2YX1A

Crystal structure of m.jannaschii trna m1g37 methyltransferase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
323
Chain Sequence
b'PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ0883
publication title Crystal structure of archaeal tRNA(m(1)G37)methyltransferase aTrm5.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 92
structure length 323
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yx1A01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2yx1A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2yx1A03
3PTAA 4IV0A 2AN3A 1V39A 1X1BA 3CKKA 1RJGA 3ELUA 2AS0A 1AQIA 2EJUA 2P8JA 2EFJA 2PVCA 3G88A 2ZSUA 3M4XA 5LQAA 4ISCA 2OPBA 4RTSA 3PFGA 4C4AA 3KR9A 2PWYA 1D2CA 1DCTA 4MWZA 3CJTA 3FUXA 3PFHA 4CKCA 4PIMA 4KW7A 3G8AA 3G2OA 4DZRA 1AQJA 1NV9A 4YMHA 5K8VA 3Q7EA 2CWWA 1KHHA 2O57A 1HMYA 3HCBA 4U7TB 2YVLA 3GNLA 3M33A 4RVHA 3CGGA 4RVDA 4BP3A 3RODA 3P2EA 2VP3A 4GOLD 3THSA 1EIZA 3SGLA 5K05A 3DMHA 3LKDA 1XCJA 4ER7A 3FPGA 2PKWA 2AOTA 3BWYA 2UYQA 5BP7A 2ADMA 4A6EA 5GINE 1EJ0A 3A7DA 3LECA 5CVVA 1G55A 1QAOA 3DULA 4IV8A 5E1BA 3HCFA 4C07A 3BGVA 4AZTA 1MHTA 3NMUF 2NXEA 1SUSA 4RTKA 4GBED 5ICGA 4E31A 2IDJA 1SG9A 3T7RA 2I62A 4EMSA 1M0EA 5E9WA 1I9GA 2GS9A 3AJDA 1KPGA 1L3IA 3DXXA 4P7KA 1N7IA 3ANXA 5DX0A 5E1MA 5F2OA 5FQOA 4DKJA 10MHA 3KR0A 4DM3A 3M70A 4FGZA 2B9EA 4X60A 5EMJA 1Q0SA 3MTEA 1QANA 5F2KA 4DCGA 1P1BA 1P39A 7MHTA 1XDSA 4U7PB 3BGDA 4A6DA 1WS6A 3HA7A 4QVKA 5GIOE 2VS1A 3C6KA 2VDUE 4XUEA 4X63A 3G5LA 5T64A 4DA4A 3OU7A 4DF3A 4E70A 2ZTHA 3LL7A 1QYRA 4HRAA 2ZIFA 4E2ZA 5CIYA 4Y2HA 3DOUA 2DPMA 1D2HA 1AF7A 5EVJA 3FYDA 3UJCA 5IKMA 3C3PA 1DL5A 4ER5A 4OA8A 2OB2A 5K0CA 1TPYA 3VC2A 3EVBA 3C3YA 3G7UA 3PX2A 3R6TA 5DSXA 3TKYA 4E33A 4OQEA 4R05A 4C06A 2ZLBA 5DTRA 2AN5A 2PX8A 4HTFA 4BLVA 3UJ9A 4YV2A 2I9KA 3KQYA 4QVGA 1BKYA 2EX4A 1R8YA 1ZGAA 2H1RA 4CTKA 3FPEA 4FR0A 5FA8A 2P7HA 2AZTA 3GU3A 1SQFA 2ZULA 4CWAA 4BLUA 5CCBA 3EVGA 1FJXA 2XYQA 3IEIA 1JR4A 3ELWA 3EMDA 4KWCA 1JG3A 3CVOA 3DXZA 2P3OA 4F86A 3KQOA 2O0LA 4QPPA 5P8WA 2NYUA 2B78A 3RIEA 2BR4A 4OBWA 4PYNA 4MTLA 2HR1A 2P3QA 2P35A 2GLUA 3UJ6A 3DUWA 3GRRA 4FSDA 4OBXA 1VPTA 5GP1A 4PINA 1D2GA 3SSMA 3Q87B 3T0IA 3JWHA 3VSEA 1NW7A 3P9NA 1G8AA 3G2QA 2R6ZA 5FHQA 5DSTA 3B7PA 4E32A 1UWVA 2IH4A 4PYJA 4RTMA 3EGEA 3HVJA 1MJFA 5DWQA 4PYMA 3KHKA 4RX1A 1F38A 1RJDA 5KS2A 4RSRA 4YV0A 4OX9Y 5FCDA 2CKDA 1L3CA 3OFKA 5IH3A 1ORHA 5DXAA 1NKVA 3C0KA 3HCCA 4R8SA 4RTJA 1ZKDA 3EGIA 3MTIA 5E2AA 4RTPA 3FTFA 3KU1A 2I7CA 1Y8CA 3PS9A 5CD1A 1YB2A 1NBIA 1IXKA 2PXXA 2YUIA 1YFJA 3PLAE 1WG8A 4P7FA 3REOA 3SXJA 4YV1A 4R6XA 3GRYA 5DX1A 1KP9A 3LCUA 5GWXA 4QDJA 5E8RA 5HIKA 2OXTA 3TMAA 1M6YA 3GO4A 3P2KA 3T7TA 4CKEA 3HCEA 5DM1A 4ER0A 3P9IA 2Z6UA 5LQJA 4E2XA 4GOOD 3TOSA 4FP9A 5LQKA 3PVCA 3OZSA 1BC5A 3E23A 3HA3A 4YUZA 3DH0A 3QV2A 4PGHA 1RI4A 4K6MA 3LBYA 1L3BA 3OCJA 1HNNA 4QTTB 1WXXA 4BLWA 1JTEA 3BT7A 2PWPA 5CM2Z 3TFWA 5KVAA 5DPMA 2O07A 3A27A 2OO3A 5CVEA 3M6VA 3TRKA 4KVZA 4AUKA 3OU6A 3TQSA 2C7QA 1KR5A 2QRVA 2AOUB 3EEYA 2BR5A 4YUVA 4XUCA 4EQZA 2G8NA 3O4FA 5CVDA 2PXAA 2Y1WA 2NXNA 3UWPA 2BZGA 3GGDA 2PV0A 3HA5A 1RJEA 4HTFB 5HIIA 2ZCJA 3EVDA 4RWZA 2NP6A 3NJRA 2G1PA 1Z3CA 3LBFA 4FSXA 1FP2A 2G72A 4PIPA 5CCXA 5K01A 5E2BA 5GIPE 1ZHFA 3GRUA 2ZZNA 4IKPA 5HFJA 1EAMA 5EPEA 1EJ6A 1JG4A 1WXWA 3MQ2A 3U81A 2AOWA 4MHTA 2ZVJA 1FPQA 5FUBA 1ORIA 3DTNA 2ZZKA 3MCTA 5CUQA 4KRGA 3TKAA 2Z6QA 2NP7A 1QZZA 4KIFA 4RV9A 1L9KA 3TM4A 1XXLA 3DP7A 3HVHA 1R00A 1R8XA 2I6GA 5EIFA 1ZGJA 1RJFA 2IDKA 3GWZA 4OA5A 5E1OA 3LGAA 3MAGA 4O29A 3ORHA 2P3LA 2IGTA 3B3FA 3HVIA 2Z6AA 1X1AA 3G89A 3P2IA 1G60A 5GM1A 4YUYA 5K03A 1XDUA 4C03A 5EMKA 1T43A 4P7GA 2P1DA 4B17A 1NBHA 2PJDA 3H2BA 3OPNA 4P7JA 1VLMA 5T67A 3MERA 4LECA 5KYGA 3DMFA 3KR1A 3UJBA 4WVLA 4L7VA 2EJTA 1YF3A 1FBNA 3OE5A 3LCCA 2XYRA 2C7OA 3I64A 3HP7A 4EVIA 1JSXA 2WA2A 2O05A 3AXSA 3DLCA 2WK1A 1G6Q1 1NW6A 5DX8A 2YR0A 3NVMB 1X19A 4ER6A 3D2LA 2GPYA 3KQMA 5FA5A 2ZW9A 1JG2A 3BWBA 5C1IA 5DTMA 3T7SA 1AV6A 3KKZA 4QQNA 2UYHA 3FYCA 2OBFA 2ESRA 4RTNA 3TR6A 4PONA 5JUWA 4Y30A 5FHRA 2C7RA 3NWEA 1XVAA 3EVZA 3F4KA 5E9QA 3B89A 2PLWA 2HTEA 2YTZA 2V74B 1F3LA 4HG2A 3SMQA 4YMGA 3DR5A 1JQEA 4RVFA 3QOWA 4IWNA 3LSTA 5G02A 3FTDA 3P97A 4M37A 5FTWA 3KQVA 4UOEA 3EMBA 5DM0A 4POOA 5LQNA 2VDWA 3S68A 4PYLA 3SVZA 2PSSA 3LPMA 2AVDA 5EC8A 3TPZA 4EKGA 5ICEA 1PJZA 3FPFA 5EZQA 4HSGA 1IM8A 2FCAA 1KYZA 1RI5A 3ELYA 3KQQA 3R3HA 1SQGA 2XYVA 1INLA 1VQ1A 3G2MA 4KDCA 3KQSA 2OYRA 4RVGA 4E2WA 2NXCA 3VYWA 1ZG3A 2IPXA 2YXLA 4M7RA 3AXTA 3CJQA 2CL5A 4PCLA 2IP2A 2ZZMA 1KPHA 1PRYA 1QAQA 1BOOA 2FK7A 2XVMA 2HV9A 3KQTA 3RW9A 1VE3A 3HM2A 5EEGA 4C08A 2JHAA 3NDIA 5DM2A 5DTQA 4KIGA 5BW4A 3DLIA 3FZGA 2R3SA 5HILA 2QM3A 3BGIA 3KQPA 1RI1A 3UA4A 4FZVA 3B3JA 3M6XA 3LHDA 2IBSA 1I4WA 2YXEA 3EEOA 1JG1A 2Q41A 3I53A 2AOTB 1JQDA 3LCVB 3UJAA 3BZBA 4PYIA 3NDJA 1UFKA 5EHIA 4WXHA 3L8DA 2JH9A 1R6AA 3BKWA 2HWKA 4CXMA 2FK8A 3HCDA 2BR3A 1NV8A 4GQBA 3B5IA 5CVUA 3GRZA 2N47A 5F2NA 2G70A 5EKXA 3E8SA 3SR4A 4DQ0A 1SUIA 3JWGA 1YUBA 3KR2A 4ER3A 5H02A 5U4XA 2DULA 4R8RA 3ERCA 3B3GA 1H1DA 3LX6A 2FHPA 3OFJA 3M6WA 3EVAA 4YUXA 5MHTA 3CC8A 2ZBPA 5HEKA 2QY6A 3GXOA 4DMGA 2AN4A 2K4MA 3I5UA 3OU2A 4V0QA 1Q0TA 2NXJA 2JHCA 4F85A 5EOVA 4BY9E 4MQ4A 3FUWA 3UFBA 3FUTA 3EVFA 2IFTA 3NTVA 2QE6A 5HOQA 3ER9A 2BM9A 1B42A 5FWAA 3R0QA 4AX8A 2ORED 5HZMA 1KIAA 2ONYA 2A14A 3LKZA 1YZ3A 2EG5A 3OE4A 5E1DA 5GM2A 1X1DA 3UZUA 3G8BA 3IYLW 3BWMA 3DMGA 3NW9A 2XVAA 5EEHA 5LQRA 1EQAA 1TW3A 3WSTA 2ZWAA 1DUSA 5K09A 3I58A 3E7PA 4PGGA 2PXCA 4PWYA 3AWIA 3G2PA 5K0LA 4Z2YA 4LWOA 5EMMA 3KPYA 2O06A 3KPUA 3LDUA 3R9XB 4YUWA 1N2XA 1VIDA 2WA1A 4X61A 5E9JA 2P40A 5K0BA 3PT9A 5LQCA 3NVKI 3KQWA 1NW8A 3FTEA 4RYLA 1RI3A 4GOMD 5E8JA 4GOND 3MB5A 2OKCA 5FQNA 2F8LA 1BHJA 2BM8A 3O31A 5K0FA 4XUDA 2UYCA 3K6RA 5EGSA 4PNEA 1TW2A 2JHPA 3KPVA 3AY0A 3O7WA 4PYKA 1XTPA 5KQRA 2UZ4A 3EGVA 2LD4A 3VC1A 1NT2A 1G38A 1L1EA 2IH2A 2XBMA 2G71A 2AR0A 4KDRA 5DLYA 4CKBA 4HH4A 2H00A 4DCMA 5HIJA 3GJYA 4GUAA 1EG2A 4PYOA 5LR6A 5FADA 2YXDA 1RI2A 1IY9A 5DM4A 5FWDA 3FUVA 4AZSA 3CJRA 4M36A 2AOVA 3BWCA 4MIKA 5DRTA 1M6EX 3HEMA 3PB3A 1XJ5A 2PT6A 4FT4A 3OZRA 2ERCA 3LDFA 4GC5A 2PX5A 5EG5A 5FULA 1NW3A 3FUUA 5D1NA 2IH5A 4G56A 3KPWA 1XCLA 1KPIA 4P58A 1O9HA 3UBTA 3P71T 1UIRA 3GDHA 3THRA 3NWBA 4AZVA 1JQ3A 2PX4A 3BUSA 5EZSA 3C6MA 8MHTA 1I1NA 4V0RA 3M6UA 4CTJA 1P1CA 3JWIA 5BW5A 4X1OA 5B1SA 2KW5A 5HIMA 1NE2A 2IBTA 5M5BA 3FPJA 1N7JA 4FT2A 2ZWVA 3A7EA 4RTQA 4RTRA 3LDGA 2VZ9A 3I9FA 4NECA 4QPNA 3A25A 1JTFA 3FPHA 2B25A 3JWJA 2FYTA 3UA3A 2E5WA 2YX1A 5EQJB 2GB4A 4GC9A 3P9CA 1JSZA 1VBFA 3BKXA 3BXOA 4QDKA 4LWPA 2P41A 3X0DA 2OY0A 4M38A 3TLJA 2ZIEA 2IIPA 1SVUA 4C05A 3FRIA 4ZTBA 3HVKA 5CVJA 3MHTA 2AOUA 5ICCA 4RTOA 3A4TA 2QRVB 5D1HA 3P9KA 3DXYA 4F84A 2C7PA 2OB1A 5C9ZA 1VP9A 3HNRA 4QTUB 5KQSA 2GH1A 4HGZA 3K0BA 2JH8A 3GCZA 5GOZA 3TM5A 2PX2A 3EVEA 4QQKA 4X41A 3MGGA 4PCAA 3MCZA 4E30A 5ERGB 2HMYB 3V8VA 9MHTA 2NNWB 4GEKA 5DXJA 2OZVA 4E2YA 5EIWA 5K0JA 5K0EA 5LSAA 2P7IA 2FPOA 2YQZA 5JR3A 4AZWA 1X1CA 1VL5A 3HTXA 3CCFA 3E05A 5LQUA 3UJ8A 2B3TA 1WY7A 3P8ZA 4H0NA 1ZQ9A 3SSOA 2CMGA 4R6WA 1OR8A 4LG1A 2JJQA 1QAMA 3GIWA 5DT2A 1NW5A 1VP3A 2PY6A 3HCAA 3KPJA 1O9GA 2FRXA 2UYOA 2V7EA 2ZFUA 3G5TA 4BP1A 3FRHA 4XCXA 3V97A 2AOXA 2B2CA 2QYOA 3FTCA 5T6BA 1YFLA 1SKMA 4C04A 5K0NA 5BXYA 2ONZA 5K0GA 3SX0A 1YZHA 3UJ7A 3ME5A 2GAFA 4HGYA 3PX3A 4EKIA 1R74A 3ER8A 3ID6C 2HNKA 4HC4A 3IHTA 1R18A 2PT9A 3EPPA 1O54A 3GRVA 2JG3A 2BH2A 5EHGA 1P91A 2Y1XA 3EVCA 4OQDA 5C0OE 5DRYA 2H11A 4FS8A 4JXJA 3UJDA 3OZTA 3ELDA 2ZIGA 3IV6A 1G8SA 1U2ZA 2ZBQA 4PYQA 3CBGA 1KXZA 1WZNA 2CMHA 2GA9A 2PBFA 3SM3A 5EMLA 3SSNA 4ATNA 3R24A 5ICFA 2AVNA 2PGXA 3QOXA 4RTLA 2VDVE 1FP1D 4GF5A 3A26A 1KYWA 5EKUA 4EK9A 1XDZA 2ZBRA
chains in the Genus database with same CATH superfamily
3RR7A 5JJIA 4ISCA 3FROA 2Y4NA 3OY7A 1GITA 3GFRA 3E70C 3PR2B 1RTJA 4QWBA 2A0WA 1SJ9A 3HP6A 4OB7A 3HB9A 3KOAA 1ZZFA 1VJCA 3KK0A 3KSAC 4Y1GA 2HNAA 1RWQA 4B6SA 4KSEB 2R87A 4FFBA 5ICGA 1A5TA 3V6LA 3ZDAA 4EBDA 3COWA 3NXKA 2BGJA 5HW0A 2JRCA 4HYYA 4QPXA 1SIUA 4HN4B 2MKJA 2WHPB 3E7XA 5JW6A 2I54A 3PRJA 3CRVA 5HHTA 2VIHA 1K9MT 2VCYA 4B9TA 4OXXA 3VU8A 3T9NA 1X4DA 5LMNJ 4N48A 4GC6A 2NYUA 2Y4OA 1KI8A 4KWEA 2XRMA 1L5SA 4U7WA 4NAHA 4ZIRA 1KIFA 1TFUA 1DX9A 4BNGA 4OQPA 4F7DA 4KVFA 1N33J 2AG6A 3UJPA 4EYEA 3KNAA 1S57A 2XCSB 1OWPA 3RB4A 3LH5A 1Y8CA 4ZEMA 3BBLA 2LRHA 3Q5EA 3WDOA 2ZREA 1D5WA 4RV4A 3T6JA 1W30A 4Z4CA 3ZZOA 5CA5A 1U8WA 4QU5A 4XA8A 5T4HA 1CYDA 1MEJA 2XCUA 2DD8S 1QFSA 2BR5A 5RUBA 4NAVA 1N5YA 1E5XA 2X9GA 3GJ8A 4EYOA 1JP7A 4PLTA 4HQ6A 3ZE9A 2HFNA 1O95D 2F48A 4NPAA 1PYTA 3U81A 1T3GA 2JAPA 4WN9B 3IUNA 4LF6F 1CLEA 3LGAA 3SHTA 3L02A 1DCKA 2HMTA 4DL5A 1MOSA 3MERA 3V3TA 1RADA 4YUAA 2ZANA 3BGWA 3PXXA 3QU7A 3H1GA 4IBOA 1RB0A 3ROQA 3VISA 4QOIA 3NVMB 1IQPA 5IUNC 1NNEA 4H7HA 4O4LF 5JALA 4Y1RB 1XEZA 1FDUA 3I4CA 3R23A 2NP7A 4CMCA 3EXIA 4UBOA 3OEHD 3KUHA 1HDGO 4IWNA 1Y3FE 3N6MA 4FR5A 3VFDA 2C96A 3TNVA 521PA 1GUBA 1TF7A 5IVKA 1Y6QA 3NAGA 3JQ8A 3DQZA 2X51A 5BQOA 4AWAA 1SZPA 4FVTA 5C8DA 3R5AA 3DLIA 3M9NB 1FP6A 1JEYA 1HWUA 3G2HA 1V8FA 3H98A 4RGYA 2P90A 4GO1A 1TK0A 2BX6A 3QQCD 5F0WA 5JQGF 1REQB 4PYRA 4F04B 3T7IA 3LGXA 3TZXA 2Z5LA 4BVLA 4QLOA 5GAEU 4NXNC 1TC1A 5J2NB 3K4PA 2OZLB 1FW8A 1N5LA 2A4KA 2GMWA 3G1TA 1M9NA 4PAWA 3NNHA 2EPIA 2VTKA 3BJIC 2DXIA 5K0LA 2X1LA 1V11A 2F1JA 1R8QA 5DNCA 1M83A 1RI3A 5JD4A 1BHJA 5H83A 2R00C 1WF6A 3JVVA 4CO3A 1KGSA 4YRGA 1RKIA 5KNCH 4B3SC 5HROA 3RJTA 2BEUA 1UW4A 1NJYA 3PQ5A 4M36A 2JAUA 1Z2AA 1U0HA 2C29D 4W7HA 1K27A 2JVJA 5D1NA 5DI9A 4Y67A 3SVTA 1XK6A 2E3JA 3GDHA 2POKA 3PR1A 3G96A 3WLQA 3QEMA 3FFBA 3T99A 5KOHB 2FGKA 5H80A 2GZMA 1RCOB 5K3BA 5H3LA 3OT9A 4GMGA 1CUBA 3SMZA 4NBSA 2JC0A 1Y98A 1GV0A 5F3TA 3JYLA 3K09C 3AEYA 3VO8A 3MMCB 2J7PA 2QAGB 4GKKF 2OILA 3MEEA 2FW0A 4HUQB 3HVTA 3VQTA 5J59A 2R7SA 4ZA1A 1EHIA 2FEWB 4LMBA 1NATA 2AUTA 4LG1A 4JSRA 3E27A 4I0WA 5G1PA 1C9NA 4C6TA 3I1JA 2D1CA 3IDZA 3G5TA 2ZFUA 1VE1A 4MIEA 5D8DA 1JPUA 4X64B 4CR8A 2B98A 2R7AA 3WICA 2XQGA 4KHRA 1UBCA 1V1RB 3F3SA 3KO8A 4WL0A 5FTJA 4PW0A 4P74A 5JD6A 4IR9A 1OREA 1NNSA 1NZJA 4TOIA 3ZD9A 3SXUA 2J85A 5K0SA 3K2EA 2Q5EA 1JQJC 4GP9A 4J3JA 1U7DA 4R16A 3WA6A 2CQIA 4AN1A 3NG1A 1TZKA 3JQPA 3I6QA 3AHDA 4AJIA 2QXTA 2B35A 1XAIA 3UKOA 2AOTA 2JVRA 3ZHBA 2B6HA 3DGPB 3O3NB 1DBIA 4IL5A 1F2UB 1FL9A 4K4VA 3E0XA 4O3FA 5IHXA 4DKJA 2EW2A 4ARUA 1JU3A 2OPPA 4OY3A 1M66A 4DQDA 2AYZA 4EZBA 1I4LD 5A02A 1DAKA 5HKLA 4RK7A 2QLWA 2V63A 2FDCA 5K0CA 2Y1LB 1NPPA 4WZAB 5K8JB 3KQYA 3QI2A 2CJWB 3EPHA 4US2R 3Q83A 2NYVA 3RIMA 4ZDKA 1VSBA 3VZBA 3NLCA 1XR3A 2SCUA 3CCRS 4OQZA 4HOYA 4LXTA 4B2PA 3A3PB 3EM1A 2VKZG 3VDRA 4RU1A 1QR6A 4IO0A 2QN8A 2PDAA 1WKKA 4P72A 3VNAA 1O5TA 4NK4A 4YN3B 3URKA 7GPBA 2P20A 4PHTA 1FKAF 4QGBA 1E9DA 2DKFA 1N4AA 1ZC3A 4RKQA 5BO5A 4IH4A 4QOJA 1B6SA 5I7UA 4YV1A 2RHGB 4YDRA 1PFKA 1S79A 1EXVA 3TMAA 1M5PC 5C8XA 3GIDA 1N34F 3H0EA 3LYHA 1JR2A 4CQNA 3T1YF 3AA9A 1F0PA 4WLOA 4I1PA 4NONA 2EKZA 5DN9A 1YK1A 1RQNA 2UVVA 2EXUA 1YMUA 1RTIA 4G0QA 4N39A 3PUWA 4IKPA 3V7UA 4L8GA 2F9JA 2XNRA 2HMUA 2XX3A 4IUBS 4V03A 4F1WA 2J7WA 3RFUA 4BNKA 2Q2WA 2Q0HA 3O2JA 3WRVA 3GR6A 4GW3A 3H2YA 1JKXA 1E4EA 4AJ2A 4M53A 4ZYTA 3OPNA 4G1CA 2VFSA 1Z6QA 1GEEA 2JFZA 1KKLA 4XR9A 4XEUA 1PR3A 3PIPQ 2OBFA 1E1RD 1GQFA 3PHLA 1RCFA 1T1RA 4YJ3B 1TIPA 2AHOB 2X3UA 4QGFA 3O8QA 1CRPA 5HTOA 2VDMB 4YJGB 2AI3A 3BF4A 4ZCPA 1NX9A 2J0SD 4MQFB 2BOVA 1ZHOA 1WUTA 2HV9A 1JHXA 1X14A 2Q28A 2GJ9A 1T2FA 2E9RX 3ISNC 3BGIA 1E3DA 2YWKA 4U7CA 4PZLA 1I0ZA 3LCVB 5DIFA 3UJAA 3ZZ0A 3FEXB 2J41A 4FFWA 1VPEA 1P7LA 1RAHB 1N2CB 3EYZA 4YFYA 1Q91A 2KBFA 1X9HA 2ZBPA 2V54A 2Q6VA 4ZO8A 1W5SA 3KEGA 4C4WA 3C48A 2LCWA 4B3OB 1X1DA 2V50A 1H0RA 2M6RA 2ZWAA 5C46F 3OY2A 1WDLA 2BE9B 3KE9A 1TCAA 2JNJA 1K4MA 2LQ5A 5LU9A 3O31A 2M5OA 4UW9A 3NFRA 4MIWA 2FEXA 4OJYA 3OPYA 4GYJA 3FVVA 1G38A 3RI3A 5IWAB 3JYNA 1CEYA 4DV0B 2D1YA 1JFLA 2JJYA 5CZXA 3GEGA 3DRPB 5IM0B 4OLBA 2H52A 2DKOA 2DH8A 1IBLC 3HEMA 4PZVA 4D2IA 3N4WA 1U1FA 3RAGA 1KPIA 2IC5A 1WKLA 2CE2X 5IX8A 1JX6A 4BUJA 1L3KA 1DPFA 1A72A 3ZTTA 1OLOA 1IY2A 1B2LA 2H65A 2QNBA 4NOLA 3ZDYB 2FV8A 1DRVA 4HRYA 2BFCA 1Z2CA 4LWPA 1C1CA 4KP7A 2OC9A 1G5IA 2ZWMA 1UBOS 3V1MA 4JI8B 4KPYA 1XU7A 3Q3JB 4QEDA 1QO0A 5AKYA 3GLTA 1SEVA 3OO1A 4FLEA 2GBFA 1JEOA 3CZPA 4OEHA 1X9WA 2LDXA 3EPJA 1IBKC 2ACWA 2G7ZA 4HGYA 2PLRA 3SJBA 1OIVA 2PIAA 1U8AA 1P1TA 5D3QA 4FYVB 1K0FA 1T3NA 1HLDA 2O7SA 4BNFA 1S49A 2Q5LA 2IQIA 3SK0A 3CCMS 4DV4F 4IKAA 4TV8B 1XQVA 4Q0BB 1RWOA 3H4BA 2Q3JA 3CZ9A 1DV1A 4J0KA 3ZWAA 1IOZA 1HQEA 1V6HA 4Z2AA 1NSQA 1UOPA 3CUUA 2CWWA 1KVTA 1PV4A 3LCRA 1IM5A 3SOZA 4DBVO 4J9QA 4GRIA 4XKJA 4KH0A 2J5KA 1R16A 2XC9A 3LWDA 2Y0DA 1TMKA 4AZTA 4JI7J 4JV0A 2VG7B 4ZAGA 1I3NA 4OMUA 5HLFB 1U8SA 3BR8A 2APOA 2APJA 4LF5B 2G76A 5BSTA 3ZGXA 4LKOA 3TW8B 1H05A 4Y3CA 2ZI6A 2EI5A 1FUKA 1JJ2R 5LP6B 5B4UA 2GF0A 3CRQA 4GECA 4HLDA 5DETA 1QTIA 4HAOA 4WZ6A 1MC5A 4UMFA 3UR0A 3FSJX 4ZT3A 3MINB 3AR7A 4WK1A 1DPGA 1FFWA 2W6ZA 1TUGA 1MLDA 4ENPA 2CLMB 2OD2A 4Q15A 5FOVA 4I2PA 1SELA 5E3IA 4DLPA 1QP0A 3BVPA 1DDGA 1ZIYA 5DCUA 2XMJA 3LQ2A 2KZFA 2WY2D 5ARCA 4NL5A 4P7FA 1N5RA 1M1YB 2J59A 1RLCL 2P6TA 4ZAWA 1VQ8S 1TA0A 2V4UA 1AHHA 2O1EA 4MUAA 3MM9B 4F3QA 5J2QB 5JVGQ 2J9XB 5KWJA 4J3NA 2HFUA 3QYAA 3HA5A 2XZWA 2FCRA 2YMQA 3SQGA 1ENPA 3LXMA 4ED2A 3DAPA 5BVGB 5MDHA 4GG1A 3ICCA 1IXSB 2WVFA 1TUEA 4MW0A 1T8UA 1NG9A 1L3SA 4LOIA 1Z4MA 4XZ3A 1RG9A 4WVLA 4ZVOB 3MFIA 1LV8A 1XNGA 2UXBC 1NYQA 1USPA 2ZRMA 2Q4DA 3E3OA 3D2LA 2YCBA 3WQSB 2IOFA 2BHSA 3SIPA 4JDUA 3SO4A 2ETVA 4MAAA 4FCWA 1OHHA 4OJKA 1T9GS 4EMUA 4C0XA 3HI9A 5F5LA 3LU1A 1NWHA 3V1LA 1B76A 3AF3A 3HXTA 4HBZA 2XYVA 4OK6A 2IBKA 4GX0A 2MYNA 1ST2A 1RTJB 1XZGA 4I50F 3EA4A 3GFOA 5DM2A 1RAGA 4YCDA 1YQTA 3ZVRA 3C6QA 3HR7A 3AB8A 3KSRA 4M5MA 4X90A 2FDXA 3MCWA 4RNDB 3H1EA 2BM0A 4FFBB 2J9DE 3AI2A 4NHEA 1X6VA 4MKVA 2Q6CA 4ARIA 3U4DA 1O6GA 3LY7A 5DYTA 1Z0UA 5DG7A 3IVAA 4X95A 3K2IA 4A15A 3N8KA 2I03A 3J81j 3BC1A 2DH6A 4QJ5A 3RT1A 1FU8A 4OHVA 4G97A 2BBOA 3M2TA 1TMMA 2UUAJ 1OWLA 2RC5A 4DPWA 1C0UA 1C3VA 4CR7A 4QJ3A 4CF7A 4PR0A 2YPYA 1JLCB 2JFWA 1WOOA 5DBFA 1L5VA 4ZJYA 3PJEA 3KPVA 2A9FA 1XB2A 1JBQA 5DGXA 2JEJA 5LMUB 4KDRA 4UY85 4ZIRB 2WV9A 3W3AD 3T1AA 1AQYA 3U19A 5CCDA 3W90A 1IY9A 5KPJA 4ALIA 1X38A 4MOWA 3I6YA 3O5AA 1Q8BA 3EVOA 4JUDX 2Q2OA 2IUFA 1WG1A 1FMTA 3A1FA 3SDSA 2CJPA 3ASYA 4NZ9A 1DHTA 1YVRA 2FMXA 3EGOA 1OYEA 2Q3CA 4LBYA 3M6LA 1XNJA 3JXOA 3PQ2A 2V7XA 3NOXA 3ZWPA 1I7PA 1WDTA 1QAYA 3PWKA 2CVZA 1W9MA 3R5FA 1NTRA 2ZR8A 5T8TA 1N5YB 1Q79A 3MDFA 1T8WA 1KN6A 2PK3A 3TLMA 3IFSA 1H2YA 5LQUA 3MCUA 2PY6A 3KPJA 4L5JA 3DAOA 1FJGF 3JZIA 1JDUA 4DIOA 5FL7A 4G9EA 1YZHA 1RADB 4DNXA 4WECA 1G64A 2PCLA 4TLQA 4EHNA 4H54A 4FS8A 4JJFA 4JL6A 2W6NA 3IV6A 4HAYA 4KTVA 1EFAA 3H4IA 3EXIB 2PKQP 4PX9A 5EMLA 2VJVA 1GAQA 2ZH3A 4YR2A 3FG9A 1HT3A 1X8JA 4DDHA 4EFNA 3RB0A 5I8PA 1P9OA 1P1LA 3WKAA 3X1WA 3JQ8B 2OG1A 4BQQA 4HWKA 2IPAB 1QIDA 1JEYB 2JEZA 1M5TA 5FFNA 2VA9A 2OD7A 2K2PA 1VL2A 2YY3A 5L4NA 4QOHA 3HHDA 3CF6R 2UP1A 1WC1A 1II9A 2YVAA 4IX9A 1SIWA 5D4OA 1VRUA 4IPTA 3PX0A 4QXMA 2JI7A 4WFNQ 3G5LA 1Z25A 3O26A 4IZIA 1HZZC 4JI6J 4BO3A 4W5NA 4HATA 4G1FA 3KC2A 1XO1A 4QPDA 4DV6F 4QOTA 1OBOA 4IS3A 3L8CA 2QA2A 1V11B 1Q8LA 2HVIA 1WCV1 3CNOA 1AIPA 5EJ8A 4QKQA 4CYUA 2JLRA 5GAGU 3D67A 2DHHA 2DNNA 1UBUS 5HROB 4BNTA 4OAOA 4F71A 2BEUB 2C2OA 1GGEA 1U0HB 2YNHA 1U1EA 1RHJA 1LK0A 1GG9A 3Q3HA 3G8CA 4AKHA 1G2QA 1HE2A 3ESAA 2I7TA 4J1NA 3RRHA 4LMPA 3SJ7A 3QEMB 5DCYA 2HXSA 1JVSA 1KJ8A 1L3BA 2F64A 1TAHA 1MVLA 1XEWX 4CH1A 2KT5A 3ZTRA 1FWPA 2BBWA 3KMQA 3Q2OA 5HMWA 3DMJA 2GJAA 2PN6A 4QZVA 1GZ4A 4C0QC 3MEEB 2Z2JA 1J56A 4TQSA 1IY8A 5K01A 3L9WA 3HVTB 4X45A 3FOWA 3W2WA 5H9WA 2IOFK 5EP1A 1ES9A 1H74A 1L9KA 4TXHA 4RZHA 2I5PO 2PANA 4I0WB 4C6TB 2DECA 1RT1A 3W2FA 2QK4A 1ZP6A 2P69A 3UAZA 4EG4A 2PGCA 4FKYA 2HGZA 4K2XA 4MIOA 3NNSA 4ZRMA 2ZHAA 3AZOA 2UZIR 1RHMA 5A5FA 3AM5A 1GLGA 1J25A 3CX8A 2R4FA 5F5NA 2KX7A 1CYEA 1QHFA 2GZDA 4GWGA 1TKXA 3SXUB 3DBHA 1U6KA 4DQIA 1QYWA 1MT0A 3R3YA 3OLCX 3U3MA 4RESA 3KQQA 4MXDA 3WYGA 2HIYA 1B00A 3V5RA 4YOEA 4R2WA 1MO2A 4KIGA 3BN3A 4B31A 5F21A 3R74A 1F5BA 3SYZA 4EH1A 4EFKA 4JYPA 2AOTB 5HQ3A 3NHRA 3T0FA 3L49A 3BICA 2IWHA 2UUCJ 2KU7A 1XTZA 3WJAA 4AJKA 1WMEA 4FHFA 2FHPA 2IHZA 2I6FA 2OPPB 3K6SA 1N77A 1NJ6A 4F85A 3GMIA 4JEIA 1DZ5A 3IT1A 3LUCA 4Y0VA 2ALYB 2BW2A 3H8SA 2AI2A 3SC6A 1ZIXA 2IP1A 1FRJA 1MXBA 1EP3B 5ESXA 4PWWA 4NU8X 4WY5A 5KFUA 1U3WA 4JELA 4D4HA 3KAPA 3KZVA 5ALJA 3OE7D 4Y2JA 3DLGA 1K4YA 3TQHA 1F60A 4DS4A 1RXSA 1U9JA 3DL4A 4BB0A 4RUBA 4NMLA 2ZR0A 3BL8A 1PEDA 1S1VA 5KEIA 4QIFA 2PS3A 5JPDA 1WD6A 2QV0A 1JDPA 3UH1A 3ZCSA 3ET6A 4MW4A 3M9OB 3M1IA 4WFQA 3C8UA 3DDZX 2AC2A 3OTCA 4FHDA 3OKAA 4ZZ0A 4N7JA 2CJQA 4NYZA 2PG3A 1WXFA 3TRJA 3L8EA 2VFRA 2VH7A 2IYYA 4WDRA 2IZ6A 1U98A 1NDKA 3TR0A 3V8EA 1YX2A 3A1CA 1W96A 3N8HA 5T6MA 3ACDA 4GRAA 2BFAA 5BY2A 4F06A 5CDFE 1EUCA 3BBPA 1QVWA 4IUCS 4LRCA 1DAPA 4ARAA 1QHIA 1OXVA 1RTIB 3H86A 3ZVLA 1SBNE 4KN5A 1BQXA 1WY7A 4KAJA 4R6WA 3CZ4A 5KYKA 3I39X 3BD9A 1Z0SA 3HCAA 2KLBA 4CT4B 4Z8XA 3FTCA 1XEWY 4B4UA 4Q43A 1Z16A 1E4EB 1W6UA 2H5EA 4X2BA 3GLFE 1GNQA 1XRPA 2DH5A 4IFIA 4EF5A 1IJBA 5CT4A 1K92A 1AXQA 1A8QA 1V4VA 2I6QA 3TPCA 1S2GA 1ZINA 5IT9A 2OAUA 2ZITA 3O1IC 1NJ8A 3O8QB 1QHYA 5FD8A 5E2IA 5L4SA 3RU7A 2FMKA 4A47A 4G1MB 1ST3A 3KL2A 2PD1A 4CFSA 2ZIXA 4NLYA 1AQJA 2ZRJA 4RLHA 3A31A 1U8TA 2P02A 1E9AA 2VUSA 1TUVA 1UJMA 5DDIP 2W83A 1N2GA 2PN1A 4LYDA 3MWLA 2XF8A 1EFCA 1TKTA 2O19A 2FHMA 3B48A 1IBRA 1SUSA 2D27A 3MS7A 2V2ZA 4RLEA 5HIAA 3DXXA 3INGA 3K9BA 3RUBL 3JQGA 1FY2A 3WYEA 4KG7A 4J7CA 1QIFA 2PGAA 1JNRB 3DAFA 5GJWC 5EI5A 5C1PA 3GW8A 3C97A 1KRHA 3HJVA 3OETA 3SJCA 4LSZA 1P4HA 5DTRA 4BLVA 4CUZA 1P5RA 4JQCA 3C14A 1NY5A 3LF0A 4JYAF 3ANYB 3HNPA 2IZZA 4O4IF 4ALMA 2R7QA 4IGFA 2O54A 3B6IA 3WNZA 1UBKS 4BDSA 4K9SA 1P9LA 3DDKA 4X64C 2UXDB 2NTYC 4JI2F 4C7OA 1YR2A 2JJ2D 1SCIA 2E4XA 1RKJA 3T1NA 2DKOB 4UZEA 5BNZA 1XMQF 4IRCA 2KZZA 3GZJA 4DL0C 1HR0J 3ONEA 1E3SA 4BLOA 4DCSA 1FERA 5DX1A 4TMKA 4C4PA 1ZO8A 5JAUA 3VYVA 4OKIA 5LP1A 4L02A 2H65B 2GCIA 1V3RA 3E9CA 3LBYA 2R9VA 2QW1A 4MIBA 2BFCB 1C1CB 2QAIA 3I5MA 5U47A 1FDNA 4DAOA 1RRGA 4ECVA 1B73A 1VPVA 2BW7A 3U44A 4FB4A 2VK1A 2NXNA 3UWPA 4B71A 3QGPA 5BQXA 3QYYA 3SCZA 1AF4A 1LQUA 3UGTA 2DNQA 4MRNA 4ALLA 4NESA 3SWWA 4QXRA 4EI2A 4YACA 2ASBA 3R3UA 3PNLA 2C2XA 3V34A 3AT1A 3LOUA 4P7GA 5C52B 3ZHVA 4WPAA 2MSWA 2VOPA 3QSYA 4MVJP 3PUKA 2EU8A 3B85A 4XWOA 5DN6D 4BTEA 4DMUB 5CHEA 4NMWA 5T7BA 2DH7A 3ESRA 4DR4J 2BBTA 2Y67A 4PEOA 2ATIA 4RVFA 4D9KA 2AYMA 2AJ0A 1SJFA 4POOA 2EGHA 3UY4A 3QU9A 4QBGB 3SCKE 4K4XA 1RWOB 2FZLA 1VQ1A 3ICQB 1W4AA 1Z5NA 2Q5OA 3TQCA 1HQEB 2FZCA 5CYMA 1D0VA 4NMHA 2B4VA 1ZR2A 4I19A 3HCOA 2C0QA 2DFVA 3ZV5A 5GVRA 1FUYB 4URGA 2PZKA 3BQNB 2CHGA 4KH0B 2MTLA 2NZYA 2AJ1A 1D0EA 1BUXA 2N47A 3LPDA 1GX6A 4TTAA 2XMGA 3ZWKA 2PGOA 2RGDA 1S2DA 2QEQA 3TQIA 2V7QA 3I9MA 4Q1EA 4LOKA 5G1OA 3ZI4A 1VHJA 5EINA 3T41A 2BM9A 2DRBA 1B6RA 1JT2A 3EASA 2Q9AA 2CLEB 4KK4A 5ALEA 4KWHA 4D0GA 3MJVA 2Z5GA 1RAFA 3NVDA 5A5DA 3DI6A 4NI2A 1XZCA 3QWBA 1EGVB 4CLWA 2M0GB 1VE6A 3AG6A 5C35A 1HBJA 2CHQA 1J9EA 1X0VA 5HIJA 1FFWB 1KDRA 4LJ7A 1TUGB 3KXKA 3VR4H 5JJLA 4I2PB 1S4EA 4EFAC 4V19X 1USGA 1GAOA 3UW1A 2A59A 4P58A 5KKNB 1RZUA 4DV1C 3QVWA 2D3ZA 4PLHA 4RL1A 1IUPA 2D13A 2QTRA 3K0SA 4DW8A 3DEHA 4O33A 2PS1A 4IVPA 3SQOP 1Z73A 4G67A 1VP9A 1XN4A 4BX3A 3OTWA 4EITA 2JCXA 2IPNA 2BJ8A 1EFHA 1RACA 2VAMA 3Q7SA 1KDOA 3O3MB 3K5LA 3GIIA 5KQLA 5AXDA 4J49A 1EUQA 3IJ5A 5BXYA 3O8WA 3M7VA 2V4ZA 3IN5A 3SZMA 1U0EA 4LF8C 5KI6A 4H0FA 4C0KA 1USPB 3DNPA 3QBTA 2R7MA 2HFKA 1J2JA 4Z9XA 3SIPB 4OMCA 2XHWA 2EFQA 5IJWA 4CMHA 1N36F 3BFPA 2EK6A 1U47A 4BNLA 1OB5A 1Q3TA 2GYUA 4CG3A 2WU4A 1NU8A 1WCXA 4AP6A 1R9MA 5AE2A 4PZPA 4LXXA 4PUIA 3ASVA 2DGSA 3CE6A 1XNRC 3OFGA 2RK4A 5LZ4A 4L95C 1BD4A 4ERNA 2I2XB 3HDTA 4DJEC 4ZARA 2D4AA 1LSSA 5LQMA 5CT8A 1XCPA 1KPGA 4MYSA 3MM8A 2C95A 4YRQA 2XTZA 1E2QA 4J7AA 1P1BA 1SI9A 1GK8A 4KLZA 2Y6UA 3DGFC 2D3TA 5BR8B 2HI0A 3H5TA 1NJFA 4B74A 2RC6A 4JI8C 3LX8A 2Q5FA 1C0UB 1TM4E 5ADUS 3ZWBA 3ZI7A 2QRHA 5JO0A 5BNTA 4R9NA 4K88A 4V0MA 2HMSA 4O1HA 4JUAA 1GV1A 3FDFA 1ODCA 1KHVA 4LI3X 5AESA 2VA2A 4D6XA 5D7NA 3I45A 4ED4A 2AH5A 1ATIA 1YJXA 4NA2A 2XWPA 2GILA 3SXJA 5FPQA 5CLJA 2QMQA 1RC8A 3SSAA 4K4UA 3OZVA 3IWXA 1J1UA 3NZEA 4MT1A 1TGVA 2CMDA 1ZEJA 5J2UA 2FJ0A 1NZFA 3FB4A 2WTBA 3I8XA 3RO7A 2LFVA 2K3KA 3MUOA 3GEDA 2GWHA 2JNWA 2GHWA 3CD5A 2P65A 4E0DA 2NMVA 2YN4A 2L17A 4J4TA 4ZLPA 2B5WA 3RB3A 3SC2A 4Q5IA 5ES4B 1VTKA 1KSGA 1Z4PX 2R1TA 2X22A 4LF5C 1DWPA 4LXUA 2IYNA 3U62A 5ALTA 1P4AA 2CFIA 4NXMF 4BP8A 5LP6C 2FVRA 3I07A 1QE1A 4FFNA 2BC9A 3UHAA 4F2RA 4X65C 3EJWA 5BPFA 2FFHA 1B6TA 3P52A 1ESNA 2JGJA 5EUBA 3HYSA 1R5BA 4FJ2A 3G8SA 1HBNA 1DOZA 1OLXA 3TPZA 3AZQA 4UJ3A 2AQ8A 2MLZA 3U02A 3WL6A 5B0GA 2QTGA 5FOSA 2PH1A 5C18A 2B8WA 4FS2A 4U39A 2ASVA 2WFZA 4I68A 3B3JA 4OHFA 2GAAA 3NMAA 4PYIA 4ED3A 1BMTA 2FK8A 2WHXA 1NAIA 5EKXA 4FS3A 3PUHA 4HLBA 1VQOS 1M5RA 3DGEC 4R8RA 4DNQA 3NORA 1VRUB 3I55S 2EP5A 2RH5A 4LYGA 5AOBA 3GN2A 5SYMA 5IJZA 2E2WA 5HF5A 1XL0A 1TQHA 3STUA 2PL5A 5PGMA 2Q8NA 2WHRA 1KH2A 4PX5A 3D4LA 4J9PA 4YCMA 1E3JA 2EG5A 4CNYA 1GPBA 2B9XA 4BNZA 3E81A 3AIOA 1Z13A 1EFPA 1B1AA 1HYQA 2VH1A 3IILA 1W0JD 1D8ZA 5EGYA 2NM0A 3HZOA 5AKJA 2C1EA 3FMFA 3ZEAA 1HQCA 3ZJ5A 1J1IA 5DE3A 1N5SA 4CYUB 4OXNA 4NNJA 16PKA 2AJ4A 3CCUS 1M10A 5A6WA 3C3BA 1IOWA 4RS3A 2VQEC 3RVSA 1FU4A 2C2OB 2BTOA 1X9GA 1Q1KA 3SSRA 2YNHB 3WX0A 1NJIT 2D2IA 3EPKA 3OCVA 5KT7A 1B16A 4H60A 1LGYA 2PT0A 3C5CA 3K9LA 4H0CA 3OM1A 5C8VA 1T2DA 1T8TA 1OH8A 1S0VA 2JF0A 1QBKC 2WJWA 1T4MA 4U3JA 2YPZA 1T15A 1A88A 2JJ1D 1ZW1A 1OAKA 3VQSA 1QVRA 4ITUA 3RTAA 4MLZA 3ZJ4A 2FMUA 3LC2O 2OPLA 2FQ1A 2GAJA 2SNIE 3DMJB 4HGZA 6AT1A 5IUJC 4QZVB 4ZO6A 2R2UA 3AF1A 4LVUA 5D5PA 3PV8A 4OYCA 2MR5A 3W2WB 5EHNA 4OHWA 2N75A 3O73A 5LL6P 4F4HA 1O8CA 4MI6A 1URRA 2XTJA 1QGYA 1RT1B 4G24A 3U17A 2L41A 4DFMA 4EUKA 1AOXA 2GASA 1DAEA 1XNHA 4K0KC 4BQOA 4JJ7A 4P2XA 1RHMB 2G4LA 1TDJA 3IMCA 3GLQA 1MR3F 1UMDA 4BO6A 2VATA 3U4HA 4AP9A 1NRXA 1TKXB 3PKYA 4UCWA 3DBHB 4P34A 4BTVA 2NREA 1SXLA 2IAJA 3GWGA 3MJFA 3MN1A 1G8GA 4ZGGA 3O47A 4JKYA 1SJQA 5FX2A 2XMDA 4X8HA 3ZLTA 4BLRA 4NEYA 4KYIB 3NT5A 4JB2A 4MZDA 4O0LA 3IIEA 1N2IA 3NEKA 3L6RA 1UZHA 1UJ5A 1ZYUA 1T34A 3W8FA 3FCXA 4YLGA 1EJ0A 5HQ3B 2JGAA 1XN1A 2KN4A 4NA3A 1KO5A 3CUVA 2FU5C 4I9HA 4KSYA 4RNCA 4F9FA 1U1DA 3TQEA 4BKOA 3RUPA 3UCFA 3K6SB 1A9YA 3I05A 4D9IA 3OHBA 1T3HA 3RROA 1MO3A 2UAGA 4OYYA 3COPA 2PUHA 5D6NA 3MYYA 2ZYSA 4O8ZA 4NSNA 2PGLA 2WNSA 3CIMA 1FD2A 1W7AA 4OQEA 5JZOA 5T3YA 4C06A 2XJ9A 4E98A 4EHBA 2A9VA 1D7AA 3CT6A 1IQUA 1B14A 3TQRA 5KTPA 1OTYA 1Y9OA 2LXFA 4HDKA 3DLGB 5CFQA 1R5JA 2XUJA 4QPPA 3V7FA 3CDAA 3SFUA 2WJ4A 3D8RA 1YDGA 1R0AA 4Z4FA 3AB3A 2VPIA 1L3CA 3ET6B 4R2LA 3RYCA 1PZMA 2C2KA 1BMFD 5H9VA 5CG2A 4K6FA 3B8EA 3VGSA 3QK7A 2E4YA 3DHWC 2RDIA 4KDFA 4I81A 1RWPA 4O63O 1DC8A 2FHJD 2PRYA 3L04A 4B35A 5CCLA 5AW3A 4ZGBA 4OZ0A 4D3XA 1WEZA 3D4BA 1EUCB 2MHCA 4EUEA 1VMAA 2XXBA 3A3NA 4C98A 2HNZA 1N32B 1K8XB 1T95A 5I3QA 2DK2A 3IS9B 2WSIA 4F4ZA 2WT4A 2WT8A 2JL9A 2ZCVA 3MLAA 2WFMA 1MN6A 4GKJF 1W2HA 4EJMA 5JNUA 3T7DA 1RHKA 3UMGA 4BQSA 3GUZA 3CE8A 2HU8A 3NYRA 3IS3A 4D9HA 1XIQA 2CQ4A 1OOEA 4DR2F 1AV6A 5C1IA 1NKBA 3KKZA 2AR9A 1NAHA 5FHRA 3MD9A 3NWEA 3R3XA 2I7DA 2BGWA 3L7PA 1COWD 1CS4A 1TK8A 3D4OA 4M6WA 3KUKA 5A4JA 2OQIA 3BERA 2ZSAA 4IUDS 4AMGA 3FR8A 2O48X 2ZIXB 3ZX5A 2F55A 1NEEA 4OZNA 1HH4A 1TVRA 1ADJA 3ZJTA 2GN4A 3VR1A 2GYYA 3CV3A 4DARA 3H90A 2FRDC 4O02B 2OCDA 3ZE7A 2BSXA 3T1HB 3N5BA 5WRFA 1TKTB 1O6CA 4B8ZA 5F23A 1T9VA 5DP1A 4M21A 5I9TA 4YCJA 1CJVC 2JFOA 2Q6LA 2DRAA 2HJWA 2CWXA 2IMWP 4BKPA 3JQGB 5CGZA 3W7VA 5D4NA 4I6YA 4H1VA 2CNLA 3H97A 3G86A 4II7A 3ILLA 4KO4S 2JFVA 1D8YA 1MABA 5E1DA 4MWSA 2GIQA 3BWMA 3DRYA 3RSSA 2JJ4D 2NOAA 4LSZB 5IFKA 1XTQA 4I6EA 5F76A 3VR6A 2PKCA 4N8OA 1YWGO 3C14B 5AM0A 1MNQA 1DRZA 1WULS 2D2XA 3VPSA 4GMXA 2LD4A 4DIKA 3KEOA 3GYGA 2VHEA 1M5HA 2FJPA 3CZMA 4GUAA 3K7RA 4C7OB 4J9SA 2IYRA 4E1AA 2J0UA 3T3PB 1ZRHA 4UBKA 5AE3A 3AILA 2YDYA 4PO9A 4F02A 3HJAA 2AKWB 1VJWA 1CVJA 2EJCA 2I0FA 2XUZA 3OPXA 2ZAIA 1IYZA 4A0SA 3PE6A 1Q19A 2B92A 1RTDA 5COQA 4A8KA 2DWQA 4RBVA 2QPAA 1Y4SA 1CQZA 2GD6A 3I01A 3U44B 1M8PA 4JH0A 2B36A 4QTUB 4TLEA 4HTIA 3ZTQA 3OCYA 1G7CA 2PVPA 8ATCA 2W43A 2YC4C 5KWEA 3HFRA 4A6XA 3Q0IA 1DQPA 2FPWA 3OXFA 3PRKE 1AGYA 1IJFA 2C5AA 3V4PB 2W2PP 3ECAA 5E3PA 4D8WA 1I24A 1O9GA 4EKYA 2PA0A 2XBPA 2JLYA 2E7GA 3AT1B 3MT9A 2NXUA 1K8RA 3HACA 2FQQA 2PFSA 4IJVA 2MSEB 4QYMA 3QSYB 5EJ7A 3FCEA 3U80A 1Z38A 2JBHA 4KX3A 4DXDA 4OYRA 1SVIA 5T14A 4JI5C 3ZZYA 2DB3A 1XVLA 4CUJA 1Q21A 4BGUA 2DPJA 1N2FA 4Y2PA 4K6CA 4R83A 1C0IA 2FZCB 5CYMB 2C2GA 2ST1A 4TLDA 1GPWB 5JXHA 1TMJA 1FYDA 3RHSA 3M33A 2QNRA 4MYUA 1YOVA 1VRCA 2QG6A 1CUXA 1ZGHA 4A6EA 4DA0A 2DUJA 1THTA 3H5VA 4Z1MD 4UDYX 3HC7A 1N6HA 4ZN3A 1CUCA 3EICA 3ECCA 5CB4F 1I9GA 4OX9J 2V8HA 4AWBA 1L7XA 3KHHA 2QR5A 2DUWA 2JCSA 3JD1A 3TQTA 1H4TA 4Y2CA 5EFOA 5T64A 1Z4JA 2JEOA 1ZM2A 1PT5A 4FQ5A 1A1VA 2CYBA 5SY9A 1RAFB 3L0YA 2RHSB 3RR2A 4YV2A 1II8A 3DI6B 4NI2B 3NKVA 4RGQA 4ZI7F 4H4CA 4LRYA 3ADKA 3IEXA 4MS1A 4ZHSA 2P9QA 3K0HA 4PNZA 1Q2XA 1PNOA 4TLMB 2P3OA 4HVTA 1AHPA 2QMWA 2GIRA 4G86A 4JLMA 3PQ3A 3SF0A 2FVQA 1FI4A 2COKA 4QX6A 1UCNA 1OIXA 3LFHA 2NTEA 1UBFA 3PRYA 3T52A 2LE0A 4Z51A 4OHXA 3VM6A 1U1CA 1M34E 3X1YA 4YQYA 4FUQA 5FNZA 5AXBA 3KKNA 4U0JA 2F3UA 4P3PA 3ZHCA 4DMCA 1H0SA 1MCZA 1HE1C 1F0XA 2C2EA 2YIVX 2ROQA 1V4BA 2E5LJ 1JG4A 1RACB 4H1HA 3SNKA 1ORIA 3EF0A 1UQTA 2LP4A 1Z2PX 2J33A 2QROA 3RAXA 4D9MA 4LV6A 1WDKA 2RE8A 4CCHA 4A16A 2QA1A 1XRMA 3I9V6 4F5DA 1EJ2A 3VPGA 1ZY2A 1RE1A 5CITA 1U7UA 3HJFA 5GONF 2QTZA 3EIUA 3HVWA 3C5HA 1AXGA 1HNZJ 2ZK7A 4DZDA 2ZATA 4H31A 2P91A 2PLWA 4IHJF 2IV2X 1W85A 1FWKA 2VDRB 4RO0A 1FTCA 1Z0KA 4PPZA 3U39A 3FPFA 4RNOA 1Y4UA 3OO0A 4ED1A 3SHOA 3V3KA 1E6MA 3U0VA 3PJXA 4E5UA 4Y9TA 2VOOA 2UXDC 2C4KA 2QFJA 3UA4A 1KMQA 2YXEA 1DQSA 5JC8A 1JQDA 3FNIA 4Y8VA 3PRBA 1BWPA 1U8YA 1U8XX 4ZREA 3B5IA 3ISJA 2QORA 3VAIA 1HQDA 3MM8B 2AQKA 3VH4A 3CW2A 1YRYE 5HMMA 1XC7A 2EATA 3CE9A 1MX1A 2FWPA 4OQYA 1Z75A 3CUKA 2VKTA 2BONA 2G9VA 3PG9A 1EQAA 4K0RA 2OHGA 4O3PA 4G9BA 1PL8A 2ZTLA 2X5XA 2CJBA 1NW8A 4AQYB 5JNRA 3HJCA 4PHCA 2XT9A 3WGOA 4E6PA 5A03A 4TN1A 3EHEA 3PDJA 3UK6A 3QW4B 2QM7A 1I10A 4YRRA 1VJGA 5K8FA 1ZBTA 4HH4A 3ZJUA 1WZUA 2OR3A 2BJHA 4PABA 3DLHA 2B4UA 1UBGA 2GDJA 3QRPA 4HDOB 1VCOA 1ISFA 2HHHC 4JQOA 4ITVA 2CFRA 4TYYA 1L7PA 4BNNA 2JFUA 2C3MA 4HAWA 4DTCA 2VZ9A 5FI3A 1XWIA 2FWNA 2NQTA 1Q0NA 1I1QB 1QO9A 1M8JA 2J5AA 3IT3A 4HZUA 3CX4A 3JVIA 3TA2A 5J2UB 4RADA 2XDAA 1US8A 5IYZA 4RWWA 2XQFA 1ZR4A 4X41A 2ASJA 4G8DA 2P7IA 3GPIA 4CCYA 2ZJ3A 1NL3A 3DMDA 5IM4A 4EVRA 1ZZGA 3MQFA 5CH8A 2DFPA 3W6OA 1CG2A 3RS0A 1J22A 2XUGA 1QWIA 3SC2B 4HDAA 4WADA 4KH1A 2HWIA 9LDBA 2R1TB 4J16A 5IC5A 2OGUA 2IODA 4F67A 4FWIB 2UU9J 4HC4A 1R18A 4J2OA 4A46A 5CYJA 3CPJB 1X1EA 3NYQA 1QE1B 1NDHA 3EWIA 5LUAA 3U1MA 3IP0A 1XMXA 3IMFA 5JBNA 1EP1B 3ZHUA 2Z2ZA 5D87A 1AGPA 5CM9C 4LOAA 1HBNB 1OLXB 1M6XC 1ZK1A 2R7OA 4EKNB 1FDIA 3NDPA 2CPFA 5KB3A 5JDIA 5A8KA 4H1UA 2P9EA 4JXXA 2ODAA 4LGMA 4GOLD 1MU2A 1MENA 5JI2E 1LFAA 1KXJA 5CVVA 4DUYB 3B1XA 3R2JA 5EJIA 1JQBA 2PZFA 1J39A 3RLFA 4NG4A 3GFFA 3B9RA 1NURA 4MVJF 4IDDA 3A1YG 2HRCA 1U5BA 1TF5A 5SICE 1LDYA 4YCAA 4DR5J 5F8HA 3E6AA 3L0ZA 3K58A 4RSMA 3W63A 2PX8A 4NWIA 1EFPB 3DLBA 5B3JA 4AJLA 3I4LA 2C1EB 1EFDN 2FLKA 3FQLA 3OTGA 4ENSA 3STXA 3UFCX 1ZICA 3LHFA 2V7GA 1J8FA 2Q99A 1TAQA 4TU7A 3RK4A 3M2PA 4ZT2A 3MAQA 2IXAA 3A4VA 1NYTA 4QASA 2ZT7A 4LHVA 1RXYA 4B73A 1EINA 1R8JA 4L28A 3VPXA 2P9TA 5J1SB 4YAWA 3GSDA 4U3JB 2O67A 4HWRA 4MWTA 4GOOD 1BJTA 1UINA 4EUHA 3H4VA 3DYAA 1AY0A 4WN3A 1E9FA 3ZHOA 2QTCA 3NNNA 2QL7A 2OPLB 4Q1CA 3WOVA 4RDXA 3NASA 7FDRA 6AT1B 1LEOA 4RZIA 2WOMA 5FBVB 3SSQA 3IGVA 1Z5PA 2HK9A 2YS7A 3FOFC 1OZHA 2QB5A 3R7NA 4G36A 5CUQA 3CWCA 4R3WA 2NNLD 3FJYA 2NZ4A 2PL3A 3VA7A 3V6DA 1OGYA 4JI0F 3GFTA 4U7HA 1Y00A 3FPLA 4C6HA 2VQFB 3K2QA 5B37A 3GDWA 2JC3A 3VH2A 4YRPA 4IH9A 4B9EA 3I83A 2OP1A 4KL8S 2FSUA 1P60A 2Z30A 1IWBB 1UMDB 1S8OA 4DLBA 2IAJB 2X15A 2ZWPA 1MJHA 2YNMD 4YONB 3ADAC 1PP4A 4DKXA 3G2MA 4GPEA 2IPXA 3UB4A 3F6BX 3MM7A 1N0WA 1RM0A 5IVHA 3ZU3A 3FE2A 1RW4A 5LWHA 3HCXA 3A9SA 2C9BA 2WINI 2NU8A 3T9FA 2X8AA 1YDMA 3KUDA 2WU0A 4WXHA 4BZPA 5TT0A 1JFFA 2QD1A 3JQAA 2BSQA 4DUZB 5ABPA 2WR8A 3NP9A 4CO1A 1LPMA 2OHVA 4MW9A 3QEAZ 4CLXA 3MEQA 2CC2A 2F3RA 5FTKA 4WGFA 5NULA 3VPAA 5HZGA 3TSCA 3AL3A 4C76A 4W5JA 2ZUFA 2QS9A 3MIZA 3NG8A 1CLFA 5G0WA 1T2VA 5HO4A 2XMUA 1YCGA 3MD1A 5JNTA 3AWIA 3HZHA 1N0UA 1ZMBA 3P4UA 3SS7X 4QBKA 1M6VA 4HDKB 2ZIWB 2H1SA 3VU0A 4PYKA 1BROA 1J42A 3NHPA 2XA2A 3BFKA 4CKBA 3UT5A 3DMPA 4A92A 1K89A 4G09A 3PYDA 4D5EA 3G0CA 4X66B 4KR7A 1R0AB 2PU5A 2WT9A 3QBVA 4IIUA 2D3O1 3V8MA 1D5CA 1JZQA 1WPXA 3R4VA 3RYCB 5J1EA 3I0RA 1QP4A 4FT2A 4XDZA 4L4UA 4BWVA 3AW9A 3DZHA 3RKUA 1V1MA 1JW9B 1RWPB 3QT6A 3BXPA 3TE7A 4OTZA 3ND8A 2PLAA 2TMKA 3ROTA 2W8ZA 3ZOKA 3CVYA 3DLKA 1NXPA 1E61A 4Y9DA 3Q8SB 3A3NB 3T0GA 2HNZB 3EYWA 5JXSA 2RCYA 1I3CA 3M2VA 1VM6A 3IVRA 2UUBB 1YJ8A 2WSCC 3GONA 4MKXA 3ZE0B 2Q1WA 4IDQA 1KWKA 1RHKB 4NLLA 4HT7A 4GZ5A 4B44A 3H1PA 2YWJA 3C2PA 1FDAA 5L4LA 2ZJQQ 1AGNA 4QPTA 2FHSA 1T11A 2EAUA 1O6ZA 3LQYA 2Z5VA 4ZDNA 3BFJA 1Q92A 2F1KA 1W6RA 3W8DA 2PLFA 3ZUGA 1CS4B 3FKSD 4IV0A 3U7GA 3AXMA 1RJGA 2VF2A 3RKRA 3QTBA 1B64A 4PHFA 4AUMA 4RTSA 4BFSA 5FUMA 4PLYA 3PFHA 4I7FA 4B87A 1TVRB 2EV9A 4RVHA 5K1ZA 2FF5A 2W2OP 4I8IA 2AXNA 4YXWA 2MQMA 2MMAB 4D9JA 5ITSA 4KGDA 3IKTA 1JHMA 1L5NA 1LTHR 4DHWA 2YWEA 1I8TA 3RU9A 2RQ4A 4DX7A 2X0IA 3W1VA 4NU5A 4RTKA 1L2FA 5E9WA 5EIXA 1NVBA 1Y6RA 2XHZA 3AFOA 1RT2A 1D8TA 5BMVF 5HM6A 1D09A 1FOEB 5I4CA 1VISA 4Q4DA 2MLXA 2EKYA 5BSHA 2CNLB 4C8OA 1QYRA 1NDQA 4JUCA 2B9YA 1P80A 4PX2A 1MABB 1EUDA 4ZT5A 4ZCSA 4OA8A 1LWNA 5IWCA 3IAEA 4ES6A 3F5MA 1E8NA 2Q2NA 3ACBA 2DR6A 1DC7A 2R8BA 1QFYA 4JI4F 2XG8A 3RFVA 1E1DA 5CCBA 3CTPA 2ZC4A 2O2JA 4K4ZA 2QRUA 3RVRA 4KBIA 2QTVA 3T4PA 2C3YA 4CJXA 2P35A 3S2YA 2ACVA 3LSYA 5FBQB 3TECE 4OQLA 2MJUA 4FI3F 2J0UB 2HDWA 4PYMA 1V3UA 2F9FA 4KXNA 1Q50A 1TQ2A 1E8MA 4RTPA 1KNQA 4QR2A 3R3SA 1YJQA 5K3SA 5E8RA 1ZZEA 1PC4A 5ALWA 3E23A 3LZCA 2XWXA 4J29A 2G3YA 3DXFA 4E8UA 1IZ0A 3OZBA 3PJRA 4XCQA 1N2EA 2ENUA 4H7PA 1RTDB 3HBFA 2VQ6A 1YBAA 1MTZA 5LOVF 4DSZA 1GDHA 2QZSA 1R6YA 1VG0B 4E5NA 2MLYA 1UZDA 3T15A 1UETA 1G7CB 3WYFA 8ATCB 1ODTC 2Z1DA 4UJ5A 3AI3A 4TL7A 1YJWS 3WSVA 3SCJE 2AOWA 2VG8A 3UMCA 1STOA 1IJFB 4KR6A 3CH7A 1OZFA 1WAMA 4L6V3 1NXXA 1TYZA 2MYTA 2XLBA 3HVIA 2O5EA 2E4VA 3GZTB 4W92B 2FQQB 1FIUA 4FBLA 2C7OA 4PEVA 3AHFA 4B5LA 1AG9A 3MEKA 4PF1A 4RZ2A 5CABA 2VHWA 3GPDG 1XXHE 3F6YA 4IIXA 1NY6A 4FN5A 2DTJA 2ASYA 1H2HA 1SZCA 4ZFNA 3CJQA 1BOOA 5EWEA 1ISJA 4QM7A 2OGZA 1GMWA 4AG6A 4KBFA 3QSIA 4Z7JA 1XKQA 1YUNA 3DAGA 5FNVF 4TMXA 1YOVB 2QTLA 3Q3CA 2ZU6A 3BZBA 3H2ZA 3P26A 4LJ5A 3BYPA 3GJ0A 4MV0A 1RWBA 1BHSA 4XIFA 1CUUA 4Y9UA 4DR6B 4IV5A 1HL3A 2JI6A 3VU9A 1H2ZA 1CVLA 4C0OC 1AT1A 2BGIA 1X0PA 4UPVA 3ROFA 4EPXA 2ZM6B 4EMBA 1AK9A 4D81A 2JD1A 1K0TA 2X0KA 3STTA 2CLOB 5B55A 4EHLA 3OEYA 3MWFA 1Z1ZA 4DR3C 1II8B 4F96A 4PYDA 5KOYA 1KOHA 2L48A 1Z39A 3NGTA 2RKOA 3E61A 4RYLA 4MS1B 4M9QA 4HKQA 4OJNA 2OUGA 3WWPA 1ISGA 3LTOA 1XTPA 5IP5A 1DO8A 3G9QA 4NE9A 5A4IS 2WZ1A 3RPEA 3LT5A 2R2TA 3IWLA 3NWPA 1EE2A 3R97A 3NV9A 3U7FB 4JJ4A 3PZPA 2NSDA 1DEKA 4DX8H 5LQDA 1S6PA 2YQ3A 2ZRAA 5J2TF 1LOUA 3RCBA 1ND6A 3AOBA 3FMBA 1SWVA 2OO5A 4AY6A 1U7WA 3R0VA 5LB2A 3WMEA 4JI1F 1EB0A 3BH0A 1ADBA 3P8BB 1USVA 4HI2A 4ZYVA 2A6OA 2Z8ZA 2E87A 4E4TA 1EX6A 1XMVA 4M86A 2K7JA 1TVEA 2UUPA 2QSZA 2RAVA 1TZ0A 3D0OA 1XA4A 1M5VC 2OH2A 5EIWA 5E3HA 3ADDA 5CGQB 1WB4A 1WW8A 2V55B 5E9AA 5HDQA 1XNQB 4U8YA 5J5CA 3EQ6A 1GAEO 2JVIA 5IAEA 3FGPA 3GRKA 3O4JA 3NT2A 3OX4A 3PYLA 5FF9A 1IKWA 1YO6A 5BN3A 1VEHA 1RE1B 2GGSA 2QQFA 1MVOA 5IW8A 4Z7OB 2RMKA 2R44A 4TZ0A 4FR2A 4KY3A 1AS3A 1C7ZA 1I2AA 4GHWA 1TL7C 1RM5A 4DEZA 4G6VB 3EG9A 1W85B 4P93A 4LDZA 4X4NA 1AKMA 3C98A 2I4OA 5ECGC 3UE2A 3LUJA 2BQ3A 4TRNA 1XMOJ 3V32A 4LISA 1WVIA 4WYWA 3IP6A 2O57A 1KBQA 4B75A 4KBYA 1TAGA 4D41A 3DMHA 1P7CA 2ADMA 1Y5LA 5IANA 1OFUX 1BU5A 4OJMX 3HXPA 3ZGLA 1K5PA 4YROA 4U9UA 2QP3A 2DGTA 1WW2A 3G6XA 4P22A 3BQ1A 2XE6A 1ZEMA 3UAGA 3ZXYA 5CIYA 1DINA 1GTSA 1ZCBA 2AB0A 2B0GA 3N6NA 1XZPA 4PGMA 2YIMA 1VJRA 4GSLA 3D9QX 3G7UA 3WRXA 3RS9A 5A1GA 3DOHA 3KHUA 2V7TA 4ZK6A 3THVA 1R15A 1H93A 3AUSA 4W1RA 4TY9A 4MQMA 1KY3A 5JYBA 2H54A 1Z18A 3LQRA 4AS3A 2D5BA 4ZYWA 1CUIA 3HDHA 3VAMA 4HK4A 3RHZA 1FQJA 2PNFA 4TS4A 1W9HA 1XZJA 3ODPA 2ZR9A 3TVZA 1JUDA 3FJ2A 4CN9A 1Z6XA 2PCJA 3W0LB 2FLVA 2PX3A 4EG1A 1B1CA 1UKZA 2J6BA 2XA1A 1MP0A 4HZUB 2P6PA 1YE8A 3HHLD 3T5GA 4UOFA 3DKIA 3NPAA 1US8B 2WMYA 3O4FA 4MMZB 5IYZB 5HIIA 4QBTA 1DKMA 2ZBUA 1R4MA 4LGVA 4ZPWR 3PC6A 5GMDA 3CJ8A 4CCYB 2SCUB 5C5IA 3MCTA 4LQLA 4CIVA 3UQYS 1QX3A 4RV9A 3TM4A 1UFRA 4KH1B 3TNLA 3H2JA 2GXAA 4KK3A 1S0NA 1APBA 3ZU6A 5E3RA 4DGQA 2IEDA 3VVTA 3FI9A 2AMVA 1NW6A 1Q83A 2YTZA 3HJUA 1BY9A 4YT8A 5JZ9A 1H65A 5EHZA 3DC7A 1S2MA 3FKBA 2ZE8A 3ETJA 4KAIA 4V19J 1WSDA 4LK3A 5BWBA 1D1PA 1SQGA 3L9XA 4K2JA 4U6SA 3O44A 1S2OA 2Q1XA 4UOGA 1BDIA 5IPFA 1KJWA 1EXWA 2YNFA 3GDOA 1K73T 2LLZA 1TNDA 1VLLA 4E5MA 2QLBA 1MU2B 3FWYA 4L1KA 1NUAA 2DFDA 2KPOA 2ADFA 3C8YA 5JJBA 2G70A 1BVUA 2HK7A 2JKVA 3A2KA 1N6LA 5FPHA 2OFFA 2LXUA 2DT8A 3H13A 4YR7A 3FQKA 1XKTA 1U5BB 4YRKA 1KZ6A 2QRMA 3NTVA 5IBPA 4YB8A 3PUYA 1ECGA 1GXUA 3OE4A 3IVMA 5M2UA 3LAMA 1KDYA 2Z57A 2AF6A 1QIKA 3KJVA 4DABA 1BE6A 2G9ZA 2FPGA 2ET6A 1R43A 3MB8A 3BCSA 3CR3C 3JTMA 1JHRA 2BRUC 1ZOSA 2P2JA 4HVAA 3SN6A 4AKGA 3D2CA 3CO5A 2DKNA 2AOVA 3KKMA 1XCLA 4BJ3A 1BH2A 1DS6A 3B1JA 2FMIA 1OI2A 2RBKA 3I0SA 1CDEA 4P3KA 1PNVA 4QJ4A 1NNI1 2EC0A 2DAPA 2VYVD 3DTVA 2QTAA 1M2FA 5DLDA 4R40A 1CJUA 3DQQA 3LC1O 3DYAB 2WM2A 4JL8A 4ANEA 1X7WA 2CKWA 3HVKA 5FO0A 1W52X 5ICCA 2Y0EA 2QAGC 3K0BA 4QQKA 1WWKA 4RH3A 2WOMB 4TYQA 3R7NB 4M2LA 3I1IA 3OPYB 3V6DB 5HFNA 2ZBVA 3R5BA 3AR5A 4DR1J 3K1AA 2QYOA 1NRWA 4KFBA 4EVQA 3BF7A 5KFJA 5IDWA 4ZVTA 1VKNA 4ELTA 3G6WA 4HT5A 4HYQA 3P5SA 2FN8A 5JWOA 1FXWA 2ZBIA 2ZH6A 4TU9A 2AUNA 2NVOA 3PDIA 3C6TA 2Z30B 1QQBA 1P2TA 2Z2IA 3EXG2 3SZGA 4E4YA 4HRVA 2JD0A 2O2CA 3MM6A 2KFYA 2O3RA 5F33A 4UARA 4IQ4A 1HBOA 1UIMA 5DI3A 3HR8A 1M6NA 4RDHA 4CDNA 1XA0A 3VC7A 1A7UA 4NYJR 3G2OA 2XLCA 3MM7B 2ZI3A 3ZWQA 2R97A 5TLSA 4QWAA 2AFIA 1JILA 1U4NA 2Z09A 2P3SA 4FDMA 1MJGA 5G0RA 2NU8B 4ESHA 3NWJA 3GMSA 2YOHA 1JFFB 3TD6A 3JQAB 2K2QB 5T7LA 4EKEA 1GTG1 1RNLA 1A4UA 1BAPA 2VHTA 5F2KA 5IZCA 1F8GA 4H7DA 3WLAA 2XGMA 3E8MA 4KNWA 1I1HA 1F2GA 4H2DA 4X62F 3PTZA 5IJXA 4YAJA 4HR2A 4US1R 1HNXB 1PGQA 2CQDA 4YTEA 4QEKA 1ZCAA 4JLAA 4IDPA 3N70A 3DV9A 3P4UB 1KK3A 1LC3A 3ORFA 3KT0A 3DLPX 1A5ZA 1SQSA 1GM5A 2HK6A 1M6VB 4Q3OA 1WDMA 1WG5A 1TADA 2ZT8A 3WJ7A 2BR4A 1E9BA 1IATA 2YZ7A 4PZ0A 3GRRA 5HN0A 1RKXA 4CKBB 1OZAA 3UT5B 2GI4A 2NT3A 1L7BA 3HVJA 1Q1ZA 4RANA 1CUYA 1RIFA 2BFWA 4MWEA 2OEKA 5HI7A 1DUIA 5J1EB 3I0RB 3NL0A 4D99A 3D7KA 1NBAA 4BGVA 4F21A 5EQFA 3QZ7A 3EJ6A 1CUDA 4NFLA 1V1MB 2V6MA 3L0BA 1YHYA 2Z3VA 1VCMA 4XPZA 2DO4A 5AI9A 2ISQA 4KVZA 3PLRA 2WUGA 3VXKA 4YUVA 3OLAA 2QX6A 5IN5A 3LK6A 3H9EO 3DLKB 1PBTA 2FB9A 1FDTA 3OICA 4HWSA 2OG2A 4HGPA 4XXHA 5KTTA 2ZZNA 4XFDA 4MHTA 4B3SF 1D6MA 4AD6A 3K6KA 4M1QA 3M30A 4YRLA 3M2VB 4RW4A 1C41A 4ECRA 2CNNA 5IK2D 3F5SA 4RIGA 2B8EA 3QWPA 4ZT6A 9LDTA 3IDSA 3GQBA 4DV3B 1PHPA 4DIBA 1I94B 3E3AA 2X7IA 3DR5A 2B6AA 4IFYA 4HXGA 3JWPA 3HUTA 1P29A 5SZIA 1ZUIA 2RB4A 7YASA 4YY3B 1PN3A 2WUVA 3O38A 1DAOA 1S01A 2NXCA 2FZ5A 2FW8A 4MYHA 4JFRA 2PC6A 2DEIA 4I7FB 4YI3A 4LJAA 1FKPA 3C6ZA 4R41A 3R2DJ 3SQGB 1I7LA 1YDWA 2P0EA 1VQ6S 1W7WA 2J5XA 1U4SA 2J9FA 5SYAA 3HLKA 3O91A 3DPIA 2QRRA 1FJEB 5CDTA 1XS3A 2AR7A 4JLBA 5LYJA 4D44A 3B3GA 1RT2B 4C7QA 2K4MA 1D09B 1DBWA 1WUUA 3IQHX 1E64A 4DSEA 1NBOA 5EX3A 5C7OO 1TUWA 4WCEQ 4DSUA 4DN9A 5IG2A 2JVOA 1Q0ZA 1EUDB 2OE2A 5EEHA 2RONA 4G41A 4MGZR 4KPUA 3WE7A 1G3OA 1Z36A 5KREA 2WSEC 2QTVB 4CL2A 5IWAC 3QX8A 4CODB 4DV0C 3ENZA 2BJ9A 1XTUA 1RAGB 4K5RA 3LVFO 1F4LA 4AZSA 3I9KA 4ZPXA 5HVGA 3T5MA 3G5UA 3RWBA 1N8KA 4HHUA 2W48A 4CF4A 1RZ3A 5FWYA 1OUMA 4QYZJ 3PD0A 3CU5A 4EGCB 1PR6A 3H4MA 1R0RE 3MT7A 9RUBA 1IK4A 3L2OB 2JLEA 3BFVA 2E5WA 4CIWA 1RYDA 1U2PA 4UXIA 4ZTBA 1CUGA 1AO3A 1PL6A 1HXHA 3PXBA 4Y6PA 5ETTA 2H8KA 2I4RA 1SCJA 1KVUA 3EGDA 4KO8A 1K8QA 2XKJE 2VSNA 1UDWA 4ID8A 1RYEA 3ND7A 1K7XB 4LQ9A 2DNOA 4CLZA 2W9BA 4DUZC 4CBVA 1BJRE 3GIWA 1FK9A 4PBRA 5AICA 4QE3A 3V97A 3DMTA 1GL3A 4BLTA 1L4EA 4LSGA 3QYJA 3QJPA 3HD1A 3EVCA 4KQXA 1IPHA 1JAZA 4M1SA 4F92B 2FJXA 4WS9A 4OIMA 2PGXA 3UC9A 3RSFA 2CQ0A 5KG0A 4F8EA 4TN5A 3S3TA 2DGVA 2Z0MA 3NRCA 1VL6A 2NYAA 1XE3A 2V58A 4LFAF 5H82A 4EY8A 1WLYA 4KX5A 4JBHA 4EG7A 3ILYA 1J9ZA 4O2RA 1GIAA 4G8CA 5E1BA 4FFDA 5EUCA 3IBYA 4ETMA 4E31A 3VI3B 3A06A 1G7RA 1E7SA 4L6IA 4A0QA 3VU9B 1IN4A 1AT1B 1VIVA 2IY8A 4B3FX 2FP4A 1U8UA 3ORSA 1GYRA 1T9HA 5KJ1A 4XLTA 4B43A 1WDWB 1GH8A 5AJHA 4MEBA 1LW2A 2F5GA 3PXCX 1N5KA 1N2OA 2I6WA 1UAWA 2JOQA 1ZGAA 2YTCA 1BE1A 2AZTA 4F2DA 3G6ES 4MNTA 2PZMA 4NBTA 3RIEA 4OBWA 4G0WA 1JBEA 4MVJI 1DEHA 4ZO9A 4JUZA 3RUCA 2EC5A 4Y0NA 1S6PB 3UWKA 2FPSA 3CJ2A 1T1SA 2WZDA 1KQ3A 1G20E 4MQ5A 1Y7HA 4AO6A 4MH4A 2J8SA 1SIWB 3MGAA 4Q9KA 2B8JA 3T7TA 2PHZA 4XRGA 2ZU0C 2WWHA 3OTHA 5AH0A 2MDTA 4GVPA 3RGIA 3M6VA 4ZYXA 2FR0A 2NSHA 5CVDA 2PXAA 3D5MA 3OX2A 2Q5QA 2ZH1A 4HR7A 3G71S 1RM3A 4LFCB 3EDMA 2I4MA 3T7CA 3TEHB 3UD3P 2FPIA 1JLLA 4WZMA 2I6GA 1RXEA 1PZEA 2KL8A 2UZ0A 3RC2A 4HF7A 3EMKA 3R7SA 4IYRA 1IKWB 5BN3B 3W5IA 1J2VA 4E6EA 2HA7A 2ZDGA 3BMOA 3I64A 3KK2A 3HO1A 1NHVA 3C8MA 5HF6A 1RHJB 5KPDA 4IDNA 4WBNF 3D8TA 3WC2A 2GRJA 3I2GA 3T7SA 1RC0A 3U1NA 3B9QA 4F1JA 5JAZA 1RABA 4B3MJ 2I6UA 1I3KA 2JGIA 3WZLA 3EG5A 4H6PA 2R8EA 1NUUA 5JANA 4MK9A 5HQMA 4L07A 4NOJA 2GMJA 3FCYA 1ZJYA 4RVGA 1R0ZA 1JPNA 1W73A 2PQ0A 3DVAA 1W59A 2FEMA 4TRRA 3HDQA 3H9JA 4DL7A 2FSVA 4JFAA 3I1FA 1EFTA 2RI6A 1Y3CE 4J7UA 3D6FA 3CPWR 4DQSA 1R3UA 4B3TJ 4RM3A 1Y5LB 2R8PA 1IBKF 3OT1A 4Z2XA 3PEFA 3DLLQ 4MTCA 1KRXA 1Q82T 4UBNA 2AWZA 3D0KA 3GVHA 2DHGA 2EBWA 1J20A 3TZHA 4BO4A 3Q3EA 4MIYA 4X6UA 3OF5A 1C4AA 2QIFA 3K70D 5E7MA 4Q34A 5AI6A 1J9GA 5HKBA 5B0FA 2O1WA 2Y0BA 4IDFA 2YV5A 4M8NE 4NLTA 3W5HA 4KHPJ 5ECWA 2M3DA 1Y34E 4WNIA 1J5EJ 3B1WA 1Y6ZA 5LQCA 5TE9A 5E8JA 4CQMD 3AJ8A 5CQGA 4CIOA 5LMUC 2H54B 3ZHZA 3OZ7A 2B4TO 2Z9DA 2AKAB 5KQGA 5TPZA 5HBGA 5BV0A 4MMYB 1VQ5S 4MUIA 5JNWA 2XOEA 2WWIA 5FA6A 1ULTA 3KPWA 1JMVA 3PW2A 2X8WA 4Y1FA 5D5QA 4C29A 2GPTA 1TL1A 1SCUA 2JIRA 4RWXA 1LNZA 4FGJA 4TWRA 2F8MA 2QLJA 4BRWA 1T5BA 4MQEA 4YAEA 2VCEA 5LJLA 2FZ4A 4WF9Q 2WSSA 2NO4A 3LBNA 3DVSX 3FVWA 5K51A 4DIFA 3EB9A 1JQ5A 4D92A 1KWGA 4ETNA 2OZVA 1R4MB 1JLEA 1MNEA 2FPOA 5I8WA 4LSNA 3RRGA 2XD4A 1ZQ9A 5ETNA 1F60B 3NGUA 4EX7A 5DT2A 1HG0A 3MR3A 2BI8A 1S1VB 3PXDA 3L4EA 5CNMA 2HH9A 2ZM6C 2VN8A 2C03A 2RSLA 5LCIA 2EL9A 3EPPA 2Q07A 4W99A 1P91A 2HFSA 4JXJA 1QIIA 2HREA 1ADCA 2DQSA 3QJJA 4Q7KA 2XNQA 2R2GA 2FGOA 4DC9A 2EL7A 3ORRA 2QUIA 1ML3A 1P61B 1HFWA 2GK4A 4MCHA 4CF3A 3HNOA 3B60A 3CJTA 5E7JA 3THOA 3CH5A 2O01C 2KFNA 1FXSA 4EHHA 3PCOB 3W5XA 2VNAA 2YNFB 2RGCA 4B33A 3NBAA 2QLBB 4O4GA 4FBTA 3Q9UA 1EM6A 4C07A 3G8YA 5AW8A 1KEVA 2UXBF 1XTKA 2GM3A 3VHQA 1GRNA 3REFA 3BKFA 1P7YA 5CDGA 1JNXX 4HNTA 1R7IA 2DQKA 3RRZA 4UTVA 2OZKA 1S9FA 5EQTA 1NVUQ 2Z57B 5KT6A 5K3EA 3KJVB 1YI1A 2WWGA 2FPGB 5HCIA 2FJVA 3U60B 3QXXA 1SKYB 3HJBA 3MD0A 1Q57A 2EVZA 3IKMB 5CNIA 4EA8A 2A4MA 2E9ZA 4NIMA 1NW7A 1K2VN 4M76B 1L5WA 5DSTA 3VSBA 3PNPA 3FUYA 4PPGA 2DGWA 1U0HC 4HQNA 3MAAA 2J0QD 1U3VA 3I0ZA 3M9XA 3U7IA 1U7LA 4WKOA 4FYMA 3I0SB 4NS1A 3REOA 3GELA 2BIFA 3GVPA 3T8YA 3V8NA 4J76A 1M2WA 3DTVB 4D9BA 1WDDA 3C6UA 1CJUB 3V48A 4ZOQI 4MZXA 2VJPA 1X7WB 5JPIA 1MNAA 2BZGA 4PN3A 1YS7A 2JLSA 1FESA 2FPRA 3LK7A 3IWNC 1H3NA 3UXMA 1C29B 3VGTA 4EENA 3Q7IA 3V1NA 5KFQA 3VNRA 3V2HA 2IZ0A 2CK3D 1A2KC 3N5KA 5B1YA 3E3XA 3QEKA 3B3FA 4NENA 1G60A 1XDUA 2EFYA 3H16A 3K1AB 3CW2C 1IAQA 4KFBB 2IKQA 3SIRA 5T67A 4ZVTB 2XM3A 1KSJA 2W6IA 4PUHA 5IDQA 2HS0A 1OB2A 3PDIB 3C6TB 2UYHA 4IFVA 1GPLA 4EKDA 3QHQA 1DVRA 3MM6B 4NF2A 2BD0A 2MKYA 1PTJA 3S68A 1HBOB 5DI3B 3NGDA 1A9OA 3HGTA 3MELA 1MGPA 2R5NA 1J2YA 3F46A 1X7YA 2WUWE 1E3IA 2ASDA 1EQ0A 4HH1A 4LJYA 2RE1A 2UZ1A 2YN2A 2AFIB 1REVA 3IB3A 1E7QA 5AJTA 4D3ZA 5G0RB 1DBRA 2SKCA 4N7MA 1SU6A 4MVJG 5A76A 3H4DA 3KUGA 1SFRA 1NX6A 3H7IA 5T7LB 3O95A 5F2NA 2GO7A 3EFEA 4R2IA 4MUJA 3M6WA 4EW3A 1Z12A 4HWOA 5CX4A 5I7RA 2NSLA 1ZW6A 4E03A 2H3HA 1X7DA 4BY9E 4MRMA 1NMQA 1B42A 3R0QA 3I34X 4PQUA 4ZVSA 3GT0A 4J0FA 4XDHA 4LIPD 4IGAA 1SNYA 3QUSA 5DTIA 2RHDA 3GBSA 4S0XA 5E9JA 1NJ2A 5K0BA 4KN6A 3BSWA 4TXJA 5K0FA 1LDNA 3Q3VA 3VVCA 4GYWA 2A5DA 2XUFA 4XM1A 3Q0TA 2JHGA 3TZWA 3K2YA 1Q1BA 4QGGA 1UMKA 1FA0A 1E59A 3CJKA 3BO4A 4KRWA 3BZQA 1NK5A 4YV7A 2OM6A 2V8BA 2K1RA 5DM6Q 4ADSG 4KMMA 4TMWA 2EW1A 3A4IA 4IIGA 4QUGA 2K6GA 1ITZA 4UU0A 4Y2XA 2JMPA 2XMQA 4C30A 2E21A 2RQKA 1PW5A 3JWIA 4BU0A 1C9DB 3GLIA 4NECA 3ZCQA 5FJJA 4BLGA 4KQCA 3UA3A 2Q3BA 2AP6A 3EVNA 1X9IA 2IIQA 1UFWA 1QK3A 3DE1X 1GPAA 2XY7A 1QTMA 3RRXA 2Y1KA 1M74A 2HJSA 4W5TA 1BDJA 1I6KA 2VAXA 5K6AA 5TB5A 2PIDA