4DCTA

Crystal structure of b. subtilis enga in complex with half-occupacy gdp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
432
structure length
401
Chain Sequence
KPVVAIVGRPNVGKSTIFNIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN ENGA
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 116
structure length 401
sequence length 432
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dctA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dctA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dctA01
2RGEA 4RVCA 4M0LA 5CLQA 1R0WA 4UKDA 2ZRPA 4Q03A 4Z1MA 4LI0A 4OL0A 3U44A 1G3RA 1W49A 1YJ5A 2J0QA 1DELA 3BIFA 3GMTA 2J0VA 1G8HA 3PUYA 4A8JA 1NBMD 1SKQA 4LY6A 3ASZA 2YJTD 4YMSA 2K5UA 1II8A 4OI1A 4B34A 3HJNA 2HJVA 3A37A 4NH0A 1DS6A 1YZGA 4JI4C 4X8OA 2IXGA 3FB4A 2AXPA 4LHXA 5JECA 4MUBA 2XZLA 3EPJA 1DAMA 1E1RA 3W8RA 1CR1A 3N70A 4BWYA 1R5BA 3GJ7A 3UIEA 1US8B 3K70D 3DKVA 3LBHA 3B7GA 4CRWB 2B8WA 3L0PA 2UU9C 4E03A 1MR3F 2ATXA 3D31A 3IHWA 4Q18A 1K6MA 3G0HA 4QJ4A 2KE5A 1MOZA 1Z83A 2X2EA 3C16C 3EA0A 4LCBA 1QBKC 1GKIA 2IYQA 2C04A 2XNDA 4G1UC 2W58A 3SJAA 3Q7PA 2WWWA 1N33C 2AWNA 1VIYA 1MH1A 2D4HA 4TYNA 1YHNA 1XMJA 3THXB 1HQCA 3K0FA 3QPVA 2ZTSA 3K09A 1U99A 1DOAA 2FZLA 4HB0A 2ZPTX 4TLCA 2FSFA 1UKKA 3F3YA 3OEHA 4KXFB 4TZ0A 3QQ5A 1G5RA 1JJ7A 4QG7A 1UPTA 4Q4HB 3DDCA 4XTCS 5FFMA 4M2LA 4QBFA 3I73A 4PQFA 2OLJA 5FBVB 3AM1A 2MMCA 3CLVA 4DV0C 4JLDA 4DKXA 3VMFA 5AJXA 4NP6A 5F2EA 3FWYA 4UNRA 2ANBA 2GRJA 2GXUA 4C0HA 2W83A 2G3YA 1ZBDA 1Z2AA 3C8UA 1A4RA 1OXUA 1P3JA 4Q4JA 2JJ2D 4R2IA 4RCYA 1UADA 2CXXA 2PX3A 4JLAA 1OPXA 4TWZA 4V0NA 2YOHA 1G5PA 2AKYA 2NZ8A 2IK8A 4Q1DA 4JLOA 1KOFA 3FMIA 1XXHB 2XB2A 3SHWA 3EPKA 3GJXC 5IWAC 2GXAA 3GEEA 2VP0A 3FTQA 1SVSA 3SYKA 1E3MA 3OF5A 2A5YB 2YHSA 3PUVA 3UG6A 5KPJA 2PLRA 4G5QA 4RZXA 4DB2A 4A0RA 3C7KA 5CJ2A 4O0MA 2WPDD 3P4XA 1ZUHA 2R9VA 3C5HA 4PSKA 3B2EA 3EARA 1KKGA 1R4AA 1GSIA 4A36A 1II9A 2BBOA 1QVRA 4G5OA 3AVQA 4V0KA 1Q44A 3P27A 5HE8A 3G5UA 4PSAA 1K5DA 2KBEA 1FW6A 4WVFA 1ZM3A 4BLQA 1OXXK 1Z5ZA 4JI1C 3K9GA 1Z6XA 5B64A 4R2HA 2A5GA 2VP5A 1OHHD 8OHMA 2V7QA 2FMXA 1T3SA 2ZE8A 1DAFA 2ZVQX 4IEEA 1KI4A 4ZKDA 5EP1A 2BBSA 1XTIA 2IS4A 4BFXA 2WWYA 2WTUA 4LBYA 3DMDA 4NCIA 1SGWA 3RWOA 1BMFA 1OF1A 2WHXA 4ZDWA 4URXR 3LW7A 6Q21A 1XFAA 4DT1B 2ONFA 2CNWD 3M1IA 4QOSA 2ZRJA 2JA1A 2ZJBA 4G5RA 5EXPA 2ECKA 2NO9A 2EWVA 1RPZA 1NBMA 4KHZA 2OT3B 2RH5A 3O8BA 2ZSEA 2VH5R 1JOSA 2WKQA 2A5DA 5JHGB 1P4SA 4PQRA 3K0AB 1SHZA 2XB4A 4FINA 5FL3A 4ZO4A 2QPAA 5K8TA 3S1AA 2ZRMA 3V4FA 1QZXA 4B33A 1Z08A 4LWZA 2ZJAA 1KSHA 3CR8A 2NO1A 2MSCB 3K9LA 4U00A 1HH4A 2KZFA 2F7SA 1M6NA 4XSGA 4HZUA 4OHWA 2VF8A 4P4TA 4AKHA 4DR3C 2ZRHA 2ZJ2A 3C4JA 5CK5A 3LBNA 1U0JA 1PUJA 1AS0A 3VR5A 1GAJA 2FFQA 3MJHA 4I1UA 1E79D 3SU8A 4A92A 5JWOA 5EJEA 2QGZA 3E2IA 5L3SA 3T06B 3U3RA 1NVWQ 1NIPA 1W44A 2OPLB 2ZITA 1ZU5A 3EASA 4GP6A 4LGMA 2C9CA 2QAJA 2CXCA 5C4GB 421PA 3EZ6A 1HEIA 5JBQA 5TDHA 3G82C 4QBIA 4LJ5A 3GLGB 5J4VA 2ZRCA 2GAOA 1QG4A 1W4AA 3QKSA 4LFCC 1IN4A 2KI5A 1NY6A 3UK6A 1NLZA 2ZRKA 3FFAA 4FMDB 4Q19A 1XCMA 2ZANA 2QORA 3GFOA 1R8QA 3F8TA 1M34E 4LOAA 4XH9B 4Q7LA 5B2ZA 3VR1A 4B3TC 3LW8A 4DR4C 3HU3A 4HLCA 4U5XA 2BMDA 1SVKA 1KJWA 4DLTA 1KNXA 3V9PA 1KO1A 1U9IA 4QFMA 5AWFC 1T3HA 2REBA 2MSEB 1KSJA 2GEUA 4X65C 5GJCA 4DCUA 2FEOA 2P2LA 4LX0A 2XSZA 4QL3A 2QMUA 4Y0AA 4V0OA 5L3VA 2BMEA 2MMGA 1ZAKA 3U6BA 1N6PA 3AVVA 1NL3A 4JVSB 3EZFA 3TAUA 3R8CA 3B60A 4NYJR 4Q5IA 1XJCA 2C98A 4Q1FA 3ADCA 1NJFA 1Q1EA 1XP8A 1R2QA 2UXBC 2ZJ5A 2AFHE 4DV6C 3NBFA 1XPRA 1KI7A 2GCOB 3R20A 2NO7A 1KO8A 2ZE6A 4V0ME 3AVYA 4C2TA 2R2AA 5HPYB 1TPZA 3RRZA 1D8TA 1JI0A 1VDZA 2WWGA 4C9BA 2Q6TA 1OHHA 3QSYA 2AFIE 1G291 2FA9A 2ZYWX 1YU9A 2FE4A 1G3IA 2FDCA 2WVJA 4M9ZA 2V54A 3T5GA 2Z4RA 3KX2A 3EWAA 2BBWA 3WMGA 3N2EA 3OIVA 5D3MB 4KFRA 1E2MA 1OKKA 4HB4A 2IT1A 3V4RA 4YXWA 1XD2A 2G0TA 5LPNA 2O8CB 1MO4A 2CNWA 5SZHB 3C41J 2EQBA 4YMVA 4EAQA 2WV9A 5JCZA 1CR4A 1D2MA 2XR1A 2V8OA 5GVSA 3GLIB 1I4DD 3QOFA 2GKSA 4RFSB 1N5KA 3QBTA 4CEHA 4JI8C 2D7DA 2FV8A 3BH6A 4IDOA 4A9AA 4NHOA 4LJ9A 1E0AA 5KHOC 4OQFA 4QRHA 4MDEA 3BH7A 4O3MA 3TGPA 2YZ2A 4BLRA 1W5TA 2FNAA 2XXAA 2IYTA 5CM9C 4FWIB 4PZLA 3AF6A 4CEJB 4BZXA 4JJKA 3KQHA 4B3FX 5EXSA 4ZDKA 2O0HA 4QHTA 1FFHA 1NKTA 1RYHA 2PT7G 2GXSA 1VG8A 4KBFA 3RRYA 2Z83A 2QL6A 3T5DA 1S3GA 4HB3A 1QHHA 5FUYA 1G7TA 4EFLA 3K0CA 5BXQC 5BQ5A 4WA7A 3H4MA 4PPGA 5EE1A 1DVRA 4MRVA 4QGAA 3AB3A 2OILA 1XF9A 1PLJA 1T8UA 3EZ7A 2P6RA 1E9DA 1E1QD 3TLXA 2G88A 5G3YA 4P0TA 4TMKA 1JNYA 4AIIA 2WWFA 1N2CE 2ZI7A 3PEUA 1T5IA 3F0TA 2Z4SA 1CP2A 1NJGA 3NH9A 1QHYA 2O8DB 2F3TA 4IDNA 2DHRA 1YZUA 1Z0DA 3FGNA 1GRRA 2IS1A 1CS4C 1P2TA 3BORA 3Q3JB 2ZVPX 1S4QA 3H2YA 4K46A 2HXSA 2E1RA 4JMPA 3VKWA 1GIAA 4M4SA 2QE7D 5FTNA 2IL1A 4P32A 2UKDA 3HR7A 1E0JA 3AVPA 1TU4A 2H1LA 2O0KA 2IUUA 1GZSA 4KAXA 2C5LA 2ZE5A 1KIMA 3DZ8A 3V00A 1P7CA 2X2FA 3L2OB 1H8EA 3N5CA 4TYYA 4L16A 4TMTA 2FGJA 1T6NA 2FH5B 1NLFA 2LKDA 5KNBA 3VFDA 3I07A 1YVDA 5DI3B 1SVMA 3GFTA 4DLUA 1CJMA 1K8RA 4JYAC 2A5FA 3NBZC 4JVMA 3ZVRA 5DNYB 2VPPA 3ZZUA 3DOFA 2ZETA 4IOMA 5LDDC 3TW4A 1OV4A 4P4SA 5IF9A 1XD8A 1LNZA 1RJ9A 3EIEA 3J80D 4WXRA 3RANA 3ZQJA 3QEOA 1UF9A 3SJCA 4PO8A 1W0JD 4PC6A 1TF5A 4RKEA 2J0UA 3OIWA 4ABYA 5FUXA 1XPUA 4EQ6A 2EYQA 2OBMA 5JFGA 3ONWA 5L3QA 2WSMA 3MWLA 4NKRA 4F38A 1X8LA 4NDZA 2FFHA 1KK0A 3CJEA 5J4YA 2QROA 2RCNA 1D2EA 2N42A 1JAIA 1JBKA 2IUTA 5K8IA 4C0LA 4NCKA 1EWRA 4OI4A 2C9YA 1KI3A 1AA9A 1AN0A 4NYIR 4DV7C 4I81A 3IEUA 3BC1A 1Q3HA 1IXSB 3QXSA 4DV1C 4R7ZA 5EUMA 3GD7A 1KI1A 4E5UA 3MJRA 4DV5C 5HE9A 2OCYC 1U8AA 5LBIA 4BRUA 2W0MA 5DHAA 1NBME 2GEVA 2ZI5A 4TLAA 3I8XA 4RZ3A 5FOXA 1JR6A 2QPTA 5EZ5A 2Q3MA 4BLSA 4NCNA 1ZUIA 1U90A 3OEED 3U61B 1UKEA 2QQ0A 4R98A 3BB3A 4ASUD 3W5JA 3U3MA 3W3ZB 4DWJA 4DXAA 2NPIA 4B3BA 2EFCB 1KI6A 1T4GA 4MTNA 3RRNA 1TF2A 4JBYA 2C95A 4MQBA 2GZDA 4WW0A 2XZPA 4LRWA 1FTSA 1JXMA 1T5LA 2D2EA 2G77B 4GSYA 4HAUA 1D9ZA 3T12A 3QVVA 5CK4A 4CW7A 2J46A 1G7CA 1SVOA 2OO7A 2HUPA 3BB1A 1AGPA 1VLAA 4LSGA 5JSZA 4NXNC 3T61A 2R6GA 1FMLA 1H8HA 4ZCMA 1CU1A 3KJHA 4JYCA 4NZYA 4FXPA 4FCVA 4QNRA 1E1QA 1GRQA 1ZNZA 3SJBA 4H9GA 4C0BA 3B6EA 4EFNA 4GOXA 3ZQ6A 3CWQA 4QHSA 1UBFA 2FFBA 3NHAA 4LC0A 4TTQA 5L3RA 3IO3A 3MFYA 1PVOA 3GLHB 2ZJOA 4HLDA 5FPTA 4EPVA 1TAGA 1AKEA 1Q57A 1UJ2A 2D62A 2HXYA 2Q9BA 2G1JA 4PSVA 1FMJA 3LAWA 4OHYA 3VR3A 4GPTA 4NTZA 4X62C 2ATVA 5FLXD 4DV4C 1NVVR 3D8BA 4KI0A 3NH6A 4NU0A 1SULA 3Q5EA 1SXJB 5EP2A 3T34A 3KFXA 3GJ8A 2AD1A 4NCJA 3KQUA 2ZRBA 1DADA 4QM7A 3J81D 1FUKA 1X8JA 3A4NA 2JLZA 1DAHA 3RABA 4PHHA 4CYMA 2JLWA 4EUNA 3PFIA 5AJZA 1G64A 3T35A 1Z0KA 3LH5A 4HAVA 3B13B 4JLVA 1Z0IA 4MRNA 4DHEA 4YC7A 3AGQA 2SHKA 3TK1A 3FHTA 2JJ8A 1CKEA 4LF5C 2ZS7A 1HY3A 4IW3B 5JWHA 4Q4AA 3B82A 4UNPA 3T1TA 2O8BB 1E9SA 2FN4A 3CH5A 1DAGA 1BYIA 3Q7QA 2OLKA 1VKJA 3AF3A 1P9NA 3RS3A 3K0SA 1OH8A 3DM5A 1COWD 3KKNA 1GL7A 1E98A 3AP1A 1F2UA 4Q9HA 3WNBA 4MRSA 4Q66C 4F93B 3L0SA 1TTTA 3CIOA 1ESNA 2FOLA 5JWRA 2V1UA 3TSWA 3HWSA 1F3OA 1KMHB 2F9MA 1UDXA 2WSSD 2GJAA 4FMBB 1XD9A 4K8OA 4TQ9A 2QT0A 1IBKC 1A2BA 4OK6A 4LJ6A 1EFRA 1W48A 1E96A 2RHMA 2FX3A 1W2HA 3TVDA 2YCBA 3EZ2A 2DFLA 1QF9A 1W7AA 2J87A 2CL7X 4PANA 2FSGA 2OXCA 2LCFA 2I1QA 3OAAA 4P33A 2ZYTX 1CIPA 3CNLA 3U2QA 1UDWA 2ZRFA 4D81A 1YZQA 1XMOC 1AS2A 2CJWA 3B1XA 4GDFA 3UMSA 1SXJC 3K0EA 1OT3A 1DG3A 3RVBA 4DLYA 1XCGB 2CE2X 1J7KA 3CB4A 1OE0A 4JT2A 3RDPA 3THWB 4YQFA 3ZLJA 2GA8A 4MGIR 1IY1A 1GITA 3CX7A 3BE4A 4TMXA 5GJVC 3QUSA 2HV8A 2PX0A 2UXDC 1RRFA 2TMKA 1M7BA 2VQFC 2BMFA 4LHWA 1KJYA 1E2FA 2A3RA 4DCVA 1E32A 1I4LD 1M7HA 5J5CA 3RS7A 3OEEA 2CL0X 3REGA 3B78A 5H70A 5G53C 1JECA 2UUAC 4PAQA 4ASUA 4C30A 2VIIA 1G3MA 1GRNA 1OFTA 5JHHB 2EYUA 4LHVA 1QHXA 3EX7C 5A0FA 1N25A 2EFGA 5BN4A 5EZ6B 4CEIA 1R7RA 4W5HA 2BCJQ 4KODA 2F43B 4JI0C 2C77A 5IHPA 1D6JA 2IYZA 2EU8A 4TTRA 1G5TA 2ERXA 4Z51A 3ZD7A 2QM7A 1DBSA 2Q3FA 2ZAOA 1L4UA 4CDGA 1EFTA 2VSXA 4LV8B 2B7CA 4JBWA 5H1YA 3TUJC 3U6KA 2HDNB 1PLLA 1CTQA 1F2TB 1R5OA 3U5ZB 3NIBA 2WIAA 4MGZR 1FQJA 1GG2A 2NIPA 3DMNA 1W46A 2ZRLA 4G5GA 3H0KA 2ORVA 4MYHA 3REFA 4JI3C 3IQXA 5IT9D 2MSDB 1N3BA 4V0MA 5B58C 1Z06A 4NXMC 3MSXA 4UJ5A 3Q85A 4GKKC 3T1QA 3CNOA 4LHYA 1WBDA 5GJBA 4LJ4A 5J4KA 2JEOA 1FZQA 2QTVB 5LB4A 1KAOA 1WXQA 4A0GA 4LZZA 4DCNA 1E2KA 4RD2A 4B6FA 5SZIA 2NO6A 1QVAA 3KKQA 2J7PA 4LBZA 4C3ZA 3B85A 2OZEA 1KK3A 2FFAA 3NEYA 1SVLA 2WMNB 4Q02A 2DWQA 1D2NA 2I4IA 1YE8A 3I5XA 1SVWA 3F5FA 4RCZA 1E0SA 2GDJA 5TY0A 1WDTA 4MH0R 4O25A 1QHIA 3CR7A 3JZMA 4FD2A 1VHTA 3QI2A 3EC1A 4WOPA 2ZROA 2AL7A 1K0RA 1E6CA 1FX0A 1OJLA 4FMDF 4TL7A 4DLRA 2ZSBA 2QL8A 1N2FA 1USPB 3A8TA 3RRMA 2A30A 2QAGA 3SZRA 3ZVLA 2RHDA 2H16A 2WAXA 2YWFA 4UJ3A 2BM1A 2IEZA 3EC2A 4TMZA 3AVOA 2HLDD 4IDHA 4URVR 4LPSA 1NVUQ 3W6NA 4POAA 3JAMD 2OUKA 1RFLA 3VU9B 1UBGA 2F1RA 2HF9A 1T9HA 2WSSA 2JLUA 2FEMA 2ZU0C 2CCGA 1G9XA 1OYYA 2Q21A 4E07A 4PAOA 5KSYA 3X1ZA 2BV3A 4XWKA 4KV9A 2VHUA 2GBLC 3MWJA 4PX9A 3KQLA 3Q9LA 4I99A 1FNNA 3GLFA 4B43A 4LK2A 3LA6A 3CW2A 1N5JA 4KBGA 1TNDA 1J8MF 3MMPA 4ZV4A 2BWJA 3UKDA 4B6EA 2N1BA 4K81B 4GT1A 1IJEA 1WMSA 4NONA 3ZS9A 3BOSA 3GKUA 4OQXA 5HCIA 1Q12A 2QGNA 4US1R 3AV0B 3FOZA 4GOKA 2GWHA 2NMVA 4GL2A 3IHLA 4RJLA 5G41A 1O3YA 3QG5A 2WJIA 2O8FB 3LX8A 1DO2A 3ND9A 4DR5C 5DI9A 3A6PC 3QF4B 3RNLA 4A2WA 2BJVA 1DPFA 1Q1QA 1Z0AA 3I8SA 1GUAA 1BYUA 4TSFD 5KUTA 2QT1A 1OFHA 3W6OA 3R7WA 1EFCA 2Z6VA 3KUCA 4B3GA 3JVVA 2W2TA 3AKEA 2N46A 2QN6A 4DV3C 3QBVA 4KCGA 3LD9A 4CT4B 2GVDC 4NE2A 4HUTA 3WYAA 5AUNB 2BEKA 5BWMA 3CX8A 1OXTA 4US0R 1MABA 1AS3A 2ZEJA 3RC8A 4PO9A 1OB2A 5FL7D 1S9DA 2CK3A 1OW3B 4MYTA 1LY1A 1EWQA 2CHQA 3HYRA 3ZVMA 1TQ2A 3VQTA 2JLSA 3AVXA 1JALA 3LXRA 3FVQA 2YC2C 1ZP6A 1ZCAA 3FFBA 1G6HA 3KB2A 3HU2A 2CEAA 1W1WA 4LYHA 4PO1A 4DLVA 3GFPA 3HYTA 3THYB 1G4UR 2YV5A 1FJGC 2EGTA 1O87A 1RRGA 1KGDA 3AUYA 2PT5A 3LNCA 4L4UA 4ZIRB 5FTJA 1E69A 1Q21A 3OTOC 1VECA 1ETUA 2OSBA 5LB2A 1UKYA 1HT2E 4ARZB 2V6IA 2QBYB 2JDID 4M22A 3TE6A 4ZI2A 2HCBA 5JI2E 4HDCA 2QEQA 1VIAA 1XMVA 2RGCA 1JXOA 1QHSA 1SXJD 1ZM9A 2ZUDA 3KKPA 4ACAA 2O0JA 4OHVA 5EP4A 2QP3A 4M8NE 1EXMA 2C2HA 1WE2A 1DAIA 1NN1A 5CDFE 2QI9C 2H92A 1D5CA 5KDDA 2W6JD 3TUZC 5DN6D 2YKGA 3I62A 1S2MA 4JLPA 2ODBA 3W3AA 4Q48A 3O47A 3SE0A 1IM2A 3TR0A 2I3BA 3VR4A 1U81A 2IYVA 1XTKA 3QY0A 4TL9A 2VBCA 3HPQA 3GPLA 1KK1A 1M7GA 3PEYA 2OEPA 3P26A 2WKPA 2VYFA 1DAKA 4RD1A 4ZDIA 1KY2A 4LYFA 5FI1B 5KNCA 1AQYA 821PA 4OJQA 3AKCA 2NTYC 4AYXA 1JPNA 2A5JA 2IXFA 1RVDA 4FN5A 3AVWA 2QRZA 3E5HA 3EERA 2OCPA 4DR1C 3QE0A 4IVRA 5G3ZA 1UEJA 5HZKA 4IXNA 2F6RA 2OCBA 1XDBA 4DSTA 1XPOA 3HR8A 5HR5A 1XNJA 1C9KA 1N0VC 2KWIA 4EPYA 1NSFA 4JI2C 3FHOA 1J8YF 4P31A 2ONJA 3BBPA 1RRPA 2VHTA 2GZAA 4L15A 2OAP1 2F3RA 5HZHA 5C4MA 3A1WA 4Q1EA 2CBZA 2X77A 3NDBB 1UBEA 4A0FA 3EPHA 2CHGA 4BLPA 1KZ7B 2ATWA 3AF2A 3WY9A 1V43A 2NGRA 2W00A 2G9NA 1I94C 1CRQA 1Z22A 3PVSA 4C0JA 4C7OA 2IF2A 2JLQA 4J0QA 5EXXA 2ZRGA 1VCOA 1Z2CA 1ZMXA 2KSQA 4KLZA 2C03A 2OBLA 1RW4A 2XTMA 2HJGA 4TSFA 5FTMA 4PC2A 1PLKA 2C78A 4GFDA 4LYJA 1X1SA 1V5WA 3LVQE 4LV6A 3WRXC 2JJ2A 3WNDA 2ASEA 4DR6C 2UUCC 5FOSA 1ZIOA 3L0OA 4RZ2A 3RYTC 4YDHB 4DBLC 2VP6A 5IK2D 1M2OB 3FYHA 3ICEA 5EE9A 4DIEA 3MRSA 3ZJYA 1CJTC 1YQTA 3ASYA 4ESHA 4H1VA 5B30A 5JS8A 3QKRB 1NNEA 4BLTA 1Z0JA 4URWR 3P4YA 5FL7A 1ZINA 3VHXA 1EGAA 3WP1B 4JL5A 5FOVA 3KJEA 4JL8A 2R6AA 2J59A 2NZJA 2YWGA 4JZKA 2P65A 3MWYW 3E70C 2JLVA 1XZPA 3SEAA 2BKUA 2WPDA 4C0KA 2IA5A 5FPSA 3GP8A 1ZNXA 5TV2A 5FH9A 2AR7A 2WWIA 2FGKA 1HQYE 2YWEA 3IIKA 4BFTA 4KU4A 4XVQA 1RE0A 2KJQA 4LJYA 5HTKA 2V55B 1KSGA 5DGXA 1KKMA 1JEDA 1H65A 1FQKA 2IX3A 4OI0A 1E99A 1OH7A 4HLUC 4LF7C 4LDJA 1XEWY 1R0XA 5E95A 2AXNA 4CZ2A 2D3WA 3U44B 4KVAA 2UZIR 4OYHA 5A2QD 2WJJA 5FUWA 4I4LA 1N6LA 3SS8A 3U4QA 1BO6A 1HNWC 2F9LA 1HTWA 2OFWA 4A8JB 4Z54A 3NTUA 4B3CA 3AKDA 3I32A 4XSHA 4NMMA 4PAMA 1II8B 5DN6A 3VKGA 1JJVA 2F1HA 1PJRA 2QSYA 5JJKA 2WWXA 4TT3D 2VLIA 5AK0A 1FOEB 2QENA 1OLOA 3H84A 2Q0HA 4TLEA 4BFSA 3SBEA 4JSYA 3UMRA 1VHLA 1ZD9A 4ILEA 1RRCA 4I1OA 3EA5A 4EJSA 4EPRA 1Z6AA 5C1BA 4F4JA 3SBDA 4PFSA 2OAQ1 4NYMQ 1FTNA 1ZB9A 3NBXX 4MKFA 4K0KC 1KAGA 5DE3A 4IRUB 2JAQA 3SI7A 2O8EA 3O8RA 3K0FB 1JPJA 2WJVA 2FG5A 4M9QA 4XD7D 1G20E 3UG7A 2J1LA 2GHIA 1MRNA 4NBSA 5BR8C 1DTSA 2FZ4A 3WMFA 5FUVA 5IRCD 2V9PA 4F91B 4EDHA 2IYRA 3P1JA 1XTRA 3GLFE 1W0KD 5ANRB 2ZJYA 5JLJA 5AUOB 1VYUA 1P60A 4B71A 1KI9A 3DOEA 1E79A 4EPWA 4Q4JB 3IUYA 1X8KA 3WP0A 4U02A 1J70A 2OESA 3DO6A 4A8JC 2ZRIA 1KHTA 1Q0UA 1XEXA 2REXB 2R65A 2ZAMA 1GNRA 2H7VA 2P67A 3B1WA 3BB4A 1Y3AA 2V4ZA 2ZM5A 2IBMA 4OQMA 5AUQA 3GLIE 3HU1A 2P5SA 3TW8B 1E2IA 3MG9A 1NY5A 2FPLA 2RGNA 2J9RA 5CITA 2VHQA 2X19A 1W36B 1OYWA 1Q22A 2NQ2C 4KFTA 1PA4A 4KFSA 2RKOA 3M0EA 3KXIA 1X6VA 1FNMA 4GMXA 1CULC 4QJ5A 4FWTA 3AVUA 3TRFA 2AK2A 4QGFA 4Q9IA 1KI8A 1W4CA 3LDAA 1A7JA 2G83A 2GK7A 3A4MA 3I92A 3LQQA 3FKQA 4DUGD 3CRMA 3KTAA 4XVRA 4JT4A 4AY2A 1ESMA 3K09C 3LXXA 4PPQA 1CEEA 2ZI9A 2UVQA 4DV2C 3C5CA 3QEJA 1SKYB 3ZZ0A 1OFIA 3O8DA 3DVLA 1AK2A 1G8GA 3TAHA 1ZB8A 3ECCA 1P73A 3DEFA 3GEIA 3KUDA 4UNQA 4D6PA 2ONKA 3PXGA 3MGCA 4IEIA 4DLSA 2ZUBA 4D0GA 1TQ4A 3CUEF 1Q3TA 5C46F 4H1UA 2W2XA 1IY2A 4NYJQ 2J41A 1Q1ZA 3LLUA 2ZRDA 2AHOA 2ZSAA 3DM9B 4LUCA 4OQLA 2EW1A 3GJ4A 3ADKA 4DSNA 3EPLA 2ERYA 1GKUB 2VEDA 5FOUA 3LLMA 4QBGB 4BFUA 1P62B 4D4KA 4DDUA 4HUQA 1W36C 1E2DA 2H8KA 2IWRA 4LHZA 4B44A 4A2QA 2CLSA 2GZHA 4B3DA 1CF4A 4QGHA 2ZE7A 1P2VA 1ZNWA 4XTRA 1U98A 5KSZA 2BDTA 1DO0A 2QTFA 4US2R 2QMOA 1VMAA 4ZKEA 3RS5A 2C9OA 2W6ID 3S1AB 4B48A 2J3EA 3ZH9B 3K70B 3PR1A 2EFEB 2PEYA 2ZXUA 4BLOA 4M53A 4DLZA 2YNMA 4HZUB 3U7GA 3Q72A 1Y63A 4MYUA 5DHFA 4AKEA 2YOFA 1XB2A 2C99A 5IDVA 2RMKA 3VX4A 1KDTA 4GMDA 5BN5A 4ESVA 1YRBA 4UNSA 4B35A 1IJFA 4HEJA 2IW3A 3EXAA 3PIRA 1J90A 4HZIA 4XD7A 3NEJA 5DO9A 1N6NA 3LFUA 3KQKA 2XZOA 1QRAA 1US8A 4B3XA 4DDTA 4HAWA 5L3SB 4B3RC 1ZM4A 2BBTA 2CMKA 5H8WA 3BS4A 1ML8A 1EFUA 3GJ3A 4P3YA 4R71A 2DCUA 3WBJA 3UWOA 3C14C 1E2EA 1E9RA 3CF6R 1FP6A 3I3SR 3MWKA 1NMZA 2P6UA 3UATA 5JMTA 3CNNA 3M4YA 5CB8A 2I1VB 2ZR7A 5BN3A 3QKSB 1FP7A 2E7GA 2PEZA 2C96A 3THXA 5LMNC 1K5GA 2ZR0A 2F1JA 1HE1C 4RFVA 2WAYA 1XNRC 3UMFA 2QMEA 5CYPA 3WHLA 4Q4HA 3QG1A 3FMFA 1T0JB 4BASA 3WXMA 2ZRAA 4F7WA 3AEZA 1M8PA 2VL7A 1X1RA 1IN8A 1CBUA 1GWNA 3KQNA 3VKHA 1BOFA 2UXCC 1NI3A 4FIDA 1LF0A 1N6HA 3K70C 2UUBC 1ODFA 2XOKD 1WA5A 2OXRA 2QE7A 4URZR 5JJIA 2QMHA 1XCPA 1E2HA 3PEWA 2ODEA 1L2FA 3EW9A 4L5BA 4OJKA 2IC5A 2HEIA 2WJHA 2LWIA 5CDFA 3SYNA 1II0A 1XXHA 5P21A 4DUGA 4JLJA 4HDQB 5FPKA 1MO6A 1D9XA 1KDRA 3X1YA 5FBRB 2QP9X 4DCSA 3EIQA 3UANA 3PV0A 2Q9CA 4M9XA 3TMKA 2BJWA 1W4RA 4P4UA 3W5IA 4ERNA 4M21A 2H5EA 4AYWA 1AZTA 3ZS8A 3PEVA 2BM0A 2GCNA 4GP7A 3AP2A 1KZGB 4HB2A 2P5TB 3AKYA 3HPRA 4IJMA 1GM5A 5TARA 4BQSA 3A58B 1EFHA 1W0JA 1XJQA 1Z29A 2V6JA 5AR1A 1CJUC 4OQNA 2RGBA 3TQFA 4DZZA 4Q7MB 1UBCA 1XD2B 4MKHA 5C18A 4D4LA 4NL4H 4HYYA 4Z1MD 1ZD8A 1SXJE 1U9IC 1M74A 1G8PA 1IBRA 1WP9A 3SFVA 4CEHB 5D3QA 1GL6A 1MT0A 3EG5A 4GZMA 4JLMA 3H86A 4DB4A 1KI2A 1JR3D 3BXZA 4TMVA 3SFZA 1MV5A 3P20A 4M1TA 1OH6A 2W6IA 2XXAB 5BYKA 4DT1A 2HT6A 5DIFA 2V3CC 1ZD1A 4LC1A 3N2IA 5CM8B 2AWOA 1HNZC 2KBFA 4AG5A 4M9SA 4NYIQ 1P2SA 4RKFA 4PHTA 4DJTA 2EFDB 1DAEA 3R9WA 4DEYA 3RS4A 4OHZA 3VNUA 3VAAA 4Q9KA 1EX7A 3TH5A 2C8VA 3A1TA 1MO3A 1QHHB 2D74A 3K0AA 1NYEA 4KITB 2XNDD 3TBKA 3AF4A 1T3LA 1U0LA 1IN7A 2HF8A 1RC8A 4JKIA 2WJGA 3CH4B 1FL9A 1G21E 3FMOB 1TADA 4I1SA 1RYFA 1OIVA 4HAXA 1EESA 4M1SA 1MRSA 3BRWD 3KJGA 4EPTA 1ZW6A 5JS7A 1E9EA 4KVGA 1Z63A 3AF5A 2WMOB 3GLGE 4WAUA 1HT1E 2IYSA 3DHWC 1WQ1R 4A2PA 2PL3A 2HCJB 4EFMA 2QSZA 4A4DA 2JMPA 2NOAA 3OZXA 3UWKA 2O52A 2R6CA 2ZJ8A 5HCNA 4QBHA 3KFVA 3OE7D 4PQYA 2VSFA 1VTKA 2Q3HA 2GESA 2R62A 2XJ4A 4XIGS 4ACBA 1Q1BA 4Q7JB 4D4JA 3Q5DA 4JLNA 3I5YA 4URYR 1P5ZB 3R9XA 4GKJC 1VCMA 2ZR9A 3PG5A 1CXZA 2OPLA 4URUR 4OK3A 1PUIA 3BFXA 1M1YE 4LF4C 1KMQA 1QG2A 5L8VA 3MUFA 3BGWA 3T15A 2NO0A 3LQRA 4PXAA 4YY3C 1G3QA 3GLGA 3B9QA 4U7DA 5UKDA 2RGDA 3HP1A 1NN5A 4B2IA 2XOKA 3OIYA 5F3WB 3GCGA 3ZGXA 2R44A 3TIFA 1CJVC 3A1VA 2A9KA 4M1KA 4WZ6A 4XWAA 4HAYA 3MCAA 4LJAA 4P4SB 1IQPA 3TR5A 5M04A 3QXCA 1R0YA 1YR9A 2RGXA 4NPHA 5CIWA 3TSOA 3K0CC 2PZFA 3GEHA 5KPDA 1KKLA 3NDPA 2GAAA 2E8FA 1RJ9B 4PZZA 5K8UA 2QZ4A 4UXHA 3K1JA 1N36C 1T8TA 4DR2C 2XTZA 1UKVY 1P6XA 1X3SA 1GNQA 4IDQA 2J0UB 4XX2A 2D06A 4CIDA 2GJ9A 3VR6A 4EQ6B 5L3QB 1S0UA 4RD4A 5K8LA 3HDTA 5HKKD 4MA4A 3DL0A 1ZIPA 5F9HA 3AF1A 2FWRA 2V7QD 1COWA 2LKCA 3JVUA 4FMCB 2E9SA 4AI6A 2CY1A 3SQXA 4YONB 1G41A 2VRWA 4FI3C 4CF7A 4TN1A 3NHBA 3B1VA 1AM4D 2GCOA 4BGDA 2G1KA 4QJ3A 1BMFD 3T1OA 4B75A 2PCLA 3LVRE 2JIZD 3KKOA 4AC9A 2GJKA 3RWMB 2YC4C 2JJ1D 5LMUC 2PH1A 3QENA 1E2LA 2BEJA 3BH0A 2FF7A 3IGFA 2XJ9A 3SQWA 1G3UA 3DKPA 1E9CA 2GEDA 3BWDD 4Q01A 1JR3A 5D3MA 2J45A 1LW7A 1OIWA 1AIPA 2BHRA 2ORIA 3B8HA 4D2IA 3PUXA 2CCKA 2O8CA 4G0NA 2DYJA 2OG2A 2W0SA 3A1SA 4MKIA 5LD2B 1KI6B 1WF3A 2E8CA 4DR7C 1NKSA 1P9RA 2ODNA 4MRRA 4TTPA 3IIMA 3IBGA 5EQTA 1N0UA 3GLIA 5E7JA 2OE2A 3LO5A 5SZKB 4X8LA 4RFSA 1R10A 3D7MA 1BS1A 1KDOA 3QNUA 4M1OA 5A4JA 2Q9AA 1E0KA 1Z0FA 1TEVA 4A6PA 1U8ZA 4Q21A 4Q1AA 1T0HB 4TYQA 5JSZB 3RS2A 3A1UA 2J0SA 2ZM6C 5J4LA 5CYOA 3QIAA 3UXMA 4CEJA 5FPHA 5AJYA 5TVKA 2XGJA 5E3HA 4BEJA 1E4YA 1HR0C 3CZQA 3BD9A 1G8FA 2DR3A 1OB5A 1QWIA 2WWHA 3P32A 5EE3A 2D7CA 3CM0A 3BFKA 3NKVA 3Q8XB 4HATA 4KYIB 5KDLA 2Z43A 3SHFA 4CT5A 2RB4A 3SN6A 2CL6X 4TYPA 3OE7A 4OX9C 2Z5FA 3EIHA 4F4IA 4Y0VA 2AKAB 1EK0A 1XWIA 4Q9LA 2Z0MA 2GTPA 1ZCBA 2REOA 2CVHA 4JLBA 4BUJA 2IXEA 2QA5A 4N0DA 5DH9A 1E94E 1NMYA 5EP3A 1S3SA 2BJOA 5GJWC 5J4HA 1IN6A 5DYGA 4DIDA 1B23P 5EE0A 2WM9B 4LF8C 1NLYA 4Q47A 5KO2A 2PCJA 2UZ3A 3W9YA 3WYGA 5LD2C 2O8DA 2RAPA 2VQSA 4JIMA 2D7VA 4TL8A 3ZIAD 1C1YA 1FUUA 2XSZD 1WBBA 4Q4AB 1GFIA 2PBRA 3BAFA 4RY2A 2IUSA 2IEYA 4TQAA 4MUAA 4CGZA 4QM6A 1HE8B 5AUPB 4IOKA 3A36A 4AURA 2GILA 3LUSA 4IOLA 2ORWA 3CBQA 1XXHE 1F2UB 2FSIA 4WXPA 4S2EA 1N34C 2QP4A 3B1ZA 1S9HA 2IS2A 4YDSA 1TQ6A 1XRJA 1ZNYA 3L82B 4QNMA 5DI3A 1PV4A 3ICQB 5KSOA 2ZIAA 5HKKA 4YLGA 4DDVA 2H57A 1NIJA 3KKMA 3RAPR 1TX4B 2HLDA 3AF0A 4B2PA 1I2MA 1U2RA 1UAAA 4W9MC 3ZYCA 3U60B 1TUEA 4BFYA 2CJWB 2ZYVX 3IKJA 5EXTA 1OKKD 2QU8A 3ZD6A 4JJZA 4C0AC 4YXWD 2RGGA 4MH4A 3NG1A 2JIZA 4XJXA 4NYMR 4YMTA 1A1VA 2JJ1A 5KNDA 1KDPA 3KXKA 5FBWB 3U3OA 1N6KA 2OBNA 4QKQA 4XVUA 4GRAA 1DE0A 3WRYC 1Z8FA 2X8AA 1DEKA 1A82A 1ZRHA 2PMKA 3CRW1 1QDEA 4L8GA 1YRAA 4F92B 1YZKA 4LJ7A 5G40A 4YHHC 1N6RA 2A7QA 2OM2A 3BJIC 4IFBA 4DEXA 2XEXA 2QRNA 1XMIA 5DSZA 4GOJA 4C0SA 1LV7A 4JKYA 1G8YA 3LV8A 2GETA 1EG7A 2CCJA 1P72A 4DSUA 4PC1A 2J7KA 4G5SA 4CEIB 2FJUA 1HA3A 5DYIA 3ZZTA 4EPXA 1BIFA 1T91A 1WCV1 4LF9C 1W47A 5KYKA 1L7VC 4D25A 1ZVQA 2VA8A 3CRVA 4NCHA 1E9FA 3LX5A 3W6PA 4N3NA 3OHMA 5JEDA 5KDOA 3CKLA 2QNRA 1LB1B 3IILA 3LBIA 2F55A 2DFNA 4BZQA 3X1WA 4JVNA 4BFWA 1C4OA 3I61A 3AQ4A 1YKSA 2VTKA 4MKGA 3CF2A 4M1WA 4D80A 4BFVA 3B9PA 5B57C 1SHKA 2PZGA 4TMWA 1ONBA 1YR6A 1N5IA 4B73A 5H68A 3X1DA 3H1TA 1HH2P 1XBTA 2B92A 3LWNA 1QHNA 2GJSA 1DG1G 1G7RA 1Z6TA 1Z3IX 4V02A 3RC3A 3LY5A 2E8EA 4FW9A 1OH5A 3WMEA 2EVWX 1S1CA 2HYDA 2VSOA 2AK3A 4KHPC 1W4BA 2ZS8A 1DARA 2DBYA 3NVAA 3GJ0A 3FPAA 2QY9A 2PN2A 1UKZA 4B76A 3GLHA 3LRPA 2XAUA 4BPBA 4Z8YA 1H8ED 3U7EB 3FMPB 1GL9B 2JDIA 3PCRB 2IWHA 1R6BX 3X1XA 3ZIAA 3T1VA 4BECA 3PJRA 1XTQA 3GQBA 1G17A 4CVNA 1E2GA 5F98A 5JRZA 2F1IA 2ZI4A 4V0LA 1FX0B 1SXJA 3D3QA 4G01B 5EUQB 3NXSA 4LF6C 2QAGB 1G4AE 3CONA 4D4MA 4WZAE 3PUWA 5JI3E 1QHGA 1HYQA 3J81k 4B47A 1IN5A 2W6JA 4X66C 2YINC 2PT7A 5SZJA 1NSTA 2JLXA 4OK5A 3U3KA 1RIFA 4Q1CA 1P2UA 4PZYA 3KXLA 4AQYC 4D26A 1N32C 5FTKA 4TLBA 4D0LB 1Z47A 1BH2A 2ASBA 1ZYUA 3IPYA 3GJ6A 2O8BA 3FHCB 4NOZA 4JBXA 3C15C 1B0UA 3OFND 3IPXA 4QC2A 1VG0B 2B6HA 3SDZA 1LS1A 3QF7A 3WNCA 3GLFB 2DWPA 2BVNA 3SJZA 4MITA 1Z6YA 3SYLA 1KO7A 2X1VA 3QPWA 5CJPA 2QQEA 1ELOA 1KMHA 5FBQB 3PQCA 4X64C 2ZYUX 3R8FA 1GKYA 3RHFA 1PZNA 2CE7A 1IBLC 4ZPXA 4D0NA 3M6AA 1OIXA 2HT1A 4AK9A 3NC0C 4Q4LA 2DFTA 2WJYA 2VP9A 2A78A 2XX3A 1TU3A 1I2DA 2O5VA 1JB1A 3KJIA 1X86B 3AP3A 4F4CA 3SOPA 3I1FA 1AGRA 4LYAA 4RD6A 3D6TB 1Z28A 3U7FB 4IVQA 1G18A 1JAHA 1NRJB 1XEWX 1OSNA 2H18A 4EKDA 5IT5A 1JR3E 1VCIA 3R7WB 4JI5C 2QAGC 3WHKA 4B3MC 2VO1A 3THWA 3U7HB 5FOTA 4YMWA 3O8CA 4HAZA 4PPFA 2JGNA 4BFZA 3X2SA 1FPMA 4W5JA 1E4VA 1AJEA 1P75A 2H17A 2ZRNA 3QKUA 4GBMA 1OFUX 3JZAA 4AD8A 4QHYA 2CLDX 4DLXA 2F4VC 2ZREA 4N1AA 4L9WA 1U0HC 3R9IA 5CB6A 3SR0A 2VQEC 1MABB 3GJ5A 4ZI3A 1XMSA 1MKYA 3NC1C 2ODWA 1WB9A 5C2JB 1XTJA 1NG1A 2B7BA 1H8HD 3T1HC 2DFKB 4PR0A 5IK2A 1UM8A 5JEEA 3AH8A 3PUZA 4HI0E 3VHLB 1GDDA 2YVUA 4B2LA 1GTVA 121PA 3B1YA 5DLQC 4OHXA 1KJZA 2F43A 5E7IA 4DC9A 1IXZA 1L2TA 1AZSC 2CHVA 3KL4A 1F6BA 5DISB 2GNOA 1OXVA 2G0NA 2CDNA 1N5LA 4IOJA 4A0HA 2ANCA 1Z6GA 1CLUA 5CLLA 2HYIC 4DUYC 3QVUA 4OI2A 3EWSA 4AKGA 4E22A 4DLWA 1F2TA 2CLCX 1AKYA 1E9AA 2CVFA 4JSTA 2JATA 1GNPA 5KU1A 3QXXA 2GCPA 5GADl 1VG9B 3KZ1E 4PHFA 1XZQA 3L0IB 1J5EC 4B3SC 4Z8XA 2GBLA 5E4FA 3ADBA 1SVIA 1VG1A 1G16A 4AG6A 3VX3A 2YWHA 3K53A 2DWOA 4TZ6A 4LJ8A 2VHCA 5KSPA 1IAQA 2IYYA 3CWZA 1ZC4A 4KLNA 4JLKA 1VCNA 1WRBA 1LS6A 4XOIA 5KOYA 2WZQA 1HV8A 2ZU6A 4JYBA 4ZDJA 2JLRA 2PJRA 2ZSDA 4WIAA 1JEEA 2JCSA 4RSGA 3TQCA 2GK6A 4Q9JA 4TYWA 4TT3A 4RD0A 2IYWA 4O2RA 4DCTA 1UFQA 5E7MA 3RSLA 5FR1A 1SKYE 1E2JA 4IXMA 4OBEA 5BW8A 1GOTA 2GVZC 4V03A 4KFUA 3OFNA 1USPA 4BEBA 1HUQA 3EAQA 1EFRD 4MGKR 4XWOA 2BKEA 3MLEA 4QGGA 5JZVA 1NVXQ 4A6XA 2R6DA 2DYKA 1N6IA 1SQ5A 3IDQA 3ZVNA 5FI0B 5TB5A 4UXIA 2VHJA 3OAAD 4BRWA 1F48A 1NMXA 3SC3A 3VU9A 1N0WA 4GZLA 1XJ0A 2BOVA 1ZU4A 1KSFX 2L0XA 4ITRC 4FCWA 2IYUA 4LPKA 4UXJA 2FU5C 2WOJA 4C2UA 2OV2A 1TF7A 4IHQA 5AJVB 1IHUA 4C7OB 1SZPA 1GVNB 2OHFA 2P0EA 3KDSE 2HHHC 1EX6A 621PA 1E2NA 1R5NA 4LV5B 5F9FA 2ZSFA 4FMCF 1ZM2A 1LQLA 1W0KA 2VF7A 1U94A 2DPXA 3W8NA 1XU4A 1J2JA 4R9UC 721PA 2GJ8A 2IF0A 4LFAC 1KTVA 4JVLA 1VYVA 3CPEA 3IEVA 1L8QA 3W90A 1YZNA 4HLQB 3IBYA 1S8FA 1YZTA 3EZ9A 4PTLA 2OFOA 1TL7C 3E1SA 3WBKA 3CPJB 2WOOA 3ZDQA 4EIWA 2R8RA 3CF0A 1L4YA 3OIUA 3THOA 4YMUA 2O8FA 4X8MA 3UPUA 2VP2A 1G19A 1IXRC 1YR7A 2AN9A 2IHBA 4Q1BA 3QF4A 1YR8A 4WZBE 3FKSD 1I4TD 2PMDA 4DDWA 4WBSA 1J99A 1TEXA 1CR2A 3CO5A 3CPHA 2FPMA 3OESA 1GP2A 1HNXC 3RSOA 3ND8A 4Q7KA 1RKBA 5KTYA 2EWWA 3MD0A 3CX6A 1XNQC 2BIFA 2PZEA 2OFXA 3QKTA 4IFEA 3B5JA 2YOGA 5J40A 3FE2A 4AWXA 4O2LA 2R6FA 4BE7B 1Z07A 2OCAA 2ZI3A 1LVGA 4QXAA 3W34A 2B21A 2GF0A 3BK7A 3CRRA 4JV5C 2ZS9A 2QG6A 3VTKA 2QUZA 3QPUA 3K8YA 4MRPA 2DB3A 5BYJA 4DVGA 2QPOA 4TLDA 3U4QB 4IKEA 3CZPA 1GILA 2J7PD 2ZQ5A 1IONA 3QXJA 4A15A 3THYA 1NP6A 2QTHA 2IYLD 5GVRA 3L8ZA 3U3JA 2XNSA 1NF3A 3ETLA 1E2PA 3GLHE 3K9NA 1S1MA 3BFVA 4ZIRA 2E5LC 221PA 4ARZA 2NPFA 4M1MA 1UEIA 3K9HA 2QBYA 4A82A 1G7SA 1YZLA 2WIBA 1U8YA 3BERA 2J5XA 1A2KC 2PJZA 3FDIA 2BCGY 4HSEA 2EFHB 4EJSB 1F60A 4TL6A 1AQUA 4UNNA 4D82A 1TMKA 4C0QC 2QM8A 3PITA 5FBLB 3A4LA 5JRJA 4DUZC 4DSOA 4TQUS 2D2FA 4PC3A 1W2GA 2P6NA 4LFBC 3I72A 3KB1A 1P61B 1N6OA 4IVPA 4PPNA 4KSCA 2YYZA 3TUIC 2BC9A 3IO5A 2FSHA 2KB0A 2ZJZA 2O8EB 1E1RD 2GXQA 3QJYA 4PHGA 1KO5A 4JL6A 1ZJ6A 1RZ3A 5FTLA 3VR2A 3DPUA 1VYTA 4G3XA 2XITA 4RZUA 4FCTA 1LF5A 1ZUNB 5TXGA 3NWJA 5TMPA 5AJWA 2JASA 3RS0A 4I1VA 4LBVA 3TVTA 2FPKA 4KSBA 5JJLA 5FPYA 3ADDA 1E9BA 3RLFA 1IBMC 2G6BA 4B32A 2B8TA 4A1FA 1A5TA 2VP4A 1JQJC 1XX6A 1CR0A 5FR2A 1TUIA 1CJKC 1XEXB 4MGYR 1HURA 2E87A 3DZDA 3CRQA 3OEHD 1NN3A 3TSZA 2ZI6A 2NG1A 2WBLC 4M1YA 4N0EA 1LTQA 2P3SA 3TKLA 4AKIA 3AGPA 4S35A 1KY3A 1KYIA 5CIQA 5A5GA 3VNVA 1Q20A 1G1MA 2BMJA 3MAAC 5J47A 1KO4A 1TQDA 4ZCIA 2DY1A 1P9WA 1OXSC 2JLYA 2IHYA 4EJSC 4PC7A 1F5NA 4RD3A 5JCPA 2PLFA 3SNHA 3AVTA 1XMQC 2WICA 4JI7C 1R8SA 4HLUA 4Q00A 1WH9A 2ZUCA 3L8YA 4MDFA 1XEFA 4E09A 4LBWA 3IQWA 3T1YC 1ANKA 2A2ZA 2W2VA 3KTAB 4BZPA 4KO8A 3FKSA 5ELXA 4UQOA 1W36D 2IS6A 4AYTA 2CK3D 3NBYC 5FOWA 1BKDR 2RGAA 1ZM7A 4GI7A 3TNFA 4W7SA 1LFDB 2V1XA 4L9SA 2Y8EA 3AUXA 1E2QA 2AD5A 4GNKA 1S96A 3QXHA 1W5SA 3L43A 1XTSA 4KJZA 4BSZA 1NVVQ 4X8HA 1NG9A 4OKSA 1KNQA 3QKRA 1IOZA 1G6OA 4II7A 1IY0A 4B74A 4IDPA 1R0ZA 4DRZA 1ZC3A 1NN0A 3WYFA 3TJZA 4W5WA 1CRPA 3I4LA 2GF9A 2XTNA 4MYCA 1KK2A 4JS0A 5EE5B 1MO5A 4ZCLA 2AX4A 1VPLA 2RGNC 2IYXA 3PENA 4HDOB 2WKRA 4HUQB 1JQLB 4ON9A 3IIJA 4KYUA 521PA 4JI6C 4C4PA
chains in the Genus database with same CATH superfamily
5EWJA 3QPDA 1BCRB 4CCAA 4REOA 4DL9A 1Q0RA 3O2EA 3GEBA 4UKDA 4YCNA 1ZOOA 4NBTA 4Q03A 4DV0B 1VJGA 1XZNA 5AVOA 4B8WA 1QAMA 4OL0A 1YRHA 3BD8A 3U1VA 3CTPA 5AOVA 4L4YA 4J1TC 3BIFA 3QLUC 1P91A 3EGEA 1G8HA 3ROXA 3ENVA 4IZ6A 1SBYA 1E3JA 4BEWA 4DCJA 2JLCA 3H4IA 1L7RA 4EA9A 2YJTD 3CRNA 2IQ5A 3CT6A 3OQPA 1V4VA 3ZWDA 3DWIA 4NH0A 3VTFA 2ZJ1A 4RXMA 4HGQA 1DI0A 2IXGA 1UK8A 4LHXA 4MUBA 4P1ZA 2XZLA 1RM0A 2IELA 3UV7A 1G38A 2IQIA 3RGWS 1E1RA 5ECWA 1N2ZA 1WB4A 3UAGA 4KWCA 2H31A 4BDSA 1TJ3A 3QEMA 5EMNA 1CR1A 3GJ7A 1C3JA 3FLBA 1US8B 4PG7A 3WLHA 2FZEA 3DKVA 2HIAA 2I3DA 3E9CA 1F38A 3L0PA 3RASA 2ONCA 1MR3F 2GNPA 4LKOA 5A06A 1MOZA 1Z83A 2X2EA 5FV7A 4BJHB 1FUEA 2I76A 3HP7A 2IYQA 3ZQUA 2Z3VA 2XNDA 1KWGA 2VPTA 3DAPA 3U3XA 5BUCA 2WWWA 3MXTA 2I7XA 7MDHA 2UZ4A 1EDBA 5BN3B 3EQ8A 3FTNA 3THXB 1MC5A 5ED4A 3K0FA 1U11A 1EP9A 1PR1A 1NU6A 1SWVA 1XROA 1YA8A 1DOAA 1C14A 1KEWA 2ZTSA 1G8SA 3R1IA 3UH1A 4AS2A 3OEHA 1H5QA 5I7AA 2FWIA 4QG7A 3WQBA 4AJ4A 4EFDA 3E9RA 3HDVA 5F78A 5JS2A 2V5UA 3KTFA 5TNXA 2OLJA 4YRZA 4AJ1A 4BYMA 4C7VA 3L6EA 3JATA 4UBIA 3H2ZA 3VMFA 3U3DA 1TCBA 4V1CA 1J8QA 4UNRA 2GXUA 5HSGA 2P4UA 1W52X 3IC5A 1Z2AA 4FP9A 2Q07A 1OXUA 1LWOA 5G0TA 4Q4JA 4R2IA 1O90A 4G6ZA 2C3PA 2AJ8A 3EEIA 1C7FA 2H06A 1YCDA 1TT5B 1GU0A 3NHMA 5ES4B 2C97A 3AB8A 3H6HA 1ZR4A 5K05A 4YJ2A 2TSYB 4FFDA 2XB2A 1TW3A 4MRMA 1QTQA 5DBHX 5IWAC 2GAJA 4FT4A 1VZ3A 2O2GA 1JU9A 1SVSA 1NU8A 3ED1A 3ZDRA 1H5UA 4EHIA 4YLEA 3SHVA 1VKNA 3DFMA 1V9SA 4GBED 3VV3A 4F9TA 3CA8A 1JHPA 1LRLA 2IHUA 3O73A 1QAQA 4RK6A 4GLLA 3T0FA 3TLEA 5BNWA 5JW6A 1JBQA 5DM60 4FBLA 4YX9A 3P4XA 4X3CA 1NUSA 3TIIA 5JBIA 3RAEC 3JV7A 4R69A 3C5HA 5EEHA 1X7XB 2VDWB 3ESZA 1R4NB 4AJHA 5JJBA 1Y1TA 1GSIA 4R40A 3QHPA 1O9HA 4KFCA 5AKXA 5ALLA 4CQLB 4RADA 2DHQA 3RIEA 1QGYA 5JPIA 3PUIA 2NWQA 2V65A 5IBQA 5ALTA 3STUA 3MJCA 3SZOA 3U09A 3WL3A 3MS4A 2HTEA 1ZH8A 4IGFA 5B64A 3SIRA 1Z6XA 3O1JC 4LMAA 4U2BA 4JXJA 8OHMA 4PGHA 2Z5LA 2YS6A 2HDOA 1I6MA 1YONA 4IEEA 2HK9A 4BKPA 1IVSA 4CI0B 5I48A 3WWPA 3I2YX 5JG7A 2F8SA 3O4RA 2IS4A 5MFZA 4EGQA 1PKEA 2BFAA 4IIUA 4IZHA 4RVSA 2G63A 1TT7A 1YR1A 4L4RA 4YI5A 1VMEA 3RTCA 1E9VA 4PCLA 1OF1A 4D9MA 2X5XA 1ZO8A 3JU3A 3LW7A 1XZAA 4ZOLF 4CN9A 1EVJA 4AJPA 4Z3DA 4TXLA 1F20A 1NBEA 2JA1A 4YJ3B 3IAUA 3EWNA 4R01A 5JXGA 1J0EA 3MJDA 5EXPA 1XIVA 1EVLA 3FUVA 3PGJA 4RANA 2RH5A 2Y0CA 1TVKA 3GEGA 4KX3A 1Z56C 3BCRA 3HG7A 1RQ2A 4RA6A 3DCJA 1JOSA 1A9YA 1CY1A 2A5DA 2WKQA 1CYEA 2MCFA 4DR4B 3K8OE 3KSRA 1KP2A 4WBXC 3DDZX 1YK0A 3OZRA 3M1LA 1P4HA 5FL3A 2XB8A 5AYVA 5H7XA 1JLSA 2Q3EA 2WJ4A 2ZRMA 3RT1A 1FC0A 4B33A 5ER6A 1WY7A 1ZPDA 1NAHA 3HJUA 1JJFA 1CRLA 1HH4A 3WA7A 1DIBA 5DTQA 4HZUA 3PU6A 4IRMA 4MLZA 5DDIP 4DR3C 3ESQA 3PFGA 1ZQ9A 3JYNA 2WJZB 3W04A 1EUYA 1CQZA 1U0JA 1EFVB 2Q1TA 3BGIA 3E27A 3UA3A 4DV6B 1ST3A 3PRKE 5K01A 2PX6A 1O95A 1H1TA 2JHCA 5JWOA 3ZE0B 3N0WA 3KQMA 3MOSA 3S5UA 1COZA 3T06B 2R79A 4Y8VA 3U3RA 2G1PA 3FSEA 1N8NA 2WTEA 3JQPA 1ZU5A 2A9VA 2EOAA 4GP6A 4H3VA 4M54A 4OY3A 4RXTA 1P1IA 1U1FA 5C4GB 1AC5A 4PU0A 421PA 3IEMA 2WB2A 1CUIA 1HEIA 1SXQA 3OOSA 4MV0A 4LJ5A 3I30X 4URFA 5J4VA 4GO1A 3C6YA 2HPHA 2IU4A 2ZPAA 5ADUS 3H2BA 2FMIA 2GAOA 1W4AA 2QDXA 4LFCC 3VYTB 5C37A 4C2BA 3WIBA 4B3JA 5K09A 2VYNA 3UK6A 3OX4A 3U16A 1IZYA 1GPH1 4PNZA 1DJLA 2QL5A 2ZANA 3PC6A 1NVTA 4C5BA 4Z4GA 2A0FA 3VR1A 1JLRA 1M34E 2GX6A 3ROMA 2AEEA 1RBMA 2GUWA 2QX8A 4U5XA 4X93A 2OQ2A 1KJWA 4YRBA 1K0FA 3H1BA 5GONB 2ENWA 1U9IA 4XM1A 1RXYA 4ZANA 2B1QA 2NU9B 3B6KA 4XEHA 2BTOA 4DCUA 2FEOA 2GZMA 4OU5A 3VTAA 3KXPA 2E1PA 1W88A 4LX0A 1KVTA 1ZMOA 2JAUA 4DGSA 4JI8B 2E82A 1EM8A 3AVVA 1ZAKA 1ODKA 1T9GR 1IMOA 1NL3A 2G5TA 1E60A 3R0XA 1ZA2A 3HB4X 1I6KA 3FB1A 2FW6A 1W75A 1FNBA 2YZKA 2QB5A 4M9CA 2PFSA 3CZ5A 4BKOA 2IZZA 1XP8A 5EKXA 5MN5A 2J3IA 3H9GA 2UXBC 2BI7A 2A14A 2AFHE 4G0ZA 2YXEA 4PSUA 1TRHA 4Z3OA 3NBFA 4NY1A 2ZBGA 1KI7A 4GH5A 2GZ1A 1WNTA 1AY0A 1U1DA 4OIFA 5EMKA 4AECA 1KO8A 2ZT7A 3PUJA 4M9RA 3S3TA 5AVWA 4E1VA 1D04A 4EYEA 2G71A 2R2AA 3FNHA 3P97A 2F3UA 3ZJVA 1VDZA 1EGHA 5BSEA 2P9TA 4U2EA 3QSYA 2AFVA 1LGYA 2AFIE 3EEBA 3P9PA 2VHYA 3CT4A 3IH5A 2FE4A 3LGXA 1CRWG 1MA0A 2X0IA 3P71T 2V54A 4PBTA 3T3MB 3T5GA 2O05A 2Z4RA 5JNUA 2CHFA 4MI3A 2BBWA 4KQ9A 4FE7A 1XZBA 4X7BA 4BZWA 3OPNA 4YJFB 1GCOA 3HI4A 3LT5A 3PNYA 1XD2A 5CNMA 4BNHA 5KSWB 5LPNA 4G07A 5A3RA 2CNWA 5SZHB 3C41J 1THTA 3UT0A 2OV3A 4IIBA 1E20A 4U2CA 3AUAA 5A4AA 1P77A 2WV9A 1RRKA 1CR4A 1D2MA 3GLIB 5MN6A 1QGUA 4C3OB 4RQUA 4L07A 1N5KA 1F8FA 1P4AA 2CZCA 3FLAA 5ALPA 3RIHA 2FV8A 3G89A 4FN4A 3U4IA 5BSMA 1SUPA 2VATA 3IR7A 3QFFA 4QRHA 1OCEA 4ENQA 1BX3A 1G0NA 3BH7A 3TQSA 1ZNQO 4J0DA 3ZK9A 3HP4A 4BLRA 3IE1A 4ZV9A 3JASA 3DQPA 5HIAA 3KKZA 4PZLA 3TPZA 3AF6A 4EGJA 4BZXA 4E4TA 3GBSA 4ZRNA 1SCUB 1ENYA 2WM3A 2Z2XA 4MIEA 5GGYA 4ZDKA 3W5CA 1RRVA 4L7VA 4QHTA 1RMYA 1WTAA 4KN6A 4UEWA 1RYHA 5H80A 1RQNA 1Y89A 3PPVA 2B1RA 3FOCA 1ONPA 1U4OA 5LLSA 3RRYA 3UHOA 2H7XA 3DOIA 3ORRA 3HLTA 2DCMA 2QL6A 4WY8A 1RADA 3L4KA 2PX4A 4EM6A 4P4LA 1DIGA 1CYDA 1MOSA 3OCZA 4K05A 5CM2Z 5BQ5A 1J0AA 4PPGA 3L8FA 1NW6A 4QGAA 3AI7A 2OILA 1PLJA 2JHGA 2O7RA 3UJ3X 3EZ7A 5DBFA 3CLSD 1QE0A 1E1QD 4D44A 2XDWA 5CFLA 3PC2A 2UDPA 3WE7A 1YWGO 2G88A 5I7UA 5HHTA 2P69A 4TMKA 3EGDA 4AIIA 4CKCB 5L53A 2CKDA 2JGKA 3KT6A 2NZWA 2Z4SA 3GJSA 3ZD9A 3NH9A 1QHYA 2WF5A 1DBWA 4B7AA 2O8DB 3KZCA 2DHRA 3EQ6A 3ANLA 4JUFA 3VSCA 1F2DA 2RARA 4K0BA 3A6KA 3C3DA 3R3HA 2IS1A 2WLTA 4L2ZA 2HXSA 4FYXA 2VR1A 5ER9A 1VL8A 4JMPA 1VRWA 2QE7D 5CB4B 3DW1X 3GRUA 3OZVA 3B3QA 4RK0A 5EXEA 5ERXA 4BVBA 5BNTA 1TU4A 4WBNA 2ET6A 2IUUA 3P2JA 4TKUA 2R4QA 2I6GA 2Q27A 4KAXA 1QGAA 2C5LA 2G5GX 4M1EA 1KIMA 4QSMA 2NUPA 2RHTA 4DV5B 4LWQA 1P7CA 1H8EA 4JX8A 5BURA 2H2DA 4E2FA 4MKRA 4A16A 2CMGA 3IAM6 4TLLB 4G4SO 2VYCA 2J9XB 4V2IA 3N5KA 5ULLA 3GFTA 5DNWA 1ICIA 1PJ3A 1CJMA 4JYAC 4MHOA 3GBVA 2W2LD 3PFCA 2NT4A 4HWKA 3KZMA 4QVIA 1DJQA 1JFVA 1XO1A 4MJXA 2ZXFA 1NF8A 2JKZA 1LNZA 1RZVA 3LHKA 1W19A 3CR3C 3GPIA 4WXRA 3GBPA 4LHEA 3U4AA 4W1PA 2OO5C 4PC6A 4ZCTA 2J0UA 3WOVA 3WYCA 3A4IA 1ZVKA 1RTKA 2DU8A 3HYNA 4EJ6A 4J7XA 2OBMA 1FUGA 3RI3A 3ONWA 5JFGA 1JEYA 3ZV3A 2WSMA 2H48A 3AFOA 3DLHA 2Y1LA 2GBGA 4J6EA 4NXNB 1PF7E 5CYGA 3H6GA 2Y3IA 2HA0A 2WLSA 3H42B 1F8XA 4S1OA 3SHTA 2QROA 2RCNA 2PGNA 2N42A 5EWLA 3RTAA 2WTBA 2DT5A 4DE5A 2BE9A 4EBBA 4YYZA 2DQSA 4LXUA 1PNRA 3QLVA 2JANA 4D9HA 3GFFA 4NCKA 2Q1SA 1ESZA 1PWXA 1N92A 2H5LA 1KI3A 3L0DA 3I1JA 1AA9A 1AN0A 5D1HA 1DWUA 2PSJA 2VSYA 4DV7C 3E82A 2EC5A 3R6GA 4E2XA 5HUHA 1IXSB 3QXSA 4ARUA 3AR9A 1P5JA 1RT9A 2QYSA 2INGX 5LXTA 2AW3A 4NDNE 1GEGA 5G0SA 1U3GA 1NZFA 4INAA 4BC1A 3RO7A 4Y7CA 5JVDF 4DV4B 3NI2A 5D6OA 4NQZA 5J9FA 5DHAA 3MT8A 1NBME 3M4JA 4F4UA 3BIJA 3OCJA 2JK1A 5IBCA 5FOXA 4WZBB 1JR6A 1WLYA 4KQHA 2V7XA 4BLSA 4NCNA 3A4YA 2EP5A 3I53A 1GUYA 2H1RA 1KHHA 2AB0A 4GVLA 3U3MA 3W5JA 4DXAA 7YASA 4K6CA 4RZSA 2A4KA 3H1PA 5IJAA 4B3BA 4Q3AA 1T4GA 3HCWA 3TJRA 4CLOB 3K2QA 1EZ1A 2C95A 3IRVA 3OJOA 4AJLA 3HY3A 4LF5B 1UM9A 3CNEA 3GAAA 3OJ0A 3PXAA 4HDSA 3GW8A 2GZDA 1W85B 2VTVA 2XCRB 2XZPA 2WU8A 1JXMA 3RWBA 3RD5A 4HAUA 1D9ZA 3T12A 3TLZA 5FPQA 1JKXA 5CK4A 3WDKA 4PSDA 3BB1A 4CW7A 1SVOA 4AZVA 1EP2B 3GF4A 5IWCA 4LSGA 1JEJA 2WJ3A 1L6RA 3UV3A 3VKUA 3TNJA 2GERA 2XOXA 5E4TA 3LBYA 1QP7A 4FCVA 2YHUA 4F60A 2XDYA 4X24A 1IVYA 1JW9B 4G1VA 1PU1A 2R8YA 4QHSA 2DECA 3V55A 2OV8A 1V47A 1UBFA 5FI3A 2ECPA 3DHNA 4MCJA 5L3RA 1FRQA 3HCRA 1FYFA 1PVOA 3T7RA 2QYHA 2G1UA 5B1IA 3GGCA 3PL5A 2RHJA 1AKEA 3DR5A 1MX9A 2VZ8A 1I2ZA 4GYKA 1FMJA 3EFBA 4QJBA 3NBQA 3WJ7A 5EIEA 4GPTA 4NTZA 4FS3A 3UW1A 4MUFA 1PZGA 3LTNC 1NVVR 1W0CA 2QZ9A 3GJZA 1XMOB 3V7YA 1MEEA 1X7YA 5EP2A 1XTTA 3T34A 3KFXA 3NCHA 4DTIA 2AD1A 3PDWA 4NCJA 1CP3A 4LZPA 3MCWA 4TKVB 4UU8A 4EB3A 2AYYA 5TGTA 3A4NA 5AE2A 5E9AA 2ZJ6A 1DAHA 3MWFA 1M2GA 1XLTC 1KEPA 1T26A 2J4CA 4CYMA 1DXQA 3F47A 3PFIA 3QJ5A 3ESRA 1VBKA 3IP1A 2UXDB 5TVGA 1PNQA 2B5VA 3TK1A 4DDKA 3IV6A 1CKEA 4G5HA 5JWHA 3W7VA 4I55A 4UNPA 2O8BB 2UUAB 2XMSA 1ETHA 2WE8A 3CH5A 4MB0A 4XFJA 4CQMA 2R1UA 3HYCA 4AZ0B 1V71A 4DRXA 3HNOA 4BU0A 1Z4OA 1JAXA 3ZHOA 5I51A 1X15A 2OKGA 2X4DA 4TM7A 1GFSA 1HMPA 2SECE 3D9QX 4Q66C 3CMCO 3D8UA 4JFAA 3ZY3A 1IDN1 1KMHB 1XKLA 2AQIA 1G8MA 3O3NB 1JU4A 1UMKA 4UQLA 1G21B 2JEZA 3F49S 4RPKA 4OK6A 5AW0A 4P38A 1ORHA 3A1CA 1E96A 2BP7B 1N77A 1ADCA 1YAJA 2C7RA 3EZ2A 2Z57A 3Q87B 1E3TA 5ALQA 2OQVA 3LQYA 2CXUA 4JP8A 4OP3A 4BMYA 3UN1A 1W7AA 4FX2A 1RJEA 1JWAB 2WJ6A 1SC6A 1XMPA 3SXPA 3IALA 3OAAA 2ZYTX 4R6XA 2FX5A 1T24A 5JIBA 3MTGA 3IKTA 2CJWA 2O3QA 4RAQA 2QN3A 3RVBA 1TJ4A 3NIWA 2PMFA 4UM7A 4U5YD 2D0OB 3ZX5A 4AUKA 4DLYA 4HUJA 3AQIA 3JZDA 5DTRA 1SUAA 5ICFA 4JI3B 3UGTA 3RVJA 1U04A 3WADA 4TUYB 4RTKA 1I6LA 2GUGA 1GITA 3U3ZA 3L8HA 4BO9A 3KHUA 5LDHA 1M1YB 2PX0A 2O1XA 3L6BA 2WC1A 1J1ZA 1C81A 3CZ4A 2TMKA 4UVEA 2WHYA 1DRKA 4LHWA 2A3RA 4NK5A 3UWPA 1M7HA 5J5CA 3RS7A 3WO1A 4C89A 3OEEA 1I51A 3B78A 3EUAA 3M5DA 1JECA 4LXTA 1O6ZA 4RMGA 3SGLA 4ASUA 3ZTWA 5CT5A 5BWNA 1G3MA 4EW1A 3L7IA 1CIVA 1S2IA 3ZHUA 3OQHA 4B81A 5JHHB 1DC8A 2G6TA 1DSSG 4FM9A 1Q14A 2VJNA 1ACLA 1ZLYA 4YJ3F 3TCNA 4D6XA 1LPSA 2BZ0A 2EFGA 3DONA 5K45A 1WETA 1Y7TA 2A59A 2BCJQ 5G0VA 5INTA 2JNVA 4RKQA 5A6SA 2C77A 3PEEA 4L50A 2VSQA 2VS1A 1WMFA 2F9FA 3FF4A 4YAJA 1AGXA 1PKXA 3D8RA 4DVJA 1D6JA 2CBXA 4HWRA 1IVNA 2WF8A 4TTRA 4HWGA 1G5TA 3ZD7A 2KLBA 4WK0B 5I9SA 5A03A 1IXYA 5TSDA 3TEFA 2A1UB 1VRVA 1WKBA 3JQEA 4MHSA 4PEVA 2W6CX 5H1YA 2XWPA 5HILA 1LBHA 1NQOA 1Z7WA 1PLLA 3TM4A 3TUJC 3E9EA 1WKVA 2GN4A 1T2VA 1QVVA 4AL4A 4MGZR 1GA1A 1ENPA 2AFHA 3D5EA 3FSGA 5H81A 5CEFA 4G1FA 5B4TA 3DMNA 3HYSA 2CU6A 2ZRLA 4OFWA 4W82A 4E3WA 3REFA 3C6XA 1RPNA 1PFYA 3IQXA 4ED9A 4JUCA 5B58C 3DGFC 3FUUA 3T1QA 1WBDA 3K0KA 5LJLA 1QK3A 4PTZA 5GJBA 2AVDA 3QE4A 2C84A 1FZQA 2IHVA 2BFOA 4LE1A 4YGYA 2P9BA 3GRVA 3TEMA 2X8WA 3EXHB 1AXRA 4O5OA 5CFOA 3FYCA 1OQAA 1WULS 2AI1A 2GGSA 1E2KA 1MFZA 5EMMA 1ILWA 3IDFA 4QTYA 1QVAA 3ZUGA 2C4VA 5LOVB 3AEKB 2BFFA 3KPVA 3TRDA 2OZEA 1KK3A 5DM70 1SVLA 1Y37A 3D7NA 5LVAA 2I4IA 2Y1XA 3FHJA 2QX6A 3B1KA 4RCZA 3JYOA 1E0SA 4QBTA 1JG2A 3SKVA 5TY0A 1WDTA 3PROC 4O25A 2EV9A 3UFXA 1AGYA 2EAUA 1NTOA 1PSDA 4JXKA 4K9KA 4CTOA 1KRXA 4ZAVA 1KZYC 3A14A 3JZMA 2XRMA 1BHSA 1E3DA 2ILTA 3EC1A 4WOPA 4CKYA 4FR5A 1SOMA 4BP1A 4UTOA 4TL7A 4MV6A 3I4FA 4BQIA 3QOWA 4OKIA 1JHAA 3D0KA 1OT5A 4M1ZA 2NSLA 1JDBC 3NXKA 3CO0S 3IP5A 2VUHB 1B6RA 2BEVA 2CWDA 4O8CA 2ZZKA 5KQGA 2WAXA 1QCCA 3F71A 2O2ZA 5B53A 3VR4H 1ZLXA 2HLDD 1WXDA 5HF6A 4ER3A 2P62A 5FAXA 1A8IA 2IY8A 1NNUA 1MOPA 4NMHA 4POAA 5TF4A 2OUKA 1RFLA 1OAOC 1UBGA 1AHHA 1T9HA 1XAJA 5EPOA 1L5HA 3R7AA 4CTNA 1C0LA 4Z6KA 3EIWA 3ZU2A 2QTBA 2YHIB 5AKYA 1DEAA 5J5VA 4DN6A 1I3CA 1AUQA 1OYYA 4MQ4A 3NTQA 1UWVA 3ODGA 4YO8A 3GEPA 4TMFA 3X1ZA 2BV3A 3NUZA 4XWKA 2VHUA 2B8EA 2BH1X 2GBLC 3CUWA 3PXBA 4PX9A 3KQLA 4F9GA 3KVYA 4OM8A 4UC0A 5KC9A 3I2KA 4I99A 1FNNA 3ABSB 5JSKA 3CW2A 4RHCA 3SM3A 2Z9BA 3UMBA 3MHTA 1H2RS 3AUFA 2PVPA 2BEWB 4UDYX 5B3LA 4CL0A 2GBFA 1P7PA 2F00A 3FPGA 4CNQA 2N1BA 3IQFA 4K81B 2H4FA 3LPNA 4MAAA 3JYLA 1IJEA 1U5AA 3HWWA 4NPCA 3DBIA 1SC4A 3FETA 3KAJA 3BQ9A 3OTOB 1Z2NX 2R751 4PAGA 4MHTA 5HRAA 1DGQA 2HQBA 4QGBA 2I78A 4OVKA 3IHLA 2UZAA 1WHSB 2JAPA 5IC5A 3BICA 2CVQA 1SA0B 3LX8A 1DO2A 1E3IA 1FYWA 5DI9A 1Q50A 1YBHA 3A6PC 2QTRA 4A2WA 1X94A 2C2OA 2X6RA 3I8SA 4BNDB 5KUTA 1XDDA 4RK4A 4P7BA 3WYNA 3TDNA 3ZWWA 3PDJA 1C0PA 1TE2A 4ZO9A 4EG0A 3KUCA 3N39C 4B3GA 4N49A 4FOOA 4D4GA 4FR2A 1PRYA 2JFXA 3LC2O 3R40A 4XQCA 4L57A 5EGNA 2WMDA 2PKXA 2ATEA 1T8SA 4CI9A 3IAS1 1CDZA 2R6ZA 3QFRA 3WYAA 3D8HA 3PTLA 1S2LA 1FW8A 4F3YA 3LBAA 2WHQA 2J9ZB 4O6VA 5DEIA 4YCMA 1A9XA 1OXTA 1NBHA 2AZ4A 5AM1A 4D6YA 3S2YA 4JEMA 1S89A 1S3IA 4ZXFA 3IUQA 4CDNA 2PK3A 2FR8C 3ASVA 1M6EX 1HSZA 1Y6RA 2A9FA 2VK1A 4JP1A 4RVFA 3I04A 3N7TA 4BNWA 1NW3A 1TQ2A 3D5QA 1JALA 1AB6A 2O3UA 3WK5A 5BNFA 5JBNA 1WMDA 1ISJA 2YMPA 3BIOA 3ZNPA 4RLSA 1G6HA 3KB2A 4DR1B 3HU2A 1GU1A 3A27A 4DLVA 3GFPA 1U1IA 5IARA 1GN8A 2YV5A 1FJGC 1O87A 2GPWA 3AWDA 3LO8A 4KGXA 1RRGA 3V1YA 2VUIB 3WDMA 4EA7A 3TQQA 4X97A 5LBTA 3PTZA 3W6ZA 1OJ7A 1N5OX 3NDJA 1RZRA 5LB2A 1VECA 2OSBA 5IDXA 4ZOLA 3IKVA 4TRRA 3TE6A 3BRSA 2ZBQA 2PRJA 1XLUA 3I1IA 2RGCA 4FWBA 1SXJD 2ZUDA 5EL0A 2IEBA 4O08A 4BMSA 4F45A 3FH0A 5C1IA 1I94B 4PTYA 5DU2A 4KACA 4CQLA 1WE2A 1XN1A 2NUAA 5KTMA 2BTEA 3WGHA 1M3SA 3M6FA 2QI9C 5CDFE 5KDDA 2W6JD 4PG4A 3HI6A 5HBRA 2PD3A 3QKWA 4RDXA 3TUZC 3O4HA 2R2GA 2Q6LA 3FNEA 1NWCA 2EX0A 4R84A 2NTNA 3K9BA 3KV1A 5EHZA 1ZHHA 1N2EA 1U7HA 1IM2A 2D5BA 2DKFA 2I3BA 3C85A 1JI3A 2LV8A 4TXJA 1JL3A 1D2RA 2ZKIA 2RHWA 4RM2A 1C9MA 4UU1A 1KK1A 5CB4F 2OEPA 1CUHA 1P80A 2VYFA 2WKPA 4OD0A 1KY2A 1AT1A 3O8OB 4KVFA 1JSLA 1ZMRA 4OJQA 2QN9A 1QF7A 5G4KB 3TOXA 3JAMA 2FHPA 1YR3A 2GM5A 4ZYLA 5KAPA 4B6QA 4Y2GA 2VP3A 3N07A 2AQ8A 3AW8A 2O14A 3E5HA 3KQVA 3OQJA 4BNKA 2OCPA 3QE0A 1SZDA 4QARA 2EP7A 2I7CA 1UEJA 2WIKA 2CUZA 4RUKA 1UJMA 2OGWA 2XCIA 1T4BA 4Y1GA 4D9KA 1U0BB 3TR3A 3OC6A 3HEAA 2KWIA 1U3WA 4QTTB 5KTRA 3FPBA 4D5EA 2CXRA 4OHPA 3TW6A 3V4LA 4R9SA 2YQZA 5L40A 1ABFA 3C74A 3RU2A 4BX9A 2VYVA 2GZAA 4OJNA 1MJHA 1TZ2A 4RJIA 4X44A 5HZHA 1BVRA 1I2AA 1RG9A 1XT6A 1WDLA 2CBZA 2EEPA 2CHGA 2EW8A 4MVCA 5DLPA 4HMQA 4QU5A 4A0FA 3GZJA 1KZ7B 5ALEA 5EA2A 3WY9A 1V43A 5CW2A 4BNJA 4FGSA 4EZIA 3VC2A 1CRQA 4Z0HO 2D54A 3F6RA 5KVAA 3PVSA 1ACJA 3GFVA 5IJXA 3WWOA 1CSEE 3P0RA 4J0QA 3WZ2A 4EHBA 4GE0A 1VCOA 3TD6A 1ZMXA 3RSZA 4F1KA 1V5FA 2IE8A 1KYWA 2YXPX 2WD7A 3D2CA 4NPAA 1TM7E 2HBQA 4PCVA 3LUAA 3AESB 3G0CA 2XA9A 2Y0DA 3HNPA 4RK5A 4RVDA 5ECYA 3TQHA 1HNWB 5CH8A 1PLKA 4UAVA 3G0BA 4MV1A 1X1SA 3PSAA 1V8BA 4GBJA 3RVRA 1PWHA 4EQZA 3LZ6A 4LY3A 1OLSB 2ASEA 1RJGA 5CGZA 4QRIA 1HL3A 4W99A 3OQ1A 3FTEA 2XMDA 5HS6A 3W1EA 2B8JA 5E0KB 1XRAA 5ALYA 4L27A 1PZFA 2ESRA 3U31A 3L0OA 3OJCA 4XYGA 4YDHB 2ZZMA 4ZEOA 4DIEA 4Y6SA 1FCJA 3MRSA 3ZJYA 3DZFA 5IC6A 1YQTA 3ASYA 3HA2A 2VHZA 3KOUA 2EARA 1TYCA 3EBPA 4IIJF 2MWMA 3HO8A 3P4YA 3A70A 3O7WA 1TFRA 3VHXA 2JD0A 1EGAA 5EHGA 4K9PA 4MROA 2G82A 4CIWA 1MJ5A 3OLXA 1X9HA 4KIWA 5FOVA 1SFRA 5BUQA 4KWTA 2YWGA 3KZNA 4JZKA 1A8UA 1IOVA 2B78A 3NRCA 4UD2A 3VU3A 4F2DA 3H2GA 2JLVA 2PRIA 3HLKA 4XUEA 3WKCA 1Q0PA 4JU9A 3X2FA 4UTRA 4O2BB 5JALA 2AR7A 1ZI8A 2WWIA 2YWEA 4GGMX 3WGKA 5I4IA 3K1ZA 4XVQA 3ROKA 5HTKA 2C9BA 1Y8RB 1YZYA 1JEDA 4OI0A 4XRRA 4UHHA 2IX3A 1D1QA 1E99A 3NLLA 1QV9A 1WU8A 4Q7EA 4UBLA 5E1DA 1UMBA 2VDVE 1R0XA 3S2ZA 4JYMA 2AXNA 3EVBA 2LCQA 4EW6A 1N3YA 1RQPA 1P7YA 2D3WA 3GRRA 3KEGA 3L07A 2FMKA 3G2OA 5FUWA 4MI9A 2TECE 3UVEA 3SS8A 3JYQA 4JGIA 2F9LA 2PX5A 3ZIDA 3UJDA 4Z54A 1CV2A 3AXTA 4JBLA 1SOUA 3MBIA 4MUIA 2PXXA 4PAMA 1II8B 2J9YB 4W7HA 5EJ9A 4JA2A 2J33A 2F1HA 2O6LA 1FVFA 1VPEA 1DJOA 2QSYA 1BGWA 4DCOA 1HF3A 4TT3D 1NDHA 1DJPA 1FOEB 4KN8A 1J0BA 1TD9A 1OLOA 2ZJ3A 3TXYA 1IIBA 2Y2UA 1H42A 4B0PA 1BCSB 1KGSA 1ZSVA 1B4DA 2C3MA 2Q41A 1J22A 2A0UA 4WL0A 1VHLA 3TR6A 1ZD9A 3JQ9A 5I8PA 4I1OA 1O97C 3EA5A 4GKVA 4BVEA 3WISA 4MB2A 4Z9FA 3SBDA 4CLRB 4OBXA 3G8BA 1ZOIA 1D09A 1SB9A 4L85A 3RREA 2GASA 4K0KC 1PP4A 2HWWA 1PEKE 2E0GA 2ADMA 2FZ5A 4HRAA 4IRUB 3GVHA 4EHDA 5F7XA 1MTOA 3RUIA 3A4TA 2F1OA 1L5MA 2WJVA 4M9QA 1D2AA 4XD7D 5ALWA 2I4TA 5LKRA 3I9NA 2CXSA 4UREA 5JAIA 2GHIA 4II3A 5C7LO 4NG4A 4DV2B 2GEBA 2OTCA 2XYRA 2ZT8A 1SKBA 1RR6A 4XVHA 3K6SB 4ADSG 3NM5A 4BN5A 1VPTA 5ITVA 5LSAA 4XX0A 1K7YA 4BC0A 3DXXA 3EDRA 4R4JA 4OLBA 1AF7A 1NZJA 3L4BC 2QX9A 1Y80A 5ESXA 2CNKA 4ZO6A 1Q11A 3GLFE 5BO5A 4BV3A 4R51A 3JZFA 2N47A 2VPYA 3ED5A 2VRCA 3MRTA 2QJTA 2FRXA 4CV2A 1E79A 1O03A 1GGKA 2H7CA 3IUYA 3OFVA 4EH1A 4RPLA 2B36A 1SCBA 4OAQA 3TGWA 3PF8A 2ZRIA 1KHTA 1XEXA 3EFOA 1GNRA 1SUDA 4W1RA 3FYUA 4CMJA 1EK5A 1JLLB 1EFPA 2HA2A 5AMXA 2QGFA 4H7FA 5AOAA 3MLAA 1IPFA 3GLIE 1M2HA 3FPSA 3VDNB 4RVNA 4IR7A 2YDXA 2YWJA 4MUEA 4XYEA 5CBPA 4UEKA 1U5BA 3UX2A 4QTZA 2FPLA 3L0ZA 4AICA 1W36B 2VHQA 1E63A 1UFKA 3MWEA 4WKGA 4KFTA 3R44A 2W11A 5D1NA 3M0EA 3KXIA 1V48A 3COSA 3V6MA 1SURA 3JS5A 2D0PB 1FNMA 2P6PA 4GMXA 3RHTA 1C5KA 1EE1A 1R4MA 4QJ5A 3W5AA 3DT6A 4IS3A 2PMWB 2C8KA 3II6X 4TUYF 1DWOA 1NMQA 1SQ0A 4CIAA 2FMFA 3DOOA 1A7JA 2GK7A 1SXHA 2QZPA 3SC4A 1ZESA 4FOPA 1P3DA 2SCUA 3A4MA 3I92A 4H31A 4NZMA 2Q8QA 3CRMA 2TS1A 4XVRA 3UHJA 3VVCA 4DUGD 1HBJA 4JT4A 3KYIB 4AY2A 3K09C 2MTBA 3E9YA 2GPTA 1Z45A 3HB5X 2CNNA 3C5CA 3KKKA 1RJDA 2DEUA 4N18A 4RH3A 4GAEA 3DE0X 2UYQA 1OFIA 3C8MA 3DVLA 4F2HA 1UCFA 4M88A 3NQ41 4V38A 1Y3IA 3V46A 1P73A 1E62A 4DNQA 1W34A 2P4QA 2B25A 4HNUA 1XPRA 3WNQA 3Q0IA 4D0GA 4B3RB 3ETCA 1TQ4A 1Q84A 1FYDA 3SX0A 2QR5A 3P2EA 3V3KA 3ORHA 5HJ7A 3CEMA 4E2WA 4C4XA 4NYJQ 5FUMA 4I1PA 2PSEA 2ZRDA 1EU1A 1CUYA 2GWRA 3EBLA 3BREA 3HO6A 4LUCA 5JYCA 2G40A 3GAMA 5BW4A 3ND6A 4DSNA 2PMBA 4OGGA 5B5SA 4R2JA 3T3HA 5JVDA 3P0EA 3DO8A 4WECA 1L7XA 4D4KA 1DEXA 4YWJA 3TZHA 4YRQA 3ILSA 3WLIA 1NXQA 1E2DA 2OOSA 3KSDO 2WFLA 3HC7A 4LHZA 5KBYA 1A5ZA 3OMXA 3ADCA 4B3DA 1T29A 4WESA 3GGOA 2FJPA 4FDAA 3ZDCA 1BD3A 1QDLB 4OOFA 1MIOB 1P2VA 1BCRA 4L5JA 3UICA 3GG9A 4Y18A 1A4UA 3UK0A 2W70A 4IM7A 1JQAA 1RU3A 2QMOA 2W8ZA 2P2DA 4YB8A 4LSMA 5CG2A 2E2WA 3UT5B 2XE6A 5TMDA 5BVGB 2YRWA 3OBBA 1EVZA 2VI5A 1PJCA