5T8TA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
388
structure length
379
Chain Sequence
b'SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIADLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthase
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound AMP and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
total genus 129
structure length 379
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA03
1MXBA 1O93A 1O90A 5A1GA 1FUGA 4L4QA 1XRAA 1P7LA 3IMLA 2OBVA 4LE5A 5A1IA 1O92A 3A4IA 4L2ZA 3TDEA 3SO4A 4KTVA 4HPVA 2P02A 1MXAA 5T8TA 2YWCA 4K0BA 5A19A 4NDNA 4ODJA 3TQIA 1RG9A 2YWBA 3S82A 3UOWA 1MXCA 3RV2A 4KTTA 1O9TA 1GPMA 4WS9A 1XRCA 1QM4A 4L7IA 5H9UA 5T8SA 2DPLA 1XRBA
chains in the Genus database with same CATH superfamily
4JI0C 4BBYA 3LAXA 3GR1A 5BSMA 4LF4C 3TDEA 4XX2A 4JI1C 4HPVA 1M6XA 2PT7G 4ZLPA 1HNZC 3S82A 3AY0A 5BUQA 4JI7C 5GTDA 3L95X 3E7XA 2M5HA 4DCSA 4R0MA 4TPSB 4DV0C 4X64C 2PN2A 3L8CA 3IEVA 1HNXC 4LE5A 5A1IA 1NYEA 1IBLC 3PBKA 5KEIA 3UX3A 2UXCC 3PESA 5LCIA 3H2TA 2YX1A 4LFAC 2WD9A 1XMOC 5T8SA 4X65C 2E8CA 4JI5C 5KYVA 5JRHA 1ZB9A 5BSUA 2ZZMA 3NPDA 2MM9A 2UUBC 4DV7C 1XNRC 5BR8C 3NYQA 4JI2C 4D57A 3IEUA 4GXQA 2Z51A 5A2QD 4KTTA 2E8FA 3OTOC 3LUSA 4DV6C 5BSVA 3NI2A 4IR7A 2MMAB 3TR3A 4LF7C 2HJGA 1XRAA 3RG2A 1RY2A 4PHTA 2DHMA 3N2QA 4YY3C 4DR5C 2P2JA 2VZEA 1MDBA 3SO4A 1VEHA 1IBMC 5A19A 4DV2C 4DV3C 3C5EA 4PUIA 4DR7C 3A9VA 4RLQA 5IWAC 4YHHC 1PG3A 5IT9D 4B3RC 5E7QA 3EQ6A 4RVNA 4DG9A 5A1GA 5BSTA 4BC9A 4DG8A 3NYRA 1O92A 4DR6C 2UXBC 2QW0X 4DV5C 4K0BA 5K8FA 1GPMA 4JI3C 1XRCA 1QM4A 5DV9A 4MH4A 1LQLA 1V60A 4U5YD 3JAMD 1XNQC 1HNWC 4B3TC 2E0GA 3J80D 4K0KC 4NDNA 3TQIA 1USPB 2Y4OA 4RM2A 1N33C 2HHHC 4GS5A 2QVZX 4DCTA 2EGTA 1WF3A 3I08A 2P20A 2OPLA 3UEBA 1UWDA 3T1HC 2YCBA 3GR0A 3N54B 5AE2A 5AE3A 1WH9A 4OYCA 2QVYX 4ZJZA 4KTVA 4ODJA 1N2FA 2V7BA 1XHJA 1RG9A 3G7SA 4DR2C 3RV2A 5AE1A 2UXDC 4JV5C 1HR0C 1HH2P 2ATWA 1L2FA 5KYTA 2JMPA 2UU9C 1MD9A 2ONFA 3DLPX 2D1QA 1T5DX 2ASBA 4L2ZA 2E8EA 5T8TA 3UZ0A 2CY1A 3R9WA 4AQYC 4JYAC 2ZZNA 3CW9A 4RMNA 2D28C 1EGAA 3E7WA 4B3MC 1LCIA 2D7VA 3CW8X 2D27A 2UUCC 2BH1X 2QL8A 1MKYA 4GKJC 1N36C 5BSWA 1JOSA 4BC7A 3DHVA 5BSRA 2DPLA 4B3SC 2JNVA 2KZ0A 2P2BA 4LFBC 2D1RA 1FJGC 1FUGA 4L4QA 3R9XA 4NXNC 4LF9C 4DV1C 1ML8A 3A4IA 4G1IA 3I07A 4X66C 2P02A 4DCUA 2Y4NA 2PROA 4OX9C 4LF8C 2P2MA 4DUYC 4D56A 2VQEC 3LNOA 1ZB8A 3CQ3A 1ULTA 3CQ2A 3EERA 2M5OA 4EATA 4MTNA 1K0RA 4PUHA 1KKGA 2ZM6C 1P7LA 5IFIA 1VLAA 4DV4C 1PU1A 3LGXA 2D1SA 1MXAA 2YWCA 1QWIA 4FTFA 4R1MA 1MDFA 4FUTA 4I9GA 1J5EC 1O9TA 3DAYA 5H9UA 2XR1A 3K6RA 1BA3A 3A25A 5ADZA 2KDNA 3CJEA 1IB8A 2D1TA 3FCCA 4DR1C 2BJOA 1PG4A 2WP0C 1V26A 3O2EA 3A9UA 4ISBA 2E5LC 4I9FA 1NY8A 4DR3C 2DYJA 1MXCA 3VNSA 3VNQA 4JI8C 4GKKC 5BUSA 3T1YC 2MCQA 4WV3A 3IPLA 3VNRA 2E7GA 1TH5A 3R44A 4G36A 4JM1A 4IZ6A 1V25A 1IBKC 1M6XC 4D4IA 2VQFC 5LMUC 4NOZA 1PA4A 5FLXD 2VSQA 3AF5A 4X62C 4LF6C 3J81D 2AYAA 3PROC 4DR4C 4L7IA 1N34C 4DCVA 2QVXX 5CZXA 1AMUA 4FUQA 4BSZA 2F4VC 2UUAC 3IMLA 2OBVA 2OPLB 2Y27A 3ETCA 1WCJA 5LMNC 3GKUA 3ETOA 2P2FA 4NXMC 4D4GA 1T5HX 4G37A 4LF5C 2KZFA 4PZPA 4RM3A 1O93A 4RLFA 1O90A 1I94C 3A26A 1P4EA 3TUFA 4LFCC 4OXIA 3FCEA 1USPA 3AF6A 2P2QA 5BURA 3KXWA 2YWBA 4GXRA 3UOWA 5CZVA 4DUZC 4PUGA 3GPCA 1YJ7A 3B7WA 2CXCA 1P4EC 4R1LA 4BCAA 1FLOA 1MXBA 2CU6A 1UKKA 1N32C 4JI6C 3LNVA 4KHPC 1XMQC 4PROC 3UX2A 5K85A 4JI4C 4RVOA 4WS9A 2OO4A 2NCLA 1XS3A 1XRBA 3CQ1A
chains in the Genus database with same CATH topology
4JI0C 4BBYA 3LAXA 3GR1A 5BSMA 4LF4C 3TDEA 4XX2A 4JI1C 4HPVA 2PT7G 4ZLPA 1HNZC 3S82A 5BUQA 4JI7C 5GTDA 3L95X 3E7XA 4DCSA 4R0MA 4TPSB 4DV0C 4X64C 2PN2A 3L8CA 3IEVA 1HNXC 4LE5A 5A1IA 1NYEA 1IBLC 3PBKA 5KEIA 2UXCC 3PESA 3H2TA 4LFAC 2WD9A 1XMOC 5T8SA 4X65C 2E8CA 4JI5C 5KYVA 5JRHA 1ZB9A 5BSUA 3NPDA 2UUBC 4DV7C 1XNRC 5BR8C 3NYQA 4JI2C 4D57A 3IEUA 4GXQA 5A2QD 4KTTA 2E8FA 3OTOC 3LUSA 4DV6C 5BSVA 3NI2A 4IR7A 4LF7C 2HJGA 1XRAA 3RG2A 1RY2A 4PHTA 4YY3C 4DR5C 3N2QA 2P2JA 2VZEA 1MDBA 3SO4A 1IBMC 5A19A 4DV2C 4DV3C 3C5EA 4DR7C 3A9VA 4RLQA 5IWAC 4YHHC 1PG3A 5IT9D 4B3RC 5E7QA 3EQ6A 4RVNA 4DG9A 5A1GA 5BSTA 4BC9A 4DG8A 3NYRA 1O92A 4DR6C 2UXBC 2QW0X 4DV5C 4K0BA 5K8FA 1GPMA 4JI3C 1XRCA 1QM4A 5DV9A 4MH4A 1LQLA 4U5YD 3JAMD 1XNQC 1HNWC 4B3TC 2E0GA 3J80D 4K0KC 4NDNA 3TQIA 1USPB 2Y4OA 4RM2A 1N33C 2HHHC 4GS5A 2QVZX 2EGTA 4DCTA 1WF3A 3I08A 2P20A 2OPLA 3T1HC 2YCBA 3GR0A 3N54B 5AE2A 5AE3A 1WH9A 4OYCA 2QVYX 4ZJZA 4KTVA 1N2FA 4DR2C 2V7BA 3G7SA 1RG9A 4ODJA 3RV2A 5AE1A 2UXDC 4JV5C 1HR0C 1HH2P 2ATWA 1L2FA 5KYTA 2JMPA 2UU9C 1MD9A 2ONFA 3DLPX 2D1QA 1T5DX 2ASBA 4L2ZA 2E8EA 5T8TA 3UZ0A 2CY1A 3R9WA 4AQYC 4JYAC 3CW9A 4RMNA 2D28C 1EGAA 3E7WA 4B3MC 1LCIA 2D7VA 3CW8X 2D27A 2UUCC 2BH1X 2QL8A 1MKYA 4GKJC 1N36C 5BSWA 1JOSA 4BC7A 3DHVA 5BSRA 2DPLA 4B3SC 2P2BA 4LFBC 2D1RA 1FJGC 1FUGA 4L4QA 3R9XA 4NXNC 4LF9C 4DV1C 1ML8A 3A4IA 4G1IA 3I07A 4X66C 2P02A 4DCUA 2Y4NA 2PROA 4OX9C 4LF8C 2P2MA 4DUYC 4D56A 2VQEC 1ZB8A 1ULTA 3EERA 4EATA 4MTNA 1K0RA 1KKGA 2ZM6C 1P7LA 5IFIA 1VLAA 4DV4C 3LGXA 2D1SA 1MXAA 2YWCA 1QWIA 4FTFA 4R1MA 1MDFA 4FUTA 4I9GA 1J5EC 1O9TA 3DAYA 5H9UA 2XR1A 1BA3A 5ADZA 3CJEA 2D1TA 3FCCA 4DR1C 2BJOA 1PG4A 2WP0C 1V26A 3A9UA 4ISBA 2E5LC 4I9FA 4DR3C 2DYJA 1MXCA 3VNSA 3VNQA 4JI8C 4GKKC 5BUSA 3T1YC 4WV3A 3IPLA 3VNRA 2E7GA 3R44A 4G36A 4JM1A 4IZ6A 1V25A 1IBKC 4D4IA 2VQFC 5LMUC 4NOZA 1PA4A 5FLXD 2VSQA 3AF5A 4X62C 4LF6C 3J81D 2AYAA 3PROC 4DR4C 4L7IA 1N34C 4DCVA 2QVXX 5CZXA 1AMUA 4FUQA 4BSZA 2F4VC 2UUAC 3IMLA 2OBVA 2OPLB 2Y27A 3ETCA 5LMNC 3GKUA 3ETOA 2P2FA 4NXMC 4D4GA 1T5HX 4G37A 4LF5C 2KZFA 4PZPA 4RM3A 1O93A 4RLFA 1O90A 1I94C 3TUFA 4LFCC 4OXIA 3FCEA 1USPA 3AF6A 2P2QA 5BURA 3KXWA 2YWBA 4GXRA 3UOWA 5CZVA 4DUZC 3GPCA 1YJ7A 3B7WA 2CXCA 4R1LA 4BCAA 1MXBA 1UKKA 1N32C 4JI6C 3LNVA 4KHPC 1XMQC 4PROC 5K85A 4JI4C 4RVOA 4WS9A 2OO4A 1XRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXB A;  1O93 A;  1O90 A;  5A1G A;  1FUG A;  4L4Q A;  1XRA A;  1P7L A;  3IML A;  2OBV A;  4LE5 A;  5A1I A;  1O92 A;  3A4I A;  4L2Z A;  3TDE A;  3SO4 A;  4KTV A;  4HPV A;  2P02 A;  1MXA A;  5T8T A;  2YWC A;  4K0B A;  5A19 A;  4NDN A;  4ODJ A;  3TQI A;  1RG9 A;  2YWB A;  3S82 A;  3UOW A;  1MXC A;  3RV2 A;  4KTT A;  1O9T A;  1GPM A;  4WS9 A;  1XRC A;  1QM4 A;  4L7I A;  5H9U A;  5T8S A;  2DPL A;  1XRB A; 
#chains in the Genus database with same CATH topology
 4JI0 C;  4BBY A;  3LAX A;  3GR1 A;  5BSM A;  4LF4 C;  3TDE A;  4XX2 A;  4JI1 C;  4HPV A;  1M6X A;  2PT7 G;  4ZLP A;  1HNZ C;  3S82 A;  3AY0 A;  5BUQ A;  4JI7 C;  5GTD A;  3L95 X;  3E7X A;  2M5H A;  4DCS A;  4R0M A;  4TPS B;  4DV0 C;  4X64 C;  2PN2 A;  3L8C A;  3IEV A;  1HNX C;  4LE5 A;  5A1I A;  1NYE A;  1IBL C;  3PBK A;  5KEI A;  3UX3 A;  2UXC C;  3PES A;  5LCI A;  3H2T A;  2YX1 A;  4LFA C;  2WD9 A;  1XMO C;  5T8S A;  4X65 C;  2E8C A;  4JI5 C;  5KYV A;  5JRH A;  1ZB9 A;  5BSU A;  2ZZM A;  3NPD A;  2MM9 A;  2UUB C;  4DV7 C;  1XNR C;  5BR8 C;  3NYQ A;  4JI2 C;  4D57 A;  3IEU A;  4GXQ A;  2Z51 A;  5A2Q D;  4KTT A;  2E8F A;  3OTO C;  3LUS A;  4DV6 C;  5BSV A;  3NI2 A;  4IR7 A;  2MMA B;  3TR3 A;  4LF7 C;  2HJG A;  1XRA A;  3RG2 A;  1RY2 A;  4PHT A;  2DHM A;  3N2Q A;  4YY3 C;  4DR5 C;  2P2J A;  2VZE A;  1MDB A;  3SO4 A;  1VEH A;  1IBM C;  5A19 A;  4DV2 C;  4DV3 C;  3C5E A;  4PUI A;  4DR7 C;  3A9V A;  4RLQ A;  5IWA C;  4YHH C;  1PG3 A;  5IT9 D;  4B3R C;  5E7Q A;  3EQ6 A;  4RVN A;  4DG9 A;  5A1G A;  5BST A;  4BC9 A;  4DG8 A;  3NYR A;  1O92 A;  4DR6 C;  2UXB C;  2QW0 X;  4DV5 C;  4K0B A;  5K8F A;  1GPM A;  4JI3 C;  1XRC A;  1QM4 A;  5DV9 A;  4MH4 A;  1LQL A;  1V60 A;  4U5Y D;  3JAM D;  1XNQ C;  1HNW C;  4B3T C;  2E0G A;  3J80 D;  4K0K C;  4NDN A;  3TQI A;  1USP B;  2Y4O A;  4RM2 A;  1N33 C;  2HHH C;  4GS5 A;  2QVZ X;  4DCT A;  2EGT A;  1WF3 A;  3I08 A;  2P20 A;  2OPL A;  3UEB A;  1UWD A;  3T1H C;  2YCB A;  3GR0 A;  3N54 B;  5AE2 A;  5AE3 A;  1WH9 A;  4OYC A;  2QVY X;  4ZJZ A;  4KTV A;  4ODJ A;  1N2F A;  2V7B A;  1XHJ A;  1RG9 A;  3G7S A;  4DR2 C;  3RV2 A;  5AE1 A;  2UXD C;  4JV5 C;  1HR0 C;  1HH2 P;  2ATW A;  1L2F A;  5KYT A;  2JMP A;  2UU9 C;  1MD9 A;  2ONF A;  3DLP X;  2D1Q A;  1T5D X;  2ASB A;  4L2Z A;  2E8E A;  5T8T A;  3UZ0 A;  2CY1 A;  3R9W A;  4AQY C;  4JYA C;  2ZZN A;  3CW9 A;  4RMN A;  2D28 C;  1EGA A;  3E7W A;  4B3M C;  1LCI A;  2D7V A;  3CW8 X;  2D27 A;  2UUC C;  2BH1 X;  2QL8 A;  1MKY A;  4GKJ C;  1N36 C;  5BSW A;  1JOS A;  4BC7 A;  3DHV A;  5BSR A;  2DPL A;  4B3S C;  2JNV A;  2KZ0 A;  2P2B A;  4LFB C;  2D1R A;  1FJG C;  1FUG A;  4L4Q A;  3R9X A;  4NXN C;  4LF9 C;  4DV1 C;  1ML8 A;  3A4I A;  4G1I A;  3I07 A;  4X66 C;  2P02 A;  4DCU A;  2Y4N A;  2PRO A;  4OX9 C;  4LF8 C;  2P2M A;  4DUY C;  4D56 A;  2VQE C;  3LNO A;  1ZB8 A;  3CQ3 A;  1ULT A;  3CQ2 A;  3EER A;  2M5O A;  4EAT A;  4MTN A;  1K0R A;  4PUH A;  1KKG A;  2ZM6 C;  1P7L A;  5IFI A;  1VLA A;  4DV4 C;  1PU1 A;  3LGX A;  2D1S A;  1MXA A;  2YWC A;  1QWI A;  4FTF A;  4R1M A;  1MDF A;  4FUT A;  4I9G A;  1J5E C;  1O9T A;  3DAY A;  5H9U A;  2XR1 A;  3K6R A;  1BA3 A;  3A25 A;  5ADZ A;  2KDN A;  3CJE A;  1IB8 A;  2D1T A;  3FCC A;  4DR1 C;  2BJO A;  1PG4 A;  2WP0 C;  1V26 A;  3O2E A;  3A9U A;  4ISB A;  2E5L C;  4I9F A;  1NY8 A;  4DR3 C;  2DYJ A;  1MXC A;  3VNS A;  3VNQ A;  4JI8 C;  4GKK C;  5BUS A;  3T1Y C;  2MCQ A;  4WV3 A;  3IPL A;  3VNR A;  2E7G A;  1TH5 A;  3R44 A;  4G36 A;  4JM1 A;  4IZ6 A;  1V25 A;  1IBK C;  1M6X C;  4D4I A;  2VQF C;  5LMU C;  4NOZ A;  1PA4 A;  5FLX D;  2VSQ A;  3AF5 A;  4X62 C;  4LF6 C;  3J81 D;  2AYA A;  3PRO C;  4DR4 C;  4L7I A;  1N34 C;  4DCV A;  2QVX X;  5CZX A;  1AMU A;  4FUQ A;  4BSZ A;  2F4V C;  2UUA C;  3IML A;  2OBV A;  2OPL B;  2Y27 A;  3ETC A;  1WCJ A;  5LMN C;  3GKU A;  3ETO A;  2P2F A;  4NXM C;  4D4G A;  1T5H X;  4G37 A;  4LF5 C;  2KZF A;  4PZP A;  4RM3 A;  1O93 A;  4RLF A;  1O90 A;  1I94 C;  3A26 A;  1P4E A;  3TUF A;  4LFC C;  4OXI A;  3FCE A;  1USP A;  3AF6 A;  2P2Q A;  5BUR A;  3KXW A;  2YWB A;  4GXR A;  3UOW A;  5CZV A;  4DUZ C;  4PUG A;  3GPC A;  1YJ7 A;  3B7W A;  2CXC A;  1P4E C;  4R1L A;  4BCA A;  1FLO A;  1MXB A;  2CU6 A;  1UKK A;  1N32 C;  4JI6 C;  3LNV A;  4KHP C;  1XMQ C;  4PRO C;  3UX2 A;  5K85 A;  4JI4 C;  4RVO A;  4WS9 A;  2OO4 A;  2NCL A;  1XS3 A;  1XRB A;  3CQ1 A; 
#chains in the Genus database with same CATH homology
 4JI0 C;  4BBY A;  3LAX A;  3GR1 A;  5BSM A;  4LF4 C;  3TDE A;  4XX2 A;  4JI1 C;  4HPV A;  2PT7 G;  4ZLP A;  1HNZ C;  3S82 A;  5BUQ A;  4JI7 C;  5GTD A;  3L95 X;  3E7X A;  4DCS A;  4R0M A;  4TPS B;  4DV0 C;  4X64 C;  2PN2 A;  3L8C A;  3IEV A;  1HNX C;  4LE5 A;  5A1I A;  1NYE A;  1IBL C;  3PBK A;  5KEI A;  2UXC C;  3PES A;  3H2T A;  4LFA C;  2WD9 A;  1XMO C;  5T8S A;  4X65 C;  2E8C A;  4JI5 C;  5KYV A;  5JRH A;  1ZB9 A;  5BSU A;  3NPD A;  2UUB C;  4DV7 C;  1XNR C;  5BR8 C;  3NYQ A;  4JI2 C;  4D57 A;  3IEU A;  4GXQ A;  5A2Q D;  4KTT A;  2E8F A;  3OTO C;  3LUS A;  4DV6 C;  5BSV A;  3NI2 A;  4IR7 A;  4LF7 C;  2HJG A;  1XRA A;  3RG2 A;  1RY2 A;  4PHT A;  4YY3 C;  4DR5 C;  3N2Q A;  2P2J A;  2VZE A;  1MDB A;  3SO4 A;  1IBM C;  5A19 A;  4DV2 C;  4DV3 C;  3C5E A;  4DR7 C;  3A9V A;  4RLQ A;  5IWA C;  4YHH C;  1PG3 A;  5IT9 D;  4B3R C;  5E7Q A;  3EQ6 A;  4RVN A;  4DG9 A;  5A1G A;  5BST A;  4BC9 A;  4DG8 A;  3NYR A;  1O92 A;  4DR6 C;  2UXB C;  2QW0 X;  4DV5 C;  4K0B A;  5K8F A;  1GPM A;  4JI3 C;  1XRC A;  1QM4 A;  5DV9 A;  4MH4 A;  1LQL A;  4U5Y D;  3JAM D;  1XNQ C;  1HNW C;  4B3T C;  2E0G A;  3J80 D;  4K0K C;  4NDN A;  3TQI A;  1USP B;  2Y4O A;  4RM2 A;  1N33 C;  2HHH C;  4GS5 A;  2QVZ X;  2EGT A;  4DCT A;  1WF3 A;  3I08 A;  2P20 A;  2OPL A;  3T1H C;  2YCB A;  3GR0 A;  3N54 B;  5AE2 A;  5AE3 A;  1WH9 A;  4OYC A;  2QVY X;  4ZJZ A;  4KTV A;  1N2F A;  4DR2 C;  2V7B A;  3G7S A;  1RG9 A;  4ODJ A;  3RV2 A;  5AE1 A;  2UXD C;  4JV5 C;  1HR0 C;  1HH2 P;  2ATW A;  1L2F A;  5KYT A;  2JMP A;  2UU9 C;  1MD9 A;  2ONF A;  3DLP X;  2D1Q A;  1T5D X;  2ASB A;  4L2Z A;  2E8E A;  5T8T A;  3UZ0 A;  2CY1 A;  3R9W A;  4AQY C;  4JYA C;  3CW9 A;  4RMN A;  2D28 C;  1EGA A;  3E7W A;  4B3M C;  1LCI A;  2D7V A;  3CW8 X;  2D27 A;  2UUC C;  2BH1 X;  2QL8 A;  1MKY A;  4GKJ C;  1N36 C;  5BSW A;  1JOS A;  4BC7 A;  3DHV A;  5BSR A;  2DPL A;  4B3S C;  2P2B A;  4LFB C;  2D1R A;  1FJG C;  1FUG A;  4L4Q A;  3R9X A;  4NXN C;  4LF9 C;  4DV1 C;  1ML8 A;  3A4I A;  4G1I A;  3I07 A;  4X66 C;  2P02 A;  4DCU A;  2Y4N A;  2PRO A;  4OX9 C;  4LF8 C;  2P2M A;  4DUY C;  4D56 A;  2VQE C;  1ZB8 A;  1ULT A;  3EER A;  4EAT A;  4MTN A;  1K0R A;  1KKG A;  2ZM6 C;  1P7L A;  5IFI A;  1VLA A;  4DV4 C;  3LGX A;  2D1S A;  1MXA A;  2YWC A;  1QWI A;  4FTF A;  4R1M A;  1MDF A;  4FUT A;  4I9G A;  1J5E C;  1O9T A;  3DAY A;  5H9U A;  2XR1 A;  1BA3 A;  5ADZ A;  3CJE A;  2D1T A;  3FCC A;  4DR1 C;  2BJO A;  1PG4 A;  2WP0 C;  1V26 A;  3A9U A;  4ISB A;  2E5L C;  4I9F A;  4DR3 C;  2DYJ A;  1MXC A;  3VNS A;  3VNQ A;  4JI8 C;  4GKK C;  5BUS A;  3T1Y C;  4WV3 A;  3IPL A;  3VNR A;  2E7G A;  3R44 A;  4G36 A;  4JM1 A;  4IZ6 A;  1V25 A;  1IBK C;  4D4I A;  2VQF C;  5LMU C;  4NOZ A;  1PA4 A;  5FLX D;  2VSQ A;  3AF5 A;  4X62 C;  4LF6 C;  3J81 D;  2AYA A;  3PRO C;  4DR4 C;  4L7I A;  1N34 C;  4DCV A;  2QVX X;  5CZX A;  1AMU A;  4FUQ A;  4BSZ A;  2F4V C;  2UUA C;  3IML A;  2OBV A;  2OPL B;  2Y27 A;  3ETC A;  5LMN C;  3GKU A;  3ETO A;  2P2F A;  4NXM C;  4D4G A;  1T5H X;  4G37 A;  4LF5 C;  2KZF A;  4PZP A;  4RM3 A;  1O93 A;  4RLF A;  1O90 A;  1I94 C;  3TUF A;  4LFC C;  4OXI A;  3FCE A;  1USP A;  3AF6 A;  2P2Q A;  5BUR A;  3KXW A;  2YWB A;  4GXR A;  3UOW A;  5CZV A;  4DUZ C;  3GPC A;  1YJ7 A;  3B7W A;  2CXC A;  4R1L A;  4BCA A;  1MXB A;  1UKK A;  1N32 C;  4JI6 C;  3LNV A;  4KHP C;  1XMQ C;  4PRO C;  5K85 A;  4JI4 C;  4RVO A;  4WS9 A;  2OO4 A;  1XRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...