5T8TA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
388
structure length
379
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIADLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound AMP and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
total genus 129
structure length 379
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA03
1O93A 3SO4A 1O90A 4NDNA 3TQIA 2YWBA 3A4IA 4KTVA 4LE5A 4L2ZA 5T8TA 5A19A 1GPMA 5T8SA 1XRAA 2P02A 1O92A 1XRCA 5A1IA 4ODJA 4WS9A 2YWCA 3UOWA 1P7LA 4K0BA 5H9UA 4L7IA 2DPLA 1MXBA 1FUGA 5A1GA 2OBVA 3S82A 4KTTA 1XRBA 4L4QA 3TDEA 3RV2A 1RG9A 3IMLA 1MXCA 1O9TA 1QM4A 1MXAA 4HPVA
chains in the Genus database with same CATH superfamily
3TQIA 2CY1A 4JI1C 1L2FA 5LMNC 3C5EA 2YCBA 2UXCC 3N54B 4LE5A 2JNVA 4AQYC 5BUQA 5BSTA 3PBKA 5BSUA 3E7WA 1I94C 5ADZA 3CW8X 3NI2A 1PG3A 1LQLA 1BA3A 4DUZC 4FUQA 2D1QA 3K6RA 3DLPX 4B3MC 3R9XA 2OPLB 1ZB9A 4JI8C 5IFIA 1EGAA 2E8FA 3AF6A 3NPDA 4K0BA 4RM2A 4TPSB 2DPLA 1N34C 4B3SC 2ZZMA 3CQ1A 5BSWA 2QVYX 1O93A 5BURA 1PG4A 5E7QA 3CQ2A 1USPA 4LF7C 3L95X 4GS5A 2NCLA 2E8EA 4YY3C 3UOWA 4X66C 2ATWA 4D4IA 4ISBA 1LCIA 3ETCA 2OBVA 3UX2A 1HNZC 4KTTA 4XX2A 4JV5C 4OYCA 4NOZA 4DR6C 1IB8A 3UEBA 3SO4A 1P4EC 5JRHA 1ZB8A 2M5HA 2JMPA 4BC9A 5T8TA 1HNXC 1O92A 4X64C 4DV5C 3NYQA 4I9FA 2E5LC 4DCUA 2UUBC 3CJEA 2QVZX 2HHHC 4D56A 1V60A 4ZLPA 1XRBA 1XMQC 3TUFA 1V25A 4YHHC 1RG9A 1TH5A 1O9TA 1MXAA 4RLFA 2E0GA 1XNQC 1V26A 4DV0C 2BH1X 4DCSA 2QW0X 1MKYA 4DV3C 3FCEA 4BBYA 1HNWC 4L2ZA 3IEUA 3LGXA 4WS9A 3ETOA 4DR2C 4PROC 4DR7C 1FUGA 2E8CA 2Y4NA 3DAYA 5LMUC 4DV2C 4DG8A 1MDBA 5DV9A 2OO4A 4GKKC 3KXWA 3A9VA 4JI7C 2KZ0A 2VQFC 5GTDA 1HH2P 2OPLA 4D57A 2D1RA 2P02A 4OXIA 1XRCA 4RLQA 4LFCC 5CZXA 4GXQA 1QWIA 1MXBA 2D1TA 1T5DX 1NY8A 1YJ7A 3IEVA 2YWBA 5IWAC 2XR1A 2ONFA 3PROC 3A26A 3E7XA 3JAMD 1XRAA 3TR3A 3AY0A 4DG9A 4DV6C 2WP0C 4RMNA 5BR8C 4R1LA 2P20A 4DR3C 2EGTA 3J81D 1ULTA 3AF5A 4RVNA 3IMLA 1K0RA 4OX9C 4LFBC 3LNOA 2MCQA 3H2TA 4RM3A 4NXMC 4JI5C 3VNSA 4RVOA 4B3TC 1KKGA 1JOSA 5KEIA 4U5YD 2Y27A 4L7IA 2F4VC 3A25A 1XMOC 2CU6A 1PA4A 2ASBA 1UWDA 3VNRA 3J80D 1N36C 1MXCA 5A19A 1XHJA 4NXNC 5LCIA 4I9GA 2P2FA 2PT7G 3A4IA 5BUSA 1FLOA 4K0KC 3O2EA 2PN2A 4FTFA 4JI6C 2HJGA 4DV4C 4R0MA 3T1HC 1P7LA 4JI0C 4GXRA 3LUSA 1HR0C 1WH9A 5A2QD 2PROA 3GR1A 4IZ6A 1IBKC 2KZFA 4LF9C 4DCTA 3I07A 1MDFA 4G36A 2P2BA 1XNRC 2QVXX 2M5OA 3UZ0A 4LF6C 2P2QA 2BJOA 2CXCA 1IBLC 2VZEA 5AE3A 3VNQA 2E7GA 3OTOC 1T5HX 3IPLA 4X62C 5BSMA 4DR5C 2Z51A 4ODJA 4JI4C 1AMUA 4PUIA 5IT9D 4DR4C 2D7VA 4HPVA 1MD9A 4KHPC 2D1SA 2WD9A 2ZM6C 4GKJC 1NYEA 4IR7A 4ZJZA 3A9UA 5H9UA 2UXBC 2KDNA 4BSZA 4X65C 4BCAA 3TDEA 4LF5C 1VEHA 1O90A 2UXDC 4JI2C 3G7SA 2VQEC 5BSRA 5AE1A 4B3RC 4KTVA 4DR1C 1M6XC 4PUGA 3LNVA 2AYAA 2P2MA 4EATA 2DYJA 3B7WA 4LF8C 2MM9A 1WCJA 4LF4C 4MH4A 4JYAC 1UKKA 1J5EC 4WV3A 5AE2A 2MMAB 1PU1A 4L4QA 2D28C 3FCCA 2DHMA 5KYTA 4G37A 3NYRA 2YX1A 1ML8A 5K85A 1N2FA 1M6XA 5T8SA 4PZPA 2P2JA 5FLXD 4JI3C 4BC7A 5K8FA 2UUAC 3S82A 3RV2A 1WF3A 2D27A 4R1MA 1QM4A 1N33C 4NDNA 4DV7C 2QL8A 3PESA 4LFAC 4MTNA 1USPB 3GKUA 4DV1C 3RG2A 1VLAA 3EQ6A 2VSQA 3N2QA 3CQ3A 4PHTA 2YWCA 4D4GA 5KYVA 2UU9C 1XS3A 3R9WA 4DCVA 3T1YC 1P4EA 4FUTA 5CZVA 1N32C 3CW9A 1FJGC 2V7BA 1GPMA 2ZZNA 1RY2A 3L8CA 5A1IA 2Y4OA 1IBMC 4PUHA 3LAXA 3I08A 4G1IA 3GPCA 3DHVA 5A1GA 4JM1A 5BSVA 3EERA 3UX3A 2UUCC 3GR0A 4DUYC 3R44A
chains in the Genus database with same CATH topology
3TQIA 2CY1A 4JI1C 1L2FA 5LMNC 3C5EA 2YCBA 2UXCC 3N54B 4LE5A 4AQYC 5BUQA 5BSTA 3PBKA 5BSUA 3E7WA 1I94C 5ADZA 3CW8X 3NI2A 1PG3A 1LQLA 1BA3A 4DUZC 4FUQA 2D1QA 3DLPX 4B3MC 3R9XA 2OPLB 1ZB9A 4JI8C 5IFIA 1EGAA 2E8FA 3AF6A 3NPDA 4K0BA 4RM2A 4TPSB 2DPLA 1N34C 4B3SC 5BSWA 2QVYX 1O93A 5BURA 1PG4A 5E7QA 1USPA 4LF7C 3L95X 4GS5A 2E8EA 4YY3C 3UOWA 4X66C 2ATWA 4D4IA 4ISBA 1LCIA 3ETCA 2OBVA 1HNZC 4KTTA 4XX2A 4JV5C 4OYCA 4NOZA 4DR6C 3SO4A 5JRHA 1ZB8A 2JMPA 4BC9A 5T8TA 1HNXC 1O92A 4X64C 4DV5C 3NYQA 4I9FA 2E5LC 4DCUA 2UUBC 3CJEA 2QVZX 2HHHC 4D56A 4ZLPA 1XRBA 1XMQC 3TUFA 1V25A 4YHHC 1RG9A 1O9TA 1MXAA 4RLFA 2E0GA 1XNQC 1V26A 4DV0C 2BH1X 4DCSA 2QW0X 1MKYA 4DV3C 3FCEA 4BBYA 1HNWC 4L2ZA 3IEUA 3LGXA 4WS9A 3ETOA 4DR2C 4PROC 4DR7C 1FUGA 2E8CA 2Y4NA 3DAYA 5LMUC 4DV2C 4DG8A 1MDBA 5DV9A 2OO4A 4GKKC 3KXWA 3A9VA 4JI7C 2VQFC 5GTDA 1HH2P 2OPLA 4D57A 2D1RA 2P02A 4OXIA 1XRCA 4RLQA 4LFCC 5CZXA 4GXQA 1QWIA 1MXBA 2D1TA 1T5DX 1YJ7A 3IEVA 2YWBA 5IWAC 2XR1A 3R44A 2ONFA 3PROC 3E7XA 3JAMD 1XRAA 4DG9A 4DV6C 2WP0C 4RMNA 5BR8C 4R1LA 2P20A 4DR3C 2EGTA 3J81D 1ULTA 3AF5A 4RVNA 3IMLA 1K0RA 4OX9C 4LFBC 3H2TA 4RM3A 4NXMC 4JI5C 3VNSA 4RVOA 4B3TC 1KKGA 1JOSA 5KEIA 4U5YD 2Y27A 4L7IA 2F4VC 1XMOC 1PA4A 2ASBA 3VNRA 3J80D 1N36C 5A19A 1MXCA 4NXNC 4I9GA 2P2FA 2PT7G 3A4IA 5BUSA 4K0KC 2PN2A 4FTFA 4JI6C 2HJGA 4DV4C 4R0MA 3T1HC 1P7LA 4JI0C 4GXRA 3LUSA 1HR0C 1WH9A 5A2QD 2PROA 3GR1A 4IZ6A 1IBKC 2KZFA 4LF9C 4DCTA 3I07A 1MDFA 4G36A 2P2BA 1XNRC 2QVXX 3UZ0A 4LF6C 2P2QA 2BJOA 2CXCA 1IBLC 2VZEA 5AE3A 3VNQA 2E7GA 3OTOC 1T5HX 3IPLA 4X62C 5BSMA 4DR5C 4ODJA 4JI4C 1AMUA 5IT9D 4DR4C 2D7VA 4HPVA 1MD9A 4KHPC 2D1SA 2WD9A 2ZM6C 4GKJC 1NYEA 4IR7A 4ZJZA 3A9UA 5H9UA 2UXBC 4BSZA 4X65C 4BCAA 3TDEA 4LF5C 1O90A 2UXDC 4JI2C 3G7SA 2VQEC 5BSRA 5AE1A 4B3RC 4KTVA 3LNVA 2AYAA 2P2MA 4EATA 2DYJA 3B7WA 4LF8C 4LF4C 4MH4A 4JYAC 1UKKA 1J5EC 4WV3A 5AE2A 4L4QA 2D28C 3FCCA 5KYTA 4G37A 3NYRA 1ML8A 5K85A 1N2FA 5T8SA 4PZPA 2P2JA 5FLXD 4JI3C 4BC7A 5K8FA 2UUAC 3S82A 3RV2A 1WF3A 2D27A 4R1MA 1QM4A 1N33C 4NDNA 4DV7C 2QL8A 3PESA 4LFAC 4MTNA 1USPB 3GKUA 4DV1C 3RG2A 1VLAA 3EQ6A 2VSQA 3N2QA 4PHTA 2YWCA 4D4GA 5KYVA 2UU9C 3R9WA 4DCVA 3T1YC 4FUTA 5CZVA 1N32C 3CW9A 1FJGC 2V7BA 1GPMA 1RY2A 3L8CA 5A1IA 2Y4OA 1IBMC 3LAXA 3I08A 4G1IA 3GPCA 3DHVA 5A1GA 4JM1A 5BSVA 3EERA 2UUCC 3GR0A 4DUYC 4DR1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O93 A;  3SO4 A;  1O90 A;  4NDN A;  3TQI A;  2YWB A;  3A4I A;  4KTV A;  4LE5 A;  4L2Z A;  5T8T A;  5A19 A;  1GPM A;  5T8S A;  1XRA A;  2P02 A;  1O92 A;  1XRC A;  5A1I A;  4ODJ A;  4WS9 A;  2YWC A;  3UOW A;  1P7L A;  4K0B A;  5H9U A;  4L7I A;  2DPL A;  1MXB A;  1FUG A;  5A1G A;  2OBV A;  3S82 A;  4KTT A;  1XRB A;  4L4Q A;  3TDE A;  3RV2 A;  1RG9 A;  3IML A;  1MXC A;  1O9T A;  1QM4 A;  1MXA A;  4HPV A; 
#chains in the Genus database with same CATH topology
 3TQI A;  2CY1 A;  4JI1 C;  1L2F A;  5LMN C;  3C5E A;  2YCB A;  2UXC C;  3N54 B;  4LE5 A;  2JNV A;  4AQY C;  5BUQ A;  5BST A;  3PBK A;  5BSU A;  3E7W A;  1I94 C;  5ADZ A;  3CW8 X;  3NI2 A;  1PG3 A;  1LQL A;  1BA3 A;  4DUZ C;  4FUQ A;  2D1Q A;  3K6R A;  3DLP X;  4B3M C;  3R9X A;  2OPL B;  1ZB9 A;  4JI8 C;  5IFI A;  1EGA A;  2E8F A;  3AF6 A;  3NPD A;  4K0B A;  4RM2 A;  4TPS B;  2DPL A;  1N34 C;  4B3S C;  2ZZM A;  3CQ1 A;  5BSW A;  2QVY X;  1O93 A;  5BUR A;  1PG4 A;  5E7Q A;  3CQ2 A;  1USP A;  4LF7 C;  3L95 X;  4GS5 A;  2NCL A;  2E8E A;  4YY3 C;  3UOW A;  4X66 C;  2ATW A;  4D4I A;  4ISB A;  1LCI A;  3ETC A;  2OBV A;  3UX2 A;  1HNZ C;  4KTT A;  4XX2 A;  4JV5 C;  4OYC A;  4NOZ A;  4DR6 C;  1IB8 A;  3UEB A;  3SO4 A;  1P4E C;  5JRH A;  1ZB8 A;  2M5H A;  2JMP A;  4BC9 A;  5T8T A;  1HNX C;  1O92 A;  4X64 C;  4DV5 C;  3NYQ A;  4I9F A;  2E5L C;  4DCU A;  2UUB C;  3CJE A;  2QVZ X;  2HHH C;  4D56 A;  1V60 A;  4ZLP A;  1XRB A;  1XMQ C;  3TUF A;  1V25 A;  4YHH C;  1RG9 A;  1TH5 A;  1O9T A;  1MXA A;  4RLF A;  2E0G A;  1XNQ C;  1V26 A;  4DV0 C;  2BH1 X;  4DCS A;  2QW0 X;  1MKY A;  4DV3 C;  3FCE A;  4BBY A;  1HNW C;  4L2Z A;  3IEU A;  3LGX A;  4WS9 A;  3ETO A;  4DR2 C;  4PRO C;  4DR7 C;  1FUG A;  2E8C A;  2Y4N A;  3DAY A;  5LMU C;  4DV2 C;  4DG8 A;  1MDB A;  5DV9 A;  2OO4 A;  4GKK C;  3KXW A;  3A9V A;  4JI7 C;  2KZ0 A;  2VQF C;  5GTD A;  1HH2 P;  2OPL A;  4D57 A;  2D1R A;  2P02 A;  4OXI A;  1XRC A;  4RLQ A;  4LFC C;  5CZX A;  4GXQ A;  1QWI A;  1MXB A;  2D1T A;  1T5D X;  1NY8 A;  1YJ7 A;  3IEV A;  2YWB A;  5IWA C;  2XR1 A;  2ONF A;  3PRO C;  3A26 A;  3E7X A;  3JAM D;  1XRA A;  3TR3 A;  3AY0 A;  4DG9 A;  4DV6 C;  2WP0 C;  4RMN A;  5BR8 C;  4R1L A;  2P20 A;  4DR3 C;  2EGT A;  3J81 D;  1ULT A;  3AF5 A;  4RVN A;  3IML A;  1K0R A;  4OX9 C;  4LFB C;  3LNO A;  2MCQ A;  3H2T A;  4RM3 A;  4NXM C;  4JI5 C;  3VNS A;  4RVO A;  4B3T C;  1KKG A;  1JOS A;  5KEI A;  4U5Y D;  2Y27 A;  4L7I A;  2F4V C;  3A25 A;  1XMO C;  2CU6 A;  1PA4 A;  2ASB A;  1UWD A;  3VNR A;  3J80 D;  1N36 C;  1MXC A;  5A19 A;  1XHJ A;  4NXN C;  5LCI A;  4I9G A;  2P2F A;  2PT7 G;  3A4I A;  5BUS A;  1FLO A;  4K0K C;  3O2E A;  2PN2 A;  4FTF A;  4JI6 C;  2HJG A;  4DV4 C;  4R0M A;  3T1H C;  1P7L A;  4JI0 C;  4GXR A;  3LUS A;  1HR0 C;  1WH9 A;  5A2Q D;  2PRO A;  3GR1 A;  4IZ6 A;  1IBK C;  2KZF A;  4LF9 C;  4DCT A;  3I07 A;  1MDF A;  4G36 A;  2P2B A;  1XNR C;  2QVX X;  2M5O A;  3UZ0 A;  4LF6 C;  2P2Q A;  2BJO A;  2CXC A;  1IBL C;  2VZE A;  5AE3 A;  3VNQ A;  2E7G A;  3OTO C;  1T5H X;  3IPL A;  4X62 C;  5BSM A;  4DR5 C;  2Z51 A;  4ODJ A;  4JI4 C;  1AMU A;  4PUI A;  5IT9 D;  4DR4 C;  2D7V A;  4HPV A;  1MD9 A;  4KHP C;  2D1S A;  2WD9 A;  2ZM6 C;  4GKJ C;  1NYE A;  4IR7 A;  4ZJZ A;  3A9U A;  5H9U A;  2UXB C;  2KDN A;  4BSZ A;  4X65 C;  4BCA A;  3TDE A;  4LF5 C;  1VEH A;  1O90 A;  2UXD C;  4JI2 C;  3G7S A;  2VQE C;  5BSR A;  5AE1 A;  4B3R C;  4KTV A;  4DR1 C;  1M6X C;  4PUG A;  3LNV A;  2AYA A;  2P2M A;  4EAT A;  2DYJ A;  3B7W A;  4LF8 C;  2MM9 A;  1WCJ A;  4LF4 C;  4MH4 A;  4JYA C;  1UKK A;  1J5E C;  4WV3 A;  5AE2 A;  2MMA B;  1PU1 A;  4L4Q A;  2D28 C;  3FCC A;  2DHM A;  5KYT A;  4G37 A;  3NYR A;  2YX1 A;  1ML8 A;  5K85 A;  1N2F A;  1M6X A;  5T8S A;  4PZP A;  2P2J A;  5FLX D;  4JI3 C;  4BC7 A;  5K8F A;  2UUA C;  3S82 A;  3RV2 A;  1WF3 A;  2D27 A;  4R1M A;  1QM4 A;  1N33 C;  4NDN A;  4DV7 C;  2QL8 A;  3PES A;  4LFA C;  4MTN A;  1USP B;  3GKU A;  4DV1 C;  3RG2 A;  1VLA A;  3EQ6 A;  2VSQ A;  3N2Q A;  3CQ3 A;  4PHT A;  2YWC A;  4D4G A;  5KYV A;  2UU9 C;  1XS3 A;  3R9W A;  4DCV A;  3T1Y C;  1P4E A;  4FUT A;  5CZV A;  1N32 C;  3CW9 A;  1FJG C;  2V7B A;  1GPM A;  2ZZN A;  1RY2 A;  3L8C A;  5A1I A;  2Y4O A;  1IBM C;  4PUH A;  3LAX A;  3I08 A;  4G1I A;  3GPC A;  3DHV A;  5A1G A;  4JM1 A;  5BSV A;  3EER A;  3UX3 A;  2UUC C;  3GR0 A;  4DUY C;  3R44 A; 
#chains in the Genus database with same CATH homology
 3TQI A;  2CY1 A;  4JI1 C;  1L2F A;  5LMN C;  3C5E A;  2YCB A;  2UXC C;  3N54 B;  4LE5 A;  4AQY C;  5BUQ A;  5BST A;  3PBK A;  5BSU A;  3E7W A;  1I94 C;  5ADZ A;  3CW8 X;  3NI2 A;  1PG3 A;  1LQL A;  1BA3 A;  4DUZ C;  4FUQ A;  2D1Q A;  3DLP X;  4B3M C;  3R9X A;  2OPL B;  1ZB9 A;  4JI8 C;  5IFI A;  1EGA A;  2E8F A;  3AF6 A;  3NPD A;  4K0B A;  4RM2 A;  4TPS B;  2DPL A;  1N34 C;  4B3S C;  5BSW A;  2QVY X;  1O93 A;  5BUR A;  1PG4 A;  5E7Q A;  1USP A;  4LF7 C;  3L95 X;  4GS5 A;  2E8E A;  4YY3 C;  3UOW A;  4X66 C;  2ATW A;  4D4I A;  4ISB A;  1LCI A;  3ETC A;  2OBV A;  1HNZ C;  4KTT A;  4XX2 A;  4JV5 C;  4OYC A;  4NOZ A;  4DR6 C;  3SO4 A;  5JRH A;  1ZB8 A;  2JMP A;  4BC9 A;  5T8T A;  1HNX C;  1O92 A;  4X64 C;  4DV5 C;  3NYQ A;  4I9F A;  2E5L C;  4DCU A;  2UUB C;  3CJE A;  2QVZ X;  2HHH C;  4D56 A;  4ZLP A;  1XRB A;  1XMQ C;  3TUF A;  1V25 A;  4YHH C;  1RG9 A;  1O9T A;  1MXA A;  4RLF A;  2E0G A;  1XNQ C;  1V26 A;  4DV0 C;  2BH1 X;  4DCS A;  2QW0 X;  1MKY A;  4DV3 C;  3FCE A;  4BBY A;  1HNW C;  4L2Z A;  3IEU A;  3LGX A;  4WS9 A;  3ETO A;  4DR2 C;  4PRO C;  4DR7 C;  1FUG A;  2E8C A;  2Y4N A;  3DAY A;  5LMU C;  4DV2 C;  4DG8 A;  1MDB A;  5DV9 A;  2OO4 A;  4GKK C;  3KXW A;  3A9V A;  4JI7 C;  2VQF C;  5GTD A;  1HH2 P;  2OPL A;  4D57 A;  2D1R A;  2P02 A;  4OXI A;  1XRC A;  4RLQ A;  4LFC C;  5CZX A;  4GXQ A;  1QWI A;  1MXB A;  2D1T A;  1T5D X;  1YJ7 A;  3IEV A;  2YWB A;  5IWA C;  2XR1 A;  3R44 A;  2ONF A;  3PRO C;  3E7X A;  3JAM D;  1XRA A;  4DG9 A;  4DV6 C;  2WP0 C;  4RMN A;  5BR8 C;  4R1L A;  2P20 A;  4DR3 C;  2EGT A;  3J81 D;  1ULT A;  3AF5 A;  4RVN A;  3IML A;  1K0R A;  4OX9 C;  4LFB C;  3H2T A;  4RM3 A;  4NXM C;  4JI5 C;  3VNS A;  4RVO A;  4B3T C;  1KKG A;  1JOS A;  5KEI A;  4U5Y D;  2Y27 A;  4L7I A;  2F4V C;  1XMO C;  1PA4 A;  2ASB A;  3VNR A;  3J80 D;  1N36 C;  5A19 A;  1MXC A;  4NXN C;  4I9G A;  2P2F A;  2PT7 G;  3A4I A;  5BUS A;  4K0K C;  2PN2 A;  4FTF A;  4JI6 C;  2HJG A;  4DV4 C;  4R0M A;  3T1H C;  1P7L A;  4JI0 C;  4GXR A;  3LUS A;  1HR0 C;  1WH9 A;  5A2Q D;  2PRO A;  3GR1 A;  4IZ6 A;  1IBK C;  2KZF A;  4LF9 C;  4DCT A;  3I07 A;  1MDF A;  4G36 A;  2P2B A;  1XNR C;  2QVX X;  3UZ0 A;  4LF6 C;  2P2Q A;  2BJO A;  2CXC A;  1IBL C;  2VZE A;  5AE3 A;  3VNQ A;  2E7G A;  3OTO C;  1T5H X;  3IPL A;  4X62 C;  5BSM A;  4DR5 C;  4ODJ A;  4JI4 C;  1AMU A;  5IT9 D;  4DR4 C;  2D7V A;  4HPV A;  1MD9 A;  4KHP C;  2D1S A;  2WD9 A;  2ZM6 C;  4GKJ C;  1NYE A;  4IR7 A;  4ZJZ A;  3A9U A;  5H9U A;  2UXB C;  4BSZ A;  4X65 C;  4BCA A;  3TDE A;  4LF5 C;  1O90 A;  2UXD C;  4JI2 C;  3G7S A;  2VQE C;  5BSR A;  5AE1 A;  4B3R C;  4KTV A;  3LNV A;  2AYA A;  2P2M A;  4EAT A;  2DYJ A;  3B7W A;  4LF8 C;  4LF4 C;  4MH4 A;  4JYA C;  1UKK A;  1J5E C;  4WV3 A;  5AE2 A;  4L4Q A;  2D28 C;  3FCC A;  5KYT A;  4G37 A;  3NYR A;  1ML8 A;  5K85 A;  1N2F A;  5T8S A;  4PZP A;  2P2J A;  5FLX D;  4JI3 C;  4BC7 A;  5K8F A;  2UUA C;  3S82 A;  3RV2 A;  1WF3 A;  2D27 A;  4R1M A;  1QM4 A;  1N33 C;  4NDN A;  4DV7 C;  2QL8 A;  3PES A;  4LFA C;  4MTN A;  1USP B;  3GKU A;  4DV1 C;  3RG2 A;  1VLA A;  3EQ6 A;  2VSQ A;  3N2Q A;  4PHT A;  2YWC A;  4D4G A;  5KYV A;  2UU9 C;  3R9W A;  4DCV A;  3T1Y C;  4FUT A;  5CZV A;  1N32 C;  3CW9 A;  1FJG C;  2V7B A;  1GPM A;  1RY2 A;  3L8C A;  5A1I A;  2Y4O A;  1IBM C;  3LAX A;  3I08 A;  4G1I A;  3GPC A;  3DHV A;  5A1G A;  4JM1 A;  5BSV A;  3EER A;  2UUC C;  3GR0 A;  4DUY C;  4DR1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...