5T8TA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
388
structure length
379
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIADLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound AMP and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
total genus 129
structure length 379
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA03
4HPVA 3A4IA 4ODJA 5T8SA 4KTTA 4WS9A 2YWCA 2OBVA 1XRAA 1FUGA 1MXBA 5H9UA 3S82A 3SO4A 4LE5A 4L7IA 4K0BA 4L4QA 3TQIA 1MXCA 3UOWA 1XRBA 5A19A 1RG9A 5A1GA 3TDEA 5A1IA 1P7LA 1MXAA 1GPMA 2YWBA 3IMLA 5T8TA 3RV2A 4NDNA 1O9TA 1O93A 1O92A 2DPLA 1O90A 1QM4A 4KTVA 4L2ZA 2P02A 1XRCA
chains in the Genus database with same CATH superfamily
1BA3A 4HPVA 1N34C 3N2QA 4BC7A 2YWCA 1FUGA 4LF6C 2QVZX 2YX1A 1PG4A 4ISBA 1UWDA 4X64C 2KZFA 2AYAA 2BJOA 4PROC 2YWBA 4OXIA 4JI0C 4RM2A 2P02A 2QVXX 2XR1A 1ULTA 1HNZC 3N54B 4EATA 2E8EA 5LCIA 2OPLB 2ZZMA 3DAYA 4B3SC 4LFBC 4JI7C 1LQLA 2MM9A 4FTFA 3G7SA 2CU6A 1O9TA 5BSUA 3VNSA 4DCUA 2F4VC 4JYAC 1T5HX 3UEBA 3ETCA 5GTDA 1HNWC 4WS9A 4NXMC 4RLFA 4JI3C 4MTNA 1PG3A 1VLAA 1J5EC 5A19A 2UU9C 3FCCA 2V7BA 3A25A 4DR1C 2QL8A 1PU1A 1V60A 4U5YD 1GPMA 4DV2C 5CZVA 4DV6C 4DUYC 2CY1A 4DV5C 4I9GA 3A4IA 4X62C 3AF5A 1V25A 3R9XA 4BCAA 1MKYA 4LF4C 4L4QA 3C5EA 1MXCA 4G1IA 3CQ3A 2D1TA 4BC9A 4D4GA 3AY0A 2UXCC 5KEIA 1JOSA 4B3MC 4RLQA 1IBKC 1ZB9A 4BBYA 5LMNC 3I07A 1O90A 4NOZA 3T1HC 1P4EC 4ZJZA 4DUZC 3CQ1A 2KZ0A 3VNRA 1QWIA 3OTOC 2VQFC 2D1RA 3KXWA 2Z51A 5IFIA 2UUBC 3EERA 4GS5A 3DLPX 5DV9A 4DV3C 5FLXD 2DHMA 1XHJA 4R0MA 4D57A 4BSZA 4YHHC 3DHVA 4GXRA 1HNXC 1HR0C 4JI8C 4R1LA 2P2MA 1WCJA 3TUFA 3B7WA 1XS3A 4XX2A 3EQ6A 4L7IA 4LF7C 5BURA 3NI2A 4RMNA 2E5LC 5A1GA 1RY2A 2WD9A 3A9UA 4DG9A 3RV2A 4FUTA 4DR3C 5E7QA 1USPB 5KYTA 3RG2A 4DR7C 3CQ2A 3L95X 4G37A 4JI6C 2ZM6C 3LNVA 1MXBA 5BUQA 4DR4C 2BH1X 3A26A 4DV4C 3J80D 1KKGA 4X65C 4B3RC 3JAMD 1HH2P 2CXCA 4R1MA 4NDNA 2DPLA 2ONFA 3NPDA 3K6RA 3R9WA 1N32C 4ODJA 4I9FA 1WF3A 4GKKC 2NCLA 1MDBA 4LE5A 1WH9A 5AE1A 1MDFA 1VEHA 4MH4A 1N33C 2JMPA 4LF9C 2PROA 1ML8A 4PZPA 4G36A 3UZ0A 2MMAB 1NY8A 4JV5C 3CW9A 1YJ7A 2ZZNA 4TPSB 2D28C 4JI5C 3IEVA 2E8FA 1IBLC 5ADZA 5BSVA 1QM4A 3NYRA 5BSRA 4JI2C 1USPA 2MCQA 3SO4A 3S82A 4PUHA 2HJGA 3TQIA 5LMUC 3GR1A 4DV0C 1I94C 4GKJC 1K0RA 4X66C 1AMUA 3L8CA 3T1YC 3LGXA 3ETOA 1TH5A 5BUSA 4ZLPA 5BSWA 4IR7A 4RVOA 4KHPC 3FCEA 4L2ZA 5JRHA 2UXBC 3GKUA 5AE3A 2Y4OA 4KTTA 4K0KC 5BR8C 5CZXA 4DCTA 1XRBA 2P2BA 2EGTA 3PBKA 1P7LA 3AF6A 4RVNA 5BSTA 1FLOA 5K8FA 2M5HA 1XNQC 2OO4A 4LFAC 1MD9A 2QW0X 2Y27A 3E7WA 1N36C 4PUIA 4RM3A 2Y4NA 1FJGC 4LF8C 1M6XC 1M6XA 2VQEC 1NYEA 1XMOC 4DCSA 4DG8A 4PUGA 2P2JA 2P2FA 2PN2A 1O93A 1P4EA 3CJEA 5A2QD 3TR3A 1EGAA 1XRAA 2WP0C 4JI1C 2D27A 1LCIA 3PROC 2D7VA 2D1SA 2OPLA 4DR6C 3IPLA 1MXAA 1IB8A 2DYJA 4JM1A 1PA4A 3IMLA 3IEUA 3UX3A 4YY3C 2E8CA 4DV7C 3A9VA 4IZ6A 4KTVA 1XRCA 3J81D 2D1QA 1V26A 3H2TA 2JNVA 1UKKA 2OBVA 5H9UA 4K0BA 2ATWA 3TDEA 5A1IA 4OX9C 3UX2A 3CW8X 3LNOA 5T8TA 5AE2A 2E0GA 4FUQA 2VZEA 4NXNC 2VSQA 4B3TC 2YCBA 3PESA 2ASBA 5BSMA 3I08A 4DR5C 5T8SA 1L2FA 4DCVA 5K85A 3NYQA 3LAXA 3GR0A 5KYVA 4DR2C 4OYCA 1RG9A 4D4IA 4LFCC 2P2QA 1IBMC 1O92A 4D56A 2M5OA 3LUSA 3GPCA 3O2EA 4WV3A 3R44A 4AQYC 4GXQA 2QVYX 1N2FA 2KDNA 4JI4C 4PHTA 2UXDC 3E7XA 1ZB8A 1T5DX 3UOWA 4LF5C 2PT7G 2UUCC 1XNRC 2E7GA 2HHHC 5IWAC 5IT9D 3VNQA 2UUAC 4DV1C 2P20A 1XMQC
chains in the Genus database with same CATH topology
1BA3A 4HPVA 1N34C 3N2QA 4BC7A 2YWCA 1FUGA 4LF6C 2QVZX 1PG4A 4ISBA 4X64C 2KZFA 2AYAA 2BJOA 4PROC 2YWBA 4OXIA 4JI0C 4RM2A 2P02A 2QVXX 2XR1A 1ULTA 1HNZC 3N54B 4EATA 2E8EA 2OPLB 3DAYA 4B3SC 4LFBC 4JI7C 1LQLA 4FTFA 3G7SA 1O9TA 5BSUA 3VNSA 4DCUA 2F4VC 4JYAC 1T5HX 3ETCA 5GTDA 1HNWC 4WS9A 4NXMC 4RLFA 4JI3C 4MTNA 1PG3A 1VLAA 1J5EC 5A19A 2UU9C 3FCCA 2V7BA 4DR1C 2QL8A 4U5YD 1GPMA 4DV2C 5CZVA 4DV6C 4DUYC 2CY1A 4DV5C 4I9GA 3A4IA 4X62C 3AF5A 1V25A 3R9XA 4BCAA 1MKYA 4LF4C 4L4QA 3C5EA 1MXCA 4G1IA 2D1TA 4BC9A 4D4GA 2UXCC 5KEIA 1JOSA 4B3MC 4RLQA 1IBKC 1ZB9A 4BBYA 5LMNC 3I07A 1O90A 4NOZA 3T1HC 4ZJZA 4DUZC 3VNRA 1QWIA 3OTOC 2VQFC 2D1RA 3KXWA 5IFIA 2UUBC 3EERA 4GS5A 3DLPX 5DV9A 4DV3C 5FLXD 4R0MA 4D57A 4BSZA 4YHHC 3DHVA 4GXRA 1HNXC 1HR0C 4JI8C 4R1LA 2P2MA 3TUFA 3B7WA 4XX2A 3EQ6A 4L7IA 4LF7C 5BURA 3NI2A 4RMNA 2E5LC 5A1GA 1RY2A 2WD9A 3A9UA 4DG9A 3RV2A 4FUTA 4DR3C 5E7QA 1USPB 5KYTA 3RG2A 4DR7C 3L95X 4G37A 4JI6C 3LNVA 2ZM6C 1MXBA 5BUQA 4DR4C 2BH1X 4DV4C 3J80D 1KKGA 4X65C 4B3RC 3JAMD 1HH2P 2CXCA 4R1MA 4NDNA 2DPLA 2ONFA 3NPDA 3R9WA 1N32C 4ODJA 4I9FA 1WF3A 4GKKC 1MDBA 4LE5A 1WH9A 5AE1A 1MDFA 4MH4A 1N33C 2JMPA 4LF9C 2PROA 1ML8A 4PZPA 4G36A 3UZ0A 4JV5C 3CW9A 1YJ7A 4TPSB 2D28C 4JI5C 3IEVA 2E8FA 1IBLC 5ADZA 5BSVA 1QM4A 3NYRA 5BSRA 4JI2C 1USPA 3SO4A 3S82A 2HJGA 3TQIA 5LMUC 3GR1A 4DV0C 1I94C 4GKJC 1K0RA 4X66C 1AMUA 3L8CA 3T1YC 3LGXA 3ETOA 5BUSA 4ZLPA 5BSWA 4IR7A 4RVOA 4KHPC 3FCEA 4L2ZA 5JRHA 2UXBC 3GKUA 5AE3A 2Y4OA 4KTTA 4K0KC 5BR8C 5CZXA 4DCTA 1XRBA 2P2BA 2EGTA 3PBKA 1P7LA 3AF6A 4RVNA 5BSTA 5K8FA 1XNQC 2OO4A 4LFAC 1MD9A 2QW0X 2Y27A 3E7WA 1N36C 4RM3A 2Y4NA 1FJGC 4LF8C 2VQEC 1NYEA 1XMOC 4DCSA 4DG8A 2P2JA 2P2FA 2PN2A 1O93A 3CJEA 5A2QD 1EGAA 1XRAA 2WP0C 4JI1C 2D27A 1LCIA 3PROC 2D7VA 2D1SA 2OPLA 4DR6C 3IPLA 1MXAA 2DYJA 4JM1A 1PA4A 3IMLA 3IEUA 4YY3C 2E8CA 4DV7C 3A9VA 4IZ6A 4KTVA 1XRCA 3J81D 2D1QA 1V26A 3H2TA 1UKKA 2OBVA 5H9UA 4K0BA 2ATWA 3TDEA 5A1IA 4OX9C 3CW8X 5T8TA 5AE2A 2E0GA 4FUQA 2VZEA 4NXNC 2VSQA 4B3TC 2YCBA 3PESA 2ASBA 5BSMA 3I08A 4DR5C 5T8SA 1L2FA 4DCVA 5K85A 3NYQA 3LAXA 3GR0A 5KYVA 4DR2C 4OYCA 1RG9A 4D4IA 4LFCC 2P2QA 1IBMC 1O92A 4D56A 3LUSA 3GPCA 4WV3A 3R44A 4AQYC 4GXQA 2QVYX 1N2FA 4JI4C 4PHTA 2UXDC 3E7XA 1ZB8A 1T5DX 3UOWA 4LF5C 2PT7G 2UUCC 1XNRC 2E7GA 2HHHC 5IWAC 5IT9D 3VNQA 2UUAC 4DV1C 2P20A 1XMQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HPV A;  3A4I A;  4ODJ A;  5T8S A;  4KTT A;  4WS9 A;  2YWC A;  2OBV A;  1XRA A;  1FUG A;  1MXB A;  5H9U A;  3S82 A;  3SO4 A;  4LE5 A;  4L7I A;  4K0B A;  4L4Q A;  3TQI A;  1MXC A;  3UOW A;  1XRB A;  5A19 A;  1RG9 A;  5A1G A;  3TDE A;  5A1I A;  1P7L A;  1MXA A;  1GPM A;  2YWB A;  3IML A;  5T8T A;  3RV2 A;  4NDN A;  1O9T A;  1O93 A;  1O92 A;  2DPL A;  1O90 A;  1QM4 A;  4KTV A;  4L2Z A;  2P02 A;  1XRC A; 
#chains in the Genus database with same CATH topology
 1BA3 A;  4HPV A;  1N34 C;  3N2Q A;  4BC7 A;  2YWC A;  1FUG A;  4LF6 C;  2QVZ X;  2YX1 A;  1PG4 A;  4ISB A;  1UWD A;  4X64 C;  2KZF A;  2AYA A;  2BJO A;  4PRO C;  2YWB A;  4OXI A;  4JI0 C;  4RM2 A;  2P02 A;  2QVX X;  2XR1 A;  1ULT A;  1HNZ C;  3N54 B;  4EAT A;  2E8E A;  5LCI A;  2OPL B;  2ZZM A;  3DAY A;  4B3S C;  4LFB C;  4JI7 C;  1LQL A;  2MM9 A;  4FTF A;  3G7S A;  2CU6 A;  1O9T A;  5BSU A;  3VNS A;  4DCU A;  2F4V C;  4JYA C;  1T5H X;  3UEB A;  3ETC A;  5GTD A;  1HNW C;  4WS9 A;  4NXM C;  4RLF A;  4JI3 C;  4MTN A;  1PG3 A;  1VLA A;  1J5E C;  5A19 A;  2UU9 C;  3FCC A;  2V7B A;  3A25 A;  4DR1 C;  2QL8 A;  1PU1 A;  1V60 A;  4U5Y D;  1GPM A;  4DV2 C;  5CZV A;  4DV6 C;  4DUY C;  2CY1 A;  4DV5 C;  4I9G A;  3A4I A;  4X62 C;  3AF5 A;  1V25 A;  3R9X A;  4BCA A;  1MKY A;  4LF4 C;  4L4Q A;  3C5E A;  1MXC A;  4G1I A;  3CQ3 A;  2D1T A;  4BC9 A;  4D4G A;  3AY0 A;  2UXC C;  5KEI A;  1JOS A;  4B3M C;  4RLQ A;  1IBK C;  1ZB9 A;  4BBY A;  5LMN C;  3I07 A;  1O90 A;  4NOZ A;  3T1H C;  1P4E C;  4ZJZ A;  4DUZ C;  3CQ1 A;  2KZ0 A;  3VNR A;  1QWI A;  3OTO C;  2VQF C;  2D1R A;  3KXW A;  2Z51 A;  5IFI A;  2UUB C;  3EER A;  4GS5 A;  3DLP X;  5DV9 A;  4DV3 C;  5FLX D;  2DHM A;  1XHJ A;  4R0M A;  4D57 A;  4BSZ A;  4YHH C;  3DHV A;  4GXR A;  1HNX C;  1HR0 C;  4JI8 C;  4R1L A;  2P2M A;  1WCJ A;  3TUF A;  3B7W A;  1XS3 A;  4XX2 A;  3EQ6 A;  4L7I A;  4LF7 C;  5BUR A;  3NI2 A;  4RMN A;  2E5L C;  5A1G A;  1RY2 A;  2WD9 A;  3A9U A;  4DG9 A;  3RV2 A;  4FUT A;  4DR3 C;  5E7Q A;  1USP B;  5KYT A;  3RG2 A;  4DR7 C;  3CQ2 A;  3L95 X;  4G37 A;  4JI6 C;  2ZM6 C;  3LNV A;  1MXB A;  5BUQ A;  4DR4 C;  2BH1 X;  3A26 A;  4DV4 C;  3J80 D;  1KKG A;  4X65 C;  4B3R C;  3JAM D;  1HH2 P;  2CXC A;  4R1M A;  4NDN A;  2DPL A;  2ONF A;  3NPD A;  3K6R A;  3R9W A;  1N32 C;  4ODJ A;  4I9F A;  1WF3 A;  4GKK C;  2NCL A;  1MDB A;  4LE5 A;  1WH9 A;  5AE1 A;  1MDF A;  1VEH A;  4MH4 A;  1N33 C;  2JMP A;  4LF9 C;  2PRO A;  1ML8 A;  4PZP A;  4G36 A;  3UZ0 A;  2MMA B;  1NY8 A;  4JV5 C;  3CW9 A;  1YJ7 A;  2ZZN A;  4TPS B;  2D28 C;  4JI5 C;  3IEV A;  2E8F A;  1IBL C;  5ADZ A;  5BSV A;  1QM4 A;  3NYR A;  5BSR A;  4JI2 C;  1USP A;  2MCQ A;  3SO4 A;  3S82 A;  4PUH A;  2HJG A;  3TQI A;  5LMU C;  3GR1 A;  4DV0 C;  1I94 C;  4GKJ C;  1K0R A;  4X66 C;  1AMU A;  3L8C A;  3T1Y C;  3LGX A;  3ETO A;  1TH5 A;  5BUS A;  4ZLP A;  5BSW A;  4IR7 A;  4RVO A;  4KHP C;  3FCE A;  4L2Z A;  5JRH A;  2UXB C;  3GKU A;  5AE3 A;  2Y4O A;  4KTT A;  4K0K C;  5BR8 C;  5CZX A;  4DCT A;  1XRB A;  2P2B A;  2EGT A;  3PBK A;  1P7L A;  3AF6 A;  4RVN A;  5BST A;  1FLO A;  5K8F A;  2M5H A;  1XNQ C;  2OO4 A;  4LFA C;  1MD9 A;  2QW0 X;  2Y27 A;  3E7W A;  1N36 C;  4PUI A;  4RM3 A;  2Y4N A;  1FJG C;  4LF8 C;  1M6X C;  1M6X A;  2VQE C;  1NYE A;  1XMO C;  4DCS A;  4DG8 A;  4PUG A;  2P2J A;  2P2F A;  2PN2 A;  1O93 A;  1P4E A;  3CJE A;  5A2Q D;  3TR3 A;  1EGA A;  1XRA A;  2WP0 C;  4JI1 C;  2D27 A;  1LCI A;  3PRO C;  2D7V A;  2D1S A;  2OPL A;  4DR6 C;  3IPL A;  1MXA A;  1IB8 A;  2DYJ A;  4JM1 A;  1PA4 A;  3IML A;  3IEU A;  3UX3 A;  4YY3 C;  2E8C A;  4DV7 C;  3A9V A;  4IZ6 A;  4KTV A;  1XRC A;  3J81 D;  2D1Q A;  1V26 A;  3H2T A;  2JNV A;  1UKK A;  2OBV A;  5H9U A;  4K0B A;  2ATW A;  3TDE A;  5A1I A;  4OX9 C;  3UX2 A;  3CW8 X;  3LNO A;  5T8T A;  5AE2 A;  2E0G A;  4FUQ A;  2VZE A;  4NXN C;  2VSQ A;  4B3T C;  2YCB A;  3PES A;  2ASB A;  5BSM A;  3I08 A;  4DR5 C;  5T8S A;  1L2F A;  4DCV A;  5K85 A;  3NYQ A;  3LAX A;  3GR0 A;  5KYV A;  4DR2 C;  4OYC A;  1RG9 A;  4D4I A;  4LFC C;  2P2Q A;  1IBM C;  1O92 A;  4D56 A;  2M5O A;  3LUS A;  3GPC A;  3O2E A;  4WV3 A;  3R44 A;  4AQY C;  4GXQ A;  2QVY X;  1N2F A;  2KDN A;  4JI4 C;  4PHT A;  2UXD C;  3E7X A;  1ZB8 A;  1T5D X;  3UOW A;  4LF5 C;  2PT7 G;  2UUC C;  1XNR C;  2E7G A;  2HHH C;  5IWA C;  5IT9 D;  3VNQ A;  2UUA C;  4DV1 C;  2P20 A;  1XMQ C; 
#chains in the Genus database with same CATH homology
 1BA3 A;  4HPV A;  1N34 C;  3N2Q A;  4BC7 A;  2YWC A;  1FUG A;  4LF6 C;  2QVZ X;  1PG4 A;  4ISB A;  4X64 C;  2KZF A;  2AYA A;  2BJO A;  4PRO C;  2YWB A;  4OXI A;  4JI0 C;  4RM2 A;  2P02 A;  2QVX X;  2XR1 A;  1ULT A;  1HNZ C;  3N54 B;  4EAT A;  2E8E A;  2OPL B;  3DAY A;  4B3S C;  4LFB C;  4JI7 C;  1LQL A;  4FTF A;  3G7S A;  1O9T A;  5BSU A;  3VNS A;  4DCU A;  2F4V C;  4JYA C;  1T5H X;  3ETC A;  5GTD A;  1HNW C;  4WS9 A;  4NXM C;  4RLF A;  4JI3 C;  4MTN A;  1PG3 A;  1VLA A;  1J5E C;  5A19 A;  2UU9 C;  3FCC A;  2V7B A;  4DR1 C;  2QL8 A;  4U5Y D;  1GPM A;  4DV2 C;  5CZV A;  4DV6 C;  4DUY C;  2CY1 A;  4DV5 C;  4I9G A;  3A4I A;  4X62 C;  3AF5 A;  1V25 A;  3R9X A;  4BCA A;  1MKY A;  4LF4 C;  4L4Q A;  3C5E A;  1MXC A;  4G1I A;  2D1T A;  4BC9 A;  4D4G A;  2UXC C;  5KEI A;  1JOS A;  4B3M C;  4RLQ A;  1IBK C;  1ZB9 A;  4BBY A;  5LMN C;  3I07 A;  1O90 A;  4NOZ A;  3T1H C;  4ZJZ A;  4DUZ C;  3VNR A;  1QWI A;  3OTO C;  2VQF C;  2D1R A;  3KXW A;  5IFI A;  2UUB C;  3EER A;  4GS5 A;  3DLP X;  5DV9 A;  4DV3 C;  5FLX D;  4R0M A;  4D57 A;  4BSZ A;  4YHH C;  3DHV A;  4GXR A;  1HNX C;  1HR0 C;  4JI8 C;  4R1L A;  2P2M A;  3TUF A;  3B7W A;  4XX2 A;  3EQ6 A;  4L7I A;  4LF7 C;  5BUR A;  3NI2 A;  4RMN A;  2E5L C;  5A1G A;  1RY2 A;  2WD9 A;  3A9U A;  4DG9 A;  3RV2 A;  4FUT A;  4DR3 C;  5E7Q A;  1USP B;  5KYT A;  3RG2 A;  4DR7 C;  3L95 X;  4G37 A;  4JI6 C;  3LNV A;  2ZM6 C;  1MXB A;  5BUQ A;  4DR4 C;  2BH1 X;  4DV4 C;  3J80 D;  1KKG A;  4X65 C;  4B3R C;  3JAM D;  1HH2 P;  2CXC A;  4R1M A;  4NDN A;  2DPL A;  2ONF A;  3NPD A;  3R9W A;  1N32 C;  4ODJ A;  4I9F A;  1WF3 A;  4GKK C;  1MDB A;  4LE5 A;  1WH9 A;  5AE1 A;  1MDF A;  4MH4 A;  1N33 C;  2JMP A;  4LF9 C;  2PRO A;  1ML8 A;  4PZP A;  4G36 A;  3UZ0 A;  4JV5 C;  3CW9 A;  1YJ7 A;  4TPS B;  2D28 C;  4JI5 C;  3IEV A;  2E8F A;  1IBL C;  5ADZ A;  5BSV A;  1QM4 A;  3NYR A;  5BSR A;  4JI2 C;  1USP A;  3SO4 A;  3S82 A;  2HJG A;  3TQI A;  5LMU C;  3GR1 A;  4DV0 C;  1I94 C;  4GKJ C;  1K0R A;  4X66 C;  1AMU A;  3L8C A;  3T1Y C;  3LGX A;  3ETO A;  5BUS A;  4ZLP A;  5BSW A;  4IR7 A;  4RVO A;  4KHP C;  3FCE A;  4L2Z A;  5JRH A;  2UXB C;  3GKU A;  5AE3 A;  2Y4O A;  4KTT A;  4K0K C;  5BR8 C;  5CZX A;  4DCT A;  1XRB A;  2P2B A;  2EGT A;  3PBK A;  1P7L A;  3AF6 A;  4RVN A;  5BST A;  5K8F A;  1XNQ C;  2OO4 A;  4LFA C;  1MD9 A;  2QW0 X;  2Y27 A;  3E7W A;  1N36 C;  4RM3 A;  2Y4N A;  1FJG C;  4LF8 C;  2VQE C;  1NYE A;  1XMO C;  4DCS A;  4DG8 A;  2P2J A;  2P2F A;  2PN2 A;  1O93 A;  3CJE A;  5A2Q D;  1EGA A;  1XRA A;  2WP0 C;  4JI1 C;  2D27 A;  1LCI A;  3PRO C;  2D7V A;  2D1S A;  2OPL A;  4DR6 C;  3IPL A;  1MXA A;  2DYJ A;  4JM1 A;  1PA4 A;  3IML A;  3IEU A;  4YY3 C;  2E8C A;  4DV7 C;  3A9V A;  4IZ6 A;  4KTV A;  1XRC A;  3J81 D;  2D1Q A;  1V26 A;  3H2T A;  1UKK A;  2OBV A;  5H9U A;  4K0B A;  2ATW A;  3TDE A;  5A1I A;  4OX9 C;  3CW8 X;  5T8T A;  5AE2 A;  2E0G A;  4FUQ A;  2VZE A;  4NXN C;  2VSQ A;  4B3T C;  2YCB A;  3PES A;  2ASB A;  5BSM A;  3I08 A;  4DR5 C;  5T8S A;  1L2F A;  4DCV A;  5K85 A;  3NYQ A;  3LAX A;  3GR0 A;  5KYV A;  4DR2 C;  4OYC A;  1RG9 A;  4D4I A;  4LFC C;  2P2Q A;  1IBM C;  1O92 A;  4D56 A;  3LUS A;  3GPC A;  4WV3 A;  3R44 A;  4AQY C;  4GXQ A;  2QVY X;  1N2F A;  4JI4 C;  4PHT A;  2UXD C;  3E7X A;  1ZB8 A;  1T5D X;  3UOW A;  4LF5 C;  2PT7 G;  2UUC C;  1XNR C;  2E7G A;  2HHH C;  5IWA C;  5IT9 D;  3VNQ A;  2UUA C;  4DV1 C;  2P20 A;  1XMQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...