1USPB

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
134
Chain Sequence
ANVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRNKIDVPADSTITARVGLQKFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
total genus 31
structure length 134
sequence length 138
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspB01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspB02
1UKKA 2UUAC 1XNRC 2DE5A 4DV5C 4DR6C 3H3VJ 4LF7C 2ZM6C 1N34C 2E8EA 4B3TC 4GKJC 5BR8C 4DR1C 1N32C 3AF5A 5C44I 4LF6C 2R7ZI 4DV1C 3IEVA 3R9XA 4A93I 4NBAA 1ML8A 2JA5I 1L2FA 4DV7C 2E5LC 4QTTA 5IP7I 1SFOI 3GTKI 3CQZI 1MKYA 2E7GA 4B3MC 1KKGA 4NXMC 4BY1I 3S1RI 2BJOA 2OPLB 4X66C 1QYPA 4JI3C 1HNWC 4DR7C 1PFTA 3HOUI 4LFAC 3GCFA 4JI4C 1Y1VI 3EERA 3I07A 4NBDA 4A3MI 2JS4A 2F4MA 3RZOI 2JNYA 1WF3A 4YY3C 5FLXD 4YHHC 3IEUA 4MTNA 2QL8A 5IP9I 5A2QD 1WH9A 2KPIA 2VQEC 2UXDC 1L1OC 4X65C 1ZB9A 4DV0C 1Y1VS 3GTGI 4A3EI 2B63I 2K5RA 3J80D 3U50C 1I50I 4DR4C 2R92I 4XX2A 4A3LI 1X3WA 4KHPC 4LF9C 1WCMI 5C4XI 1J5EC 5LMUC 2PN2A 1RLYA 3GKQA 4BSZA 4DV4C 2VUMI 3S17I 4JI8C 2UXCC 5FLMI 4B3SC 2PK7A 4LFBC 1NUIA 3PO3I 4BY7I 1LQLA 1USPA 3HOXI 3VMGA 1WW9A 1TWHI 2NVXI 3S2DI 3GTMI 1TWCI 4DUYC 3GTQI 4DV2C 1XNQC 2DE7A 2NVQI 2UU9C 3M3YI 5C3EI 1XMOC 2R93I 4Y7NI 4JV5C 3PO3S 4MH4A 2ONFA 4NBCA 1FJGC 4A3II 3ESWA 3GTMS 2JR6A 4DR2C 4DCVA 1HNXC 4LF4C 2JA8I 3S1MI 5IT9D 3T1YC 2HHHC 3HOZI 2E2II 3LUSA 3S15I 2P3YA 4JI0C 4Y52I 3K7AI 3HOWI 4LF8C 3I4MI 4DR3C 4X6AI 4BBSI 2UUCC 4OX9C 1Y1WI 2VQFC 2YU9I 1K0RA 3GTJI 4NBEA 4B3RC 3AF6A 4A3KI 4NBBA 2AKLA 2NVYI 4DCSA 4JI6C 4NBGA 4GKKC 3GTPI 1TWAI 4DV3C 4NOZA 3HOYI 3GKUA 1I94C 1HNZC 2E8CA 2F4OA 3FKII 3Q87A 3VMIA 2EGTA 3D6WA 3J81D 1TWGI 2OPLA 1YUAA 1TWFI 1RO4A 1I3QI 4NBHA 3S2HI 3S1NI 1DL6A 4BBRI 4DV6C 2E2HI 2ATWA 3M4OI 3S14I 1HR0C 4DUZC 5IWAC 3PO2I 1K83I 3VB9A 1R9TI 2XR1A 1VLAA 4JI2C 2UXBC 3OTOC 2JA6I 1QWIA 4NXNC 2JMPA 3H0GI 3I4NI 2CY1A 2HF1A 4X64C 4BXXI 2ASBA 4A3DI 2JA7I 4DR5C 1HH2P 2J6AA 4DCUA 3T1HC 3HOVI 1PA4A 5LMNC 1USPB 4JI7C 1ZB8A 2KZFA 4NB8A 4QTUA 2D7VA 4A3GI 2E2JI 1N36C 3S16I 2RBLA 2YCBA 3JAMD 4A3CI 1N33C 4JYAC 2DYJA 1N2FA 3CJEA 4DCTA 4LF5C 1X3ZA 3R9WA 1IBKC 2CXCA 4K0KC 4JI1C 2UUBC 4A3BI 3S1QI 1IBMC 4A3JI 4NB9A 2HJGA 5C4JI 4JI5C 1TFIA 4A3FI 3RZDI 2F4VC 1IBLC 1NYEA 1EGAA 2E8FA 1XMQC 4LFCC 5CM2M 3GTOI 1JOSA 3GTLI 4AQYC 2DE6A 4X62C 4NBFA 2NVTI 1I6HI 2PT7G 3VMHA
chains in the Genus database with same CATH superfamily
1IB8A 1UKKA 2Y4NA 2VPYA 2UUAC 2OO4A 4L7IA 5BSTA 4E2ZA 4E33A 1S72Z 1XNRC 2DE5A 5BSUA 1YJ91 4LE5A 3G711 3G4S1 3CPWY 1QVGZ 4JM1A 4DV5C 4DR6C 2E0GA 3H3VJ 4LF7C 2W03A 4GXRA 4R1MA 3T4NB 3RG2A 1VEHA 2ZM6C 1VQK1 1N34C 2E8EA 4I9GA 4B3TC 4GKJC 2H85A 5T67A 1MXBA 5BR8C 4DR1C 1N32C 3TDHB 3AF5A 5C44I 4LF6C 5GTDA 4DK1A 2R7ZI 4DV1C 5T6BA 2V3VA 3IEVA 3R9XA 1YJW1 1VQ4Z 2WAQA 1VQN1 4A93I 4MD8A 4KTVA 1SIWA 4NBAA 1ML8A 2V8KA 2D1QA 2JA5I 1L2FA 4DV7C 3D2LA 1M901 4QTTA 2E5LC 2P2MA 5IP7I 1SFOI 3CCQ1 3GTKI 4DGLA 3IPLA 3CQZI 1MKYA 2E7GA 1YIJZ 4B3MC 1VQKZ 1T5DX 4D56A 3BG1B 1KC82 1WJ2A 1KKGA 1YI2Z 1MXCA 4NXMC 4BY1I 1KD11 4MRIA 3S1RI 2BJOA 2OPLB 1Z02A 4X66C 1QYPA 4JI3C 2V7BA 4RV9A 3CCE1 1Q861 2NCLA 4OXIA 4DR7C 1HNWC 1Q812 2OOYB 1PFTA 2NAPA 3HOUI 1V26A 2M6NA 3KIHA 3DLPX 1VQNZ 2E7ZA 4RVOA 4LFAC 3GCFA 4JI4C 1Y1VI 1K9M1 2P02A 3C5EA 3EERA 4I9FA 3I07A 4NBDA 1P9NA 4A3MI 2M5OA 2JS4A 1NJI1 2F4MA 4MXUA 4S1TA 1YJ7A 2HU9A 3RZOI 5IT9b 1Z03A 2JNYA 1RG9A 1WF3A 1KQSZ 3KIFA 4YY3C 1UWDA 5FLXD 2DHMA 5KYTA 3J80f 1V60A 5DV9A 4PROC 2Z51A 2Y0SA 1JJ2Z 4YHHC 4AYBA 3IEUA 4MTNA 1AMUA 2QL8A 3I56Z 5JRHA 3CC71 3CD61 1QXFA 5IP9I 2AYAA 1Z01A 5BUQA 5A2QD 1QVGY 1WH9A 2KPIA 1V25A 2VQEC 2UXDC 5FLXb 2VUGA 1S721 1L1OC 4X65C 3GPCA 1ZB9A 3CQ2A 4PUGA 4DV0C 3KXWA 2PROA 1Y1VS 3GTGI 4A3EI 3R44A 4BC9A 5AE1A 2B63I 2K5RA 3J80D 3N54B 2VPZA 4BBYA 3U50C 2QVZX 1NY8A 1I50I 4DR4C 5A2Qb 2R92I 1PG3A 4XX2A 4A3LI 2YWCA 3CC41 1X3WA 2MM9A 4NH1C 3NDJA 1Q822 2JIMA 4KHPC 4LF9C 3UEBA 3CCM1 2G2KA 1WCMI 5C4XI 2OTJZ 5LMUC 1VQL1 1J5EC 5D1PA 3FQMA 2PN2A 1RLYA 3LAXA 4D4GA 3CC7Z 3GKQA 4BSZA 3NH5A 4DV4C 2GTHA 3CD6Z 2KZ0A 1VQ41 2VUMI 4PHTA 3S17I 4JI8C 2UXCC 5FLMI 2D1SA 1AA6A 2PK7A 4R0MA 3G6EZ 4B3SC 4LFBC 3AY0A 1NUIA 4RVNA 1P7LA 3S82A 4L4QA 3N2QA 3PO3I 3IR7A 4ISBA 4RLFA 3UX2A 3VNQA 2WD9A 3SO4A 4BY7I 1LQLA 1JWHC 1USPA 1YJNZ 4NDNA 3HOXI 1YIJ1 2QLVB 2ZZNA 4L2ZA 3VMGA 1WW9A 1TWHI 2AYDA 2NVXI 2QKDA 3S2DI 4PUIA 4D57A 3EQ6A 3GTMI 1TWCI 3CC4Z 4DUYC 1YI21 3GTQI 3CW9A 3UZ0A 4DV2C 2DE7A 1T5HX 3NH4A 3L95X 1FLOA 1XNQC 2V45A 2NVQI 3CCMZ 3CMEZ 2VPWA 3A26A 2QVYX 1VQLZ 1NP6A 2UU9C 3M3YI 1M1K1 3J81b 5C3EI 3PBKA 4RMNA 1XMOC 3CCU1 1N8R2 2R93I 4D4IA 3A25A 2GU2A 1Q7Y2 3PESA 4Y7NI 4PZPA 5T64A 4E31A 5ADZA 4JV5C 1KQSY 3PO3S 4MH4A 3A9VA 1VQ9Z 2ONFA 5A1IA 4NBCA 3CCS1 2LEXA 1JJ2Y 3E7WA 1FJGC 4A3II 1FUGA 2BH1X 3LGXA 3IFUA 3ESWA 5CZVA 1RO0A 3GTMS 4RVHA 2JR6A 4DR2C 2R6MA 4DCVA 3I561 1FDIA 1Y8CA 3F3FC 1BA3A 1VQ61 1S7MA 3P5JB 1HNXC 4LF4C 2JA8I 3CCRZ 1WCJA 5FLXf 3S1MI 5IT9D 1Q16A 2D1TA 1W2BY 3B7WA 1VQ51 1VQPZ 1M6XA 1O9TA 3CCUZ 5D1OA 5IFIA 3T1YC 5BSRA 2HHHC 3HOZI 2E2II 2E9HA 2RPRA 5BURA 3OW2Z 5A2Qf 3LUSA 3I551 3S15I 2P3YA 4JI0C 4Y52I 3K7AI 3CCSZ 1YHQZ 3HOWI 3GR1A 4LF8C 1VQ71 3IX0A 2QVXX 3I4MI 1M902 4DR3C 4X6AI 2YX1A 4BBSI 3CW8X 3A4IA 2UUCC 4TNUA 3CXCY 2OTJ1 4OX9C 1RY2A 2OOXB 2W04A 1Y1WI 1K8A2 3UX3A 4BCAA 2VQFC 2QREB 1RO2A 4CL1A 2YU9I 1VQ6Z 2VPXA 3A9UA 1K0RA 1QVFZ 2VSQA 3QWUA 2LIYA 3GTJI 3G6E1 4NBEA 5H9UA 1VQ5Z 1KD12 2M5HA 4B3RC 3F3PC 3JAMb 4ZLPA 4FUQA 3UOWA 3AF6A 3NPDA 4A3KI 1FDOA 2IZ3A 4NBBA 2AKLA 1Q862 3FQQA 1W2BZ 4E2YA 2NVYI 4RVDA 4DCSA 1YJN1 3NH8A 1MXAA 4JI6C 5KYVA 3HKZA 3I55Z 1XRBA 4ODJA 3MZLB 2KI7B 3TE5B 4E32A 1XHJA 4NBGA 4GKKC 1KRLA 1K9M2 2Q4ZA 3O2EA 3VNRA 1VQ7Z 4WS9A 1QM4A 4G36A 1NJI2 1YITZ 2V8JA 3GTPI 3CME1 5BUSA 3VTNA 3TR3A 5LL6f 1TWAI 4DV3C 4NOZA 3J81f 3HOYI 3GKUA 2YWBA 3IF8A 2DPLA 4NFRA 2JIRA 3CXCZ 2YADA 2IZ4A 1P4EC 1I94C 3CCL1 4FUTA 5E7QA 1HNZC 5K8FA 2M48A 1VQOZ 2E8CA 1TH5A 2F4OA 2Y4OA 3FKII 2OTLZ 1P4EA 1VQ91 4GS5A 5A19A 3Q87A 4R1LA 3LNOA 3VMIA 2EGTA 3EEDA 2D27A 4ZJZA 2RIQA 3MZKB 2QEXZ 3D6WA 3J81D 3H2TA 3CCJ1 4K0BA 4HGZA 1TWGI 2OPLA 2RHBA 4RS4A 4OYCA 2K3RA 1YUAA 1RNIA 1TWFI 2QRDB 2CU6A 2P2FA 4GXQA 2V8IA 3CC2Z 1RO4A 1K732 1I3QI 4NBHA 1GPMA 1ZH1A 3S2HI 3S1NI 2LFUA 4RLQA 3CCR1 3TQIA 4DG9A 1KC81 4BBRI 1DL6A 4DQYB 2E2HI 3DHVA 5T8SA 4DV6C 2ATWA 3M4OI 3S14I 1VQP1 3OW2Y 3NFZA 3CMAZ 1HR0C 4DUZC 4TPSB 3NYQA 4MD9A 5IWAC 3K6RA 3GR0A 3CCLZ 2MMAB 3PO2I 1K83I 1X0TA 4DG8A 4PUHA 5BSWA 1Q811 3VB9A 5IT9f 1R9TI 2XR1A 4IR7A 2QW0X 1VLAA 1YHQ1 4JI2C 2UXBC 1VQ8Z 2Y27A 3OTOC 3CCV1 1VQMZ 2O4HA 2JNVA 4HH4A 3FCEA 1MDFA 2JA6I 1QWIA 3CCJZ 4NXNC 2JMPA 3NDIA 3H0GI 3I4NI 2JIOA 4RVGA 1QVFY 4E30A 2CY1A 4RVFA 4KTTA 4BC7A 2HF1A 4G1IA 5AE2A 2VF1A 4BXXI 4X64C 2PMZA 3MONA 2PM9A 5AN9F 2MCQA 2QA41 3VNSA 2P20A 2ASBA 4HGYA 1YJ9Z 1M6XC 3G71Z 3G4SZ 4A3DI 2JA7I 3JAMf 3I08A 4RM2A 4DR5C 1MDBA 1HH2P 2J6AA 3DAYA 3LNVA 4DCUA 3T1HC 1K8A1 1XRAA 2VZEA 3D9XA 3CPWZ 3HOVI 1PA4A 2ZZMA 5AE3A 5LMNC 1USPB 2JIQA 2KDNA 1M1K2 2P2BA 5LCIA 4JI7C 4MD7A 1ZB8A 1LCIA 2KZFA 4NB8A 4QTUA 3BG0B 3CCVZ 4A3GI 2E2JI 2D7VA 1N36C 3S16I 3ETCA 2QR1B 2OZKA 2I3CA 2RBLA 3PROC 1YIT1 2D1RA 2YCBA 3JAMD 1QF8A 2WP0C 4G37A 3TUFA 1YJWZ 4E2WA 1RQFA 4A3CI 2JUBA 1N33C 1Q821 2QA4Z 1XS3A 4JYAC 1VQO1 3CQ3A 2JMOA 5BSMA 3NYRA 4HPVA 3CCQZ 1WIIA 4E2XA 2OTL1 2P28A 3J7A4 5T8TA 2DYJA 3G7SA 3ETOA 1PU1A 1N2FA 1WZNA 1O90A 3RV2A 2Q51A 1O92A 5A1GA 3CJEA 2QEX1 5K85A 4DCTA 4LF5C 2P2QA 1YUKA 1X3ZA 4U5YD 5BSVA 2RT9A 5KEIA 2GTIA 1IBKC 3R9WA 2CXCA 4FTFA 1ULTA 1O93A 4K0KC 2JIPA 2ZAEB 3CC21 3CCEZ 4JI1C 2UUBC 4EWCA 5CZXA 4A3BI 3S1QI 1IBMC 4A3JI 2D28C 4NB9A 3CQ1A 2HJGA 5C4JI 4JI5C 1TFIA 4A3FI 3RZDI 3FCCA 3NI2A 2F4VC 1XRCA 3L8CA 4EATA 3E7XA 1IBLC 1NYEA 3CMA1 2P2JA 5D1OB 1EGAA 2E8FA 1XMQC 1K731 4WV3A 2WB1A 3TDEA 4LFCC 5CM2M 3GTOI 1JOSA 3GTLI 2O53A 1VQ81 4AQYC 2DE6A 1N8R1 4X62C 4NBFA 1VQM1 3J80b 2NVTI 3IMLA 1I6HI 1PG4A 2QRCB 2OBVA 1Q7Y1 2IV2X 2PT7G 3VMHA 4MONA 4IZ6A 1MD9A 4RM3A
chains in the Genus database with same CATH topology
1UKKA 2Y4NA 2UUAC 2OO4A 4L7IA 5BSTA 4E2ZA 4E33A 1S72Z 1XNRC 2DE5A 5BSUA 1YJ91 4LE5A 3G711 3G4S1 3CPWY 1QVGZ 4JM1A 4DV5C 4DR6C 2E0GA 3H3VJ 4LF7C 2W03A 4GXRA 4R1MA 3T4NB 3RG2A 2ZM6C 1VQK1 1N34C 2E8EA 4I9GA 4B3TC 4GKJC 2H85A 5T67A 1MXBA 5BR8C 4DR1C 1N32C 3TDHB 3AF5A 5C44I 4LF6C 5GTDA 4DK1A 2R7ZI 4DV1C 5T6BA 3IEVA 3R9XA 1YJW1 1VQ4Z 2WAQA 1VQN1 4A93I 4MD8A 4KTVA 4NBAA 1ML8A 2V8KA 2D1QA 2JA5I 1L2FA 4DV7C 1M901 4QTTA 2E5LC 2P2MA 5IP7I 1SFOI 3CCQ1 3GTKI 4DGLA 3IPLA 3CQZI 1MKYA 2E7GA 1YIJZ 4B3MC 1VQKZ 1T5DX 4D56A 3BG1B 1KC82 1KKGA 1YI2Z 1MXCA 4NXMC 4BY1I 1KD11 4MRIA 3S1RI 2BJOA 2OPLB 1Z02A 4X66C 1QYPA 4JI3C 2V7BA 4RV9A 3CCE1 1Q861 4OXIA 4DR7C 1HNWC 1Q812 2OOYB 1PFTA 3HOUI 1V26A 2M6NA 3KIHA 3DLPX 1VQNZ 4RVOA 4LFAC 3GCFA 4JI4C 1Y1VI 1K9M1 2P02A 3C5EA 3EERA 4I9FA 3I07A 4NBDA 1P9NA 4A3MI 2JS4A 1NJI1 2F4MA 4MXUA 4S1TA 1YJ7A 2HU9A 3RZOI 5IT9b 1Z03A 2JNYA 1RG9A 1WF3A 1KQSZ 3KIFA 4YY3C 5FLXD 5KYTA 3J80f 5DV9A 4PROC 2Y0SA 1JJ2Z 4YHHC 4AYBA 3IEUA 4MTNA 1AMUA 2QL8A 3I56Z 5JRHA 3CC71 3CD61 5IP9I 2AYAA 1Z01A 5BUQA 5A2QD 1QVGY 1WH9A 2KPIA 1V25A 2VQEC 2UXDC 5FLXb 2VUGA 1S721 1L1OC 4X65C 3GPCA 1ZB9A 4DV0C 3KXWA 2PROA 1Y1VS 3GTGI 4A3EI 3R44A 4BC9A 5AE1A 2B63I 2K5RA 3J80D 3N54B 4BBYA 3U50C 2QVZX 1I50I 4DR4C 5A2Qb 2R92I 1PG3A 4XX2A 4A3LI 2YWCA 3CC41 1X3WA 4NH1C 3NDJA 1Q822 4KHPC 4LF9C 3CCM1 2G2KA 1WCMI 5C4XI 2OTJZ 5LMUC 1VQL1 1J5EC 5D1PA 3FQMA 2PN2A 1RLYA 3LAXA 4D4GA 3CC7Z 3GKQA 4BSZA 3NH5A 4DV4C 2GTHA 3CD6Z 1VQ41 2VUMI 4PHTA 3S17I 4JI8C 2UXCC 5FLMI 2D1SA 4B3SC 2PK7A 4R0MA 3G6EZ 4LFBC 1NUIA 4RVNA 1P7LA 3S82A 4L4QA 3N2QA 3PO3I 4ISBA 4RLFA 3VNQA 2WD9A 3SO4A 4BY7I 1LQLA 1JWHC 1USPA 1YJNZ 4NDNA 3HOXI 1YIJ1 2QLVB 4L2ZA 3VMGA 1WW9A 1TWHI 2NVXI 3S2DI 2QKDA 4D57A 3EQ6A 3GTMI 1TWCI 3CC4Z 4DUYC 1YI21 3GTQI 3CW9A 3UZ0A 4DV2C 2DE7A 1T5HX 3NH4A 3L95X 1XNQC 2NVQI 3CCMZ 3CMEZ 2QVYX 1VQLZ 1NP6A 2UU9C 3M3YI 1M1K1 3J81b 5C3EI 3PBKA 4RMNA 1XMOC 3CCU1 1N8R2 2R93I 4D4IA 2GU2A 1Q7Y2 3PESA 4Y7NI 4PZPA 5T64A 4E31A 5ADZA 4JV5C 1KQSY 3PO3S 4MH4A 3A9VA 1VQ9Z 2ONFA 5A1IA 4NBCA 3CCS1 1JJ2Y 3E7WA 1FJGC 4A3II 1FUGA 2BH1X 3LGXA 3IFUA 3ESWA 5CZVA 1RO0A 3GTMS 4RVHA 2JR6A 4DR2C 2R6MA 4DCVA 3I561 3F3FC 1BA3A 1VQ61 1S7MA 3P5JB 1HNXC 4LF4C 2JA8I 3CCRZ 5FLXf 3S1MI 5IT9D 2D1TA 1W2BY 3B7WA 1VQ51 1VQPZ 1O9TA 3CCUZ 5D1OA 5IFIA 3T1YC 5BSRA 2HHHC 3HOZI 2E2II 2E9HA 2RPRA 5BURA 3OW2Z 5A2Qf 3LUSA 3I551 3S15I 2P3YA 4JI0C 4Y52I 3K7AI 3CCSZ 1YHQZ 3HOWI 3GR1A 4LF8C 1VQ71 3IX0A 2QVXX 3I4MI 1M902 4DR3C 4X6AI 4BBSI 3CW8X 3A4IA 2UUCC 4TNUA 3CXCY 2OTJ1 4OX9C 1RY2A 2OOXB 2W04A 1Y1WI 1K8A2 4BCAA 2VQFC 2QREB 1RO2A 4CL1A 2YU9I 1VQ6Z 3A9UA 1K0RA 1QVFZ 2VSQA 3QWUA 2LIYA 3GTJI 3G6E1 4NBEA 5H9UA 1VQ5Z 1KD12 4B3RC 3F3PC 3JAMb 4ZLPA 4FUQA 3UOWA 3AF6A 3NPDA 4A3KI 2IZ3A 4NBBA 2AKLA 1Q862 3FQQA 1W2BZ 4E2YA 2NVYI 4RVDA 4DCSA 1YJN1 3NH8A 1MXAA 4JI6C 5KYVA 3HKZA 3I55Z 1XRBA 4ODJA 3MZLB 2KI7B 3TE5B 4E32A 4NBGA 4GKKC 1KRLA 1K9M2 2Q4ZA 3VNRA 1VQ7Z 4WS9A 1QM4A 4G36A 1NJI2 1YITZ 2V8JA 3GTPI 3CME1 5BUSA 3VTNA 5LL6f 1TWAI 4DV3C 4NOZA 3J81f 3HOYI 3GKUA 2YWBA 3IF8A 2DPLA 4NFRA 3CXCZ 2YADA 2IZ4A 1I94C 3CCL1 4FUTA 5E7QA 1HNZC 5K8FA 2M48A 1VQOZ 2E8CA 2Y4OA 2F4OA 3FKII 2OTLZ 1VQ91 4GS5A 5A19A 3Q87A 4R1LA 3VMIA 2EGTA 3EEDA 2D27A 4ZJZA 2RIQA 3MZKB 2QEXZ 3D6WA 3J81D 3H2TA 3CCJ1 4K0BA 4HGZA 1TWGI 2OPLA 2RHBA 4RS4A 4OYCA 2K3RA 1YUAA 1RNIA 1TWFI 2QRDB 2P2FA 4GXQA 2V8IA 3CC2Z 1RO4A 1K732 1I3QI 4NBHA 1GPMA 1ZH1A 3S2HI 3S1NI 2LFUA 4RLQA 3CCR1 3TQIA 4DG9A 1KC81 4BBRI 1DL6A 4DQYB 2E2HI 3DHVA 5T8SA 4DV6C 2ATWA 3M4OI 3S14I 1VQP1 3OW2Y 3NFZA 3CMAZ 1HR0C 4DUZC 4TPSB 3NYQA 4MD9A 5IWAC 3GR0A 3CCLZ 3PO2I 1K83I 1X0TA 4DG8A 5BSWA 1Q811 3VB9A 5IT9f 1R9TI 2XR1A 4IR7A 2QW0X 1VLAA 1YHQ1 4JI2C 2UXBC 1VQ8Z 2Y27A 3OTOC 3CCV1 1VQMZ 2O4HA 4HH4A 3FCEA 1MDFA 2JA6I 1QWIA 3CCJZ 4NXNC 2JMPA 3NDIA 3H0GI 3I4NI 4RVGA 1QVFY 2CY1A 4E30A 4KTTA 4RVFA 4BC7A 2HF1A 4G1IA 5AE2A 2VF1A 4BXXI 4X64C 2PMZA 3MONA 2PM9A 5AN9F 2QA41 3VNSA 2P20A 2ASBA 4HGYA 1YJ9Z 3G71Z 3G4SZ 4A3DI 2JA7I 3JAMf 3I08A 4RM2A 4DR5C 1MDBA 1HH2P 2J6AA 3DAYA 3LNVA 4DCUA 3T1HC 1K8A1 1XRAA 2VZEA 3D9XA 3CPWZ 3HOVI 1PA4A 5AE3A 5LMNC 1USPB 1M1K2 2P2BA 4JI7C 4MD7A 1ZB8A 1LCIA 2KZFA 4NB8A 4QTUA 3BG0B 3CCVZ 4A3GI 2E2JI 2D7VA 1N36C 3S16I 3ETCA 2QR1B 2OZKA 2I3CA 2RBLA 3PROC 1YIT1 2D1RA 2YCBA 3JAMD 1QF8A 2WP0C 4G37A 3TUFA 1YJWZ 4E2WA 1RQFA 4A3CI 2JUBA 1N33C 1Q821 2QA4Z 4JYAC 1VQO1 2JMOA 5BSMA 3NYRA 4HPVA 3CCQZ 1WIIA 4E2XA 2OTL1 2P28A 3J7A4 5T8TA 2DYJA 3G7SA 3ETOA 1N2FA 1O90A 3RV2A 2Q51A 1O92A 5A1GA 3CJEA 2QEX1 5K85A 4DCTA 4LF5C 2P2QA 1YUKA 1X3ZA 4U5YD 5BSVA 2RT9A 5KEIA 2GTIA 1IBKC 3R9WA 2CXCA 4FTFA 1ULTA 1O93A 4K0KC 3CCEZ 2ZAEB 3CC21 4JI1C 2UUBC 4EWCA 5CZXA 4A3BI 3S1QI 1IBMC 4A3JI 2D28C 4NB9A 2HJGA 5C4JI 4JI5C 1TFIA 4A3FI 3RZDI 3FCCA 3NI2A 2F4VC 1XRCA 3L8CA 4EATA 3E7XA 1IBLC 1NYEA 3CMA1 2P2JA 5D1OB 1EGAA 2E8FA 1XMQC 1K731 4WV3A 2WB1A 3TDEA 4LFCC 5CM2M 3GTOI 1JOSA 3GTLI 2O53A 1VQ81 4AQYC 2DE6A 1N8R1 4X62C 4NBFA 1VQM1 3J80b 2NVTI 3IMLA 1I6HI 1PG4A 2QRCB 2OBVA 1Q7Y1 2PT7G 3VMHA 4MONA 4IZ6A 1MD9A 4RM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UKK A;  2UUA C;  1XNR C;  2DE5 A;  4DV5 C;  4DR6 C;  3H3V J;  4LF7 C;  2ZM6 C;  1N34 C;  2E8E A;  4B3T C;  4GKJ C;  5BR8 C;  4DR1 C;  1N32 C;  3AF5 A;  5C44 I;  4LF6 C;  2R7Z I;  4DV1 C;  3IEV A;  3R9X A;  4A93 I;  4NBA A;  1ML8 A;  2JA5 I;  1L2F A;  4DV7 C;  2E5L C;  4QTT A;  5IP7 I;  1SFO I;  3GTK I;  3CQZ I;  1MKY A;  2E7G A;  4B3M C;  1KKG A;  4NXM C;  4BY1 I;  3S1R I;  2BJO A;  2OPL B;  4X66 C;  1QYP A;  4JI3 C;  1HNW C;  4DR7 C;  1PFT A;  3HOU I;  4LFA C;  3GCF A;  4JI4 C;  1Y1V I;  3EER A;  3I07 A;  4NBD A;  4A3M I;  2JS4 A;  2F4M A;  3RZO I;  2JNY A;  1WF3 A;  4YY3 C;  5FLX D;  4YHH C;  3IEU A;  4MTN A;  2QL8 A;  5IP9 I;  5A2Q D;  1WH9 A;  2KPI A;  2VQE C;  2UXD C;  1L1O C;  4X65 C;  1ZB9 A;  4DV0 C;  1Y1V S;  3GTG I;  4A3E I;  2B63 I;  2K5R A;  3J80 D;  3U50 C;  1I50 I;  4DR4 C;  2R92 I;  4XX2 A;  4A3L I;  1X3W A;  4KHP C;  4LF9 C;  1WCM I;  5C4X I;  1J5E C;  5LMU C;  2PN2 A;  1RLY A;  3GKQ A;  4BSZ A;  4DV4 C;  2VUM I;  3S17 I;  4JI8 C;  2UXC C;  5FLM I;  4B3S C;  2PK7 A;  4LFB C;  1NUI A;  3PO3 I;  4BY7 I;  1LQL A;  1USP A;  3HOX I;  3VMG A;  1WW9 A;  1TWH I;  2NVX I;  3S2D I;  3GTM I;  1TWC I;  4DUY C;  3GTQ I;  4DV2 C;  1XNQ C;  2DE7 A;  2NVQ I;  2UU9 C;  3M3Y I;  5C3E I;  1XMO C;  2R93 I;  4Y7N I;  4JV5 C;  3PO3 S;  4MH4 A;  2ONF A;  4NBC A;  1FJG C;  4A3I I;  3ESW A;  3GTM S;  2JR6 A;  4DR2 C;  4DCV A;  1HNX C;  4LF4 C;  2JA8 I;  3S1M I;  5IT9 D;  3T1Y C;  2HHH C;  3HOZ I;  2E2I I;  3LUS A;  3S15 I;  2P3Y A;  4JI0 C;  4Y52 I;  3K7A I;  3HOW I;  4LF8 C;  3I4M I;  4DR3 C;  4X6A I;  4BBS I;  2UUC C;  4OX9 C;  1Y1W I;  2VQF C;  2YU9 I;  1K0R A;  3GTJ I;  4NBE A;  4B3R C;  3AF6 A;  4A3K I;  4NBB A;  2AKL A;  2NVY I;  4DCS A;  4JI6 C;  4NBG A;  4GKK C;  3GTP I;  1TWA I;  4DV3 C;  4NOZ A;  3HOY I;  3GKU A;  1I94 C;  1HNZ C;  2E8C A;  2F4O A;  3FKI I;  3Q87 A;  3VMI A;  2EGT A;  3D6W A;  3J81 D;  1TWG I;  2OPL A;  1YUA A;  1TWF I;  1RO4 A;  1I3Q I;  4NBH A;  3S2H I;  3S1N I;  1DL6 A;  4BBR I;  4DV6 C;  2E2H I;  2ATW A;  3M4O I;  3S14 I;  1HR0 C;  4DUZ C;  5IWA C;  3PO2 I;  1K83 I;  3VB9 A;  1R9T I;  2XR1 A;  1VLA A;  4JI2 C;  2UXB C;  3OTO C;  2JA6 I;  1QWI A;  4NXN C;  2JMP A;  3H0G I;  3I4N I;  2CY1 A;  2HF1 A;  4X64 C;  4BXX I;  2ASB A;  4A3D I;  2JA7 I;  4DR5 C;  1HH2 P;  2J6A A;  4DCU A;  3T1H C;  3HOV I;  1PA4 A;  5LMN C;  1USP B;  4JI7 C;  1ZB8 A;  2KZF A;  4NB8 A;  4QTU A;  2D7V A;  4A3G I;  2E2J I;  1N36 C;  3S16 I;  2RBL A;  2YCB A;  3JAM D;  4A3C I;  1N33 C;  4JYA C;  2DYJ A;  1N2F A;  3CJE A;  4DCT A;  4LF5 C;  1X3Z A;  3R9W A;  1IBK C;  2CXC A;  4K0K C;  4JI1 C;  2UUB C;  4A3B I;  3S1Q I;  1IBM C;  4A3J I;  4NB9 A;  2HJG A;  5C4J I;  4JI5 C;  1TFI A;  4A3F I;  3RZD I;  2F4V C;  1IBL C;  1NYE A;  1EGA A;  2E8F A;  1XMQ C;  4LFC C;  5CM2 M;  3GTO I;  1JOS A;  3GTL I;  4AQY C;  2DE6 A;  4X62 C;  4NBF A;  2NVT I;  1I6H I;  2PT7 G;  3VMH A; 
#chains in the Genus database with same CATH topology
 1IB8 A;  1UKK A;  2Y4N A;  2VPY A;  2UUA C;  2OO4 A;  4L7I A;  5BST A;  4E2Z A;  4E33 A;  1S72 Z;  1XNR C;  2DE5 A;  5BSU A;  1YJ9 1;  4LE5 A;  3G71 1;  3G4S 1;  3CPW Y;  1QVG Z;  4JM1 A;  4DV5 C;  4DR6 C;  2E0G A;  3H3V J;  4LF7 C;  2W03 A;  4GXR A;  4R1M A;  3T4N B;  3RG2 A;  1VEH A;  2ZM6 C;  1VQK 1;  1N34 C;  2E8E A;  4I9G A;  4B3T C;  4GKJ C;  2H85 A;  5T67 A;  1MXB A;  5BR8 C;  4DR1 C;  1N32 C;  3TDH B;  3AF5 A;  5C44 I;  4LF6 C;  5GTD A;  4DK1 A;  2R7Z I;  4DV1 C;  5T6B A;  2V3V A;  3IEV A;  3R9X A;  1YJW 1;  1VQ4 Z;  2WAQ A;  1VQN 1;  4A93 I;  4MD8 A;  4KTV A;  1SIW A;  4NBA A;  1ML8 A;  2V8K A;  2D1Q A;  2JA5 I;  1L2F A;  4DV7 C;  3D2L A;  1M90 1;  4QTT A;  2E5L C;  2P2M A;  5IP7 I;  1SFO I;  3CCQ 1;  3GTK I;  4DGL A;  3IPL A;  3CQZ I;  1MKY A;  2E7G A;  1YIJ Z;  4B3M C;  1VQK Z;  1T5D X;  4D56 A;  3BG1 B;  1KC8 2;  1WJ2 A;  1KKG A;  1YI2 Z;  1MXC A;  4NXM C;  4BY1 I;  1KD1 1;  4MRI A;  3S1R I;  2BJO A;  2OPL B;  1Z02 A;  4X66 C;  1QYP A;  4JI3 C;  2V7B A;  4RV9 A;  3CCE 1;  1Q86 1;  2NCL A;  4OXI A;  4DR7 C;  1HNW C;  1Q81 2;  2OOY B;  1PFT A;  2NAP A;  3HOU I;  1V26 A;  2M6N A;  3KIH A;  3DLP X;  1VQN Z;  2E7Z A;  4RVO A;  4LFA C;  3GCF A;  4JI4 C;  1Y1V I;  1K9M 1;  2P02 A;  3C5E A;  3EER A;  4I9F A;  3I07 A;  4NBD A;  1P9N A;  4A3M I;  2M5O A;  2JS4 A;  1NJI 1;  2F4M A;  4MXU A;  4S1T A;  1YJ7 A;  2HU9 A;  3RZO I;  5IT9 b;  1Z03 A;  2JNY A;  1RG9 A;  1WF3 A;  1KQS Z;  3KIF A;  4YY3 C;  1UWD A;  5FLX D;  2DHM A;  5KYT A;  3J80 f;  1V60 A;  5DV9 A;  4PRO C;  2Z51 A;  2Y0S A;  1JJ2 Z;  4YHH C;  4AYB A;  3IEU A;  4MTN A;  1AMU A;  2QL8 A;  3I56 Z;  5JRH A;  3CC7 1;  3CD6 1;  1QXF A;  5IP9 I;  2AYA A;  1Z01 A;  5BUQ A;  5A2Q D;  1QVG Y;  1WH9 A;  2KPI A;  1V25 A;  2VQE C;  2UXD C;  5FLX b;  2VUG A;  1S72 1;  1L1O C;  4X65 C;  3GPC A;  1ZB9 A;  3CQ2 A;  4PUG A;  4DV0 C;  3KXW A;  2PRO A;  1Y1V S;  3GTG I;  4A3E I;  3R44 A;  4BC9 A;  5AE1 A;  2B63 I;  2K5R A;  3J80 D;  3N54 B;  2VPZ A;  4BBY A;  3U50 C;  2QVZ X;  1NY8 A;  1I50 I;  4DR4 C;  5A2Q b;  2R92 I;  1PG3 A;  4XX2 A;  4A3L I;  2YWC A;  3CC4 1;  1X3W A;  2MM9 A;  4NH1 C;  3NDJ A;  1Q82 2;  2JIM A;  4KHP C;  4LF9 C;  3UEB A;  3CCM 1;  2G2K A;  1WCM I;  5C4X I;  2OTJ Z;  5LMU C;  1VQL 1;  1J5E C;  5D1P A;  3FQM A;  2PN2 A;  1RLY A;  3LAX A;  4D4G A;  3CC7 Z;  3GKQ A;  4BSZ A;  3NH5 A;  4DV4 C;  2GTH A;  3CD6 Z;  2KZ0 A;  1VQ4 1;  2VUM I;  4PHT A;  3S17 I;  4JI8 C;  2UXC C;  5FLM I;  2D1S A;  1AA6 A;  2PK7 A;  4R0M A;  3G6E Z;  4B3S C;  4LFB C;  3AY0 A;  1NUI A;  4RVN A;  1P7L A;  3S82 A;  4L4Q A;  3N2Q A;  3PO3 I;  3IR7 A;  4ISB A;  4RLF A;  3UX2 A;  3VNQ A;  2WD9 A;  3SO4 A;  4BY7 I;  1LQL A;  1JWH C;  1USP A;  1YJN Z;  4NDN A;  3HOX I;  1YIJ 1;  2QLV B;  2ZZN A;  4L2Z A;  3VMG A;  1WW9 A;  1TWH I;  2AYD A;  2NVX I;  2QKD A;  3S2D I;  4PUI A;  4D57 A;  3EQ6 A;  3GTM I;  1TWC I;  3CC4 Z;  4DUY C;  1YI2 1;  3GTQ I;  3CW9 A;  3UZ0 A;  4DV2 C;  2DE7 A;  1T5H X;  3NH4 A;  3L95 X;  1FLO A;  1XNQ C;  2V45 A;  2NVQ I;  3CCM Z;  3CME Z;  2VPW A;  3A26 A;  2QVY X;  1VQL Z;  1NP6 A;  2UU9 C;  3M3Y I;  1M1K 1;  3J81 b;  5C3E I;  3PBK A;  4RMN A;  1XMO C;  3CCU 1;  1N8R 2;  2R93 I;  4D4I A;  3A25 A;  2GU2 A;  1Q7Y 2;  3PES A;  4Y7N I;  4PZP A;  5T64 A;  4E31 A;  5ADZ A;  4JV5 C;  1KQS Y;  3PO3 S;  4MH4 A;  3A9V A;  1VQ9 Z;  2ONF A;  5A1I A;  4NBC A;  3CCS 1;  2LEX A;  1JJ2 Y;  3E7W A;  1FJG C;  4A3I I;  1FUG A;  2BH1 X;  3LGX A;  3IFU A;  3ESW A;  5CZV A;  1RO0 A;  3GTM S;  4RVH A;  2JR6 A;  4DR2 C;  2R6M A;  4DCV A;  3I56 1;  1FDI A;  1Y8C A;  3F3F C;  1BA3 A;  1VQ6 1;  1S7M A;  3P5J B;  1HNX C;  4LF4 C;  2JA8 I;  3CCR Z;  1WCJ A;  5FLX f;  3S1M I;  5IT9 D;  1Q16 A;  2D1T A;  1W2B Y;  3B7W A;  1VQ5 1;  1VQP Z;  1M6X A;  1O9T A;  3CCU Z;  5D1O A;  5IFI A;  3T1Y C;  5BSR A;  2HHH C;  3HOZ I;  2E2I I;  2E9H A;  2RPR A;  5BUR A;  3OW2 Z;  5A2Q f;  3LUS A;  3I55 1;  3S15 I;  2P3Y A;  4JI0 C;  4Y52 I;  3K7A I;  3CCS Z;  1YHQ Z;  3HOW I;  3GR1 A;  4LF8 C;  1VQ7 1;  3IX0 A;  2QVX X;  3I4M I;  1M90 2;  4DR3 C;  4X6A I;  2YX1 A;  4BBS I;  3CW8 X;  3A4I A;  2UUC C;  4TNU A;  3CXC Y;  2OTJ 1;  4OX9 C;  1RY2 A;  2OOX B;  2W04 A;  1Y1W I;  1K8A 2;  3UX3 A;  4BCA A;  2VQF C;  2QRE B;  1RO2 A;  4CL1 A;  2YU9 I;  1VQ6 Z;  2VPX A;  3A9U A;  1K0R A;  1QVF Z;  2VSQ A;  3QWU A;  2LIY A;  3GTJ I;  3G6E 1;  4NBE A;  5H9U A;  1VQ5 Z;  1KD1 2;  2M5H A;  4B3R C;  3F3P C;  3JAM b;  4ZLP A;  4FUQ A;  3UOW A;  3AF6 A;  3NPD A;  4A3K I;  1FDO A;  2IZ3 A;  4NBB A;  2AKL A;  1Q86 2;  3FQQ A;  1W2B Z;  4E2Y A;  2NVY I;  4RVD A;  4DCS A;  1YJN 1;  3NH8 A;  1MXA A;  4JI6 C;  5KYV A;  3HKZ A;  3I55 Z;  1XRB A;  4ODJ A;  3MZL B;  2KI7 B;  3TE5 B;  4E32 A;  1XHJ A;  4NBG A;  4GKK C;  1KRL A;  1K9M 2;  2Q4Z A;  3O2E A;  3VNR A;  1VQ7 Z;  4WS9 A;  1QM4 A;  4G36 A;  1NJI 2;  1YIT Z;  2V8J A;  3GTP I;  3CME 1;  5BUS A;  3VTN A;  3TR3 A;  5LL6 f;  1TWA I;  4DV3 C;  4NOZ A;  3J81 f;  3HOY I;  3GKU A;  2YWB A;  3IF8 A;  2DPL A;  4NFR A;  2JIR A;  3CXC Z;  2YAD A;  2IZ4 A;  1P4E C;  1I94 C;  3CCL 1;  4FUT A;  5E7Q A;  1HNZ C;  5K8F A;  2M48 A;  1VQO Z;  2E8C A;  1TH5 A;  2F4O A;  2Y4O A;  3FKI I;  2OTL Z;  1P4E A;  1VQ9 1;  4GS5 A;  5A19 A;  3Q87 A;  4R1L A;  3LNO A;  3VMI A;  2EGT A;  3EED A;  2D27 A;  4ZJZ A;  2RIQ A;  3MZK B;  2QEX Z;  3D6W A;  3J81 D;  3H2T A;  3CCJ 1;  4K0B A;  4HGZ A;  1TWG I;  2OPL A;  2RHB A;  4RS4 A;  4OYC A;  2K3R A;  1YUA A;  1RNI A;  1TWF I;  2QRD B;  2CU6 A;  2P2F A;  4GXQ A;  2V8I A;  3CC2 Z;  1RO4 A;  1K73 2;  1I3Q I;  4NBH A;  1GPM A;  1ZH1 A;  3S2H I;  3S1N I;  2LFU A;  4RLQ A;  3CCR 1;  3TQI A;  4DG9 A;  1KC8 1;  4BBR I;  1DL6 A;  4DQY B;  2E2H I;  3DHV A;  5T8S A;  4DV6 C;  2ATW A;  3M4O I;  3S14 I;  1VQP 1;  3OW2 Y;  3NFZ A;  3CMA Z;  1HR0 C;  4DUZ C;  4TPS B;  3NYQ A;  4MD9 A;  5IWA C;  3K6R A;  3GR0 A;  3CCL Z;  2MMA B;  3PO2 I;  1K83 I;  1X0T A;  4DG8 A;  4PUH A;  5BSW A;  1Q81 1;  3VB9 A;  5IT9 f;  1R9T I;  2XR1 A;  4IR7 A;  2QW0 X;  1VLA A;  1YHQ 1;  4JI2 C;  2UXB C;  1VQ8 Z;  2Y27 A;  3OTO C;  3CCV 1;  1VQM Z;  2O4H A;  2JNV A;  4HH4 A;  3FCE A;  1MDF A;  2JA6 I;  1QWI A;  3CCJ Z;  4NXN C;  2JMP A;  3NDI A;  3H0G I;  3I4N I;  2JIO A;  4RVG A;  1QVF Y;  4E30 A;  2CY1 A;  4RVF A;  4KTT A;  4BC7 A;  2HF1 A;  4G1I A;  5AE2 A;  2VF1 A;  4BXX I;  4X64 C;  2PMZ A;  3MON A;  2PM9 A;  5AN9 F;  2MCQ A;  2QA4 1;  3VNS A;  2P20 A;  2ASB A;  4HGY A;  1YJ9 Z;  1M6X C;  3G71 Z;  3G4S Z;  4A3D I;  2JA7 I;  3JAM f;  3I08 A;  4RM2 A;  4DR5 C;  1MDB A;  1HH2 P;  2J6A A;  3DAY A;  3LNV A;  4DCU A;  3T1H C;  1K8A 1;  1XRA A;  2VZE A;  3D9X A;  3CPW Z;  3HOV I;  1PA4 A;  2ZZM A;  5AE3 A;  5LMN C;  1USP B;  2JIQ A;  2KDN A;  1M1K 2;  2P2B A;  5LCI A;  4JI7 C;  4MD7 A;  1ZB8 A;  1LCI A;  2KZF A;  4NB8 A;  4QTU A;  3BG0 B;  3CCV Z;  4A3G I;  2E2J I;  2D7V A;  1N36 C;  3S16 I;  3ETC A;  2QR1 B;  2OZK A;  2I3C A;  2RBL A;  3PRO C;  1YIT 1;  2D1R A;  2YCB A;  3JAM D;  1QF8 A;  2WP0 C;  4G37 A;  3TUF A;  1YJW Z;  4E2W A;  1RQF A;  4A3C I;  2JUB A;  1N33 C;  1Q82 1;  2QA4 Z;  1XS3 A;  4JYA C;  1VQO 1;  3CQ3 A;  2JMO A;  5BSM A;  3NYR A;  4HPV A;  3CCQ Z;  1WII A;  4E2X A;  2OTL 1;  2P28 A;  3J7A 4;  5T8T A;  2DYJ A;  3G7S A;  3ETO A;  1PU1 A;  1N2F A;  1WZN A;  1O90 A;  3RV2 A;  2Q51 A;  1O92 A;  5A1G A;  3CJE A;  2QEX 1;  5K85 A;  4DCT A;  4LF5 C;  2P2Q A;  1YUK A;  1X3Z A;  4U5Y D;  5BSV A;  2RT9 A;  5KEI A;  2GTI A;  1IBK C;  3R9W A;  2CXC A;  4FTF A;  1ULT A;  1O93 A;  4K0K C;  2JIP A;  2ZAE B;  3CC2 1;  3CCE Z;  4JI1 C;  2UUB C;  4EWC A;  5CZX A;  4A3B I;  3S1Q I;  1IBM C;  4A3J I;  2D28 C;  4NB9 A;  3CQ1 A;  2HJG A;  5C4J I;  4JI5 C;  1TFI A;  4A3F I;  3RZD I;  3FCC A;  3NI2 A;  2F4V C;  1XRC A;  3L8C A;  4EAT A;  3E7X A;  1IBL C;  1NYE A;  3CMA 1;  2P2J A;  5D1O B;  1EGA A;  2E8F A;  1XMQ C;  1K73 1;  4WV3 A;  2WB1 A;  3TDE A;  4LFC C;  5CM2 M;  3GTO I;  1JOS A;  3GTL I;  2O53 A;  1VQ8 1;  4AQY C;  2DE6 A;  1N8R 1;  4X62 C;  4NBF A;  1VQM 1;  3J80 b;  2NVT I;  3IML A;  1I6H I;  1PG4 A;  2QRC B;  2OBV A;  1Q7Y 1;  2IV2 X;  2PT7 G;  3VMH A;  4MON A;  4IZ6 A;  1MD9 A;  4RM3 A; 
#chains in the Genus database with same CATH homology
 1UKK A;  2Y4N A;  2UUA C;  2OO4 A;  4L7I A;  5BST A;  4E2Z A;  4E33 A;  1S72 Z;  1XNR C;  2DE5 A;  5BSU A;  1YJ9 1;  4LE5 A;  3G71 1;  3G4S 1;  3CPW Y;  1QVG Z;  4JM1 A;  4DV5 C;  4DR6 C;  2E0G A;  3H3V J;  4LF7 C;  2W03 A;  4GXR A;  4R1M A;  3T4N B;  3RG2 A;  2ZM6 C;  1VQK 1;  1N34 C;  2E8E A;  4I9G A;  4B3T C;  4GKJ C;  2H85 A;  5T67 A;  1MXB A;  5BR8 C;  4DR1 C;  1N32 C;  3TDH B;  3AF5 A;  5C44 I;  4LF6 C;  5GTD A;  4DK1 A;  2R7Z I;  4DV1 C;  5T6B A;  3IEV A;  3R9X A;  1YJW 1;  1VQ4 Z;  2WAQ A;  1VQN 1;  4A93 I;  4MD8 A;  4KTV A;  4NBA A;  1ML8 A;  2V8K A;  2D1Q A;  2JA5 I;  1L2F A;  4DV7 C;  1M90 1;  4QTT A;  2E5L C;  2P2M A;  5IP7 I;  1SFO I;  3CCQ 1;  3GTK I;  4DGL A;  3IPL A;  3CQZ I;  1MKY A;  2E7G A;  1YIJ Z;  4B3M C;  1VQK Z;  1T5D X;  4D56 A;  3BG1 B;  1KC8 2;  1KKG A;  1YI2 Z;  1MXC A;  4NXM C;  4BY1 I;  1KD1 1;  4MRI A;  3S1R I;  2BJO A;  2OPL B;  1Z02 A;  4X66 C;  1QYP A;  4JI3 C;  2V7B A;  4RV9 A;  3CCE 1;  1Q86 1;  4OXI A;  4DR7 C;  1HNW C;  1Q81 2;  2OOY B;  1PFT A;  3HOU I;  1V26 A;  2M6N A;  3KIH A;  3DLP X;  1VQN Z;  4RVO A;  4LFA C;  3GCF A;  4JI4 C;  1Y1V I;  1K9M 1;  2P02 A;  3C5E A;  3EER A;  4I9F A;  3I07 A;  4NBD A;  1P9N A;  4A3M I;  2JS4 A;  1NJI 1;  2F4M A;  4MXU A;  4S1T A;  1YJ7 A;  2HU9 A;  3RZO I;  5IT9 b;  1Z03 A;  2JNY A;  1RG9 A;  1WF3 A;  1KQS Z;  3KIF A;  4YY3 C;  5FLX D;  5KYT A;  3J80 f;  5DV9 A;  4PRO C;  2Y0S A;  1JJ2 Z;  4YHH C;  4AYB A;  3IEU A;  4MTN A;  1AMU A;  2QL8 A;  3I56 Z;  5JRH A;  3CC7 1;  3CD6 1;  5IP9 I;  2AYA A;  1Z01 A;  5BUQ A;  5A2Q D;  1QVG Y;  1WH9 A;  2KPI A;  1V25 A;  2VQE C;  2UXD C;  5FLX b;  2VUG A;  1S72 1;  1L1O C;  4X65 C;  3GPC A;  1ZB9 A;  4DV0 C;  3KXW A;  2PRO A;  1Y1V S;  3GTG I;  4A3E I;  3R44 A;  4BC9 A;  5AE1 A;  2B63 I;  2K5R A;  3J80 D;  3N54 B;  4BBY A;  3U50 C;  2QVZ X;  1I50 I;  4DR4 C;  5A2Q b;  2R92 I;  1PG3 A;  4XX2 A;  4A3L I;  2YWC A;  3CC4 1;  1X3W A;  4NH1 C;  3NDJ A;  1Q82 2;  4KHP C;  4LF9 C;  3CCM 1;  2G2K A;  1WCM I;  5C4X I;  2OTJ Z;  5LMU C;  1VQL 1;  1J5E C;  5D1P A;  3FQM A;  2PN2 A;  1RLY A;  3LAX A;  4D4G A;  3CC7 Z;  3GKQ A;  4BSZ A;  3NH5 A;  4DV4 C;  2GTH A;  3CD6 Z;  1VQ4 1;  2VUM I;  4PHT A;  3S17 I;  4JI8 C;  2UXC C;  5FLM I;  2D1S A;  4B3S C;  2PK7 A;  4R0M A;  3G6E Z;  4LFB C;  1NUI A;  4RVN A;  1P7L A;  3S82 A;  4L4Q A;  3N2Q A;  3PO3 I;  4ISB A;  4RLF A;  3VNQ A;  2WD9 A;  3SO4 A;  4BY7 I;  1LQL A;  1JWH C;  1USP A;  1YJN Z;  4NDN A;  3HOX I;  1YIJ 1;  2QLV B;  4L2Z A;  3VMG A;  1WW9 A;  1TWH I;  2NVX I;  3S2D I;  2QKD A;  4D57 A;  3EQ6 A;  3GTM I;  1TWC I;  3CC4 Z;  4DUY C;  1YI2 1;  3GTQ I;  3CW9 A;  3UZ0 A;  4DV2 C;  2DE7 A;  1T5H X;  3NH4 A;  3L95 X;  1XNQ C;  2NVQ I;  3CCM Z;  3CME Z;  2QVY X;  1VQL Z;  1NP6 A;  2UU9 C;  3M3Y I;  1M1K 1;  3J81 b;  5C3E I;  3PBK A;  4RMN A;  1XMO C;  3CCU 1;  1N8R 2;  2R93 I;  4D4I A;  2GU2 A;  1Q7Y 2;  3PES A;  4Y7N I;  4PZP A;  5T64 A;  4E31 A;  5ADZ A;  4JV5 C;  1KQS Y;  3PO3 S;  4MH4 A;  3A9V A;  1VQ9 Z;  2ONF A;  5A1I A;  4NBC A;  3CCS 1;  1JJ2 Y;  3E7W A;  1FJG C;  4A3I I;  1FUG A;  2BH1 X;  3LGX A;  3IFU A;  3ESW A;  5CZV A;  1RO0 A;  3GTM S;  4RVH A;  2JR6 A;  4DR2 C;  2R6M A;  4DCV A;  3I56 1;  3F3F C;  1BA3 A;  1VQ6 1;  1S7M A;  3P5J B;  1HNX C;  4LF4 C;  2JA8 I;  3CCR Z;  5FLX f;  3S1M I;  5IT9 D;  2D1T A;  1W2B Y;  3B7W A;  1VQ5 1;  1VQP Z;  1O9T A;  3CCU Z;  5D1O A;  5IFI A;  3T1Y C;  5BSR A;  2HHH C;  3HOZ I;  2E2I I;  2E9H A;  2RPR A;  5BUR A;  3OW2 Z;  5A2Q f;  3LUS A;  3I55 1;  3S15 I;  2P3Y A;  4JI0 C;  4Y52 I;  3K7A I;  3CCS Z;  1YHQ Z;  3HOW I;  3GR1 A;  4LF8 C;  1VQ7 1;  3IX0 A;  2QVX X;  3I4M I;  1M90 2;  4DR3 C;  4X6A I;  4BBS I;  3CW8 X;  3A4I A;  2UUC C;  4TNU A;  3CXC Y;  2OTJ 1;  4OX9 C;  1RY2 A;  2OOX B;  2W04 A;  1Y1W I;  1K8A 2;  4BCA A;  2VQF C;  2QRE B;  1RO2 A;  4CL1 A;  2YU9 I;  1VQ6 Z;  3A9U A;  1K0R A;  1QVF Z;  2VSQ A;  3QWU A;  2LIY A;  3GTJ I;  3G6E 1;  4NBE A;  5H9U A;  1VQ5 Z;  1KD1 2;  4B3R C;  3F3P C;  3JAM b;  4ZLP A;  4FUQ A;  3UOW A;  3AF6 A;  3NPD A;  4A3K I;  2IZ3 A;  4NBB A;  2AKL A;  1Q86 2;  3FQQ A;  1W2B Z;  4E2Y A;  2NVY I;  4RVD A;  4DCS A;  1YJN 1;  3NH8 A;  1MXA A;  4JI6 C;  5KYV A;  3HKZ A;  3I55 Z;  1XRB A;  4ODJ A;  3MZL B;  2KI7 B;  3TE5 B;  4E32 A;  4NBG A;  4GKK C;  1KRL A;  1K9M 2;  2Q4Z A;  3VNR A;  1VQ7 Z;  4WS9 A;  1QM4 A;  4G36 A;  1NJI 2;  1YIT Z;  2V8J A;  3GTP I;  3CME 1;  5BUS A;  3VTN A;  5LL6 f;  1TWA I;  4DV3 C;  4NOZ A;  3J81 f;  3HOY I;  3GKU A;  2YWB A;  3IF8 A;  2DPL A;  4NFR A;  3CXC Z;  2YAD A;  2IZ4 A;  1I94 C;  3CCL 1;  4FUT A;  5E7Q A;  1HNZ C;  5K8F A;  2M48 A;  1VQO Z;  2E8C A;  2Y4O A;  2F4O A;  3FKI I;  2OTL Z;  1VQ9 1;  4GS5 A;  5A19 A;  3Q87 A;  4R1L A;  3VMI A;  2EGT A;  3EED A;  2D27 A;  4ZJZ A;  2RIQ A;  3MZK B;  2QEX Z;  3D6W A;  3J81 D;  3H2T A;  3CCJ 1;  4K0B A;  4HGZ A;  1TWG I;  2OPL A;  2RHB A;  4RS4 A;  4OYC A;  2K3R A;  1YUA A;  1RNI A;  1TWF I;  2QRD B;  2P2F A;  4GXQ A;  2V8I A;  3CC2 Z;  1RO4 A;  1K73 2;  1I3Q I;  4NBH A;  1GPM A;  1ZH1 A;  3S2H I;  3S1N I;  2LFU A;  4RLQ A;  3CCR 1;  3TQI A;  4DG9 A;  1KC8 1;  4BBR I;  1DL6 A;  4DQY B;  2E2H I;  3DHV A;  5T8S A;  4DV6 C;  2ATW A;  3M4O I;  3S14 I;  1VQP 1;  3OW2 Y;  3NFZ A;  3CMA Z;  1HR0 C;  4DUZ C;  4TPS B;  3NYQ A;  4MD9 A;  5IWA C;  3GR0 A;  3CCL Z;  3PO2 I;  1K83 I;  1X0T A;  4DG8 A;  5BSW A;  1Q81 1;  3VB9 A;  5IT9 f;  1R9T I;  2XR1 A;  4IR7 A;  2QW0 X;  1VLA A;  1YHQ 1;  4JI2 C;  2UXB C;  1VQ8 Z;  2Y27 A;  3OTO C;  3CCV 1;  1VQM Z;  2O4H A;  4HH4 A;  3FCE A;  1MDF A;  2JA6 I;  1QWI A;  3CCJ Z;  4NXN C;  2JMP A;  3NDI A;  3H0G I;  3I4N I;  4RVG A;  1QVF Y;  2CY1 A;  4E30 A;  4KTT A;  4RVF A;  4BC7 A;  2HF1 A;  4G1I A;  5AE2 A;  2VF1 A;  4BXX I;  4X64 C;  2PMZ A;  3MON A;  2PM9 A;  5AN9 F;  2QA4 1;  3VNS A;  2P20 A;  2ASB A;  4HGY A;  1YJ9 Z;  3G71 Z;  3G4S Z;  4A3D I;  2JA7 I;  3JAM f;  3I08 A;  4RM2 A;  4DR5 C;  1MDB A;  1HH2 P;  2J6A A;  3DAY A;  3LNV A;  4DCU A;  3T1H C;  1K8A 1;  1XRA A;  2VZE A;  3D9X A;  3CPW Z;  3HOV I;  1PA4 A;  5AE3 A;  5LMN C;  1USP B;  1M1K 2;  2P2B A;  4JI7 C;  4MD7 A;  1ZB8 A;  1LCI A;  2KZF A;  4NB8 A;  4QTU A;  3BG0 B;  3CCV Z;  4A3G I;  2E2J I;  2D7V A;  1N36 C;  3S16 I;  3ETC A;  2QR1 B;  2OZK A;  2I3C A;  2RBL A;  3PRO C;  1YIT 1;  2D1R A;  2YCB A;  3JAM D;  1QF8 A;  2WP0 C;  4G37 A;  3TUF A;  1YJW Z;  4E2W A;  1RQF A;  4A3C I;  2JUB A;  1N33 C;  1Q82 1;  2QA4 Z;  4JYA C;  1VQO 1;  2JMO A;  5BSM A;  3NYR A;  4HPV A;  3CCQ Z;  1WII A;  4E2X A;  2OTL 1;  2P28 A;  3J7A 4;  5T8T A;  2DYJ A;  3G7S A;  3ETO A;  1N2F A;  1O90 A;  3RV2 A;  2Q51 A;  1O92 A;  5A1G A;  3CJE A;  2QEX 1;  5K85 A;  4DCT A;  4LF5 C;  2P2Q A;  1YUK A;  1X3Z A;  4U5Y D;  5BSV A;  2RT9 A;  5KEI A;  2GTI A;  1IBK C;  3R9W A;  2CXC A;  4FTF A;  1ULT A;  1O93 A;  4K0K C;  3CCE Z;  2ZAE B;  3CC2 1;  4JI1 C;  2UUB C;  4EWC A;  5CZX A;  4A3B I;  3S1Q I;  1IBM C;  4A3J I;  2D28 C;  4NB9 A;  2HJG A;  5C4J I;  4JI5 C;  1TFI A;  4A3F I;  3RZD I;  3FCC A;  3NI2 A;  2F4V C;  1XRC A;  3L8C A;  4EAT A;  3E7X A;  1IBL C;  1NYE A;  3CMA 1;  2P2J A;  5D1O B;  1EGA A;  2E8F A;  1XMQ C;  1K73 1;  4WV3 A;  2WB1 A;  3TDE A;  4LFC C;  5CM2 M;  3GTO I;  1JOS A;  3GTL I;  2O53 A;  1VQ8 1;  4AQY C;  2DE6 A;  1N8R 1;  4X62 C;  4NBF A;  1VQM 1;  3J80 b;  2NVT I;  3IML A;  1I6H I;  1PG4 A;  2QRC B;  2OBV A;  1Q7Y 1;  2PT7 G;  3VMH A;  4MON A;  4IZ6 A;  1MD9 A;  4RM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...