1USPB

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
134
Chain Sequence
ANVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRNKIDVPADSTITARVGLQKFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
total genus 31
structure length 134
sequence length 138
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspB01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspB02
4A3EI 3I4MI 1I6HI 3S16I 3S2DI 3HOWI 1QWIA 3VMIA 4DV4C 1RO4A 2K5RA 1I50I 3J80D 2EGTA 5IP9I 4QTUA 4DV3C 4Y7NI 1R9TI 5C4JI 4LF5C 4B3TC 3HOUI 3VMHA 4X6AI 3RZOI 2OPLB 3GKUA 4MTNA 4YY3C 1NYEA 1ZB9A 3GTKI 5IWAC 3J81D 2RBLA 1FJGC 2ATWA 3K7AI 2PN2A 1HR0C 4A3KI 4JV5C 3GKQA 3OTOC 1N32C 2DE5A 3LUSA 3PO3S 1KKGA 3H0GI 4JI6C 1USPB 4NXMC 4DV0C 3S1NI 2DE6A 1K0RA 1XNRC 2UXCC 2E2HI 1TWAI 4DR7C 4A3MI 4OX9C 1K83I 4GKJC 1RLYA 3HOXI 3M3YI 5LMNC 1N36C 3PO3I 2OPLA 4JI3C 1LQLA 2ASBA 4NBGA 4X65C 1IBLC 3EERA 2VQFC 1ML8A 2E2JI 4JI4C 1XMOC 4LF9C 4LF4C 2JA8I 1L1OC 4GKKC 1DL6A 1J5EC 1XMQC 5IP7I 1Y1VI 1L2FA 1JOSA 3S2HI 4NBDA 2HF1A 1TWCI 4NBCA 4JI5C 4A3FI 2BJOA 2JA6I 3VB9A 2E7GA 3GCFA 4BBSI 4DUYC 3JAMD 1WH9A 5A2QD 3RZDI 2QL8A 3GTQI 3T1YC 2JNYA 4NBFA 5C4XI 4DR5C 4MH4A 1N33C 2D7VA 3FKII 1EGAA 1HNWC 2UXDC 1IBKC 2UUAC 2P3YA 3D6WA 3CQZI 1YUAA 5C3EI 4DR1C 2NVXI 2ZM6C 1HNZC 4YHHC 3T1HC 4B3RC 3R9WA 1Y1WI 4NB8A 3ESWA 4A3LI 3S1MI 4LF6C 2UXBC 2NVTI 1X3ZA 3GTPI 2DYJA 1TWHI 2F4VC 3GTLI 4DV7C 2R92I 1N34C 1ZB8A 1IBMC 2NVQI 4LFAC 2DE7A 4BXXI 3GTOI 2NVYI 4NBAA 4BSZA 2YU9I 2PK7A 4X62C 2UUCC 2B63I 2CY1A 1I94C 3CJEA 3R9XA 2UU9C 5FLXD 2E8EA 4B3MC 2JR6A 4BY7I 4DR2C 1MKYA 3HOZI 4K0KC 4XX2A 4AQYC 4DUZC 1USPA 4A3DI 4NBBA 3GTMS 2R93I 3PO2I 4LF8C 3S17I 1WCMI 5LMUC 3GTGI 1WF3A 3VMGA 1NUIA 3AF5A 1Y1VS 2E8CA 4X66C 2JMPA 2YCBA 4DV2C 1TWFI 1I3QI 3S1QI 1TWGI 3GTMI 4BY1I 3H3VJ 4JI2C 2F4OA 2E5LC 4NBEA 2PT7G 4A3II 3HOVI 2KZFA 4NOZA 3IEVA 4DCUA 2JS4A 2R7ZI 2VQEC 2UUBC 5FLMI 1PFTA 4Y52I 2KPIA 3U50C 4A3GI 5CM2M 3S1RI 4DR3C 1PA4A 2AKLA 2HHHC 1UKKA 4JI8C 1SFOI 2E2II 3AF6A 4JI7C 4DR6C 4A3BI 1HNXC 4DR4C 1VLAA 4LF7C 4JI0C 2XR1A 3IEUA 4X64C 1TFIA 3S14I 3HOYI 2HJGA 3GTJI 5C44I 1QYPA 4B3SC 2F4MA 4A3JI 4DCTA 2VUMI 4BBRI 4JYAC 4A93I 4DV5C 3M4OI 5IT9D 1XNQC 4A3CI 2JA5I 4KHPC 4JI1C 3Q87A 4DV6C 1HH2P 2E8FA 1X3WA 4DCSA 4NB9A 2CXCA 2ONFA 4DCVA 3S15I 1N2FA 4LFCC 1WW9A 4DV1C 4NBHA 5BR8C 2J6AA 4QTTA 3I07A 2JA7I 4LFBC 4NXNC 3I4NI
chains in the Genus database with same CATH superfamily
3I4MI 2G2KA 4TNUA 3S16I 3HOWI 3S2DI 3VMIA 3NYQA 4DV4C 1M6XA 1PG3A 5BURA 2QKDA 3A26A 1MXAA 5C4JI 4B3TC 4E2ZA 2OPLB 4FTFA 4MTNA 4D56A 3NDIA 1YJN1 1Q7Y1 3IX0A 5T64A 1VQOZ 3OTOC 1KKGA 3PO3S 4NXMC 4BCAA 4DV0C 3S1NI 2DE6A 3CXCY 1K0RA 2AYAA 3EEDA 2VPYA 4DR7C 2WB1A 4BC9A 3CCEZ 1RLYA 3M3YI 1N8R2 2ASBA 5LL6f 3EERA 4PHTA 2V8JA 2RIQA 1XMOC 4LF9C 3D2LA 4LF4C 5IT9f 4PZPA 2P2FA 1ZH1A 1DL6A 5AN9F 3JAMf 1J5EC 1L2FA 1JOSA 1MXCA 3J81b 2Y27A 3S2HI 4NBDA 2KZ0A 4NBCA 4JI5C 3CW8X 3NH4A 2JA6I 1FUGA 4ODJA 2HU9A 1Q7Y2 2PROA 3GCFA 4RS4A 3JAMD 1WH9A 3FCEA 1P4EC 5KYTA 2D28C 4RVNA 5BSMA 3T1YC 4NBFA 3FCCA 4MH4A 5IFIA 1HNWC 2UXDC 1O93A 1QVFY 1WJ2A 3J80f 1XHJA 1FLOA 2NVXI 4YHHC 3CC41 3T1HC 1Y1WI 1YJWZ 5CZVA 1QVGY 3N54B 2KI7B 4R1MA 1TWHI 5D1OA 3CCRZ 3NH5A 4DGLA 3CXCZ 2DE7A 1Q862 2NVYI 1YIJZ 2ZZNA 4E33A 3E7XA 4X62C 4GXRA 3I08A 1RO2A 5FLXD 4B3MC 3S82A 3TDHB 4K0BA 2VUGA 1XRCA 2E9HA 2R93I 1VQ51 3GTGI 2W03A 4S1TA 3J81f 2JMPA 5D1PA 2YCBA 4ISBA 1YITZ 3S1QI 3H3VJ 2QW0X 2KZFA 5T8SA 4DCUA 2JS4A 3CCQ1 4EWCA 4R1LA 1VQ5Z 4HGYA 5T8TA 2GU2A 3BG1B 4RVGA 2E2II 4G37A 4JI7C 1AA6A 3IEUA 2OTL1 4X64C 2QLVB 5AE3A 1QYPA 3L8CA 4A3JI 4JYAC 3UEBA 2O4HA 1VQNZ 1QVGZ 2I3CA 3UX3A 4ZLPA 1K8A1 3NFZA 3Q87A 4NFRA 3T4NB 2E8FA 4DCSA 2CXCA 2WP0C 2ONFA 3CC71 5A1GA 5A1IA 1VQ81 4DV1C 4IR7A 5BR8C 5JRHA 1I6HI 1QWIA 1LCIA 4GXQA 1I50I 2DPLA 1P4EA 4QTUA 3D9XA 1VQ8Z 3N2QA 1VQ71 3UZ0A 1Z01A 2YADA 3RZOI 3GKUA 3JAMb 1NYEA 3I56Z 3GTKI 4LE5A 1SIWA 5IT9b 2D1SA 4DG8A 2ATWA 1VQMZ 1V26A 2PN2A 3GKQA 3CCVZ 4WS9A 3H0GI 4JI6C 1USPB 4E2WA 2JIQA 3LNVA 2E2HI 4OYCA 1P9NA 4GKJC 1YI2Z 2JNVA 4KTTA 2QA41 1LQLA 1VQ9Z 4NBGA 4WV3A 4D4GA 4X65C 4RLFA 2VQFC 3G71Z 2JIPA 1Q861 2M6NA 1VQK1 1RY2A 2V7BA 2V3VA 4DG9A 3FQMA 3F3FC 3J80b 3I551 1KC82 2P02A 1QXFA 3CCJZ 1TWCI 3DHVA 1T5DX 3IPLA 3VB9A 2YX1A 1Z03A 2JIOA 2VZEA 1YIT1 5CZXA 4DUYC 1NJI2 2V8IA 4RVFA 5BUQA 3CQ3A 2QL8A 2GTIA 2JUBA 1JJ2Z 5C4XI 2QRCB 4KTVA 2D7VA 1KD12 3NPDA 1GPMA 2OO4A 4PUHA 5C3EI 3F3PC 3KIFA 2QA4Z 1VQ91 4B3RC 5A2Qb 4L2ZA 3CQ1A 4AYBA 4E31A 4HGZA 3ESWA 3CD6Z 4LF6C 4EATA 1X3ZA 3GTPI 3CCV1 2F4VC 4MD7A 1QVFZ 3GTLI 4LFAC 1ZB8A 4BXXI 2D1TA 5BUSA 1YJW1 3E7WA 4NDNA 3I561 2CY1A 2QEX1 3R44A 4R0MA 2E8EA 4BY7I 4DK1A 1P7LA 4XX2A 3A4IA 5GTDA 1V60A 2O53A 5T67A 1VQLZ 3PO2I 3ETOA 4BBYA 2Q51A 4E30A 2ZZMA 1WF3A 1FDOA 1Y1VS 3B7WA 2VPXA 3IMLA 1I3QI 3CC7Z 3GTMI 4JI2C 2VF1A 2Y4NA 3QWUA 3HOVI 1V25A 1RG9A 4HPVA 5KEIA 5E7QA 5D1OB 4Y52I 3U50C 1NP6A 1VQN1 4FUQA 3S1RI 2E7ZA 4DR3C 1PA4A 2AKLA 1SFOI 3VNSA 3AF6A 2D1RA 4A3BI 1VLAA 1UWDA 3C5EA 4JI0C 1TFIA 4U5YD 2HJGA 4TPSB 2IZ3A 2QREB 4BBRI 1Q821 3CCQZ 4OXIA 5KYVA 3M4OI 5IT9D 4PUIA 1XNQC 1JJ2Y 2JA5I 4JI1C 2V45A 4D57A 2P2JA 4DV6C 2H85A 4MRIA 1N2FA 4LFCC 3CCU1 4NBHA 3I07A 1FDIA 2QVXX 4NXNC 2Y0SA 3A9UA 1WIIA 2K5RA 3CQ2A 3RV2A 4I9FA 1VQ4Z 4Y7NI 3O2EA 5BSWA 4DV3C 4LF5C 3NI2A 3A9VA 2OBVA 2YWBA 3VMHA 2E0GA 2OTJ1 2Q4ZA 3CPWZ 1VQ61 1TH5A 2MMAB 2RT9A 2WAQA 3CCM1 4L4QA 4JV5C 1VQPZ 2IZ4A 1Q811 3NYRA 1M6XC 1XNRC 1NJI1 1O90A 2UXCC 4FUTA 2JIMA 1Y8CA 1VQ7Z 4OX9C 3HOXI 2P20A 5LMNC 2OPLA 5FLXf 4JM1A 1IBLC 2E2JI 2M5OA 4RM2A 4JI4C 3CCL1 2JA8I 3J7A4 4GKKC 5K8FA 1XMQC 5IP7I 1MXBA 5BSUA 3VNRA 1QF8A 1S721 5BSTA 2M48A 1WCJA 1YUKA 2QVYX 1K731 2P28A 4A3FI 3AY0A 1M1K2 4L7IA 2BJOA 3VNQA 4BBSI 1VQP1 5A2QD 2JNYA 5FLXb 4D4IA 2JIRA 1M902 1EGAA 2RPRA 3GR0A 1YI21 3MZKB 2UUAC 3PESA 3CQZI 1YUAA 4NH1C 4DR1C 3GR1A 2ZM6C 3DAYA 1HNZC 2NCLA 1BA3A 1T5HX 2R6MA 2GTHA 2IV2X 4RM3A 1YHQZ 4A3LI 3S1MI 1RNIA 5ADZA 2DYJA 3LNOA 1YJ9Z 5AE2A 4DV7C 2R92I 2JMOA 1N34C 2BH1X 2NVQI 1IBMC 4DR4C 4BSZA 2QRDB 4HH4A 1YJNZ 2PK7A 1JWHC 2RHBA 2B63I 1O92A 2UU9C 4E32A 3CPWY 2JR6A 5BSVA 1RQFA 2QR1B 1VQKZ 1MKYA 4AQYC 1WZNA 1PG4A 1M901 3CCS1 3G7SA 3GTMS 2Z51A 3LGXA 3TQIA 4GS5A 5A19A 3S17I 2OOXB 1KRLA 4RMNA 1NUIA 4E2XA 1K9M2 4ZJZA 3CCMZ 1KQSZ 4BY1I 2F4OA 1Q16A 1VQ6Z 2V8KA 4A3II 2PT7G 3OW2Y 3CCR1 2VQEC 5FLMI 2KPIA 5CM2M 2YWCA 2HHHC 1UKKA 3CC4Z 1KQSY 4RVDA 3S14I 3HOYI 2DHMA 3GTJI 3G6EZ 5C44I 1M1K1 3DLPX 4B3SC 3G6E1 2QVZX 4DCTA 2VUMI 4A93I 1AMUA 1YJ91 4DV5C 4A3CI 3TUFA 1MDBA 3CME1 4RV9A 4G36A 1HH2P 2KDNA 4DCVA 2MM9A 1WW9A 3CC2Z 4QTTA 1VEHA 4LFBC 5T6BA 2WD9A 2P2BA 4A3EI 4MD9A 4BC7A 5BSRA 1RO0A 3TE5B 5K85A 1Q812 1RO4A 1MDFA 2MCQA 5H9UA 3J80D 3H2TA 5IP9I 1YIJ1 1R9TI 3HOUI 2OTLZ 3RG2A 4X6AI 1PU1A 4YY3C 1K9M1 1ZB9A 5IWAC 3J81D 1FJGC 2RBLA 4RVOA 3K7AI 1K732 1HR0C 4A3KI 1W2BZ 1N32C 2P2MA 2DE5A 3LUSA 3L95X 1VQO1 5DV9A 2VPZA 3CMEZ 2D1QA 4MD8A 2W04A 1VQL1 1Q822 1TWAI 4A3MI 1K83I 2PMZA 1N36C 4G1IA 3PO3I 4JI3C 1QM4A 5LCIA 3CMA1 1MD9A 1YHQ1 1ML8A 1W2BY 4IZ6A 3NDJA 1ULTA 2VSQA 1L1OC 3G711 3UOWA 1Y1VI 3TR3A 2HF1A 2LFUA 1N8R1 1IB8A 3PROC 2OTJZ 3G4S1 2OZKA 3SO4A 4MXUA 2E7GA 3G4SZ 4RLQA 2M5HA 4CL1A 3RZDI 2LEXA 3GTQI 4DR5C 3LAXA 1N33C 3FKII 3CCSZ 2ZAEB 2D27A 3TDEA 3CCE1 1IBKC 2P3YA 3D6WA 3KXWA 3GPCA 3CCUZ 3CMAZ 3R9WA 4NB8A 3CCLZ 3ETCA 2UXBC 2NVTI 5AE1A 3IFUA 3P5JB 5A2Qf 3CCJ1 3UX2A 4MONA 3I55Z 3GTOI 4NBAA 2P2QA 2YU9I 1O9TA 2UUCC 3R9XA 1I94C 2AYDA 3VTNA 3CJEA 3MONA 4K0KC 4DR2C 3KIHA 3HOZI 2PM9A 4DUZC 2OOYB 1USPA 4A3DI 1KD11 3IR7A 4NBBA 3BG0B 1VQ41 4LF8C 1YJ7A 3NH8A 1WCMI 5LMUC 3VMGA 4X66C 3AF5A 2E8CA 4DV2C 3CC21 1TWFI 4PROC 4E2YA 1TWGI 1VQM1 1Z02A 2K3RA 1XS3A 4NBEA 4I9GA 2E5LC 3IEVA 4PUGA 4NOZA 2CU6A 3EQ6A 2R7ZI 2UUBC 3A25A 1PFTA 1NY8A 1S72Z 1XRBA 4A3GI 4JI8C 4DR6C 1HNXC 4LF7C 4RVHA 2XR1A 1X0TA 3MZLB 2QEXZ 3PBKA 2VPWA 3OW2Z 2F4MA 2LIYA 1S7MA 3FQQA 1K8A2 4KHPC 3IF8A 3HKZA 2Y4OA 1X3WA 1XRAA 4NB9A 3CW9A 4DQYB 3S15I 3K6RA 3CD61 2J6AA 2JA7I 2EGTA 2NAPA 1KC81 3I4NI
chains in the Genus database with same CATH topology
3I4MI 2G2KA 4TNUA 3S16I 3HOWI 3S2DI 3VMIA 3NYQA 4DV4C 1PG3A 5BURA 2QKDA 1MXAA 5C4JI 4B3TC 4E2ZA 2OPLB 4FTFA 4MTNA 4D56A 3NDIA 1YJN1 1Q7Y1 3IX0A 5T64A 1VQOZ 3OTOC 1KKGA 3PO3S 4NXMC 4BCAA 4DV0C 3S1NI 2DE6A 3CXCY 1K0RA 2AYAA 3EEDA 4DR7C 2WB1A 4BC9A 3CCEZ 1RLYA 3M3YI 1N8R2 2ASBA 5LL6f 3EERA 4PHTA 2V8JA 2RIQA 1XMOC 4LF9C 4LF4C 5IT9f 4PZPA 2P2FA 1ZH1A 1DL6A 5AN9F 3JAMf 1J5EC 1L2FA 1JOSA 1MXCA 3J81b 2Y27A 3S2HI 4NBDA 4NBCA 4JI5C 3CW8X 3NH4A 2JA6I 1FUGA 4ODJA 2HU9A 1Q7Y2 2PROA 3GCFA 4RS4A 3JAMD 1WH9A 3FCEA 5KYTA 2D28C 4RVNA 5BSMA 3T1YC 4NBFA 3FCCA 4MH4A 5IFIA 1HNWC 2UXDC 1O93A 1QVFY 3J80f 2NVXI 4YHHC 3CC41 3T1HC 1Y1WI 1YJWZ 5CZVA 1QVGY 3N54B 2KI7B 4R1MA 1TWHI 5D1OA 3CCRZ 3NH5A 4DGLA 3CXCZ 2DE7A 1Q862 2NVYI 1YIJZ 4E33A 3E7XA 4X62C 4GXRA 3I08A 1RO2A 5FLXD 4B3MC 3S82A 3TDHB 4K0BA 2VUGA 1XRCA 2E9HA 2R93I 1VQ51 3GTGI 2W03A 4S1TA 3J81f 2JMPA 5D1PA 2YCBA 4ISBA 1YITZ 3S1QI 3H3VJ 2QW0X 2KZFA 5T8SA 4DCUA 2JS4A 3CCQ1 4EWCA 4R1LA 1VQ5Z 4HGYA 5T8TA 2GU2A 3BG1B 4RVGA 2E2II 4G37A 4JI7C 3IEUA 2OTL1 4X64C 2QLVB 5AE3A 1QYPA 3L8CA 4A3JI 4JYAC 2O4HA 1VQNZ 1QVGZ 2I3CA 4ZLPA 1K8A1 3NFZA 3Q87A 4NFRA 3T4NB 2E8FA 4DCSA 2CXCA 2WP0C 2ONFA 3CC71 5A1GA 5A1IA 1VQ81 4DV1C 4IR7A 5BR8C 5JRHA 1I6HI 1QWIA 1LCIA 4GXQA 1I50I 2DPLA 4QTUA 3D9XA 1VQ8Z 3N2QA 1VQ71 3UZ0A 1Z01A 2YADA 3RZOI 3GKUA 3JAMb 1NYEA 3I56Z 3GTKI 4LE5A 5IT9b 2D1SA 4DG8A 2ATWA 1VQMZ 1V26A 2PN2A 3GKQA 3CCVZ 4WS9A 3H0GI 4JI6C 1USPB 4E2WA 3LNVA 2E2HI 4OYCA 1P9NA 4GKJC 1YI2Z 4KTTA 2QA41 1LQLA 1VQ9Z 4NBGA 4WV3A 4D4GA 4X65C 4RLFA 2VQFC 3G71Z 1Q861 2M6NA 1VQK1 1RY2A 2V7BA 4DG9A 3FQMA 3F3FC 3J80b 3I551 1KC82 2P02A 3CCJZ 1TWCI 3DHVA 1T5DX 3IPLA 3VB9A 1Z03A 2VZEA 1YIT1 5CZXA 4DUYC 1NJI2 2V8IA 4RVFA 5BUQA 2QL8A 2GTIA 2JUBA 1JJ2Z 5C4XI 2QRCB 4KTVA 2D7VA 1KD12 3NPDA 1GPMA 2OO4A 5C3EI 3F3PC 3KIFA 2QA4Z 1VQ91 4B3RC 5A2Qb 4L2ZA 4AYBA 4E31A 4HGZA 3ESWA 3CD6Z 4LF6C 4EATA 1X3ZA 3GTPI 3CCV1 2F4VC 4MD7A 1QVFZ 3GTLI 4LFAC 1ZB8A 4BXXI 2D1TA 5BUSA 1YJW1 3E7WA 4NDNA 3I561 2CY1A 2QEX1 3R44A 4R0MA 2E8EA 4BY7I 4DK1A 1P7LA 4XX2A 3A4IA 5GTDA 2O53A 5T67A 1VQLZ 3PO2I 3ETOA 4BBYA 2Q51A 4E30A 1WF3A 1Y1VS 3B7WA 3IMLA 1I3QI 3CC7Z 3GTMI 4JI2C 2VF1A 2Y4NA 3QWUA 3HOVI 1V25A 1RG9A 4HPVA 5KEIA 5E7QA 5D1OB 4Y52I 3U50C 1NP6A 1VQN1 4FUQA 3S1RI 4DR3C 1PA4A 2AKLA 1SFOI 3VNSA 3AF6A 2D1RA 4A3BI 1VLAA 4JI0C 3C5EA 1TFIA 4U5YD 2HJGA 4TPSB 2IZ3A 2QREB 4BBRI 1Q821 3CCQZ 4OXIA 5KYVA 3M4OI 5IT9D 1XNQC 1JJ2Y 2JA5I 4JI1C 4D57A 2P2JA 4DV6C 2H85A 4MRIA 1N2FA 4LFCC 3CCU1 4NBHA 3I07A 2QVXX 4NXNC 2Y0SA 3A9UA 1WIIA 2K5RA 3RV2A 4I9FA 1VQ4Z 4Y7NI 5BSWA 4DV3C 4LF5C 3NI2A 3A9VA 2OBVA 2YWBA 3VMHA 2E0GA 2OTJ1 2Q4ZA 3CPWZ 1VQ61 2RT9A 2WAQA 3CCM1 4L4QA 4JV5C 1VQPZ 2IZ4A 1Q811 3NYRA 1XNRC 1NJI1 1O90A 2UXCC 4FUTA 1VQ7Z 4OX9C 3HOXI 2P20A 5LMNC 2OPLA 5FLXf 4JM1A 1IBLC 2E2JI 4RM2A 4JI4C 3CCL1 2JA8I 3J7A4 4GKKC 5K8FA 1XMQC 5IP7I 1MXBA 5BSUA 3VNRA 1QF8A 1S721 5BSTA 2M48A 1YUKA 2QVYX 1K731 2P28A 4A3FI 4L7IA 1M1K2 2BJOA 3VNQA 4BBSI 1VQP1 5A2QD 2JNYA 5FLXb 4D4IA 1M902 1EGAA 2RPRA 3GR0A 1YI21 3MZKB 2UUAC 3PESA 3CQZI 1YUAA 4NH1C 4DR1C 3GR1A 2ZM6C 3DAYA 1HNZC 1BA3A 1T5HX 2R6MA 2GTHA 4RM3A 1YHQZ 4A3LI 3S1MI 1RNIA 5ADZA 2DYJA 1YJ9Z 5AE2A 4DV7C 2R92I 2JMOA 1N34C 2BH1X 2NVQI 1IBMC 4DR4C 4BSZA 2QRDB 4HH4A 1YJNZ 2PK7A 1JWHC 2RHBA 2B63I 1O92A 2UU9C 4E32A 3CPWY 2JR6A 5BSVA 1RQFA 2QR1B 1VQKZ 1MKYA 4AQYC 1PG4A 1M901 3CCS1 3G7SA 3GTMS 3LGXA 5A19A 3TQIA 4GS5A 3S17I 2OOXB 1KRLA 4RMNA 1NUIA 4E2XA 1K9M2 4ZJZA 3CCMZ 1KQSZ 4BY1I 2F4OA 1VQ6Z 2PT7G 2V8KA 4A3II 3OW2Y 3CCR1 2VQEC 5FLMI 2KPIA 5CM2M 2YWCA 2HHHC 1UKKA 3CC4Z 1KQSY 4RVDA 3S14I 3HOYI 3GTJI 3G6EZ 5C44I 1M1K1 3DLPX 4B3SC 3G6E1 2QVZX 4DCTA 2VUMI 4A93I 1AMUA 1YJ91 4DV5C 4A3CI 3TUFA 1MDBA 3CME1 4RV9A 4G36A 1HH2P 4DCVA 1WW9A 3CC2Z 4QTTA 4LFBC 5T6BA 2WD9A 2P2BA 4A3EI 4MD9A 4BC7A 5BSRA 1RO0A 3TE5B 5K85A 1Q812 1RO4A 1MDFA 5H9UA 3J80D 3H2TA 5IP9I 1YIJ1 1R9TI 3HOUI 2OTLZ 3RG2A 4X6AI 4YY3C 1K9M1 1ZB9A 5IWAC 3J81D 1FJGC 2RBLA 4RVOA 3K7AI 1K732 1HR0C 4A3KI 1W2BZ 1N32C 2P2MA 2DE5A 3LUSA 3L95X 1VQO1 5DV9A 3CMEZ 2D1QA 4MD8A 2W04A 1VQL1 1Q822 1TWAI 4A3MI 1K83I 2PMZA 1N36C 4G1IA 3PO3I 4JI3C 1QM4A 3CMA1 1MD9A 1YHQ1 1ML8A 1W2BY 4IZ6A 3NDJA 1ULTA 2VSQA 1L1OC 3G711 3UOWA 1Y1VI 2HF1A 2LFUA 1N8R1 3PROC 2OTJZ 3G4S1 2OZKA 3SO4A 4MXUA 2E7GA 3G4SZ 4RLQA 4CL1A 3RZDI 3GTQI 4DR5C 3LAXA 1N33C 3FKII 3CCSZ 2ZAEB 2D27A 3TDEA 3CCE1 1IBKC 2P3YA 3D6WA 3KXWA 3GPCA 3CCUZ 3CMAZ 3R9WA 4NB8A 3CCLZ 3ETCA 2UXBC 2NVTI 5AE1A 3IFUA 3P5JB 5A2Qf 3CCJ1 4MONA 3I55Z 3GTOI 4NBAA 2P2QA 2YU9I 1O9TA 2UUCC 3R9XA 1I94C 3VTNA 3CJEA 3MONA 4K0KC 4DR2C 3KIHA 3HOZI 2PM9A 4DUZC 2OOYB 1USPA 4A3DI 1KD11 4NBBA 3BG0B 1VQ41 4LF8C 1YJ7A 3NH8A 1WCMI 5LMUC 3VMGA 4X66C 3AF5A 2E8CA 4DV2C 3CC21 1TWFI 4PROC 4E2YA 1TWGI 1VQM1 1Z02A 2K3RA 2E5LC 4NBEA 4I9GA 3IEVA 4NOZA 3EQ6A 2R7ZI 2UUBC 1PFTA 1XRBA 1S72Z 4A3GI 4JI8C 4DR6C 1HNXC 4LF7C 4RVHA 2XR1A 1X0TA 3MZLB 2QEXZ 3PBKA 3OW2Z 2F4MA 2LIYA 1S7MA 3FQQA 1K8A2 4KHPC 3IF8A 3HKZA 2Y4OA 1X3WA 1XRAA 4NB9A 3CW9A 4DQYB 3S15I 3CD61 2J6AA 2JA7I 2EGTA 1KC81 3I4NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E I;  3I4M I;  1I6H I;  3S16 I;  3S2D I;  3HOW I;  1QWI A;  3VMI A;  4DV4 C;  1RO4 A;  2K5R A;  1I50 I;  3J80 D;  2EGT A;  5IP9 I;  4QTU A;  4DV3 C;  4Y7N I;  1R9T I;  5C4J I;  4LF5 C;  4B3T C;  3HOU I;  3VMH A;  4X6A I;  3RZO I;  2OPL B;  3GKU A;  4MTN A;  4YY3 C;  1NYE A;  1ZB9 A;  3GTK I;  5IWA C;  3J81 D;  2RBL A;  1FJG C;  2ATW A;  3K7A I;  2PN2 A;  1HR0 C;  4A3K I;  4JV5 C;  3GKQ A;  3OTO C;  1N32 C;  2DE5 A;  3LUS A;  3PO3 S;  1KKG A;  3H0G I;  4JI6 C;  1USP B;  4NXM C;  4DV0 C;  3S1N I;  2DE6 A;  1K0R A;  1XNR C;  2UXC C;  2E2H I;  1TWA I;  4DR7 C;  4A3M I;  4OX9 C;  1K83 I;  4GKJ C;  1RLY A;  3HOX I;  3M3Y I;  5LMN C;  1N36 C;  3PO3 I;  2OPL A;  4JI3 C;  1LQL A;  2ASB A;  4NBG A;  4X65 C;  1IBL C;  3EER A;  2VQF C;  1ML8 A;  2E2J I;  4JI4 C;  1XMO C;  4LF9 C;  4LF4 C;  2JA8 I;  1L1O C;  4GKK C;  1DL6 A;  1J5E C;  1XMQ C;  5IP7 I;  1Y1V I;  1L2F A;  1JOS A;  3S2H I;  4NBD A;  2HF1 A;  1TWC I;  4NBC A;  4JI5 C;  4A3F I;  2BJO A;  2JA6 I;  3VB9 A;  2E7G A;  3GCF A;  4BBS I;  4DUY C;  3JAM D;  1WH9 A;  5A2Q D;  3RZD I;  2QL8 A;  3GTQ I;  3T1Y C;  2JNY A;  4NBF A;  5C4X I;  4DR5 C;  4MH4 A;  1N33 C;  2D7V A;  3FKI I;  1EGA A;  1HNW C;  2UXD C;  1IBK C;  2UUA C;  2P3Y A;  3D6W A;  3CQZ I;  1YUA A;  5C3E I;  4DR1 C;  2NVX I;  2ZM6 C;  1HNZ C;  4YHH C;  3T1H C;  4B3R C;  3R9W A;  1Y1W I;  4NB8 A;  3ESW A;  4A3L I;  3S1M I;  4LF6 C;  2UXB C;  2NVT I;  1X3Z A;  3GTP I;  2DYJ A;  1TWH I;  2F4V C;  3GTL I;  4DV7 C;  2R92 I;  1N34 C;  1ZB8 A;  1IBM C;  2NVQ I;  4LFA C;  2DE7 A;  4BXX I;  3GTO I;  2NVY I;  4NBA A;  4BSZ A;  2YU9 I;  2PK7 A;  4X62 C;  2UUC C;  2B63 I;  2CY1 A;  1I94 C;  3CJE A;  3R9X A;  2UU9 C;  5FLX D;  2E8E A;  4B3M C;  2JR6 A;  4BY7 I;  4DR2 C;  1MKY A;  3HOZ I;  4K0K C;  4XX2 A;  4AQY C;  4DUZ C;  1USP A;  4A3D I;  4NBB A;  3GTM S;  2R93 I;  3PO2 I;  4LF8 C;  3S17 I;  1WCM I;  5LMU C;  3GTG I;  1WF3 A;  3VMG A;  1NUI A;  3AF5 A;  1Y1V S;  2E8C A;  4X66 C;  2JMP A;  2YCB A;  4DV2 C;  1TWF I;  1I3Q I;  3S1Q I;  1TWG I;  3GTM I;  4BY1 I;  3H3V J;  4JI2 C;  2F4O A;  2E5L C;  4NBE A;  2PT7 G;  4A3I I;  3HOV I;  2KZF A;  4NOZ A;  3IEV A;  4DCU A;  2JS4 A;  2R7Z I;  2VQE C;  2UUB C;  5FLM I;  1PFT A;  4Y52 I;  2KPI A;  3U50 C;  4A3G I;  5CM2 M;  3S1R I;  4DR3 C;  1PA4 A;  2AKL A;  2HHH C;  1UKK A;  4JI8 C;  1SFO I;  2E2I I;  3AF6 A;  4JI7 C;  4DR6 C;  4A3B I;  1HNX C;  4DR4 C;  1VLA A;  4LF7 C;  4JI0 C;  2XR1 A;  3IEU A;  4X64 C;  1TFI A;  3S14 I;  3HOY I;  2HJG A;  3GTJ I;  5C44 I;  1QYP A;  4B3S C;  2F4M A;  4A3J I;  4DCT A;  2VUM I;  4BBR I;  4JYA C;  4A93 I;  4DV5 C;  3M4O I;  5IT9 D;  1XNQ C;  4A3C I;  2JA5 I;  4KHP C;  4JI1 C;  3Q87 A;  4DV6 C;  1HH2 P;  2E8F A;  1X3W A;  4DCS A;  4NB9 A;  2CXC A;  2ONF A;  4DCV A;  3S15 I;  1N2F A;  4LFC C;  1WW9 A;  4DV1 C;  4NBH A;  5BR8 C;  2J6A A;  4QTT A;  3I07 A;  2JA7 I;  4LFB C;  4NXN C;  3I4N I; 
#chains in the Genus database with same CATH topology
 3I4M I;  2G2K A;  4TNU A;  3S16 I;  3HOW I;  3S2D I;  3VMI A;  3NYQ A;  4DV4 C;  1M6X A;  1PG3 A;  5BUR A;  2QKD A;  3A26 A;  1MXA A;  5C4J I;  4B3T C;  4E2Z A;  2OPL B;  4FTF A;  4MTN A;  4D56 A;  3NDI A;  1YJN 1;  1Q7Y 1;  3IX0 A;  5T64 A;  1VQO Z;  3OTO C;  1KKG A;  3PO3 S;  4NXM C;  4BCA A;  4DV0 C;  3S1N I;  2DE6 A;  3CXC Y;  1K0R A;  2AYA A;  3EED A;  2VPY A;  4DR7 C;  2WB1 A;  4BC9 A;  3CCE Z;  1RLY A;  3M3Y I;  1N8R 2;  2ASB A;  5LL6 f;  3EER A;  4PHT A;  2V8J A;  2RIQ A;  1XMO C;  4LF9 C;  3D2L A;  4LF4 C;  5IT9 f;  4PZP A;  2P2F A;  1ZH1 A;  1DL6 A;  5AN9 F;  3JAM f;  1J5E C;  1L2F A;  1JOS A;  1MXC A;  3J81 b;  2Y27 A;  3S2H I;  4NBD A;  2KZ0 A;  4NBC A;  4JI5 C;  3CW8 X;  3NH4 A;  2JA6 I;  1FUG A;  4ODJ A;  2HU9 A;  1Q7Y 2;  2PRO A;  3GCF A;  4RS4 A;  3JAM D;  1WH9 A;  3FCE A;  1P4E C;  5KYT A;  2D28 C;  4RVN A;  5BSM A;  3T1Y C;  4NBF A;  3FCC A;  4MH4 A;  5IFI A;  1HNW C;  2UXD C;  1O93 A;  1QVF Y;  1WJ2 A;  3J80 f;  1XHJ A;  1FLO A;  2NVX I;  4YHH C;  3CC4 1;  3T1H C;  1Y1W I;  1YJW Z;  5CZV A;  1QVG Y;  3N54 B;  2KI7 B;  4R1M A;  1TWH I;  5D1O A;  3CCR Z;  3NH5 A;  4DGL A;  3CXC Z;  2DE7 A;  1Q86 2;  2NVY I;  1YIJ Z;  2ZZN A;  4E33 A;  3E7X A;  4X62 C;  4GXR A;  3I08 A;  1RO2 A;  5FLX D;  4B3M C;  3S82 A;  3TDH B;  4K0B A;  2VUG A;  1XRC A;  2E9H A;  2R93 I;  1VQ5 1;  3GTG I;  2W03 A;  4S1T A;  3J81 f;  2JMP A;  5D1P A;  2YCB A;  4ISB A;  1YIT Z;  3S1Q I;  3H3V J;  2QW0 X;  2KZF A;  5T8S A;  4DCU A;  2JS4 A;  3CCQ 1;  4EWC A;  4R1L A;  1VQ5 Z;  4HGY A;  5T8T A;  2GU2 A;  3BG1 B;  4RVG A;  2E2I I;  4G37 A;  4JI7 C;  1AA6 A;  3IEU A;  2OTL 1;  4X64 C;  2QLV B;  5AE3 A;  1QYP A;  3L8C A;  4A3J I;  4JYA C;  3UEB A;  2O4H A;  1VQN Z;  1QVG Z;  2I3C A;  3UX3 A;  4ZLP A;  1K8A 1;  3NFZ A;  3Q87 A;  4NFR A;  3T4N B;  2E8F A;  4DCS A;  2CXC A;  2WP0 C;  2ONF A;  3CC7 1;  5A1G A;  5A1I A;  1VQ8 1;  4DV1 C;  4IR7 A;  5BR8 C;  5JRH A;  1I6H I;  1QWI A;  1LCI A;  4GXQ A;  1I50 I;  2DPL A;  1P4E A;  4QTU A;  3D9X A;  1VQ8 Z;  3N2Q A;  1VQ7 1;  3UZ0 A;  1Z01 A;  2YAD A;  3RZO I;  3GKU A;  3JAM b;  1NYE A;  3I56 Z;  3GTK I;  4LE5 A;  1SIW A;  5IT9 b;  2D1S A;  4DG8 A;  2ATW A;  1VQM Z;  1V26 A;  2PN2 A;  3GKQ A;  3CCV Z;  4WS9 A;  3H0G I;  4JI6 C;  1USP B;  4E2W A;  2JIQ A;  3LNV A;  2E2H I;  4OYC A;  1P9N A;  4GKJ C;  1YI2 Z;  2JNV A;  4KTT A;  2QA4 1;  1LQL A;  1VQ9 Z;  4NBG A;  4WV3 A;  4D4G A;  4X65 C;  4RLF A;  2VQF C;  3G71 Z;  2JIP A;  1Q86 1;  2M6N A;  1VQK 1;  1RY2 A;  2V7B A;  2V3V A;  4DG9 A;  3FQM A;  3F3F C;  3J80 b;  3I55 1;  1KC8 2;  2P02 A;  1QXF A;  3CCJ Z;  1TWC I;  3DHV A;  1T5D X;  3IPL A;  3VB9 A;  2YX1 A;  1Z03 A;  2JIO A;  2VZE A;  1YIT 1;  5CZX A;  4DUY C;  1NJI 2;  2V8I A;  4RVF A;  5BUQ A;  3CQ3 A;  2QL8 A;  2GTI A;  2JUB A;  1JJ2 Z;  5C4X I;  2QRC B;  4KTV A;  2D7V A;  1KD1 2;  3NPD A;  1GPM A;  2OO4 A;  4PUH A;  5C3E I;  3F3P C;  3KIF A;  2QA4 Z;  1VQ9 1;  4B3R C;  5A2Q b;  4L2Z A;  3CQ1 A;  4AYB A;  4E31 A;  4HGZ A;  3ESW A;  3CD6 Z;  4LF6 C;  4EAT A;  1X3Z A;  3GTP I;  3CCV 1;  2F4V C;  4MD7 A;  1QVF Z;  3GTL I;  4LFA C;  1ZB8 A;  4BXX I;  2D1T A;  5BUS A;  1YJW 1;  3E7W A;  4NDN A;  3I56 1;  2CY1 A;  2QEX 1;  3R44 A;  4R0M A;  2E8E A;  4BY7 I;  4DK1 A;  1P7L A;  4XX2 A;  3A4I A;  5GTD A;  1V60 A;  2O53 A;  5T67 A;  1VQL Z;  3PO2 I;  3ETO A;  4BBY A;  2Q51 A;  4E30 A;  2ZZM A;  1WF3 A;  1FDO A;  1Y1V S;  3B7W A;  2VPX A;  3IML A;  1I3Q I;  3CC7 Z;  3GTM I;  4JI2 C;  2VF1 A;  2Y4N A;  3QWU A;  3HOV I;  1V25 A;  1RG9 A;  4HPV A;  5KEI A;  5E7Q A;  5D1O B;  4Y52 I;  3U50 C;  1NP6 A;  1VQN 1;  4FUQ A;  3S1R I;  2E7Z A;  4DR3 C;  1PA4 A;  2AKL A;  1SFO I;  3VNS A;  3AF6 A;  2D1R A;  4A3B I;  1VLA A;  1UWD A;  3C5E A;  4JI0 C;  1TFI A;  4U5Y D;  2HJG A;  4TPS B;  2IZ3 A;  2QRE B;  4BBR I;  1Q82 1;  3CCQ Z;  4OXI A;  5KYV A;  3M4O I;  5IT9 D;  4PUI A;  1XNQ C;  1JJ2 Y;  2JA5 I;  4JI1 C;  2V45 A;  4D57 A;  2P2J A;  4DV6 C;  2H85 A;  4MRI A;  1N2F A;  4LFC C;  3CCU 1;  4NBH A;  3I07 A;  1FDI A;  2QVX X;  4NXN C;  2Y0S A;  3A9U A;  1WII A;  2K5R A;  3CQ2 A;  3RV2 A;  4I9F A;  1VQ4 Z;  4Y7N I;  3O2E A;  5BSW A;  4DV3 C;  4LF5 C;  3NI2 A;  3A9V A;  2OBV A;  2YWB A;  3VMH A;  2E0G A;  2OTJ 1;  2Q4Z A;  3CPW Z;  1VQ6 1;  1TH5 A;  2MMA B;  2RT9 A;  2WAQ A;  3CCM 1;  4L4Q A;  4JV5 C;  1VQP Z;  2IZ4 A;  1Q81 1;  3NYR A;  1M6X C;  1XNR C;  1NJI 1;  1O90 A;  2UXC C;  4FUT A;  2JIM A;  1Y8C A;  1VQ7 Z;  4OX9 C;  3HOX I;  2P20 A;  5LMN C;  2OPL A;  5FLX f;  4JM1 A;  1IBL C;  2E2J I;  2M5O A;  4RM2 A;  4JI4 C;  3CCL 1;  2JA8 I;  3J7A 4;  4GKK C;  5K8F A;  1XMQ C;  5IP7 I;  1MXB A;  5BSU A;  3VNR A;  1QF8 A;  1S72 1;  5BST A;  2M48 A;  1WCJ A;  1YUK A;  2QVY X;  1K73 1;  2P28 A;  4A3F I;  3AY0 A;  1M1K 2;  4L7I A;  2BJO A;  3VNQ A;  4BBS I;  1VQP 1;  5A2Q D;  2JNY A;  5FLX b;  4D4I A;  2JIR A;  1M90 2;  1EGA A;  2RPR A;  3GR0 A;  1YI2 1;  3MZK B;  2UUA C;  3PES A;  3CQZ I;  1YUA A;  4NH1 C;  4DR1 C;  3GR1 A;  2ZM6 C;  3DAY A;  1HNZ C;  2NCL A;  1BA3 A;  1T5H X;  2R6M A;  2GTH A;  2IV2 X;  4RM3 A;  1YHQ Z;  4A3L I;  3S1M I;  1RNI A;  5ADZ A;  2DYJ A;  3LNO A;  1YJ9 Z;  5AE2 A;  4DV7 C;  2R92 I;  2JMO A;  1N34 C;  2BH1 X;  2NVQ I;  1IBM C;  4DR4 C;  4BSZ A;  2QRD B;  4HH4 A;  1YJN Z;  2PK7 A;  1JWH C;  2RHB A;  2B63 I;  1O92 A;  2UU9 C;  4E32 A;  3CPW Y;  2JR6 A;  5BSV A;  1RQF A;  2QR1 B;  1VQK Z;  1MKY A;  4AQY C;  1WZN A;  1PG4 A;  1M90 1;  3CCS 1;  3G7S A;  3GTM S;  2Z51 A;  3LGX A;  3TQI A;  4GS5 A;  5A19 A;  3S17 I;  2OOX B;  1KRL A;  4RMN A;  1NUI A;  4E2X A;  1K9M 2;  4ZJZ A;  3CCM Z;  1KQS Z;  4BY1 I;  2F4O A;  1Q16 A;  1VQ6 Z;  2V8K A;  4A3I I;  2PT7 G;  3OW2 Y;  3CCR 1;  2VQE C;  5FLM I;  2KPI A;  5CM2 M;  2YWC A;  2HHH C;  1UKK A;  3CC4 Z;  1KQS Y;  4RVD A;  3S14 I;  3HOY I;  2DHM A;  3GTJ I;  3G6E Z;  5C44 I;  1M1K 1;  3DLP X;  4B3S C;  3G6E 1;  2QVZ X;  4DCT A;  2VUM I;  4A93 I;  1AMU A;  1YJ9 1;  4DV5 C;  4A3C I;  3TUF A;  1MDB A;  3CME 1;  4RV9 A;  4G36 A;  1HH2 P;  2KDN A;  4DCV A;  2MM9 A;  1WW9 A;  3CC2 Z;  4QTT A;  1VEH A;  4LFB C;  5T6B A;  2WD9 A;  2P2B A;  4A3E I;  4MD9 A;  4BC7 A;  5BSR A;  1RO0 A;  3TE5 B;  5K85 A;  1Q81 2;  1RO4 A;  1MDF A;  2MCQ A;  5H9U A;  3J80 D;  3H2T A;  5IP9 I;  1YIJ 1;  1R9T I;  3HOU I;  2OTL Z;  3RG2 A;  4X6A I;  1PU1 A;  4YY3 C;  1K9M 1;  1ZB9 A;  5IWA C;  3J81 D;  1FJG C;  2RBL A;  4RVO A;  3K7A I;  1K73 2;  1HR0 C;  4A3K I;  1W2B Z;  1N32 C;  2P2M A;  2DE5 A;  3LUS A;  3L95 X;  1VQO 1;  5DV9 A;  2VPZ A;  3CME Z;  2D1Q A;  4MD8 A;  2W04 A;  1VQL 1;  1Q82 2;  1TWA I;  4A3M I;  1K83 I;  2PMZ A;  1N36 C;  4G1I A;  3PO3 I;  4JI3 C;  1QM4 A;  5LCI A;  3CMA 1;  1MD9 A;  1YHQ 1;  1ML8 A;  1W2B Y;  4IZ6 A;  3NDJ A;  1ULT A;  2VSQ A;  1L1O C;  3G71 1;  3UOW A;  1Y1V I;  3TR3 A;  2HF1 A;  2LFU A;  1N8R 1;  1IB8 A;  3PRO C;  2OTJ Z;  3G4S 1;  2OZK A;  3SO4 A;  4MXU A;  2E7G A;  3G4S Z;  4RLQ A;  2M5H A;  4CL1 A;  3RZD I;  2LEX A;  3GTQ I;  4DR5 C;  3LAX A;  1N33 C;  3FKI I;  3CCS Z;  2ZAE B;  2D27 A;  3TDE A;  3CCE 1;  1IBK C;  2P3Y A;  3D6W A;  3KXW A;  3GPC A;  3CCU Z;  3CMA Z;  3R9W A;  4NB8 A;  3CCL Z;  3ETC A;  2UXB C;  2NVT I;  5AE1 A;  3IFU A;  3P5J B;  5A2Q f;  3CCJ 1;  3UX2 A;  4MON A;  3I55 Z;  3GTO I;  4NBA A;  2P2Q A;  2YU9 I;  1O9T A;  2UUC C;  3R9X A;  1I94 C;  2AYD A;  3VTN A;  3CJE A;  3MON A;  4K0K C;  4DR2 C;  3KIH A;  3HOZ I;  2PM9 A;  4DUZ C;  2OOY B;  1USP A;  4A3D I;  1KD1 1;  3IR7 A;  4NBB A;  3BG0 B;  1VQ4 1;  4LF8 C;  1YJ7 A;  3NH8 A;  1WCM I;  5LMU C;  3VMG A;  4X66 C;  3AF5 A;  2E8C A;  4DV2 C;  3CC2 1;  1TWF I;  4PRO C;  4E2Y A;  1TWG I;  1VQM 1;  1Z02 A;  2K3R A;  1XS3 A;  4NBE A;  4I9G A;  2E5L C;  3IEV A;  4PUG A;  4NOZ A;  2CU6 A;  3EQ6 A;  2R7Z I;  2UUB C;  3A25 A;  1PFT A;  1NY8 A;  1S72 Z;  1XRB A;  4A3G I;  4JI8 C;  4DR6 C;  1HNX C;  4LF7 C;  4RVH A;  2XR1 A;  1X0T A;  3MZL B;  2QEX Z;  3PBK A;  2VPW A;  3OW2 Z;  2F4M A;  2LIY A;  1S7M A;  3FQQ A;  1K8A 2;  4KHP C;  3IF8 A;  3HKZ A;  2Y4O A;  1X3W A;  1XRA A;  4NB9 A;  3CW9 A;  4DQY B;  3S15 I;  3K6R A;  3CD6 1;  2J6A A;  2JA7 I;  2EGT A;  2NAP A;  1KC8 1;  3I4N I; 
#chains in the Genus database with same CATH homology
 3I4M I;  2G2K A;  4TNU A;  3S16 I;  3HOW I;  3S2D I;  3VMI A;  3NYQ A;  4DV4 C;  1PG3 A;  5BUR A;  2QKD A;  1MXA A;  5C4J I;  4B3T C;  4E2Z A;  2OPL B;  4FTF A;  4MTN A;  4D56 A;  3NDI A;  1YJN 1;  1Q7Y 1;  3IX0 A;  5T64 A;  1VQO Z;  3OTO C;  1KKG A;  3PO3 S;  4NXM C;  4BCA A;  4DV0 C;  3S1N I;  2DE6 A;  3CXC Y;  1K0R A;  2AYA A;  3EED A;  4DR7 C;  2WB1 A;  4BC9 A;  3CCE Z;  1RLY A;  3M3Y I;  1N8R 2;  2ASB A;  5LL6 f;  3EER A;  4PHT A;  2V8J A;  2RIQ A;  1XMO C;  4LF9 C;  4LF4 C;  5IT9 f;  4PZP A;  2P2F A;  1ZH1 A;  1DL6 A;  5AN9 F;  3JAM f;  1J5E C;  1L2F A;  1JOS A;  1MXC A;  3J81 b;  2Y27 A;  3S2H I;  4NBD A;  4NBC A;  4JI5 C;  3CW8 X;  3NH4 A;  2JA6 I;  1FUG A;  4ODJ A;  2HU9 A;  1Q7Y 2;  2PRO A;  3GCF A;  4RS4 A;  3JAM D;  1WH9 A;  3FCE A;  5KYT A;  2D28 C;  4RVN A;  5BSM A;  3T1Y C;  4NBF A;  3FCC A;  4MH4 A;  5IFI A;  1HNW C;  2UXD C;  1O93 A;  1QVF Y;  3J80 f;  2NVX I;  4YHH C;  3CC4 1;  3T1H C;  1Y1W I;  1YJW Z;  5CZV A;  1QVG Y;  3N54 B;  2KI7 B;  4R1M A;  1TWH I;  5D1O A;  3CCR Z;  3NH5 A;  4DGL A;  3CXC Z;  2DE7 A;  1Q86 2;  2NVY I;  1YIJ Z;  4E33 A;  3E7X A;  4X62 C;  4GXR A;  3I08 A;  1RO2 A;  5FLX D;  4B3M C;  3S82 A;  3TDH B;  4K0B A;  2VUG A;  1XRC A;  2E9H A;  2R93 I;  1VQ5 1;  3GTG I;  2W03 A;  4S1T A;  3J81 f;  2JMP A;  5D1P A;  2YCB A;  4ISB A;  1YIT Z;  3S1Q I;  3H3V J;  2QW0 X;  2KZF A;  5T8S A;  4DCU A;  2JS4 A;  3CCQ 1;  4EWC A;  4R1L A;  1VQ5 Z;  4HGY A;  5T8T A;  2GU2 A;  3BG1 B;  4RVG A;  2E2I I;  4G37 A;  4JI7 C;  3IEU A;  2OTL 1;  4X64 C;  2QLV B;  5AE3 A;  1QYP A;  3L8C A;  4A3J I;  4JYA C;  2O4H A;  1VQN Z;  1QVG Z;  2I3C A;  4ZLP A;  1K8A 1;  3NFZ A;  3Q87 A;  4NFR A;  3T4N B;  2E8F A;  4DCS A;  2CXC A;  2WP0 C;  2ONF A;  3CC7 1;  5A1G A;  5A1I A;  1VQ8 1;  4DV1 C;  4IR7 A;  5BR8 C;  5JRH A;  1I6H I;  1QWI A;  1LCI A;  4GXQ A;  1I50 I;  2DPL A;  4QTU A;  3D9X A;  1VQ8 Z;  3N2Q A;  1VQ7 1;  3UZ0 A;  1Z01 A;  2YAD A;  3RZO I;  3GKU A;  3JAM b;  1NYE A;  3I56 Z;  3GTK I;  4LE5 A;  5IT9 b;  2D1S A;  4DG8 A;  2ATW A;  1VQM Z;  1V26 A;  2PN2 A;  3GKQ A;  3CCV Z;  4WS9 A;  3H0G I;  4JI6 C;  1USP B;  4E2W A;  3LNV A;  2E2H I;  4OYC A;  1P9N A;  4GKJ C;  1YI2 Z;  4KTT A;  2QA4 1;  1LQL A;  1VQ9 Z;  4NBG A;  4WV3 A;  4D4G A;  4X65 C;  4RLF A;  2VQF C;  3G71 Z;  1Q86 1;  2M6N A;  1VQK 1;  1RY2 A;  2V7B A;  4DG9 A;  3FQM A;  3F3F C;  3J80 b;  3I55 1;  1KC8 2;  2P02 A;  3CCJ Z;  1TWC I;  3DHV A;  1T5D X;  3IPL A;  3VB9 A;  1Z03 A;  2VZE A;  1YIT 1;  5CZX A;  4DUY C;  1NJI 2;  2V8I A;  4RVF A;  5BUQ A;  2QL8 A;  2GTI A;  2JUB A;  1JJ2 Z;  5C4X I;  2QRC B;  4KTV A;  2D7V A;  1KD1 2;  3NPD A;  1GPM A;  2OO4 A;  5C3E I;  3F3P C;  3KIF A;  2QA4 Z;  1VQ9 1;  4B3R C;  5A2Q b;  4L2Z A;  4AYB A;  4E31 A;  4HGZ A;  3ESW A;  3CD6 Z;  4LF6 C;  4EAT A;  1X3Z A;  3GTP I;  3CCV 1;  2F4V C;  4MD7 A;  1QVF Z;  3GTL I;  4LFA C;  1ZB8 A;  4BXX I;  2D1T A;  5BUS A;  1YJW 1;  3E7W A;  4NDN A;  3I56 1;  2CY1 A;  2QEX 1;  3R44 A;  4R0M A;  2E8E A;  4BY7 I;  4DK1 A;  1P7L A;  4XX2 A;  3A4I A;  5GTD A;  2O53 A;  5T67 A;  1VQL Z;  3PO2 I;  3ETO A;  4BBY A;  2Q51 A;  4E30 A;  1WF3 A;  1Y1V S;  3B7W A;  3IML A;  1I3Q I;  3CC7 Z;  3GTM I;  4JI2 C;  2VF1 A;  2Y4N A;  3QWU A;  3HOV I;  1V25 A;  1RG9 A;  4HPV A;  5KEI A;  5E7Q A;  5D1O B;  4Y52 I;  3U50 C;  1NP6 A;  1VQN 1;  4FUQ A;  3S1R I;  4DR3 C;  1PA4 A;  2AKL A;  1SFO I;  3VNS A;  3AF6 A;  2D1R A;  4A3B I;  1VLA A;  4JI0 C;  3C5E A;  1TFI A;  4U5Y D;  2HJG A;  4TPS B;  2IZ3 A;  2QRE B;  4BBR I;  1Q82 1;  3CCQ Z;  4OXI A;  5KYV A;  3M4O I;  5IT9 D;  1XNQ C;  1JJ2 Y;  2JA5 I;  4JI1 C;  4D57 A;  2P2J A;  4DV6 C;  2H85 A;  4MRI A;  1N2F A;  4LFC C;  3CCU 1;  4NBH A;  3I07 A;  2QVX X;  4NXN C;  2Y0S A;  3A9U A;  1WII A;  2K5R A;  3RV2 A;  4I9F A;  1VQ4 Z;  4Y7N I;  5BSW A;  4DV3 C;  4LF5 C;  3NI2 A;  3A9V A;  2OBV A;  2YWB A;  3VMH A;  2E0G A;  2OTJ 1;  2Q4Z A;  3CPW Z;  1VQ6 1;  2RT9 A;  2WAQ A;  3CCM 1;  4L4Q A;  4JV5 C;  1VQP Z;  2IZ4 A;  1Q81 1;  3NYR A;  1XNR C;  1NJI 1;  1O90 A;  2UXC C;  4FUT A;  1VQ7 Z;  4OX9 C;  3HOX I;  2P20 A;  5LMN C;  2OPL A;  5FLX f;  4JM1 A;  1IBL C;  2E2J I;  4RM2 A;  4JI4 C;  3CCL 1;  2JA8 I;  3J7A 4;  4GKK C;  5K8F A;  1XMQ C;  5IP7 I;  1MXB A;  5BSU A;  3VNR A;  1QF8 A;  1S72 1;  5BST A;  2M48 A;  1YUK A;  2QVY X;  1K73 1;  2P28 A;  4A3F I;  4L7I A;  1M1K 2;  2BJO A;  3VNQ A;  4BBS I;  1VQP 1;  5A2Q D;  2JNY A;  5FLX b;  4D4I A;  1M90 2;  1EGA A;  2RPR A;  3GR0 A;  1YI2 1;  3MZK B;  2UUA C;  3PES A;  3CQZ I;  1YUA A;  4NH1 C;  4DR1 C;  3GR1 A;  2ZM6 C;  3DAY A;  1HNZ C;  1BA3 A;  1T5H X;  2R6M A;  2GTH A;  4RM3 A;  1YHQ Z;  4A3L I;  3S1M I;  1RNI A;  5ADZ A;  2DYJ A;  1YJ9 Z;  5AE2 A;  4DV7 C;  2R92 I;  2JMO A;  1N34 C;  2BH1 X;  2NVQ I;  1IBM C;  4DR4 C;  4BSZ A;  2QRD B;  4HH4 A;  1YJN Z;  2PK7 A;  1JWH C;  2RHB A;  2B63 I;  1O92 A;  2UU9 C;  4E32 A;  3CPW Y;  2JR6 A;  5BSV A;  1RQF A;  2QR1 B;  1VQK Z;  1MKY A;  4AQY C;  1PG4 A;  1M90 1;  3CCS 1;  3G7S A;  3GTM S;  3LGX A;  5A19 A;  3TQI A;  4GS5 A;  3S17 I;  2OOX B;  1KRL A;  4RMN A;  1NUI A;  4E2X A;  1K9M 2;  4ZJZ A;  3CCM Z;  1KQS Z;  4BY1 I;  2F4O A;  1VQ6 Z;  2PT7 G;  2V8K A;  4A3I I;  3OW2 Y;  3CCR 1;  2VQE C;  5FLM I;  2KPI A;  5CM2 M;  2YWC A;  2HHH C;  1UKK A;  3CC4 Z;  1KQS Y;  4RVD A;  3S14 I;  3HOY I;  3GTJ I;  3G6E Z;  5C44 I;  1M1K 1;  3DLP X;  4B3S C;  3G6E 1;  2QVZ X;  4DCT A;  2VUM I;  4A93 I;  1AMU A;  1YJ9 1;  4DV5 C;  4A3C I;  3TUF A;  1MDB A;  3CME 1;  4RV9 A;  4G36 A;  1HH2 P;  4DCV A;  1WW9 A;  3CC2 Z;  4QTT A;  4LFB C;  5T6B A;  2WD9 A;  2P2B A;  4A3E I;  4MD9 A;  4BC7 A;  5BSR A;  1RO0 A;  3TE5 B;  5K85 A;  1Q81 2;  1RO4 A;  1MDF A;  5H9U A;  3J80 D;  3H2T A;  5IP9 I;  1YIJ 1;  1R9T I;  3HOU I;  2OTL Z;  3RG2 A;  4X6A I;  4YY3 C;  1K9M 1;  1ZB9 A;  5IWA C;  3J81 D;  1FJG C;  2RBL A;  4RVO A;  3K7A I;  1K73 2;  1HR0 C;  4A3K I;  1W2B Z;  1N32 C;  2P2M A;  2DE5 A;  3LUS A;  3L95 X;  1VQO 1;  5DV9 A;  3CME Z;  2D1Q A;  4MD8 A;  2W04 A;  1VQL 1;  1Q82 2;  1TWA I;  4A3M I;  1K83 I;  2PMZ A;  1N36 C;  4G1I A;  3PO3 I;  4JI3 C;  1QM4 A;  3CMA 1;  1MD9 A;  1YHQ 1;  1ML8 A;  1W2B Y;  4IZ6 A;  3NDJ A;  1ULT A;  2VSQ A;  1L1O C;  3G71 1;  3UOW A;  1Y1V I;  2HF1 A;  2LFU A;  1N8R 1;  3PRO C;  2OTJ Z;  3G4S 1;  2OZK A;  3SO4 A;  4MXU A;  2E7G A;  3G4S Z;  4RLQ A;  4CL1 A;  3RZD I;  3GTQ I;  4DR5 C;  3LAX A;  1N33 C;  3FKI I;  3CCS Z;  2ZAE B;  2D27 A;  3TDE A;  3CCE 1;  1IBK C;  2P3Y A;  3D6W A;  3KXW A;  3GPC A;  3CCU Z;  3CMA Z;  3R9W A;  4NB8 A;  3CCL Z;  3ETC A;  2UXB C;  2NVT I;  5AE1 A;  3IFU A;  3P5J B;  5A2Q f;  3CCJ 1;  4MON A;  3I55 Z;  3GTO I;  4NBA A;  2P2Q A;  2YU9 I;  1O9T A;  2UUC C;  3R9X A;  1I94 C;  3VTN A;  3CJE A;  3MON A;  4K0K C;  4DR2 C;  3KIH A;  3HOZ I;  2PM9 A;  4DUZ C;  2OOY B;  1USP A;  4A3D I;  1KD1 1;  4NBB A;  3BG0 B;  1VQ4 1;  4LF8 C;  1YJ7 A;  3NH8 A;  1WCM I;  5LMU C;  3VMG A;  4X66 C;  3AF5 A;  2E8C A;  4DV2 C;  3CC2 1;  1TWF I;  4PRO C;  4E2Y A;  1TWG I;  1VQM 1;  1Z02 A;  2K3R A;  2E5L C;  4NBE A;  4I9G A;  3IEV A;  4NOZ A;  3EQ6 A;  2R7Z I;  2UUB C;  1PFT A;  1XRB A;  1S72 Z;  4A3G I;  4JI8 C;  4DR6 C;  1HNX C;  4LF7 C;  4RVH A;  2XR1 A;  1X0T A;  3MZL B;  2QEX Z;  3PBK A;  3OW2 Z;  2F4M A;  2LIY A;  1S7M A;  3FQQ A;  1K8A 2;  4KHP C;  3IF8 A;  3HKZ A;  2Y4O A;  1X3W A;  1XRA A;  4NB9 A;  3CW9 A;  4DQY B;  3S15 I;  3CD6 1;  2J6A A;  2JA7 I;  2EGT A;  1KC8 1;  3I4N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...