5T8TA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
388
structure length
379
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIADLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound AMP and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
total genus 129
structure length 379
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8tA03
2DPLA 1QM4A 1P7LA 3TDEA 5A19A 4KTTA 1MXAA 1O93A 4L4QA 3RV2A 4ODJA 4L2ZA 5T8SA 4HPVA 1MXBA 2YWCA 4L7IA 4NDNA 5H9UA 3SO4A 4WS9A 5A1IA 1MXCA 1GPMA 1FUGA 1O90A 2P02A 3A4IA 4KTVA 3UOWA 4K0BA 4LE5A 3IMLA 2YWBA 1XRCA 1O92A 1XRBA 5T8TA 1RG9A 1O9TA 3S82A 2OBVA 5A1GA 3TQIA 1XRAA
chains in the Genus database with same CATH superfamily
3E7XA 4KHPC 2YX1A 4RLFA 5BSWA 4X64C 2UUBC 3GR0A 4DG9A 5H9UA 2E0GA 4LF4C 3UX3A 5BSTA 1V26A 1MDFA 3J80D 4PROC 3B7WA 3CQ1A 4X66C 3FCCA 4ZJZA 2UXCC 4G1IA 1ZB8A 3I07A 4R1MA 4X62C 4DR5C 5IWAC 3I08A 1PA4A 2VQEC 2UXDC 1IBLC 1YJ7A 3EQ6A 1MXCA 4PUHA 4DCSA 4RVNA 5BUSA 4B3TC 3CW9A 1XRBA 3FCEA 4TPSB 1O9TA 2D1RA 3G7SA 3O2EA 4MH4A 1AMUA 2OBVA 5LMNC 5A1GA 2QL8A 2P2BA 2Y4OA 3GKUA 2BH1X 1XMOC 4KTTA 4JI8C 1N36C 2P2FA 1P4EA 1TH5A 4RVOA 2M5HA 2MM9A 1HNZC 4YHHC 1O90A 4YY3C 2P2JA 3UOWA 4AQYC 2E8EA 2KDNA 2BJOA 3CQ3A 1O92A 3UZ0A 3A9VA 2DYJA 3S82A 3CQ2A 2UXBC 4RM3A 3DHVA 4DR1C 2KZ0A 4B3RC 2NCLA 2ZZMA 2QVYX 2JMPA 4HPVA 5KYVA 5JRHA 4JYAC 4PUIA 3A4IA 5ADZA 1M6XC 4GKKC 2E8FA 4D4GA 4DR4C 2D28C 4LE5A 3PROC 5KEIA 4DV0C 2EGTA 3T1YC 3K6RA 5AE2A 5K8FA 1P7LA 1XHJA 3R9XA 4L4QA 4ZLPA 4LF6C 2UU9C 3ETCA 1JOSA 3OTOC 4X65C 4K0BA 1XMQC 4BC7A 4DV3C 4GXRA 1T5HX 5E7QA 4I9FA 2WP0C 2ASBA 2MCQA 4DCUA 1MXBA 4L7IA 4OYCA 3LNVA 4WS9A 3DAYA 4LF9C 4RMNA 3RG2A 1P4EC 1VEHA 2DHMA 2JNVA 3CW8X 5IFIA 3LUSA 5LCIA 5BSVA 4JI0C 3L8CA 1MDBA 2VZEA 3IEVA 2DPLA 2D7VA 4PUGA 1HH2P 2CU6A 1NY8A 1LQLA 4ISBA 4D57A 2D1QA 1WCJA 3T1HC 4G36A 4LFBC 2P2MA 4DUZC 4LFAC 1N34C 3N54B 5A19A 4DV2C 4BSZA 3NPDA 2HJGA 1XNQC 1XNRC 4B3SC 5CZXA 4I9GA 1PU1A 2XR1A 3LAXA 4KTVA 1T5DX 5BURA 3AF6A 4OXIA 5BUQA 2YWBA 3UX2A 4DV7C 1MD9A 5AE3A 4B3MC 1V25A 2ZZNA 3TDEA 1HR0C 1MXAA 1N2FA 4GS5A 2UUAC 4ODJA 4NXNC 4DR7C 1N32C 4NDNA 3SO4A 2QW0X 2ATWA 4K0KC 4NOZA 1XRCA 4FUQA 5T8TA 1RG9A 4MTNA 2PN2A 3CJEA 3A25A 3VNSA 4LF7C 1QM4A 3DLPX 1WF3A 3J81D 1O93A 3C5EA 1QWIA 5KYTA 3R9WA 2YWCA 4JI2C 2OO4A 1PG4A 3H2TA 4DCTA 4EATA 2P20A 2MMAB 2D1TA 4FUTA 4IZ6A 4DR6C 4U5YD 5LMUC 4JI1C 5BR8C 4GKJC 1XS3A 4LF5C 5BSMA 2CXCA 4L2ZA 4DR2C 1L2FA 2F4VC 4IR7A 3EERA 4DR3C 1FLOA 4LF8C 2CY1A 3TR3A 5BSUA 4DUYC 4RLQA 4DG8A 3VNQA 5A2QD 1EGAA 2E8CA 4JI5C 4JM1A 5T8SA 2ONFA 4DCVA 3R44A 1M6XA 2P02A 2YCBA 4D56A 1MKYA 4DV1C 1XRAA 1FJGC 4WV3A 4NXMC 2D1SA 2E7GA 2PROA 2HHHC 5DV9A 1IB8A 1VLAA 3ETOA 2Z51A 5CZVA 4BC9A 1IBKC 3NYQA 3AF5A 1ULTA 5IT9D 4XX2A 1UWDA 5BSRA 4PHTA 1NYEA 2OPLB 2AYAA 3PBKA 3UEBA 3NYRA 4FTFA 1IBMC 1ZB9A 4GXQA 3IPLA 1FUGA 3AY0A 1USPB 1USPA 3TUFA 4RM2A 3IMLA 3LGXA 5AE1A 2Y4NA 2VSQA 3KXWA 2QVZX 3A9UA 3E7WA 1K0RA 4JI4C 3IEUA 2VQFC 3JAMD 1HNXC 4PZPA 4BBYA 2PT7G 4DV5C 2OPLA 1N33C 4D4IA 5A1IA 4JI6C 4G37A 1GPMA 2M5OA 4LFCC 4JI7C 4DV6C 2P2QA 1J5EC 2UUCC 2ZM6C 1WH9A 3L95X 2KZFA 4BCAA 3VNRA 1KKGA 2QVXX 5FLXD 5GTDA 2WD9A 3TQIA 4DV4C 1RY2A 1UKKA 2Y27A 4JV5C 1HNWC 3N2QA 4R1LA 1PG3A 2D27A 2E5LC 3RV2A 3LNOA 1ML8A 3PESA 1I94C 1V60A 3GR1A 3GPCA 4JI3C 5K85A 3NI2A 4OX9C 1BA3A 1LCIA 3A26A 4R0MA 2V7BA
chains in the Genus database with same CATH topology
3E7XA 4KHPC 4RLFA 5BSWA 4X64C 2UUBC 3GR0A 4DG9A 5H9UA 2E0GA 4LF4C 5BSTA 1V26A 1MDFA 3J80D 4PROC 3B7WA 4X66C 3FCCA 4ZJZA 2UXCC 4G1IA 1ZB8A 3I07A 4R1MA 4X62C 4DR5C 5IWAC 3I08A 1PA4A 2VQEC 2UXDC 1IBLC 1YJ7A 3EQ6A 1MXCA 4DCSA 4RVNA 5BUSA 4B3TC 3CW9A 1XRBA 3FCEA 4TPSB 1O9TA 2D1RA 3G7SA 4MH4A 1AMUA 2OBVA 5LMNC 5A1GA 2QL8A 2P2BA 2Y4OA 3GKUA 2BH1X 1XMOC 4KTTA 4JI8C 1N36C 2P2FA 4RVOA 1HNZC 4YHHC 1O90A 4YY3C 2P2JA 3UOWA 4AQYC 2E8EA 2BJOA 1O92A 3UZ0A 3A9VA 2DYJA 3S82A 2UXBC 4RM3A 3DHVA 4DR1C 4B3RC 2QVYX 2JMPA 4HPVA 5KYVA 5JRHA 4JYAC 3A4IA 5ADZA 4GKKC 2E8FA 4D4GA 4DR4C 2D28C 4LE5A 3PROC 5KEIA 4DV0C 2EGTA 3T1YC 5AE2A 5K8FA 1P7LA 3R9XA 4L4QA 4ZLPA 4LF6C 2UU9C 3ETCA 1JOSA 3OTOC 4X65C 4K0BA 1XMQC 4BC7A 4DV3C 4GXRA 1T5HX 5E7QA 4I9FA 2WP0C 2ASBA 4DCUA 1MXBA 4L7IA 4OYCA 3LNVA 4WS9A 3DAYA 4LF9C 4RMNA 3RG2A 3CW8X 5IFIA 3LUSA 5BSVA 4JI0C 3L8CA 1MDBA 2VZEA 3IEVA 2DPLA 2D7VA 1HH2P 1LQLA 4ISBA 4D57A 2D1QA 3T1HC 4G36A 4LFBC 2P2MA 4DUZC 4LFAC 1N34C 3N54B 5A19A 4DV2C 4BSZA 3NPDA 2HJGA 1XNQC 1XNRC 4B3SC 5CZXA 4I9GA 2XR1A 3LAXA 4KTVA 1T5DX 5BURA 3AF6A 4OXIA 5BUQA 2YWBA 4DV7C 1MD9A 5AE3A 4B3MC 1V25A 3TDEA 1HR0C 1MXAA 1N2FA 4GS5A 2UUAC 4ODJA 4NXNC 4DR7C 1N32C 4NDNA 3SO4A 2QW0X 2ATWA 4K0KC 4NOZA 1XRCA 4FUQA 5T8TA 1RG9A 4MTNA 2PN2A 3CJEA 3VNSA 4LF7C 1QM4A 3DLPX 1WF3A 3J81D 1O93A 3C5EA 1QWIA 5KYTA 3R9WA 2YWCA 4JI2C 2OO4A 1PG4A 3H2TA 4DCTA 4EATA 2P20A 2D1TA 4FUTA 4IZ6A 4DR6C 4U5YD 5LMUC 4JI1C 5BR8C 4GKJC 4LF5C 5BSMA 2CXCA 4L2ZA 4DR2C 1L2FA 2F4VC 4IR7A 3EERA 4DR3C 4LF8C 2CY1A 5BSUA 4DUYC 4RLQA 4DG8A 3VNQA 5A2QD 1EGAA 2E8CA 4JI5C 4JM1A 5T8SA 2ONFA 4DCVA 3R44A 2P02A 2YCBA 4D56A 1MKYA 4DV1C 1XRAA 1FJGC 4WV3A 4NXMC 2D1SA 2E7GA 2PROA 2HHHC 5DV9A 1VLAA 3ETOA 5CZVA 4BC9A 1IBKC 3NYQA 3AF5A 1ULTA 5IT9D 4XX2A 5BSRA 4PHTA 1NYEA 2OPLB 2AYAA 3PBKA 3NYRA 4FTFA 1IBMC 1ZB9A 4GXQA 3IPLA 1FUGA 1USPB 1USPA 3TUFA 4RM2A 3IMLA 3LGXA 5AE1A 2Y4NA 2VSQA 3KXWA 2QVZX 3A9UA 3E7WA 1K0RA 4JI4C 3IEUA 2VQFC 3JAMD 1HNXC 4PZPA 4BBYA 2PT7G 4DV5C 2OPLA 1N33C 4D4IA 5A1IA 4JI6C 4G37A 1GPMA 4LFCC 4JI7C 4DV6C 2P2QA 1J5EC 2UUCC 2ZM6C 1WH9A 3L95X 2KZFA 4BCAA 3VNRA 1KKGA 2QVXX 5FLXD 5GTDA 2WD9A 3TQIA 4DV4C 1RY2A 1UKKA 2Y27A 4JV5C 1HNWC 3N2QA 4R1LA 1PG3A 2D27A 2E5LC 3RV2A 1ML8A 3PESA 1I94C 3GR1A 3GPCA 4JI3C 5K85A 3NI2A 4OX9C 1BA3A 1LCIA 4R0MA 2V7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPL A;  1QM4 A;  1P7L A;  3TDE A;  5A19 A;  4KTT A;  1MXA A;  1O93 A;  4L4Q A;  3RV2 A;  4ODJ A;  4L2Z A;  5T8S A;  4HPV A;  1MXB A;  2YWC A;  4L7I A;  4NDN A;  5H9U A;  3SO4 A;  4WS9 A;  5A1I A;  1MXC A;  1GPM A;  1FUG A;  1O90 A;  2P02 A;  3A4I A;  4KTV A;  3UOW A;  4K0B A;  4LE5 A;  3IML A;  2YWB A;  1XRC A;  1O92 A;  1XRB A;  5T8T A;  1RG9 A;  1O9T A;  3S82 A;  2OBV A;  5A1G A;  3TQI A;  1XRA A; 
#chains in the Genus database with same CATH topology
 3E7X A;  4KHP C;  2YX1 A;  4RLF A;  5BSW A;  4X64 C;  2UUB C;  3GR0 A;  4DG9 A;  5H9U A;  2E0G A;  4LF4 C;  3UX3 A;  5BST A;  1V26 A;  1MDF A;  3J80 D;  4PRO C;  3B7W A;  3CQ1 A;  4X66 C;  3FCC A;  4ZJZ A;  2UXC C;  4G1I A;  1ZB8 A;  3I07 A;  4R1M A;  4X62 C;  4DR5 C;  5IWA C;  3I08 A;  1PA4 A;  2VQE C;  2UXD C;  1IBL C;  1YJ7 A;  3EQ6 A;  1MXC A;  4PUH A;  4DCS A;  4RVN A;  5BUS A;  4B3T C;  3CW9 A;  1XRB A;  3FCE A;  4TPS B;  1O9T A;  2D1R A;  3G7S A;  3O2E A;  4MH4 A;  1AMU A;  2OBV A;  5LMN C;  5A1G A;  2QL8 A;  2P2B A;  2Y4O A;  3GKU A;  2BH1 X;  1XMO C;  4KTT A;  4JI8 C;  1N36 C;  2P2F A;  1P4E A;  1TH5 A;  4RVO A;  2M5H A;  2MM9 A;  1HNZ C;  4YHH C;  1O90 A;  4YY3 C;  2P2J A;  3UOW A;  4AQY C;  2E8E A;  2KDN A;  2BJO A;  3CQ3 A;  1O92 A;  3UZ0 A;  3A9V A;  2DYJ A;  3S82 A;  3CQ2 A;  2UXB C;  4RM3 A;  3DHV A;  4DR1 C;  2KZ0 A;  4B3R C;  2NCL A;  2ZZM A;  2QVY X;  2JMP A;  4HPV A;  5KYV A;  5JRH A;  4JYA C;  4PUI A;  3A4I A;  5ADZ A;  1M6X C;  4GKK C;  2E8F A;  4D4G A;  4DR4 C;  2D28 C;  4LE5 A;  3PRO C;  5KEI A;  4DV0 C;  2EGT A;  3T1Y C;  3K6R A;  5AE2 A;  5K8F A;  1P7L A;  1XHJ A;  3R9X A;  4L4Q A;  4ZLP A;  4LF6 C;  2UU9 C;  3ETC A;  1JOS A;  3OTO C;  4X65 C;  4K0B A;  1XMQ C;  4BC7 A;  4DV3 C;  4GXR A;  1T5H X;  5E7Q A;  4I9F A;  2WP0 C;  2ASB A;  2MCQ A;  4DCU A;  1MXB A;  4L7I A;  4OYC A;  3LNV A;  4WS9 A;  3DAY A;  4LF9 C;  4RMN A;  3RG2 A;  1P4E C;  1VEH A;  2DHM A;  2JNV A;  3CW8 X;  5IFI A;  3LUS A;  5LCI A;  5BSV A;  4JI0 C;  3L8C A;  1MDB A;  2VZE A;  3IEV A;  2DPL A;  2D7V A;  4PUG A;  1HH2 P;  2CU6 A;  1NY8 A;  1LQL A;  4ISB A;  4D57 A;  2D1Q A;  1WCJ A;  3T1H C;  4G36 A;  4LFB C;  2P2M A;  4DUZ C;  4LFA C;  1N34 C;  3N54 B;  5A19 A;  4DV2 C;  4BSZ A;  3NPD A;  2HJG A;  1XNQ C;  1XNR C;  4B3S C;  5CZX A;  4I9G A;  1PU1 A;  2XR1 A;  3LAX A;  4KTV A;  1T5D X;  5BUR A;  3AF6 A;  4OXI A;  5BUQ A;  2YWB A;  3UX2 A;  4DV7 C;  1MD9 A;  5AE3 A;  4B3M C;  1V25 A;  2ZZN A;  3TDE A;  1HR0 C;  1MXA A;  1N2F A;  4GS5 A;  2UUA C;  4ODJ A;  4NXN C;  4DR7 C;  1N32 C;  4NDN A;  3SO4 A;  2QW0 X;  2ATW A;  4K0K C;  4NOZ A;  1XRC A;  4FUQ A;  5T8T A;  1RG9 A;  4MTN A;  2PN2 A;  3CJE A;  3A25 A;  3VNS A;  4LF7 C;  1QM4 A;  3DLP X;  1WF3 A;  3J81 D;  1O93 A;  3C5E A;  1QWI A;  5KYT A;  3R9W A;  2YWC A;  4JI2 C;  2OO4 A;  1PG4 A;  3H2T A;  4DCT A;  4EAT A;  2P20 A;  2MMA B;  2D1T A;  4FUT A;  4IZ6 A;  4DR6 C;  4U5Y D;  5LMU C;  4JI1 C;  5BR8 C;  4GKJ C;  1XS3 A;  4LF5 C;  5BSM A;  2CXC A;  4L2Z A;  4DR2 C;  1L2F A;  2F4V C;  4IR7 A;  3EER A;  4DR3 C;  1FLO A;  4LF8 C;  2CY1 A;  3TR3 A;  5BSU A;  4DUY C;  4RLQ A;  4DG8 A;  3VNQ A;  5A2Q D;  1EGA A;  2E8C A;  4JI5 C;  4JM1 A;  5T8S A;  2ONF A;  4DCV A;  3R44 A;  1M6X A;  2P02 A;  2YCB A;  4D56 A;  1MKY A;  4DV1 C;  1XRA A;  1FJG C;  4WV3 A;  4NXM C;  2D1S A;  2E7G A;  2PRO A;  2HHH C;  5DV9 A;  1IB8 A;  1VLA A;  3ETO A;  2Z51 A;  5CZV A;  4BC9 A;  1IBK C;  3NYQ A;  3AF5 A;  1ULT A;  5IT9 D;  4XX2 A;  1UWD A;  5BSR A;  4PHT A;  1NYE A;  2OPL B;  2AYA A;  3PBK A;  3UEB A;  3NYR A;  4FTF A;  1IBM C;  1ZB9 A;  4GXQ A;  3IPL A;  1FUG A;  3AY0 A;  1USP B;  1USP A;  3TUF A;  4RM2 A;  3IML A;  3LGX A;  5AE1 A;  2Y4N A;  2VSQ A;  3KXW A;  2QVZ X;  3A9U A;  3E7W A;  1K0R A;  4JI4 C;  3IEU A;  2VQF C;  3JAM D;  1HNX C;  4PZP A;  4BBY A;  2PT7 G;  4DV5 C;  2OPL A;  1N33 C;  4D4I A;  5A1I A;  4JI6 C;  4G37 A;  1GPM A;  2M5O A;  4LFC C;  4JI7 C;  4DV6 C;  2P2Q A;  1J5E C;  2UUC C;  2ZM6 C;  1WH9 A;  3L95 X;  2KZF A;  4BCA A;  3VNR A;  1KKG A;  2QVX X;  5FLX D;  5GTD A;  2WD9 A;  3TQI A;  4DV4 C;  1RY2 A;  1UKK A;  2Y27 A;  4JV5 C;  1HNW C;  3N2Q A;  4R1L A;  1PG3 A;  2D27 A;  2E5L C;  3RV2 A;  3LNO A;  1ML8 A;  3PES A;  1I94 C;  1V60 A;  3GR1 A;  3GPC A;  4JI3 C;  5K85 A;  3NI2 A;  4OX9 C;  1BA3 A;  1LCI A;  3A26 A;  4R0M A;  2V7B A; 
#chains in the Genus database with same CATH homology
 3E7X A;  4KHP C;  4RLF A;  5BSW A;  4X64 C;  2UUB C;  3GR0 A;  4DG9 A;  5H9U A;  2E0G A;  4LF4 C;  5BST A;  1V26 A;  1MDF A;  3J80 D;  4PRO C;  3B7W A;  4X66 C;  3FCC A;  4ZJZ A;  2UXC C;  4G1I A;  1ZB8 A;  3I07 A;  4R1M A;  4X62 C;  4DR5 C;  5IWA C;  3I08 A;  1PA4 A;  2VQE C;  2UXD C;  1IBL C;  1YJ7 A;  3EQ6 A;  1MXC A;  4DCS A;  4RVN A;  5BUS A;  4B3T C;  3CW9 A;  1XRB A;  3FCE A;  4TPS B;  1O9T A;  2D1R A;  3G7S A;  4MH4 A;  1AMU A;  2OBV A;  5LMN C;  5A1G A;  2QL8 A;  2P2B A;  2Y4O A;  3GKU A;  2BH1 X;  1XMO C;  4KTT A;  4JI8 C;  1N36 C;  2P2F A;  4RVO A;  1HNZ C;  4YHH C;  1O90 A;  4YY3 C;  2P2J A;  3UOW A;  4AQY C;  2E8E A;  2BJO A;  1O92 A;  3UZ0 A;  3A9V A;  2DYJ A;  3S82 A;  2UXB C;  4RM3 A;  3DHV A;  4DR1 C;  4B3R C;  2QVY X;  2JMP A;  4HPV A;  5KYV A;  5JRH A;  4JYA C;  3A4I A;  5ADZ A;  4GKK C;  2E8F A;  4D4G A;  4DR4 C;  2D28 C;  4LE5 A;  3PRO C;  5KEI A;  4DV0 C;  2EGT A;  3T1Y C;  5AE2 A;  5K8F A;  1P7L A;  3R9X A;  4L4Q A;  4ZLP A;  4LF6 C;  2UU9 C;  3ETC A;  1JOS A;  3OTO C;  4X65 C;  4K0B A;  1XMQ C;  4BC7 A;  4DV3 C;  4GXR A;  1T5H X;  5E7Q A;  4I9F A;  2WP0 C;  2ASB A;  4DCU A;  1MXB A;  4L7I A;  4OYC A;  3LNV A;  4WS9 A;  3DAY A;  4LF9 C;  4RMN A;  3RG2 A;  3CW8 X;  5IFI A;  3LUS A;  5BSV A;  4JI0 C;  3L8C A;  1MDB A;  2VZE A;  3IEV A;  2DPL A;  2D7V A;  1HH2 P;  1LQL A;  4ISB A;  4D57 A;  2D1Q A;  3T1H C;  4G36 A;  4LFB C;  2P2M A;  4DUZ C;  4LFA C;  1N34 C;  3N54 B;  5A19 A;  4DV2 C;  4BSZ A;  3NPD A;  2HJG A;  1XNQ C;  1XNR C;  4B3S C;  5CZX A;  4I9G A;  2XR1 A;  3LAX A;  4KTV A;  1T5D X;  5BUR A;  3AF6 A;  4OXI A;  5BUQ A;  2YWB A;  4DV7 C;  1MD9 A;  5AE3 A;  4B3M C;  1V25 A;  3TDE A;  1HR0 C;  1MXA A;  1N2F A;  4GS5 A;  2UUA C;  4ODJ A;  4NXN C;  4DR7 C;  1N32 C;  4NDN A;  3SO4 A;  2QW0 X;  2ATW A;  4K0K C;  4NOZ A;  1XRC A;  4FUQ A;  5T8T A;  1RG9 A;  4MTN A;  2PN2 A;  3CJE A;  3VNS A;  4LF7 C;  1QM4 A;  3DLP X;  1WF3 A;  3J81 D;  1O93 A;  3C5E A;  1QWI A;  5KYT A;  3R9W A;  2YWC A;  4JI2 C;  2OO4 A;  1PG4 A;  3H2T A;  4DCT A;  4EAT A;  2P20 A;  2D1T A;  4FUT A;  4IZ6 A;  4DR6 C;  4U5Y D;  5LMU C;  4JI1 C;  5BR8 C;  4GKJ C;  4LF5 C;  5BSM A;  2CXC A;  4L2Z A;  4DR2 C;  1L2F A;  2F4V C;  4IR7 A;  3EER A;  4DR3 C;  4LF8 C;  2CY1 A;  5BSU A;  4DUY C;  4RLQ A;  4DG8 A;  3VNQ A;  5A2Q D;  1EGA A;  2E8C A;  4JI5 C;  4JM1 A;  5T8S A;  2ONF A;  4DCV A;  3R44 A;  2P02 A;  2YCB A;  4D56 A;  1MKY A;  4DV1 C;  1XRA A;  1FJG C;  4WV3 A;  4NXM C;  2D1S A;  2E7G A;  2PRO A;  2HHH C;  5DV9 A;  1VLA A;  3ETO A;  5CZV A;  4BC9 A;  1IBK C;  3NYQ A;  3AF5 A;  1ULT A;  5IT9 D;  4XX2 A;  5BSR A;  4PHT A;  1NYE A;  2OPL B;  2AYA A;  3PBK A;  3NYR A;  4FTF A;  1IBM C;  1ZB9 A;  4GXQ A;  3IPL A;  1FUG A;  1USP B;  1USP A;  3TUF A;  4RM2 A;  3IML A;  3LGX A;  5AE1 A;  2Y4N A;  2VSQ A;  3KXW A;  2QVZ X;  3A9U A;  3E7W A;  1K0R A;  4JI4 C;  3IEU A;  2VQF C;  3JAM D;  1HNX C;  4PZP A;  4BBY A;  2PT7 G;  4DV5 C;  2OPL A;  1N33 C;  4D4I A;  5A1I A;  4JI6 C;  4G37 A;  1GPM A;  4LFC C;  4JI7 C;  4DV6 C;  2P2Q A;  1J5E C;  2UUC C;  2ZM6 C;  1WH9 A;  3L95 X;  2KZF A;  4BCA A;  3VNR A;  1KKG A;  2QVX X;  5FLX D;  5GTD A;  2WD9 A;  3TQI A;  4DV4 C;  1RY2 A;  1UKK A;  2Y27 A;  4JV5 C;  1HNW C;  3N2Q A;  4R1L A;  1PG3 A;  2D27 A;  2E5L C;  3RV2 A;  1ML8 A;  3PES A;  1I94 C;  3GR1 A;  3GPC A;  4JI3 C;  5K85 A;  3NI2 A;  4OX9 C;  1BA3 A;  1LCI A;  4R0M A;  2V7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...