5T8TA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
388
structure length
379
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIADLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthase
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound AMP and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
total genus 129
structure length 379
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA03
3IMLA 5H9UA 3UOWA 3S82A 2YWCA 1O93A 1MXCA 3SO4A 4L2ZA 4ODJA 5T8TA 1MXAA 1GPMA 1P7LA 3TDEA 1MXBA 3TQIA 4KTTA 2YWBA 2P02A 1XRCA 2OBVA 1RG9A 1XRBA 4NDNA 5T8SA 1FUGA 4WS9A 1O90A 4LE5A 5A19A 4HPVA 4L4QA 5A1GA 5A1IA 2DPLA 4KTVA 4L7IA 1QM4A 3RV2A 3A4IA 1O92A 1O9TA 1XRAA 4K0BA
chains in the Genus database with same CATH superfamily
4LFCC 2D27A 4JI2C 3GR0A 3I08A 3A9VA 5KYVA 4JI4C 5JRHA 5T8SA 2CU6A 2MM9A 5K85A 1J5EC 1LCIA 2QW0X 3PESA 1PA4A 1QM4A 5IT9D 2QVYX 1IBMC 1RY2A 4D4GA 5LMUC 4IR7A 1TH5A 2MCQA 4DCUA 4GXRA 4GKJC 2KDNA 5CZXA 4FUQA 3T1HC 5AE1A 3IEVA 2BH1X 1N33C 1NY8A 1RG9A 3AY0A 5ADZA 5K8FA 4JI6C 2E8FA 2CXCA 1O92A 2VSQA 2YWCA 4TPSB 2V7BA 3E7XA 4NXMC 3OTOC 4ZLPA 2D7VA 2WD9A 4DV0C 3FCEA 3ETOA 2M5HA 2ATWA 4DV7C 1AMUA 3R9WA 5BUSA 5BSMA 1BA3A 5LMNC 1XRAA 4X62C 4DCTA 4DUYC 1IBKC 2Y27A 1XMQC 1PG4A 4JM1A 2XR1A 1P7LA 1L2FA 3EQ6A 4K0KC 4BCAA 5LCIA 3TR3A 3UZ0A 4DV2C 1T5DX 2P02A 2QVXX 1ULTA 3CQ2A 3LNOA 3R44A 4R1LA 1HNWC 4KHPC 4LF4C 3GKUA 4RMNA 3VNRA 4PZPA 1XHJA 3AF6A 4RLQA 4FUTA 1LQLA 4LFAC 5BSUA 2E5LC 2PN2A 4KTTA 2UUBC 4LF5C 1XRBA 1O90A 5A1IA 1WH9A 3R9XA 5KYTA 2NCLA 5GTDA 1USPA 4DG8A 3J81D 3IMLA 3ETCA 2E7GA 2VZEA 5T8TA 2F4VC 3DAYA 5BSWA 2Z51A 3EERA 4DR5C 1VEHA 1MXBA 4X66C 3GR1A 3LAXA 4PUGA 1ML8A 5FLXD 5A2QD 1VLAA 4DV6C 4LFBC 4DV1C 3RV2A 4JI3C 2D1RA 3A4IA 2AYAA 3L95X 4MTNA 2PROA 4IZ6A 3GPCA 4GXQA 4DR3C 2UUAC 3NPDA 2KZ0A 1V26A 3S82A 1MXCA 4XX2A 4JV5C 3TUFA 3NYRA 3TDEA 1N36C 4NOZA 4RVOA 2ZM6C 1N2FA 3LGXA 4NDNA 1FLOA 1HH2P 4RLFA 4U5YD 2CY1A 4RM2A 3IPLA 4DV4C 4BC7A 4KTVA 1P4EC 5AE3A 1USPB 3FCCA 4RM3A 2UXBC 4GS5A 2E8EA 4LF9C 3SO4A 5BSRA 2Y4NA 3A9UA 3IEUA 1XMOC 4X64C 1M6XC 4BSZA 3VNQA 2WP0C 2KZFA 2UXDC 4R0MA 2P2QA 4D56A 3RG2A 3N54B 4OXIA 3CW8X 3UOWA 2M5OA 5IWAC 3UEBA 1XNRC 1GPMA 1N34C 4I9GA 2P2FA 4DR4C 4YHHC 2EGTA 2OBVA 1P4EA 4PUHA 2BJOA 4LE5A 4JI7C 3NI2A 1T5HX 3CJEA 4G37A 3KXWA 3DLPX 2HJGA 1M6XA 5A1GA 4X65C 4B3MC 1IBLC 5KEIA 3J80D 1MD9A 3C5EA 4MH4A 4DV5C 4PUIA 2OO4A 2D1QA 1XNQC 4GKKC 4HPVA 1KKGA 1UKKA 4ZJZA 1EGAA 5IFIA 1O9TA 3K6RA 5CZVA 3I07A 2DYJA 4JI5C 1K0RA 1UWDA 2ASBA 2ZZMA 4D57A 2VQFC 2UXCC 4D4IA 3PBKA 1V25A 1YJ7A 3AF5A 2D1TA 5BSTA 4BBYA 5E7QA 4I9FA 1FUGA 2DHMA 3CQ1A 5A19A 3E7WA 2E8CA 4L7IA 5BR8C 1HNZC 4ISBA 1WCJA 4R1MA 4OX9C 2QL8A 2UU9C 2YWBA 3VNSA 1IB8A 1N32C 1NYEA 3T1YC 2OPLB 3H2TA 4G1IA 4JI8C 3A26A 2JNVA 2ONFA 4LF7C 1WF3A 4OYCA 4DCSA 1O93A 3CQ3A 4ODJA 5BSVA 2P2MA 3PROC 4LF6C 3L8CA 3CW9A 1JOSA 1V60A 2ZZNA 2VQEC 1FJGC 3O2EA 4K0BA 5H9UA 1PG3A 4JI0C 4DUZC 3LUSA 2YCBA 3JAMD 2P20A 4EATA 3LNVA 2QVZX 1MKYA 2P2JA 2P2BA 2MMAB 4WS9A 5DV9A 4DV3C 4WV3A 4DR6C 1HR0C 4DR1C 1ZB9A 4JI1C 4YY3C 4LF8C 1MDFA 4DG9A 1PU1A 2HHHC 1MDBA 4JYAC 5BUQA 2YX1A 1HNXC 2D1SA 4PROC 1XRCA 4G36A 1QWIA 2OPLA 4FTFA 2DPLA 3B7WA 3NYQA 5AE2A 4RVNA 4NXNC 1ZB8A 3G7SA 4B3SC 4B3TC 2E0GA 2JMPA 4L2ZA 4PHTA 1MXAA 2Y4OA 3TQIA 3UX2A 3DHVA 4DR2C 2UUCC 4B3RC 3A25A 3UX3A 4L4QA 4AQYC 4BC9A 3N2QA 1I94C 4DR7C 2PT7G 5BURA 2D28C 4DCVA 1XS3A
chains in the Genus database with same CATH topology
4LFCC 2D27A 4JI2C 3GR0A 3I08A 3A9VA 5KYVA 4JI4C 5JRHA 5T8SA 5K85A 1J5EC 1LCIA 2QW0X 3PESA 1PA4A 1QM4A 5IT9D 2QVYX 1IBMC 1RY2A 4D4GA 5LMUC 4IR7A 4DCUA 4GXRA 4GKJC 5CZXA 4FUQA 3T1HC 5AE1A 3IEVA 2BH1X 1N33C 1RG9A 5ADZA 5K8FA 4JI6C 2E8FA 2CXCA 1O92A 2VSQA 2YWCA 4TPSB 2V7BA 3E7XA 4NXMC 3OTOC 4ZLPA 2D7VA 2WD9A 4DV0C 3FCEA 3ETOA 2ATWA 4DV7C 1AMUA 3R9WA 5BUSA 5BSMA 1BA3A 5LMNC 1XRAA 4X62C 4DCTA 4DUYC 1IBKC 2Y27A 1XMQC 1PG4A 4JM1A 2XR1A 1P7LA 1L2FA 3EQ6A 4K0KC 4BCAA 3UZ0A 4DV2C 1T5DX 2P02A 2QVXX 1ULTA 3R44A 4R1LA 1HNWC 4KHPC 4LF4C 3GKUA 4RMNA 3VNRA 4PZPA 3AF6A 4RLQA 4FUTA 1LQLA 4LFAC 5BSUA 2E5LC 2PN2A 4KTTA 2UUBC 4LF5C 1XRBA 1O90A 5A1IA 1WH9A 3R9XA 5KYTA 5GTDA 1USPA 4DG8A 3J81D 3IMLA 3ETCA 2E7GA 2VZEA 5T8TA 2F4VC 3DAYA 5BSWA 3EERA 4DR5C 1MXBA 4X66C 3GR1A 3LAXA 1ML8A 5FLXD 5A2QD 1VLAA 4DV6C 4LFBC 4DV1C 3RV2A 4JI3C 2D1RA 3A4IA 2AYAA 3L95X 4MTNA 2PROA 4IZ6A 3GPCA 4GXQA 4DR3C 2UUAC 3NPDA 1V26A 3S82A 1MXCA 4XX2A 4JV5C 3TUFA 3NYRA 3TDEA 1N36C 4NOZA 4RVOA 2ZM6C 1N2FA 3LGXA 4NDNA 1HH2P 4RLFA 4U5YD 2CY1A 4RM2A 3IPLA 4DV4C 4BC7A 4KTVA 5AE3A 1USPB 3FCCA 4RM3A 2UXBC 4GS5A 2E8EA 4LF9C 3SO4A 5BSRA 2Y4NA 3A9UA 3IEUA 1XMOC 4X64C 4BSZA 3VNQA 2WP0C 2KZFA 2UXDC 4R0MA 2P2QA 4D56A 3RG2A 3N54B 4OXIA 3CW8X 3UOWA 5IWAC 1XNRC 1GPMA 1N34C 4I9GA 2P2FA 4DR4C 4YHHC 2EGTA 2OBVA 2BJOA 4LE5A 4JI7C 3NI2A 1T5HX 3CJEA 4G37A 3KXWA 3DLPX 2HJGA 5A1GA 4X65C 4B3MC 1IBLC 5KEIA 3J80D 1MD9A 3C5EA 4MH4A 4DV5C 2OO4A 2D1QA 1XNQC 4GKKC 4HPVA 1KKGA 1UKKA 4ZJZA 1EGAA 5IFIA 1O9TA 5CZVA 3I07A 2DYJA 4JI5C 1K0RA 2ASBA 4D57A 2VQFC 2UXCC 4D4IA 3PBKA 1V25A 1YJ7A 3AF5A 2D1TA 5BSTA 4BBYA 5E7QA 4I9FA 1FUGA 5A19A 3E7WA 2E8CA 4L7IA 5BR8C 1HNZC 4ISBA 4R1MA 4OX9C 2QL8A 2UU9C 2YWBA 3VNSA 1N32C 1NYEA 3T1YC 2OPLB 3H2TA 4G1IA 4JI8C 2ONFA 4LF7C 1WF3A 4OYCA 4DCSA 1O93A 4ODJA 5BSVA 2P2MA 3PROC 4LF6C 3L8CA 3CW9A 1JOSA 2VQEC 1FJGC 4K0BA 5H9UA 1PG3A 4JI0C 4DUZC 3LUSA 2YCBA 3JAMD 2P20A 4EATA 3LNVA 2QVZX 1MKYA 2P2JA 2P2BA 4WS9A 5DV9A 4DV3C 4WV3A 4DR6C 1HR0C 4DR1C 1ZB9A 4JI1C 4YY3C 4LF8C 1MDFA 4DG9A 2HHHC 1MDBA 4JYAC 5BUQA 1HNXC 2D1SA 4PROC 1XRCA 4G36A 1QWIA 2OPLA 4FTFA 2DPLA 3B7WA 3NYQA 5AE2A 4RVNA 4NXNC 1ZB8A 3G7SA 4B3SC 4B3TC 2E0GA 2JMPA 4L2ZA 4PHTA 1MXAA 2Y4OA 3TQIA 3DHVA 4DR2C 2UUCC 4B3RC 4L4QA 4AQYC 4BC9A 3N2QA 1I94C 4DR7C 2PT7G 5BURA 2D28C 4DCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IML A;  5H9U A;  3UOW A;  3S82 A;  2YWC A;  1O93 A;  1MXC A;  3SO4 A;  4L2Z A;  4ODJ A;  5T8T A;  1MXA A;  1GPM A;  1P7L A;  3TDE A;  1MXB A;  3TQI A;  4KTT A;  2YWB A;  2P02 A;  1XRC A;  2OBV A;  1RG9 A;  1XRB A;  4NDN A;  5T8S A;  1FUG A;  4WS9 A;  1O90 A;  4LE5 A;  5A19 A;  4HPV A;  4L4Q A;  5A1G A;  5A1I A;  2DPL A;  4KTV A;  4L7I A;  1QM4 A;  3RV2 A;  3A4I A;  1O92 A;  1O9T A;  1XRA A;  4K0B A; 
#chains in the Genus database with same CATH topology
 4LFC C;  2D27 A;  4JI2 C;  3GR0 A;  3I08 A;  3A9V A;  5KYV A;  4JI4 C;  5JRH A;  5T8S A;  2CU6 A;  2MM9 A;  5K85 A;  1J5E C;  1LCI A;  2QW0 X;  3PES A;  1PA4 A;  1QM4 A;  5IT9 D;  2QVY X;  1IBM C;  1RY2 A;  4D4G A;  5LMU C;  4IR7 A;  1TH5 A;  2MCQ A;  4DCU A;  4GXR A;  4GKJ C;  2KDN A;  5CZX A;  4FUQ A;  3T1H C;  5AE1 A;  3IEV A;  2BH1 X;  1N33 C;  1NY8 A;  1RG9 A;  3AY0 A;  5ADZ A;  5K8F A;  4JI6 C;  2E8F A;  2CXC A;  1O92 A;  2VSQ A;  2YWC A;  4TPS B;  2V7B A;  3E7X A;  4NXM C;  3OTO C;  4ZLP A;  2D7V A;  2WD9 A;  4DV0 C;  3FCE A;  3ETO A;  2M5H A;  2ATW A;  4DV7 C;  1AMU A;  3R9W A;  5BUS A;  5BSM A;  1BA3 A;  5LMN C;  1XRA A;  4X62 C;  4DCT A;  4DUY C;  1IBK C;  2Y27 A;  1XMQ C;  1PG4 A;  4JM1 A;  2XR1 A;  1P7L A;  1L2F A;  3EQ6 A;  4K0K C;  4BCA A;  5LCI A;  3TR3 A;  3UZ0 A;  4DV2 C;  1T5D X;  2P02 A;  2QVX X;  1ULT A;  3CQ2 A;  3LNO A;  3R44 A;  4R1L A;  1HNW C;  4KHP C;  4LF4 C;  3GKU A;  4RMN A;  3VNR A;  4PZP A;  1XHJ A;  3AF6 A;  4RLQ A;  4FUT A;  1LQL A;  4LFA C;  5BSU A;  2E5L C;  2PN2 A;  4KTT A;  2UUB C;  4LF5 C;  1XRB A;  1O90 A;  5A1I A;  1WH9 A;  3R9X A;  5KYT A;  2NCL A;  5GTD A;  1USP A;  4DG8 A;  3J81 D;  3IML A;  3ETC A;  2E7G A;  2VZE A;  5T8T A;  2F4V C;  3DAY A;  5BSW A;  2Z51 A;  3EER A;  4DR5 C;  1VEH A;  1MXB A;  4X66 C;  3GR1 A;  3LAX A;  4PUG A;  1ML8 A;  5FLX D;  5A2Q D;  1VLA A;  4DV6 C;  4LFB C;  4DV1 C;  3RV2 A;  4JI3 C;  2D1R A;  3A4I A;  2AYA A;  3L95 X;  4MTN A;  2PRO A;  4IZ6 A;  3GPC A;  4GXQ A;  4DR3 C;  2UUA C;  3NPD A;  2KZ0 A;  1V26 A;  3S82 A;  1MXC A;  4XX2 A;  4JV5 C;  3TUF A;  3NYR A;  3TDE A;  1N36 C;  4NOZ A;  4RVO A;  2ZM6 C;  1N2F A;  3LGX A;  4NDN A;  1FLO A;  1HH2 P;  4RLF A;  4U5Y D;  2CY1 A;  4RM2 A;  3IPL A;  4DV4 C;  4BC7 A;  4KTV A;  1P4E C;  5AE3 A;  1USP B;  3FCC A;  4RM3 A;  2UXB C;  4GS5 A;  2E8E A;  4LF9 C;  3SO4 A;  5BSR A;  2Y4N A;  3A9U A;  3IEU A;  1XMO C;  4X64 C;  1M6X C;  4BSZ A;  3VNQ A;  2WP0 C;  2KZF A;  2UXD C;  4R0M A;  2P2Q A;  4D56 A;  3RG2 A;  3N54 B;  4OXI A;  3CW8 X;  3UOW A;  2M5O A;  5IWA C;  3UEB A;  1XNR C;  1GPM A;  1N34 C;  4I9G A;  2P2F A;  4DR4 C;  4YHH C;  2EGT A;  2OBV A;  1P4E A;  4PUH A;  2BJO A;  4LE5 A;  4JI7 C;  3NI2 A;  1T5H X;  3CJE A;  4G37 A;  3KXW A;  3DLP X;  2HJG A;  1M6X A;  5A1G A;  4X65 C;  4B3M C;  1IBL C;  5KEI A;  3J80 D;  1MD9 A;  3C5E A;  4MH4 A;  4DV5 C;  4PUI A;  2OO4 A;  2D1Q A;  1XNQ C;  4GKK C;  4HPV A;  1KKG A;  1UKK A;  4ZJZ A;  1EGA A;  5IFI A;  1O9T A;  3K6R A;  5CZV A;  3I07 A;  2DYJ A;  4JI5 C;  1K0R A;  1UWD A;  2ASB A;  2ZZM A;  4D57 A;  2VQF C;  2UXC C;  4D4I A;  3PBK A;  1V25 A;  1YJ7 A;  3AF5 A;  2D1T A;  5BST A;  4BBY A;  5E7Q A;  4I9F A;  1FUG A;  2DHM A;  3CQ1 A;  5A19 A;  3E7W A;  2E8C A;  4L7I A;  5BR8 C;  1HNZ C;  4ISB A;  1WCJ A;  4R1M A;  4OX9 C;  2QL8 A;  2UU9 C;  2YWB A;  3VNS A;  1IB8 A;  1N32 C;  1NYE A;  3T1Y C;  2OPL B;  3H2T A;  4G1I A;  4JI8 C;  3A26 A;  2JNV A;  2ONF A;  4LF7 C;  1WF3 A;  4OYC A;  4DCS A;  1O93 A;  3CQ3 A;  4ODJ A;  5BSV A;  2P2M A;  3PRO C;  4LF6 C;  3L8C A;  3CW9 A;  1JOS A;  1V60 A;  2ZZN A;  2VQE C;  1FJG C;  3O2E A;  4K0B A;  5H9U A;  1PG3 A;  4JI0 C;  4DUZ C;  3LUS A;  2YCB A;  3JAM D;  2P20 A;  4EAT A;  3LNV A;  2QVZ X;  1MKY A;  2P2J A;  2P2B A;  2MMA B;  4WS9 A;  5DV9 A;  4DV3 C;  4WV3 A;  4DR6 C;  1HR0 C;  4DR1 C;  1ZB9 A;  4JI1 C;  4YY3 C;  4LF8 C;  1MDF A;  4DG9 A;  1PU1 A;  2HHH C;  1MDB A;  4JYA C;  5BUQ A;  2YX1 A;  1HNX C;  2D1S A;  4PRO C;  1XRC A;  4G36 A;  1QWI A;  2OPL A;  4FTF A;  2DPL A;  3B7W A;  3NYQ A;  5AE2 A;  4RVN A;  4NXN C;  1ZB8 A;  3G7S A;  4B3S C;  4B3T C;  2E0G A;  2JMP A;  4L2Z A;  4PHT A;  1MXA A;  2Y4O A;  3TQI A;  3UX2 A;  3DHV A;  4DR2 C;  2UUC C;  4B3R C;  3A25 A;  3UX3 A;  4L4Q A;  4AQY C;  4BC9 A;  3N2Q A;  1I94 C;  4DR7 C;  2PT7 G;  5BUR A;  2D28 C;  4DCV A;  1XS3 A; 
#chains in the Genus database with same CATH homology
 4LFC C;  2D27 A;  4JI2 C;  3GR0 A;  3I08 A;  3A9V A;  5KYV A;  4JI4 C;  5JRH A;  5T8S A;  5K85 A;  1J5E C;  1LCI A;  2QW0 X;  3PES A;  1PA4 A;  1QM4 A;  5IT9 D;  2QVY X;  1IBM C;  1RY2 A;  4D4G A;  5LMU C;  4IR7 A;  4DCU A;  4GXR A;  4GKJ C;  5CZX A;  4FUQ A;  3T1H C;  5AE1 A;  3IEV A;  2BH1 X;  1N33 C;  1RG9 A;  5ADZ A;  5K8F A;  4JI6 C;  2E8F A;  2CXC A;  1O92 A;  2VSQ A;  2YWC A;  4TPS B;  2V7B A;  3E7X A;  4NXM C;  3OTO C;  4ZLP A;  2D7V A;  2WD9 A;  4DV0 C;  3FCE A;  3ETO A;  2ATW A;  4DV7 C;  1AMU A;  3R9W A;  5BUS A;  5BSM A;  1BA3 A;  5LMN C;  1XRA A;  4X62 C;  4DCT A;  4DUY C;  1IBK C;  2Y27 A;  1XMQ C;  1PG4 A;  4JM1 A;  2XR1 A;  1P7L A;  1L2F A;  3EQ6 A;  4K0K C;  4BCA A;  3UZ0 A;  4DV2 C;  1T5D X;  2P02 A;  2QVX X;  1ULT A;  3R44 A;  4R1L A;  1HNW C;  4KHP C;  4LF4 C;  3GKU A;  4RMN A;  3VNR A;  4PZP A;  3AF6 A;  4RLQ A;  4FUT A;  1LQL A;  4LFA C;  5BSU A;  2E5L C;  2PN2 A;  4KTT A;  2UUB C;  4LF5 C;  1XRB A;  1O90 A;  5A1I A;  1WH9 A;  3R9X A;  5KYT A;  5GTD A;  1USP A;  4DG8 A;  3J81 D;  3IML A;  3ETC A;  2E7G A;  2VZE A;  5T8T A;  2F4V C;  3DAY A;  5BSW A;  3EER A;  4DR5 C;  1MXB A;  4X66 C;  3GR1 A;  3LAX A;  1ML8 A;  5FLX D;  5A2Q D;  1VLA A;  4DV6 C;  4LFB C;  4DV1 C;  3RV2 A;  4JI3 C;  2D1R A;  3A4I A;  2AYA A;  3L95 X;  4MTN A;  2PRO A;  4IZ6 A;  3GPC A;  4GXQ A;  4DR3 C;  2UUA C;  3NPD A;  1V26 A;  3S82 A;  1MXC A;  4XX2 A;  4JV5 C;  3TUF A;  3NYR A;  3TDE A;  1N36 C;  4NOZ A;  4RVO A;  2ZM6 C;  1N2F A;  3LGX A;  4NDN A;  1HH2 P;  4RLF A;  4U5Y D;  2CY1 A;  4RM2 A;  3IPL A;  4DV4 C;  4BC7 A;  4KTV A;  5AE3 A;  1USP B;  3FCC A;  4RM3 A;  2UXB C;  4GS5 A;  2E8E A;  4LF9 C;  3SO4 A;  5BSR A;  2Y4N A;  3A9U A;  3IEU A;  1XMO C;  4X64 C;  4BSZ A;  3VNQ A;  2WP0 C;  2KZF A;  2UXD C;  4R0M A;  2P2Q A;  4D56 A;  3RG2 A;  3N54 B;  4OXI A;  3CW8 X;  3UOW A;  5IWA C;  1XNR C;  1GPM A;  1N34 C;  4I9G A;  2P2F A;  4DR4 C;  4YHH C;  2EGT A;  2OBV A;  2BJO A;  4LE5 A;  4JI7 C;  3NI2 A;  1T5H X;  3CJE A;  4G37 A;  3KXW A;  3DLP X;  2HJG A;  5A1G A;  4X65 C;  4B3M C;  1IBL C;  5KEI A;  3J80 D;  1MD9 A;  3C5E A;  4MH4 A;  4DV5 C;  2OO4 A;  2D1Q A;  1XNQ C;  4GKK C;  4HPV A;  1KKG A;  1UKK A;  4ZJZ A;  1EGA A;  5IFI A;  1O9T A;  5CZV A;  3I07 A;  2DYJ A;  4JI5 C;  1K0R A;  2ASB A;  4D57 A;  2VQF C;  2UXC C;  4D4I A;  3PBK A;  1V25 A;  1YJ7 A;  3AF5 A;  2D1T A;  5BST A;  4BBY A;  5E7Q A;  4I9F A;  1FUG A;  5A19 A;  3E7W A;  2E8C A;  4L7I A;  5BR8 C;  1HNZ C;  4ISB A;  4R1M A;  4OX9 C;  2QL8 A;  2UU9 C;  2YWB A;  3VNS A;  1N32 C;  1NYE A;  3T1Y C;  2OPL B;  3H2T A;  4G1I A;  4JI8 C;  2ONF A;  4LF7 C;  1WF3 A;  4OYC A;  4DCS A;  1O93 A;  4ODJ A;  5BSV A;  2P2M A;  3PRO C;  4LF6 C;  3L8C A;  3CW9 A;  1JOS A;  2VQE C;  1FJG C;  4K0B A;  5H9U A;  1PG3 A;  4JI0 C;  4DUZ C;  3LUS A;  2YCB A;  3JAM D;  2P20 A;  4EAT A;  3LNV A;  2QVZ X;  1MKY A;  2P2J A;  2P2B A;  4WS9 A;  5DV9 A;  4DV3 C;  4WV3 A;  4DR6 C;  1HR0 C;  4DR1 C;  1ZB9 A;  4JI1 C;  4YY3 C;  4LF8 C;  1MDF A;  4DG9 A;  2HHH C;  1MDB A;  4JYA C;  5BUQ A;  1HNX C;  2D1S A;  4PRO C;  1XRC A;  4G36 A;  1QWI A;  2OPL A;  4FTF A;  2DPL A;  3B7W A;  3NYQ A;  5AE2 A;  4RVN A;  4NXN C;  1ZB8 A;  3G7S A;  4B3S C;  4B3T C;  2E0G A;  2JMP A;  4L2Z A;  4PHT A;  1MXA A;  2Y4O A;  3TQI A;  3DHV A;  4DR2 C;  2UUC C;  4B3R C;  4L4Q A;  4AQY C;  4BC9 A;  3N2Q A;  1I94 C;  4DR7 C;  2PT7 G;  5BUR A;  2D28 C;  4DCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...