1USPB

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
134
Chain Sequence
ANVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRNKIDVPADSTITARVGLQKFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
total genus 31
structure length 134
sequence length 138
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspB01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspB02
1EGAA 3U50C 4Y52I 4A3BI 3T1HC 2DE7A 1MKYA 2PK7A 3H0GI 1I3QI 4Y7NI 2E2II 5LMUC 3I07A 1WCMI 2JNYA 3GKUA 3VMGA 4JI3C 4BSZA 2CY1A 4BY1I 2UXBC 3PO3S 2KZFA 1XMOC 3GTMI 2E2HI 3S16I 3PO3I 3GTLI 1UKKA 2QL8A 1N33C 4BBRI 1TWHI 3HOZI 3FKII 4JV5C 3GTQI 4DR5C 2UXCC 4BY7I 5CM2M 1XMQC 3M4OI 4MH4A 3VB9A 3IEUA 2ZM6C 1PA4A 2B63I 2EGTA 3HOUI 4X62C 4A3KI 2F4MA 5C44I 4DCVA 3HOXI 4JI0C 3S1MI 3CJEA 4DCUA 1HR0C 4AQYC 2ATWA 3VMIA 4A3GI 4DUYC 1HH2P 4NBGA 1USPA 1N32C 4JI1C 4NOZA 3RZOI 2JA8I 2E8EA 4LF8C 4B3TC 4A3EI 4NB8A 2NVYI 3CQZI 2JA6I 4JI2C 4A3DI 4JI8C 2XR1A 1TWAI 4DV1C 3S17I 5FLXD 1N34C 3S2DI 3LUSA 1N2FA 5IP7I 5C3EI 1ZB9A 4XX2A 2CXCA 3OTOC 4JI6C 2E8FA 1HNXC 2J6AA 2P3YA 4NXNC 1WH9A 3AF6A 3AF5A 4LF6C 4DV7C 2E2JI 4DR4C 5IP9I 2D7VA 5FLMI 3R9XA 3Q87A 1XNRC 1PFTA 3I4MI 3S1RI 2HHHC 5C4JI 3GTKI 4DR6C 1VLAA 4NXMC 4DV0C 4BBSI 3M3YI 4LFCC 1JOSA 4A3LI 1QYPA 2DE5A 2VQEC 3GKQA 4JYAC 4JI5C 4NBAA 3H3VJ 3GTPI 1USPB 3IEVA 2R7ZI 4A3FI 1J5EC 2JS4A 2JR6A 3S14I 3D6WA 2F4VC 3R9WA 2AKLA 2R92I 3HOWI 1NUIA 4DV4C 2K5RA 3S1NI 1IBLC 2E7GA 1KKGA 1NYEA 4LFBC 1HNZC 5A2QD 1I94C 4OX9C 2DYJA 4A3II 4NBCA 1TFIA 3GTGI 3GTOI 4K0KC 4GKKC 2VUMI 3PO2I 4LF5C 2JA5I 2RBLA 1IBKC 2HJGA 2OPLA 3EERA 4B3RC 2R93I 2KPIA 2NVQI 4GKJC 2UUBC 3GCFA 4NBBA 1YUAA 4JI4C 3S15I 4A93I 2BJOA 3RZDI 4JI7C 4YY3C 1FJGC 4NBDA 1Y1VS 1Y1WI 5BR8C 2E8CA 2UXDC 4MTNA 4QTTA 4X65C 1Y1VI 4DR2C 4LF7C 2YU9I 2DE6A 1HNWC 1X3ZA 2JA7I 2ASBA 2NVTI 1L1OC 4DUZC 3JAMD 3HOVI 4YHHC 4DR7C 2NVXI 2UU9C 1XNQC 3GTMS 4DR1C 5IT9D 3I4NI 4LF4C 1DL6A 2UUCC 4A3CI 3ESWA 2E5LC 4DCSA 3T1YC 1LQLA 3S1QI 2UUAC 1TWCI 4B3MC 1ZB8A 4NBFA 4A3MI 1TWFI 3K7AI 1IBMC 4NBEA 1X3WA 5C4XI 2ONFA 4X64C 4LF9C 4X66C 4BXXI 4B3SC 2OPLB 5LMNC 3GTJI 4DV2C 1RLYA 4QTUA 1QWIA 1ML8A 4DR3C 3J81D 4DCTA 1R9TI 4X6AI 1SFOI 2F4OA 3S2HI 1WF3A 2YCBA 1RO4A 2HF1A 4NBHA 2PN2A 1N36C 4LFAC 4NB9A 1I6HI 1TWGI 1WW9A 3J80D 3HOYI 2VQFC 2JMPA 1K0RA 5IWAC 1K83I 4DV5C 3VMHA 1L2FA 1I50I 4A3JI 4DV6C 2PT7G 4KHPC 4DV3C
chains in the Genus database with same CATH superfamily
1EGAA 3PESA 4E2WA 1UWDA 1VQ81 3I56Z 1BA3A 3CCQ1 3U50C 4DK1A 1VQ4Z 4CL1A 4Y52I 2OO4A 3TDHB 4A3BI 2Q4ZA 3T1HC 2DE7A 3F3FC 2KZ0A 1PG3A 1MKYA 2PK7A 4MD7A 3H0GI 1I3QI 4Y7NI 2E2II 3VNQA 5LMUC 3I07A 1WCMI 2JNYA 3GKUA 2VPYA 3HKZA 1YIJ1 3GR1A 2PM9A 3VTNA 3VMGA 4E30A 4ZLPA 2OTJ1 2V8IA 2V8JA 4JI3C 4BSZA 1MD9A 1Q821 4E2XA 2CY1A 3LGXA 4BY1I 3K6RA 2D1TA 2P02A 1QXFA 3PO3S 2UXBC 3CC21 1K9M1 3CCLZ 2KZFA 4MD9A 1XMOC 1MXCA 3CMAZ 4WS9A 3CD61 3GTMI 4IR7A 2E2HI 5D1OA 1XRCA 2Y0SA 2RT9A 2OOXB 3S16I 2M6NA 3PO3I 3CQ3A 2W04A 3GTLI 1UKKA 2QL8A 3A25A 4I9FA 2LEXA 1N33C 4EWCA 4BBRI 1TWHI 3HOZI 1QM4A 3FKII 4JV5C 1NY8A 3DHVA 3GTQI 4DR5C 2UXCC 4KTVA 1VQ51 3S82A 2JNVA 2RPRA 4RVFA 4BY7I 5CM2M 1XMQC 3FCCA 2P2QA 1YHQ1 3ETCA 2JUBA 1O9TA 3M4OI 4MH4A 4RM2A 2E0GA 3VB9A 3IEUA 2AYAA 2ZM6C 3FQMA 3G4S1 1PA4A 2B63I 2QVXX 1YJN1 1XS3A 2EGTA 1PU1A 3DLPX 3HOUI 5H9UA 4A3KI 2YWCA 2F4MA 4X62C 4L7IA 2PROA 3CCQZ 1YUKA 3TQIA 1KD12 1RO2A 5C44I 4DCVA 2I3CA 3HOXI 4E2ZA 2QA4Z 4ZJZA 3IPLA 2G2KA 1V60A 2Q51A 4JI0C 4OYCA 3S1MI 1VQPZ 2Y4NA 1N8R2 2V7BA 3CJEA 2OTL1 4DCUA 1RY2A 1HR0C 4AQYC 3CCVZ 2ATWA 4HH4A 1Q811 1P7LA 3A4IA 3VMIA 4HGZA 4DG8A 4A3GI 4DUYC 2WAQA 5FLXf 3I551 1VQOZ 1HH2P 2GTHA 4NBGA 1VQK1 5D1PA 1FUGA 1USPA 1N32C 4JI1C 1S7MA 4E33A 5T6BA 4TNUA 3O2EA 3KIFA 3J80b 1M902 3N54B 4NOZA 4DGLA 1VQ91 3RZOI 2JA8I 2E8EA 3G6E1 4B3TC 3F3PC 2OOYB 2O4HA 3NYQA 4LF8C 3MONA 3NH8A 3CD6Z 4A3EI 4MXUA 2JIQA 3ETOA 1O90A 4NB8A 4RVDA 2E7ZA 4NH1C 3G71Z 4DQYB 2NVYI 2IZ4A 5BSWA 5FLXb 1Q862 4OXIA 5IFIA 3A26A 3CQZI 2JA6I 4JI2C 4A3DI 4JI8C 1P4EA 2OBVA 2XR1A 1TWAI 1VQ6Z 4DV1C 4HGYA 3S17I 5FLXD 1N34C 3S2DI 3LUSA 1N2FA 2VF1A 5IP7I 5C3EI 1M1K2 1VEHA 2QVZX 2HU9A 3NFZA 2JIOA 3CCE1 2D27A 4PUIA 1VQM1 1ZB9A 4RVHA 4XX2A 1YHQZ 1YI2Z 2CXCA 4GXRA 4D4IA 5GTDA 4BCAA 3OTOC 4JI6C 2E8FA 3CCMZ 2JIRA 2QREB 1HNXC 2J6AA 2P3YA 4S1TA 4NXNC 1MDFA 2CU6A 1AMUA 2Y27A 4IZ6A 1WH9A 3AF6A 3C5EA 3BG0B 4RVOA 3CCJZ 1Q7Y2 3AF5A 4LF6C 1M901 4DV7C 2VPXA 3PROC 3P5JB 5D1OB 1S721 2E2JI 1K731 4K0BA 2KDNA 4DR4C 1KQSY 5IP9I 2D7VA 2P2FA 3OW2Y 3LNVA 1RQFA 1NJI2 2P2JA 3CCUZ 3D9XA 1M6XA 5BUQA 1O93A 1JJ2Y 1Z03A 5FLMI 3R9XA 3Q87A 2D1RA 1XNRC 1PFTA 3AY0A 5AE2A 1NP6A 1YITZ 4D57A 3I4MI 3TR3A 3S1RI 1KC82 3RG2A 3CC41 3E7XA 2P20A 3CME1 2KI7B 4RMNA 5ADZA 3IFUA 1KQSZ 3OW2Z 2HHHC 5C4JI 4RV9A 1KRLA 4KTTA 3VNSA 1QVFY 1GPMA 3FQQA 3CCRZ 2QEX1 2R6MA 3GTKI 4PHTA 1XRAA 2QRCB 1VQLZ 1JJ2Z 4DR6C 1V26A 2O53A 1VLAA 3QWUA 3EEDA 4NXMC 1FLOA 3UZ0A 4DV0C 4BBSI 2QR1B 1VQNZ 1W2BY 2WD9A 3NDJA 1YJ9Z 3M3YI 4LFCC 1QF8A 1JOSA 2MM9A 4A3LI 1K8A2 1P9NA 1QYPA 3MZKB 5A2Qf 1LCIA 2DE5A 2VQEC 1QVFZ 2Y4OA 3GKQA 4GS5A 4JYAC 4JI5C 4NBAA 3H3VJ 3A9VA 1VQ71 3GTPI 1VQ8Z 1USPB 5CZVA 3IEVA 2R7ZI 4RLQA 4A3FI 1J5EC 2JIPA 2JS4A 3CQ2A 2NAPA 5DV9A 2V3VA 5A1GA 3KIHA 2QKDA 5T8TA 1FDOA 2JR6A 3S14I 3D6WA 2F4VC 2AYDA 1WZNA 3NH4A 3R9WA 1W2BZ 2AKLA 4G36A 2R92I 4TPSB 3HOWI 1NUIA 5A2Qb 4DV4C 2K5RA 4RVNA 3S1NI 4E2YA 4BC9A 1IBLC 3VNRA 1YIJZ 2E7GA 5BUSA 3I561 1KKGA 2P2MA 2DHMA 4JM1A 1NYEA 2VSQA 1HNZC 2OTJZ 5JRHA 4GXQA 5A2QD 3NI2A 1I94C 4LFBC 4OX9C 2DYJA 2WB1A 4A3II 3TDEA 4NBCA 2M48A 3G7SA 5LCIA 3CC2Z 1Z02A 1TFIA 2Z51A 3GTGI 3GTOI 4FUQA 4K0KC 4GKKC 2VUMI 3PO2I 4LF5C 2JA5I 5CZXA 4WV3A 2RBLA 2M5HA 3UEBA 3KXWA 4NDNA 1IBKC 5KYVA 2HJGA 1WCJA 1YJW1 1FDIA 2OPLA 2RIQA 2V8KA 3EERA 4B3RC 5BSRA 5AE3A 3L95X 2P28A 1KD11 1MDBA 4RLFA 3CCL1 3CPWY 2R93I 2KPIA 4MONA 1VQ5Z 3CMA1 2NVQI 4D56A 4GKJC 3IF8A 2UUBC 3GCFA 3MZLB 4NBBA 1N8R1 5KEIA 2OZKA 4R1LA 3NH5A 1YUAA 1Z01A 3G4SZ 2YWBA 4JI4C 1YJNZ 4PUHA 3IMLA 3S15I 2QLVB 2BJOA 4A93I 4MD8A 3RZDI 4JI7C 3GPCA 4YY3C 3R44A 1Q822 1MXBA 1FJGC 3RV2A 4NBDA 1Y1VS 2GU2A 1K9M2 1Y1WI 4R1MA 5T67A 2VPWA 5BR8C 3CXCY 3CPWZ 2E8CA 3B7WA 2UXDC 4MTNA 4QTTA 3JAMf 1RG9A 4X65C 2OTLZ 1ULTA 4FUTA 5T64A 3NYRA 2QRDB 1Y1VI 4PROC 5BSMA 5IT9f 4DR2C 4LF7C 1RO0A 3D2LA 2YU9I 3I55Z 4ISBA 1VQKZ 2VZEA 4E32A 2D1SA 1Q861 4MRIA 2DE6A 2V45A 1Y8CA 1XRBA 3CW8X 4BC7A 1HNWC 1X3ZA 2QA41 4G37A 3L8CA 2GTIA 3CXCZ 1VQ9Z 2JA7I 1VQP1 3G6EZ 4I9GA 3JAMb 1M1K1 5E7QA 1O92A 2H85A 5AE1A 4U5YD 2ASBA 1QVGY 5BSVA 2NVTI 4PZPA 3CCV1 1Q16A 4RS4A 1L1OC 4DUZC 5IT9b 3LAXA 2D28C 3GR0A 3JAMD 3IR7A 3HOVI 4YHHC 1YJ7A 4AYBA 4DR7C 1VQO1 2NVXI 3CCS1 1WJ2A 2UU9C 1T5DX 1XNQC 2IV2X 3GTMS 2DPLA 4DR1C 1YJWZ 5IT9D 3I4NI 2NCLA 1DL6A 4LF4C 2UUCC 4A3CI 2E9HA 5BSUA 2PMZA 3EQ6A 3ESWA 2ZZMA 2E5LC 1ZH1A 4DCSA 1P4EC 1Q7Y1 3T1YC 3CCEZ 2P2BA 1VQMZ 2M5OA 3CW9A 1QVGZ 1LQLA 3S1QI 2UUAC 1Q812 1TWCI 4B3MC 5T8SA 1NJI1 3G711 4RVGA 1ZB8A 4NBFA 4A3MI 3UX2A 1TWFI 4DG9A 3K7AI 2MCQA 2QW0X 4NBEA 1IBMC 1VQ61 1X3WA 5LL6f 3J81f 5C4XI 3UX3A 3CC71 2RHBA 3E7WA 1S72Z 1YI21 1KC81 2JMOA 2ONFA 4NFRA 3PBKA 4X64C 5AN9F 3CCM1 3UOWA 2YADA 2VUGA 4LF9C 4X66C 4BXXI 3BG1B 4B3SC 4FTFA 4BBYA 2JIMA 2OPLB 1VQ41 3I08A 2W03A 3NPDA 5LMNC 1M6XC 4LE5A 3GTJI 2K3RA 3J80f 2LIYA 3J81b 3CCJ1 1TH5A 4DV2C 4PUGA 1RLYA 4QTUA 3J7A4 1QWIA 3CC4Z 1ML8A 3CMEZ 1PG4A 2BH1X 4D4GA 4DR3C 3J81D 1IB8A 4DCTA 1R9TI 2IZ3A 5BURA 3CCU1 3H2TA 4X6AI 1K8A1 1XHJA 1SFOI 2F4OA 4EATA 3S2HI 2LFUA 1WF3A 2WP0C 2QEXZ 3CCSZ 2YX1A 2YCBA 1T5HX 1RO4A 1V25A 3TUFA 2HF1A 4ODJA 1MXAA 4NBHA 2PN2A 1YIT1 4RM3A 5A19A 3N2QA 1WIIA 2QVYX 1K732 4E31A 1RNIA 1JWHC 1AA6A 1N36C 4LFAC 4NB9A 1I6HI 1TWGI 1WW9A 3J80D 3CQ1A 2VPZA 4L2ZA 3IX0A 5K8FA 3CCR1 3HOYI 2VQFC 1VQ7Z 3DAYA 2JMPA 2ZAEB 2D1QA 1VQL1 1K0RA 4R0MA 5IWAC 1K83I 4L4QA 4DV5C 2ZZNA 3VMHA 3A9UA 1L2FA 1I50I 5K85A 1VQN1 4HPVA 4G1IA 3CC7Z 3NDIA 3T4NB 3FCEA 2MMAB 1YJ91 4A3JI 3TE5B 1X0TA 3LNOA 5A1IA 5BSTA 4DV6C 3SO4A 2PT7G 4KHPC 1SIWA 4DV3C 5KYTA
chains in the Genus database with same CATH topology
1EGAA 3PESA 4E2WA 1VQ81 3I56Z 1BA3A 3CCQ1 3U50C 4DK1A 1VQ4Z 4CL1A 4Y52I 2OO4A 3TDHB 4A3BI 2Q4ZA 3T1HC 2DE7A 3F3FC 1PG3A 1MKYA 2PK7A 4MD7A 3H0GI 1I3QI 4Y7NI 2E2II 3VNQA 5LMUC 3I07A 1WCMI 2JNYA 3GKUA 3HKZA 1YIJ1 3GR1A 2PM9A 3VTNA 3VMGA 4E30A 4ZLPA 2OTJ1 2V8IA 2V8JA 4JI3C 4BSZA 1MD9A 1Q821 4E2XA 2CY1A 3LGXA 4BY1I 2D1TA 2P02A 3PO3S 2UXBC 3CC21 1K9M1 3CCLZ 2KZFA 4MD9A 1XMOC 1MXCA 3CMAZ 4WS9A 3CD61 3GTMI 4IR7A 2E2HI 5D1OA 1XRCA 2Y0SA 2RT9A 2OOXB 3S16I 2M6NA 3PO3I 2W04A 3GTLI 1UKKA 2QL8A 4I9FA 1N33C 4EWCA 4BBRI 1TWHI 3HOZI 1QM4A 3FKII 4JV5C 3DHVA 3GTQI 4DR5C 2UXCC 4KTVA 1VQ51 3S82A 2RPRA 4RVFA 4BY7I 5CM2M 1XMQC 3FCCA 2P2QA 1YHQ1 3ETCA 2JUBA 1O9TA 3M4OI 4MH4A 4RM2A 2E0GA 3VB9A 3IEUA 2AYAA 2ZM6C 3FQMA 3G4S1 1PA4A 2B63I 2QVXX 1YJN1 2EGTA 3DLPX 3HOUI 5H9UA 4A3KI 2YWCA 2F4MA 4X62C 4L7IA 2PROA 3CCQZ 1YUKA 3TQIA 1KD12 1RO2A 5C44I 4DCVA 2I3CA 3HOXI 4E2ZA 2QA4Z 4ZJZA 3IPLA 2G2KA 2Q51A 4JI0C 4OYCA 3S1MI 1VQPZ 2Y4NA 1N8R2 2V7BA 3CJEA 2OTL1 4DCUA 1RY2A 1HR0C 4AQYC 3CCVZ 2ATWA 4HH4A 1Q811 1P7LA 3A4IA 3VMIA 4HGZA 4DG8A 4A3GI 4DUYC 2WAQA 5FLXf 1VQOZ 3I551 1HH2P 2GTHA 4NBGA 1VQK1 5D1PA 1FUGA 1USPA 1N32C 4JI1C 1S7MA 4E33A 5T6BA 4TNUA 3KIFA 3J80b 1M902 3N54B 4NOZA 4DGLA 1VQ91 3RZOI 2JA8I 2E8EA 3G6E1 4B3TC 3F3PC 2OOYB 2O4HA 3NYQA 4LF8C 3MONA 3NH8A 3CD6Z 4A3EI 4MXUA 3ETOA 1O90A 4NB8A 4RVDA 4NH1C 3G71Z 4DQYB 2NVYI 2IZ4A 5BSWA 5FLXb 1Q862 4OXIA 5IFIA 3CQZI 2JA6I 4JI2C 4A3DI 4JI8C 2OBVA 2XR1A 1TWAI 1VQ6Z 4DV1C 4HGYA 3S17I 5FLXD 1N34C 3S2DI 3LUSA 1N2FA 2VF1A 5IP7I 5C3EI 1M1K2 2QVZX 2HU9A 3NFZA 3CCE1 2D27A 1VQM1 1ZB9A 4RVHA 4XX2A 1YHQZ 1YI2Z 2CXCA 4GXRA 4D4IA 5GTDA 4BCAA 3OTOC 4JI6C 2E8FA 3CCMZ 2QREB 1HNXC 2J6AA 2P3YA 4S1TA 4NXNC 1MDFA 1AMUA 2Y27A 4IZ6A 1WH9A 3AF6A 3C5EA 3BG0B 4RVOA 3CCJZ 1Q7Y2 3AF5A 4LF6C 1M901 4DV7C 3PROC 3P5JB 5D1OB 1S721 2E2JI 1K731 4K0BA 4DR4C 1KQSY 5IP9I 2D7VA 2P2FA 3OW2Y 3LNVA 1RQFA 1NJI2 2P2JA 3CCUZ 3D9XA 5BUQA 1O93A 1JJ2Y 1Z03A 5FLMI 3R9XA 3Q87A 2D1RA 1XNRC 1PFTA 5AE2A 1NP6A 1YITZ 4D57A 3I4MI 3S1RI 1KC82 3RG2A 3CC41 3E7XA 2P20A 3CME1 2KI7B 4RMNA 5ADZA 3IFUA 1KQSZ 3OW2Z 2HHHC 5C4JI 4RV9A 1KRLA 4KTTA 3VNSA 1QVFY 1GPMA 3FQQA 3CCRZ 2QEX1 2R6MA 3GTKI 4PHTA 1XRAA 2QRCB 1VQLZ 1JJ2Z 4DR6C 1V26A 2O53A 1VLAA 3QWUA 3EEDA 4NXMC 3UZ0A 4DV0C 4BBSI 2QR1B 1VQNZ 1W2BY 2WD9A 3NDJA 1YJ9Z 3M3YI 4LFCC 1QF8A 1JOSA 4A3LI 1K8A2 1P9NA 1QYPA 3MZKB 5A2Qf 1LCIA 2DE5A 2VQEC 1QVFZ 2Y4OA 3GKQA 4GS5A 4JYAC 4JI5C 4NBAA 3H3VJ 3A9VA 1VQ71 3GTPI 1VQ8Z 1USPB 5CZVA 3IEVA 2R7ZI 4RLQA 4A3FI 1J5EC 2JS4A 5DV9A 5A1GA 3KIHA 2QKDA 5T8TA 2JR6A 3S14I 3D6WA 2F4VC 3NH4A 3R9WA 1W2BZ 2AKLA 4G36A 2R92I 4TPSB 3HOWI 1NUIA 5A2Qb 4DV4C 2K5RA 4RVNA 3S1NI 4E2YA 4BC9A 1IBLC 3VNRA 1YIJZ 2E7GA 5BUSA 3I561 1KKGA 2P2MA 4JM1A 1NYEA 2VSQA 1HNZC 2OTJZ 5JRHA 4GXQA 5A2QD 3NI2A 1I94C 4LFBC 4OX9C 2DYJA 2WB1A 4A3II 3TDEA 4NBCA 2M48A 3G7SA 3CC2Z 1Z02A 1TFIA 3GTGI 3GTOI 4FUQA 4K0KC 4GKKC 2VUMI 3PO2I 4LF5C 2JA5I 5CZXA 4WV3A 2RBLA 3KXWA 4NDNA 1IBKC 5KYVA 2HJGA 1YJW1 2OPLA 2RIQA 2V8KA 3EERA 4B3RC 5BSRA 5AE3A 3L95X 2P28A 1KD11 1MDBA 4RLFA 3CCL1 3CPWY 2R93I 2KPIA 4MONA 1VQ5Z 3CMA1 2NVQI 4D56A 4GKJC 3IF8A 2UUBC 3GCFA 3MZLB 4NBBA 1N8R1 5KEIA 2OZKA 4R1LA 3NH5A 1YUAA 1Z01A 3G4SZ 2YWBA 4JI4C 1YJNZ 3IMLA 3S15I 2QLVB 2BJOA 4A93I 4MD8A 3RZDI 4JI7C 3GPCA 4YY3C 3R44A 1Q822 1MXBA 1FJGC 3RV2A 4NBDA 1Y1VS 2GU2A 1K9M2 1Y1WI 4R1MA 5T67A 5BR8C 3CXCY 3CPWZ 2E8CA 3B7WA 2UXDC 4MTNA 4QTTA 3JAMf 1RG9A 4X65C 2OTLZ 1ULTA 4FUTA 5T64A 3NYRA 2QRDB 1Y1VI 4PROC 5BSMA 5IT9f 4DR2C 4LF7C 1RO0A 2YU9I 3I55Z 4ISBA 1VQKZ 2VZEA 4E32A 2D1SA 1Q861 4MRIA 2DE6A 1XRBA 3CW8X 4BC7A 1HNWC 1X3ZA 2QA41 4G37A 3L8CA 2GTIA 3CXCZ 1VQ9Z 2JA7I 1VQP1 3G6EZ 4I9GA 3JAMb 1M1K1 5E7QA 1O92A 2H85A 5AE1A 4U5YD 2ASBA 1QVGY 5BSVA 2NVTI 4PZPA 3CCV1 4RS4A 1L1OC 4DUZC 5IT9b 3LAXA 2D28C 3GR0A 3JAMD 3HOVI 4YHHC 1YJ7A 4AYBA 4DR7C 1VQO1 2NVXI 3CCS1 2UU9C 1T5DX 1XNQC 3GTMS 2DPLA 4DR1C 1YJWZ 5IT9D 3I4NI 4LF4C 1DL6A 2UUCC 4A3CI 2E9HA 5BSUA 2PMZA 3EQ6A 3ESWA 2E5LC 1ZH1A 4DCSA 1Q7Y1 3T1YC 3CCEZ 2P2BA 1VQMZ 3CW9A 1QVGZ 1LQLA 3S1QI 2UUAC 1Q812 1TWCI 4B3MC 5T8SA 1NJI1 3G711 4RVGA 1ZB8A 4NBFA 4A3MI 1TWFI 4DG9A 3K7AI 2QW0X 4NBEA 1IBMC 1VQ61 1X3WA 5LL6f 3J81f 5C4XI 3CC71 2RHBA 3E7WA 1S72Z 1YI21 1KC81 2JMOA 2ONFA 4NFRA 3PBKA 4X64C 5AN9F 3CCM1 3UOWA 2YADA 2VUGA 4LF9C 4X66C 4BXXI 3BG1B 4B3SC 4FTFA 4BBYA 2OPLB 1VQ41 3I08A 2W03A 3NPDA 5LMNC 4LE5A 3GTJI 2K3RA 3J80f 2LIYA 3J81b 3CCJ1 4DV2C 1RLYA 4QTUA 3J7A4 1QWIA 3CC4Z 1ML8A 3CMEZ 1PG4A 2BH1X 4D4GA 4DR3C 3J81D 4DCTA 1R9TI 2IZ3A 5BURA 3CCU1 3H2TA 4X6AI 1K8A1 1SFOI 2F4OA 4EATA 3S2HI 2LFUA 1WF3A 2WP0C 2QEXZ 3CCSZ 2YCBA 1T5HX 1RO4A 1V25A 3TUFA 2HF1A 4ODJA 1MXAA 4NBHA 2PN2A 1YIT1 4RM3A 5A19A 3N2QA 1WIIA 2QVYX 1K732 4E31A 1RNIA 1JWHC 1N36C 4LFAC 4NB9A 1I6HI 1TWGI 1WW9A 3J80D 4L2ZA 3IX0A 5K8FA 3CCR1 3HOYI 2VQFC 1VQ7Z 3DAYA 2JMPA 2ZAEB 2D1QA 1VQL1 1K0RA 4R0MA 5IWAC 1K83I 4L4QA 4DV5C 3VMHA 3A9UA 1L2FA 1I50I 5K85A 1VQN1 4HPVA 4G1IA 3CC7Z 3NDIA 3T4NB 3FCEA 1YJ91 4A3JI 3TE5B 1X0TA 5A1IA 5BSTA 4DV6C 3SO4A 2PT7G 4KHPC 4DV3C 5KYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EGA A;  3U50 C;  4Y52 I;  4A3B I;  3T1H C;  2DE7 A;  1MKY A;  2PK7 A;  3H0G I;  1I3Q I;  4Y7N I;  2E2I I;  5LMU C;  3I07 A;  1WCM I;  2JNY A;  3GKU A;  3VMG A;  4JI3 C;  4BSZ A;  2CY1 A;  4BY1 I;  2UXB C;  3PO3 S;  2KZF A;  1XMO C;  3GTM I;  2E2H I;  3S16 I;  3PO3 I;  3GTL I;  1UKK A;  2QL8 A;  1N33 C;  4BBR I;  1TWH I;  3HOZ I;  3FKI I;  4JV5 C;  3GTQ I;  4DR5 C;  2UXC C;  4BY7 I;  5CM2 M;  1XMQ C;  3M4O I;  4MH4 A;  3VB9 A;  3IEU A;  2ZM6 C;  1PA4 A;  2B63 I;  2EGT A;  3HOU I;  4X62 C;  4A3K I;  2F4M A;  5C44 I;  4DCV A;  3HOX I;  4JI0 C;  3S1M I;  3CJE A;  4DCU A;  1HR0 C;  4AQY C;  2ATW A;  3VMI A;  4A3G I;  4DUY C;  1HH2 P;  4NBG A;  1USP A;  1N32 C;  4JI1 C;  4NOZ A;  3RZO I;  2JA8 I;  2E8E A;  4LF8 C;  4B3T C;  4A3E I;  4NB8 A;  2NVY I;  3CQZ I;  2JA6 I;  4JI2 C;  4A3D I;  4JI8 C;  2XR1 A;  1TWA I;  4DV1 C;  3S17 I;  5FLX D;  1N34 C;  3S2D I;  3LUS A;  1N2F A;  5IP7 I;  5C3E I;  1ZB9 A;  4XX2 A;  2CXC A;  3OTO C;  4JI6 C;  2E8F A;  1HNX C;  2J6A A;  2P3Y A;  4NXN C;  1WH9 A;  3AF6 A;  3AF5 A;  4LF6 C;  4DV7 C;  2E2J I;  4DR4 C;  5IP9 I;  2D7V A;  5FLM I;  3R9X A;  3Q87 A;  1XNR C;  1PFT A;  3I4M I;  3S1R I;  2HHH C;  5C4J I;  3GTK I;  4DR6 C;  1VLA A;  4NXM C;  4DV0 C;  4BBS I;  3M3Y I;  4LFC C;  1JOS A;  4A3L I;  1QYP A;  2DE5 A;  2VQE C;  3GKQ A;  4JYA C;  4JI5 C;  4NBA A;  3H3V J;  3GTP I;  1USP B;  3IEV A;  2R7Z I;  4A3F I;  1J5E C;  2JS4 A;  2JR6 A;  3S14 I;  3D6W A;  2F4V C;  3R9W A;  2AKL A;  2R92 I;  3HOW I;  1NUI A;  4DV4 C;  2K5R A;  3S1N I;  1IBL C;  2E7G A;  1KKG A;  1NYE A;  4LFB C;  1HNZ C;  5A2Q D;  1I94 C;  4OX9 C;  2DYJ A;  4A3I I;  4NBC A;  1TFI A;  3GTG I;  3GTO I;  4K0K C;  4GKK C;  2VUM I;  3PO2 I;  4LF5 C;  2JA5 I;  2RBL A;  1IBK C;  2HJG A;  2OPL A;  3EER A;  4B3R C;  2R93 I;  2KPI A;  2NVQ I;  4GKJ C;  2UUB C;  3GCF A;  4NBB A;  1YUA A;  4JI4 C;  3S15 I;  4A93 I;  2BJO A;  3RZD I;  4JI7 C;  4YY3 C;  1FJG C;  4NBD A;  1Y1V S;  1Y1W I;  5BR8 C;  2E8C A;  2UXD C;  4MTN A;  4QTT A;  4X65 C;  1Y1V I;  4DR2 C;  4LF7 C;  2YU9 I;  2DE6 A;  1HNW C;  1X3Z A;  2JA7 I;  2ASB A;  2NVT I;  1L1O C;  4DUZ C;  3JAM D;  3HOV I;  4YHH C;  4DR7 C;  2NVX I;  2UU9 C;  1XNQ C;  3GTM S;  4DR1 C;  5IT9 D;  3I4N I;  4LF4 C;  1DL6 A;  2UUC C;  4A3C I;  3ESW A;  2E5L C;  4DCS A;  3T1Y C;  1LQL A;  3S1Q I;  2UUA C;  1TWC I;  4B3M C;  1ZB8 A;  4NBF A;  4A3M I;  1TWF I;  3K7A I;  1IBM C;  4NBE A;  1X3W A;  5C4X I;  2ONF A;  4X64 C;  4LF9 C;  4X66 C;  4BXX I;  4B3S C;  2OPL B;  5LMN C;  3GTJ I;  4DV2 C;  1RLY A;  4QTU A;  1QWI A;  1ML8 A;  4DR3 C;  3J81 D;  4DCT A;  1R9T I;  4X6A I;  1SFO I;  2F4O A;  3S2H I;  1WF3 A;  2YCB A;  1RO4 A;  2HF1 A;  4NBH A;  2PN2 A;  1N36 C;  4LFA C;  4NB9 A;  1I6H I;  1TWG I;  1WW9 A;  3J80 D;  3HOY I;  2VQF C;  2JMP A;  1K0R A;  5IWA C;  1K83 I;  4DV5 C;  3VMH A;  1L2F A;  1I50 I;  4A3J I;  4DV6 C;  2PT7 G;  4KHP C;  4DV3 C; 
#chains in the Genus database with same CATH topology
 1EGA A;  3PES A;  4E2W A;  1UWD A;  1VQ8 1;  3I56 Z;  1BA3 A;  3CCQ 1;  3U50 C;  4DK1 A;  1VQ4 Z;  4CL1 A;  4Y52 I;  2OO4 A;  3TDH B;  4A3B I;  2Q4Z A;  3T1H C;  2DE7 A;  3F3F C;  2KZ0 A;  1PG3 A;  1MKY A;  2PK7 A;  4MD7 A;  3H0G I;  1I3Q I;  4Y7N I;  2E2I I;  3VNQ A;  5LMU C;  3I07 A;  1WCM I;  2JNY A;  3GKU A;  2VPY A;  3HKZ A;  1YIJ 1;  3GR1 A;  2PM9 A;  3VTN A;  3VMG A;  4E30 A;  4ZLP A;  2OTJ 1;  2V8I A;  2V8J A;  4JI3 C;  4BSZ A;  1MD9 A;  1Q82 1;  4E2X A;  2CY1 A;  3LGX A;  4BY1 I;  3K6R A;  2D1T A;  2P02 A;  1QXF A;  3PO3 S;  2UXB C;  3CC2 1;  1K9M 1;  3CCL Z;  2KZF A;  4MD9 A;  1XMO C;  1MXC A;  3CMA Z;  4WS9 A;  3CD6 1;  3GTM I;  4IR7 A;  2E2H I;  5D1O A;  1XRC A;  2Y0S A;  2RT9 A;  2OOX B;  3S16 I;  2M6N A;  3PO3 I;  3CQ3 A;  2W04 A;  3GTL I;  1UKK A;  2QL8 A;  3A25 A;  4I9F A;  2LEX A;  1N33 C;  4EWC A;  4BBR I;  1TWH I;  3HOZ I;  1QM4 A;  3FKI I;  4JV5 C;  1NY8 A;  3DHV A;  3GTQ I;  4DR5 C;  2UXC C;  4KTV A;  1VQ5 1;  3S82 A;  2JNV A;  2RPR A;  4RVF A;  4BY7 I;  5CM2 M;  1XMQ C;  3FCC A;  2P2Q A;  1YHQ 1;  3ETC A;  2JUB A;  1O9T A;  3M4O I;  4MH4 A;  4RM2 A;  2E0G A;  3VB9 A;  3IEU A;  2AYA A;  2ZM6 C;  3FQM A;  3G4S 1;  1PA4 A;  2B63 I;  2QVX X;  1YJN 1;  1XS3 A;  2EGT A;  1PU1 A;  3DLP X;  3HOU I;  5H9U A;  4A3K I;  2YWC A;  2F4M A;  4X62 C;  4L7I A;  2PRO A;  3CCQ Z;  1YUK A;  3TQI A;  1KD1 2;  1RO2 A;  5C44 I;  4DCV A;  2I3C A;  3HOX I;  4E2Z A;  2QA4 Z;  4ZJZ A;  3IPL A;  2G2K A;  1V60 A;  2Q51 A;  4JI0 C;  4OYC A;  3S1M I;  1VQP Z;  2Y4N A;  1N8R 2;  2V7B A;  3CJE A;  2OTL 1;  4DCU A;  1RY2 A;  1HR0 C;  4AQY C;  3CCV Z;  2ATW A;  4HH4 A;  1Q81 1;  1P7L A;  3A4I A;  3VMI A;  4HGZ A;  4DG8 A;  4A3G I;  4DUY C;  2WAQ A;  5FLX f;  3I55 1;  1VQO Z;  1HH2 P;  2GTH A;  4NBG A;  1VQK 1;  5D1P A;  1FUG A;  1USP A;  1N32 C;  4JI1 C;  1S7M A;  4E33 A;  5T6B A;  4TNU A;  3O2E A;  3KIF A;  3J80 b;  1M90 2;  3N54 B;  4NOZ A;  4DGL A;  1VQ9 1;  3RZO I;  2JA8 I;  2E8E A;  3G6E 1;  4B3T C;  3F3P C;  2OOY B;  2O4H A;  3NYQ A;  4LF8 C;  3MON A;  3NH8 A;  3CD6 Z;  4A3E I;  4MXU A;  2JIQ A;  3ETO A;  1O90 A;  4NB8 A;  4RVD A;  2E7Z A;  4NH1 C;  3G71 Z;  4DQY B;  2NVY I;  2IZ4 A;  5BSW A;  5FLX b;  1Q86 2;  4OXI A;  5IFI A;  3A26 A;  3CQZ I;  2JA6 I;  4JI2 C;  4A3D I;  4JI8 C;  1P4E A;  2OBV A;  2XR1 A;  1TWA I;  1VQ6 Z;  4DV1 C;  4HGY A;  3S17 I;  5FLX D;  1N34 C;  3S2D I;  3LUS A;  1N2F A;  2VF1 A;  5IP7 I;  5C3E I;  1M1K 2;  1VEH A;  2QVZ X;  2HU9 A;  3NFZ A;  2JIO A;  3CCE 1;  2D27 A;  4PUI A;  1VQM 1;  1ZB9 A;  4RVH A;  4XX2 A;  1YHQ Z;  1YI2 Z;  2CXC A;  4GXR A;  4D4I A;  5GTD A;  4BCA A;  3OTO C;  4JI6 C;  2E8F A;  3CCM Z;  2JIR A;  2QRE B;  1HNX C;  2J6A A;  2P3Y A;  4S1T A;  4NXN C;  1MDF A;  2CU6 A;  1AMU A;  2Y27 A;  4IZ6 A;  1WH9 A;  3AF6 A;  3C5E A;  3BG0 B;  4RVO A;  3CCJ Z;  1Q7Y 2;  3AF5 A;  4LF6 C;  1M90 1;  4DV7 C;  2VPX A;  3PRO C;  3P5J B;  5D1O B;  1S72 1;  2E2J I;  1K73 1;  4K0B A;  2KDN A;  4DR4 C;  1KQS Y;  5IP9 I;  2D7V A;  2P2F A;  3OW2 Y;  3LNV A;  1RQF A;  1NJI 2;  2P2J A;  3CCU Z;  3D9X A;  1M6X A;  5BUQ A;  1O93 A;  1JJ2 Y;  1Z03 A;  5FLM I;  3R9X A;  3Q87 A;  2D1R A;  1XNR C;  1PFT A;  3AY0 A;  5AE2 A;  1NP6 A;  1YIT Z;  4D57 A;  3I4M I;  3TR3 A;  3S1R I;  1KC8 2;  3RG2 A;  3CC4 1;  3E7X A;  2P20 A;  3CME 1;  2KI7 B;  4RMN A;  5ADZ A;  3IFU A;  1KQS Z;  3OW2 Z;  2HHH C;  5C4J I;  4RV9 A;  1KRL A;  4KTT A;  3VNS A;  1QVF Y;  1GPM A;  3FQQ A;  3CCR Z;  2QEX 1;  2R6M A;  3GTK I;  4PHT A;  1XRA A;  2QRC B;  1VQL Z;  1JJ2 Z;  4DR6 C;  1V26 A;  2O53 A;  1VLA A;  3QWU A;  3EED A;  4NXM C;  1FLO A;  3UZ0 A;  4DV0 C;  4BBS I;  2QR1 B;  1VQN Z;  1W2B Y;  2WD9 A;  3NDJ A;  1YJ9 Z;  3M3Y I;  4LFC C;  1QF8 A;  1JOS A;  2MM9 A;  4A3L I;  1K8A 2;  1P9N A;  1QYP A;  3MZK B;  5A2Q f;  1LCI A;  2DE5 A;  2VQE C;  1QVF Z;  2Y4O A;  3GKQ A;  4GS5 A;  4JYA C;  4JI5 C;  4NBA A;  3H3V J;  3A9V A;  1VQ7 1;  3GTP I;  1VQ8 Z;  1USP B;  5CZV A;  3IEV A;  2R7Z I;  4RLQ A;  4A3F I;  1J5E C;  2JIP A;  2JS4 A;  3CQ2 A;  2NAP A;  5DV9 A;  2V3V A;  5A1G A;  3KIH A;  2QKD A;  5T8T A;  1FDO A;  2JR6 A;  3S14 I;  3D6W A;  2F4V C;  2AYD A;  1WZN A;  3NH4 A;  3R9W A;  1W2B Z;  2AKL A;  4G36 A;  2R92 I;  4TPS B;  3HOW I;  1NUI A;  5A2Q b;  4DV4 C;  2K5R A;  4RVN A;  3S1N I;  4E2Y A;  4BC9 A;  1IBL C;  3VNR A;  1YIJ Z;  2E7G A;  5BUS A;  3I56 1;  1KKG A;  2P2M A;  2DHM A;  4JM1 A;  1NYE A;  2VSQ A;  1HNZ C;  2OTJ Z;  5JRH A;  4GXQ A;  5A2Q D;  3NI2 A;  1I94 C;  4LFB C;  4OX9 C;  2DYJ A;  2WB1 A;  4A3I I;  3TDE A;  4NBC A;  2M48 A;  3G7S A;  5LCI A;  3CC2 Z;  1Z02 A;  1TFI A;  2Z51 A;  3GTG I;  3GTO I;  4FUQ A;  4K0K C;  4GKK C;  2VUM I;  3PO2 I;  4LF5 C;  2JA5 I;  5CZX A;  4WV3 A;  2RBL A;  2M5H A;  3UEB A;  3KXW A;  4NDN A;  1IBK C;  5KYV A;  2HJG A;  1WCJ A;  1YJW 1;  1FDI A;  2OPL A;  2RIQ A;  2V8K A;  3EER A;  4B3R C;  5BSR A;  5AE3 A;  3L95 X;  2P28 A;  1KD1 1;  1MDB A;  4RLF A;  3CCL 1;  3CPW Y;  2R93 I;  2KPI A;  4MON A;  1VQ5 Z;  3CMA 1;  2NVQ I;  4D56 A;  4GKJ C;  3IF8 A;  2UUB C;  3GCF A;  3MZL B;  4NBB A;  1N8R 1;  5KEI A;  2OZK A;  4R1L A;  3NH5 A;  1YUA A;  1Z01 A;  3G4S Z;  2YWB A;  4JI4 C;  1YJN Z;  4PUH A;  3IML A;  3S15 I;  2QLV B;  2BJO A;  4A93 I;  4MD8 A;  3RZD I;  4JI7 C;  3GPC A;  4YY3 C;  3R44 A;  1Q82 2;  1MXB A;  1FJG C;  3RV2 A;  4NBD A;  1Y1V S;  2GU2 A;  1K9M 2;  1Y1W I;  4R1M A;  5T67 A;  2VPW A;  5BR8 C;  3CXC Y;  3CPW Z;  2E8C A;  3B7W A;  2UXD C;  4MTN A;  4QTT A;  3JAM f;  1RG9 A;  4X65 C;  2OTL Z;  1ULT A;  4FUT A;  5T64 A;  3NYR A;  2QRD B;  1Y1V I;  4PRO C;  5BSM A;  5IT9 f;  4DR2 C;  4LF7 C;  1RO0 A;  3D2L A;  2YU9 I;  3I55 Z;  4ISB A;  1VQK Z;  2VZE A;  4E32 A;  2D1S A;  1Q86 1;  4MRI A;  2DE6 A;  2V45 A;  1Y8C A;  1XRB A;  3CW8 X;  4BC7 A;  1HNW C;  1X3Z A;  2QA4 1;  4G37 A;  3L8C A;  2GTI A;  3CXC Z;  1VQ9 Z;  2JA7 I;  1VQP 1;  3G6E Z;  4I9G A;  3JAM b;  1M1K 1;  5E7Q A;  1O92 A;  2H85 A;  5AE1 A;  4U5Y D;  2ASB A;  1QVG Y;  5BSV A;  2NVT I;  4PZP A;  3CCV 1;  1Q16 A;  4RS4 A;  1L1O C;  4DUZ C;  5IT9 b;  3LAX A;  2D28 C;  3GR0 A;  3JAM D;  3IR7 A;  3HOV I;  4YHH C;  1YJ7 A;  4AYB A;  4DR7 C;  1VQO 1;  2NVX I;  3CCS 1;  1WJ2 A;  2UU9 C;  1T5D X;  1XNQ C;  2IV2 X;  3GTM S;  2DPL A;  4DR1 C;  1YJW Z;  5IT9 D;  3I4N I;  2NCL A;  1DL6 A;  4LF4 C;  2UUC C;  4A3C I;  2E9H A;  5BSU A;  2PMZ A;  3EQ6 A;  3ESW A;  2ZZM A;  2E5L C;  1ZH1 A;  4DCS A;  1P4E C;  1Q7Y 1;  3T1Y C;  3CCE Z;  2P2B A;  1VQM Z;  2M5O A;  3CW9 A;  1QVG Z;  1LQL A;  3S1Q I;  2UUA C;  1Q81 2;  1TWC I;  4B3M C;  5T8S A;  1NJI 1;  3G71 1;  4RVG A;  1ZB8 A;  4NBF A;  4A3M I;  3UX2 A;  1TWF I;  4DG9 A;  3K7A I;  2MCQ A;  2QW0 X;  4NBE A;  1IBM C;  1VQ6 1;  1X3W A;  5LL6 f;  3J81 f;  5C4X I;  3UX3 A;  3CC7 1;  2RHB A;  3E7W A;  1S72 Z;  1YI2 1;  1KC8 1;  2JMO A;  2ONF A;  4NFR A;  3PBK A;  4X64 C;  5AN9 F;  3CCM 1;  3UOW A;  2YAD A;  2VUG A;  4LF9 C;  4X66 C;  4BXX I;  3BG1 B;  4B3S C;  4FTF A;  4BBY A;  2JIM A;  2OPL B;  1VQ4 1;  3I08 A;  2W03 A;  3NPD A;  5LMN C;  1M6X C;  4LE5 A;  3GTJ I;  2K3R A;  3J80 f;  2LIY A;  3J81 b;  3CCJ 1;  1TH5 A;  4DV2 C;  4PUG A;  1RLY A;  4QTU A;  3J7A 4;  1QWI A;  3CC4 Z;  1ML8 A;  3CME Z;  1PG4 A;  2BH1 X;  4D4G A;  4DR3 C;  3J81 D;  1IB8 A;  4DCT A;  1R9T I;  2IZ3 A;  5BUR A;  3CCU 1;  3H2T A;  4X6A I;  1K8A 1;  1XHJ A;  1SFO I;  2F4O A;  4EAT A;  3S2H I;  2LFU A;  1WF3 A;  2WP0 C;  2QEX Z;  3CCS Z;  2YX1 A;  2YCB A;  1T5H X;  1RO4 A;  1V25 A;  3TUF A;  2HF1 A;  4ODJ A;  1MXA A;  4NBH A;  2PN2 A;  1YIT 1;  4RM3 A;  5A19 A;  3N2Q A;  1WII A;  2QVY X;  1K73 2;  4E31 A;  1RNI A;  1JWH C;  1AA6 A;  1N36 C;  4LFA C;  4NB9 A;  1I6H I;  1TWG I;  1WW9 A;  3J80 D;  3CQ1 A;  2VPZ A;  4L2Z A;  3IX0 A;  5K8F A;  3CCR 1;  3HOY I;  2VQF C;  1VQ7 Z;  3DAY A;  2JMP A;  2ZAE B;  2D1Q A;  1VQL 1;  1K0R A;  4R0M A;  5IWA C;  1K83 I;  4L4Q A;  4DV5 C;  2ZZN A;  3VMH A;  3A9U A;  1L2F A;  1I50 I;  5K85 A;  1VQN 1;  4HPV A;  4G1I A;  3CC7 Z;  3NDI A;  3T4N B;  3FCE A;  2MMA B;  1YJ9 1;  4A3J I;  3TE5 B;  1X0T A;  3LNO A;  5A1I A;  5BST A;  4DV6 C;  3SO4 A;  2PT7 G;  4KHP C;  1SIW A;  4DV3 C;  5KYT A; 
#chains in the Genus database with same CATH homology
 1EGA A;  3PES A;  4E2W A;  1VQ8 1;  3I56 Z;  1BA3 A;  3CCQ 1;  3U50 C;  4DK1 A;  1VQ4 Z;  4CL1 A;  4Y52 I;  2OO4 A;  3TDH B;  4A3B I;  2Q4Z A;  3T1H C;  2DE7 A;  3F3F C;  1PG3 A;  1MKY A;  2PK7 A;  4MD7 A;  3H0G I;  1I3Q I;  4Y7N I;  2E2I I;  3VNQ A;  5LMU C;  3I07 A;  1WCM I;  2JNY A;  3GKU A;  3HKZ A;  1YIJ 1;  3GR1 A;  2PM9 A;  3VTN A;  3VMG A;  4E30 A;  4ZLP A;  2OTJ 1;  2V8I A;  2V8J A;  4JI3 C;  4BSZ A;  1MD9 A;  1Q82 1;  4E2X A;  2CY1 A;  3LGX A;  4BY1 I;  2D1T A;  2P02 A;  3PO3 S;  2UXB C;  3CC2 1;  1K9M 1;  3CCL Z;  2KZF A;  4MD9 A;  1XMO C;  1MXC A;  3CMA Z;  4WS9 A;  3CD6 1;  3GTM I;  4IR7 A;  2E2H I;  5D1O A;  1XRC A;  2Y0S A;  2RT9 A;  2OOX B;  3S16 I;  2M6N A;  3PO3 I;  2W04 A;  3GTL I;  1UKK A;  2QL8 A;  4I9F A;  1N33 C;  4EWC A;  4BBR I;  1TWH I;  3HOZ I;  1QM4 A;  3FKI I;  4JV5 C;  3DHV A;  3GTQ I;  4DR5 C;  2UXC C;  4KTV A;  1VQ5 1;  3S82 A;  2RPR A;  4RVF A;  4BY7 I;  5CM2 M;  1XMQ C;  3FCC A;  2P2Q A;  1YHQ 1;  3ETC A;  2JUB A;  1O9T A;  3M4O I;  4MH4 A;  4RM2 A;  2E0G A;  3VB9 A;  3IEU A;  2AYA A;  2ZM6 C;  3FQM A;  3G4S 1;  1PA4 A;  2B63 I;  2QVX X;  1YJN 1;  2EGT A;  3DLP X;  3HOU I;  5H9U A;  4A3K I;  2YWC A;  2F4M A;  4X62 C;  4L7I A;  2PRO A;  3CCQ Z;  1YUK A;  3TQI A;  1KD1 2;  1RO2 A;  5C44 I;  4DCV A;  2I3C A;  3HOX I;  4E2Z A;  2QA4 Z;  4ZJZ A;  3IPL A;  2G2K A;  2Q51 A;  4JI0 C;  4OYC A;  3S1M I;  1VQP Z;  2Y4N A;  1N8R 2;  2V7B A;  3CJE A;  2OTL 1;  4DCU A;  1RY2 A;  1HR0 C;  4AQY C;  3CCV Z;  2ATW A;  4HH4 A;  1Q81 1;  1P7L A;  3A4I A;  3VMI A;  4HGZ A;  4DG8 A;  4A3G I;  4DUY C;  2WAQ A;  5FLX f;  1VQO Z;  3I55 1;  1HH2 P;  2GTH A;  4NBG A;  1VQK 1;  5D1P A;  1FUG A;  1USP A;  1N32 C;  4JI1 C;  1S7M A;  4E33 A;  5T6B A;  4TNU A;  3KIF A;  3J80 b;  1M90 2;  3N54 B;  4NOZ A;  4DGL A;  1VQ9 1;  3RZO I;  2JA8 I;  2E8E A;  3G6E 1;  4B3T C;  3F3P C;  2OOY B;  2O4H A;  3NYQ A;  4LF8 C;  3MON A;  3NH8 A;  3CD6 Z;  4A3E I;  4MXU A;  3ETO A;  1O90 A;  4NB8 A;  4RVD A;  4NH1 C;  3G71 Z;  4DQY B;  2NVY I;  2IZ4 A;  5BSW A;  5FLX b;  1Q86 2;  4OXI A;  5IFI A;  3CQZ I;  2JA6 I;  4JI2 C;  4A3D I;  4JI8 C;  2OBV A;  2XR1 A;  1TWA I;  1VQ6 Z;  4DV1 C;  4HGY A;  3S17 I;  5FLX D;  1N34 C;  3S2D I;  3LUS A;  1N2F A;  2VF1 A;  5IP7 I;  5C3E I;  1M1K 2;  2QVZ X;  2HU9 A;  3NFZ A;  3CCE 1;  2D27 A;  1VQM 1;  1ZB9 A;  4RVH A;  4XX2 A;  1YHQ Z;  1YI2 Z;  2CXC A;  4GXR A;  4D4I A;  5GTD A;  4BCA A;  3OTO C;  4JI6 C;  2E8F A;  3CCM Z;  2QRE B;  1HNX C;  2J6A A;  2P3Y A;  4S1T A;  4NXN C;  1MDF A;  1AMU A;  2Y27 A;  4IZ6 A;  1WH9 A;  3AF6 A;  3C5E A;  3BG0 B;  4RVO A;  3CCJ Z;  1Q7Y 2;  3AF5 A;  4LF6 C;  1M90 1;  4DV7 C;  3PRO C;  3P5J B;  5D1O B;  1S72 1;  2E2J I;  1K73 1;  4K0B A;  4DR4 C;  1KQS Y;  5IP9 I;  2D7V A;  2P2F A;  3OW2 Y;  3LNV A;  1RQF A;  1NJI 2;  2P2J A;  3CCU Z;  3D9X A;  5BUQ A;  1O93 A;  1JJ2 Y;  1Z03 A;  5FLM I;  3R9X A;  3Q87 A;  2D1R A;  1XNR C;  1PFT A;  5AE2 A;  1NP6 A;  1YIT Z;  4D57 A;  3I4M I;  3S1R I;  1KC8 2;  3RG2 A;  3CC4 1;  3E7X A;  2P20 A;  3CME 1;  2KI7 B;  4RMN A;  5ADZ A;  3IFU A;  1KQS Z;  3OW2 Z;  2HHH C;  5C4J I;  4RV9 A;  1KRL A;  4KTT A;  3VNS A;  1QVF Y;  1GPM A;  3FQQ A;  3CCR Z;  2QEX 1;  2R6M A;  3GTK I;  4PHT A;  1XRA A;  2QRC B;  1VQL Z;  1JJ2 Z;  4DR6 C;  1V26 A;  2O53 A;  1VLA A;  3QWU A;  3EED A;  4NXM C;  3UZ0 A;  4DV0 C;  4BBS I;  2QR1 B;  1VQN Z;  1W2B Y;  2WD9 A;  3NDJ A;  1YJ9 Z;  3M3Y I;  4LFC C;  1QF8 A;  1JOS A;  4A3L I;  1K8A 2;  1P9N A;  1QYP A;  3MZK B;  5A2Q f;  1LCI A;  2DE5 A;  2VQE C;  1QVF Z;  2Y4O A;  3GKQ A;  4GS5 A;  4JYA C;  4JI5 C;  4NBA A;  3H3V J;  3A9V A;  1VQ7 1;  3GTP I;  1VQ8 Z;  1USP B;  5CZV A;  3IEV A;  2R7Z I;  4RLQ A;  4A3F I;  1J5E C;  2JS4 A;  5DV9 A;  5A1G A;  3KIH A;  2QKD A;  5T8T A;  2JR6 A;  3S14 I;  3D6W A;  2F4V C;  3NH4 A;  3R9W A;  1W2B Z;  2AKL A;  4G36 A;  2R92 I;  4TPS B;  3HOW I;  1NUI A;  5A2Q b;  4DV4 C;  2K5R A;  4RVN A;  3S1N I;  4E2Y A;  4BC9 A;  1IBL C;  3VNR A;  1YIJ Z;  2E7G A;  5BUS A;  3I56 1;  1KKG A;  2P2M A;  4JM1 A;  1NYE A;  2VSQ A;  1HNZ C;  2OTJ Z;  5JRH A;  4GXQ A;  5A2Q D;  3NI2 A;  1I94 C;  4LFB C;  4OX9 C;  2DYJ A;  2WB1 A;  4A3I I;  3TDE A;  4NBC A;  2M48 A;  3G7S A;  3CC2 Z;  1Z02 A;  1TFI A;  3GTG I;  3GTO I;  4FUQ A;  4K0K C;  4GKK C;  2VUM I;  3PO2 I;  4LF5 C;  2JA5 I;  5CZX A;  4WV3 A;  2RBL A;  3KXW A;  4NDN A;  1IBK C;  5KYV A;  2HJG A;  1YJW 1;  2OPL A;  2RIQ A;  2V8K A;  3EER A;  4B3R C;  5BSR A;  5AE3 A;  3L95 X;  2P28 A;  1KD1 1;  1MDB A;  4RLF A;  3CCL 1;  3CPW Y;  2R93 I;  2KPI A;  4MON A;  1VQ5 Z;  3CMA 1;  2NVQ I;  4D56 A;  4GKJ C;  3IF8 A;  2UUB C;  3GCF A;  3MZL B;  4NBB A;  1N8R 1;  5KEI A;  2OZK A;  4R1L A;  3NH5 A;  1YUA A;  1Z01 A;  3G4S Z;  2YWB A;  4JI4 C;  1YJN Z;  3IML A;  3S15 I;  2QLV B;  2BJO A;  4A93 I;  4MD8 A;  3RZD I;  4JI7 C;  3GPC A;  4YY3 C;  3R44 A;  1Q82 2;  1MXB A;  1FJG C;  3RV2 A;  4NBD A;  1Y1V S;  2GU2 A;  1K9M 2;  1Y1W I;  4R1M A;  5T67 A;  5BR8 C;  3CXC Y;  3CPW Z;  2E8C A;  3B7W A;  2UXD C;  4MTN A;  4QTT A;  3JAM f;  1RG9 A;  4X65 C;  2OTL Z;  1ULT A;  4FUT A;  5T64 A;  3NYR A;  2QRD B;  1Y1V I;  4PRO C;  5BSM A;  5IT9 f;  4DR2 C;  4LF7 C;  1RO0 A;  2YU9 I;  3I55 Z;  4ISB A;  1VQK Z;  2VZE A;  4E32 A;  2D1S A;  1Q86 1;  4MRI A;  2DE6 A;  1XRB A;  3CW8 X;  4BC7 A;  1HNW C;  1X3Z A;  2QA4 1;  4G37 A;  3L8C A;  2GTI A;  3CXC Z;  1VQ9 Z;  2JA7 I;  1VQP 1;  3G6E Z;  4I9G A;  3JAM b;  1M1K 1;  5E7Q A;  1O92 A;  2H85 A;  5AE1 A;  4U5Y D;  2ASB A;  1QVG Y;  5BSV A;  2NVT I;  4PZP A;  3CCV 1;  4RS4 A;  1L1O C;  4DUZ C;  5IT9 b;  3LAX A;  2D28 C;  3GR0 A;  3JAM D;  3HOV I;  4YHH C;  1YJ7 A;  4AYB A;  4DR7 C;  1VQO 1;  2NVX I;  3CCS 1;  2UU9 C;  1T5D X;  1XNQ C;  3GTM S;  2DPL A;  4DR1 C;  1YJW Z;  5IT9 D;  3I4N I;  4LF4 C;  1DL6 A;  2UUC C;  4A3C I;  2E9H A;  5BSU A;  2PMZ A;  3EQ6 A;  3ESW A;  2E5L C;  1ZH1 A;  4DCS A;  1Q7Y 1;  3T1Y C;  3CCE Z;  2P2B A;  1VQM Z;  3CW9 A;  1QVG Z;  1LQL A;  3S1Q I;  2UUA C;  1Q81 2;  1TWC I;  4B3M C;  5T8S A;  1NJI 1;  3G71 1;  4RVG A;  1ZB8 A;  4NBF A;  4A3M I;  1TWF I;  4DG9 A;  3K7A I;  2QW0 X;  4NBE A;  1IBM C;  1VQ6 1;  1X3W A;  5LL6 f;  3J81 f;  5C4X I;  3CC7 1;  2RHB A;  3E7W A;  1S72 Z;  1YI2 1;  1KC8 1;  2JMO A;  2ONF A;  4NFR A;  3PBK A;  4X64 C;  5AN9 F;  3CCM 1;  3UOW A;  2YAD A;  2VUG A;  4LF9 C;  4X66 C;  4BXX I;  3BG1 B;  4B3S C;  4FTF A;  4BBY A;  2OPL B;  1VQ4 1;  3I08 A;  2W03 A;  3NPD A;  5LMN C;  4LE5 A;  3GTJ I;  2K3R A;  3J80 f;  2LIY A;  3J81 b;  3CCJ 1;  4DV2 C;  1RLY A;  4QTU A;  3J7A 4;  1QWI A;  3CC4 Z;  1ML8 A;  3CME Z;  1PG4 A;  2BH1 X;  4D4G A;  4DR3 C;  3J81 D;  4DCT A;  1R9T I;  2IZ3 A;  5BUR A;  3CCU 1;  3H2T A;  4X6A I;  1K8A 1;  1SFO I;  2F4O A;  4EAT A;  3S2H I;  2LFU A;  1WF3 A;  2WP0 C;  2QEX Z;  3CCS Z;  2YCB A;  1T5H X;  1RO4 A;  1V25 A;  3TUF A;  2HF1 A;  4ODJ A;  1MXA A;  4NBH A;  2PN2 A;  1YIT 1;  4RM3 A;  5A19 A;  3N2Q A;  1WII A;  2QVY X;  1K73 2;  4E31 A;  1RNI A;  1JWH C;  1N36 C;  4LFA C;  4NB9 A;  1I6H I;  1TWG I;  1WW9 A;  3J80 D;  4L2Z A;  3IX0 A;  5K8F A;  3CCR 1;  3HOY I;  2VQF C;  1VQ7 Z;  3DAY A;  2JMP A;  2ZAE B;  2D1Q A;  1VQL 1;  1K0R A;  4R0M A;  5IWA C;  1K83 I;  4L4Q A;  4DV5 C;  3VMH A;  3A9U A;  1L2F A;  1I50 I;  5K85 A;  1VQN 1;  4HPV A;  4G1I A;  3CC7 Z;  3NDI A;  3T4N B;  3FCE A;  1YJ9 1;  4A3J I;  3TE5 B;  1X0T A;  5A1I A;  5BST A;  4DV6 C;  3SO4 A;  2PT7 G;  4KHP C;  4DV3 C;  5KYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...