4DCTA

Crystal structure of b. subtilis enga in complex with half-occupacy gdp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
432
structure length
401
Chain Sequence
KPVVAIVGRPNVGKSTIFNIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
total genus 116
structure length 401
sequence length 432
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dctA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dctA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dctA01
3BERA 3JAMD 1R5OA 2VEDA 4YHHC 4TYNA 2REBA 1NY6A 3GLHE 4NTZA 2F4VC 1LY1A 1VYTA 4B44A 3U3KA 2Q9CA 1XTKA 2UU9C 1N5KA 1C1YA 1MO3A 2WMOB 3A1WA 4WZAE 3N2IA 4M8NE 2ZU0C 1NN3A 2LKDA 3FE2A 3PEYA 1KSFX 1ZRHA 5M04A 1JBKA 1E9EA 1JXMA 2FEOA 2G0TA 4LJ9A 4BECA 3FHCB 1RKBA 2ERXA 2FFAA 4A0FA 4DT1B 3L0IB 2BBTA 2DWQA 2J5XA 4W9MC 3UXMA 3WHKA 4OI4A 2HHHC 4KFUA 3SZRA 3NBFA 4L4UA 1E2NA 2F1JA 3K70C 1F2TB 2OFXA 2WAYA 4DCSA 1XBTA 4X8LA 1XMSA 4PC2A 3EPLA 1Q3HA 1M8PA 1VG1A 1AZTA 5CJ2A 3KZ1E 2N1BA 4P4TA 5AJYA 2VA8A 1XCMA 5JECA 4C3ZA 1QHNA 5FTLA 3HP1A 4C0SA 2OG2A 2PT7G 1DAFA 1G5TA 1RE0A 3Q5EA 4FMBB 4DB2A 3B85A 3O47A 4IOMA 1OT3A 1L4UA 1Y3AA 4Q9HA 1PA4A 2MMCA 2UUBC 1NF3A 1IBRA 2QM8A 4DUZC 2C03A 1GVNB 1W44A 1XB2A 4MYCA 1IY1A 5JWRA 4NONA 3GP8A 1XTSA 3PXGA 2CDNA 1VCNA 2J7PD 3UG7A 3CH4B 5JSZA 3IKJA 2XNSA 5FBQB 4UKDA 4A15A 2JDIA 2IBMA 4Q9KA 4MDFA 2OAP1 2XSZA 4GRAA 4XOIA 4L9SA 2VTKA 4DV7C 4LF9C 3TVDA 4U7DA 1N5IA 2GJSA 2PZFA 5LMNC 1LB1B 2GJ8A 4Z8XA 3VR4A 1GL9B 1G7TA 3AVQA 5CITA 3HU3A 2JGNA 1PLJA 2ZYVX 4LY6A 1KO4A 4LV8B 4TMZA 3OE7A 2GEVA 3VFDA 4I4LA 4B3TC 1IXRC 1SVKA 2BBSA 4HLUA 4QGHA 5D3MB 1R5NA 1KJZA 4B2IA 3T5DA 4PQFA 621PA 3Q3JB 5P21A 4UNRA 2AFIE 2VSXA 3WYGA 1N34C 1T8UA 1WMSA 3O8BA 2XNDD 4RFSB 3EWAA 1E3MA 4Z8YA 4KXFB 3OF5A 2BBWA 2O8DB 2AK2A 1T4GA 2UKDA 1GL7A 4KO8A 4IVQA 1NVVQ 3KFVA 3KKMA 4LUCA 1J90A 5G40A 2WM9B 1N6IA 2ZM5A 4M1SA 1VDZA 4QL3A 4KHZA 3D7MA 2PMKA 1TL7C 3VX3A 1D9XA 1HE8B 2G1KA 3C5HA 4K81B 4N1AA 1BYUA 4BUJA 3LVRE 2ONFA 2OPLA 3NIBA 3GJ7A 2FOLA 2Q21A 3GJ6A 4YMTA 4B34A 1FQJA 1LS1A 5HCIA 1JJVA 3B1WA 4AY2A 4TMWA 3Q7PA 4MYUA 4N0EA 3THXA 2WJJA 2EU8A 1EX7A 2YJTD 3HYRA 1AKYA 1KAOA 2IYRA 2O0JA 4J0QA 1XD8A 2X19A 2ZJYA 5EUQB 4A2WA 3CR8A 4U5XA 4GL2A 4IXNA 4AC9A 3CRVA 4C30A 2IYQA 5FL3A 3RDPA 4NOZA 3QJYA 1X86B 4AKEA 1RVDA 4DDVA 1P75A 1R5BA 3MCAA 1CJTC 1FZQA 2H7VA 2J0VA 1LNZA 3QVUA 5JFGA 4IDOA 2G3YA 2RAPA 2XTMA 3EIHA 1TTTA 4LF8C 3BGWA 4AKHA 1ZD8A 3FMFA 1LTQA 1KK0A 5IT9D 1G8FA 1K5GA 1BMFD 3KKQA 4JVLA 1Q0UA 4M0LA 4LYAA 1H65A 2FPMA 2W6IA 4YDSA 4RZUA 3B2EA 1N5LA 2Z4SA 1QHHB 4NYJR 4DIDA 1TMKA 2GBLC 4LF4C 5TARA 2JJ2A 3AB3A 4HDQB 3AF0A 1XZPA 1EG7A 1N6NA 4XTRA 1ZNYA 1LW7A 2DYJA 4B2LA 2P6RA 3Q9LA 1CJMA 1OIWA 1HUQA 1R0ZA 3DHWC 1E6CA 5EP1A 1HT2E 2WPDD 2QT0A 3K0FA 5EZ6B 2B21A 3CZQA 4DZZA 3UK6A 2NTYC 4DXAA 1G8HA 3WYFA 4B3XA 1JECA 5B58C 4EPWA 1G21E 3QE0A 1SXJC 2BWJA 4EQ6B 4OL0A 2HLDD 2WMNB 4FXPA 4QM6A 3VR6A 4V0KA 4B33A 2FPKA 2WKQA 2FFHA 1NN1A 4PAQA 1F5NA 2PX3A 5F2EA 1MRSA 1CRPA 1GITA 5AUNB 3EPHA 4P32A 4GDFA 4XD7A 3EX7C 5A4JA 4IJMA 1ONBA 2NQ2C 3AH8A 1T3SA 3QBTA 2HF8A 3EG5A 3B5JA 2QORA 2R9VA 4FCTA 1QG4A 2NO7A 1X8LA 4KBGA 4M53A 1KI8A 4C7OB 2DFTA 3THYA 3LUSA 1U0JA 2MSDB 2AD1A 4WOPA 2ZR7A 4A0HA 2DFLA 3RRYA 1NMZA 1NG1A 2FGKA 3OFNA 3QI2A 4RD1A 2FX3A 3P32A 1ZNZA 3AVPA 3K0EA 4DJTA 2QSYA 3AEZA 3NTUA 3K9NA 5BR8C 3RWOA 1G16A 3KTAA 2IX3A 3AGQA 4LJ5A 2A5FA 1BKDR 2BVNA 1OLOA 3AUYA 3ASZA 4ZO4A 2OXRA 2FN4A 5K8UA 1YZQA 2ZXUA 3CPJB 1RRFA 2GESA 3MRSA 1BOFA 2EYQA 2VLIA 4O0MA 1ZB8A 1UF9A 2A9KA 1QHSA 5EJEA 3TMKA 5E7MA 1Z2CA 3I92A 2ATXA 4IDHA 4LCBA 2GEDA 2IXEA 2QAJA 5JJIA 3BB3A 3CF0A 1CP2A 2IYUA 3DVLA 3K0AA 2G77B 4KVAA 1CLUA 1LS6A 1JALA 1YR7A 2ZRIA 4PC3A 3ZVRA 4M1WA 4BASA 2Q3HA 5IWAC 1AQUA 2OCBA 1N0WA 4BRWA 3CIOA 3EC2A 4H1UA 3CX8A 3T12A 1ML8A 3DL0A 3BH7A 4O2LA 1RYHA 2PT7A 1U2RA 4Q7JB 5CLQA 2EYUA 3FVQA 1G5RA 1Q44A 1YR9A 1YQTA 2RGNA 3GD7A 5DI3A 4A0GA 1JR3E 4AKGA 4CGZA 1N6RA 2VQFC 1E0AA 2X2FA 4XWOA 4HZUB 2R44A 1OIXA 4WAUA 2ODNA 4K8OA 3RVBA 3VKGA 1ETUA 4MGZR 3RWMB 4URXR 5DISB 2FH5B 1ZD1A 1CR0A 1YZLA 2BHRA 3RRNA 3GLHB 4QGAA 3CRQA 4JT2A 3WBKA 1VCMA 1LV7A 4D4KA 3AVWA 1KOFA 3U61B 2V6IA 2H8KA 3N2EA 4EFNA 2JASA 3DOFA 1YZNA 2O8BA 3A4NA 1VCIA 4NU0A 4KYIB 3QKTA 4DUGA 2HT6A 3CO5A 1COWA 1JXOA 1G6HA 2G6BA 4FI3C 5FBVB 2ZVQX 2DFNA 3LXXA 1FP6A 2GF0A 2QE7D 2QPTA 3IDQA 2BMFA 3LXRA 4KFRA 1GNPA 5FL7D 5FOUA 1N2CE 2QMHA 3KUDA 3IGFA 4HLCA 2BEKA 1PJRA 2ZSAA 1ZIOA 3CR7A 3L8ZA 4EQ6A 3GEIA 1DADA 1KI6B 3U7GA 4P3YA 2QL6A 1IXZA 3CONA 2R6GA 1XEWX 4MRVA 1S8FA 4HATA 3AP2A 5H1YA 4XWAA 3PCRB 1P6XA 2XTNA 521PA 4CIDA 1KNXA 3UANA 4A2QA 1SVWA 3H1TA 1E1RA 1KSHA 1EWQA 3UMSA 3X1ZA 3LDAA 3UWOA 3MWYW 4HLDA 3X1DA 4B47A 2J1LA 4FN5A 3P27A 2PL3A 1T8TA 1YRBA 3A8TA 4TL6A 3OIWA 4JBXA 1XTIA 1YJ5A 1Z3IX 3GLIE 2ZYTX 4DCTA 1Z06A 3TAHA 4RY2A 2DYKA 5GVSA 1J2JA 2RGAA 4Y0AA 5EP3A 3RS0A 1Z6TA 3EIEA 3HWSA 3DOEA 1W47A 1F3OA 3QG1A 4PANA 4ZKEA 3RSOA 3VX4A 1JB1A 1G7RA 4X64C 2B7BA 2AFHE 3ZS8A 2RHDA 5JRZA 3VNVA 3TK1A 3BBPA 1F48A 3CJEA 4JV5C 1S2MA 1UJ2A 1VG8A 3QKUA 4M1OA 3WYAA 4EIWA 4JZKA 3B9PA 4NH0A 5DHFA 2FSGA 1NLFA 3K0CA 4UNQA 4HZIA 2IS6A 3TE6A 1K6MA 5IK2A 5BQ5A 2D7VA 3R20A 2DWPA 4AKIA 3CM0A 4DR4C 3REGA 4TZ6A 2FA9A 4JVMA 1ODFA 1J99A 2V1UA 4RKEA 1TF7A 3ADDA 3QPUA 2CJWA 3A6PC 4B3MC 4OI2A 1XJQA 3RS4A 3U7EB 3LO5A 4LYJA 2UZ3A 1XEXA 4KODA 2ONKA 5E3HA 2CVFA 3LBHA 3DM9B 2WWXA 2WJGA 3NBZC 5JCPA 1P5ZB 4B73A 1VIAA 4QGGA 4P33A 4I1UA 2VL7A 3VNUA 1NSTA 1BYIA 2EVWX 4D80A 2CLSA 2ZRCA 3TLXA 4KFTA 2YOGA 3GLHA 3FTQA 5HR5A 4D25A 1J8YF 1TUIA 1KYIA 3L8YA 1JOSA 4DLUA 4Q9IA 2OAQ1 4LV5B 4KBFA 3H0KA 1TF2A 2VRWA 2CNWD 1UADA 4D0NA 1FUUA 1ZB9A 4B3CA 4D4JA 5C46F 1P9NA 2BDTA 2HJVA 4BRUA 3BIFA 1P7CA 2ZRNA 4OK3A 1P60A 2UXDC 1UBFA 2RKOA 3NVAA 1NMYA 5BW8A 4HAXA 1QVRA 1QDEA 1W4CA 4B75A 3P26A 1SQ5A 1XWIA 2FFBA 1E94E 4LRWA 3A4LA 1NKSA 1R8QA 5LD2B 1BO6A 4KAXA 2BEJA 3NKVA 3R8CA 3LLMA 3UKDA 3WMFA 2QP9X 3HPQA 4I99A 3K0CC 1E9AA 3CRW1 1E9BA 2IEZA 1SXJA 3TR5A 4A82A 4LFCC 2PN2A 2JJ1A 2LWIA 3JZMA 5AUOB 3ICQB 5DYGA 2O5VA 3QXJA 2NGRA 2W00A 2Z0MA 3C41J 4LBWA 5TV2A 2BIFA 2ZI7A 2F1HA 1KHTA 4TTPA 3K70B 3DKVA 2V8OA 1KI1A 2KBFA 1X3SA 1C4OA 4DR6C 2B8WA 3A58B 1N6OA 1DAGA 3QSYA 3MG9A 1HQYE 4EPTA 3RHFA 1H8ED 3K0SA 4EFLA 3U7HB 3LA6A 1G3RA 2ZI3A 3EASA 3ND9A 4AYXA 4OQFA 3AUXA 2L0XA 1G7SA 3BC1A 2BBOA 5CB8A 2ZE5A 4ON9A 3HDTA 1U81A 3PQCA 4RSGA 4PXAA 4DV4C 2GVDC 1D6JA 1G5PA 1JQLB 1Q1ZA 1XD9A 2WZQA 1OKKA 4DVGA 3PUZA 3AVVA 2ZETA 2R6DA 4LDJA 1UFQA 3ZDQA 1Z2AA 3WP1B 4RD0A 3KKNA 4C9BA 1WE2A 5FBRB 1DE0A 1YE8A 4QNMA 2ZRHA 2UXBC 4K46A 3NDBB 4PPNA 1KMHB 3RS7A 3LQRA 2DFKB 3IIJA 1N3BA 4PO8A 4YMVA 1E2EA 1HQCA 1YVDA 4GSYA 1W2HA 4R7ZA 4TYYA 2ECKA 5H68A 1Q12A 4GKKC 5FUWA 2ZS9A 2IHBA 2QENA 2TMKA 2CL6X 4DT1A 1LFDB 5F9FA 1MO4A 4IDPA 1N2FA 3T06B 1UBEA 2WJVA 4D26A 3C4JA 4GBMA 2BJOA 2ZUDA 5IF9A 2WPDA 3FMPB 2NZ8A 4D4LA 4JI3C 2W58A 3C8UA 4C2TA 4CDGA 1D8TA 1FX0A 2QRNA 3CWQA 4BLRA 4UXJA 1HURA 2YCBA 3EZ6A 1P9RA 2H57A 2YINC 3I5YA 2VHCA 4OX9C 3VR3A 4EPYA 5AJXA 2OILA 3X1XA 1FW6A 4QBGB 1WA5A 2PMDA 1E9RA 4HAYA 1OXTA 2ONJA 2ATVA 1OFIA 1A2KC 2EGTA 2GJ9A 4DR1C 1SKYB 1U8ZA 1QF9A 1UDXA 3F5FA 5CYPA 1JEDA 4BFWA 3O8DA 4V03A 4XSGA 2BOVA 2ZJ8A 5LB4A 5HKKA 4NCJA 1PUIA 2CVHA 4M9QA 2AKYA 4KI0A 1A5TA 2QA5A 2GK6A 4Q1DA 2OBMA 3BD9A 4KJZA 1OH5A 2E8EA 4DV3C 1KO1A 2C9OA 4HAZA 1JR3A 2P5TB 2F55A 1GNQA 2XOKA 3V00A 1XEWY 3FFBA 4FCWA 5AK0A 1MR3F 2QNRA 3C7KA 4MRSA 4EAQA 4QM7A 1IXSB 3VU9B 4I1VA 4A8JA 4LK2A 2KE5A 2QT1A 1KJWA 1Y63A 4RZXA 2Q3MA 2XJ4A 4H1VA 1R8SA 3TGPA 4JLKA 1U99A 4KVGA 3V4FA 3ZIAA 4NYIR 1AS3A 4GI7A 2QPAA 4PSKA 5TB5A 2XZLA 4TMVA 1KDOA 1L8QA 1PVOA 1VTKA 4TLCA 4G5GA 3GJXC 3LBNA 5LBIA 3MWLA 2JMPA 3LVQE 1AKEA 4JI6C 3T61A 2ZUCA 2V55B 3BE4A 1G18A 5L3RA 1WCV1 3PEUA 3I07A 1QRAA 2E87A 2F3RA 2PLFA 3Q7QA 5HE8A 1CS4C 4LOAA 1R0XA 1ZC3A 2VPPA 1XEXB 3UPUA 4JLVA 4MUBA 3W5JA 3T1TA 1ZM7A 4CEIA 3B82A 4GZLA 3BB1A 3B1YA 5AUPB 5L3SA 3SJBA 1IN8A 1XXHA 3IO5A 3T34A 5LPNA 3SYLA 1P62B 4HLQB 5FOWA 4E22A 2JEOA 2AR7A 3W8RA 3I61A 3TSZA 4DLZA 3BFKA 2IWHA 3TVTA 5A2QD 2ORWA 1XRJA 1TPZA 2IYZA 4PHFA 1JAHA 1MABB 3L43A 4AQYC 1N25A 4LX0A 2GRJA 2KJQA 2WOOA 5FTNA 1ZP6A 4F7WA 1NY5A 5DLQC 2XGJA 1IN6A 3KJEA 4JLMA 5K8LA 3RANA 2GCOB 1SULA 4M1YA 1UPTA 2ZJZA 2YWFA 4KYUA 3IHWA 2QP3A 4DUGD 3BS4A 4MKGA 2CL7X 2OFOA 2HJGA 3AGPA 1OXXK 3KB2A 3PUVA 4ILEA 3SJZA 3CNOA 1WBBA 2HUPA 1W1WA 1VCOA 4JSTA 2J0QA 3RS3A 2OFWA 5FL7A 4ESVA 1DEKA 1E4VA 1EGAA 3KQUA 4B76A 1W48A 4DWJA 1NBMA 2AKAB 4TYPA 2IS2A 1PV4A 1CR4A 3CF2A 4Q47A 3TW8B 1HEIA 2X77A 5DIFA 5FTMA 3GMTA 4TMTA 2JLXA 2A7QA 2GKSA 2GETA 4C0BA 1S3SA 5AJWA 3MWKA 5FUXA 2A3RA 4XWKA 1YZKA 2ZSDA 1DTSA 1TEXA 2A2ZA 4A0RA 1XMIA 4LYFA 3P1JA 3CW2A 3VTKA 2XR1A 3ZGXA 2RGGA 1KSJA 4A9AA 2FFQA 2QZ4A 5JRJA 1GTVA 1E0KA 1ZNWA 2Y8EA 5UKDA 2IL1A 2CL0X 3HU2A 4HYYA 3SFZA 2IS1A 6Q21A 4X66C 5J4LA 3F3YA 2ZJBA 3EXAA 2H92A 4A8JC 2WSSD 2NPFA 1CF4A 3SDZA 4PAOA 2IYVA 1N5JA 5DI3B 1CJKC 2OUKA 1GKYA 5EE5B 3PFIA 2ZJ5A 3CRRA 2JLVA 3E70C 3RABA 4NE2A 1IHUA 5EE0A 4BLOA 1W2GA 4JVNA 1CBUA 1O87A 2P2LA 3V9PA 1I4TD 3M4YA 4TLDA 5FTJA 2WWGA 1G3MA 1SVOA 4KSCA 5EXXA 3FFAA 3I5XA 2P5SA 1FTSA 3DMDA 3QKRB 4MH4A 3P4XA 5AJVB 3DM5A 3KB1A 5KHOC 1X1RA 4Q7KA 5EXSA 2GAAA 4B3SC 1U9IC 2QMUA 5LB2A 5LMUC 2WOJA 1ZVQA 1KO8A 1HH2P 4QJ5A 5L3SB 4YQFA 2BV3A 2ZREA 3BB4A 4M1TA 1CR1A 3I72A 5HKKD 4YXWA 2C96A 4LJYA 5A5GA 2W6JD 1I4LD 2UUCC 1G20E 2HCJB 2OM2A 4BZQA 4KSBA 3VR1A 3LX8A 4EFMA 3ZLJA 1AN0A 3TUIC 2FGJA 1K0RA 3W3ZB 1ZINA 4DLWA 2MSCB 2GDJA 3KTAB 2FEMA 4QHSA 2HYDA 3GEHA 5H70A 2Q9BA 4HB4A 5TVKA 2GXQA 4PC1A 1Z22A 3AF5A 1Z83A 2CXXA 2D7CA 4PR0A 4QHYA 4AI6A 4ASUA 3ND8A 3S1AB 3SYNA 2WWFA 3BORA 3UMFA 3ZD7A 3IILA 1Q57A 1ZM9A 2CHGA 3D3QA 1ZC4A 5EE1A 2NIPA 4BQSA 4Z1MD 1KI2A 1P73A 1YKSA 1AZSC 3QEJA 1CKEA 3QIAA 4A8JB 3VR5A 1KK1A 4B2PA 4EPRA 5L3QA 1OJLA 2ZYUX 5IHPA 4RD3A 1Z47A 2GBLA 2YZ2A 2DWOA 2D2FA 1OHHD 4MH0R 2ODWA 4A36A 4D81A 5H8WA 5F3WB 2C9CA 4M1MA 4QJ3A 1E2DA 2GWHA 2E9SA 2H5EA 4LPSA 2YVUA 1YHNA 3PEWA 1II8B 2ZE8A 3JZAA 4V0MA 4QJ4A 2CLDX 4B6FA 4BLTA 2JJ1D 4LFBC 1KDPA 3EA0A 4DV5C 3KXIA 2WJHA 1XPOA 1CJVC 1EFHA 3NC1C 4Q4HB 5J4YA 5DGXA 4IRUB 1ZU4A 2ZSEA 2HYIC 2D62A 1XF9A 3U3MA 1G291 1HA3A 1DOAA 2J0UB 5SZKB 1XP8A 3U7FB 1BMFA 4DUYC 5FR1A 1SKYE 1Z08A 3B1VA 4IOKA 1WH9A 4DV6C 4JYAC 5CDFE 2A5DA 4TT3D 3B60A 1A1VA 1IN4A 2XEXA 3H4MA 2YC2C 1FTNA 4LI0A 3GLIA 1K8RA 3LW8A 3OAAA 4M1KA 3SOPA 1N0VC 4URVR 1RW4A 2H18A 1ELOA 1N36C 4IDNA 5FOVA 2WICA 3RS2A 4NCIA 1T5IA 2A5JA 3KUCA 1RC8A 1XNQC 4LJ4A 1U90A 3DEFA 2AWNA 1N33C 2CEAA 2DCUA 3A1SA 4TTRA 5JJKA 3B13B 3GFPA 1UKKA 3KKOA 5JLJA 4NDZA 2QEQA 4LHXA 1WXQA 2YNMA 4LFAC 4KV9A 5J5CA 1U94A 2JCSA 3P4YA 4B48A 1DO2A 1MABA 4LHYA 4R71A 4Q4LA 3REFA 2QTVB 3EPJA 2C99A 2CCGA 2XOKD 3TRFA 2C95A 2F43B 1L4YA 2FWRA 2YOHA 3KQKA 4LJAA 2CNWA 2PH1A 1DG1G 4QNRA 3NEYA 4LZZA 2ZU6A 1ZBDA 4JMPA 1OH6A 3AVXA 1AK2A 4HUQB 4MRNA 4RKFA 1E9CA 1J8MF 2X1VA 1T91A 2EWWA 3KKPA 1CEEA 1Z0AA 3ASYA 5BN5A 1XNJA 3HR8A 1S9DA 1E2GA 2QP4A 4DR3C 4JLAA 3A1UA 2GHIA 2PBRA 2WIAA 5GJBA 3RLFA 3R9XA 4M2LA 1ZNXA 2F7SA 3MLEA 2N46A 1W5TA 1M74A 2FE4A 4IVPA 4W5HA 1P2UA 3OESA 4BLSA 1Q3TA 3A36A 2KSQA 3DKPA 3RRMA 1IN5A 1VYVA 4IEEA 4DEYA 3AF1A 2PZGA 3SFVA 5TY0A 3FOZA 1E1RD 1Z5ZA 1VKJA 2ANCA 2GILA 2GF9A 1TU4A 4EKDA 1XPRA 2JIZA 3UWKA 2Q0HA 3KXLA 4JI5C 5CDFA 3VAAA 1SXJB 4Z51A 4BWYA 1G4AE 2O8EB 4BZXA 1PZNA 2ZRJA 1IY0A 3DPUA 1YRAA 2ZJAA 5DE3A 3AM1A 3MD0A 4M9ZA 1RFLA 2WVJA 3UATA 3G5UA 4DRZA 2FMXA 4TYQA 4E5UA 4XIGS 3EARA 3P20A 4KLZA 1ZD9A 1VMAA 2EFHB 1OKKD 2NO9A 1FL9A 2ZROA 2ZRKA 1I94C 4Q1BA 3IUYA 2AX4A 3L0SA 4NYJQ 4Q1CA 2CCJA 2GVZC 2VF7A 4G5QA 1S1MA 4B43A 2OZEA 3SC3A 1W36B 4NCNA 3WMGA 2VQEC 3U44A 3IIMA 4O3MA 4A6PA 3FDIA 1LQLA 4YY3C 2W83A 1SXJE 4BEBA 2OBNA 3ZH9B 1JI0A 2ZM6C 3K9LA 3KDSE 4Z54A 1E1QD 1G8GA 1GP2A 1XD2A 2KBEA 2VYFA 3T1QA 4A92A 1DPFA 4JJKA 3TR0A 4F4CA 4S2EA 3L2OB 1E32A 5EP2A 2ASBA 3PUWA 2QMOA 1GRRA 2VO1A 1G41A 4QBFA 3NBXX 4TYWA 5SZHB 1BS1A 1XXHB 1VG0B 1MV5A 4UNSA 1TUEA 2QU8A 4JL8A 5KTYA 3IPXA 1E79A 1OH8A 2I4IA 4WXPA 1I4DD 2CY1A 2QG6A 4GMDA 2O8FB 4TQUS 5JZVA 1DS6A 4BEJA 3J81k 2V3CC 2QROA 1G1MA 2ZS7A 5CIWA 4Q21A 1G3UA 2OHFA 4NYMQ 3VU9A 1DAEA 1AM4D 1VG9B 4IEIA 3QEOA 3UIEA 4BSZA 2WKPA 1GRQA 5CM8B 1KKLA 2XITA 2ZRBA 1FNNA 5FPSA 2R65A 3AVTA 4O25A 4L5BA 4HUQA 2HT1A 4LBYA 2ZI6A 3FHTA 2AL7A 2R6CA 4MYHA 4BFVA 4ARZB 3QUSA 5FPKA 1ZM4A 4HDCA 4LHVA 1JAIA 2BKEA 2YKGA 1SVIA 4WA7A 1UKYA 1VHLA 1XXHE 2VP2A 3D8BA 1HV8A 1YU9A 4N0DA 1ZUNB 1QHGA 2IK8A 4Q00A 4YONB 2F9MA 2ZI5A 3QF4B 3U4QA 4YDHB 2IT1A 5D3MA 2RCNA 3TH5A 2QN6A 1G7CA 2E8FA 1T3HA 2KI5A 1ZYUA 3QKSB 3SQWA 2XB4A 4Q19A 3THWB 3MGCA 3LBIA 3LWNA 4V0NA 2YYZA 1UKZA 1KZGB 5FOXA 3D6TB 2J9RA 4GZMA 1E98A 4FW9A 5CYOA 2MSEB 2IUUA 4C2UA 1XFAA 3K53A 2IXFA 2V4ZA 4LC0A 2ASEA 3SU8A 1XMOC 5LDDC 4B71A 2UVQA 5FOTA 2QE7A 3OFND 1EX6A 1ZMXA 1KI6A 3RYTC 3EZ9A 2H16A 1AS2A 2BMJA 5AR1A 3QXCA 2GK7A 4HSEA 4PFSA 3SJAA 1GL6A 4ACBA 3U6BA 4MDEA 5DH9A 5IK2D 4DR7C 1HE1C 4Q7LA 2BM0A 1ZCAA 4B32A 1FNMA 2XB2A 3LV8A 1QVAA 2NPIA 3KQLA 4RD4A 1T9HA 2EW1A 2ORVA 3GJ8A 2J45A 4JIMA 2AD5A 2CE7A 1G6OA 4GOJA 3SS8A 3PEVA 4XVQA 4C0JA 1TNDA 1WRBA 3W34A 1S0UA 5J4HA 4Q7MB 1WDTA 2D3WA 3OTOC 2R6FA 1BH2A 4FMDF 1KMHA 4OHXA 4QKQA 3IQXA 1KI9A 3TSOA 2FV8A 3AVYA 1E2KA 1HTWA 3AVOA 1Z0DA 1TU3A 3LD9A 4UNPA 3MAAC 1PUJA 4TSFD 2QBYA 1FFHA 2ZRDA 4YMSA 4KCGA 4BFZA 2H17A 4K0KC 2ZRMA 2WWIA 1GG2A 1W46A 3KQNA 3WP0A 2V1XA 5FR2A 4EJSA 3GEEA 1R7RA 2UZIR 4JI8C 2MMGA 4BLPA 2EFDB 4DR2C 2QAGB 3T1VA 4PSAA 1W0KD 3I8SA 3U5ZB 1IBMC 1VYUA 2RMKA 3JVVA 3PR1A 5KNBA 1XEFA 1KZ7B 2OCAA 1Q20A 1A82A 4IFBA 4LHZA 2BMEA 1H8HA 2RGEA 4B3DA 4DIEA 4US1R 2XXAB 2ZPTX 5KPJA 5FLXD 1KMQA 4IXMA 4ZI2A 1DAIA 2E1RA 1NBMD 1Q22A 1OFHA 1T0JB 4MKIA 5K8TA 1YR6A 1Z6XA 2REOA 3K09A 4OK6A 4PC7A 4CW7A 4FMCB 1G3QA 4X62C 1VPLA 4TLEA 1SKQA 5BXQC 2CK3D 2OXCA 4ZI3A 2CBZA 4HB3A 2IYSA 1W4AA 3AKYA 3R7WB 4C4PA 2RGBA 3OEHA 5GJWC 3QKSA 2O8DA 1II9A 2JLQA 1XTQA 2GZAA 3BWDD 4MGYR 5EXTA 4WBSA 5HZHA 1W7AA 4FWTA 4BFSA 5DNYB 3U4QB 4DSUA 4ACAA 4W5WA 1DG3A 1H8EA 1KK3A 3THOA 4F4IA 4PPFA 4NYMR 2FSIA 1S9HA 2JATA 2DPXA 3ECCA 3M1IA 2VP0A 1OV4A 5JEDA 1II8A 2VQSA 3DZ8A 4PX9A 5A0FA 4IW3B 4WVFA 4QHTA 1AGPA 2BC9A 2J0SA 2IC5A 4EPVA 2X8AA 1NN0A 4L8GA 2YWEA 4Q4JB 2ZUBA 4TL8A 2C8VA 3WNDA 3ZIAD 5CK4A 1F60A 2AN9A 5AWFC 4YC7A 5EE9A 2AHOA 2Z4RA 1MO5A 3HYTA 1W36C 1AJEA 1JR6A 3MSXA 2GNOA 1JPJA 2PEZA 4WZBE 4IOJA 5J40A 4Q18A 1NJFA 1R0WA 4CT5A 5HPYB 5KSYA 2P65A 2G0NA 3TUJC 1RRPA 2QMEA 2DHRA 2Z5FA 3CNNA 1E2MA 1P4SA 4HB2A 1IJEA 5E4FA 3BRWD 1XZQA 1T5LA 1R0YA 1UBGA 2IYXA 2QUZA 2VHUA 1VLAA 1EFRD 4CEJB 1PLKA 2WJIA 2I1QA 3DO6A 5BYKA 1F2UB 1KDRA 2W6JA 3K0FB 1SVLA 4O2RA 3IHLA 2PX0A 1NLZA 2IA5A 2PJZA 4BFTA 1KJYA 4QXAA 3HPRA 3PJRA 1IONA 3IEVA 4P31A 3M6AA 1A7JA 2XZOA 5SZIA 4F91B 3VKWA 3SR0A 3IBYA 3OIYA 1LVGA 2ZAMA 3A4MA 5J4KA 4URYR 5JEEA 4L9WA 3ETLA 2RGNC 3K9GA 5FI0B 2B92A 3ONWA 1QG2A 4R2HA 3B6EA 4B3RC 4AYTA 4DBLC 3OEED 5FBLB 3AVUA 2GTPA 3EAQA 2I3BA 2VP5A 1G64A 3ADKA 3DDCA 3EPKA 2JLRA 1N6LA 4U02A 4CVNA 4JI7C 2F9LA 1MT0A 4POAA 4LJ8A 2ZIAA 2J59A 4JL5A 4HDOB 3GKUA 1RJ9A 1QHIA 5FBWB 3QG5A 4CEHA 3EIQA 2C04A 2GJAA 2Z83A 3K0AB 4ZCLA 2XTZA 4LBZA 2IYLD 2ERYA 4URZR 2E5LC 1KKMA 1E2FA 2J7PA 3JVUA 2CE2X 2BCGY 1U0HC 2BKUA 4JKIA 3ZVNA 3AP1A 1CIPA 3FWYA 3OIUA 1M34E 2NMVA 1CU1A 2X2EA 1W4BA 2D06A 4DLSA 2CXCA 1E2JA 4NYIQ 4P4SA 3U2QA 2ZAOA 4TWZA 2V9PA 1NN5A 4C0QC 1UAAA 421PA 4DSTA 3CH5A 4WZ6A 4OHWA 2GA8A 2YC4C 4QG7A 4IDQA 4AK9A 4OI1A 4LGMA 1IY2A 4M21A 3CUEF 4JYBA 4KFSA 4LWZA 2HF9A 3BFXA 3BH6A 2OT3B 4HAVA 4UJ5A 1XMVA 3ZZ0A 4NCHA 2UXCC 3QF7A 1DAKA 4XJXA 1OXVA 3NHAA 2ZE6A 1G17A 4TMKA 1FJGC 4XX2A 2ZRPA 5TMPA 1GKIA 4LBVA 3SN6A 3EA5A 1IBKC 1GRNA 1II0A 4JLJA 4V0OA 2PJRA 1AQYA 1G19A 5G3YA 5DN6A 5JJLA 1NVUQ 3CPEA 4DKXA 4JYCA 4X8MA 1L2FA 4QBHA 3U3JA 5JI3E 3IO3A 1P72A 3QPWA 3SEAA 1FMLA 1NG9A 1FPMA 1H8HD 4H9GA 5C4MA 2ZITA 4A6XA 3HJNA 4X65C 4HI0E 4KLNA 4RZ3A 2G1JA 2GCOA 2C2HA 1E2HA 1DAMA 2J41A 3QPVA 121PA 1D2NA 4DC9A 3HU1A 4DSNA 3V4RA 2XAUA 2OESA 4DLVA 4KHPC 2LKCA 3PITA 4US0R 3I32A 4OHZA 4ESHA 2YV5A 3QQ5A 2ZSBA 2OBLA 2R62A 4LSGA 4ZIRA 1GIAA 1TADA 1USPB 1ZAKA 2IF0A 4EDHA 5KPDA 5DHAA 1D9ZA 3BJIC 5BN4A 3C16C 2NO6A 1F6BA 1IAQA 4MA4A 1E69A 1E9FA 1E79D 5FUYA 1N32C 1KO5A 2ZR9A 3QNUA 5JSZB 4Q1FA 1JNYA 3GLIB 2V7QD 2QGZA 4ZDWA 2F1IA 3KJIA 3IPYA 5CM9C 1ESMA 1TF5A 4IHQA 4G0NA 1QHHA 3WXMA 3N70A 1ZCBA 2VP4A 4Q9JA 4MRRA 5FH9A 1R6BX 5JHHB 5JBQA 2OCPA 4FCVA 4OQXA 4Q48A 3WRXC 3LW7A 3RC3A 4PQRA 1QHYA 2V6JA 1XJ0A 5CK5A 4C0AC 4RFVA 2QRZA 1KNQA 1EESA 4DR5C 3PIRA 1G3IA 3I4LA 5TXGA 4RD2A 3KQHA 4NZYA 2ZEJA 1Z07A 2ZVPX 3MMPA 4F92B 4R2IA 2PEYA 1Q21A 1UDWA 2PLRA 2RGXA 1XMJA 4GFDA 2QAGA 4DEXA 3TAUA 5EP4A 1KAGA 2C9YA 1SHKA 2WSMA 1V43A 3VHXA 5JMTA 3ADCA 2R6AA 4AIIA 1W36D 3ZD6A 1I2DA 3A37A 3FPAA 2C77A 2VSFA 4Q01A 3F8TA 1XMQC 1EFRA 4G3XA 4URWR 3KJHA 1OYYA 3S1AA 2IYWA 1OB5A 1FOEB 3I62A 3K8YA 4LYHA 4WW0A 1HT1E 5FPYA 3ZZTA 4V0ME 4DCUA 2FNAA 4V02A 3VQTA 3AF3A 4B35A 4B6EA 1US8A 4P0TA 3VR2A 1NKTA 2R2AA 1E1QA 5KOYA 4DDWA 4OJKA 5TDHA 3LRPA 4QGFA 3NWJA 5AJZA 1EFCA 3CNLA 3TKLA 4PZZA 4BFYA 4XH9B 5GVRA 2QGNA 3QVVA 4IOLA 5KUTA 2KB0A 1Z6YA 3OEHD 5JWOA 3W3AA 5E7JA 1JPNA 2F1RA 5E95A 721PA 2OE2A 5JHGB 5FPHA 1USPA 5KDOA 1S4QA 4ZPXA 2IYYA 2NZJA 3E1SA 4TSFA 4V0LA 3T1YC 1CJUC 1NBME 1OXUA 1ZUHA 4IKEA 3GJ3A 5KDLA 1XJCA 2P67A 2RGDA 1NJGA 2BMDA 2WWWA 2WSSA 1P2TA 5KSOA 2WBLC 3EZFA 5FUVA 1X8JA 4FMCF 2WHXA 3H2YA 3W90A 3W8NA 1KI4A 4Q66C 1P2SA 4RD6A 5LD2C 1P2VA 3EC1A 2EFGA 2O52A 3B7GA 1SHZA 1KSGA 3WNCA 4AD8A 1HR0C 4LHWA 3RC8A 4Z1MA 4JI0C 1KO7A 2Q6TA 2DB3A 2D7DA 1GOTA 3GCGA 3GLGB 3PENA 2JAQA 1KK2A 3NHBA 5G53C 4R98A 3W6PA 3ZYCA 4CEIB 2QPOA 4PPGA 1OHHA 3W5IA 2OPLB 2AXPA 1GUAA 1EWRA 3ADBA 1TQ2A 3SHWA 5C2JB 2K5UA 1E9SA 3GLFB 2IF2A 3FMOB 2CK3A 2CHQA 4TLBA 4OHYA 1IBLC 1Z6AA 2ATWA 1ANKA 4YLGA 4DHEA 4M4SA 2XJ9A 2Q3FA 3TBKA 4E03A 2O8CA 4YXWD 1N0UA 3LNCA 3PG5A 3WNBA 3ICEA 5FTKA 2O8FA 5HZKA 1XNRC 3OZXA 4DLRA 2LCFA 3EZ2A 2JIZD 3T1HC 4P4SB 3EERA 3VMFA 2ZYWX 3KL4A 3PUXA 4RFSA 3UMRA 3FB4A 1NL3A 5HTKA 1E2IA 8OHMA 1E0JA 1PLLA 3Q5DA 2QSZA 3CF6R 4A4DA 3RSLA 1AA9A 4GPTA 1KI7A 1ZM3A 4NXMC 3SYKA 3T15A 1VHTA 4E09A 2N42A 4DSOA 3F0TA 3T5GA 4OI0A 2XSZD 4D6PA 3FKSD 1IM2A 2V54A 3CB4A 4UNNA 2W2XA 2Z6VA 1AGRA 3THWA 2YWGA 2OLJA 5EZ5A 3TQFA 4TMXA 1FUKA 2ZR0A 4TQAA 3X1WA 2ZJ2A 2NG1A 1E4YA 2ZRLA 3I1FA 4QFMA 2GAOA 1SGWA 3T35A 3NH9A 3TSWA 5IRCD 4PPQA 2FG5A 1W5SA 1XCPA 4D4MA 4MUAA 5JCZA 4MTNA 1GDDA 2GEUA 1OE0A 4JT4A 4A2PA 1NVXQ 2BCJQ 5C4GB 5IDVA 2VH5R 4PO1A 2C78A 2FPLA 2JLZA 5BYJA 2VF8A 3L0OA 1ZM2A 4LF5C 2ZI9A 3LAWA 1UEJA 4NPHA 3B9QA 3BH0A 3PV0A 4LC1A 2FSFA 1KGDA 1JQJC 1R2QA 3C15C 3RNLA 3WHLA 4Q9LA 1JJ7A 1C9KA 1J70A 1OPXA 4OQNA 4IVRA 4JVSB 1R10A 3WMEA 4F38A 2NO0A 2HDNB 2B6HA 3KXKA 2GXSA 5KDDA 4TT3A 2KZFA 4M9SA 2OCYC 4CEJA 3EWSA 5CJPA 3ZZUA 1J7KA 5E7IA 3PVSA 1DBSA 3R9IA 3NEJA 3OAAD 3KJGA 4NP6A 2JLYA 4GKJC 4OQLA 2W2TA 3CKLA 4Q1AA 4CZ2A 1CR2A 3KFXA 3DMNA 5D3QA 4NCKA 2O8CB 2E8CA 1FP7A 4G5OA 4D0GA 2GXUA 1UM8A 4MKHA 5DN6D 4BFXA 4PHHA 3CPHA 2IXGA 2ANBA 4G5SA 1ZW6A 4WIAA 1XD2B 1LF5A 5EUMA 4B3GA 4DCVA 3E5HA 1JEEA 2I1VB 4Q4JA 1ESNA 1GFIA 5B2ZA 1FQKA 4DCNA 1A2BA 1WB9A 3LX5A 2O0KA 3C5CA 5G3ZA 1F2TA 4EJSC 3BFVA 3GLGA 1HNWC 1QHXA 1LF0A 2AXNA 3U44B 5ELXA 1S1CA 1OB2A 2QM7A 1TQ4A 1GKUB 2FJUA 4C0HA 2J7KA 3EW9A 2FDCA 3BOSA 2UUAC 1OSNA 4Q4AB 3HR7A 1X1SA 3K1JA 3NBYC 2REXB 1I2MA 1NRJB 4RZ2A 5G41A 4LJ7A 3ZQJA 4NMMA 1TEVA 4W5JA 1NI3A 3FKQA 3MJHA 4D82A 4BE7B 4DV0C 2YWHA 2GJKA 2ORIA 2HXSA 3NH6A 1ZIPA 5F9HA 3PUYA 3TQCA 4MYTA 3K9HA 1SVMA 2IYTA 2Q9AA 2B8TA 4HAUA 2ZE7A 1FX0B 2FU5C 4JL6A 4KITB 1D2EA 2ZRGA 4OBEA 4MQBA 4MGIR 2YHSA 2XXAA 2P6NA 4PTLA 4Q5IA 4CT4B 1VIYA 2R8RA 2ZJOA 4UXIA 1HNZC 2NOAA 2RB4A 3CRMA 3L0PA 2WIBA 4Y0VA 3RAPR 2WKRA 2EFCB 1R4AA 1US8B 3AV0B 4MRPA 3QBVA 2O8BB 2WWYA 3IIKA 2HV8A 4BZPA 3LH5A 3GLFA 2GCPA 3E2IA 3FGNA 4JLDA 4PSVA 2ZSFA 1TAGA 5BN3A 3OEEA 1UKEA 1XX6A 2OO7A 2OLKA 2QBYB 3WRYC 3L82B 1HNXC 2IEYA 1Z6GA 1E0SA 4C7OA 4HZUA 3MUFA 4JS0A 1Z0JA 2QQ0A 4M22A 4ZV4A 1COWD 4XVRA 4GT1A 5CIQA 5JI2E 1B23P 4NKRA 1MO6A 4CRWB 1MRNA 4BLQA 1D5CA 2A5YB 1M6NA 2P6UA 4HUTA 4NXNC 5B30A 1NNEA 4XSHA 2IWRA 4MGKR 1DO0A 1J5EC 4BFUA 1K5DA 4UJ3A 3T1OA 2VP9A 4OKSA 4CYMA 4XVUA 4ZCIA 1OW3B 2EQBA 4DV1C 4OK5A 4GMXA 5L3VA 3VKHA 2GZDA 2QL8A 1YZUA 5JWHA 1HY3A 3W6NA 4L16A 4JLOA 3R9WA 3C14C 4Q1EA 2DY1A 1QBKC 4BPBA 3IBGA 2RH5A 4I1OA 4S35A 3GPLA 5KNDA 4PZYA 5B57C 5DYIA 4JBYA 1L7VC 2W2VA 3QXSA 1MOZA 4PZLA 3FHOA 1GNRA 4TQ9A 3R8FA 1EXMA 4ZDJA 4JLNA 4RVCA 2J0UA 2RHMA 2VHTA 2OSBA 4G5RA 5CB6A 3B8HA 3QF4A 2CMKA 3CBQA 4GP7A 4FINA 2JLUA 2EWVA 3Q72A 4FIDA 4AG6A 2CLCX 3I3SR 1NLYA 4Q4HA 4RCZA 2ZI4A 1G8PA 2QY9A 1AIPA 1FMJA 3CX6A 3NC0C 1NMXA 4QC2A 2IW3A 4E07A 1WBDA 3UG6A 1IQPA 1Q1EA 2PCJA 4ARZA 4PHGA 3LY5A 1T3LA 2FZLA 3NG1A 2G88A 2VHJA 3AQ4A 4DLXA 2PT5A 4JLPA 4F93B 3IEUA 1U0LA 3SNHA 2O8EA 4BGDA 4JJZA 5FOSA 3BK7A 2D4HA 5B64A 3SE0A 4ZDIA 4DLTA 3AKEA 3O8CA 4Q03A 3K70D 3OIVA 1NP6A 1M1YE 1M7HA 5J47A 4ZKDA 2CJWB 3DZDA 1NVWQ 5GJCA 1B0UA 4FWIB 1U8AA 2OV2A 3NDPA 4HAWA 3J80D 4AG5A 3TNFA 4RCYA 4LPKA 2QTHA 4NHOA 4LF6C 1OFUX 5HE9A 4OHVA 2HEIA 2FZ4A 1NVVR 1E99A 3LQQA 2JLWA 4ITRC 3TJZA 4NL4H 5IT5A 1GM5A 4GOKA 1RJ9B 3VHLB 2PZEA 1P61B 2QI9C 3TIFA 3SBEA 3OHMA 3GLFE 1TQDA 1U9IA 2ODBA 4I1SA 2JDID 1W0JA 1E2LA 2GZHA 1M7GA 4LJ6A 1W49A 1HH4A 1ZUIA 5EE3A 4Q02A 3FKSA 4MKFA 4Q4AA 1MKYA 4C0LA 3G0HA 4IFEA 1S96A 1E9DA 4MITA 4GP6A 3SQXA 3NXSA 2F43A 1P3JA 1EFUA 4DDTA 2QAGC 4EPXA 3H86A 4ZIRB 3QOFA 1RZ3A 4FD2A 4TN1A 3N5CA 4CEHB 5K8IA 3MFYA 4ZCMA 4YMUA 1DELA 5KSZA 4PC6A 3AKDA 1GILA 4QBIA 1OH7A 1OFTA 3EZ7A 2XZPA 3M0EA 4JI1C 1E96A 1Z0KA 2ZRFA 5FI1B 1V5WA 3BAFA 1KDTA 1XTJA 3X1YA 1ZU5A 1DARA 2AWOA 1KY3A 5JS7A 4LV6A 4JLBA 4ABYA 1NYEA 221PA 4JKYA 3X2SA 2J3EA 5L8VA 2CCKA 1UBCA 2VIIA 4QRHA 1Z8FA 2NO1A 5AUQA 2BM1A 4UQOA 1Q1QA 4CF7A 3ZVMA 2Z43A 2D74A 4P4UA 1UKVY 1KTVA 1M7BA 2W6ID 1S3GA 2W0SA 5HCNA 2QQEA 2YOFA 2B7CA 2C98A 2ZANA 4N3NA 4G1UC 4TL9A 3RRZA 2A5GA 4AWXA 4HB0A 3IQWA 2O0HA 3TUZC 4OYHA 4RJLA 4PAMA 3SJCA 5C18A 1IOZA 2F3TA 5KNCA 1WQ1R 1CTQA 2VHQA 3LFUA 4L15A 4WXRA 5EQTA 1AS0A 2FSHA 1OIVA 2FF7A 5ANRB 1CRQA 3K09C 5KSPA 3AKCA 4DLYA 2HXYA 1EK0A 1X8KA 4DV2C 1SZPA 2XX3A 4HLUC 2HLDA 4B3BA 1U8YA 3Q85A 5GJVC 3GFTA 3QY0A 4X8OA 2H1LA 3THYB 1MH1A 1CULC 4X8HA 4M9XA 1NIJA 5FPTA 1Z29A 4UXHA 1G4UR 2OEPA 3B78A 1Z28A 3MWJA 3SHFA 1JR3D 1KI3A 4JBWA 1YR8A 5DSZA 2AK3A 4XD7D 5L3QB 1XU4A 1RYFA 5J4VA 3QXXA 4LF7C 1N6HA 2JJ8A 1NIPA 1RIFA 2F6RA 3D31A 4PO9A 2EFEB 4TLAA 3ZQ6A 3AF6A 1Z63A 2BJVA 1E2PA 3U3OA 1CXZA 3AF4A 3SBDA 2IUSA 3WY9A 1U98A 1O3YA 5BWMA 1IN7A 3RS5A 3ZJYA 3GJ5A 2HCBA 4DDUA 4GNKA 1G9XA 3O8RA 4AYWA 3FYHA 821PA 2A78A 4EUNA 3MJRA 3ZS9A 2JJ2D 1WP9A 2P3SA 3Q8XB 2JLSA 2WJYA 3CLVA 2IHYA 1BIFA 1T6NA 2RGCA 2SHKA 3OE7D 4QOSA 3FMIA 2C5LA 3TW4A 5KYKA 2IS4A 4NBSA 1SXJD 1P9WA 2D2EA 2J46A 3AF2A 1Q1BA 1IJFA 2G83A 3A1VA 3BXZA 3R7WA 1ZJ6A 2E7GA 1TQ6A 2WAXA 1KKGA 1W0KA 3GFOA 2ZQ5A 3H84A 4XTCS 4YMWA 4W7SA 2XNDA 2W0MA 5F98A 4PHTA 1Z0IA 4AURA 4II7A 4TTQA 1A4RA 3GQBA 4GOXA 1GAJA 3CZPA 1EFTA 4KU4A 4B3FX 3A1TA 1RRCA 4C0KA 4TZ0A 5SZJA 4TL7A 4EJSB 2BJWA 2WV9A 2CHVA 2GCNA 3I8XA 3U60B 1F2UA 1RRGA 2DR3A 3QKRA 3LLUA 1M2OB 1E2QA 1N6KA 1X6VA 4US2R 2KWIA 3W6OA 2J87A 1L2TA 2IUTA 5GADl 3GLGE 3G82C 3WBJA 4I81A 4U00A 2VP6A 4JI4C 1W4RA 3QXHA 2G9NA 5KO2A 3GJ4A 3AP3A 4OQMA 4OJQA 5DI9A 5DO9A 5JS8A 1XCGB 3I73A 1OF1A 5KU1A 4HEJA 1XPUA 2A30A 4JSYA 5C1BA 1DVRA 1XTRA 2GXAA 1HYQA 2DBYA 3J81D 1XDBA 3THXB 4G01B 3QENA 1N6PA 3KX2A 4D0LB 2P0EA 1YZTA 1DAHA 1NSFA 2VBCA 2ZS8A 2ODEA 4JI2C 1OXSC 3CX7A 5FFMA 4A1FA 1TX4B 1WF3A 2ZTSA 1T0HB 1D2MA 1GWNA 1KY2A 1YZGA 3ZVLA 4ERNA 4R9UC 3W9YA 5EXPA 1W0JD 2JA1A 2PCLA 4ASUD 3SI7A 1UEIA 4B74A 1QZXA 1G8YA 1SVSA 1KIMA 1GZSA 2ZRAA 4DB4A 3B1XA 1RPZA 1VECA 3GJ0A 5CLLA 2QTFA 2WWHA 3CWZA 3U6KA 1Z0FA 4URUR 1OYWA 4F4JA 3B1ZA 3U3RA 4FMDB 2VSOA 4ZDKA 4D2IA 2WTUA 2V7QA 1QWIA 4PQYA 1GSIA
chains in the Genus database with same CATH superfamily
3JD4A 1HG1A 5KQPA 3JAMD 4TYNA 2EG9A 1G5HA 2LDBA 3C3BA 3OT1B 4NU5A 4JP3A 5GIOE 3RHSA 1H6AA 3RIMA 3U3KA 4H1TA 4BV9A 2UU9C 2FW1A 2I54A 3O0DA 4AJPA 1C1YA 1E66A 2FZCA 3O8OA 1KQGA 1SXIA 1F7UA 3OPYI 3CX4A 1O96B 2R751 2J4DA 5CU7A 2CT8A 1ZRHA 2W98A 3EFEA 3EBOA 3K8ZA 4KAJA 3FY4A 4O4LB 1I13A 1RKBA 2RHJA 2G08A 4XW2A 2VJLA 3L0IB 4AZWA 5IVPA 4D41A 3U16A 3D81A 3DGEC 4R9VA 3HGMA 3WKAA 4BMXA 3KT6A 3WLKX 4C6TB 3E7WA 4KLCA 4S12A 3WDLA 2WP0A 5JC8A 2A9RA 1EIWA 1AMNA 1FQWA 1F2TB 1ODSA 2OFXA 4I5FA 3VPDA 1H2AS 5E6RB 3T9CA 1EH5A 5F9MA 3U3XA 1Y6GA 3EPLA 3EIUA 4NY1A 4E0BA 5CJ2A 1TU0A 3GRAA 4KRGA 3MGBA 2W71A 4BN5A 3GR6A 2VA8A 5AJYA 4C3ZA 1QHNA 3HP1A 4KVFA 5B53A 4QOHA 2OG2A 1DAFA 2WUEA 3BFJA 4OAQA 5EHNA 4CT0A 2JW5A 3B85A 5F52A 4Q9HA 1C0KA 4JWTA 1NF3A 3DVSX 3ORRA 3WLLA 2C03A 4B4OA 4PGFA 1W44A 1XB2A 5LZ9A 1IY1A 3T0IA 5JWRA 1HKUA 3GEDA 2G25A 1UWCA 4LYGA 4DS3A 2ZJ6A 3Q6MA 1DWPA 2JFWA 1CUBA 2FHSA 5TMBA 3X0DA 3AEQA 1Z6ZA 3OSUA 2XSZA 1DTEA 1K8ZB 1M8FA 3I34X 3NRCA 4OLHA 5F2KA 1WZUA 3IQIX 2WW8A 4L9SA 4A73A 4GBED 5HIKA 5K8FA 3IP8A 4I5GA 4U7DA 2PSEA 2Q29A 1M72A 1HL7A 1Z75A 1JLSA 1LB1B 1NRXA 1OI3A 2GTIA 3G2NA 1GL9B 3LC0A 3VR4A 1VIVA 1Q1NA 2ZYVX 2YRWA 3DHEA 4IIVA 4MTCA 3NTRA 2HBRA 1C1XB 1KO4A 3EMDA 4LV8B 3C4QA 4M0MA 4L4SA 4I4LA 5F7XA 1SVKA 4QGBA 4QGHA 1VJTA 3JPWA 1M54A 4WK2B 1ATIA 1R5NA 2D8MA 1WM1A 2WZCA 3OT1A 1HBJA 4B2IA 2IZ1A 3N3BC 1K92A 1QCYA 4XE5A 4ZANA 3SZ3A 4UNRA 3EXIA 2QUJA 4J03A 2QQFA 4KQWA 3WYGA 1C9EA 4FTFA 4G0XA 4K1XA 3O8BA 5BT9A 5L40A 3EWAA 1E3MA 3GA5A 3KOUA 4H60A 1RI5A 4WA8A 1ODIA 1UINA 5JCOA 1W34A 4ZREA 2A94A 2EEPA 4KO8A 1ZSVA 3KL2A 1NVVQ 1XFDA 3FAKA 3KKMA 5G40A 2WJPA 4WE3A 5LSAA 3SS7X 4B40A 2ZM5A 4RPJA 2HSJA 3GK3A 3CN9A 1QH8A 3OJEA 3ITEA 2C1EA 4FCCA 2IKQA 4H7JA 3FIUA 4MUEA 1LQUA 1UFOA 2N3ZA 3N2ZB 4QQ8A 1YD7A 3CVOA 3EEQA 4RK0A 5E1DA 3NIBA 4UVEA 5TIIA 3OKFA 4YMTA 4L8WB 4ETMA 1BE8A 5LBTA 1TEZA 3VH1A 2G17A 5HCIA 3D3KA 2QW0X 4QFBA 2REQB 4TMWA 1RWMA 4UUQA 1U9JA 4E30A 3MHPA 1RWXA 5LLTA 3HJAA 3WJ7A 5KNDD 1EX7A 4Q82A 3O4VA 1W2WB 5JBNA 3I1JA 5DLYA 3COSA 2BL4A 4QT4A 2VTVA 3F78A 2IYRA 1MX9A 1XD8A 3DBLB 5DMHA 4A2WA 1J25A 3OCVA 1DAOA 3CR8A 3DMPA 4U5XA 3CRVA 4DDVA 3QJYA 5HSGA 2YQ4A 3PVZA 1P1KA 2FK8A 4FFOA 3LUPA 4P92A 4Z7JA 5K09A 1A7KA 3L18A 1OI4A 3F7NA 2B20A 2IBSA 2TRSB 1RBMA 2EFYA 4B7UA 4E3ZA 2NU7A 3JR7A 4L3VA 2JPDA 4UUNA 5JIBA 1WXWA 3TGLA 2GPNA 4AKHA 1Z73A 1MQ9A 2HQRA 3DQZA 5BP7A 5GZ1A 1J7JA 1WDMA 1K5GA 3FM9A 3IQHX 3C98A 4JVLA 1IBSA 1Q0UA 4LSMA 4M7RA 4Q3BA 3OLZA 2VQEB 1EHCA 4I9GA 3JRXA 2FPMA 2W6IA 1Y8QB 3BXHA 4RZUA 3B2EA 2W42A 2O7VA 2Z4SA 1KAHA 3BWVA 4F97A 4CV0A 3ZGNA 2LBPA 5TARA 1SOWA 2JJ2A 4ZRDA 1SC6A 4W1SA 1N6NA 1DLJA 4XTRA 1AXEA 2P2SA 5KMGA 1U7DA 2P6RA 1VE1A 5CFNA 3B2QA 4D6YA 3ESXA 3Q9LA 5IVIA 4F3RA 2CKDA 4ZOAA 4IIHA 1NF9A 3G2OA 1KYXA 1Y4ZA 3WNQA 1HSOA 3KXPA 3MF4A 4DHWA 1Y1KE 4LK3A 3Q8KA 3UK6A 3CISA 4IDCA 1W8DA 5B58C 1BJTA 4AFNA 4IHJB 3QE0A 4MZXA 2XMZA 3KSRA 4YRMA 1CB0A 1OLUA 2BWJA 4EQ6B 4QM6A 2HLDD 2VDLB 4MCIA 4COOA 3KQQA 3MYRA 2HTFA 4FILA 2WKQA 1A9XB 2FFHA 2QVCA 1NN1A 4QXRA 4AAYA 1CZKA 4TTSA 1PAUA 1AHHA 2PX3A 4DJ5X 1CRPA 2HCTA 1TVKA 3JYQA 1QHEA 4IJVA 3RSSA 1NM5A 3KQSA 2A3NA 4MLDA 4TRJA 4L4RA 5IT4A 3AH8A 3GRUA 2HF8A 4C01A 3U40A 4NXNB 5K01A 3EG5A 1Z35A 3B5JA 3P0FA 3DB1A 3LMKA 4MPPA 2Y1LA 4KBGA 4M53A 4I36A 4C7OB 4FJ1A 2EV9A 2DFTA 3GAMA 2B0JA 4ZI7F 4QYSA 3THYA 1MBZA 3OBIA 4P54A 1FNBA 4I55F 4XFDA 3E03A 4KWCA 5FNVF 2XYHA 3N2NA 1BOOA 1XWWA 3OFNA 4ITVA 4KAAA 1Y3BE 2IIQA 2FX3A 1I5OA 2BP7A 2WA2A 3P32A 3QLUC 4N7JA 4TS1A 1X38A 5E1MA 4B3SB 2HL6A 3K0EA 1C0IA 4DJTA 3NTUA 3D0KA 5K3BA 3AC0A 9LDTA 4BXOA 5K6AC 1JIXA 2GOYA 1BDHA 4QA9A 4ZI5A 3OLXA 4EYOA 3L7DA 2A5FA 1Y6QA 2BVNA 1OLOA 1KTIA 2VPIA 3A6KA 4BO7A 5K8UA 2I6TA 3N7UA 2ZXUA 3ILHA 2D5AA 3CPJB 2CXQA 4IFTA 4CMJA 3DMTA 4V24A 2GESA 5JATA 1QK3A 1HE5A 1N3YA 3KLOA 1L5SA 1N7GA 3E58A 3MRSA 3GDFA 4BRZA 5KOHA 1S4MA 4ZTZB 4D9GA 1Q14A 1ZB8A 5JXWA 2QW1A 2A9KA 4HWPA 1QHSA 3V1MA 4GRDA 4IDBA 3AR9A 5C1IA 4WLOA 5ES3A 4LCBA 3UK0A 5B64A 3CLHA 4X54A 4GLFA 1A5ZA 1U1FA 3MCUA 4L8FA 1CP2A 2IYUA 2O4CA 4MVCA 2G77B 4KVAA 4F3KA 1QQ5A 1LS6A 4K0RA 1JALA 1M5UA 2ZRIA 4FGKA 1LDNA 2Q3HA 1V26A 5IWAC 2C83A 2OCBA 3LXUX 1GT6A 1ZD4A 2P0AA 4OGFA 3UKJA 2K6GA 3C7CB 3CIOA 4JEMA 1NGSA 2ID9A 1H4SA 2WHPA 3CX8A 1J0DA 3T12A 3WQSB 1ML8A 4Z6KA 2WTXA 3B5EA 1RYHA 4XDYA 4S1WA 2A9OA 3WK6A 4EF4A 5FNVB 5BVGB 1HRDA 3CG4A 5F5NA 2WHYA 4CIXA 5DI3A 3GD7A 3BE8A 4CGZA 3WAJA 2VTBB 3UOGA 1JDUA 3CINA 1S7GA 1ZVJA 1E0AA 3DHNA 2X2FA 1C1HA 5BPHA 4HZUB 1OIXA 1V1MA 4AMVA 5BUZA 3AERA 1VCHA 2G07A 3QLVA 4K8OA 4MGZR 1J8QA 1E1DA 1PJCA 3C74A 1XZBA 4ONEA 3OFKA 1F0KA 2JHGA 1WVIA 2RC5A 1ZD1A 1YZLA 2QPLA 3RIHA 3GLHB 3CRQA 2ZTVA 5DKFA 3M81A 3AVWA 2JD0A 5G4LA 2J3QA 1LPOA 2V6IA 3IOBA 4EFNA 1DIOB 1GEEA 1EVLA 1TKCA 1XRMA 3A4NA 3DTVA 3L0CA 4WGGA 4N5DA 3NHUA 4KYIB 3QKTA 2YH2A 5EFZA 4CR7A 4C89A 4WTOA 1U3TA 1SCUA 1R8YA 3JCZA 3DLHA 1CWUA 4GX5A 1Z38A 1P1IA 1NATA 1V8BA 2GF0A 1U7WA 2HRBA 2QE7D 4OGKA 4YI3A 2UYYA 5IJ0B 3OTWA 4KFRA 5HRUA 5FOUA 4DJJA 1Q5PA 3IGFA 4NNOA 3OPMA 4NBKA 2ID8A 1VMEA 4WBNB 1PJRA 2ZSAA 4HDMB 3EGCA 4FFNA 5K3DA 2NU8A 4EITA 4AZTA 1DADA 1LBHA 5BUQA 2QL6A 1IXZA 3CONA 2PX2A 4P3YA 2DCMA 5FO0A 3Q2KA 1WV1A 2IE0A 1TM7E 2PR7A 4UVGA 1M2EA 1SOVA 1SZCA 3SKXA 4FKBA 2XTNA 1GPH1 4G2TA 1NBWB 1JFFB 4EYSA 1SVWA 1OROA 5B4VA 4DMUB 1JQBA 1KSHA 4WOBA 4NQZA 1QLJA 3CPSA 3LDAA 1KGSA 3C3WA 4PLVA 5EZYA 3X1DA 2W22A 4QTZA 1E7YA 4KQ2A 5A6VA 2D54A 2P1DA 1RQ2A 3RVDA 1TECE 1YRBA 3A8TA 3DV9A 3H7IA 3OIWA 4EG4A 5A9SB 1WMFA 1XZJA 2HH9A 1PG2A 1Y81A 1Z3IX 3I5MA 3F2VA 3VR4D 2WVAA 4EEKA 3C3XA 1Z06A 3PFBA 4P58A 3IPRA 4Q4CA 5BSFA 3HRIA 1KPIA 1I24A 4QODA 1NW5A 1T26A 4F6RA 5I4IA 3IBFA 1K6IA 3EIEA 4PIVA 3WB2A 2VPXA 4GKKB 3HWSA 1F3OA 4BTEA 2EBWA 1G7RA 2XUIA 3W2HA 3M1YA 3WMEA 2AFHE 3KP1A 4NESA 4PFJA 1H05A 1WVGA 4YREA 3ZS8A 4DR5B 4RYLA 3BBPA 1UPFA 2AS0A 3P52A 5KNLA 3CJEA 1IZ0A 4HPWA 4LYYA 5FO1A 5K0ZA 3GFGA 2DERA 3I9LA 2ACVA 1VG8A 3L7IA 3QKUA 4HNSA 1KZ1A 2RIRA 3EAGA 3L8MA 3W5CA 2I7DA 3TS1A 2AEJA 4XYMA 4YP1A 3A4YA 4YJHB 3RUPA 1SA0A 2JNVA 2C5GA 2KZ0A 1NI5A 2VAMA 3RU3A 3VBCA 3VTFA 4A26A 5JAHA 4HZIA 2UDPA 4MB0A 4IWXA 4IWNA 4R1LA 4K6HA 4XVCA 2ILTA 4LZOA 4XYBA 4JOCA 1RE1A 1XLVA 2C2MA 4BO5A 4AKIA 4P98A 4J0KA 4GZ5A 1OFUA 4WCVA 3SF0A 4EHFA 4MDYA 3JZFA 2FA9A 2ZB3A 4JITA 3OMLA 4RKEA 1VBKA 4UAVA 3W04A 1ZK3A 1H6DA 2PBLA 2WIDA 4P4GA 5I9MA 1GTSA 3DBRA 4RKYA 4B3MC 2VHYA 1XJQA 4OI2A 3RS4A 3U7EB 3TLZA 1U9YA 1O1YA 5ALGA 3QMVA 3IBTA 4HGYA 2CVFA 3LBHA 3E4DA 3OQOA 1HSZA 4FIZA 4BB0A 2WJGA 3NBZC 3FNBA 4BO9A 4NMHA 4EG8A 1P5ZB 3UTDA 4B73A 1X1BA 4KHPB 3Q8LA 3TX2A 1BDBA 3B7WA 1IDN1 4L6CA 4QGGA 2GTHA 4R7TA 4LDQA 1D03A 1YUMA 2MSNA 3TDKA 4EOGA 3VNUA 1NU6A 3UQYS 4EHJA 6YASA 5FWNA 2EVWX 4HTAA 2ZRCA 2Y1CA 1CK4A 5D1NA 4N76A 2JCVA 1JOSA 2P02A 1WLYA 1E5VA 1KXJA 3EZXA 4JQZA 2HDHA 4EL0A 3VPFA 2AW5A 1NBEA 3C97A 1WU7A 2BONA 3TIGA 1RJEA 3OZCA 5FRDA 4D1YA 1ZB9A 1N75A 1V5GA 4B3CA 1NA5A 7ABPA 4BO0A 4JXZA 1UBNA 1GPDG 3JRWA 4BRUA 2ZRNA 3NXKA 3FTDA 4B6JA 3GEBA 4ETIA 4BNNA 3NCHA 2VWGA 1QDEA 3FYCA 1W4CA 4B75A 3P26A 4RK4A 1VZ3A 2EKBA 2FFBA 2HEGA 1YU6A 4LRWA 2GRAA 4PGHA 4E12A 3D6UA 5LU9A 3WB0A 2BI7A 5DHUA 1JDVA 2OHIA 2UVPA 1U3VA 1VM6A 3NKVA 3H2SA 5JAOA 3LLMA 3EOAI 1RVV1 4KI7A 3P9IA 4OEHA 4XCQA 5H83A 3I0MA 4RHCA 1OT5A 1U4NA 3K0CC 4M8LA 4TVOA 3N2QA 3MMNA 5K6AA 2IUEA 3MWEA 1SXJA 4HKTA 4OOEA 1RPJA 1Y0BA 2JJ1A 3OLCX 3ICQB 3AR8A 4G0YA 4BNFA 1OGJA 3KVYA 1TVEA 4QAJA 5TV2A 4KXXA 5EPEA 3GHYA 4RIGA 4EZIA 2ZUUA 2II6A 2QNIA 5AFSA 5A9RA 2DBZA 2OGSA 2Y1EA 5LIRA 4BVKA 2H1OA 1KI1A 1X3SA 4MR9B 4UUOA 3A58B 1V3UA 2JGEA 2B8NA 4IHKA 5HIMA 1DAGA 2IXTA 3PTAA 3MG9A 1ORRA 3LM8A 3K0SA 1JH8A 2HN9A 3LA6A 1G3RA 3R4VA 1U04A 1UBOS 4AYXA 4B9EA 3AUXA 2L0XA 4O4IF 1D4AA 1TKRA 2W2LA 1DQPA 4N0PA 1N33B 5JQGF 1JDTA 2ZE5A 3HDTA 1U81A 3C1OA 3CVJA 3PQCA 3C87A 3TRHA 1JQEA 1WUJS 1JR4A 2NVOA 1EINA 4QJBA 4YPFA 3OQMA 2X7JA 5IAAA 2WUWE 1JKJA 5J1TB 5FEUA 3DWIA 2R6DA 3AM4A 2SCUA 1PEAA 3NM4A 4QJIA 4L0DA 1L7QA 4MR8B 3WP1B 2H5LA 3KKNA 2EQ5A 4C9BA 1WE2A 1NFQA 4F5DA 3ZHQA 1YE8A 3GEGA 3Q6IA 3IJEB 4QNMA 4W63A 2ZRHA 1RS0A 2GD6A 4K46A 4PPNA 3RS7A 1WMBA 4M7WA 2RBEA 5CD9A 1NQAO 2O6HA 3GL9A 4PO8A 1ZUWA 1YVDA 3KHUA 1HEYA 3QOWA 1FDSA 3BVPA 1LPMA 4FJ0A 4I1IA 4LS3A 2ECKA 2Q2OA 1UK8A 5FUWA 2IY8A 2TMKA 3PNQA 1GFSA 4WKBA 3UJ9A 1KORA 3DMHA 1MO4A 4YRFA 2Y27A 3L8CA 4IDPA 4YAGA 16PKA 3KNZA 3C4JA 1SN7A 4DNQA 2AFIB 3OO1A 1WBJB 1YS4A 2G8NA 2ZUDA 2AHRA 5IF9A 2WPDA 4OAPA 3MWDB 2NZ8A 4D4LA 4JI3C 4QXQA 3W78A 4A2CA 1L5WA 4NMLA 4WLUA 5D5PA 4C2TA 1FTWA 3KAPA 1NXOA 3IP5A 2P2NA 1V3QE 3B48A 4BLRA 3AFHA 3IS3A 1LVHA 1TZMA 3OTIA 2LVBA 4J4HA 3K4PA 1P9RA 1GZ6A 3GIWA 1V3VA 4IEFB 1O5OA 4L5AA 4KV7A 3BXXA 3EEOA 3VR3A 5AJXA 1CE8A 4IIUA 3X1XA 4AIRA 4QBGB 2VKQA 3DEIA 1WA5A 2PMDA 4JZYA 3F6CA 3AEKA 4TXJA 1E9RA 1E3IA 1NI4B 1JIJA 1P91A 1UOEA 1XKLA 2VNIA 4IKPA 4K6OA 3AHIA 2GEFA 3B6JA 3LI2A 2OD9A 4DR1C 3MCWA 1U8ZA 1ORIA 2FSSA 1UDXA 3JYHA 4XARA 4XM2A 2P41A 5FF9A 5IBRA 4NBWA 4XX0B 5D7NA 4DMCA 1BWPA 1IXYA 2XYGA 4ZO7A 3HRKA 2H8GA 4HOYA 3GARA 3WIVA 1ODTC 1Z33A 3RB8A 4EZBA 1XRRA 5KHLB 1HK7A 3FRHA 2Z58A 4CM3A 4UDXX 5FNZA 4Y18A 3LF1A 5KYXB 4K9MA 3CR3C 3L4SO 1C7EA 4R1UA 2AZXA 1FVXA 1SBZA 3BQNB 4X1YA 4D9BA 2LGJA 4WX2B 2E8EA 4DV3C 2VJQA 2C9OA 2ZUSA 4FFPA 3HCPA 3EQ7A 5EJ6A 1DIAA 1XQXA 2AI3A 1NYLA 2XOKA 2GLUA 3ZDXB 4I19A 3A6LA 2HRRA 3LWZA 2UYQA 5AK0A 5AM1A 4WD3A 1YQWA 4X95A 2A86A 4B1FA 3RFFA 2IX9A 3QVWA 2FLWA 1TW3A 2VDUE 2P27A 1Y63A 2XJ4A 2XMCA 3PTZA 3HB7A 5JSYA 1DL5A 1UCFA 2GPWA 3UMGA 3L41A 3LOQA 1E3WA 1U2DA 4BFCA 4UNIA 3JATB 4GI7A 5TB5A 1A8HA 1U5BB 3NHKA 3TNLA 1PVOA 2ZYGA 4LRXA 1OC2A 3TI9A 1E5DA 4G5GA 1IM8A 4LOJA 1RHQA 3MWLA 3CZAA 3TOXA 1I1OA 1QYIA 4ZVMA 1H69A 3RUFA 1G5QA 1T9BA 2HKIA 2VAVA 2ZVDA 3LSYA 4RK6A 1QKJA 3T61A 4D8TA 1DWOA 2ZUCA 3BE4A 5INTA 5L3RA 2XB9A 2ZDGA 4L27A 4G36A 3H11A 3RK0A 3GGCA 1CS4C 1R0XA 4KX3A 1JWAB 1AKQA 5GPBA 1YL7A 3UPUA 2Z6AA 4DAOA 4GGOA 3T1TA 5I8WA 4FBGA 4FFBA 3QBDA 2XMBA 3B82A 4CEIA 3TF5A 2HHLA 3T99A 4BX3A 2P68A 3BGIA 2AFVA 3ZK7A 1IN8A 1XXHA 2XIQA 4Q37A 4U2FA 4UPVA 2CXSA 3RSFA 3ACBA 4DJDC 5FOWA 3GZJA 3ZHVA 1BNCA 4CLXA 3W8RA 2AR7A 4O4HF 5KYGA 2H1WA 4X00A 4FE3A 3DW1X 1A9RA 3KCQA 4KNYA 1TPZA 2DFPA 2IYZA 2OORA 3A9WA 3X1JA 3ETHA 3BIOA 4LX0A 4KX5A 1DIHA 2Z9DA 4GPD1 3SLKA 1KVUA 2WOOA 3W77A 3RNOA 3A4TA 5DLQC 5HS4A 5KCZA 5JSHA 1DRJA 3QEBZ 4O02B 2JVIA 1IN6A 4JLMA 4OSPA 1YQQA 2GCOB 3L49A 1SULA 4KRYA 1UPTA 2ZJZA 2YWFA 2WNSA 3MB8A 3OX4A 1I3OA 2CL7X 1PZEA 2OFOA 3BN3A 4JUFA 4RESA 2ZYIA 2BHTA 2HMAA 2GVNA 3BWMA 1TXGA 1QC5A 1WEHA 4M9CA 1WBBA 3GF4A 4W9RA 4JSTA 4M6WB 4R0NA 4B6SA 1YH3A 4LMBA 1DEKA 4OYLA 1NF2A 1EGAA 2OHHA 3RSQA 1BJRE 1NUSA 3M1AA 3O84A 2Q46A 2VZEA 1P29A 3CGWA 4ATNA 4R40A 1W48A 4B76A 3QNMA 4TYPA 4G67A 4DWJA 1R4MA 2A0YA 1LFAA 4TWAA 1H94A 4LCJA 5DIFA 5EWLB 1TC1A 4RY9A 5EAIA 1Q7CA 2EJTA 5EHXA 1RLIA 3AEKB 3IRVA 1P1CA 3P94A 1POWA 2H1FA 1MGOA 3VGPA 2G5TA 3LTNC 4DTIA 3OURA 3GXOA 1S3SA 3AOGA 3T38A 3WIOA 4AZ3B 1E61A 3SWWA 2RE8A 1KQOA 5KBYA 4NENB 2WMYA 5AP9A 4XWKA 1VE9A 1K2VN 1YZKA 1SC3A 2GSWA 2H1SA 2ZSDA 1EUCB 1OFVA 1TEXA 2OBYA 1XMIA 4LYFA 3MS4A 1XKTA 4F2GA 3PROC 3AG5A 2HGZA 2WQZA 2X9NA 4FE7A 4NK4A 1KSJA 5IHXA 2VJAA 4YQYA 4A9AA 5JRJA 1GTVA 2Y8EA 3H5RA 1VJ1A 2GM3A 4I8DA 2PBZA 2FR8A 4MI9A 4EM6A 3RTDA 4YCSA 3T0FA 1FSSA 3GROA 4M1QA 2R79A 4JUAA 1XA0A 4Z99A 2AOXA 2CMDA 3EXAA 2GSDA 3DXZA 1WUHS 1PX0A 3EWNA 4HH0A 4NAHA 4QSHA 5L53A 4ID3A 1Z7YA 5DI3B 2OUKA 1GKYA 5BVGA 3DC2A 2ZJ5A 1QO0A 4EGSA 4M87A 1X42A 1XCJA 3E70C 2OO5A 5EJAA 1DEOA 4RHFA 1IHUA 5EE0A 4IICA 5DBFA 5CA1A 1CUGA 5IWCA 3DDNA 3ZBUA 3GIDA 4D02A 2ZCUA 3E2PA 3M4YA 4YO7A 4PZ9A 2WWGA 2WHQA 3PRYA 3X1MA 5DNAA 5GZ3A 3L6EA 1U8TA 1WMAA 3CQ9A 3F3KA 2VN8A 3W5SA 4F4FA 1FTSA 1P19A 3ECSA 2YL2A 5JO9A 4Q7EA 3WQBA 4D5EA 3RG2A 4Q7KA 4NI5A 2H07A 2A9VA 2QMUA 1UBMS 1DKOA 4NOKA 1W9MA 1ZK4A 4QOFA 3F49S 3H5LA 2VJMB 4RPCA 3UXYA 4B0PA 2WEKA 4CF4A 5I6DA 1HH2P 4QJ5A 1O6ZA 2VDVE 3ET4A 4U3JA 4XFKA 4YQFA 1E1NA 5L3SB 4W5TA 2X0IA 4M3NA 1P2DA 4M1TA 3EZLA 3I72A 5GZ6A 1WY7A 4YUZA 4LJYA 2ZBVA 1QANA 3OIFA 4I1RA 4P86A 3QSGA 1GG5A 2C88A 4H6XA 4NG4A 2FGJA 4YAEA 1VDMA 3W3ZB 3RGGA 4BP1A 1PR5A 1KXZA 3LK6A 1ZL2A 1QAMA 4Q3CA 5JMWA 2AKEA 4QHSA 5H70A 5J2UB 1QMPA 4J2OA 1NJ1A 4UHFA 4V1CB 3NI2A 1AX9A 1QX3A 5E9JA 2FVXA 1P6UA 1UKCA 3MWEB 1C30A 1XRSB 2D8AA 4AXBA 4C4OA 1TKBA 2OCXA 2WFMA 4GICA 3TVYA 4E5VA 2QZSA 2YY6A 1WCXA 3G88A 4MA0A 4CFSA 3OLQA 1RWBA 2I62A 3QPAA 4N0MA 1K86A 2XUDA 5E9AA 3BORA 3UMFA 4L5IA 3H2GA 2PM8A 3ZD7A 2YFKA 3LU1A 1ZM9A 5EHZA 3VO8A 4G1EB 3RRJA 4Z9XA 3UJ6A 1K7XB 2X40A 2PYDA 3MERA 3QEJA 5L3QA 3OIGA 3VHRA 3L6BA 5J63A 4B2PA 5I7WA 2C59A 4QPCA 3GHHA 1FX1A 1ZN9A 1MA0A 3SQMA 1OLSA 4RD3A 4ZGWA 3OX1A 4GWGA 2GBLA 4JJ7A 5D1HA 5BYBA 3O4HA 3TJRA 4ZEOA 2KS6A 2ODWA 4FHZA 4LMAA 4MH0R 5F3WB 4A36A 2C9CA 2G6TA 4QJ3A 4GWLA 3OQIA 1YIDA 5ESXA 2EG5A 3DFFA 3JQCA 4RTSA 3PE6A 4OB7A 4V0MA 4BO2A 1MFZA 2C3YA 3UC5A 1EK2A 2FDRA 3O03A 4LFBC 3PT9A 3KWMA 3EA0A 3KXIA 3SP1A 4EG0A 5LU8A 3D2CA 2W2PA 1YGPA 1XTBA 2NSLA 3AJEA 3N2KA 1DJLA 4Q4HB 4RAOA 4WWHA 1VKZA 1NFFA 3DDHA 4CMHA 4YXFA 1EUQA 1ZU4A 3GC6A 4YAUA 1HXHA 3TTWA 4YRAA 4N4AA 4DUYC 1PK8A 4IOKA 1B8VA 1N92A 1I30A 1WH9A 4DV6C 5CDFE 3LVFO 4RJKA 3IOCA 4TT3D 4KRXA 1PR3A 1L3CA 1WXEA 1FTNA 1C7ZA 2YC2C 3OUTA 3T3GA 4PYIA 3GLIA 2X6RA 4G97A 3HZHA 3LW8A 3QVGA 2HSZA 4M1KA 4QIHA 1KQNA 4ZZ1A 1ZK2A 5A5VA 5JOQA 1N36C 2L69A 3GNSA 1DGQA 2P9GA 2VBIA 4OYCA 2WICA 3EUWA 2DMRA 1IUKA 1NW7A 2A5JA 2DLDA 3EGXA 1RC8A 5DTMA 2ZWAA 2JAWA 5EIXA 4GM1A 2Y99A 3VC3A 2DCUA 3EXEB 1QKKA 4YMHA 2Y9PB 5AVTA 4QPJC 4DWOA 5JJKA 4EQZA 4LRUA 3WOHA 2X76A 1AQJA 3MFQA 4NDZA 4FFVA 2BMVA 1GLGA 2YNMA 2C3OA 3FZEA 4OFXA 4B48A 2XT9A 3SVTA 1DO2A 3SEFA 3NFYA 5IG2A 3PFNA 2BR5A 4KNVA 4U4AA 3WKBA 1OXKB 2P3LA 1NQWA 4YV2A 3VJMA 5ESWA 4Z5XA 4FEGA 2CCGA 3Q3IA 3LT1A 4EKNB 5M7EA 1C3VA 1THTA 2QAIA 2QRMA 3FN4A 1KEWA 1K6JA 2AYYA 4NV3A 1P0CA 3WRXA 3KQKA 2CU6A 1J2EA 2XQVA 4UHJA 4C4AA 3Q9NA 4YRLA 1YFKA 5HW0A 2GFHA 3BWEA 1DV2A 2ZU6A 1IVYA 1ZBDA 2DY0A 4CV2A 1YMVA 4JUCA 1OH6A 4FDAA 3AVXA 5E4YA 5A9SA 4HUQB 2PMBA 2PKCA 3OCXA 2C7RA 2VQ3A 4D8WA 5AK3A 2CY0A 5BUCA 3OOSA 1T91A 2EWWA 4RK1A 5FI3A 1LWNA 5LZ8A 2CDRA 1CEEA 1KEUA 1Z0AA 2F2TA 3CO0S 3S1LA 3JTMA 3ZGLA 3BHMA 3KOMA 3Q3VA 1E2GA 2GGSA 4ML3A 4LRYA 1JUDA 1X70A 4XJTA 3VDXA 4HQ6A 4HDRB 1Z4PX 4KQHA 2VPTA 3C3YA 2A9PA 2F62A 3A7DA 4IH4A 3JQGB 4W5HA 2OFPA 2P4UA 1UXGA 2QJOA 3CEPB 4BDSA 1W8IA 2I2DA 4ENSA 2OENG 1JHDA 1LC3A 1R4MB 4WBNA 1J8DA 1V11B 4HN9A 3NWEA 2DKNA 4Z0HO 4EVSA 3ROEA 3I2FA 2EF0A 4TOIA 1JG3A 1Z5ZA 1H2FA 1EBUA 1VKJA 2P78A 3UHPA 3OOWA 4BMOB 1DINA 1PEKE 4WOCA 2RJNA 2AOWA 3K1AB 4UTZA 4JI5C 4HTFB 1ZRNA 1X9GA 4XB6B 4N3CA 4LFBB 4S1NA 4RYDA 1E3QA 1PZNA 1IY0A 3I01M 3PE4A 2ZJAA 4UZEA 1MJHA 3UJHA 4KIWA 3UATA 2C5FA 3G5UA 3G1WA 1J0XO 4HGNA 4BV8A 4DRZA 3UAGA 1WPXA 4XIGS 3SVLA 2C9BA 3U19A 1VMAA 2P7HA 2YJ5A 2QHXA 1E7SA 4IZOA 3Q1KA 4JEHA 4CM8B 4MTLA 1SQ0A 3ZY4A 1FL9A 4IO1A 3SS9X 4RVOA 1L7AA 1QTIA 2SICE 3UICA 3AIKA 4EHHA 4ABTA 2A8YA 4MQ5A 1V8ZA 4DIBA 1TUBB 1CHNA 2G8LA 4MGEA 2GRUA 4ZHSA 1S1MA 4B43A 5BN1A 1ULSA 2YZNA 3Q0IA 3HXKA 1YB7A 2HO4A 3D6FA 3DEHA 4RVFA 1LQLA 3VPCA 4KDCA 5CHYA 3F6YA 4JA2A 4NR0A 1V45E 1U3FA 5TSDA 3SLRA 1JE1A 1ZEJA 1RYDA 4Y0NA 1XA4A 3EJWA 3RSHA 5E9WA 3BILA 1JI0A 2ZM6C 2AOVA 3D59A 3UEBA 2HFKA 3EPRA 3FDJA 3GMIA 3K9LA 5EMHA 4Z54A 2VYFA 3T1QA 3KS9A 4MQ4A 4G5XA 3HCNA 3VYUB 1GN9A 2J85A 4UU7A 2F3QA 4CTMA 2BGNA 3L4JA 1LK5A 1YUBA 2I7XA 1EWKA 2H1HA 2QMOA 5F77A 3IEIA 3R3WA 1BX3A 3WK9A 4HWTA 1QRRA 3TSYA 4TYWA 3HSSA 5E6RA 3NM5A 1G6Q1 1R9MA 1OH8A 5JAUA 3SIRA 1KP9A 2QU8A 2WSYB 2YJ4A 3IPXA 5KTYA 1CUUA 2YHBA 1NT4A 2CY1A 1UFKA 1X7XA 2QG6A 2YYYA 3TNJA 1M2HA 2LTAA 4HT3B 1QRUA 3W6UA 1TJPB 1U31A 1IUOA 1LZLA 3HG7A 3IDAA 2YUTA 3AL2A 3PQ3A 3S27A 3J81k 3HM2A 1MAVA 5L6LB 1B76A 2Q3JA 5DHRA 4YRNA 1KKLA 2XITA 3HFJA 4FHEA 2BFFB 1F6DA 1E63A 1PJZA 3R7LA 2R65A 3UYLA 4KR7A 2IHUA 1GTRA 4IDAA 2NCLA 1ND6A 1WKVA 5CNKA 4H2DA 2AL7A 2R6CA 1GTG1 1JKMA 2AOUB 3BRQA 1D8AA 3QUSA 3ZWWA 3KKZA 4K6CA 4ARZB 2Y1DA 2Q0QA 4YV0A 1CVIA 1JAIA 3AX6A 4XR4A 2BKEA 4L4XA 1GXSA 4DCCA 4DYHA 3DF9A 2YKGA 3R0JA 1XDDA 1N5DA 1ZQ1A 2MOKA 1TYZA 1XXHE 4NAUA 3TM5A 3VZQA 2B1QA 3PGXA 2R7KA 3WK5A 1ZUNB 1OUMA 1QHGA 2I9PA 4Q00A 5JNRA 2ZI5A 3QF4B 2QJWA 3PC6A 5ER6A 3I39X 2PQMA 1CQIA 3RAEC 2XB6A 3GR0A 2E8FA 1QK4A 2QMZA 4KXLA 3QKSB 3SQWA 5TQ0A 1PS8A 1P5JA 2HWUA 3THRA 4DLNA 4CKBA 3LWNA 1UT6A 2YYZA 3BGDA 3D6TB 1D2GA 5GGYA 3U81A 1BVHA 2PS0A 2YFYA 3LUGA 2NN3C 4OJTA 4UZFA 2G5GX 3UW3A 2V4ZA 1TYBE 3HCEA 2VSNA 3ELYA 3PC3A 5JMPA 5A71A 1SFRA 3SU8A 5LDDC 3EQ9A 2HZ7A 2EX4A 2WLTA 2F00A 3FNFA 1XMXA 3L7CA 1SOAA 1T25A 3AR3A 1ACLA 1FCJA 3FPGA 3QXCA 4IH1A 3SJAA 2INGX 3U6BA 1GL6A 1W96A 3JQ7B 4N18A 1AF4A 4RF2A 1P2BA 2Q3BA 1LLCA 2BM0A 4P3OA 1ZCAA 2BD0A 3SZGA 3OPVA 4D9FA 3LV8A 2XB2A 3FNQA 1RJWA 1JHMA 2NPIA 3HBJA 4FKMA 4YDRA 2J45A 1NXXA 2AD5A 3H5IA 1RQGA 4GOJA 4IYJA