFA 1G20E 3K0SA 1Z0DA 3RYHB 1OWLA 2QE7A 2GF0A 2BEKA 1AS2A 4TZKA 3OQHA 2DGDA 3N2QA 1Z06A 4WN3A 3O92A 1U0BB 4ZEWA 5M04A 3B60A 3L7KA 4FQ8A 4AS3A 3W5JA 1U80A 1P4HA 5JEEA 3MJ4A 5B55A 1XLTC 2JHCA 2WMYA 3FAZA 3HEAA 1RRVA 3H17A 4R5HA 5ALJA 1GGNA 1LDMA 4B3SC 4MV8A 3V4RA 2WNHA 1O58A 3GWGA 2VP3A 4WGFA 2HY7A 4DCGA 1EHCA 3NDRA 2ZCVA 3EVZA 4WLNA 5TB5A 4DR3C 1JHDA 1KP9A 2R1VA 3UK2A 4AURA 1KE2A 2G83A 2FMTA 3ESAA 1YCFA 1J23A 2WSYB 2OMKA 3L8CA 2ZIXB 1CKEA 1LFDB 1PWEA 3LK6A 5EE0A 3UFBA 3T1HB 2O5VA 1QE5A 1FMCA 1SIUA 3CLTC 2Y99A 4HRVA 1RLOA 5K6AC 1SVLA 2D1SA 3V1LA 4HB0A 3COZA 3VR3A 1XPOA 4JYMA 2EXXA 5BR8B 4CI9A 3LZ6A 4RVDA 4N18A 4EZEA 2C0QA 3FNQA 2Y1DA 5CLLA 4E09A 2ZTUA 3EGXB 3UYLA 1JEEA 1SU7A 5FTNA 4U39A 1XIVA 3VHXB 4ZI7A 4M1SA 1JU9A 1ZUNB 3I9NA 3HVRA 3EXEA 4FC6A 2H4JA 1A9PA 3SLRA 3EYAA 3I08A 4KSBA 2V8OA 1W4BA 5L3RA 1UWVA 3AU9A 2I8CA 5EWMA 4X62B 2PYIA 2IFTA 3HG7A 5MN5A 3FTPA 4HZIA 1E1NA 1R7RA 4HKTA 4UTRA 1NVUQ 2QS9A 2FPMA 3IUQA 4U3JA 4EA8A 3ZHOA 2Z8YM 4WOCA 1EVIA 1TA4A 2ONZA 4IIEA 1DRUA 4F96A 1LX6A 3BFVA 2FZGA 4BMOB 4S05A 3FNFA 4CM9A 2YXNA 4HP8A 1QWOA 1V6CA 2RCNA 3GAMA 4OPMA 4UZSA 3DFUA 1GKUB 1ZN8A 3EK2A 1GQYA 1TM7E 1UEJA 1L7NA 2P9FA 5EP1A 5ILQA 2XRYA 1KDYA 4DV5B 5B4VA 1A8HA 4DARA 4L9WA 2CYAA 2JHPA 2N1MA 1A7KA 2AYZA 2P90A 5JVDF 5FA6A 1PG3A 1QR2A 4TQGA 5FL7A 1ENYA 4JXKA 1YC2A 4AZ0A 1OYWA 5AUPB 1SK9A 1LLQA 3KAQA 2GOYA 2PYZA 1W4AA 3HV0A 4X92A 3KU1A 5D3QA 2QRJA 2EARA 1IRXA 3JD1A 4ZO7A 4GL2A 2EX4A 4JC4A 3ZDFA 1TEVA 1DCMA 1H5UA 1K8ZB 3GRKA 1F51E 1US8B 1DZIA 3LF2A 2QXUA 3JQAA 4JL6A 5EJEA 2GWRA 3SR3A 3Q8KA 4FE7A 1YBFA 3DOFA 3GGJA 3VC2A 2J3IA 3QF4A 2D2EA 5A71A 2JIMA 2WU1A 4DV7B 1TIBA 2RHOA 3FROA 1IZYA 2Y2VA 4IQ4A 4QBIA 4YUWA 2Q9AA 1ZSVA 1QZTA 1W8IA 3PYMA 4GQAA 3ULKA 4F91B 2VOEA 1UMBA 4B5KA 4YTEA 2XSZA 1B6SA 2XCSB 5K85A 4EYKA 3U80A 2C4HA 4U0JA 3DBHA 3W8FA 4F46A 4XYLA 2XBLA 2G76A 4N3AA 4GKKC 1Z0FA 4E0BA 2POQX 3T7TA 2ZRDA 2EBFX 3JWPA 4U7HA 3TD6A 3PITA 3QPCA 3VBEA 1JR2A 3CJEA 5K0JA 3D3JA 1JJFA 1FS4A 4FD2A 3I9JA 4CCAA 4XQEA 4U7PB 3PFNA 1J8DA 1C9DB 3I32A 1PDOA 3WK4A 2GEDA 5EERA 2ZT6A 5A4IS 1N1DA 3GA0A 5CT4A 1M1XB 3H1BA 4XFDA 4N5HX 1N2JA 1MVLA 1YDMA 3OWOA 4CDGA 5TEWA 5TX7A 1EEHA 3RSOA 4B76A 1KFBB 2JIQA 2IXBA 4EL0A 2ZWVA 3L7BA 3RE1A 4NCJA 4Q3EA 2VK8A 3L7CA 4FFLA 2AVNA 3QLUC 4HGQA 3N8KA 3PHGA 4I50B 4PUGA 2I7DA 4I0WB 3P9NA 1JFFA 4R1TA 4ALKA 4JYZA 1HEUA 2PS1A 4G81A 2PE5A 4DA0A 3HM2A 1XU4A 4R9SA 3PHBE 5TXGA 3UGQA 1PNTA 4F6CA 4C7OA 1OYYA 4HDMB 2AI3A 2X5KO 1A0OA 1IG0A 2HU8A 1IQPA 4NWIA 1HQYE 4RY9A 2J08A 3BD8A 1GYPA 2I8AA 2VBIA 4LX0A 5TJHA 4QZVA 3HGTA 3ACCA 4V0OA 3SE7A 3LXXA 3GVXA 4OLBA 3RIYA 3U7JA 4KZPA 1VP3A 4F2GA 1O0CA 2G06A 4YEDA 1H2BA 3QF7A 1A5SB 3NTVA 5KAMA 2WJ4A 1QWSA 5SY6A 2FP4B 1QO7A 3TUFA 4E12A 2AI2A 5EJMA 1ENOA 3A6ZA 3SS9X 1L4KA 3ZXYA 2FEMA 3EY4A 4QHSA 1I1QB 3GGOA 2PM8A 3HO8A 3TQHA 1NC1A 1U1IA 1OTHA 2QPLA 1O8BA 3QKTA 3TTUA 3UGTA 3UWKA 2R751 4BMCA 4EG8A 2OD7A 5AXAA 3IALA 1QU3A 4HDNB 2XGOA 5K2OA 1NQAO 3IVAA 3RRFA 1W96A 4NC9A 1RMYA 3WIDA 5A9TA 2F8LA 3E1KA 3LBHA 3KJIA 1VYHA 3WLPA 3BPSA 5DM0A 3PQ7A 2VHZA 4LSZA 1EFRD 1KI7A 2GPBA 3NNDA 4GX2A 4ZQBA 1KMHA 1F4LA 3BXHA 1BRTA 3NTLA 3GQBA 3NIWA 3Q5GA 3SZMA 4R2WA 3ES9A 3S2IA 1TJ4A 1U2SA 4R1OA 3TBKA 1DBIA 2F48A 4ZO8A 3RRBA 1Q6YA 5LQMA 1I10A 1QH1B 3ETCA 5B37A 1KPIA 1YD7A 3RROA 3SYKA 4EIWA 3OPXA 3SXPA 5FBZA 1VHQA 4TWIA 2HQSA 1RXVA 4M0CA 1MC4A 1ZOLA 3EZ6A 2JH8A 5K20A 4ZT7A 4K81B 4OA5A 4YFVA 4ETNA 3SYRA 5J4LA 3SWWA 4P0TA 4MPPA 2X4GA 2DLNA 4NV3A 1R9NA 4NYIR 4QA9A 3IOCA 3SF8B 5C8ZA 5I4CA 1ISHA 2JGAA 3CE6A 1ELOA 3DEHA 4AZ3A 2JIOA 2GEVA 1DOZA 4Q9NA 1GTJ1 5FTLA 5HKKA 1HH4A 4I2VA