1USPB

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
134
Chain Sequence
ANVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRNKIDVPADSTITARVGLQKFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
total genus 31
structure length 134
sequence length 138
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspB01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspB02
4A3FI 2E2JI 3GTJI 1TWHI 5IWAC 4LFBC 2OPLB 1RO4A 4JI4C 3S17I 4X62C 4A3CI 3IEUA 4NBHA 4NBDA 4JI1C 1IBKC 4NBEA 1TWFI 2R93I 4LF6C 4DV0C 4BBSI 3S2DI 4BBRI 3HOVI 4BY7I 1LQLA 2BJOA 2CXCA 2KZFA 4DCUA 1USPB 3PO3S 4DV1C 1I94C 2E5LC 3IEVA 4QTUA 5BR8C 2JNYA 1Y1VI 1XMOC 1USPA 4X6AI 3GTQI 3AF5A 5FLXD 1J5EC 3Q87A 2E8EA 5LMUC 1HNZC 4A3DI 1Y1VS 4DV6C 4LFCC 3VMIA 2F4VC 3I4MI 2DE6A 3CJEA 3GTKI 3RZOI 3PO3I 4Y52I 4DUZC 4DCSA 4K0KC 1NYEA 2DYJA 1N33C 4A3II 1MKYA 2HF1A 1KKGA 2OPLA 4DV2C 2NVQI 3VMGA 4JI6C 4NXNC 3GTMS 2P3YA 5A2QD 4NXMC 4MH4A 2EGTA 4LF8C 2PN2A 4A3EI 3CQZI 4BY1I 4QTTA 2HJGA 4DV4C 3K7AI 1TWCI 3GTGI 3GKQA 4B3TC 4X66C 1YUAA 2E2II 3I07A 2E7GA 2QL8A 1UKKA 4XX2A 2XR1A 3I4NI 5LMNC 5IT9D 4BXXI 2PK7A 3M4OI 3S2HI 4NBGA 1EGAA 2PT7G 3PO2I 4DR5C 1N36C 4A3JI 4DR6C 2B63I 4A3MI 4B3MC 1QYPA 4NBAA 4X65C 3LUSA 1HNWC 2R7ZI 4GKKC 2E8FA 5FLMI 3R9XA 1VLAA 1WCMI 2YU9I 2CY1A 4NOZA 3J81D 4B3RC 3JAMD 2JA5I 4DV7C 1HR0C 4JI0C 5C44I 4NBCA 3T1HC 4JI8C 4DR7C 2UXDC 2ASBA 4LF9C 1I3QI 2F4OA 2E2HI 3GTPI 4A3LI 2E8CA 1WW9A 3J80D 4LF5C 1ML8A 1I50I 4AQYC 2ZM6C 1TWAI 3HOWI 2UUCC 3S1RI 4A3KI 3GTOI 3GKUA 2JR6A 3OTOC 2R92I 1XMQC 4A3GI 3D6WA 1TWGI 1X3WA 4NBBA 3S1QI 1K0RA 3AF6A 1NUIA 2JA8I 4A93I 1QWIA 2JMPA 1FJGC 3H3VJ 3S15I 1K83I 4NB9A 3HOYI 4GKJC 2J6AA 3S1NI 1R9TI 1N34C 2JA7I 1PFTA 2JA6I 4LF4C 1JOSA 2ATWA 1ZB8A 2AKLA 2DE7A 5IP7I 1XNQC 3H0GI 4MTNA 1IBLC 1L1OC 4JI2C 5C4JI 4YHHC 3S14I 2K5RA 3U50C 4BSZA 4DR1C 4YY3C 1N2FA 3M3YI 4NBFA 1RLYA 3ESWA 2YCBA 1WF3A 4B3SC 1HH2P 1WH9A 2F4MA 3HOZI 4DUYC 4DR2C 3FKII 2ONFA 4DR3C 4DR4C 2VQFC 4NB8A 3GTMI 4LFAC 1TFIA 2RBLA 4DV3C 1PA4A 4JV5C 1L2FA 2HHHC 3VB9A 4JI3C 2VQEC 4OX9C 2DE5A 3S16I 4DCTA 1HNXC 4KHPC 3HOXI 1N32C 1SFOI 2UU9C 4DCVA 3S1MI 3HOUI 3EERA 5IP9I 1DL6A 3VMHA 4JYAC 5C3EI 5C4XI 2NVTI 2UXBC 2D7VA 4A3BI 2VUMI 4LF7C 2UUAC 1I6HI 4JI5C 4DV5C 1XNRC 2UUBC 4X64C 3R9WA 2UXCC 1IBMC 3T1YC 2NVYI 4Y7NI 1ZB9A 3RZDI 4JI7C 3GCFA 5CM2M 1Y1WI 2NVXI 3GTLI 2KPIA 1X3ZA 2JS4A
chains in the Genus database with same CATH superfamily
5AE2A 1YI21 1NJI2 4A3CI 2MMAB 5T8SA 4NBHA 4RMNA 2OTLZ 4BBYA 2K3RA 3S2DI 3HOVI 4BY7I 1I94C 2OTJ1 2E5LC 4LF8C 3PO3S 5T6BA 2ZZNA 2VZEA 5BR8C 2JNYA 1XMOC 1YIJZ 4X6AI 3AF5A 3H2TA 5LMUC 1VQL1 4LFCC 2OZKA 4TNUA 4A3DI 1PU1A 4PUIA 1QVGZ 3CD6Z 3GTKI 3G4SZ 3PO3I 4K0KC 2IZ3A 1N33C 1P4EC 1MXBA 3B7WA 4FUTA 1KKGA 3CCLZ 2NVQI 3VMGA 4WV3A 2ZAEB 1VQM1 4MH4A 1K8A2 5BSTA 1Z01A 2QREB 4BY1I 5T64A 3LNVA 2AYAA 2NCLA 4B3TC 1YUAA 2E7GA 2G2KA 5JRHA 2Q51A 3KXWA 1Q16A 3I4NI 1V60A 5IT9D 2VUGA 1X0TA 3LNOA 3M4OI 3S2HI 1V25A 2PT7G 2V45A 5BURA 4DR6C 3CCEZ 1QYPA 4NBAA 1W2BY 3IR7A 3D2LA 4KTTA 4RVHA 3JAMD 2JA5I 2QW0X 4DV7C 4L7IA 1HR0C 1M1K2 1P7LA 3T1HC 5LL6f 4RVGA 4LF9C 1I3QI 2F4OA 2E2HI 1WIIA 3J80D 3CME1 5LCIA 4MD7A 1TWAI 4A3KI 4E32A 3GTOI 2Z51A 2JR6A 4R1MA 2R92I 4EATA 1XMQC 1O93A 4A3GI 3J81b 1UWDA 3AF6A 1NUIA 3OW2Y 4A93I 2P2JA 3H3VJ 2JIQA 2JIMA 5A2Qf 4E31A 1R9TI 1Q7Y1 1QM4A 2QRCB 2VF1A 5KYTA 2ATWA 1ZB8A 3I561 2QA4Z 4MTNA 3CMEZ 3CCS1 5C4JI 2K5RA 3I551 1VQ9Z 2LIYA 4CL1A 3CC41 3GPCA 2V8JA 3M3YI 3UEBA 4DR1C 1QXFA 4NBFA 2YCBA 3O2EA 1Q821 1VQN1 2VSQA 2QVZX 1GPMA 3HKZA 1HH2P 4DG8A 4B3SC 3FKII 2ONFA 5BSVA 4NB8A 1T5HX 1PA4A 2JMOA 2PMZA 3VB9A 2VQEC 1VQ7Z 2VPZA 4DQYB 2QVXX 2KZ0A 1FLOA 3CC2Z 3HOUI 3EERA 5IP9I 1M6XA 2WAQA 5H9UA 3SO4A 3CC71 4JYAC 2UXBC 1YJNZ 1VQ5Z 4A3BI 2VUMI 4GS5A 5AE3A 1I6HI 3R9WA 5A1IA 2NVYI 3NYRA 2D27A 5IT9f 1RQFA 4JI7C 1Y1WI 1N8R1 3S82A 3G6E1 2DPLA 2JS4A 4E33A 4ISBA 3CPWY 3L95X 4RVOA 4LFBC 2OPLB 1RO4A 4K0BA 3S17I 2OOXB 4RVDA 4JI1C 5IFIA 2R93I 1KC82 4BBSI 3MZLB 1O92A 4MONA 1YIJ1 3LGXA 2Q4ZA 4BBRI 3CCQ1 1N8R2 1LQLA 4DV1C 4DCUA 2GU2A 1YUKA 4G1IA 3F3FC 3Q87A 1Y1VS 2W04A 1YITZ 3VMIA 4FTFA 2O4HA 3I4MI 3CJEA 3RZOI 4Y52I 2E9HA 2DYJA 4A3II 3IX0A 1M902 1JWHC 3CCR1 3DAYA 5A2QD 4HGZA 1YJWZ 2QKDA 1PG3A 2PN2A 1T5DX 3K7AI 4GXQA 3CC7Z 1Z03A 3FQQA 2JIPA 2QL8A 4XX2A 2PK7A 3VTNA 3CCL1 1WJ2A 4NBGA 1EGAA 3CQ1A 1VQNZ 4A3JI 1V26A 2P2QA 3CW9A 2B63I 4B3MC 3NDIA 4X65C 2R7ZI 1XRAA 2D1RA 2E8FA 5E7QA 1VLAA 1WCMI 2NAPA 3J81D 4B3RC 5CZXA 4JI0C 5C44I 4JI8C 4MD9A 2P20A 4RLQA 1O90A 4NFRA 2OTJZ 4DR7C 2UXDC 3BG1B 2ASBA 2ZZMA 3GTPI 4A3LI 3UOWA 4BC7A 4RVFA 2RPRA 3S1RI 1RG9A 5T8TA 3GKUA 1YJW1 1VQ4Z 3D6WA 1TWGI 1X3WA 1K0RA 3G6EZ 1FJGC 2RIQA 3FCEA 3S15I 1K83I 4NB9A 3OW2Z 3HOYI 2J6AA 4D56A 3I08A 1AMUA 1N34C 1PFTA 2JA6I 4EWCA 2GTHA 3TDHB 1AA6A 2RT9A 4PUHA 1XRBA 4NH1C 3G711 4OYCA 5IP7I 1L1OC 4E2WA 2E0GA 3TE5B 2M5HA 3UX3A 3ESWA 2M48A 1Y8CA 5AN9F 2WP0C 4FUQA 4D4IA 1Q7Y2 4DR3C 3KIFA 3NYQA 3MONA 1IB8A 3I55Z 1VQ91 3GTMI 4RS4A 4I9GA 1TFIA 2RBLA 4HGYA 3CCSZ 2VQFC 2HHHC 3DHVA 3A25A 4JI3C 2DE5A 4OX9C 2I3CA 3S1MI 1SIWA 3CCRZ 2OBVA 2WD9A 3VMHA 3FQMA 3RG2A 2PROA 1VQ71 1FUGA 3PBKA 3NH8A 1VQ41 3CCJZ 1QF8A 1M901 3IPLA 1XNRC 1ULTA 1IBMC 3T1YC 4Y7NI 2P2BA 1WCJA 3CC21 3GCFA 1Q862 5D1PA 3C5EA 3A26A 1TWHI 2WB1A 1S72Z 2YX1A 1VQ61 3CD61 3CCQZ 4RM2A 1YIT1 5A2Qb 5KYVA 4NBDA 1MDBA 3I56Z 1NP6A 4S1TA 3J81f 3NPDA 4LF6C 4DV0C 3PROC 3RV2A 1Q861 4E2XA 2CXCA 1USPB 2IZ4A 4QTUA 2D1SA 1USPA 1PG4A 3GTQI 5K85A 2E8EA 1HNZC 4PUGA 3UX2A 2JNVA 2H85A 1MXAA 4DCSA 5T67A 1K9M2 2QEXZ 2HF1A 4OXIA 4DV2C 2YWCA 4JI6C 2VPWA 4PZPA 4NXMC 4A3EI 3CQZI 2KDNA 4QTTA 3J7A4 1YJN1 4G36A 1FDOA 4DV4C 1TWCI 3GTGI 1WZNA 3GKQA 2D1TA 4DG9A 2E2II 3I07A 4D4GA 1K9M1 2XR1A 3CCUZ 3GR1A 4HH4A 1MD9A 5A1GA 3PO2I 3AY0A 4R1LA 2YADA 4L4QA 1HNWC 3CC4Z 1XS3A 4GKKC 5FLMI 2HU9A 2CY1A 4TPSB 1XRCA 4NOZA 1W2BZ 3FCCA 1VQO1 1YI2Z 5BSRA 3CPWZ 2KI7B 1LCIA 1KD12 5KEIA 2M5OA 2E8CA 1K8A1 5BSUA 5GTDA 1I50I 4AQYC 2ZM6C 2Y4NA 3CCM1 3CW8X 2UUCC 1JJ2Y 4PHTA 3N2QA 3OTOC 3TR3A 2GTIA 1VQ51 4D57A 5FLXb 1VQ8Z 1S7MA 2JA8I 1QWIA 3CMA1 1YJ7A 2CU6A 5BUQA 2MCQA 4LF4C 1VQPZ 4ZJZA 2YWBA 2DE7A 4R0MA 4JI2C 2V8KA 4YHHC 3U50C 2R6MA 4MRIA 4YY3C 1N2FA 3CCE1 1RLYA 4KTVA 4DUYC 4E30A 3HOZI 2DHMA 4DR4C 1M1K1 1VQK1 2P2MA 4LFAC 4ZLPA 2QA41 1NY8A 3KIHA 1L2FA 4KHPC 3EEDA 4I9FA 4IR7A 3GR0A 1RO2A 1RO0A 3HOXI 3R44A 1VQMZ 3T4NB 4DCVA 2P28A 1DL6A 2UU9C 4IZ6A 2VPYA 1BA3A 2NVTI 4U5YD 4RM3A 3N54B 2V8IA 4LF7C 2UUAC 4JI5C 4RV9A 4DV5C 2UXCC 3BG0B 4RLFA 3RZDI 1VQLZ 5CM2M 3CMAZ 2NVXI 1KRLA 5BUSA 2KPIA 4A3FI 2E2JI 3GTJI 3VNSA 5IWAC 2LFUA 1KQSZ 2QRDB 4JI4C 4X62C 3IEUA 1RY2A 2AYDA 4NXNC 1YJ91 1IBKC 4NBEA 1TWFI 3J80b 1FDIA 4LE5A 4PROC 4DK1A 2BJOA 2KZFA 3IEVA 1VEHA 2O53A 3JAMb 1MXCA 1Y1VI 1J5EC 5FLXD 3DLPX 2D28C 4DV6C 3K6RA 1ZH1A 2F4VC 2DE6A 2OO4A 2Y27A 2E7ZA 4DUZC 1NYEA 2M6NA 4DGLA 1KQSY 1MKYA 2MM9A 1VQ81 2OPLA 1Q812 4ODJA 4RVNA 5IT9b 3NDJA 3CCU1 3GTMS 2P3YA 3L8CA 3PESA 5D1OB 5CZVA 2EGTA 2JUBA 3A9VA 3TUFA 4WS9A 1QVFZ 5D1OA 2HJGA 3CCJ1 2Y4OA 1Q811 4X66C 2Y0SA 3G4S1 1Z02A 2QR1B 3ETCA 1KC81 1UKKA 3NH4A 5LMNC 4BXXI 1MDFA 3CXCZ 3TQIA 1VQOZ 3IF8A 4DR5C 2OOYB 1N36C 4G37A 3ETOA 4L2ZA 4A3MI 4GXRA 1TH5A 2QLVB 3LUSA 3UZ0A 3R9XA 2OTL1 2YU9I 3EQ6A 2V3VA 1VQP1 3F3PC 4NBCA 3CXCY 2V7BA 1XHJA 3IMLA 2W03A 3A4IA 3LAXA 1WW9A 4LF5C 1ML8A 2D1QA 2IV2X 4E2YA 3G71Z 1K731 3HOWI 3CCV1 1VQ6Z 5BSMA 1S721 3S1QI 4NBBA 3MZKB 1NJI1 2QEX1 2JMPA 3TDEA 2P02A 4NDNA 5A19A 4GKJC 3S1NI 3E7XA 4AYBA 2RHBA 3D9XA 2JA7I 3CCMZ 3E7WA 3CQ2A 1JOSA 1Q822 1YJ9Z 2AKLA 1XNQC 3H0GI 1IBLC 1RNIA 2PM9A 3S14I 4BSZA 1VQKZ 5DV9A 2JIRA 1M6XC 1K732 5AE1A 3IFUA 2LEXA 1WF3A 4BCAA 3NFZA 5FLXf 2F4MA 2VPXA 3P5JB 1WH9A 1O9TA 3A9UA 4DR2C 4MXUA 3VNRA 1YHQZ 4DV3C 1QVFY 2JIOA 1P4EA 4JV5C 5ADZA 4HPVA 5K8FA 3S16I 1HNXC 3JAMf 4MD8A 4DCTA 1N32C 1SFOI 4JM1A 3NI2A 3VNQA 5BSWA 1P9NA 3CQ3A 4E2ZA 5C3EI 3NH5A 5C4XI 3J80f 1JJ2Z 1QVGY 2D7VA 1KD11 3QWUA 3CCVZ 2QVYX 2P2FA 3G7SA 2UUBC 4X64C 1YHQ1 2BH1X 1ZB9A 3GTLI 4BC9A 1X3ZA
chains in the Genus database with same CATH topology
5AE2A 1YI21 1NJI2 4A3CI 5T8SA 4NBHA 4RMNA 2OTLZ 4BBYA 2K3RA 3S2DI 3HOVI 4BY7I 1I94C 2OTJ1 2E5LC 4LF8C 3PO3S 5T6BA 2VZEA 5BR8C 2JNYA 1XMOC 1YIJZ 4X6AI 3AF5A 3H2TA 5LMUC 1VQL1 4LFCC 2OZKA 4TNUA 4A3DI 1QVGZ 3CD6Z 3GTKI 3G4SZ 3PO3I 4K0KC 2IZ3A 1N33C 1MXBA 3B7WA 4FUTA 1KKGA 3CCLZ 2NVQI 3VMGA 4WV3A 2ZAEB 1VQM1 4MH4A 1K8A2 5BSTA 1Z01A 2QREB 4BY1I 5T64A 3LNVA 2AYAA 4B3TC 1YUAA 2E7GA 2G2KA 5JRHA 2Q51A 3KXWA 3I4NI 5IT9D 2VUGA 1X0TA 3M4OI 3S2HI 1V25A 2PT7G 5BURA 4DR6C 3CCEZ 1QYPA 4NBAA 1W2BY 4KTTA 4RVHA 3JAMD 2JA5I 2QW0X 4DV7C 4L7IA 1HR0C 1M1K2 1P7LA 3T1HC 5LL6f 4RVGA 4LF9C 1I3QI 2F4OA 2E2HI 1WIIA 3J80D 3CME1 4MD7A 1TWAI 4A3KI 4E32A 3GTOI 2JR6A 4R1MA 2R92I 4EATA 1XMQC 1O93A 4A3GI 3J81b 3AF6A 1NUIA 3OW2Y 4A93I 2P2JA 3H3VJ 5A2Qf 4E31A 1R9TI 1Q7Y1 1QM4A 2QRCB 2VF1A 5KYTA 2ATWA 1ZB8A 3I561 2QA4Z 4MTNA 3CMEZ 3CCS1 5C4JI 2K5RA 1VQ9Z 2LIYA 4CL1A 3I551 3CC41 3GPCA 2V8JA 3M3YI 4DR1C 4NBFA 2YCBA 1Q821 1VQN1 2VSQA 2QVZX 1GPMA 3HKZA 1HH2P 4DG8A 4B3SC 3FKII 2ONFA 5BSVA 4NB8A 1T5HX 1PA4A 2JMOA 2PMZA 3VB9A 2VQEC 1VQ7Z 2QVXX 4DQYB 3CC2Z 3HOUI 3EERA 5IP9I 2WAQA 5H9UA 3SO4A 3CC71 4JYAC 2UXBC 1YJNZ 1VQ5Z 4A3BI 2VUMI 4GS5A 5AE3A 1I6HI 3R9WA 5A1IA 2NVYI 3NYRA 2D27A 5IT9f 1RQFA 4JI7C 1Y1WI 1N8R1 3S82A 3G6E1 2DPLA 2JS4A 4E33A 4ISBA 3CPWY 3L95X 4RVOA 4LFBC 2OPLB 1RO4A 4K0BA 3S17I 2OOXB 4RVDA 4JI1C 5IFIA 2R93I 1KC82 4BBSI 3MZLB 1O92A 4MONA 1YIJ1 3LGXA 2Q4ZA 4BBRI 3CCQ1 1N8R2 1LQLA 4DV1C 4DCUA 2GU2A 1YUKA 4G1IA 3F3FC 3Q87A 1Y1VS 2W04A 1YITZ 3VMIA 4FTFA 2O4HA 3I4MI 3CJEA 3RZOI 4Y52I 2E9HA 2DYJA 4A3II 3IX0A 1M902 1JWHC 3CCR1 3DAYA 5A2QD 4HGZA 1YJWZ 2QKDA 1PG3A 2PN2A 1T5DX 3K7AI 4GXQA 3CC7Z 1Z03A 3FQQA 2QL8A 4XX2A 2PK7A 3VTNA 3CCL1 4NBGA 1EGAA 1VQNZ 4A3JI 1V26A 2P2QA 3CW9A 2B63I 4B3MC 3NDIA 4X65C 2R7ZI 1XRAA 2D1RA 2E8FA 5E7QA 1VLAA 1WCMI 3J81D 4B3RC 5CZXA 4JI0C 5C44I 4JI8C 4MD9A 2P20A 4RLQA 1O90A 4NFRA 2OTJZ 4DR7C 2UXDC 3BG1B 2ASBA 3GTPI 4A3LI 3UOWA 4BC7A 4RVFA 2RPRA 3S1RI 1RG9A 5T8TA 3GKUA 1YJW1 1VQ4Z 3D6WA 1TWGI 1X3WA 1K0RA 3G6EZ 1FJGC 2RIQA 3FCEA 3S15I 1K83I 4NB9A 3OW2Z 3HOYI 2J6AA 4D56A 3I08A 1AMUA 1N34C 1PFTA 2JA6I 4EWCA 2GTHA 3TDHB 2RT9A 1XRBA 4NH1C 3G711 4OYCA 5IP7I 1L1OC 4E2WA 2E0GA 3TE5B 3ESWA 2M48A 5AN9F 2WP0C 4FUQA 4D4IA 1Q7Y2 4DR3C 3KIFA 3NYQA 3MONA 3I55Z 1VQ91 3GTMI 4RS4A 4I9GA 1TFIA 2RBLA 4HGYA 3CCSZ 2VQFC 2HHHC 3DHVA 4JI3C 4OX9C 2DE5A 2I3CA 3S1MI 3CCRZ 2OBVA 2WD9A 3VMHA 3FQMA 3RG2A 2PROA 1VQ71 1FUGA 3PBKA 3NH8A 1VQ41 3CCJZ 1QF8A 1M901 3IPLA 1XNRC 1ULTA 1IBMC 3T1YC 4Y7NI 2P2BA 3CC21 3GCFA 1Q862 5D1PA 3C5EA 1TWHI 2WB1A 1S72Z 1VQ61 3CD61 3CCQZ 4RM2A 1YIT1 5A2Qb 5KYVA 4NBDA 1MDBA 3I56Z 1NP6A 4S1TA 3J81f 3NPDA 4LF6C 4DV0C 3PROC 3RV2A 1Q861 4E2XA 2CXCA 1USPB 2IZ4A 4QTUA 2D1SA 1USPA 1PG4A 3GTQI 5K85A 2E8EA 1HNZC 2H85A 1MXAA 4DCSA 5T67A 1K9M2 2QEXZ 2HF1A 4OXIA 4DV2C 2YWCA 4JI6C 4PZPA 4NXMC 4A3EI 3CQZI 4QTTA 3J7A4 1YJN1 4G36A 4DV4C 1TWCI 3GTGI 3GKQA 2D1TA 4DG9A 2E2II 3I07A 4D4GA 1K9M1 2XR1A 3CCUZ 3GR1A 4HH4A 1MD9A 5A1GA 3PO2I 4R1LA 2YADA 4L4QA 1HNWC 3CC4Z 4GKKC 5FLMI 2HU9A 2CY1A 4TPSB 1XRCA 4NOZA 1W2BZ 3FCCA 1VQO1 1YI2Z 5BSRA 3CPWZ 2KI7B 1LCIA 1KD12 5KEIA 2E8CA 1K8A1 5BSUA 5GTDA 1I50I 4AQYC 2ZM6C 2Y4NA 3CCM1 3CW8X 2UUCC 1JJ2Y 4PHTA 3N2QA 3OTOC 2GTIA 1VQ51 4D57A 5FLXb 1VQ8Z 1S7MA 2JA8I 1QWIA 3CMA1 1YJ7A 5BUQA 4LF4C 1VQPZ 4ZJZA 2YWBA 2DE7A 4R0MA 4JI2C 2V8KA 4YHHC 3U50C 2R6MA 4MRIA 4YY3C 1N2FA 3CCE1 1RLYA 4KTVA 4DUYC 4E30A 3HOZI 4DR4C 1M1K1 1VQK1 2P2MA 4LFAC 4ZLPA 2QA41 3KIHA 1L2FA 4KHPC 3EEDA 4I9FA 4IR7A 3GR0A 1RO2A 1RO0A 3HOXI 3R44A 1VQMZ 3T4NB 4DCVA 2P28A 1DL6A 2UU9C 4IZ6A 1BA3A 2NVTI 4U5YD 4RM3A 3N54B 2V8IA 4LF7C 2UUAC 4JI5C 4RV9A 4DV5C 2UXCC 3BG0B 4RLFA 3RZDI 1VQLZ 5CM2M 3CMAZ 2NVXI 1KRLA 5BUSA 2KPIA 4A3FI 2E2JI 3GTJI 3VNSA 5IWAC 2LFUA 1KQSZ 2QRDB 4JI4C 4X62C 3IEUA 1RY2A 4NXNC 1YJ91 1IBKC 4NBEA 1TWFI 3J80b 4LE5A 4PROC 4DK1A 2BJOA 2KZFA 3IEVA 2O53A 3JAMb 1MXCA 1Y1VI 1J5EC 5FLXD 3DLPX 2D28C 4DV6C 1ZH1A 2F4VC 2DE6A 2OO4A 2Y27A 4DUZC 1NYEA 2M6NA 4DGLA 1KQSY 1MKYA 4ODJA 1VQ81 2OPLA 1Q812 4RVNA 5IT9b 3NDJA 3CCU1 3GTMS 2P3YA 3L8CA 3PESA 5D1OB 5CZVA 2EGTA 2JUBA 3A9VA 3TUFA 4WS9A 1QVFZ 5D1OA 2HJGA 3CCJ1 2Y4OA 1Q811 4X66C 2Y0SA 3G4S1 1Z02A 2QR1B 3ETCA 1KC81 1UKKA 3NH4A 5LMNC 4BXXI 1MDFA 3CXCZ 3TQIA 1VQOZ 3IF8A 4DR5C 2OOYB 1N36C 4G37A 3ETOA 4L2ZA 4A3MI 4GXRA 2QLVB 3LUSA 3UZ0A 3R9XA 2OTL1 2YU9I 3EQ6A 1VQP1 3F3PC 4NBCA 3CXCY 2V7BA 3IMLA 2W03A 3A4IA 3LAXA 1WW9A 4LF5C 1ML8A 2D1QA 4E2YA 3G71Z 1K731 3HOWI 3CCV1 1VQ6Z 5BSMA 1S721 3S1QI 4NBBA 3MZKB 1NJI1 2QEX1 2JMPA 3TDEA 2P02A 4NDNA 5A19A 4GKJC 3S1NI 3E7XA 4AYBA 2RHBA 3D9XA 2JA7I 3CCMZ 3E7WA 1JOSA 1Q822 1YJ9Z 2AKLA 1XNQC 3H0GI 1IBLC 1RNIA 2PM9A 3S14I 4BSZA 1VQKZ 5DV9A 1K732 5AE1A 3IFUA 1WF3A 4BCAA 3NFZA 5FLXf 2F4MA 1WH9A 3P5JB 4DR2C 1O9TA 3A9UA 4MXUA 3VNRA 1YHQZ 4DV3C 1QVFY 4JV5C 5ADZA 4HPVA 5K8FA 3S16I 1HNXC 3JAMf 4MD8A 4DCTA 1N32C 1SFOI 4JM1A 3NI2A 3VNQA 5BSWA 1P9NA 4E2ZA 5C3EI 3NH5A 5C4XI 3J80f 1JJ2Z 1QVGY 2D7VA 1KD11 3QWUA 3CCVZ 2QVYX 2P2FA 3G7SA 2UUBC 4X64C 1YHQ1 2BH1X 1ZB9A 3GTLI 4BC9A 1X3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F I;  2E2J I;  3GTJ I;  1TWH I;  5IWA C;  4LFB C;  2OPL B;  1RO4 A;  4JI4 C;  3S17 I;  4X62 C;  4A3C I;  3IEU A;  4NBH A;  4NBD A;  4JI1 C;  1IBK C;  4NBE A;  1TWF I;  2R93 I;  4LF6 C;  4DV0 C;  4BBS I;  3S2D I;  4BBR I;  3HOV I;  4BY7 I;  1LQL A;  2BJO A;  2CXC A;  2KZF A;  4DCU A;  1USP B;  3PO3 S;  4DV1 C;  1I94 C;  2E5L C;  3IEV A;  4QTU A;  5BR8 C;  2JNY A;  1Y1V I;  1XMO C;  1USP A;  4X6A I;  3GTQ I;  3AF5 A;  5FLX D;  1J5E C;  3Q87 A;  2E8E A;  5LMU C;  1HNZ C;  4A3D I;  1Y1V S;  4DV6 C;  4LFC C;  3VMI A;  2F4V C;  3I4M I;  2DE6 A;  3CJE A;  3GTK I;  3RZO I;  3PO3 I;  4Y52 I;  4DUZ C;  4DCS A;  4K0K C;  1NYE A;  2DYJ A;  1N33 C;  4A3I I;  1MKY A;  2HF1 A;  1KKG A;  2OPL A;  4DV2 C;  2NVQ I;  3VMG A;  4JI6 C;  4NXN C;  3GTM S;  2P3Y A;  5A2Q D;  4NXM C;  4MH4 A;  2EGT A;  4LF8 C;  2PN2 A;  4A3E I;  3CQZ I;  4BY1 I;  4QTT A;  2HJG A;  4DV4 C;  3K7A I;  1TWC I;  3GTG I;  3GKQ A;  4B3T C;  4X66 C;  1YUA A;  2E2I I;  3I07 A;  2E7G A;  2QL8 A;  1UKK A;  4XX2 A;  2XR1 A;  3I4N I;  5LMN C;  5IT9 D;  4BXX I;  2PK7 A;  3M4O I;  3S2H I;  4NBG A;  1EGA A;  2PT7 G;  3PO2 I;  4DR5 C;  1N36 C;  4A3J I;  4DR6 C;  2B63 I;  4A3M I;  4B3M C;  1QYP A;  4NBA A;  4X65 C;  3LUS A;  1HNW C;  2R7Z I;  4GKK C;  2E8F A;  5FLM I;  3R9X A;  1VLA A;  1WCM I;  2YU9 I;  2CY1 A;  4NOZ A;  3J81 D;  4B3R C;  3JAM D;  2JA5 I;  4DV7 C;  1HR0 C;  4JI0 C;  5C44 I;  4NBC A;  3T1H C;  4JI8 C;  4DR7 C;  2UXD C;  2ASB A;  4LF9 C;  1I3Q I;  2F4O A;  2E2H I;  3GTP I;  4A3L I;  2E8C A;  1WW9 A;  3J80 D;  4LF5 C;  1ML8 A;  1I50 I;  4AQY C;  2ZM6 C;  1TWA I;  3HOW I;  2UUC C;  3S1R I;  4A3K I;  3GTO I;  3GKU A;  2JR6 A;  3OTO C;  2R92 I;  1XMQ C;  4A3G I;  3D6W A;  1TWG I;  1X3W A;  4NBB A;  3S1Q I;  1K0R A;  3AF6 A;  1NUI A;  2JA8 I;  4A93 I;  1QWI A;  2JMP A;  1FJG C;  3H3V J;  3S15 I;  1K83 I;  4NB9 A;  3HOY I;  4GKJ C;  2J6A A;  3S1N I;  1R9T I;  1N34 C;  2JA7 I;  1PFT A;  2JA6 I;  4LF4 C;  1JOS A;  2ATW A;  1ZB8 A;  2AKL A;  2DE7 A;  5IP7 I;  1XNQ C;  3H0G I;  4MTN A;  1IBL C;  1L1O C;  4JI2 C;  5C4J I;  4YHH C;  3S14 I;  2K5R A;  3U50 C;  4BSZ A;  4DR1 C;  4YY3 C;  1N2F A;  3M3Y I;  4NBF A;  1RLY A;  3ESW A;  2YCB A;  1WF3 A;  4B3S C;  1HH2 P;  1WH9 A;  2F4M A;  3HOZ I;  4DUY C;  4DR2 C;  3FKI I;  2ONF A;  4DR3 C;  4DR4 C;  2VQF C;  4NB8 A;  3GTM I;  4LFA C;  1TFI A;  2RBL A;  4DV3 C;  1PA4 A;  4JV5 C;  1L2F A;  2HHH C;  3VB9 A;  4JI3 C;  2VQE C;  4OX9 C;  2DE5 A;  3S16 I;  4DCT A;  1HNX C;  4KHP C;  3HOX I;  1N32 C;  1SFO I;  2UU9 C;  4DCV A;  3S1M I;  3HOU I;  3EER A;  5IP9 I;  1DL6 A;  3VMH A;  4JYA C;  5C3E I;  5C4X I;  2NVT I;  2UXB C;  2D7V A;  4A3B I;  2VUM I;  4LF7 C;  2UUA C;  1I6H I;  4JI5 C;  4DV5 C;  1XNR C;  2UUB C;  4X64 C;  3R9W A;  2UXC C;  1IBM C;  3T1Y C;  2NVY I;  4Y7N I;  1ZB9 A;  3RZD I;  4JI7 C;  3GCF A;  5CM2 M;  1Y1W I;  2NVX I;  3GTL I;  2KPI A;  1X3Z A;  2JS4 A; 
#chains in the Genus database with same CATH topology
 5AE2 A;  1YI2 1;  1NJI 2;  4A3C I;  2MMA B;  5T8S A;  4NBH A;  4RMN A;  2OTL Z;  4BBY A;  2K3R A;  3S2D I;  3HOV I;  4BY7 I;  1I94 C;  2OTJ 1;  2E5L C;  4LF8 C;  3PO3 S;  5T6B A;  2ZZN A;  2VZE A;  5BR8 C;  2JNY A;  1XMO C;  1YIJ Z;  4X6A I;  3AF5 A;  3H2T A;  5LMU C;  1VQL 1;  4LFC C;  2OZK A;  4TNU A;  4A3D I;  1PU1 A;  4PUI A;  1QVG Z;  3CD6 Z;  3GTK I;  3G4S Z;  3PO3 I;  4K0K C;  2IZ3 A;  1N33 C;  1P4E C;  1MXB A;  3B7W A;  4FUT A;  1KKG A;  3CCL Z;  2NVQ I;  3VMG A;  4WV3 A;  2ZAE B;  1VQM 1;  4MH4 A;  1K8A 2;  5BST A;  1Z01 A;  2QRE B;  4BY1 I;  5T64 A;  3LNV A;  2AYA A;  2NCL A;  4B3T C;  1YUA A;  2E7G A;  2G2K A;  5JRH A;  2Q51 A;  3KXW A;  1Q16 A;  3I4N I;  1V60 A;  5IT9 D;  2VUG A;  1X0T A;  3LNO A;  3M4O I;  3S2H I;  1V25 A;  2PT7 G;  2V45 A;  5BUR A;  4DR6 C;  3CCE Z;  1QYP A;  4NBA A;  1W2B Y;  3IR7 A;  3D2L A;  4KTT A;  4RVH A;  3JAM D;  2JA5 I;  2QW0 X;  4DV7 C;  4L7I A;  1HR0 C;  1M1K 2;  1P7L A;  3T1H C;  5LL6 f;  4RVG A;  4LF9 C;  1I3Q I;  2F4O A;  2E2H I;  1WII A;  3J80 D;  3CME 1;  5LCI A;  4MD7 A;  1TWA I;  4A3K I;  4E32 A;  3GTO I;  2Z51 A;  2JR6 A;  4R1M A;  2R92 I;  4EAT A;  1XMQ C;  1O93 A;  4A3G I;  3J81 b;  1UWD A;  3AF6 A;  1NUI A;  3OW2 Y;  4A93 I;  2P2J A;  3H3V J;  2JIQ A;  2JIM A;  5A2Q f;  4E31 A;  1R9T I;  1Q7Y 1;  1QM4 A;  2QRC B;  2VF1 A;  5KYT A;  2ATW A;  1ZB8 A;  3I56 1;  2QA4 Z;  4MTN A;  3CME Z;  3CCS 1;  5C4J I;  2K5R A;  3I55 1;  1VQ9 Z;  2LIY A;  4CL1 A;  3CC4 1;  3GPC A;  2V8J A;  3M3Y I;  3UEB A;  4DR1 C;  1QXF A;  4NBF A;  2YCB A;  3O2E A;  1Q82 1;  1VQN 1;  2VSQ A;  2QVZ X;  1GPM A;  3HKZ A;  1HH2 P;  4DG8 A;  4B3S C;  3FKI I;  2ONF A;  5BSV A;  4NB8 A;  1T5H X;  1PA4 A;  2JMO A;  2PMZ A;  3VB9 A;  2VQE C;  1VQ7 Z;  2VPZ A;  4DQY B;  2QVX X;  2KZ0 A;  1FLO A;  3CC2 Z;  3HOU I;  3EER A;  5IP9 I;  1M6X A;  2WAQ A;  5H9U A;  3SO4 A;  3CC7 1;  4JYA C;  2UXB C;  1YJN Z;  1VQ5 Z;  4A3B I;  2VUM I;  4GS5 A;  5AE3 A;  1I6H I;  3R9W A;  5A1I A;  2NVY I;  3NYR A;  2D27 A;  5IT9 f;  1RQF A;  4JI7 C;  1Y1W I;  1N8R 1;  3S82 A;  3G6E 1;  2DPL A;  2JS4 A;  4E33 A;  4ISB A;  3CPW Y;  3L95 X;  4RVO A;  4LFB C;  2OPL B;  1RO4 A;  4K0B A;  3S17 I;  2OOX B;  4RVD A;  4JI1 C;  5IFI A;  2R93 I;  1KC8 2;  4BBS I;  3MZL B;  1O92 A;  4MON A;  1YIJ 1;  3LGX A;  2Q4Z A;  4BBR I;  3CCQ 1;  1N8R 2;  1LQL A;  4DV1 C;  4DCU A;  2GU2 A;  1YUK A;  4G1I A;  3F3F C;  3Q87 A;  1Y1V S;  2W04 A;  1YIT Z;  3VMI A;  4FTF A;  2O4H A;  3I4M I;  3CJE A;  3RZO I;  4Y52 I;  2E9H A;  2DYJ A;  4A3I I;  3IX0 A;  1M90 2;  1JWH C;  3CCR 1;  3DAY A;  5A2Q D;  4HGZ A;  1YJW Z;  2QKD A;  1PG3 A;  2PN2 A;  1T5D X;  3K7A I;  4GXQ A;  3CC7 Z;  1Z03 A;  3FQQ A;  2JIP A;  2QL8 A;  4XX2 A;  2PK7 A;  3VTN A;  3CCL 1;  1WJ2 A;  4NBG A;  1EGA A;  3CQ1 A;  1VQN Z;  4A3J I;  1V26 A;  2P2Q A;  3CW9 A;  2B63 I;  4B3M C;  3NDI A;  4X65 C;  2R7Z I;  1XRA A;  2D1R A;  2E8F A;  5E7Q A;  1VLA A;  1WCM I;  2NAP A;  3J81 D;  4B3R C;  5CZX A;  4JI0 C;  5C44 I;  4JI8 C;  4MD9 A;  2P20 A;  4RLQ A;  1O90 A;  4NFR A;  2OTJ Z;  4DR7 C;  2UXD C;  3BG1 B;  2ASB A;  2ZZM A;  3GTP I;  4A3L I;  3UOW A;  4BC7 A;  4RVF A;  2RPR A;  3S1R I;  1RG9 A;  5T8T A;  3GKU A;  1YJW 1;  1VQ4 Z;  3D6W A;  1TWG I;  1X3W A;  1K0R A;  3G6E Z;  1FJG C;  2RIQ A;  3FCE A;  3S15 I;  1K83 I;  4NB9 A;  3OW2 Z;  3HOY I;  2J6A A;  4D56 A;  3I08 A;  1AMU A;  1N34 C;  1PFT A;  2JA6 I;  4EWC A;  2GTH A;  3TDH B;  1AA6 A;  2RT9 A;  4PUH A;  1XRB A;  4NH1 C;  3G71 1;  4OYC A;  5IP7 I;  1L1O C;  4E2W A;  2E0G A;  3TE5 B;  2M5H A;  3UX3 A;  3ESW A;  2M48 A;  1Y8C A;  5AN9 F;  2WP0 C;  4FUQ A;  4D4I A;  1Q7Y 2;  4DR3 C;  3KIF A;  3NYQ A;  3MON A;  1IB8 A;  3I55 Z;  1VQ9 1;  3GTM I;  4RS4 A;  4I9G A;  1TFI A;  2RBL A;  4HGY A;  3CCS Z;  2VQF C;  2HHH C;  3DHV A;  3A25 A;  4JI3 C;  2DE5 A;  4OX9 C;  2I3C A;  3S1M I;  1SIW A;  3CCR Z;  2OBV A;  2WD9 A;  3VMH A;  3FQM A;  3RG2 A;  2PRO A;  1VQ7 1;  1FUG A;  3PBK A;  3NH8 A;  1VQ4 1;  3CCJ Z;  1QF8 A;  1M90 1;  3IPL A;  1XNR C;  1ULT A;  1IBM C;  3T1Y C;  4Y7N I;  2P2B A;  1WCJ A;  3CC2 1;  3GCF A;  1Q86 2;  5D1P A;  3C5E A;  3A26 A;  1TWH I;  2WB1 A;  1S72 Z;  2YX1 A;  1VQ6 1;  3CD6 1;  3CCQ Z;  4RM2 A;  1YIT 1;  5A2Q b;  5KYV A;  4NBD A;  1MDB A;  3I56 Z;  1NP6 A;  4S1T A;  3J81 f;  3NPD A;  4LF6 C;  4DV0 C;  3PRO C;  3RV2 A;  1Q86 1;  4E2X A;  2CXC A;  1USP B;  2IZ4 A;  4QTU A;  2D1S A;  1USP A;  1PG4 A;  3GTQ I;  5K85 A;  2E8E A;  1HNZ C;  4PUG A;  3UX2 A;  2JNV A;  2H85 A;  1MXA A;  4DCS A;  5T67 A;  1K9M 2;  2QEX Z;  2HF1 A;  4OXI A;  4DV2 C;  2YWC A;  4JI6 C;  2VPW A;  4PZP A;  4NXM C;  4A3E I;  3CQZ I;  2KDN A;  4QTT A;  3J7A 4;  1YJN 1;  4G36 A;  1FDO A;  4DV4 C;  1TWC I;  3GTG I;  1WZN A;  3GKQ A;  2D1T A;  4DG9 A;  2E2I I;  3I07 A;  4D4G A;  1K9M 1;  2XR1 A;  3CCU Z;  3GR1 A;  4HH4 A;  1MD9 A;  5A1G A;  3PO2 I;  3AY0 A;  4R1L A;  2YAD A;  4L4Q A;  1HNW C;  3CC4 Z;  1XS3 A;  4GKK C;  5FLM I;  2HU9 A;  2CY1 A;  4TPS B;  1XRC A;  4NOZ A;  1W2B Z;  3FCC A;  1VQO 1;  1YI2 Z;  5BSR A;  3CPW Z;  2KI7 B;  1LCI A;  1KD1 2;  5KEI A;  2M5O A;  2E8C A;  1K8A 1;  5BSU A;  5GTD A;  1I50 I;  4AQY C;  2ZM6 C;  2Y4N A;  3CCM 1;  3CW8 X;  2UUC C;  1JJ2 Y;  4PHT A;  3N2Q A;  3OTO C;  3TR3 A;  2GTI A;  1VQ5 1;  4D57 A;  5FLX b;  1VQ8 Z;  1S7M A;  2JA8 I;  1QWI A;  3CMA 1;  1YJ7 A;  2CU6 A;  5BUQ A;  2MCQ A;  4LF4 C;  1VQP Z;  4ZJZ A;  2YWB A;  2DE7 A;  4R0M A;  4JI2 C;  2V8K A;  4YHH C;  3U50 C;  2R6M A;  4MRI A;  4YY3 C;  1N2F A;  3CCE 1;  1RLY A;  4KTV A;  4DUY C;  4E30 A;  3HOZ I;  2DHM A;  4DR4 C;  1M1K 1;  1VQK 1;  2P2M A;  4LFA C;  4ZLP A;  2QA4 1;  1NY8 A;  3KIH A;  1L2F A;  4KHP C;  3EED A;  4I9F A;  4IR7 A;  3GR0 A;  1RO2 A;  1RO0 A;  3HOX I;  3R44 A;  1VQM Z;  3T4N B;  4DCV A;  2P28 A;  1DL6 A;  2UU9 C;  4IZ6 A;  2VPY A;  1BA3 A;  2NVT I;  4U5Y D;  4RM3 A;  3N54 B;  2V8I A;  4LF7 C;  2UUA C;  4JI5 C;  4RV9 A;  4DV5 C;  2UXC C;  3BG0 B;  4RLF A;  3RZD I;  1VQL Z;  5CM2 M;  3CMA Z;  2NVX I;  1KRL A;  5BUS A;  2KPI A;  4A3F I;  2E2J I;  3GTJ I;  3VNS A;  5IWA C;  2LFU A;  1KQS Z;  2QRD B;  4JI4 C;  4X62 C;  3IEU A;  1RY2 A;  2AYD A;  4NXN C;  1YJ9 1;  1IBK C;  4NBE A;  1TWF I;  3J80 b;  1FDI A;  4LE5 A;  4PRO C;  4DK1 A;  2BJO A;  2KZF A;  3IEV A;  1VEH A;  2O53 A;  3JAM b;  1MXC A;  1Y1V I;  1J5E C;  5FLX D;  3DLP X;  2D28 C;  4DV6 C;  3K6R A;  1ZH1 A;  2F4V C;  2DE6 A;  2OO4 A;  2Y27 A;  2E7Z A;  4DUZ C;  1NYE A;  2M6N A;  4DGL A;  1KQS Y;  1MKY A;  2MM9 A;  1VQ8 1;  2OPL A;  1Q81 2;  4ODJ A;  4RVN A;  5IT9 b;  3NDJ A;  3CCU 1;  3GTM S;  2P3Y A;  3L8C A;  3PES A;  5D1O B;  5CZV A;  2EGT A;  2JUB A;  3A9V A;  3TUF A;  4WS9 A;  1QVF Z;  5D1O A;  2HJG A;  3CCJ 1;  2Y4O A;  1Q81 1;  4X66 C;  2Y0S A;  3G4S 1;  1Z02 A;  2QR1 B;  3ETC A;  1KC8 1;  1UKK A;  3NH4 A;  5LMN C;  4BXX I;  1MDF A;  3CXC Z;  3TQI A;  1VQO Z;  3IF8 A;  4DR5 C;  2OOY B;  1N36 C;  4G37 A;  3ETO A;  4L2Z A;  4A3M I;  4GXR A;  1TH5 A;  2QLV B;  3LUS A;  3UZ0 A;  3R9X A;  2OTL 1;  2YU9 I;  3EQ6 A;  2V3V A;  1VQP 1;  3F3P C;  4NBC A;  3CXC Y;  2V7B A;  1XHJ A;  3IML A;  2W03 A;  3A4I A;  3LAX A;  1WW9 A;  4LF5 C;  1ML8 A;  2D1Q A;  2IV2 X;  4E2Y A;  3G71 Z;  1K73 1;  3HOW I;  3CCV 1;  1VQ6 Z;  5BSM A;  1S72 1;  3S1Q I;  4NBB A;  3MZK B;  1NJI 1;  2QEX 1;  2JMP A;  3TDE A;  2P02 A;  4NDN A;  5A19 A;  4GKJ C;  3S1N I;  3E7X A;  4AYB A;  2RHB A;  3D9X A;  2JA7 I;  3CCM Z;  3E7W A;  3CQ2 A;  1JOS A;  1Q82 2;  1YJ9 Z;  2AKL A;  1XNQ C;  3H0G I;  1IBL C;  1RNI A;  2PM9 A;  3S14 I;  4BSZ A;  1VQK Z;  5DV9 A;  2JIR A;  1M6X C;  1K73 2;  5AE1 A;  3IFU A;  2LEX A;  1WF3 A;  4BCA A;  3NFZ A;  5FLX f;  2F4M A;  2VPX A;  3P5J B;  1WH9 A;  1O9T A;  3A9U A;  4DR2 C;  4MXU A;  3VNR A;  1YHQ Z;  4DV3 C;  1QVF Y;  2JIO A;  1P4E A;  4JV5 C;  5ADZ A;  4HPV A;  5K8F A;  3S16 I;  1HNX C;  3JAM f;  4MD8 A;  4DCT A;  1N32 C;  1SFO I;  4JM1 A;  3NI2 A;  3VNQ A;  5BSW A;  1P9N A;  3CQ3 A;  4E2Z A;  5C3E I;  3NH5 A;  5C4X I;  3J80 f;  1JJ2 Z;  1QVG Y;  2D7V A;  1KD1 1;  3QWU A;  3CCV Z;  2QVY X;  2P2F A;  3G7S A;  2UUB C;  4X64 C;  1YHQ 1;  2BH1 X;  1ZB9 A;  3GTL I;  4BC9 A;  1X3Z A; 
#chains in the Genus database with same CATH homology
 5AE2 A;  1YI2 1;  1NJI 2;  4A3C I;  5T8S A;  4NBH A;  4RMN A;  2OTL Z;  4BBY A;  2K3R A;  3S2D I;  3HOV I;  4BY7 I;  1I94 C;  2OTJ 1;  2E5L C;  4LF8 C;  3PO3 S;  5T6B A;  2VZE A;  5BR8 C;  2JNY A;  1XMO C;  1YIJ Z;  4X6A I;  3AF5 A;  3H2T A;  5LMU C;  1VQL 1;  4LFC C;  2OZK A;  4TNU A;  4A3D I;  1QVG Z;  3CD6 Z;  3GTK I;  3G4S Z;  3PO3 I;  4K0K C;  2IZ3 A;  1N33 C;  1MXB A;  3B7W A;  4FUT A;  1KKG A;  3CCL Z;  2NVQ I;  3VMG A;  4WV3 A;  2ZAE B;  1VQM 1;  4MH4 A;  1K8A 2;  5BST A;  1Z01 A;  2QRE B;  4BY1 I;  5T64 A;  3LNV A;  2AYA A;  4B3T C;  1YUA A;  2E7G A;  2G2K A;  5JRH A;  2Q51 A;  3KXW A;  3I4N I;  5IT9 D;  2VUG A;  1X0T A;  3M4O I;  3S2H I;  1V25 A;  2PT7 G;  5BUR A;  4DR6 C;  3CCE Z;  1QYP A;  4NBA A;  1W2B Y;  4KTT A;  4RVH A;  3JAM D;  2JA5 I;  2QW0 X;  4DV7 C;  4L7I A;  1HR0 C;  1M1K 2;  1P7L A;  3T1H C;  5LL6 f;  4RVG A;  4LF9 C;  1I3Q I;  2F4O A;  2E2H I;  1WII A;  3J80 D;  3CME 1;  4MD7 A;  1TWA I;  4A3K I;  4E32 A;  3GTO I;  2JR6 A;  4R1M A;  2R92 I;  4EAT A;  1XMQ C;  1O93 A;  4A3G I;  3J81 b;  3AF6 A;  1NUI A;  3OW2 Y;  4A93 I;  2P2J A;  3H3V J;  5A2Q f;  4E31 A;  1R9T I;  1Q7Y 1;  1QM4 A;  2QRC B;  2VF1 A;  5KYT A;  2ATW A;  1ZB8 A;  3I56 1;  2QA4 Z;  4MTN A;  3CME Z;  3CCS 1;  5C4J I;  2K5R A;  1VQ9 Z;  2LIY A;  4CL1 A;  3I55 1;  3CC4 1;  3GPC A;  2V8J A;  3M3Y I;  4DR1 C;  4NBF A;  2YCB A;  1Q82 1;  1VQN 1;  2VSQ A;  2QVZ X;  1GPM A;  3HKZ A;  1HH2 P;  4DG8 A;  4B3S C;  3FKI I;  2ONF A;  5BSV A;  4NB8 A;  1T5H X;  1PA4 A;  2JMO A;  2PMZ A;  3VB9 A;  2VQE C;  1VQ7 Z;  2QVX X;  4DQY B;  3CC2 Z;  3HOU I;  3EER A;  5IP9 I;  2WAQ A;  5H9U A;  3SO4 A;  3CC7 1;  4JYA C;  2UXB C;  1YJN Z;  1VQ5 Z;  4A3B I;  2VUM I;  4GS5 A;  5AE3 A;  1I6H I;  3R9W A;  5A1I A;  2NVY I;  3NYR A;  2D27 A;  5IT9 f;  1RQF A;  4JI7 C;  1Y1W I;  1N8R 1;  3S82 A;  3G6E 1;  2DPL A;  2JS4 A;  4E33 A;  4ISB A;  3CPW Y;  3L95 X;  4RVO A;  4LFB C;  2OPL B;  1RO4 A;  4K0B A;  3S17 I;  2OOX B;  4RVD A;  4JI1 C;  5IFI A;  2R93 I;  1KC8 2;  4BBS I;  3MZL B;  1O92 A;  4MON A;  1YIJ 1;  3LGX A;  2Q4Z A;  4BBR I;  3CCQ 1;  1N8R 2;  1LQL A;  4DV1 C;  4DCU A;  2GU2 A;  1YUK A;  4G1I A;  3F3F C;  3Q87 A;  1Y1V S;  2W04 A;  1YIT Z;  3VMI A;  4FTF A;  2O4H A;  3I4M I;  3CJE A;  3RZO I;  4Y52 I;  2E9H A;  2DYJ A;  4A3I I;  3IX0 A;  1M90 2;  1JWH C;  3CCR 1;  3DAY A;  5A2Q D;  4HGZ A;  1YJW Z;  2QKD A;  1PG3 A;  2PN2 A;  1T5D X;  3K7A I;  4GXQ A;  3CC7 Z;  1Z03 A;  3FQQ A;  2QL8 A;  4XX2 A;  2PK7 A;  3VTN A;  3CCL 1;  4NBG A;  1EGA A;  1VQN Z;  4A3J I;  1V26 A;  2P2Q A;  3CW9 A;  2B63 I;  4B3M C;  3NDI A;  4X65 C;  2R7Z I;  1XRA A;  2D1R A;  2E8F A;  5E7Q A;  1VLA A;  1WCM I;  3J81 D;  4B3R C;  5CZX A;  4JI0 C;  5C44 I;  4JI8 C;  4MD9 A;  2P20 A;  4RLQ A;  1O90 A;  4NFR A;  2OTJ Z;  4DR7 C;  2UXD C;  3BG1 B;  2ASB A;  3GTP I;  4A3L I;  3UOW A;  4BC7 A;  4RVF A;  2RPR A;  3S1R I;  1RG9 A;  5T8T A;  3GKU A;  1YJW 1;  1VQ4 Z;  3D6W A;  1TWG I;  1X3W A;  1K0R A;  3G6E Z;  1FJG C;  2RIQ A;  3FCE A;  3S15 I;  1K83 I;  4NB9 A;  3OW2 Z;  3HOY I;  2J6A A;  4D56 A;  3I08 A;  1AMU A;  1N34 C;  1PFT A;  2JA6 I;  4EWC A;  2GTH A;  3TDH B;  2RT9 A;  1XRB A;  4NH1 C;  3G71 1;  4OYC A;  5IP7 I;  1L1O C;  4E2W A;  2E0G A;  3TE5 B;  3ESW A;  2M48 A;  5AN9 F;  2WP0 C;  4FUQ A;  4D4I A;  1Q7Y 2;  4DR3 C;  3KIF A;  3NYQ A;  3MON A;  3I55 Z;  1VQ9 1;  3GTM I;  4RS4 A;  4I9G A;  1TFI A;  2RBL A;  4HGY A;  3CCS Z;  2VQF C;  2HHH C;  3DHV A;  4JI3 C;  4OX9 C;  2DE5 A;  2I3C A;  3S1M I;  3CCR Z;  2OBV A;  2WD9 A;  3VMH A;  3FQM A;  3RG2 A;  2PRO A;  1VQ7 1;  1FUG A;  3PBK A;  3NH8 A;  1VQ4 1;  3CCJ Z;  1QF8 A;  1M90 1;  3IPL A;  1XNR C;  1ULT A;  1IBM C;  3T1Y C;  4Y7N I;  2P2B A;  3CC2 1;  3GCF A;  1Q86 2;  5D1P A;  3C5E A;  1TWH I;  2WB1 A;  1S72 Z;  1VQ6 1;  3CD6 1;  3CCQ Z;  4RM2 A;  1YIT 1;  5A2Q b;  5KYV A;  4NBD A;  1MDB A;  3I56 Z;  1NP6 A;  4S1T A;  3J81 f;  3NPD A;  4LF6 C;  4DV0 C;  3PRO C;  3RV2 A;  1Q86 1;  4E2X A;  2CXC A;  1USP B;  2IZ4 A;  4QTU A;  2D1S A;  1USP A;  1PG4 A;  3GTQ I;  5K85 A;  2E8E A;  1HNZ C;  2H85 A;  1MXA A;  4DCS A;  5T67 A;  1K9M 2;  2QEX Z;  2HF1 A;  4OXI A;  4DV2 C;  2YWC A;  4JI6 C;  4PZP A;  4NXM C;  4A3E I;  3CQZ I;  4QTT A;  3J7A 4;  1YJN 1;  4G36 A;  4DV4 C;  1TWC I;  3GTG I;  3GKQ A;  2D1T A;  4DG9 A;  2E2I I;  3I07 A;  4D4G A;  1K9M 1;  2XR1 A;  3CCU Z;  3GR1 A;  4HH4 A;  1MD9 A;  5A1G A;  3PO2 I;  4R1L A;  2YAD A;  4L4Q A;  1HNW C;  3CC4 Z;  4GKK C;  5FLM I;  2HU9 A;  2CY1 A;  4TPS B;  1XRC A;  4NOZ A;  1W2B Z;  3FCC A;  1VQO 1;  1YI2 Z;  5BSR A;  3CPW Z;  2KI7 B;  1LCI A;  1KD1 2;  5KEI A;  2E8C A;  1K8A 1;  5BSU A;  5GTD A;  1I50 I;  4AQY C;  2ZM6 C;  2Y4N A;  3CCM 1;  3CW8 X;  2UUC C;  1JJ2 Y;  4PHT A;  3N2Q A;  3OTO C;  2GTI A;  1VQ5 1;  4D57 A;  5FLX b;  1VQ8 Z;  1S7M A;  2JA8 I;  1QWI A;  3CMA 1;  1YJ7 A;  5BUQ A;  4LF4 C;  1VQP Z;  4ZJZ A;  2YWB A;  2DE7 A;  4R0M A;  4JI2 C;  2V8K A;  4YHH C;  3U50 C;  2R6M A;  4MRI A;  4YY3 C;  1N2F A;  3CCE 1;  1RLY A;  4KTV A;  4DUY C;  4E30 A;  3HOZ I;  4DR4 C;  1M1K 1;  1VQK 1;  2P2M A;  4LFA C;  4ZLP A;  2QA4 1;  3KIH A;  1L2F A;  4KHP C;  3EED A;  4I9F A;  4IR7 A;  3GR0 A;  1RO2 A;  1RO0 A;  3HOX I;  3R44 A;  1VQM Z;  3T4N B;  4DCV A;  2P28 A;  1DL6 A;  2UU9 C;  4IZ6 A;  1BA3 A;  2NVT I;  4U5Y D;  4RM3 A;  3N54 B;  2V8I A;  4LF7 C;  2UUA C;  4JI5 C;  4RV9 A;  4DV5 C;  2UXC C;  3BG0 B;  4RLF A;  3RZD I;  1VQL Z;  5CM2 M;  3CMA Z;  2NVX I;  1KRL A;  5BUS A;  2KPI A;  4A3F I;  2E2J I;  3GTJ I;  3VNS A;  5IWA C;  2LFU A;  1KQS Z;  2QRD B;  4JI4 C;  4X62 C;  3IEU A;  1RY2 A;  4NXN C;  1YJ9 1;  1IBK C;  4NBE A;  1TWF I;  3J80 b;  4LE5 A;  4PRO C;  4DK1 A;  2BJO A;  2KZF A;  3IEV A;  2O53 A;  3JAM b;  1MXC A;  1Y1V I;  1J5E C;  5FLX D;  3DLP X;  2D28 C;  4DV6 C;  1ZH1 A;  2F4V C;  2DE6 A;  2OO4 A;  2Y27 A;  4DUZ C;  1NYE A;  2M6N A;  4DGL A;  1KQS Y;  1MKY A;  4ODJ A;  1VQ8 1;  2OPL A;  1Q81 2;  4RVN A;  5IT9 b;  3NDJ A;  3CCU 1;  3GTM S;  2P3Y A;  3L8C A;  3PES A;  5D1O B;  5CZV A;  2EGT A;  2JUB A;  3A9V A;  3TUF A;  4WS9 A;  1QVF Z;  5D1O A;  2HJG A;  3CCJ 1;  2Y4O A;  1Q81 1;  4X66 C;  2Y0S A;  3G4S 1;  1Z02 A;  2QR1 B;  3ETC A;  1KC8 1;  1UKK A;  3NH4 A;  5LMN C;  4BXX I;  1MDF A;  3CXC Z;  3TQI A;  1VQO Z;  3IF8 A;  4DR5 C;  2OOY B;  1N36 C;  4G37 A;  3ETO A;  4L2Z A;  4A3M I;  4GXR A;  2QLV B;  3LUS A;  3UZ0 A;  3R9X A;  2OTL 1;  2YU9 I;  3EQ6 A;  1VQP 1;  3F3P C;  4NBC A;  3CXC Y;  2V7B A;  3IML A;  2W03 A;  3A4I A;  3LAX A;  1WW9 A;  4LF5 C;  1ML8 A;  2D1Q A;  4E2Y A;  3G71 Z;  1K73 1;  3HOW I;  3CCV 1;  1VQ6 Z;  5BSM A;  1S72 1;  3S1Q I;  4NBB A;  3MZK B;  1NJI 1;  2QEX 1;  2JMP A;  3TDE A;  2P02 A;  4NDN A;  5A19 A;  4GKJ C;  3S1N I;  3E7X A;  4AYB A;  2RHB A;  3D9X A;  2JA7 I;  3CCM Z;  3E7W A;  1JOS A;  1Q82 2;  1YJ9 Z;  2AKL A;  1XNQ C;  3H0G I;  1IBL C;  1RNI A;  2PM9 A;  3S14 I;  4BSZ A;  1VQK Z;  5DV9 A;  1K73 2;  5AE1 A;  3IFU A;  1WF3 A;  4BCA A;  3NFZ A;  5FLX f;  2F4M A;  1WH9 A;  3P5J B;  4DR2 C;  1O9T A;  3A9U A;  4MXU A;  3VNR A;  1YHQ Z;  4DV3 C;  1QVF Y;  4JV5 C;  5ADZ A;  4HPV A;  5K8F A;  3S16 I;  1HNX C;  3JAM f;  4MD8 A;  4DCT A;  1N32 C;  1SFO I;  4JM1 A;  3NI2 A;  3VNQ A;  5BSW A;  1P9N A;  4E2Z A;  5C3E I;  3NH5 A;  5C4X I;  3J80 f;  1JJ2 Z;  1QVG Y;  2D7V A;  1KD1 1;  3QWU A;  3CCV Z;  2QVY X;  2P2F A;  3G7S A;  2UUB C;  4X64 C;  1YHQ 1;  2BH1 X;  1ZB9 A;  3GTL I;  4BC9 A;  1X3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...