2YX1A

Crystal structure of m.jannaschii trna m1g37 methyltransferase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
323
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ0883
publication title Crystal structure of archaeal tRNA(m(1)G37)methyltransferase aTrm5.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 92
structure length 323
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yx1A01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2yx1A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2yx1A03
3KR0A 4PIMA 5BW5A 5DSTA 4WVLA 3B7PA 1KYWA 2EJTA 3NW9A 5F2NA 1DCTA 2F8LA 2G72A 2QRVB 4GBED 3T7RA 4HTFB 4ZTBA 1TPYA 4MIKA 3O31A 2WA1A 5C1IA 3EVZA 4PYJA 3TM5A 2KW5A 4GOOD 2UYOA 1ZKDA 3M6XA 3IHTA 5KQSA 2I7CA 2I6GA 3A27A 3FPFA 2BH2A 5ICCA 3M4XA 2C7RA 1YF3A 5EC8A 3PT9A 2PX5A 4E2XA 1NV9A 2P3LA 4R8SA 2NP6A 1JTEA 1EQAA 4PCLA 2PBFA 3T0IA 2PWPA 5HEKA 5EMLA 4QVKA 3KQPA 3OZSA 4ER5A 5FUBA 2GH1A 3BT7A 4P58A 2CMGA 2IBTA 2C7OA 2NXJA 5LQUA 5FA5A 3KQTA 1BHJA 3TM4A 4P7FA 4RTNA 4MHTA 4GOMD 4K6MA 5EKXA 1RI3A 3KKZA 2BR5A 3KQYA 3R24A 1QANA 3BGIA 2ZWVA 4QQKA 2JHAA 2YUIA 2E5WA 4OA5A 5EPEA 2O05A 2HR1A 3ANXA 2OBFA 4FSDA 2FYTA 4HGYA 3NTVA 4MWZA 4CTKA 2AOUA 2PGXA 2AOTB 3SM3A 1NW6A 4BLWA 3LCCA 3HCDA 4HG2A 5GIPE 2G8NA 2EG5A 3G2MA 5DWQA 4EQZA 3Q7EA 3V97A 3V8VA 3P9CA 5LQNA 3L8DA 2Z6UA 2AZTA 2OKCA 4FR0A 5E9JA 5HIJA 3MHTA 3GRRA 3M6UA 2OB2A 4RVGA 5GOZA 3THRA 2ONYA 3G88A 5K01A 3FPGA 3KPWA 2P1DA 3P71T 5EG5A 5CVJA 4CKEA 3FTDA 3LKDA 3SSMA 3TKYA 3R9XB 2QM3A 3ELWA 4GOLD 5T67A 4PNEA 1VIDA 3D2LA 1JTFA 3SSOA 1SKMA 5ICGA 4AX8A 3A7EA 3O4FA 4ISCA 1KHHA 3UBTA 4B17A 3A26A 1UFKA 1VPTA 1ZHFA 3I58A 4KIFA 1NV8A 5D1NA 3DP7A 4HTFA 5D1HA 5DRYA 4EKGA 1M0EA 3DH0A 2JJQA 5E9WA 2BM8A 8MHTA 3HVHA 4ER0A 4RTMA 1G8SA 3QV2A 1NW5A 3MCTA 3TR6A 3A25A 3DXYA 4KDCA 5DXAA 3LSTA 3ELYA 5DM0A 5FADA 3AWIA 3PVCA 4GC5A 1Y8CA 4POOA 2XBMA 5DTMA 3M6VA 4RVFA 5CD1A 4HC4A 3HA7A 3FUWA 4PYMA 1RI4A 1G38A 4IKPA 1Z3CA 3EGEA 4PIPA 3QOWA 4DCGA 3DMFA 1WXXA 5EEHA 1KPIA 3M70A 3TOSA 4U7TB 2IPXA 5EHIA 3IV6A 5K8VA 3KPYA 3G8AA 5T64A 5GWXA 4V0QA 4C04A 2C7QA 3FPEA 3E7PA 3LL7A 2NXNA 1WXWA 2V74B 2OB1A 2OPBA 3MB5A 2P40A 1I4WA 3OFKA 3KPJA 4KDRA 3UJCA 5DSXA 2JG3A 1L9KA 5H02A 1JR4A 2HMYB 4P7GA 1EAMA 1I9GA 3CJQA 3C3YA 2AN4A 4RVHA 4YMGA 4YMHA 2EJUA 5EIFA 2ZIFA 3HNRA 4PYLA 3RIEA 5GIOE 3NMUF 4R05A 5DM2A 2LD4A 4OQDA 4YV1A 3BGDA 4XUCA 3LDGA 3GWZA 4LECA 2QYOA 3UA4A 3GJYA 3DR5A 4HGZA 1R8XA 3BZBA 1AF7A 2PXXA 3LDFA 2OZVA 3P9NA 3VSEA 1YFJA 4X41A 3GXOA 5FWAA 5E1OA 1YZHA 4GUAA 2HWKA 1XDUA 5FQOA 2ZBPA 3HP7A 4RTRA 1IM8A 2BR4A 2Z6QA 1R00A 5BW4A 4F84A 2O57A 1DUSA 4YUZA 1NE2A 1RJDA 5FCDA 3LX6A 5LR6A 2FK7A 3GU3A 3HCEA 1KR5A 2UYQA 3VC2A 1SQFA 5K05A 2PSSA 2JHCA 1JQDA 2BM9A 3GO4A 3WSTA 5F2KA 1R6AA 1XTPA 2GB4A 1D2HA 5KVAA 4LWOA 3LPMA 5DRTA 5GM1A 5EQJB 2PT6A 5HIIA 3RW9A 2ERCA 3UJBA 1NBHA 1WY7A 3EVEA 5FHRA 3H2BA 2I9KA 4PINA 2PT9A 5K0GA 2ZBQA 1ZG3A 3EEYA 3AY0A 5C9ZA 5LQJA 2VDUE 3KQWA 3NWBA 5M5BA 2P3OA 3GRUA 3ID6C 1XXLA 5EEGA 2H11A 2PKWA 3FPHA 1P1CA 2O07A 1QAOA 4R6XA 4Y2HA 4P7KA 5KS2A 3JWGA 3VYWA 3HVJA 1XCLA 3ER8A 3FUUA 2NYUA 4DKJA 4PYQA 1L3CA 1O9HA 1V39A 2YTZA 2P3QA 1QAQA 3P2KA 3RODA 3LBFA 3UA3A 2UYCA 3OE4A 3SSNA 3ME5A 5CUQA 3G8BA 3OZTA 9MHTA 3EVAA 3GDHA 2FRXA 2P7IA 3BKXA 2PXCA 3DMGA 3KQMA 3P2EA 3HCAA 4P7JA 5E8RA 1NKVA 3LKZA 3HM2A 5MHTA 3MERA 1WG8A 2N47A 1M6EX 3CVOA 3EVBA 4X1OA 2XVMA 4E33A 3VC1A 5IH3A 1JQEA 1JSXA 2JHPA 1VE3A 3QOXA 1RJFA 1FPQA 4QPNA 2FCAA 2G71A 3OU7A 1QZZA 4C4AA 5K0BA 1NW7A 5LQCA 3G2OA 3LCUA 2IP2A 2GPYA 3KQSA 4CKBA 4F85A 3PTAA 3EEOA 3DLCA 2EFJA 4XUDA 4A6DA 2G70A 4LWPA 4OBWA 5FTWA 3CC8A 2IIPA 3G89A 1R8YA 4E30A 3LGAA 1T43A 5EMJA 4RTQA 2ADMA 4FGZA 3B5IA 1X1DA 1VLMA 2R3SA 3OCJA 3B3JA 5EVJA 4G56A 4GC9A 1YB2A 3PX2A 1G6Q1 4HSGA 1FJXA 1NT2A 2AN5A 3P97A 4ER6A 4IV0A 1X1AA 2VP3A 3SMQA 1JG2A 1X1BA 1JG3A 2ZFUA 5E8JA 4F86A 5KYGA 4RTOA 4DQ0A 1NBIA 3GRYA 3LDUA 3OFJA 4NECA 1KP9A 3PS9A 2NP7A 4DMGA 1HNNA 3MTIA 5CVDA 4XUEA 2GAFA 10MHA 3FUVA 4CKCA 2QRVA 2V7EA 2YX1A 4E2YA 2ONZA 3BWBA 3PFGA 4YUYA 5EZQA 5LQKA 1Q0TA 3X0DA 2XYQA 4PONA 5EHGA 1I1NA 4KIGA 3UJ6A 4RVDA 5K09A 2ZWAA 3KU1A 3T7TA 4AZVA 2P35A 3GIWA 4QTUB 4AZTA 1OR8A 1NW8A 1D2CA 2GS9A 3AXSA 5DX8A 1WS6A 4BLVA 2ZLBA 3CGGA 3OPNA 3SXJA 2NNWB 1MHTA 2PVCA 4GOND 4OBXA 3HCFA 5EKUA 4ER3A 5LQAA 3FZGA 1IXKA 3LCVB 3E23A 4RWZA 2Y1WA 5K0FA 3ERCA 2AVDA 5E1DA 2OO3A 3PLAE 1X19A 2DPMA 3CBGA 3HCBA 3BUSA 3B3FA 4C08A 1XDSA 2PXAA 5CCBA 4JXJA 2YQZA 3P8ZA 2AVNA 3S68A 3UJAA 5K0JA 4YUVA 2ZIGA 2H1RA 2ZTHA 5EZSA 3NWEA 4DA4A 2WK1A 1PRYA 4E2ZA 2O06A 4QDJA 2YXEA 2ZZMA 3FRIA 4YV2A 2PX4A 2AOTA 3KR1A 4GEKA 4CTJA 5DPMA 4EK9A 3P2IA 3FTEA 3I53A 3ORHA 3GCZA 2IH4A 3HVKA 4A6EA 1EG2A 3HTXA 2ZULA 1JG1A 2NXCA 5DTQA 3DLIA 5EIWA 5FA8A 1SUIA 2QY6A 1EIZA 2YR0A 5FULA 1X1CA 1FP2A 4V0RA 3BWMA 1NW3A 5K0NA 4RTSA 3EVGA 3JWHA 4C06A 2CWWA 1N7IA 1KPHA 3K6RA 5DM4A 4BY9E 2B25A 2IGTA 3HVIA 3R6TA 5E2AA 5F2OA 3TQSA 2PJDA 3AJDA 4FS8A 4KVZA 4KWCA 3MCZA 2PWYA 4E32A 3OE5A 1L3BA 1VP9A 1RI5A 4X61A 1TW2A 3UJ8A 4LG1A 3P9KA 1PJZA 1QYRA 4PYNA 4PGHA 5E9QA 2R6ZA 3KQOA 3DXXA 2AOWA 2FK8A 2FPOA 3O7WA 3KPUA 4YV0A 5CCXA 4OX9Y 3MQ2A 3NVKI 4AZWA 4QQNA 5T6BA 4FZVA 3Q87B 5U4XA 2ZZKA 2Y1XA 2ESRA 4O29A 5C0OE 3A7DA 2AR0A 3EMDA 4AZSA 4E31A 3FRHA 3M33A 1HMYA 2ZCJA 5CM2Z 5EOVA 3I5UA 4M37A 4CWAA 3G7UA 4PGGA 5LSAA 2IFTA 2HV9A 4DCMA 2H00A 2XYRA 2PX8A 3FTCA 4GF5A 5G02A 4C05A 4OA8A 3KQQA 3MAGA 1JG4A 1H1DA 1FP1D 1JSZA 3NJRA 4M38A 4MTLA 4DZRA 4UOEA 3THSA 2P41A 2ZVJA 3C6KA 4FT2A 1VP3A 2PY6A 3PB3A 3A4TA 4QVGA 3TMAA 3B89A 4RSRA 4BLUA 4ER7A 3EVFA 4KRGA 1G55A 1QAMA 3M6WA 3EVCA 3UWPA 2Q41A 2YVLA 4PYIA 4E70A 2VDVE 5LQRA 3IEIA 2UYHA 1AV6A 3LBYA 1ZGAA 3DUWA 4HRAA 5DTRA 3TPZA 2AOVA 2C7PA 4PWYA 2EX4A 3CJTA 3BGVA 5FQNA 1KYZA 3GGDA 3SR4A 3OU2A 1XJ5A 2GA9A 2A14A 2O0LA 3DMHA 2CL5A 2DULA 1XCJA 3DULA 4PCAA 4YUXA 5K0LA 1EJ6A 1ORHA 2IDKA 4IWNA 5GM2A 3C6MA 4Z2YA 2HNKA 3FYDA 4U7PB 3C0KA 1BOOA 1P91A 2XYVA 3GRZA 1RJGA 5EGSA 5EMKA 1P39A 4PYKA 4QTTB 1VQ1A 1VBFA 2VDWA 3OU6A 1R18A 3UJ9A 2P8JA 1SUSA 3CCFA 5B1SA 5ICFA 4EVIA 1MJFA 3BWYA 1BC5A 3DXZA 3ELDA 3PFHA 4FSXA 3IYLW 3LHDA 5HFJA 3EVDA 3K0BA 4WXHA 5E2BA 4R6WA 5K0EA 1O9GA 3I9FA 3U81A 5DT2A 3TKAA 2G1PA 2VZ9A 2CMHA 3JWIA 2QE6A 1P1BA 2JH8A 2PLWA 3DOUA 3AXTA 4E2WA 2FHPA 2Z6AA 5HOQA 5HIMA 2ZBRA 3DTNA 3FUTA 3G2PA 3KR2A 2GLUA 4QDKA 4FT4A 3TFWA 2I62A 5IKMA 2AOXA 1Q0SA 5ERGB 1EJ0A 1F38A 1VL5A 1L1EA 2B78A 2OY0A 4BP1A 1YFLA 1RI1A 3NDJA 3UJDA 1G8AA 1YUBA 5K0CA 5GINE 5K03A 3UJ7A 1N7JA 4RYLA 4RX1A 4X63A 3G5TA 4RTPA 3UZUA 4H0NA 2WA2A 4C03A 5FHQA 2OXTA 3E8SA 3G5LA 4M36A 5E1MA 3HEMA 4RTKA 3R0QA 1SQGA 2ZW9A 5HZMA 2ZSUA 3HA5A 4XCXA 3TRKA 3PX3A 3HA3A 5DM1A 1RJEA 3KPVA 5FWDA 2JH9A 3GRVA 2XVAA 2HTEA 2IDJA 4IV8A 1L3IA 2IH5A 2CKDA 1B42A 1BKYA 3MGGA 4R8RA 4Y30A 4CXMA 5HIKA 4FP9A 4ATNA 2B9EA 3NVMB 1UWVA 5P8WA 4GQBA 5EMMA 3EGIA 4YUWA 1FBNA 3BXOA 1INLA 3F4KA 3I64A 5CVUA 5JUWA 2IBSA 3FPJA 2B3TA 1ZGJA 3JWJA 5CVVA 1G60A 1WZNA 2VS1A 2ZZNA 1D2GA 2NXEA 3EGVA 4AUKA 1O54A 2PX2A 4KW7A 4RTLA 4PYOA 3E05A 4EMSA 3CKKA 4M7RA 5GP1A 3T7SA 3FUXA 4BP3A 4MQ4A 1ORIA 7MHTA 3FYCA 5E1BA 2OYRA 2B2CA 3ER9A 1F3LA 3B3GA 1TW3A 5CVEA 4QPPA 3CJRA 1IY9A 4DF3A 3SVZA 1SVUA 5ICEA 2AS0A 2YXLA 3LECA 4HH4A 3UFBA 5DXJA 2P7HA 1KIAA 2AN3A 1RI2A 3KHKA 1R74A 3C3PA 3HCCA 3NDIA 3TLJA 5HILA 4OQEA 2BZGA 1UIRA 1U2ZA 1XVAA 2ORED 1SG9A 2AOUB 3G2QA 2ZIEA 1XDZA 5DLYA 5BP7A 2PV0A 3SGLA 3P9IA 3FTFA 4RTJA 3GNLA 5DX0A 5BXYA 1JQ3A 1KXZA 2K4MA 3BWCA 3R3HA 4X60A 3OZRA 4C07A 1KPGA 1N2XA 5JR3A 3BKWA 5KQRA 5CIYA 1M6YA 5DX1A 4L7VA 3ELUA 4DM3A 1DL5A 1ZQ9A 1AQIA 3EPPA 1AQJA 3MTEA 3EMBA 2YXDA 4EKIA 3REOA 2UZ4A 2IH2A 2BR3A 3SX0A 3KR9A 1YZ3A 3KQVA 4RV9A
chains in the Genus database with same CATH superfamily
3E5HA 3JYNA 2LRHA 3TG8A 2GVZC 4ZZ2A 4LPKA 6GPBA 2CHEA 4CM9A 2F1OA 3T5HA 2C7RA 4GLOA 4ZOQI 3PEJA 1YZKA 4NDNE 3T0IA 2OCLA 3PPIA 3KQPA 3BT7A 4B5KA 5BYSA 3D67A 3U5TA 4CIAA 4H3KB 4Q3KA 3GAMA 1H5QA 4C7JA 5EVCA 2E82A 1XVUA 1E20A 3TR5A 3HHLB 2RGWA 2ZTLA 4OHRA 2GZOA 1VC0A 3R9XB 1GPNA 3I31A 3BVPA 2JFHA 3WBFA 1NV8A 5CK4A 4EBEA 5KDOA 3LSTA 3GLJA 3E2IA 2AIRA 2RSQA 4ED7A 3EFBA 3LWMA 3QZ8A 1IPHA 4M9SA 1PWEA 4NPHA 2PT7G 5HANA 4PC6A 3KTDA 1SCQA 7ABPA 1U0JA 1CR0A 2KI5A 3ADOA 3H9CA 4PWUA 5CT8A 4XUCA 3ICPA 3WRVA 4ZKDA 3GJYA 1MNQA 3DLKB 3IRUA 2ZUTA 1ZPVA 2OCGA 3O82A 5ITWA 3IAS9 5FBZA 1E6VB 1A04A 3OT4A 1A2KC 2GB4A 3AY7A 4MGKR 3IIMA 5FHRA 2XTNA 3HACA 2OESA 3NXKA 3NEKA 2J9GA 1AA9A 4XWGA 3R44A 2PMBA 4ZVTA 1ARZA 4MVXA 4RGVA 4BTVA 4Y67A 1RAAB 2OXEA 5LJ3Y 1UUFA 4EU0A 4UMVA 2IZ1A 1CQIB 3PXGA 5DM70 1N6LA 2HFUA 1MU2B 2Q7DA 1Z4QA 3DLCA 3LLMA 4MMZB 1NXOA 4I8XA 2HWTA 2ZR9A 2XBLA 5K5EA 1K8AT 3HDJA 2JFPA 1WOYA 3JSRA 2PKQP 4CKWB 2G9RA 1YO6A 4BO9A 4C0KA 4MK9A 5K14B 1NVXQ 4LF4J 1FRXA 3N8DA 3K2EA 2B83A 1M1ZA 5HA5A 5AIAA 1OB2A 3EGXA 4RY2A 1U5BB 3L92A 1S02A 2AJ1A 1V1JA 2ZUCA 4ND8A 1AM4D 2GXQA 3GFYA 1M66A 2XPCA 1R6BX 5E0KB 1PNQA 2Y1IA 3L06A 1P7LA 1JNRB 1KY2A 3HVKA 3A3PB 4PG5A 3X2FA 5CYJA 4DR3B 3C39A 1OWXA 2J0QD 4DPTA 4MUAA 3INRA 3SCIE 4V0RA 4KPYA 5D8DA 1SIUA 4PQFA 1RYNA 3QH4A 2XB6A 3ICEA 1TTHA 2FZKB 3BMNB 4NFYA 4A8MP 2V1XA 3IR7A 1DJLA 2D13A 5HUHA 3KKEA 4B31A 4UULA 3T4EA 4WZMA 4LSZB 3ZEIA 1GPBA 3NVKI 4ABTA 3FNRA 3OF2A 4X62J 5FUYA 5LSAA 1A2OA 4EEYA 1YZNA 3ISND 1I2BA 4FYYB 4XR4A 2Y92A 4W1SA 4ZQFA 4NRTA 4MS3A 4KRGA 4CG2A 4LYDA 4AP9A 2G2YA 1GN9A 2JJMA 1YJ5A 3EDMA 2GFQA 2J9FA 4TM8A 5A5DA 5HLFB 3KOWA 3QU5A 2H7CA 2HF7A 5IDXA 3QQCD 3MPYA 1T35A 3IMLA 3U4QA 3EVDA 4E11A 2NVBA 3FVTA 2PLWA 3VR4H 2VSFA 1VE7A 2ZRAA 3TS1A 4FWIB 1YJVA 3OXGA 1O96B 2F1JA 2CZQA 3JZIA 2P9HA 5DYNA 4B9EA 2UZIR 3O6QA 1D09A 2WONA 2W24A 3K9HA 2OSQA 1PNRA 2JFWA 4JT9A 5J1SB 5I4CA 1LDGA 3SYTA 2AC7A 1Q44A 1WV1A 2X1MA 1LQ9A 4MR8A 1XTZA 4DQDA 3O0DA 5A8KB 3W5UA 2QBYA 1T2NA 4KQ6A 2C2WA 5JSHA 4IQXA 1FKAF 4L8YA 2ZIUB 3GLFA 2WU1A 1ZIDA 1Q6YA 2GYUA 4F0MA 2RHRA 4EB6B 2DT5A 3W9JA 2DT8A 3FCUB 5HM8A 1Y33E 4GMKA 4YFVA 1O9BA 3LP1A 4B4DA 5LDDC 1ZQ9A 1SBQA 4X3CA 4CKEB 1H5NA 3KR0A 1RRPA 1D6NA 4GZ5A 1I2AA 4V19J 3UWMA 2O8NA 1SZPA 1VJRA 2VSNA 3FNGA 2R7TA 2BBSA 2NTYC 5FBRB 1DLOA 5JXHA 4Q1AA 1X7XB 2P67A 4UNRA 3ET5A 1GX6A 1GLGA 2WB4A 3UN2A 3KQYA 2FHOB 4Z51A 3PDIB 4LQCA 3LQ4A 4FNHA 3CTMA 1EUQA 3L8DA 4FVCA 3OG9A 5I47A 4DMMA 5J2TA 1I3LA 2GBLC 1CQWA 2CDNA 5A8WB 1JB9A 2XLCA 4ISCA 4QOJA 1P0MA 1RC1A 4G5OA 2NYRA 1NW5A 1UODA 3VU9B 5DXAA 2ZDOA 1FFWA 3FY4A 2BJ1A 1VIMA 1DQRA 4OLFA 1Q1QA 3AI7A 4EDFA 5CT6A 4JP5A 2X5JO 3SJAA 1A7AA 3EXIB 3G82A 2NOAA 2XUIA 2HXYA 2V63A 3RU0A 4YMGA 2I3BA 4OSOA 2DR2A 1O6CA 2ZIFA 2R2UA 3PEWA 1XZ8A 1XAHA 4MLZA 1TAHA 2KM8C 2NT3A 4MCJA 4H3SA 3WXMA 3CC4S 1JL3A 3RKSA 2JH3A 1M6XA 2FE4A 4Q7QA 1U49A 1EFVB 1LV8A 3SCZA 1E3LA 3K1YA 1RHQB 3RBZA 2ZT7A 1IKWA 3SY8A 3MMBB 1RHMB 1HI0P 1N34C 1P4AA 5SYAA 2X7XA 2DWOA 4GI3A 1VA5A 4DLNA 5ITZB 5J9FA 1N25A 3FDXA 2VP5A 2MKYA 2CDBA 1FQKA 1UCNA 1YL5A 3VNBA 3TQRA 3LALA 1E62A 1RWWA 1L5UA 3U1LA 4GC6A 2WW8A 2FMIA 1A0OB 3WGMA 2V4UA 2VA3A 2BUBA 5TQ2A 5HIAA 4AAYA 1BFUA 4B8WA 2J5QA 4QQ8A 4XGRA 1ZHHA 4IUYA 3AQPA 3PFIA 3CVYA 4YMUA 4CIOA 2VAWA 3DM2B 5JS2A 4NCIA 5JMOA 3WMWA 4ZVFA 2PPVA 1JKFA 4LFCF 2N4DA 4TYBA 2BFDA 4X66B 1VG0B 2WF6A 1L5NA 3RM3A 2O2JA 3SC2B 3A12A 1HG1A 3WIBA 3HJAA 2HNZA 3C6XA 5EJEA 7MDHA 1YRUA 3AR5A 5MN4A 1YI2S 1UBUS 1EGVB 3MCOA 1T6ZA 1BLUA 4KKVA 1P2GA 1HDEA 2DFDA 4M0LA 1KQGA 4B3CA 1KKGA 3DONA 1VHWA 3OUTA 1TM4E 3AL3A 3CZAA 4RHTA 3L7BA 4LMAA 5D0HA 1IB8A 2P02A 2YJGA 4ITVA 1YUNA 3JTPA 4DV6F 4F4HA 2BE7A 2DH6A 2JLXA 2J8AA 3HSZA 1NXVA 4FKMA 3BH6A 2Y1XA 4YJFA 1CUGA 2VSQA 3CRZA 4B6RA 9RUBA 2WINI 4EEZA 5EGNA 1OH6A 1TL7B 2QW0X 3PXUA 3Q40A 4TSKA 1RE1B 4GWKA 3MUEA 1FNBA 5IVKA 5ALWA 3H9JA 5D4LA 2RS2A 4N8DA 5CDUA 4PZZA 2P78A 3JXOA 1PQ4A 3IAAA 2IEGA 2R68A 3QE3A 2EVZA 1UOQA 1NH7A 3DHVA 2W7AA 2HNAA 2ZSIA 2AD1A 4IDNA 4EJSB 1DJQA 2ECPA 2DX7A 5I48A 4M8NE 4IRUB 1UKZA 1Z28A 2VK8A 5I01A 2REXB 2B5VA 4ZZ0A 3WKCA 4TLCA 1KLMA 1D6SA 2WNSA 4NFSA 4TLMB 3MWYW 6Q21A 2ZW9A 3UXYA 4U5QA 1N6RA 1LWXA 3AD8C 3R5GA 5JCJD 3D7MA 1T3GA 2PLFA 1UVIA 3SDZA 1HV8A 3V6HA 1GYQA 4DWOA 3QXGA 2IYRA 1C8LA 1MX9A 5EFOA 2OQRA 1XMQF 3VZBA 5J4LA 3ZWPA 5L7WA 3CW2C 4B3IA 4WERA 5FLEX 3GP8A 4EKYA 5JAMA 4WV3A 3STHA 3CQ9A 3DCJA 1EM6A 1TW3A 1VFPA 1CEZA 2GAHC 1NB2A 3KHLA 2IQIA 5ADVA 3ZBPA 3KXIA 1KIAA 1OFVA 1EKRA 3W2IA 1SA0B 3K0AA 4QXOA 3ONEA 3AHCA 5IT9A 4IMJB 4UPEA 5IT9U 3VO8A 4GWGA 3M2TA 4ZEMA 3U3KA 4L7VA 2XKBA 3U2QA 1VSTA 1YDMA 5T41A 4XDYA 3B7PA 3HXOA 2JGDA 1U7UA 1PKUA 1WPQA 4RZSA 2YWJA 2NP6A 5CFRA 1WCV1 4YQFA 1W2WB 2GH1A 3I9LA 1ZLXA 4K6MA 2E8EA 2BR5A 4D6PA 4KLNA 4YIKA 5B5SA 4V3BA 3P27A 4OZNA 1CY6A 3MT8A 2ON6A 2B6NA 4NEGA 1S72S 2PZAA 2IXFA 1FFXB 1U1RA 2ZSBA 4C8LA 3K3PA 4ID3A 4NARA 3T3FA 4PHFA 1N2EA 4PAQA 3IO3A 3UBTA 4RXUA 1SPXA 4KIFA 1OE0A 2PMFA 4ECTA 4Z5XA 3AHEA 1RT6A 1YHYA 1KWKA 1R3NA 1E3JA 1Q95G 2P2MA 4LTMA 4N03A 2W6OA 1VMEA 1RMTA 5LIRA 4DWIA 3NP7A 2PN2A 2RRNA 3W60A 3I1YA 1TZCA 2IL1A 2D3WA 5DU2A 4R8LA 2QX6A 4UKDA 4E98A 5K20B 1RXUA 1E1LA 2LCQA 4C0JA 4TQGA 4IG0A 4O2AB 2M7SA 2U1AA 3JSMA 4UQPA 1K3FA 1Y6RA 4YJHB 5C18A 2FZWA 2WWYA 1XBWA 3GO4A 2E89A 3UPUA 1SJ3P 4NDZA 2P6MA 3ZV3A 2YH1A 1CVRA 2IYGA 4ZXFA 1N0HA 3SIPA 5M5BA 2DKOB 3MAAB 2GSWA 1OY1A 1TKZB 3BS4A 4IDKA 1A8IA 8ADHA 2R9LA 5IJ9A 1N78A 1IN4A 3H2YA 2GBIA 1XCBA 3E84A 4TY9A 4MPTA 2C78A 1OJ4A 1V3VA 1YBFA 3D6MA 4AT1A 5DN6A 1Q79A 4ICLA 4I4LA 4RH0A 3AB2B 4KN6A 4EAQA 4JI4B 4AMUA 2Q6TA 5EJ5A 3IXLA 1UAWA 5JIBA 2ZH5A 2HFNA 4YRTA 3HZZA 2A9PA 1R3UA 2PTGA 3UMRA 1ZGHA 3GR1A 3KJVA 1E6UA 1EARA 1MV8A 3FDJA 1RJ9B 4QWAA 3HHEA 4R41A 4DZZA 4E5NA 3RVDA 4KO1S 1V11A 1A7KA 1Z63A 4N56A 5A1GA 3HD2A 2FD2A 2QB5A 3TLBA 2NSLA 3RC2A 1IL0A 2QRGA 4MWEA 1E61A 2PX4A 3CH6A 3P2IA 1NU4A 4ZYUA 1JG1A 2E5GA 5A4KA 1CDEA 3RW6A 1T5SA 3AINA 4U2EA 1XTQA 5C25A 1CJVC 4KGMA 3PQEA 3WAGA 2VT7A 5TMDA 2Z8YA 2AV5A 2UXBC 2ORYA 4DMFA 1S0VA 4LOLA 1CY1A 4AURA 3LBNA 2RAFA 1UDCA 3BE6A 5JI2E 4BMVA 1UAAA 2ASYA 4QQNA 3EVOA 1O90A 1QF9A 1CNEA 2YCLA 4WJKB 1XD9A 3S1SA 1OI7A 4L4YA 4HNGA 4NBUA 1GZ7A 3VYTB 4PXCA 3ESZA 2NTEA 3HRHA 1IUOA 3V2GA 2D5BA 4ZC1A 4DV0F 1UBKS 1GEHA 3FJ2A 1QOPB 4MJLA 4A03A 1TGVA 1IMJA 1J7KA 3H2JA 1O8CA 2EEYA 2MT9A 3ZH2A 1E2KA 4S1WA 2DPIA 3VNQA 1L5QA 1P2BA 5DP1A 3GTYX 1RTTA 3VR5H 4UAVA 3GUZA 1VMAA 4KV8B 3K94A 4GMHA 3FBTA 1G5TA 2HWXA 3WZLA 4RNMA 1Y5MA 2O54A 1QLHA 1N5TA 4R69A 1VL0A 1RUSA 3A9TA 1S1VB 3ZTSA 3HA5A 4W4MA 2PH1A 5L8VA 3A32A 3NNCA 4RQBA 3GVPA 3OSZA 3P2MA 1WNTA 3GLIA 1P2DA 3SQOA 1QQBA 4GGPA 4EYGA 2I1QA 5BQFA 4BPRA 4RFVA 5BNFA 4I9UA 1KJ8A 2VQEF 1ZH5A 3RJMB 1ZRNA 1U2GC 2BW0A 2QSJA 3IAS6 2AS0A 4ZPBA 4RS3A 1YA6A 3CR3C 4WXYB 5F51A 1WDKA 1HNZC 4PWWA 2HBZB 1WVIA 2XZPA 3KJFA 4JI0C 1NWHA 1WC0A 2MYTA 2I6TA 2W58A 4H17A 2Y77A 3MRSA 4LFBC 1DMSA 1DSSG 1X7DA 4YDSA 1WSBA 3R6LA 4IKOA 3V00A 4UZBA 3EPIA 5KCMA 2C1EB 4GNKA 5J4YA 5EPOA 4F3YA 3M7IA 4P98A 4DG9A 1N0WA 4WTOA 5HBMA 3NTVA 2LMIA 5H9EK 1LI5A 3BCUA 1GDHA 4MYHA 2QX4A 4ZLPA 3IOEA 1G63A 1D07A 9ATCA 4B9NA 4AXJA 1ZZFA 5FBKA 4RLHA 4O02B 2AQHA 3WTBA 4L5BA 2R0QC 2Y1DA 2AEJA 2GNOA 2IAJB 1LI7A 1NOIA 4YRFA 1UZHA 4XDHA 4PLPA 3NDBB 5ETNA 3E27A 5CD4H 3RHTA 1QH8A 2QE7A 1PG2A 1LLQA 2ORWA 3LP5A 5BR8B 4G36A 3FDZA 4FFSA 1TL3A 1Z2PX 1J99A 2C2OA 3HJGA 4ZVRA 2J6CA 3HP7A 3A04A 1DKNA 1XDWA 1AIPA 2XCPA 4G25A 3LC2O 3OJFA 1YKSA 4E5YA 2P65A 3SF8A 4R7TA 5IWAB 1F8GA 4KH1A 3ICWA 1CRZA 1C8KA 4HDOB 4ZQBA 1W48A 4X6LA 3QFFA 1DTEA 3W2HA 4TZKA 1GGKA 1X80A 3ZCPA 5M7EA 3NGRA 1JR3D 4X7MA 3J80U 3MTJA 5EJ2A 4X1OA 3GU0A 2W2PP 4C4AA 2Y4OA 4JYAB 4RNOA 2XMSA 2UZ3A 4O23A 3ZO7A 2DSTA 2PNFA 1B3RA 4E30A 2HMTA 1HL3A 1IBMC 5AJYA 5E6RB 4MKYA 3MEGA 2WFMA 3BB1A 4FMCB 2VP6A 4FPRA 5C8XA 4ALKA 1BHSA 2HSEA 4YRJA 2QMYA 4IJVA 2OZPA 3C15B 2NCLA 4MQ6A 1XT6A 3W6NA 4CMAA 2NP7A 1XHJA 10MHA 1KI7A 4KT0C 3FTPA 3CSUA 4XYGA 1HZZA 3IQDB 3UGTA 2F3UA 3EPRA 1JJFA 4QTUB 1N8KA 1R8PA 1S2DA 2CYBA 3DSRA 4JYBA 4RWXA 1P2SA 1QYWA 2ET6A 1IK6A 2BFBB 4J9NA 4JGBA 1Z2AA 2M5OA 4DVJA 1DURA 4C97A 4UDOA 4LF6J 4GP9A 4P7BA 4UVGA 4LCBA 4FCCA 1TCBA 2GZHA 4NOMA 2E49A 3HTXA 4U7UD 2IBKA 1E58A 3NCTA 1SQ0A 4XFDA 2HF2A 3QYJA 1SUPA 2LP4Y 5K0NA 3W65A 4WZBB 3FCYA 1W85B 1E1RD 3I23A 4ZMMA 1P1RA 5DWDA 1PWXA 4D3GA 3E3NA 3PI7A 4FZRA 2YXBA 2VDWB 4LIWA 3EFEA 5BV8A 4F4DA 5ECWA 2VTVA 1KL7A 3FD8A 2FK8A 1X2BA 4R1TA 4GDFA 2BFCB 1HLGA 3U4IA 3V32A 1JEQB 3CUSA 2ALJA 4ZVPA 1MAHA 1IAVA 3HHLD 2CG4A 2OM2A 2IHUA 4URWR 3TR0A 3BJRA 5CFNA 2D28C 2WZQA 1WEYA 2GYVA 2RK3A 3RVJA 2H2WA 1NVUQ 2GHVC 3FJOA 4LZWA 5CD9A 3UKDA 2QG9A 2XE7A 1QVWA 3OZGA 3ONQA 4OZ3A 1I3NA 3FKSA 1DC5A 4OXXA 2LTAA 4YDRA 1GT6A 2YFHA 2HIYA 4IOAQ 3A3KA 4KZPA 4KOEC 2JBWA 4E09A 4RC9A 2C42A 1OIVA 1DEKA 5E4YA 5ICSA 1W2GA 3GRCA 4CO4A 4DR3F 2FEPA 3O9ZA 3CPEA 4IPTA 1YULA 4XCXA 1T3HA 2XW6A 3ZIUA 3C7AA 1TOAA 2HO4A 2XQKA 4XM0A 1N2HA 1YH3A 1Z36A 1ODCA 2KG0A 5JUWA 1QR6A 1B16A 3FPJA 4G63A 3H19A 5F3WB 2YHSA 4XYMA 4LRAA 4AXXA 1GIAA 3FYCA 4DBLC 3ZEAA 3SX4A 4MB2A 4MWOA 5B3LA 3EQ7A 3NIGB 5ALOA 3RFUA 5DDRC 4MKZA 5FOWA 1RT2B 4OQEA 2FF7A 4HTIA 1UT6A 1XN1A 3ZDXB 4D0GA 3TA2A 4YCLA 2H92A 5COQA 5HMYA 1DIAA 2E1RA 3W6PA 3AHFA 3KDPA 4P54A 2F8LA 3U13A 3DOHA 4P3PA 1ZGZA 3O2IA 3US5A 3L8GA 2F65A 4Q4HB 3ROXA 3IBWA 1FFEA 2ORVA 1N7GA 1NVAA 4Q1BA 3G0BA 1DWOA 1U2PA 1GTEA 4BQFA 4KPGA 1AMNA 1F5AA 4RTNA 1RI3A 1SD1A 4ED1A 3PG9A 1UW9A 1FFAA 2CBZA 3HRKA 2WJZB 5GIPE 3DKIA 2IRXA 4DVGA 1A9YA 3QT8A 3WAJA 2DQSA 3AM1A 4UTNA 1TECE 2D74A 5DHQA 2VBYA 1USGA 5B12A 2MTBA 1VRUA 3N28A 1JLQB 2WAYA 2DR0A 1A5SB 5CJPA 1ZM9A 5ETTA 2OC4A 4M5HA 3UMSA 3D2WA 1O92A 1UKAA 4Y1GA 1R64A 3GZNA 1DRZA 3H5RA 2NXNA 1XLWA 5C42B 1N54B 3JS9A 4F92B 4DLVA 3CJQA 4C87A 5GPBA 4BEVA 3LDGA 3Q3IA 4JI7B 3B3QA 1VYTA 3VV2A 5AJHA 4ZGGA 1POXA 1C3JA 3ISNC 1HYQA 1TLLA 2W0MA 1DC3A 2AJLI 1TVEA 1FJ7A 1N3LA 1TVRB 2YKMA 3WHIA 1MN6A 2PRKA 3QM1A 3UMFA 4REMA 4EO9A 1EUZA 4OI4A 4HB2A 1W30A 5EWJB 2PMEA 2VUHB 3KSRA 2YTZA 1RWKA 2J76E 1R7RA 4J16C 4W1RA 2JB9A 3KZXA 4A9AA 1K1QA 2D2EA 1NPPA 1Y9OA 1USPA 3AM3A 4EHNA 4DR1B 2ZNYA 1Z7EA 3RIGA 3V4IA 2C2HA 4LT6A 1KO8A 3V34A 1Z0IA 3KDNA 3AM5A 2HBRA 5LNK1 1L6RA 1JVBA 4C8OA 3L7AA 3H86A 2CUYA 4D57A 3RTAA 3G5UA 4Q9DA 4H1HA 4UVDA 4CQLA 4W5QA 3FJ1A 1LLDA 4IVRA 5LQKA 3H17A 3UVEA 1I1NA 3IP7A 2KFNA 3HXKA 2XQGA 3GJ8A 4G4JA 4ZHSA 5ALXA 2PVCA 1JJBA 5IABA 2BDPA 5E1DA 1TYEB 3TMYA 3I2GA 2OV3A 1AXGA 3UI3A 4MDEA 3I1IA 3Q2TC 3TD6A 3H0EA 4MIYA 2WK1A 1Y6FA 3TRHA 3GJSB 3E58A 1XZPA 1K6JA 2DXFA 1P3DA 1Y6GA 3WOVA 1IHDA 3JAKB 2F1RA 3HKCA 2AX4A 4OHXA 3FGOA 4HAZA 1TC2A 4G4SO 1DOHA 1N7IA 1RBZA 2NU6B 1S49A 2GM3A 1XKQA 5BO5A 1KFEB 3WLQA 3TP2A 2QLFB 2X3UA 1VIVA 3DLPX 4QXMA 4U5XA 3RC7A 5J5VA 4ZAXA 1NONA 1QC5B 4DSNA 1NZAA 3QMWA 1X9IA 2ZKTA 3GL9A 4CM6A 1ILWA 4BNDA 3VOAA 2CLHB 1KSJA 3TA1A 3PROC 3U56A 5J2MA 2AZXA 4OV6B 2EG2A 2VHJA 3B89A 2KXFA 1ZSYA 4EHIA 3CA8A 5KG3A 2J59A 4EWTA 3CCVS 5IVDA 1DEHA 1N32J 2N4CA 1PL7A 4A36A 4X66F 4BASA 4PYKA 1R27B 1TKXA 3KUHA 5EMNA 5BNIA 3ZE6A 2OBXA 1XZLA 3LVRE 1R8AA 1JQBA 4KFSA 3BGRA 4AXBA 2ATCB 1VQMS 1OFGA 1D3AA 5JYBA 4F5ZA 2I54A 4CQMA 1I6JA 3RIMA 3RB6A 1NG1A 5L3RA 4ZV9A 2NQTA 1XRRA 1HF3A 1ZRHA 1T8YA 2OG2A 3G0IA 1Y9DA 4OYAA 3C3DA 3AB4B 1IDN1 7AT1B 2PCLA 1LJLA 3TTTA 1UF9A 3AIIA 1XSEA 2PA0A 1UA1A 4LF1A 3EGVA 5HS6A 4XX0B 4HVAA 2XIQA 1P4RA 4P4NA 4IGEA 1R6YA 3FNNA 3IUQA 1TK8A 3ZZNA 1SUQA 2QY9A 3J7AC 1EX7A 3REQB 1Y5NB 1XRQA 2PEYA 1HNIA 4G0YA 4J7AA 4XWTA 1FX1A 2GCIA 3I8XA 2FVXA 4RMIA 1XVAA 4ZRDA 1D8TA 2CB9A 2ACVA 1A72A 2P5TB 2WBMA 2WE7A 1UAYA 2H8GA 3GNQA 3W6UA 4DM3A 4Q47A 5TLSA 4L9WA 2DPYA 2IC5A 2W71A 3O2QB 4ILLA 4U2GA 2D2VA 3WISA 3QGHA 1NJXA 4AKSA 4Q1FA 4KE5A 5K3FA 3M8ZA 2C88A 5C7LO 4KNYA 1RADA 4B46A 5A3RA 1LEHA 4UTVA 2CXUA 3Q5GA 2IIBA 3IE2A 3EM1A 2V03A 5AUNB 3BGIA 1IN1A 5EPEA 2O05A 4FSDA 5KSOA 4LXGA 1FNMA 1Z45A 5L1KA 1IY8A 1I36A 4G67A 3R7WB 2C96A 4TWZA 4HGRA 4N47A 4YXWA 1WD6A 2QM3A 3DBRB 1BE8A 3NZEA 2X1LA 5M34A 3ZDBA 2NO5A 3M2VA 2XCSB 5TMPA 4NXMC 4DIBA 4RUBA 1SJ9A 1RXSA 5LQMA 2PMCA 3CU5A 4RU9A 4QDZA 1MQ9A 3IDQA 5AO9A 2K2QB 4EG4A 3SQNA 2R84A 1T9XA 4JYZA 1UBHS 8GPBA 5HVFA 3GJ6A 5H16A 2VOOA 1XMSA 4TYMA 2CADA 4OJ3A 4CL8A 1AUXA 1URRA 1BEZA 3EISA 5ELXA 4NEHB 4GBGA 4W5RA 5G1PA 1T3LA 1RWNA 3BFKA 1KBZA 1PQPA 3SBDA 1ULSA 5HUQA 5GJBA 4US0R 3DVSX 2QQFA 1N6QA 4DFMA 4NK5A 3DCAA 1LWFA 1ODTC 4NL4H 4CMIA 1JJ2R 1XROA 2DR8A 3DJYA 4BX3A 3IGFA 3A2NA 4H7KA 5ISMA 2H1WA 3P2YA 3SEFA 1QIDA 1CEQA 3ME5A 4LFCC 3ADBA 3MINA 1S97A 2XI4A 1E9BA 1XL1A 3OQIB 2M6KA 2IS6A 3VTKA 2VDLB 1YBHA 1E7WA 4Q7AA 4R7GA 4KACA 2G2OA 4LIRA 2XNSA 2Q8PA 2XTZA 1V8FA 1MJNA 3L05A 1L1FA 2ONKA 3B3AA 1VMIA 1V41E 4KMSA 1O95A 3WOHA 1RWXA 3ETJA 3RUPA 4ECVA 1JG3A 2FVSA 2W7OA 4KH0B 2Q5QA 2GM5A 1OWOA 3K1AA 4KR7A 3VVBA 2P4SA 2C7GA 1LWCA 4ZJOA 4V1CA 1JFTA 2ZBUA 3ZUPA 3A0UA 5IC6B 1NBEB 3A8JA 4ZMRA 3M8SA 4DV6C 2B61A 4LSLB 3E23A 4O2AF 4OQNA 3D28A 4KXFB 2CNDA 2W2QA 1K5PA 1N34J 1XTSA 3GJTA 4YRMA 2FR1A 2RIJA 4EYIB 1OYOA 4GO7X 3OHBA 1WR8A 1XRBA 1E7MA 1TI7A 4AN4A 3N74A 4M5NA 4A6PA 1OLSA 1Z2OX 5KJ1A 4G65A 4K6GA 1R9MA 5EE9A 2HQRA 3T1OA 3DOMB 2E1AA 1WCYA 1ICEA 2IGTA 2JVOA 5AYVA 1AY0A 4QPXA 5DG8A 2KLBA 3DVQX 1EE9A 4UBIA 4HXGA 2V8HA 4ZHRB 3TAHA 2UUCB 3ADCA 3AEUA 1SH7A 3OLCX 5DV9A 1QZXA 2XLIA 1FDDA 1UMDB 1T1RA 4AP5A 2GTHA 3W8PA 3HO1A 4UTXA 6NULA 1R4MB 3CW8X 1X15A 4JI4F 3A37A 3AEYA 3ET6A 2X77A 4OHPA 4KGXA 4EJ6A 4IFYB 3K5OA 5EINA 3Q12A 2FW1A 2W2NP 2XB2A 5F0UA 5CFOA 3ZX4A 5CXTA 1KR2A 4PTYA 1CS0B 3SR4A 4RW4A 1DDOA 4BS2A 2OQVA 2C84A 3RTVA 4CM5A 1LPPA 1HNZF 1NPRA 2H48B 2ZVSA 2GPTA 3BRQA 4QHSA 2P2QA 4NG4A 3U0VA 1ZUIA 1XMQC 2R00A 4D97A 1G66A 1Z5NA 1L0BA 1RLCL 3DW3X 4NX9A 2CQIA 1FWKA 4IIEA 4B75A 1E32A 4RGBA 1CQXA 1CZOA 4Q1EA 2GGPA 1XX6A 3X1MA 1AZSA 1OPIA 1T91A 3UB2A 5DFAA 5KTKA 4HYTA 4IIJF 4ARVA 1TYBE 4QGSA 1XD2B 3I2FA 4YP5A 2IH5A 3E7XA 3DFKA 2HURA 4HH1A 4LPSA 1Z5UA 5CVCA 1KYQA 5FOSA 3RRYA 1M2KA 1M72A 2LQBA 1QP4A 4UVIA 4ZS6A 1SRRA 3Q4GA 1CYEA 4NYIQ 2X8WA 4AJLA 1HWUA 4OQFA 2V58A 2V9ZA 1QQAA 4XA8A 4DF3A 3TJRA 3OHAA 1V96A 3KWMA 2QN2A 2WVHA 3U4GA 4WIQA 3TO5A 2M9KA 1H9AA 1S3IA 2E55A 1E2MA 1TT5B 4FJ0A 1FD2A 3BKWA 4OM8A 1R0AA 4ZJLA 5B57C 2OD9A 1VE5A 5DT9A 2NO4A 3KXKA 1REVB 2C4VA 2JVJA 4PPQA 4CLEA 4AY4A 1RAEA 5GONB 2DRAA 3HGTA 2WFLA 5JDCC 2YKQA 4LOAA 2AF3C 1OIAA 4E03A 3VPCA 3OZSA 1C7EA 3FBWA 4HAUA 2BONA 3IDSA 2YNIB 4YJ2F 3IOMA 3PUVA 4D26A 1QANA 5LDGA 2M98A 4NPAA 4MWZA 4HSEA 1H1TA 4P10A 1EZ4A 4GPIB 1M5PC 2RCYA 1GXTA 5HN0A 3L0YA 2G25A 1JDJA 4CGYA 1HSOA 2OB2A 1SKAA 2VA8A 2BFEA 2DHSA 2W1BA 2V45A 2IWRA 4HVLA 4X54A 4IDGA 1Y4ZA 1DAPA 1RRMA 3U60B 2JC1A 1QGYA 2K87A 5FADA 1TC1A 2ZJ7A 1ZLYA 1QHGA 2XUQA 4V0SA 2Z30A 1FRQA 4RD0A 1NQVA 2XSZA 1KVSA 1YVFA 1GAQA 3RW7A 1C1DB 4UOZA 3WWCA 4IR9A 3B6KA 1SBRA 1VGYA 1HDZA 2PHZA 3BH7A 3KSUA 3BTUA 3VUFA 1XE3A 2X2FA 4Y6LA 4EJFA 1GT91 2QNBA 4FN5A 5IVHA 2O2YA 4RF2A 2FEMA 2Z1NA 2CXTA 1GZVA 1WTAA 1XDUA 3X1XA 1MRNA 1U2SA 1PIEA 2JDID 4F84A 3DNPA 4ECWA 5FEMA 5CDSA 3WK7A 3QSGA 1DIHA 2O3SA 4RIIA 4EFKA 2W0SA 2M5YA 2HT6A 4D8UA 4PINA 4MGZR 5AHKA 1KS9A 1HD1A 1P1CA 4LVNA 3VYWA 4CMHA 1R5JA 3FUUA 1O9HA 3MLBA 4WBFA 5CW2A 4CCWA 5C5CA 3JARA 1DIRA 3AUXA 4JV0A 1GM5A 2GTPA 3O3NB 1EVZA 5HGJA 3TRJA 3W5IA 5T7LA 1UBEA 4NYJQ 2C3OA 4UOGA 3PJGA 3PVXA 2AB0A 3O8QA 2AYYA 3CD7A 3V81B 3G2JA 5EPUA 3NG1A 2I1RA 4TT8A 3P9XA 1ZB9A 3EYZA 5KOJA 2AQIA 3L0IB 5H7XA 5LQDA 4C4TA 2JARA 4X65B 4K40A 1FKPA 3ZTRA 2BC9A 3RRJA 4KWEA 2D7SA 4P86A 3NHJA 4Q02A 1C0UA 5BT9A 1XVIA 5HKOA 1ZICA 3RHSA 1NX6A 1QRRA 1QMGA 2GS9A 4P80A 4DCOB 1Z74A 1PFWA 1KY5A 2V7PA 5DNDA 3ZPXA 4L8WB 3SSSA 1QV7A 1X86B 3NPMA 4N40A 5T57A 5EHZA 5JAIA 1ADFA 1ZCBA 1FFSB 3CRNA 4G5RA 3IULA 3ZTPA 2ZUBA 5DZSA 4BUCA 1T1SA 3TZXA 2VAMA 1WH9A 1X1CA 2DGTA 2JA1A 4JT2A 4HZIA 5EUBA 4CTAA 1T6BY 4MW5A 3AFOA 3TVZA 3GLIE 3SC3A 1KDPA 4B3FX 1NNSA 3QF4B 1SCNE 3MM7B 3ONVA 2GAAA 2OHXA 3KLGA 1KTIA 4P35A 4JYAF 5JADA 1QP0A 5HK4A 3OZVA 4LY0A 2CPIA 1WC5A 3BGLA 1UWDA 1VSBA 4FMCF 4L16A 3EVFA 5BSKA 4EO7A 1NDLA 3LQYA 2BEFA 4QTXA 3TTSA 4KE8A 3LVQE 2ZRHA 4BJHB 4Y28C 2BOPA 1VQ1A 4K3VA 5JAZA 3FMIA 4PBTA 3C5CA 2V97A 4OHUA 1NY6A 2CMHA 2ONJA 4I0WB 2F3TA 3L1UA 1YRBA 3FROA 2OCBA 4PQYA 5TT1A 2CVPA 4ANFA 4DMCA 4AJEA 1VRTB 3KV3O 2VQEC 3P0HA 3IFEA 4B8ZA 1HLPA 1GQQA 1PR1A 1JT9A 4Z99A 4OQZA 1XG5A 2GRJA 4ZTUB 4A82A 2UXBJ 1MDBA 1RBMA 3S82A 4EY4A 2LLZA 3AF3A 3ED5A 3PXXA 4F4IA 4L5AA 5AVVA 2XQVA 2XLBA 4EMBA 2MYUA 1IONA 2Q5IA 1C3OA 2NXEA 1XZHA 3ZZ1A 3H0PA 3VNUA 2DCUA 3F73A 1LJ8A 1DOZA 5DGXA 3S0JA 3Q2IA 2VJUA 5F98A 1X4DA 3NAZA 1BX3A 2W93A 3L02A 1OFIA 2E66A 3TXAA 2X8BA 5JJBA 3RPEA 3UK0A 2EK6A 3KLHB 5CXXA 3QMPA 3GFPA 4I7EA 2BR3A 4RV9A 1KDRA 2R62A 2ENUA 3HHNB 1H2UX 4YQYA 1PT6A 1SN7A 1Y82A 4MEAA 2OOSA 1VJGA 1NM2A 1KSHA 2Q5FA 3U48A 1L1QA 4J0CA 3DLGA 2BVNA 1JR2A 1CZHA 1JMTA 3GNTA 3TZWA 1J5EB 3C16A 3LLVA 3ILJA 3BDAA 1KZHA 1T3TA 4JROA 4TWBA 1P2UA 3LKDA 2WPDA 4Y2MA 1RQ0A 3MUNA 2G4LA 1ODSA 2W9CB 1VQYA 1I2MA 4GMFA 1AXEA 3AWIA 1MN7A 1HNZJ 5DNVA 5LZ9A 1NKTA 1Z5OA 1SU7A 4GKAA 1BCRA 4ER8A 4ES3A 2JGAA 2NZXA 4NCXA 5CLLA 4JI0J 2NSBA 3VR3A 3RB0A 1ZK3A 2Y1FA 3J7TA 1X87A 3ZTYA 2VH7A 4I2PA 5JXSA 1R0XA 3JZDA 1FXSA 5ILQA 2G4VA 4RLEA 5KYUA 3TH5A 4LFBJ 4M5MA 2AJTA 1M2GA 3G6XA 2ZRQA 2RBKA 3THYB 1TUBA 3HHLC 2HS3A 1Z17A 1TJPB 1HBNA 1UZDA 4WOPA 3H1TA 2AI1A 4MROA 4YJ3A 2OZEA 1CYDA 4MV6A 1N57A 3OJSA 3O94A 1JFVA 1ZG3A 1N2CE 2ZYHA 4YRLA 3DMRA 5KTTA 3N6RA 1ACMB 3N3AC 1ZEMA 3V3TA 5DEIA 4G1EB 1C1YA 1ADGA 3P2JA 1JFSA 3HCAA 4KXYA 1PJ7A 2GYYA 1U1KA 3WADA 4WX2B 1IVNA 3VYSB 1JQEA 1XNHA 2JX2A 1TYDE 1A1SA 1S1CA 4MUKA 3G0HA 1Q2XA 1FQOA 3OFFA 2WAQD 3OCJA 2R8YA 3T5PA 1MLDA 3N2ZB 3B6BA 1FJXA 1NT2A 1GMWD 1VHTA 1BY9A 5GZ1A 1WLSA 2VYQA 3EH1A 3P5BP 1CRQA 1WABA 3S2EA 3VGJA 3LC0A 4NJMA 4R01A 2O19A 1JV2B 5LOVF 1NSYA 2G3YA 2XI3A 1I1HA 3E15A 3WS7A 3KSMA 3IODA 1N52B 1KI6A 4JI7F 3L8EA 4ZLLA 5I4IA 3L6OO 1U2TA 1W5EA 2BFNA 3IMFA 4I5DA 1BKDR 4ERDA 2LZ0A 2EU8A 3WGIA 1DOAA 1VQ9S 4K4UA 3I53A 4IJ5A 4YB1P 2FEKA 3MMZA 1FP2A 3D8HA 1IWPB 2HRQA 1O77A 5I8PA 1N8TA 3R6TA 2G63A 1S79A 4F97A 1WA5A 2WV9A 1KQFB 1W47A 3NT2A 4CYUA 1OASA 4RIGA 1IBMJ 1E92A 1TYZA 1LPSA 1SELA 5AXKA 4DR1F 1XL0A 3KLBA 1GWNA 1DG9A 3U62A 1GU7A 5A1IA 1L3VA 2B7LA 1H4SA 5JCPA 1J0AA 2HPUA 3S2IA 5FAKA 2H4XA 4XPIA 2IGBA 2XUDA 4DR3C 1D6MA 3OOJA 2M88A 3FIUA 4YUXA 1ORHA 4C8KA 4RW8B 5ALUA 2K1RB 1IN0A 3GK3A 1T5HX 1B8VA 1BC5A 2ZE8A 1MX3A 4ZCMA 3E9YA 2FGOA 1NUSA 2PFKA 2JASA 2IXEA 1YQ9A 4G4SP 1Z18A 1U1DA 1YUBA 2XLJA 1N7JA 1ZBTA 3VR4A 2WA2A 1NKSA 4MJ7A 4HRXA 2CQPA 3CMES 2QV6A 4C48A 3K0JA 4LE5A 3BFXA 4FE7A 4BDTA 2V94A 1GCOA 3WK4A 2YZKA 1J2RA 3CG0A 4K2AA 4NCGA 4G8BA 1OBOA 1NJYA 4IIFA 4FYXA 1J90A 1S2MA 2VDPB 3R5SA 4PPNA 1ENOA 2AFHE 4FNMA 2VB6A 4OCZA 2IU0A 3PZBA 3H11A 2AWNA 3UT5A 4L8GA 3RV4A 1BXZA 2CDCA 1IK4A 4LHXA 1C1XA 4YAKA 1SIZA 3EPLA 2ORED 2MDTA 4NXMF 2QTRA 2NSDA 1MC1A 5LOQA 1MVLA 4LE0A 2BPOA 1Z6QA 3TAPA 2YW2A 1LFAA 4Y2SA 5E3AA 2ICAA 1THGA 4FYHA 3TM5A 1DAKA 2HLPA 2FQQB 1R2QA 3ZU4A 1GKIA 1RNLA 1ZS9A 4KHPB 2C9CA 4CO2A 3EK2A 1LPNA 3C6BA 2VVTA 4OHYA 3GIMA 1XDGA 2OSVA 1E2EA 3T7KA 2NZUG 4ZZIA 3BQ2A 2W6JA 2H1OA 3MT7A 3OE7A 4TTQA 4JU9A 3MJHA 4F71A 3GR6A 4CWBA 2WF5A 2BM8A 3RRGA 4ZGBA 5IJ0B 1C8BA 3NH6A 3M3PA 4IVNA 3N2KB 3T9NA 4N82A 4MR9B 4AL4A 3EGEA 3MBKA 3WLFA 4L5IA 3CLKA 1U45A 3KYCA 1UP1A 5FPYA 5AQ1A 5C1PA 4PQAA 3KPJA 1UL3A 1YDWA 3I82A 1D2AA 4NF2A 3HJNA 1T36A 3PHIA 4F67A 3GWZA 1BH2A 3OTOB 3VSBA 4E3ZA 3PDUA 3SR0A 4ZXPA 1KO5A 4GOXA 2Z5GA 3GB9A 4JEHA 2C3UA 2KBEA 4KLZA 1R31A 1R7IA 3UD3P 1AKEA 3P9RA 3WSTA 5T8SA 2A8YA 3BXHA 4N12A 3RLFA 3ZCSA 2G67A 4G8JA 4FSHA 3BSYA 1SG6A 3Q8VA 3ID6C 1C7JA 2JAUA 1EXVA 4V0KA 1TIBA 1MF7A 5JT1A 1UL1X 1YQTA 5B0AA 3QHAA 4PF1A 4CM3A 2DMRA 4IDDA 2HZVA 2JZNA 2ANCA 2XXJA 4WD3A 3KJQA 4YJKA 1G16A 3WRYA 2BW7A 3G49A 3O83A 3ZVNA 3ZJTA 4F6RB 3G89A 1Q8LA 2VP9A 2AHOB 4BP9A 3Q6NA 4F25A 3QVOA 5A5EA 3ELBA 3P49B 3TIGA 3IX7A 4M1ZA 3ROQA 4LSWA 3PGXA 2IA0A 1QAYA 4M0CA 3CIFA 3PFCA 3T7TA 3PYMA 4BNLA 2R8GA 4JBHA 3QQ5A 2IVFA 3PNKA 3PUJA 4PE5B 2DUUA 3CBGA 4M6WB 4I19A 3CR7A 2WJVA 2H1RA 1GFWB 4KFBA 4HLNA 2QU8A 1YVDA 4K4YA 5FWYB 3BHMA 4G5HA 1NT4A 4A6EA 4LIPD 1CJSA 1HHQA 1E2HA 4W8OA 1Y8RA 1JLSA 2XWYA 2Z8QA 3W7AA 3CT4A 1SC4B 3EWAA 4R3WA 2AQ8A 1NYEA 3ISTA 4HKQA 3LCJA 3G8YA 5HUJA 4B3OA 1SIWA 4UEKA 2PWYA 1RTDB 4AECA 1ML4A 3LYAA 4RLFA 3AI3A 5HM6A 3QVGB 1WRBA 4X66C 2J07A 4KSBA 4JVLA 1PBUA 2YJTD 4AZSA 2ZUSA 4QLOA 1QS0A 1DX6A 2DP4E 3M33A 1G8PA 2XYRA 3DD1A 1LF0A 1SBIA 4LRWA 4BOYA 5EFZA 3A58B 2ZVJA 1ZW6A 1IZZA 2NQPA 2E9ZA 2ZU6A 1N8RT 621PA 5E6SB 2FZEA 2WG0A 3L3CA 5B6PA 2HHUA 4LZNA 4C0OC 2GJSA 1GCUA 3D3BJ 2EFDB 1K3TA 3WWOA 2FPRA 1NR1A 5HFJA 3FZEA 1JLBB 3VAMA 4F2HA 4HVCA 3NAQA 5FDLA 3GFTA 4Q1CA 1PO6A 3BD8A 4C6RA 5JVHQ 1CUUA 1ZIYA 3QLEA 4TLBA 4UU8A 3RARA 2EL7A 1TL7C 2J7WA 1NDUA 4WL0A 2W2KA 4UY8T 5JZBA 4AJOA 3ND9A 4I14A 1J2TA 2XVAA 3NO4A 1EDDA 1X0FA 3ZV6A 2FZCA 1WUIS 2Q9UA 3F8SA 1RQRA 1WHWA 3PQ3A 4YB8A 4MHSA 3WDLA 4FQ5A 5HQMA 1J9EA 1F3LA 4Q3DA 4GZ3A 1U09A 3BWVA 1A97A 1WV0A 4EJSC 3E53A 2UVVA 1O0BA 1E59A 1DC6A 4BGUA 3OZFA 4TYAA 2DR6A 3G2QA 1CEEA 2G9OA 4Q1VA 3BWDD 4MVJP 5HO4A 4WP8A 3HXMA 4ZPVR 3IC1A 4RE6A 1NN0A 2MZTA 4G24A 2OM6A 4HFJA 4BFLA 1N36F 2RKWA 5HJXA 2Z95A 5DULA 5A4IS 2KHDA 3O5TB 1PS9A 1NF2A 3TNVA 2WICA 3A8EA 3D3JA 2VP2A 4ZIVA 1OILA 2VQ3A 5CYMB 2IV2X 3LP0B 1UAGA 3RSLA 3DVAB 5TIIA 1J70A 3GT3A 3K5HA 2QL5A 5KNCH 2GF2A 1B43A 1SU8A 2PYIA 4UHFA 2XZTA 4U7FA 1UJCA 1QZUA 4EW1A 3G2LA 4QYIA 4M1SA 3GFRA 1DS6A 3UMJA 3JVIA 2WIBA 1TO6A 3AW8A 4U6PA 5H81A 5SYNA 3T5MA 2IZ7A 4PYAA 1PW7A 3UNYA 4QXAA 5EHIA 1KVUA 3TOCA 4KDRA 5EL0A 2NO9A 3K71B 1FDNA 3KZNA 5HMWA 3M4NA 1YGYA 1DY3A 4ZP7A 3PCOB 1Y0BA 5CYQB 4WFIA 1YAHA 3ECSA 1RABA 2C58A 1A9NB 2VJDA 4ACAA 3BQNB 3KVRA 4LJAA 4KX5A 2HSJA 1KHVA 3S3TA 1T9GR 2VDNB 3GCXA 4YRZA 3MD1A 2Q49A 1YHQS 1OLXA 5GONF 1JJVA 3KOXA 2DSNA 3SHOA 4UNIA 2R4QA 1ZXBA 2CMKA 3TPFA 2CDQA 3SHTA 5KX5F 3I5BA 2OD2A 4FXPA 3T06B 2GT1A 2CLKB 2KZMA 2FZ5A 1HSZA 4C3KA 2O8BB 1EQ0A 3VVTA 4Y2IA 1L5VA 2CB0A 2DYAA 5JD4A 3MJDA 1S7IA 3EPHA 1QK4A 4PLWA 2XJ9A 2B4KA 1AA6A 5LPNA 1UMCA 2O2XA 5FTWA 2GO8A 3B5IA 3A6JA 3HN7A 3BXZA 4L0CA 4RLSA 4WKCA 2FIUA 4CLXA 1EWQA 3HSKA 2O4CA 3M8KA 1EZZA 1XEXA 4B2LA 2IHVA 2VOEA 3OVMA 5LZ7A 3CTRA 1EK0A 2QM7A 3MAAC 2ZC4A 2VHGA 1WUHS 4DY4A 2C4KA 3MZ0A 3AP2A 4RVDA 4AZTA 3BH0A 4QYTA 4Y2PA 4CO1A 4YT2A 2ZIZA 5EKUA 2F43B 2GESA 2PS3A 4B3MB 1FCJA 1W0KA 1DFIA 5LWHA 5JYCA 4EHJA 5AKXA 4PHHA 1PCXA 4HQ0A 3GLSA 4M0PA 4JI4C 4LI3X 2AKEA 4LFCJ 3C97A 4H6XA 4E1BA 3FYSA 3PVSA 1W4AA 4BQQA 4F2PA 1G98A 1P29A 1AXRA 4L76A 1P0FA 3WBKA 5LJLA 3P9QA 2V65A 3ZU5A 4ENUA 3CVKA 2QT7A 3NU1A 2C82A 4E07A 2ID9A 2OILA 3AUUA 4KQKA 4TKVA 4QX6A 5EP3A 2I3AA 4L75A 2I0FA 4HQOA 5BN4B 2RGYA 3GJRA 4AG5A 2ATLA 2BEUB 3OPYI 1Y1TA 1R0YA 3R7DA 2ACWA 2GLXA 3DTYA 4X65F 1DXYA 1Y5IA 2BZ1A 5JXGA 1RS0A 5SICE 4DV6J 4FBUA 2J6HA 1SBYA 1RT4B 2NZWA 4N3CA 4XAQA 2BHRA 4E7OA 3TRFA 1CC7A 4GP7A 2EFQA 5DG7A 3QMVA 4WZZA 1N75A 2JH8A 3LA0A 2D3TA 1G0NA 4OI0A 2VT2A 1S01A 5L8RC 4EVRA 1SB6A 3VR5A 1LWNA 3SV3A 3F5DA 4NASA 1C7FA 3SXPA 2HQBA 1SU6A 1RFGE 3FNBA 4ZDWA 1ZM4A 3I5XA 1WEHA 4N8NA 3W3ZB 3E8SA 2B20A 2B4UA 4WACA 1Z6GA 3IT3A 2D4AA 2RMKA 3DLTA 2RBEA 3OT5A 2VTBA 3ANSA 1VYHA 2ODQA 1OD6A 3FCEA 4DCUA 4F93B 5KYWB 1O97C 1N4LA 2EKLA 3O8NA 4CHTA 2ASJA 5ALLA 4NSNA 5A0YB 3A4IA 4F4KA 3A1UA 3DB1A 3PE3A 4KP7A 4HOYA 1F1JA 4OM7A 5G40A 3HEBA 5DXJA 5KPDA 5CEFA 4C7OA 2V8VA 4X4QA 3LBIA 4MMYB 1OA0A 2PGCA 4K28A 4ZZ1A 4NNPA 3CSDA 4LV8B 1JZSA 4MUBA 1FKOB 2R7UA 1XMQJ 4JK3A 1GPYA 4KEAA 1O5IA 3W5JA 4YO8A 3L8YA 3H9UA 1Z33A 2YVAA 4H27A 4EI2A 3SYKA 2WM2A 3QWPA 3U3ZA 2ZT5A 3J80A 1ITPA 2QU7A 4E2XA 5JS7A 2JGNA 4KR6A 3DDIA 2HQIA 2RH5A 1YZUA 3ANYB 1KQKA 1OU4A 2EZ8A 3QHPA 2OG1A 2C8KA 4IH5A 1KRWA 2WD9A 4BBJA 1KDVA 5ADZA 5AJTA 1UVKA 2PEZA 5LXTA 5EWLB 3HCRA 4USWA 1ORRA 4BB5A 2QLXA 4DLWA 4XIGS 1X5OA 3C87A 4QR0A 3DDUA 2BTEA 5CLGA 1VCNA 4TT3A 3LHIA 1V5IA 1I6KA 1KMQA 4AX8A 4XWYA 3CUYA 4WXMA 4WLUA 4J7CA 3UG6A 2DNNA 3ICVA 4POOA 2IYPA 1P4JA 5BN5B 5FEUA 4C04A 1RE0A 2FUNB 2R8ZA 4AZ3B 2ZDGA 3ACCA 3F7MA 3TLGA 1P1KA 2XMMA 5B2FA 3A6GA 7ADHA 3WYEA 3MECB 5CD4A 3WC2A 3UCFA 2D1FA 3TJAA 1DQNA 3TW8B 5KFUA 4IS2A 1RJDA 1D0IA 4FINA 3E1SA 1N2CA 3VKGA 4DSLA 3R4CA 2JGJA 4M87A 2ADBA 2WD7A 3ORSA 4E2FB 4WDRA 3RASA 3NWBA 3H5NA 3GAZA 4QD3A 2OBNA 4CL3A 3ZWOA 5KNBH 3G8CA 3QUTA 2W9XA 4N65A 9MHTA 4OQYA 4PR3A 4N39A 5BR8C 4DCJA 4QPNA 3EXEA 3WGVA 2XE4A 4ALLA 1MA3A 1UIMA 3CKLA 2OGWA 1Q74A 2RSLA 3DNCA 1BRTA 1WG5A 2R3SA 4K9PA 2EZTA 1CHNA 1WP4A 2ZJBA 4Y1FA 3V8MA 2VP3A 3DZBA 4F6CA 4L78A 5EWGA 3CGWA 2ZH8A 4Y2GA 4WLFA 3Q9NA 2FMFA 1IKXA 3LK7A 3IBCB 2COEA 1XTBA 3HB4X 1U8ZA 3MN1A 1MHTA 5A7HA 2B5JB 4KPCA 1W46A 4KG7A 4LMZA 4M63A 1SKYE 2VYNA 5M04A 4D96A 1JXVA 2AZMA 4JYAC 1L5LA 1E79D 4Y2VA 2XNQA 4N0QA 1NVEA 3UMBA 4ESHA 4RW7B 2ZBEA 4Z54A 3NGUA 1V26A 2VFAA 3NHRA 3OURA 3P0FA 4G0VA 4G0XA 2YNHA 1P5ZB 3BWMA 5KFMA 3KU4A 1JS1X 1R8JA 1J8QA 4XYBA 3C15C 3BKTA 1J24A 3Q7SA 2QAGA 5K6AC 2WSBA 4B73A 1W581 4Y3UA 4A92A 3O7WA 4YLEA 2KT2A 3MTDA 1VB3A 1RM5A 3PPWA 4HDSA 4X4NA 2Q2WA 1ZISA 1H6DA 4RVNA 4V0NA 1U63A 3DVRX 3GPCA 3MBIA 4BZWA 5DYIA 1FEHA 5DHAA 1E96A 1JIHA 3QBTA 1GPKA 4IDHA 4W99A 4R1LA 3ETMA 3GHHA 4B9LA 4CEIA 1OWMA 2AMJA 4GKKB 1YOBA 1QYXA 3WLNA 2X7HA 1I4LD 4R9RA 4JUIA 1VHFA 3TLAA 4U7DA 4IMPA 3LSYA 2J3QA 3DHEA 3PFHA 1S1UB 4KE6A 1OU0A 2H65A 3RVRA 5TPZA 1PQUA 1G5QA 4B08A 3PIDA 4ZHQB 2ZOGA 2QE6A 4L5YA 3INYA 3YASA 3FNQA 2FMXA 2Z6AA 2XM3A 3FUTA 1BXKA 4FT4A 1UBSB 2XRFA 3AF1A 3TTXA 4E3WA 1GQEA 3TTYA 3I72A 3K2QA 1I1QB 3FOEC 4DG8A 4TOIA 1WEXA 3LT4A 4DV0J 2DXDA 1SIBE 1R8QA 1J5PA 1VXRA 3RRHA 3WV5A 4F3KA 4DDTA 1TV6B 2AMYA 1B70B 2HMAA 3KFVA 3JQBC 1YBMA 3FZQA 5KFEA 4J7UA 1MO6A 1Q1KA 1F0XA 2AFHA 5KOYA 4YVFA 4CYMA 5C1DA 1REQA 1F8XA 3QPAA 4BQIA 3D0IE 2AG1A 3VKFA 3E05A 3WBJA 2JCVA 5AUQA 3GFGA 3ETHA 2HIQA 5KZMB 4HH4A 2BZGA 1TH5A 3JAWB 2C5GA 3PJ9A 4ZK7M 3BWCA 4RUKA 4O44B 2BD0A 1JQJC 2IH2A 2QGZA 2Q21A 3RSZA 2VUTA 4FBGA 2L17A 2VQEJ 1UFOA 2BYTA 3M6FA 4BLQA 1VI7A 1P4EC 4F3NA 4WS9A 1NV9A 3O9VA 4QBFA 3ZK7A 3C5WP 1XR7A 4X4TA 1C9YA 4MMXB 3OR2B 1VHJA 2I5PO 3OPVA 4DQLA 1XYGA 2YUIA 2IM1A 2HR1A 4XDZA 2BMDA 3ZTWA 1VL6A 1JLCB 2ATVA 2XMKA 4RQAA 4B43A 1Q7RA 3H20A 3QTLA 2GZSA 3AETA 2PRYA 1ACLA 5L40A 3BDIA 5C37A 2EW8A 1T29A 3BAFA 4DT1A 4BNHA 1ZHFA 3EW7A 4Y1RA 3WFJA 3LNVA 1LXCA 1PJLA 3OIYA 1XF9A 4IW3B 1U6JA 3UAYA 4MVCA 2FW9A 3NCHA 1TA0A 1O0PA 3G8AA 3H2LA 3OTHA 1DLJA 2DEUA 1YAJA 2OPRB 1GL9B 1HD0A 3FGVA 3QKSA 1U0EA 2LEPA 3MJVA 3QG1A 2H52A 2G08A 2PGNA 3AY6A 2C4MA 3N0TA 2G9QA 3C6YA 3AXKA 4JA2A 3NXSA 4P0PB 5KG6A 2QGFB 4I55B 2H3EB 3U19A 3UJ3X 2PGAA 2RQ4A 4F04B 3MGAA 4EFAC 2B34A 3PX0A 1NVDA 2ZJ0A 3DF9A 3ASYA 4K9MA 3BMQA 1AKUA 3SZUA 5AOBA 4KHPF 2X58A 1SKWA 4WA7A 1GKKA 4RX6A 2H11A 4KGKA 2YNMD 2XYPA 3FHOA 3KB1A 2C2KB 4JT8A 5L3QA 3KQMA 3W2WB 1V95A 2Y9HA 3DI6A 2VUIB 3KTAA 4C4PA 2QN6A 2QMHA 2W6MA 4JI7C 1KJQA 1CS4B 4FNIA 4BNUA 3A1WA 3ESDA 1OXVA 1URPA 4TLQA 3KLOA 2YDXA 4K2JA 1D4OA 3RSOA 3QWFA 4NEZA 3CRRA 3PEHA 1RBLA 1HA3A 4DLXA 3DO8A 2XVYA 4WEOA 2OPPA 4QSMA 3BZQA 2J9EA 1CZNA 1LVUA 3HFZB 2XD9A 4XWAA 3GMIA 1HYEA 2ECOA 1RCUA 4KQJA 4HGOA 3OTOF 3N8GA 1OSNA 4OYYA 5I6DA 2IF2A 5IYZA 2J7PA 2ZTHA 5EZSA 4DR1C 4MKIA 2WF9A 2H2AA 1JLHA 3PLNA 4TU7A 2RS8A 3U7JA 3ORHA 3PVZA 2CVQA 4AW9A 1U1FA 3WL6A 1N3BA 3KB8A 2C61A 4GSYA 5L9NA 2XC9A 1OV6A 2VL1A 1KMIY 5F4BA 1OUMA 1KI4A 3WNVA 2QTWB 5U1PA 1KGSA 3TG2A 2A3JA 1XEAA 3OJCA 1DLIA 3QT6A 3GR0A 5A2QU 1Z8DA 5ADUS 1LNQA 4D4LA 1BMDA 4B35A 4LRCA 3Q87B 4DTIA 4P72A 2WIJA 3HHDA 5CM2Z 1QVFR 3NKYA 4M9UA 1W0CA 4C05A 2YRXA 1JG4A 2YV4A 1J56A 2BEVA 2IZZA 3CLUD 2XWQA 2YZMA 5HQ8A 1SC3A 4BB6A 3IVCA 1RHRB 2Z2MA 4NX2A 4X91A 3BGVA 1U1NA 3WKEA 3GLHE 5ALKA 4YN3A 2PQ0A 4Q0BB 5HK8A 2ZS7A 3M2UB 5DGDA 1WUKS 1JT2A 5KWJA 5GMDA 3C98A 3SKVA 2EIHA 5DXFA 4Q05A 1JHZA 3DO5A 3DR3A 2R7RA 1K3UB 4I36A 2NX2A 1UMBA 5IC4A 4WPGA 4RTPA 3T9BA 3OP1A 1LBQA 2Z2LA 4X3PA 3BTVA 4YI3A 2F3QA 2OENG 1P5RA 3JQ9A 2J5XA 1V5VA 3QKTA 1TL4A 2ZSHA 3ZBQA 1VLYA 3OIWA 5KFWA 2CKDA 2ZIAA 2B9EA 3CUUA 4JP3A 2GCEA 1TUGA 3DC2A 4NXNB 1GZ6A 2VQ6A 4Y2TA 2X3DA 1IZ0A 1P1JA 3RS4A 2E4ZA 4QUAA 2PUWA 1P2TA 4DR3J 4B9MA 1DU4A 1V43A 4BC0A 1Z2EA 3GLRA 4KIUA 4IICA 3NBKA 2CDRA 5DLQC 1GKUB 3I52A 1Q5PA 3TTWA 2B1JA 1T8UA 3TWOA 1KJZA 1NJ6A 5G4KB 1P77A 1VRVA 4NCAA 4AZ0B 1QNFA 4HVZA 4JSTA 3EXYA 2ZS8A 1LRJA 1NHGA 3NVAA 2FHMA 2V4MA 2UYOA 1FRJA 3K0CC 5JANA 1NURA 1X7ZB 2WE8A 2ZIXB 2P3LA 1KYTA 3CJKA 1IJFB 3KKZA 1UVLA 3ILYA 3LZ6A 1ZYQA 4BSZA 2ZWVA 4D4HA 4CTKA 3EN0A 3MM6B 4MAAA 4PROC 2ZAOA 5BWCA 4Q4JB 4IH4A 1FDVA 2XB8A 2IBOA 4N77A 1LSOA 1X0VA 1SKQA 4L85A 2O3RA 2V96A 1SBCA 1YB4A 3OD2A 2R97A 1QUFA 5C7PA 4D80A 1IVSA 4P5DA 4RH3A 3TYXA 4QYSA 3A25A 2QPTA 3GW8A 5J2PA 2W2VA 3NHKA 1D1SA 5AK6A 2P2FA 3EX7B 3FSIA 3IT0A 4GX1A 4XOUA 1R8CA 3WLAA 3PYLA 2O2EA 5EEHA 1WHXA 3L46A 1XMPA 4R1MA 2ZH9A 2CUNA 2HHQA 1FTCA 2PU5A 3D4OA 2HMYB 4DM4A 2E5LB 5AW7A 1YRHA 4B7CA 4ETMA 3I34X 2YOHA 2ZPTX 1IWAA 5K8TA 4FYVA 2OD4A 4ZN1A 4JMPA 2RHDA 1IQRA 4KO2S 1WXIA 3SX2A 2FV8A 4KN9S 3T54A 3OQBA 5IJXA 4TL8A 2O8CB 1A8PA 1LF5A 3PPVA 1PAUA 2VJLA 1B1CA 2HCRA 5KG1A 5M2UA 1M0TA 3SBXA 2Q4TA 1L7BA 5GM1A 4C89A 3GC6A 4RY9A 3RW9A 5K0ZA 3UTCA 4JS0A 4Z8XA 2PMWB 5H82A 3MIZA 4ODJA 2HHWA 1QMPA 1KP3A 1LK7A 2MY8A 1IOZA 3OE4A 1G20E 5EESA 3ZGVA 1JHVA 4HNUA 4CLSA 3M8PB 5JY6A 1G18A 5F77A 3WNCA 5C7IO 3W5YA 1LW2A 2OO4A 2XHZA 1NN5A 3ND8A 2XOKA 2B4RO 1ZNWA 4AWAA 3CYFA 2FJ0A 5FXMA 3K8OE 4JLNA 4MR7A 2V0CA 1Y6JA 5DM7Q 2E7XA 1OYDA 2L41A 1X1BA 1R0CA 4F86A 4RZ3A 2CLEB 1U0HA 3UMGA 3FUVA 1NN1A 3K31A 2Z2YB 5AVQA 3ZHRA 2AGOA 5T4BA 4HTAA 1G8MA 2G9UA 3VBEA 3VJKA 4B6FA 1YCHA 3HBMA 2AUNA 4MQFA 4M76B 2EFVA 4LBVA 5LD2B 2NYAA 1WG4A 1DPFA 1AC5A 3ERCA 3AVWA 2WQ6A 3IPAA 3ZXSA 3NHUA 2VUSA 2D1YA 3MFIA 2IPOB 4UHKA 5JJCA 1S6QA 1H7WA 3UK1A 4H4EA 4UU0A 3LAMA 4TKZA 1GAEO 4W9NA 3MURP 3H13A 2C2BA 4HXYA 2PAAA 2YVQA 1H85A 2JRCA 3QT7A 2VR1A 2HQFA 5DDPC 4PSUA 4FIDA 1H2WA 2II6A 1K6XA 2VDMB 4ZJYA 4BAUA 1G1AA 3V9PA 1YJAA 2W5UA 1MEOA 5BMVB 4WUTA 2BWJA 4CE6A 2FR8C 4XGIA 2HSDA 1PJ2A 5EP2A 2ZBFA 3FETA 2ERXA 1ZCAA 4O4HA 1K4MA 1SUWA 3GJQA 1F51E 2UU9B 4JGGA 4NMWA 1I5OA 2EARA 5B7NA 5CA5A 1KH3A 4WN9A 4ZOLA 1UZLA 1E6YA 5J2NA 3A6EA 5IX8A 4Z0HO 4MKBA 1YCFA 5ETVA 3P4UB 2F8MA 1BX0A 2H16A 2O2IA 1PG5A 2FZ4A 3C6MA 1D8ZA 3AY3A 1BXGA 4DN0A 1A9ZA 3CCFA 2FPHX 5ICFA 3UD4P 4B3MF 5ALJA 3IYLW 1JJ4A 5EJ6A 5REQA 2GLTA 5P21A 3SDSA 3U7QB 1DUIA 2Q2QA 3TPCA 4CCYA 5EE0A 1FLVA 1Y9ZA 1P4SA 2CVOA 2ZYGA 2VPQA 5BQOA 1BJRE 3U1MA 3SI7A 2P6UA 2JAPA 3PLRA 2ZRJA 3MWJA 3UK2A 1S1TB 3AD9C 3INGA 2V2QA 2ZDHA 4X66J 2ACYA 4S2EA 3S7ZA 4DL6A 3K9NA 3MR2A 1F7UA 4K87A 1BKYA 2R1UA 4K9KA 3BF4A 4PEVA 2QFJA 1SB8A 3LKVA 1J39A 5EMMA 2W01A 3CN7A 4YPFA 1N36C 2AR7A 1OBFO 2ZQZA 4BP3A 4A0GA 3NJ8A 4ZT3A 4OLAA 3MWKA 2DNRA 2K6GA 3CXCR 2EJCA 4HVTA 4GG1A 2FLLA 2AOUB 1URNA 2FQYA 2Z5VA 3ITKA 1JHAA 2RH8A 1K2WA 1NTOA 1ZTTA 2EWMA 4GH5A 2R4UA 3O91A 1GJRA 1OLUA 4MGHA 1DCTA 2RHQB 5ETRA 2QTAA 3FCHA 1DKUA 1MB0A 2HK9A 2I67A 2N7CA 1HNVA 3DOFA 3FHLA 4PYJA 3LHSA 4N18A 3M6XA 3IP0A 2BXJA 3SC4A 4F02A 1CFZA 4UOQA 3VMFA 4ZI5A 1HFEL 2I4TA 5EWFA 3E01A 3ON5A 1HRDA 1QE1B 2I2BA 2RG1A 4R8MA 3D6FB 3BIXA 3FYUB 4K0KB 4X1KA 4F11A 5AJWA 4CRJA 1UWCA 3A13A 2HN9A 2J6BA 4LHEA 2MM9A 2OMEA 3R3XA 4I4TB 2IHNA 5EGYA 5B58T 1Q0NA 2M32A 3QXCA 2R48A 4G5SA 3R3TA 2X3FA 1PEYA 3AJ1A 1DPGA 5T67A 3WYGA 1CLFA 1WORA 1HORA 1ZO8A 2Y0BA 5D1NA 2YS6A 5KT7A 4EWLA 2Z8XA 1P33A 2V55B 2KZFA 5BR8F 3CX3A 1Z3CA 2JAXA 5HCNA 4RENA 1ZH0A 1EB9A 2JJ1D 2VWQA 1JJHA 4H7EA 4Y0VA 4XDGA 3GEIA 3H5LA 3G87A 3HZGA 4BPBA 4RF5A 4LECA 5K8JB 4FF4A 4GT1A 5IWAF 1BD6A 2AYBA 2A0FB 1YUMA 3O38A 4NZPA 4V1Ak 3AAWB 3TR3A 1LW0B 2XGQA 2X2PA 1FJCA 3LFUA 4PLGA 3OL7A 2WJ6A 3MC1A 2R86A 4MS4B 3N6NA 1YIAA 4C4YA 1SVOA 5HBRA 4D42A 3WY9A 1OSCA 3N8KA 2WM3A 3SSNA 3DCNA 1H73A 1U7TA 5FPKA 5ENVA 5HW0A 5HROB 2J8SA 5FF9A 1OIWA 2WMDA 2XUOA 3L7UA 4RCZA 1PNTA 3RR2A 1T3NA 1JIKA 1RM3A 4CN8A 1RU3A 1T43A 2O52A 2Z08A 4AB1A 1HE8B 4UBOA 3IS9A 2AT1B 2CNKB 4Q01A 3H1AA 3WC0A 2ZOMA 3KHUA 4YUYA 3FLMA 2MGZA 4OYPA 4IUCS 2QI9F 3FN4A 4TZ6A 2YUTA 4JGIA 3AGQA 1T0IA 1UKVY 1IXKA 5IEBA 5HZKA 1GGHA 4U63A 3CEJA 2FDCA 3TNDA 4CO3A 1Y98A 3QHQA 2BEKA 4HWOA 1BMQA 4HWGA 3M30B 4HNAA 4BC9A 1S2NA 4AKHA 4ELUA 1RAIA 3ZHQA 2IOYA 1RAFA 3Q0AA 1H65A 1JU3A 4I9FA 1H8HD 1RWOA 2Q1TA 4UBNA 3F6BX 2UUAB 1UC4B 4X65C 2OO5C 4BY9E 4NZMA 3GEGA 4KQZA 2VA9A 1YASA 2Q1SA 3TQHA 1UBGA 1REGX 4DX8H 4Y2QA 2HBQA 4QQFA 1PV4A 4XD2A 4ZA1A 3U3RA 4KGZB 3K0HA 3GCDA 2FWNA 2JFKA 3MQ2A 2MSWA 5AVZA 2P2JA 4DI6A 4BB0A 5CEJA 4HDNB 2AWZA 3ZY3A 3H5WA 3NDRA 3OTGA 1SHLA 2EGUA 1HQYE 1HBMB 2VH2A 4LF9B 3L7JA 4FT2A 3RRBA 4LHSA 3E8XA 4OK6A 2R8HA 1EA7A 5LQRA 1COWA 4X64B 3CJTA 3MGKA 3EE3A 2OH2A 2BQRA 4MIWA 5DNWA 2YN2A 3LRXA 4DL7A 4UD6A 1XS3A 4BO1A 4RCVA 2FNAA 1GNTA 3PD7A 1VBFA 3Q15C 4LJ9A 3ZHSA 2G76A 2IYFA 2BKNA 1DBVO 2MKJA 4JI4J 3TKAA 4QGHA 4GI2A 1CJUA 3RGIA 2XO6A 1RQXA 2ZAGA 1BNCA 2P9CA 4M54A 2OGSA 4LJMA 1FLDA 1FNXH 4UMDA 4PTZA 4BKOA 5HKAA 4NRUA 4BQOA 3GWCA 5CR9A 5BOSA 1THMA 1KXJA 3GEHA 5TQJA 3IR5B 4NLXA 3W8GA 3VAFA 1WF1A 1M7GA 2I3GA 3OKPA 4B80A 1VCTA 1ZJ5A 3QFWA 1MCZA 3RTCA 4H4OB 3V2HA