2YX1A

Crystal structure of m.jannaschii trna m1g37 methyltransferase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
323
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of archaeal tRNA(m(1)G37)methyltransferase aTrm5.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Hypothetical protein MJ0883
total genus 92
structure length 323
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yx1A01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2yx1A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2yx1A03
2BR5A 2JH9A 3JWIA 5DRTA 2IIPA 5DSTA 4KRGA 4KIFA 3GU3A 4L7VA 4OBXA 5EG5A 3HA3A 2YX1A 5HFJA 3VSEA 3SM3A 2LD4A 3MHTA 1PJZA 3UZUA 2DULA 5LR6A 1DUSA 3CKKA 4OQEA 2DPMA 1JTEA 3MCZA 3E7PA 5F2KA 3NDJA 3MERA 2PX8A 2OZVA 4EVIA 2CMHA 4RTJA 4C4AA 2AN4A 4IKPA 3OE5A 4GQBA 3T0IA 3SMQA 2PX2A 5BP7A 2Z6QA 2VZ9A 2R6ZA 3M4XA 4BY9E 1KR5A 3OU7A 4QVGA 3CJTA 4CWAA 5KQSA 4RVFA 5BW4A 3FPGA 5HILA 2IP2A 3LHDA 2ONZA 3LSTA 3HA7A 3O4FA 5E1BA 1U2ZA 1FBNA 4LWOA 1NBHA 3C3PA 5K0NA 5K09A 4POOA 2IH2A 5E1OA 2YXLA 2ZZKA 4GEKA 3UFBA 5M5BA 4C05A 3HA5A 2UYOA 2ZW9A 3PX2A 2PY6A 3FUXA 2G71A 4DQ0A 1SUIA 4ZTBA 4DKJA 5DTMA 4EQZA 4FS8A 5DTQA 5EZQA 2VDUE 4KWCA 1XTPA 4YV2A 1YFJA 3M6XA 3MCTA 5D1NA 2AVDA 4RX1A 1NW7A 5CCBA 1DCTA 5C0OE 5CVDA 4M37A 3GRRA 5B1SA 3FPJA 4R05A 4YUVA 1XCJA 3P97A 1JQEA 4OA5A 5DLYA 1QAOA 1YZ3A 2Z6UA 3PLAE 3WSTA 3EVBA 3FUUA 4FP9A 3X0DA 2H00A 4FT2A 4DCMA 4HRAA 3LL7A 4P58A 2B25A 2PJDA 5HIJA 4E70A 4NECA 3FRIA 5CD1A 4RSRA 1AF7A 4M38A 4XUDA 5EGSA 5ERGB 2O0LA 5KYGA 4X41A 3FTEA 4PINA 2FHPA 4HC4A 4BP1A 3FPFA 2EX4A 3TRKA 1HMYA 3KKZA 3JWHA 3P9IA 4EKIA 5EQJB 1YF3A 2IBSA 2OYRA 2AOXA 1I4WA 3ANXA 3AXTA 2EG5A 5FADA 4GF5A 4HH4A 5LQNA 1NW5A 1EAMA 2A14A 2FK8A 4PYKA 1TW3A 1N7IA 4RVGA 4QPNA 1X1AA 4DMGA 2KW5A 5DM1A 2P7IA 1KIAA 5K8VA 2V74B 1JG2A 1WXXA 4M36A 2C7RA 2C7QA 3BWMA 10MHA 4AZWA 4GOMD 4CKEA 4PGGA 5FULA 3UJ8A 2G70A 3EVEA 3LKZA 3MB5A 3QOXA 1L3BA 1SQFA 2IGTA 3KR1A 1F38A 3OE4A 1RJFA 4X61A 1SKMA 1VLMA 1KXZA 5EIFA 2NXJA 1G8AA 2B2CA 2I62A 2JHAA 1BOOA 3DXXA 2AN5A 3DR5A 2PKWA 3I9FA 5E8JA 3PFGA 2GS9A 5FQNA 4EKGA 4KDCA 5E9QA 3LCUA 1KP9A 5JUWA 2GLUA 4QDJA 1P1BA 3HCDA 3UA4A 3P9CA 4RV9A 2IFTA 3LBFA 4GC5A 3MQ2A 4KW7A 3ORHA 4B17A 4E2XA 2P3LA 4P7FA 4C03A 3P2KA 4R6WA 3KPUA 1MHTA 3ELDA 2ZZMA 4OX9Y 2JH8A 5ICGA 4HTFB 4MIKA 5DWQA 1NKVA 3TOSA 3OPNA 3PX3A 4GC9A 5JR3A 3HCBA 2AOUB 1WS6A 1BC5A 1R18A 2Y1XA 3C0KA 5FTWA 2OY0A 3LDUA 3P9KA 2QY6A 3DLCA 4FGZA 2PT9A 3E05A 2K4MA 5CVEA 1KYWA 1UIRA 2F8LA 3EEOA 3HCCA 2P8JA 2B9EA 2ORED 3EVDA 3I58A 3NW9A 7MHTA 4ER6A 2YTZA 3EMBA 3G2QA 3GWZA 2OB1A 4E2WA 2C7OA 4WVLA 3NJRA 3MAGA 4JXJA 5ICEA 3I64A 4GUAA 5EKUA 3FUTA 4MQ4A 3OU6A 5CM2Z 5DXJA 3U81A 3BT7A 1O54A 1G55A 1SG9A 3M6WA 1OR8A 3NVMB 4OBWA 2ZBQA 2ZBPA 3P2IA 3OZTA 3E23A 4KIGA 4RTNA 5P8WA 1IXKA 1QZZA 2BM9A 3KR9A 4QQNA 4IV8A 1AQIA 2IPXA 2O07A 4P7KA 1NE2A 4P7GA 4PONA 5GOZA 2O06A 2AZTA 3JWGA 4X60A 5GWXA 4F86A 2YR0A 2WA2A 5EIWA 3AWIA 4BLVA 3CJQA 2NYUA 1QANA 2AVNA 2ZIGA 3P2EA 2JHPA 3G5LA 3OU2A 2P35A 3MTEA 2NP7A 1M6EX 1JG3A 2Z6AA 4DA4A 4PWYA 3MGGA 3FUVA 1XVAA 3AJDA 4PYMA 3GXOA 3CVOA 1NT2A 3TR6A 3UJ6A 1VE3A 2CKDA 1FP1D 4A6EA 1JR4A 4KDRA 2GA9A 3CGGA 2P7HA 5LSAA 1IY9A 5GIPE 1R00A 2P3QA 4ATNA 3UJAA 1NV9A 3OCJA 3UJDA 5FHQA 4YV1A 4M7RA 1FPQA 1NW6A 2BR3A 3KPYA 3R6TA 4E2ZA 1JG1A 3SGLA 2JJQA 4FZVA 3T7RA 2NP6A 4P7JA 3NWEA 2HWKA 4QVKA 3HP7A 5BXYA 4OQDA 5EKXA 4R8RA 1RI5A 5U4XA 2OKCA 3PB3A 2QM3A 4DCGA 1QAQA 1JG4A 1R8XA 3SSNA 1BKYA 4CKBA 3G2PA 1VIDA 1YZHA 2ZFUA 1RJGA 2IH5A 3LX6A 2FK7A 3F4KA 2PT6A 1D2HA 2AS0A 3B89A 2O57A 3DH0A 4HG2A 9MHTA 3FZGA 2EJUA 5EMLA 1R6AA 2H1RA 4BLWA 2IDKA 4BP3A 2AN3A 3M70A 2ADMA 1SVUA 4R6XA 3DMGA 3LCVB 5HEKA 5K03A 1ORIA 3DXZA 3OFKA 3BWBA 5F2NA 5K0LA 3NDIA 2P1DA 2H11A 3G2MA 4PIPA 1L9KA 1EJ0A 3GRYA 3RW9A 3GO4A 2FRXA 5T6BA 2ESRA 3PFHA 1XDSA 3FTFA 4AZVA 3HCEA 2PXCA 3V8VA 3P71T 1G8SA 3EEYA 5EOVA 4E2YA 3K0BA 4F85A 5LQAA 2R3SA 3DMHA 4U7PB 2PX4A 4A6DA 1Y8CA 3I53A 3G8AA 4CXMA 3FRHA 2OPBA 3M6UA 3O7WA 2B3TA 3HVIA 4FSDA 2VDVE 1JQ3A 2ZSUA 3I5UA 5E1MA 3BWYA 1FJXA 3E8SA 3V97A 3LDGA 3TMAA 4PCAA 4C08A 3KQPA 3CCFA 1R74A 1BHJA 2AR0A 1X19A 3Q7EA 2BH2A 2HNKA 1B42A 1KPHA 2UYQA 1RJEA 4PYNA 4RTPA 2UYCA 3FYCA 2CWWA 1HNNA 5EEHA 1RJDA 3BUSA 1VL5A 4PYOA 2XVMA 4LWPA 2PV0A 5MHTA 1TW2A 1T43A 3M33A 1UWVA 2WK1A 3EGIA 1V39A 3CJRA 5DSXA 5K01A 3G8BA 4PNEA 5C9ZA 2NXNA 3FTDA 1G38A 2AOUA 1RI4A 4Y30A 5DX1A 1XXLA 1EQAA 5E9JA 1L1EA 1WY7A 3KQMA 2AOTA 5EC8A 5IH3A 3TM4A 4MHTA 2OBFA 1SUSA 1NBIA 2IH4A 4PGHA 3TQSA 3T7TA 1XDUA 1NV8A 1EIZA 4LG1A 2ZVJA 3KQVA 2ZIFA 1INLA 1N2XA 4CKCA 4ER5A 4HGZA 3EVGA 2CL5A 5K0EA 3HVHA 4G56A 5EHIA 2BZGA 1EJ6A 1X1DA 2AOWA 4YMGA 5K05A 4H0NA 1AQJA 5E9WA 2JG3A 3MTIA 1P91A 1ZGAA 3A4TA 3BKXA 3B3FA 1D2CA 1SQGA 2QRVA 5EEGA 4MWZA 5BW5A 3PVCA 5K0JA 3Q87B 4AZTA 1DL5A 2ZIEA 4E33A 5LQRA 2HR1A 4RTSA 3ERCA 3KPJA 3BZBA 4LECA 3BGVA 5FWDA 5CIYA 2JHCA 4PYIA 4QQKA 5EMKA 1XJ5A 3HEMA 5K0GA 2P41A 2G8NA 3L8DA 3OZSA 5H02A 4K6MA 3A27A 5E1DA 5C1IA 2C7PA 2IDJA 3UJBA 3KQOA 5CVVA 2I7CA 1YB2A 2QE6A 5HOQA 3G2OA 5GINE 1JSZA 1ZHFA 4RTMA 3EVCA 4XCXA 3UBTA 3NMUF 1XDZA 3VC1A 3GGDA 4C06A 5FA5A 2ERCA 3TFWA 4UOEA 5FA8A 2ZULA 3GJYA 4KVZA 2PWYA 3EPPA 3SXJA 2NXCA 3KPVA 3KQTA 2UYHA 2IBTA 3R0QA 3KQQA 2QRVB 1Q0TA 2HTEA 1D2GA 5FUBA 4AZSA 3G7UA 4IWNA 1O9GA 1X1BA 2ONYA 3C6MA 3OFJA 5F2OA 5FWAA 3UA3A 4YV0A 2I6GA 4RYLA 3KR2A 4CTKA 3VC2A 3TPZA 3LKDA 3ELWA 4WXHA 3THSA 1NW8A 1M0EA 2ZCJA 3GDHA 3GIWA 3KU1A 1QYRA 5DRYA 2P3OA 2PXXA 4F84A 3GRVA 2QYOA 1MJFA 4X63A 4V0RA 5EVJA 1UFKA 1XCLA 2BM8A 3PTAA 3SVZA 5ICFA 4E31A 1TPYA 1N7JA 5E2AA 1VPTA 1VBFA 3HCFA 3BXOA 2ZLBA 4RTQA 3O31A 4PYJA 3NVKI 5CUQA 4YUWA 1O9HA 1G60A 3R3HA 1VQ1A 3HNRA 4X1OA 4ISCA 3RODA 3ER9A 1IM8A 2EJTA 1R8YA 2GPYA 5EMJA 1JSXA 3HCAA 3UJ7A 1RI2A 1RI1A 2XYQA 3HVJA 3IEIA 1EG2A 4RVDA 4FR0A 4GOOD 2YUIA 2E5WA 3GNLA 3PS9A 2P40A 5EZSA 3KQYA 4Z2YA 4ER7A 3P9NA 3ELUA 2YVLA 2O05A 5D1HA 1L3CA 4RWZA 3BGIA 4QTUB 2VDWA 4Y2HA 5DM2A 5EMMA 3ER8A 3HTXA 5FCDA 1KPIA 1ZQ9A 3R24A 1M6YA 3B5IA 3TLJA 4DF3A 5DTRA 4CTJA 2HMYB 1KYZA 2YXEA 1ZGJA 3ELYA 3DXYA 3B3JA 1L3IA 2PWPA 4GBED 5KVAA 3CC8A 3A25A 2PLWA 1ZKDA 2FYTA 1VP3A 3A7DA 3FUWA 3FPEA 2YXDA 5GM2A 3RIEA 2PX5A 5DXAA 1YUBA 4YUYA 5K0FA 8MHTA 3DOUA 2GAFA 3AY0A 3SX0A 1JQDA 3ID6C 4DZRA 2BR4A 2V7EA 4AX8A 3EVAA 5T67A 2NXEA 2ZBRA 3BGDA 3R9XB 2YQZA 5HZMA 2ZWAA 3TM5A 2PBFA 5DM0A 5KQRA 3G5TA 1I9GA 3IV6A 2ZWVA 2PSSA 4GOND 4QPPA 4E32A 4GOLD 1ORHA 3DP7A 4YUZA 1G6Q1 4O29A 5K0CA 2G1PA 3A7EA 3THRA 5GIOE 5DPMA 2PXAA 3LGAA 5DT2A 1QAMA 4FT4A 4ER3A 1YFLA 3K6RA 1ZG3A 1I1NA 2N47A 2VP3A 3EGEA 3G89A 4HSGA 5FHRA 3DLIA 1Q0SA 2PGXA 3QV2A 4E30A 3IYLW 3DUWA 3KQSA 2CMGA 5EPEA 1F3LA 3PT9A 5LQJA 3S68A 3EVFA 5DX0A 2OXTA 2HV9A 4U7TB 3NWBA 4YMHA 4R8SA 2XBMA 3HVKA 2FPOA 3NTVA 2Q41A 3BWCA 4RTKA 1NW3A 5DM4A 3UJCA 3T7SA 4ER0A 3KPWA 2GB4A 5FQOA 2AOVA 3HM2A 4QDKA 2NNWB 3EGVA 3DTNA 3OZRA 4QTTB 4XUCA 5E2BA 5GM1A 2WA1A 2FCAA 2UZ4A 3AXSA 4HGYA 3BKWA 3P8ZA 3KR0A 5CVUA 3UJ9A 3B3GA 1P1CA 2GH1A 3LCCA 5GP1A 5HIIA 5KS2A 3H2BA 1KPGA 2G72A 3LECA 4RTOA 3FYDA 4OA8A 3REOA 2B78A 3GRZA 3JWJA 2XYVA 3FTCA 5HIMA 1X1CA 3LPMA 5G02A 3IHTA 5CVJA 5CCXA 2AOTB 2ZZNA 2ZTHA 5ICCA 3ME5A 3EVZA 3KHKA 3UWPA 2VS1A 1WXWA 4MTLA 4EK9A 5LQKA 1PRYA 5DX8A 4IV0A 2I9KA 3LBYA 1P39A 1H1DA 1KHHA 3DMFA 2PVCA 5IKMA 5LQCA 3VYWA 2OB2A 4RTRA 4BLUA 3GCZA 5HIKA 4V0QA 1WG8A 4XUEA 3EMDA 4RTLA 4DM3A 3CBGA 3C6KA 4HTFA 4PYLA 3SSMA 4YUXA 4C04A 3SR4A 3A26A 3KQWA 4RVHA 2OO3A 3M6VA 4EMSA 3G88A 2Y1WA 3QOWA 5EHGA 3GRUA 5K0BA 4PCLA 2XVAA 1FP2A 5E8RA 1JTFA 3TKYA 4AUKA 1Z3CA 5LQUA 1WZNA 3TKAA 3D2LA 3DULA 2EFJA 1VP9A 3LDFA 3B7PA 3C3YA 4FSXA 4PIMA 5T64A 1AV6A 3FPHA 2XYRA 4PYQA 1RI3A 4C07A 3SSOA
chains in the Genus database with same CATH superfamily
5LZ2A 4DDMA 3I23A 2UXBF 3T4UA 4I3GA 1CJBA 2NUPA 4JLAA 3GCGA 1P73A 2NTJA 3MMCA 2RRNA 1Y7PA 2FR1A 4W1SA 3FCAA 3PFFA 1O90A 3QSIA 4Z53A 2P2QA 4RXTA 4CEJA 1G6OA 2ZB7A 1DTWA 3K9LA 3SDZA 2R9LA 1MB3A 4N6GA 3IE1A 1U3WA 4F9GA 1NW7A 3L5KA 4M49A 4HHHA 5FV4A 4FMPA 2QL9A 1E7RA 4EB0A 4LJYA 1IHXA 4CNBA 1K44A 4JLVA 3E70C 1RBMA 3EZUA 2Y2UA 1IJFB 3L6OO 2KKHA 3V6JA 4HD8A 1O57A 1CJVB 4W8GA 1CNMA 1HE2A 3HBNA 3C7CB 1CJVA 2EX0A 2GKGA 3I28A 3D4BA 2IK8A 4JSTA 3L0SA 4Q9LA 3Q8YA 5D7NA 1Y6FA 1V3SA 1XKQA 4BDTA 2XAAA 1BXRB 5IUNC 1DWUA 2JHFA 5A03A 5HF8A 2GYVA 2R86A 3FBGA 4EH1A 1WMBA 1P9NA 1GTL1 4KXFB 4PUIA 3M1AA 1P7VA 4J76A 1WMFA 1CUHA 1IUKA 1XMSA 1ZR4A 1UDBA 5ULLA 4JJGA 5BOVA 2GHQA 3RJMB 4QJBA 2EF0A 3PDIB 1FXRA 3ZWDA 3FFTA 1RRGA 4KGVA 3L04A 5E41A 3Q12A 3V2GA 5IOLA 5BNFA 4BLVA 3NAIA 4WYLA 5CFZA 2B4KA 2QRZA 4Q37A 1SU8A 1LW0B 1NIPA 4YR3A 4MUMA 3UJ6A 1TVCA 5B7QA 1RT6A 3SGLA 4Q18A 4YJKA 1RTHB 5AYVA 2OPQA 1D03A 5LA6A 1EFPB 3JX9A 2FOIA 5CDYA 2YBDA 2IXTA 1FVXA 1IFXA 1QTNA 4BFSA 4QO8A 1OLXA 3MWEA 4M6WA 1TTQB 3IUMA 3RBZA 2IXBA 4ZMMA 4ER8A 5HS6A 5EE5B 5LIPA 5GMKa 3UN5A 3QXJA 5A0YB 3NNSA 1UVMA 1L7NA 3OQ2A 4MRMA 2MMCA 3KETA 3A6EA 4M7PA 2VKQA 5K5EA 3I5UA 2UZ0A 4GXTA 2VRNA 1H05A 3V7UA 2QTBA 5INTA 2XUPA 4CTMA 3GEMA 2CD7A 1BWVA 3C4VA 1U25A 5L39A 3LANA 3D1QA 1SBNE 1RYYA 4I66A 3OTCA 2VUTA 5F1PA 1L4UA 1E1RD 2ZJ5A 3RFCA 4HUTA 3COPA 2F3TA 5GADl 1T36B 3OIYA 1F8XA 2FF7A 2ZIEA 2YXBA 1YQWA 3V4SA 2QZZA 5D3MA 2XBPA 2OK7A 1JDBB 3MAJA 3TI0A 1LLFA 1QDUB 4XCXA 4MB6A 1NT4A 5HFNA 3SXJA 3KPVA 4FFBA 3OTIA 4RKWA 1BN6A 2FTRA 2LGJA 3RHSA 2P9CA 4QSMA 5JV5A 2ZG6A 4Z0TA 4YAEA 2WK4A 3RIYA 2ZM5A 1O0PA 2HCTA 1TE2A 2GCIA 5EA2A 2FEAA 2AXEA 2YWKA 2NZ2A 4YJGB 1FJGF 3HSYA 2HW8A 2Z8XA 5FX2A 5FORA 1FYVA 3R6DA 4B6PA 2JGNA 3K7RA 4LF7F 2JGRA 5KVVA 3FZYA 2H0AA 5IWAC 4DF3A 4WTYA 3IHWA 4B4KA 3B3JA 4R9VA 3BGWA 2ISSD 3S55A 5CFNA 4PR6A 1IYZA 2CV1A 1ECGA 4Z6KA 2XWBF 2BAGA 1CYEA 1NVWQ 3KJXA 4AX8A 4X5OA 3CLRC 2Z2YA 1XHLA 3T5JA 3IRUA 4MAMA 4BBZA 2LXUA 2O7RA 5A62A 1VQPS 2OSQA 4RNNA 4FT4A 4D9EA 4TL6A 4N5SA 1B14A 2GZSA 2XB2A 1RYNA 3COWA 1K66A 4ML3A 3EXFA 2OXTA 1KBRA 3U56A 2BW7A 1FLNA 1NW3A 1HWUA 2BHLA 3WMGA 2WV7A 4TV8B 5TQ0A 3UJ9A 2AC4A 4EO6A 4BO1A 3WK7A 1A76A 3PI6A 2AOTB 1W9HA 2ZWMA 3IAM6 2X5KO 4X20B 2OHHA 3MJFA 2ZB4A 3C6KA 2VDMB 2V34A 5JAMA 2R62A 4ESVA 2CXNA 4LIRA 2KH9A 3C1UA 2HQIA 2AMYA 1H74A 4ICLA 5TPWA 3HM9A 3UMVA 3ZC4A 1IUPA 4WBNB 2IJFA 4LF8C 3TZYA 3V81B 4BNIA 5ESXA 3TOCA 4ES3A 3FFAA 4RF4A 3LZ6A 1YBFA 3NALA 1KH2A 2QX7A 1UM9A 5F8GA 3W06A 2QL5A 2HPHA 3FJYA 4YDSA 5HKOA 3A05A 4DKJA 4J9QA 4B9EA 2FJEB 1NULA 4MYSA 4LN1A 3J7YU 1USPA 4I6GA 5E7MA 4R83A 1HFKA 4P2GA 4Z9BA 1KQOA 2E49A 4F7DA 2B8WA 5HUJA 1ACLA 2R47A 2Z3WA 4MWCA 3PYGA 1FRLA 3D0QA 1G8YA 2WYUA 2AOXA 1I4TD 3FMVA 2YQ4A 3W3AD 2OWEA 3WZMA 2H2GA 4XQ0A 1EK0A 2MQ8A 1XRMA 3JYLA 3PWTA 3SKXA 1T3OA 2V7XA 1DBQA 5IC6B 1I3MA 1NF3A 3EASA 1SVDA 4KIAA 3DBHB 1O89A 2YKOA 3DBHA 3K5OA 1YBAA 4D8YA 3GRAA 2XNSA 3NEPX 3V4FA 1K8QA 3CJKA 5KYVA 4GO1A 2IIHA 1L4HA 4ND5A 4ELVA 2HRYA 3FFBA 3VBEA 2D9PA 4DUZF 2AYYA 4US0R 2BFBA 3K05A 1GLVA 1I3OA 3MMSA 5JBQA 1V5IA 2JHPA 4YDQA 4Q93A 2FR0A 1MVNA 4ZMBA 4PLHA 1Q95G 3CZ9A 1FDOA 4ZQIA 1FL9A 3PUZA 1NSKL 3UDCA 1R0BA 4TSFD 4OYBA 1RMYA 5T3UA 1JBQA 2WOJA 4UMDA 1GR0A 3LUSA 3W5CA 5C1PA 2OPHA 4EGCB 1CKEA 2IOFA 4Z4GA 4R8MA 4X4VA 2IEBA 2Y1RI 4L4UA 1T9GR 2COLA 4TQRA 5K0LA 4N5NA 6Q21A 1NVXQ 3O8QB 4BNUA 1Y8CA 5EXDA 2SKDA 2BFMA 1CG2A 4WU2A 2X5XA 3PU6A 2XLBA 4YJ3B 1EYZA 2OOSA 5F9LA 4TTAA 5AKYA 2XUAA 2X9QA 3EHEA 3P5BA 3KT8A 3WLJA 1R6VA 3MF4A 3T1VA 1WTAA 1EVJA 3OIUA 3QPDA 2GEDA 3KOUA 2O2HA 1T29A 3EYWA 1CJKB 5DCYA 1F0PA 4M63A 3WA7A 4KXUA 3BK2A 1Q8IA 2G04A 2JVIA 1MV8A 2X58A 4IGEA 3MCNA 2G9UA 2E5LF 3BO2A 1X4CA 4LKRA 2IDJA 1N34J 1FT8A 5F8MA 1T3SA 2OC9A 1ZHFA 4BO4A 1RK8A 2R8PA 1KZHA 2VJOA 4GKJC 3LOQA 2QL7B 3AFIA 2I6GA 1LWEA 4YMTA 1HY3A 2XMUA 2VXBA 1PA4A 4MULA 2G5CA 2J9CA 4PXCA 2HHAA 4ZT6A 1KFJB 2BEVB 2OFPA 1U5AA 4Y3UA 1XU9A 1YIDA 2XW6A 4FDAA 3CCVS 1KQSR 2OORA 3FBTA 4TOIA 4C7VA 4CL8A 2R8XA 3TECE 1X7HA 1SQEA 4NTZA 2PLWA 2Y68A 2VVTA 5K8OA 4OB7A 2XF2A 1BWSA 2XNDD 2A5FA 3PHJA 3PHGA 1XWWA 3EGNA 4Y6LA 4F5YA 1OPXA 2Z6VA 1S2DA 1I1NA 3IGFA 4E3ZA 1B70B 1E3EA 4AO6A 3CLKA 1N2SA 5E5NA 1J00A 3G6XA 3BAFA 5KFSA 1FUGA 1I5OA 1OZAA 1KFCB 4JNCA 1YFKA 3QQCD 2VB6A 5GJWC 2KO1A 1Q7RA 1QB7A 4OHPA 3SBDA 1E1QA 2QXUA 2MSKA 4G1FA 2H5IB 1CJUA 4FBUA 4D0GA 1USIA 4PPQA 1QHEA 5F9NA 1JHYA 5KJCA 4F0MA 3LBYA 1J1IA 1KOHA 3SR0A 3NBXX 5C34B 4D9GA 5EXTA 3PCRB 4X1YA 4FSHA 4E15A 4FZRA 1IZ9A 2CXEA 1Q2UA 3D8RA 1Z29A 4UUPA 4WZAE 2MSCB 2AKWB 3QT5A 1F2TB 1H65A 2FX3A 3DLAA 4F6RB 1JTFA 3AOBA 1Z3CA 3RHTA 4G0VA 4P9SA 1VP9A 1E3WB 1QTNB 5CH7B 1FJGB 2HDNB 1SEPA 3ZQKA 1EFCA 2RJNA 1DQPA 2XGOA 4ONEA 4HS9A 4QPDA 5ADVA 3VAKA 2E37A 121PA 3W8NA 1FS5A 4IGFA 4IIJA 2VH5R 3KYIB 3UKJA 2OIHA 3ZY4A 4LWOA 4GHWA 1E8DA 4J0GA 5AW7A 2WD9A 4ZT3A 5I7VA 4ZTBA 1YJWS 1RLOA 4QCLA 1SIOA 2H4HA 5IDYA 3M30A 2QD2A 2APJA 2R2GA 1JYSA 4YR2A 4PLPA 2V45A 2HA2A 2B34A 2Z0GA 4Y6RA 5HMYA 4C8MA 3J81j 1X2BA 3RQIA 4DREA 3ITHA 5AI5A 2HAIA 4XYMA 3AOGA 2ICAA 3FSGD 4HHJA 2IIQA 1FQWA 3FCOA 3S8SA 1POXA 3DOFA 2GXUA 3W62A 5J47A 3WG9A 2QTGA 2H54A 1UC4B 2HRDA 1BXGB 3CX7A 1E6LA 4S0MA 4CI0B 3TIVA 1A7AA 1QG0A 2DZDA 1U8WA 3EA4A 1ESNA 3HI9A 4NOZA 4YFYA 3ANTA 2Z95A 2MSWA 1NY6A 5HTOA 2IC3A 3ORHA 4BZQA 3GAZA 1E4OA 4UNNA 1P5HA 3S6JA 1CDEA 1KTIA 2QJTA 3ETLA 3P19A 4Z0PA 2BMEA 4I5FA 4ZJYA 4JI7C 2F8LA 4RGVA 4M5NA 1K2WA 5DBIA 4E8UA 4UT4A 4ZVOB 3PR5B 2C9ZA 3EW7A 1AMUA 3W9SA 4PX5A 3MUEA 1O97D 5F8IA 2QN6A 2YXPX 2BQRA 3MYRA 4TZ6A 4YQYA 2BKAA 5CQGA 2PMDA 3VR2D 3QVSA 4ITRC 2CXUA 2PT7A 3F74A 2MGZB 4AF6A 2OPPB 4CM8A 1EBFA 2Z2YB 1Z0DA 3X2SA 2Q4DA 3T1HJ 4DEYA 4QEZA 2R8RA 4HAOA 2W4PA 2JDJA 4J1NA 3UTCA 2Y4OA 3UK7A 1E9SA 4A92A 1SHUX 2G3YA 4JCOA 1U24A 1W44A 3QKRA 1RTJB 1I2AA 4UBNA 1G21E 4A6DA 1RCUA 5BYKA 1RWPA 2UUTA 3BBFA 2EJCA 5U47A 4XPCA 4JODA 3UC9A 3QZ8A 2HRZA 4NLWA 1WB5A 4NLQA 3OTGA 2P6TA 1JW9B 3LP2A 4HEA6 5A3JA 3TQCA 4UBKA 5EJFA 4JI0B 5EEHA 1RJDA 5RUBA 2PV0A 1GEHA 5ESRA 1C5KA 2C9YA 1R6DA 2H48B 2R7WA 1VSUA 2I2CA 4RD2A 1DPGA 1V9SA 3RQSA 1OIXA 4INAA 4AZTA 4LDQA 4KX5A 4JBHA 1I6KA 3PXAA 4X66F 3NHUA 2O2XA 2HGMA 1JR6A 3K0SA 4C22A 2H65A 1T9WA 2WKPA 3S5JA 4JI2C 2BOAA 2BH1X 4JI5J 1S9EB 4A10A 1UJBA 2VU5A 3K0EA 2CXSA 4KLRA 4JI4C 4W7IA 1RRKA 1FKAF 4H7DA 1CEXA 3EXIA 2RU3A 1IHOA 1PG2A 2RJOA 5JEDA 2PHZA 3CSUA 5YASA 4Z4CA 3FJ1A 5F8HA 4D7AA 1Y6QA 5AM2A 3NAQA 1EG2A 1XZMA 2YVLA 1YRUA 1XPOA 4NNOA 1TA4A 5IHXA 3B5IA 1ZD4A 5F64A 4WADA 4EGSA 3VNVA 1Y3CE 2F62A 3SEZA 3BORA 2FYTA 4J0EA 3ZLVA 1QGDA 3SHWA 4M87A 5L1IA 4ON9A 2BR4A 1N5YB 3B48A 1A7UA 4WE3A 1ZD9A 3GG2A 1KK2A 3M9OB 4FYXA 3UV3A 3NOVA 3EDRB 4PHCA 1XPUA 2XB4A 2Y8YA 3QVKA 1ZPDA 3KO8A 1NMYA 4NLOA 3UJCA 1RM5A 1ULUA 3JD4A 1YR6A 4MQLA 1P0IA 3NETA 5L3QB 4ZVSB 3VSDA 4PSCA 4ZVSA 3ADCA 5DS7A 2NCLA 3MM9B 4MK8A 4O4LB 2B8PA 5IAGA 3C3WA 2C8LA 4UBOA 2IZ7A 4YP9A 3CJ2A 2H3HA 4G5FA 3SBEA 1V60A 2FY8A 3TJ8A 4AUKA 5E8RA 1EUCB 1S76D 1WZNA 3AR9A 3D2LA 3DULA 3RIXA 2IC3B 4QYRA 4Q6WA 2X1GA 1CPZA 4CMEC 1YZNA 4N49A 4DPKA 4HAXA 3E27A 3S8EA 3UZUA 4I1TA 1UIMA 2XTNA 3RF7A 2OWDA 1EQ2A 3JAKA 2Z57A 2ZDQA 1V1MB 2RD5C 4HDKA 3UK6A 1L4GA 1C9KA 4ZCLA 2JRLA 3IUJA 3K9QO 4E5SA 2V4UA 1ZZEA 2W7AA 4ARIA 4YFVA 5D86A 4YOEA 1VECA 3KKFA 3GUZA 1VMDA 3ZWXA 4O0MA 4J1SA 4F9TA 1SCBA 2O20A 4DN0A 3CWJA 4FF3A 3OC6A 4BNTA 3HHLB 2RCNA 2QTTA 2F3JA 5IJWA 5EQFA 3AW8A 2R4FA 1FP4B 3CUWA 1EP2B 3K1AB 2OGUA 1A96A 2M32A 1J70A 1DCFA 4B4WA 3SC2B 4B3OB 3HDVA 1PZXA 4PBSA 1U3VA 1J5OB 1PVOA 4U5XA 2YW2A 1FW8A 2ZANA 2IDMA 3T8YA 4DL9A 3TH5A 3QQPA 3EPKA 3KE8A 5LZ5A 1AHNA 4KX3A 4BNFA 2YWRA 1ZVJA 3DBRA 1RMQA 5AHOA 5CA1B 5HQJA 1NRWA 3CZRA 3OPNA 1W96A 5B3LA 3CVWA 1Y7TA 2AOUB 3LDUA 1WX1A 4CV0A 5GJCA 4NXMC 2VG5B 3NLLA 4YXWA 4NZOA 3FNRA 3GGSA 1SCUB 1EGQA 4WVLA 1PDOA 4WTOA 3T7EA 3VZIA 1HDYA 2YJ5A 4TWAA 2PUCA 1SKAA 3G4SS 1Z7EA 2JC0A 2X2OA 3K57A 4K2HA 3UAVA 4LJAA 2OD7A 2WUFA 1W85A 4UU1A 3CVOA 1LPAB 1UK7A 1WD5A 3UK1A 3Q3IA 2XZPA 1M6WA 1NV9A 1U0EA 5CM9C 2F17A 1ZN9A 1TJ3A 1KOOA 2HEIA 3Q7IA 5BXYA 2V7QD 1DBRA 2JFXA 2E0GA 5BYJA 2R68A 2XWSA 2X4DA 1P2VA 1IUJA 3NH6A 3NBPB 5BQOA 1UMCB 1GGJA 1TYDE 2WM9B 1ZUD1 2W70A 4G85A 2NCKL 4W9NA 2X6TA 1AZTA 4RS3A 3IM9A 1XG5A 2RUGA 5CB4B 3PHIA 3X2EA 4F5WA 3ZVLA 1RAJA 1PKUA 2HQCA 5K45A 4OOEA 2ASVA 1OY6A 1ZAKA 3AM5A 3Q3VA 4MUBA 3ESXA 2QTLA 3BTVA 1JLKA 2RG1A 2XTJA 3AUUA 4MPTA 2L69A 4BGEA 4UREA 4DZZA 2EAUA 5I4BA 2ZVSA 1WHXA 3R6WA 4MAAA 2OBFA 1GPAA 4AUNA 3PW0A 1JILA 2IELA 4H0CA 2F3QA 3HR7A 2LXIA 5K05A 5KYNA 3HJBA 4ZOBA 1SQGA 4F0KA 2REQA 4WIAA 3NGMA 3OMWA 3LWBA 3JQ9C 3FRJA 4JV5J 1DADA 1OT3A 1I8TA 2C3UA 2OLEA 2PX6A 4CGZA 5A8KB 3DAGA 2CEAA 5CYQA 2F90A 1SCAA 3QLHA 4PCVA 1XJ0A 2YV1A 1RWUA 5FOTA 1PK9A 1P9OA 3RC1A 3ICPA 2QMWA 3KDAA 1HQEB 2VF3A 2P6MA 1KBQA 1SUEA 4PLFA 3JS5A 1MJGA 1SXHA 4OBBA 4F93B 2ZYTX 3K15A 3DRYA 3UX2A 1LX7A 4V3BA 3TDMA 3VWSA 2Z43A 1N5OX 4YNBA 5JWHA 4EGQA 2YOFA 2CZCA 1Z07A 3OX2A 1XMPA 5IVKA 3K17A 1W36C 3K0KA 1O6BA 1SZPA 1J6UA 5BN3B 3PE6A 2MM9A 1RQXA 1Y4ZB 3SX0A 2W22A 2XDQB 2ZRFA 4TQ9A 4HOYA 3MPUA 2E18A 2QTRA 3CCTA 3FKQA 2BTQA 5CT5A 3T0GA 2CPJA 2V65A 4LX8A 2QRUA 2LW7A 4ZD6A 3T5CA 1CIPA 3J81Y 3IOYA 4UOGA 3U60B 2Q41A 2OCBA 1GZVA 2FN9A 1IN0A 5KC8A 3EGVA 4AKTA 5GM1A 2BP7A 4U8VA 4BL5A 1P1CA 1DAEA 1OZ0A 2QA1A 5HP1A 5CVJA 4DTIA 3VKFA 3PGKA 1PJ2A 2DKOA 2YJZA 2D06A 3FNQA 3GIRA 2KPOA 4QGBA 4Q7EA 4F92B 3F9IA 1IQUA 2HH9A 3S7RA 3TI9A 1X7XB 1OX6A 3KK1B 2ODWA 3AVXA 3NRJA 2VDNB 3I4LA 5FFMA 3B7PA 4F3MA 4G81A 4RLEA 1HNIB 4ZHQF 5C18A 4UE2A 1U0HA 2H1VA 2HQDA 2O7VA 4G4GA 3MHTA 3LGXA 4BLGA 1PKEA 1OY8A 3HR8A 3L8CA 4DMZA 3OE5A 2V0NA 4DR2F 1W6RA 4JFAA 3LHDA 2EJVA 4DUYF 4ZOQI 4B6GA 3D2WA 1SIBE 2BEUB 3COSA 1UAWA 5GVQA 1MCZA 4J9KA 2BKOA 2VTBB 2G17A 621PA 1DO8A 5C24A 4UFNA 3O95A 2G8LA 3IOBA 1GM5A 1P17A 4OI4A 3HJCA 4JI3B 2QN1A 3ZHZA 3B3AA 3HKBA 4F1JA 3ASVA 4JM1A 4UNPA 4RKYA 1XIQA 3BQ0A 3ZBPA 1TK8A 1UVKA 1CCWA 4PSKA 3RTVA 2KW5A 5HXAA 3W1YC 4WFXA 10MHA 5BURA 1JT2A 3N76A 3FPCA 5AT1B 4LF9B 4H18A 1QHHB 3U7IA 1QP4A 3OHBA 2EARA 2DR7A 1CUFA 2RKIA 3AA9A 3TDEA 1QHYA 4X6UA 4YYEA 1EKXA 3QELB 1N52B 2QL9B 2YIMA 1PAUA 1N0IA 4MR7A 5CZVA 3MCAA 1FMJA 4MEJA 4QPCA 3AF2A 1C7FA 3I0SB 3FPAA 3D5QA 2MYFA 1E2LA 3E05A 2NSLA 1GMWD 5HVNA 2AG0A 5FUQA 4GWLA 4ACAA 3HS3A 2UXDF 4B7CA 4DR5C 1CV2A 2Q1YA 3O8OB 1U0SA 3SHFA 1EX1A 3W6PA 3ZNOA 4EATA 3AT1A 2CPZA 3VH4A 4MRRA 1XRLA 3F46A 2NP7A 4MGIR 3SQWA 2EI5A 3N2QA 1N32B 4BO0A 2I3GA 1EFVB 3R6LB 2PX3A 3OX1A 4MJ3A 4Q9AA 5FUVA 2JJQA 1PGNA 2BW2A 4BLTA 1JXEA 3AF0A 3DM5A 5KCZA 5FL3A 3GCDA 3PPXA 5C42A 1ODLA 3V8PA 4QEDA 2GCPA 3KZMA 1G9SA 2W98A 1VIXA 4Q4CA 2QV6A 4ZJLA 3N6VA 3HFJA 2WVFA 1LF0A 1YQUA 4DA6A 2B0JA 1S48A 3A9UA 5FWXA 3DU6A 3EXIB 2C98A 4J9SA 1NZ8A 4DN9A 3CZAA 1G8FA 1A9SA 3VR3D 3BE5A 4GKKJ 3CPHA 3VU0A 3IP6A 3MCUA 3ZWBA 3H75A 2FW8A 1DXQA 1KC1A 2BMVA 4RPIA 2QA4G 3EMKA 3KSAC 3HCPA 2A1BA 3OQ1A 1GTRA 3DNFA 3LW8A 3Q1LA 3O9MA 2NU9A 3AHPA 4J4BA 1OASA 3HVWA 2AH5A 4TTSA 4ALIA 1GGHA 3QVTA 1N34F 4IFTA 4I2NA 4AD6A 3H9UA 1B43A 1THZA 3VJLA 1QZTA 5KG0A 5C5EA 3CX3A 3RS2A 1NPYA 4RTMA 4LRTB 4K4SA 1CC8A 1GGMA 2ETXA 2R65A 4KQCA 2NREA 1DG3A 4HAZA 4AZSA 2AZ4A 1H2RS 3AHEA 1QH1B 3V1NA 1H0KA 3H98A 2IDZA 4Q5VA 1VMBA 1GT91 2QSUA 2VQFB 3IT2A 2IF2A 1DFDA 1WKKA 1PBTA 1QOPB 2IPNA 3CHYA 4YMSA 3K9GA 1ZIXA 5DBHX 2C07A 2YUIA 1F9AA 4KN5A 1RSZA 5MN6A 2ACYA 2QA2A 2ZYWX 3I92A 2QQFA 4CLHA 4RK0A 1TFYA 3RFVA 4RPFA 4CLDA 3MZIA 4ND8B 2X5NA 4L2IA 1RJ9B 4RZIA 4AJPA 2M9KA 2NGRA 2PX5A 1TELA 1RJ9A 3W34A 1U4NA 3NM5A 1X8JA 4LFBB 2AFHB 2Y05A 1RKJA 2W43A 4MI3A 2XQGA 2EWMA 3AG5A 1XTJA 2VAVA 5TARA 3CTRA 4YMHA 4FYYB 1SQ0A 3LX5A 1P0MA 4ZI7B 1URPA 4ID5B 2A6PA 3GPDG 4HEJA 4C4TA 5AXNA 3OM9A 3WB0A 4GP9A 1S9GA 4FHFA 2AZ1A 3DI6B 1W4ZA 1CR1A 4DCUA 2IZ5A 3FSYA 5E3CA 1NB2A 4M5IA 3N2EA 1BHQ1 1PNOA 4E3WA 3BIFA 2BKUA 2GJ8A 4EUEA 2J46A 5SY9A 1OAOC 3R5DA 1GGNA 3CD5A 1MB9A 1LBSA 3N3AC 5C4GB 3V34A 3K94A 2FWNA 5KU7A 4YQFA 3EZ2A 1UDXA 4N4AA 3WYAA 1AT1A 4BOYA 4C4YA 4WASA 3WRXC 5AKJA 1VLAA 1R9MA 3CNNA 2NU7B 2XJ4A 1KR5A 1XA3A 3HHNB 2B5JA 1QGYA 4M6WB 1F3VA 4I5EA 4Q7LA 1Y00A 4KGZB 3CEPB 3IBGA 1PC5A 4OX9J 3WZ0A 1GL9B 3S6EA 1KOFA 2W2MA 3WV4A 4BHTA 3F9CA 4YI5A 5FBWB 3H84A 4AI6A 3PYLA 3CNQS 3VR5H 2Y1GA 4KFTA 3HL0A 3MIIA 2PO7A 3AU9A 2X0FA 1NBEA 2FHPA 2V9PA 3FHJA 2HGSA 2PJZA 5CEJA 4BWMA 2BSQA 1UK9A 4NDNE 1TW3A 4IFIA 5DTIA 4M9RA 4O0NA 2IYPA 5DWVA 4IDKB 4M36A 4O08A 2X0JA 3QFWA 2P91A 5GAHI 1Z4KA 3QHAA 4UTVA 4D81A 2WVAA 4GYWA 3VYVA 2QLLA 3CUSA 3DLJA 4AJ4A 4R5MA 3ML1A 4GC5A 3IT0A 4HPXB 3SM9A 5JAOA 1N8TA 4K50A 2CBZA 1ODFA 4CTNA 2J31A 5CEEA 3BCHA 1RT3A 4EITA 2G2OA 3OJFA 3OF5A 3V4LA 1WC6A 3U3ZA 3EEOA 4I2VA 2CFTA 3G2QA 3MAGA 5ICEA 5EKUA 2ZYRA 4BMCA 1HNXF 3FVYA 3HULA 1SL2A 2XWXA 2FE4A 4H6VA 4FBLA 1H3FA 2GW8A 1NE2A 3V8EA 3H18A 3D8TA 3OC0A 4HLUC 4FXVA 1YK9A 3GLTA 1K8ZB 5CDUA 4Q3EA 2FPHX 2HSZA 3KNZA 4S0ZA 4O4HB 4ZV9A 3QVUA 4C7OB 3KFLA 4DQUA 1RADB 3BHJA 2OKCA 3GH3A 2W9CB 2WT9A 3D28A 4B5LA 2PUBA 4MKBA 2KXFA 3E9DA 2VF2A 1JHUA 2WMDA 3NDIA 1VQNS 2D1RA 2C20A 3H0CA 4KE9A 4LSZB 2HNAA 1JQ5A 2ZT8A 4C87A 1SBQA 1BMQB 3FSEA 1Y9JA 1RWKB 3ONNA 1JLFA 4WN9A 1BHJA 4ZPWR 2GXAA 2P62A 2HHXA 4HO1X 2C5FA 4QUBA 4KI7A 3V3TA 3I6YA 2GDJA 3WGJA 3RAPR 3J7AN 5E9WA 2O8FB 4LCEA 3ET4A 5JZBA 2GEKA 3EW9A 3DAPA 4I1VA 2HURA 4OYHA 3ITKA 2GXSA 4NLXA 4P84A 2BJ7A 3CW8X 4OBEA 2HMIA 5ALJA 1NJZA 2C4UA 5KG4A 4CV2A 1X9SA 4WIQA 4RAOA 3AHDA 4BJHB 1ABEA 3HLKA 4LY0A 1Q19A 3CUNA 2PYIA 4ZT2A 5AESA 3L1UA 4G0QA 1MJNA 2AJQA 1F20A 4PQUB 5TQVA 2BEWB 2BP7B 4JI5C 1WDWB 2WI8A 3DLKB 2MQLA 2ZJRQ 4PZDA 2C2OB 3VZCA 4HX5A 3ADBA 2JARA 4DLAA 1QZXA 1ISJA 5HF6A 3F97A 4WDQA 1DWQA 3R24A 2XAUA 1LKZA 3JRWA 4PLYA 3IUEA 1T1SA 5BO5A 1DUIA 1RT4B 1ONNA 2COUA 2CSUA 4MKZA 2A3JA 1M2VB 3E5NA 3HJRA 3UEOA 4QNMA 4BDPA 2F4VB 4ZYWA 3OEWA 4L5JA 1ZVVA 4NJMB 3IR7A 3ABRB 2ALJA 4F6RA 3DKKA 4USVA 1V6CA 3JVVA 2PUEA 4ALZA 1UR5A 3EXYA 5DNEA 2QJRA 3RYCA 1PSWA 2E5IA 2Q5CA 4TVAB 1N5MA 1KFSA 3V32A 3N6NA 1SKYE 1RHKA 4N0QA 5I3QA 3M8SA 1O4VA 4JBLA 4M8NE 2O6HA 3WIUA 2VPYB 2J67A 3G8YA 4IV0A 3NNHA 3CUVA 4XWAA 4Z7OB 4LBVA 5IWAF 5GV8A 2XZDA 4URWR 4UEWA 1E60A 1GAWA 3M6VA 2ENUA 1VRCA 1W4CA 4PZUA 4DHEA 4CZ2A 4PIMA 1J5EB 4G65A 1CZKA 2Q1TA 2RDJA 2FW9A 5DP1A 3MA0A 3TTSA 3EUNA 2KDNA 2QTAA 1EFUA 4RV5A 3RHZA 4WXOA 4ZJUA 3R4VA 1OZFA 5TLSA 1L5SA 4DM4A 1ZSYA 1Q7BA 4MICA 1XHEA 2R6ZA 3OTHA 2ZQ5A 2ZB3A 4KR6A 5L9XA 2CQGA 4DHVA 2P11A 1FBNA 1L5VA 4PVCA 3NFYA 4KQWA 4HH1A 4ND7A 2FB9A 5SY6A 1I5RA 4CG3A 1CB0A 4CLZA 3T7CA 2E29A 3PV0A 2I2XB 5JYCA 3E9CA 4GW3A 4HZIA 1M5SA 3IXQA 3VOTA 3IAEA 4MQEB 2IITA 2A5GA 2JRSA 1NWCA 1T0IA 3SO4A 5KC9A 3GAMA 3WGIA 2OD6A 3E9ZA 2QW8A 5JATA 1TJ5A 4IRDA 2D3O1 2CYAA 1Y3IA 2VHCA 4HWPA 5JQGA 1YF3A 5IF3A 1GZ7A 2EG5A 4AL7A 3D1OA 2JIQA 5IMBA 1MO4A 1WC3A 3GJSA 2FN8A 1L3VA 1FRXA 2ET6A 5F3ZA 3LBAA 1J2EA 3KNGA 3H5XA 2QTWA 2PG3A 2J3QA 2PA0A 1T4DA 1VQLS 4ZVQA 2O1PA 2XYPB 3MEDB 2V55B 4YCMA 1FFWA 3EMTA 3KLMX 5E9QA 4GM1A 2OBVA 2EKBA 4DN6A 4L27A 1OLSA 3O1JC 4XDCA 3ZK9A 3VJRA 5ICGA 4CUZA 1KNZA 2I91A 2WILA 4RKRA 3DSRA 4ZHQA 3TNLA 4W63A 1CQMA 2J9DE 5AXLA 1B8PA 3FCEA 2CNWD 2OCGA 4CI9A 2PT9A 1SH0A 2KX7A 1DELA 5IDQA 3QLUC 4CQ1A 5KOJA 1O54A 3L7KA 4WZBB 1NZJA 2XB6A 1SQ6A 2QD1A 3CNLA 1I80A 1HNZJ 2JIZD 1HE1C 4NYIR 2AGOA 5AFSA 1RYFA 5JXHA 2R1VB 1K06A 3LCMA 1IWPB 4KIUA 4WKYA 4P22A 4EKYA 2OXEA 1HQUA 4OX9B 1ESCA 1VIYA 2BR3A 2ZHOA 1C3OA 3HP7A 3MW8A 1SVIA 4PIVA 5K3FA 5FOUA 2E4AA 3COZA 5B6IA 2AR9A 1TECE 1E6WA 2WB1D 1SJRA 1NAIA 1NOKA 1KI9A 1PW5A 2HKEA 4L6IA 5AK4A 3ILLA 1GFSA 4X84A 5CYMA 4B7AA 3R7DA 3W5VA 1C9DB 1ODIA 2JJMA 1NQOA 4N1AA 1IULA 3PD0A 4XYBA 2M4MA 4CMEA 4RIFA 2MCFA 1HMVB 4H17A 4BN5A 2WG2A 2ZDOA 5FBKA 3ANNA 3CJRA 1Z36A 4HCJA 1T2VA 1NVVQ 1T8YA 1GTZA 2PWBA 3LLMA 3E5MA 2Q9UA 1BMDA 1N32C 2M5HA 3KELA 2CNWA 1T25A 3PJXA 4NLDA 1FX1A 5JCOA 3NUGA 1QVRA 1SHJA 3EXAA 4XASA 3SCIE 2WF7A 1ZPVA 3G2OA 4QL3A 4JH0A 1DFHA 2QE7D 3A4VA 1W1UA 2KZZA 2YC4C 4P34A 1SJFA 2ASJA 5H80A 5FR1A 1MLAA 3SLKA 5E7QA 2C7GA 2MKYA 5B57C 3T61A 4D0NA 3HJAA 1MWQA 4IDHA 4QYWA 3AVQA 3SY8A 3V81A 1MTOA 3I5YA 1KQPA 3JQGA 1K47A 4IRUB 3PS9A 2HY7A 2XTMA 3GEDA 5F1YA 2C59A 3DDSA 1EDDA 2B20A 4XW2A 3GZ7A 3PNOA 5JY6A 4LSWA 4KOEC 4OHBA 5A2QD 2FPLA 3L4BC 4RIIA 3J7A1 4J7AA 1E8NA 2PZLA 3KLGB 4Z37A 1KWKA 1E1QD 1TA0A 5G4KA 1EP3B 2GARA 3N2IA 2KJVA 4CKWA 1VSBA 2HX1A 1EA7A 1T2EA 1HOTA 4O0IA 1VFPA 3R9IA 4TKMA 4FYVA 5ALFA 1PT5A 3C41J 1NPRA 2DBZA 3MTQA 4J07A 2L9DA 1SUWA 3ZOKA 5D4NA 1O96B 3BWCA 3SU8A 5HF9A 2C95A 2VCEA 5H59A 2C9OA 2XB9A 5T3YA 3SS9X 4LV6A 1RTIB 1UK8A 4LF9J 2XYVA 4LVCA 4FBMA 2FUG6 2L48A 1KJ9A 4UEKA 1NGSA 2ZIZA 4DM3A 1KVJA 5CT4A 3VR4A 2HHPA 1DC7A 4D4IA 1RADA 4KITB 4Q1DA 4NV0A 5AOVA 1ODJA 1Q17A 4OEHA 1T8TA 4M5MA 2BISA 3IPLA 3OURA 5D84A 3L46A 5EGYA 1PQUA 1BWRA 3ORQA 2P1ZA 3NVDA 3L1IA 2L19A 1X7ZB 3E7PA 3CRW1 1XMXA 3CT9A 4GIBA 4OXYA 3D6JA 3ROPA 2VJBA 4FYHA 2CE2X 2B61A 2FF5A 4EL0A 3MI7X 2F4FA 1KQFA 4BX3A 2BDEA 1LUAA 2HB6A 4U39A 1WZCA 5I3UB 3CJ0A 1C30B 4QEKA 5I3PA 2ID7A 5AK3A 1UXIA 4P54A 4Z54A 2ZH6A 3MG9A 3PR2B 1IBLC 3RU3A 2BMDA 1OYYA 2I8LA 3DEKA 2H9YA 1N7IA 1QVZA 3HGQA 1GLNA 5AOAA 5LU8A 2HU2A 3NORA 5F0WA 2AK2A 3KSZO 4O1MA 1BWEA 4E46A 4Q39A 2N1MA 1YHZA 1NN1A 1WI6A 3ZK8A 2GS9A 4I99A 3BB5A 3WBFA 3RRHA 2A1UA 2A8YA 3QYFA 3GG0A 2ETVA 2WYWA 5CNIA 3TVKA 4C03A 5TEWA 2AD9A 1Z83A 3QNMA 5FH9A 3NKFA 4OYRA 2WF9A 1U28A 2F1JA 2C2OA 1JMYA 3EVDA 2RAVA 1U8AA 1KOJA 5K7SA 4ROTA 4IL5A 4MK9A 5L7WA 4HFMA 1XMOF 1HEYA 2ZJAA 1E7SA 3UUGA 1PC4A 3ANYB 4DLBA 2XXAB 3B6BA 3LK6A 1WUYA 3M9XA 1P1KA 4GKJJ 4LNAA 4C88A 2EFVA 3SBMA 4IW3B 2OC4A 5GMOA 1MNAA 1P6QA 2Q6KA 3UWOA 1S01A 4FGJA 3PGJA 1TEVA 3DE4X 1JSLA 2W2PA 4WK0B 3U3DA 3SQDA 4JB0A 3R6TA 4M7RA 3KPYA 4G89A 1YCGA 2FH5B 1DQ9A 1JJHA 1NO8A 3MEEB 4BQEA 4CKBA 4NYJQ 4MIWA 2OE2A 4D0SA 3HLYA 3RYCB 3OZVA 1SVUA 3TLAA 1T5BA 2EBGA 4ENSA 5HRUA 5KT4A 5ER9A 5KYWB 1NSFA 5ENVA 3FTFA 4AZVA 2QYCA 5LBIA 1HNVA 3IB6A 3ND8A 4H4KA 1D8AA 2R7VA 3AZOA 3R9WA 4N77A 5LMUF 5HBMA 4BLOA 3M9MB 1ZO8A 2QRRA 3AR8A 1TV6B 3MGJA 1CERA 1YKGA 3DBOB 4AY2A 2BJOA 4INPA 5G53C 1XRPA 4YLGA 4CL0A 2YV4A 4RR5A 2G08A 4V0NA 1DIRA 4DRXB 1TO2E 2BEKA 2WK1A 1CP3A 3WGLA 3SZ2A 4PQRA 3KZKA 4XVUA 4N3AA 5CTJA 4EHAA 1X87A 3RGWS 2ZJOA 4YI3A 4MWSA 1R0SA 3CO5A 2AOWA 1YS1X 2P9GA 2GVDA 3PUWA 2HHQA 1VLVA 1TAHA 5D6NA 2RCYA 2IYQA 2O6LA 2YWCA 1REVB 1K7CA 4PC7A 4TPKA 2DGSA 2PZEA 3K0CA 4WFJA 4F5DA 1WPXA 2XC9A 2IBTA 1LDBA 4LSLB 1A27A 1U31A 1S49A 2EKLA 4YAIA 3BYPA 1X7DA 2YY7A 3KU1A 3ZDFA 2BWJA 3FZBA 3PNMA 2PFDA 1YJRA 3G23A 1GARA 2AR7A 4CLFA 3HYRA 1CZLA 1A2OA 3BYZA 1FEZA 5DTEA 3UN1A 2ODBA 1OW3B 3HVJA 4DV3J 4DLKA 3NU1A 4Z4HA 3SEOA 3OFNA 2XUJA 4KO0A 4DV4J 1N5IA 1KK3A 3WQRA 3DZFA 2NLOA 4N7MA 4E6EA 3Q8VA 3FZEA 1L3IA 1P6XA 1JJ7A 2ZSFA 5A8WA 1XEWX 2X6QA 4NLPA 4IS3A 3UNXA 5C42B 4KFRA 4QHYA 3R9XB 3JB9k 4NLSA 1S5PA 3DP7A 2IIBA 2R7SA 3MMPA 1S9HA 5KOIA 3LH5A 2O3JA 5ADHA 2XY5A 1YDLA 3TD2A 3Q3EA 1U7OA 2DGXA 5JNRA 3PQEA 1UEVA 1D6MA 1XNGA 3O93A 4R8SA 3NTVA 2ZJ8A 1M2OA 2R2SA 3DXSX 3SP1A 4JIGA 1P1RA 3E35A 4K6KA 4DYHA 4YHHC 3E4DA 3NI2A 3RVNA 2W7PA 4FD2A 1FDTA 2H8KA 3L79A 3IC5A 1RDFA 1NK0A 2JLCA 4IOMA 5HN0A 5MAOA 2VSXA 3MINA 5TMEA 1PRYA 1ZGHA 2VLIA 3JYQA 3ZBQA 2V2ZA 2KZMA 1WG8A 1G2IA 2JCYA 5DCWA 1RTIA 3QOWA 1M8KA 5DYNA 1U02A 4IIXA 1I0ZA 3TKYA 4Z7NB 3RYIB 1EGAA 4DDFA 5LQUA 3DV2A 3RIMA 4A0FA 2W58A 1TL7A 5M2UA 4B6FA 1CHDA 1E6KA 4OBXA 1GPYA 1SBIA 2FGKA 2UXDC 2VFRA 2DFPA 2HSEA 4ENWA 1GDTA 1C3XA 1BGVA 3JALB 3NDJA 3HJTA 3U7FB 4M83A 4EVIA 3CINA 2HG4A 4ZVQB 3IURA 2H51B 2RB7A 2AG8A 2JLXA 1HQDA 3ZZTA 4RLFA 4JXKA 4CLOB 4KC0A 4IXDA 3NWGA 1DVRA 2Z1MA 4UUOA 2M8DB 1CY8A 1PT8A 2ODTX 1XTPA 2JLWA 2FPWA 4F2HA 2C2MB 4M0CA 2ONJA 1SWVA 4FW9A 1JQEA 2JL9A 1MC8A 2BGJA 3EVOA 4I6YA 1EM8B 2YDYA 3DFIA 1AF7A 3W90A 2NADA 3A3NA 3ZXSA 3BF8A 1KKLA 1BCSA 3T7KA 4X7PA 5IHPA 1QM5A 3TCNA 1C1DA 1YI8A 3CVYA 1K9MT 4CM6A 2UAGA 1JHVA 1V11B 5DI3B 1GVNB 2W11A 4YMUA 1M2GA 2NZJA 3QE3A 3A0UA 2C54A 1H2BA 2AK3A 1XUOA 3FOFC 3DHYA 4HR7A 5FPHA 4QDJA 3RDPA 2PS9A 1D0IA 4LZLA 2C4KA 4RE6A 2BFBB 4KKOA 1OO0B 2RIRA 4CEIB 1HL3A 2QX0A 5H7XA 2QW1A 3UAOA 1GZ4A 3OT1A 3HHKA 5LYYA 2FUG1 1LRKA 1ACMA 3CH6A 1EXDA 5CYPA 1SBHA 4TXLA 3TNFA 1RIIA 4F8RA 3P2EA 1F06A 2AMVA 3WNQA 5T41A 4H4DA 4I1PA 4X7MA 3PSHA 4Q47A 2PZ8A 4BQIA 2DLCX 4NL4H 1E89A 3ODGA 2N3LA 4A03A 3KJVB 3ZWPA 1UP6A 3WMFA 5BN4A 4OHYA 3B1XA 3JYOA 4MB2A 2HC9A 3D6MA 3BXZA 2PT6A 5KO2A 3CS3A 2JW5A 2D5IA 2RSQA 4G6VB 5ED0A 2XMCA 1O8BA 1MGOA 1X42A 3QZ7A 2ZYIA 4IHQA 4XCQA 1X4HA 3LP6A 3ZV7A 1ZH5A 3IODA 3TSWA 3OSZA 2FSHA 1ZMXA 5C2CA 3FRHA 4P3KA 3VH1A 3CF2A 2YNIA 1TEHA 4JI2J 1T5SA 3VUFA 1CZRA 3CCFA 1PG4A 4IDNA 2GNKA 2GJSA 1G8MA 4GPD1 4ZEMA 1Y5IB 1G4UR 1DBIA 4LWPA 4B3TB 3NC4A 3CCZA 4EEZA 5J2NB 2QYTA 2V1UA 2PYZA 1PYTA 4DMUB 3E3LA 5E9JA 2WV9A 3UV7A 2D59A 3UNGC 1KY2A 3ESAA 1ITZA 2PGLA 1FFGA 5J4VA 3A4TA 2FOXA 2PCJA 2QUZA 1ZXLA 1JFLA 3MEGA 5BUCA 2HHLA 3M1VA 1EUDB 2BRUC 3EGWA 1GITA 3DZCA 4ENTA 5DEIA 4F36A 4MCAA 2EQBA 4ZDWA 4H08A 1OLUA 4FFDA 2HTEA 3ZFVA 4M0UA 4OQ4A 3U16A 3E4CA 1J09A 3AK4A 3R77A 1C30A 1I4OA 4TRMA 4RCYA 1QM4A 4D43A 3DOMA 2V67A 2QMOA 4BVAA 3NDBB 2BI7A 4LDPA 4W8HA 3ESYA 2XMSA 5D2CA 5EHHA 3KZNA 5AWFC 2WTUA 2ZIWB 4G5YA 2F55A 2AKAB 2OAQ1 1U80A 3OTWA 1U2RA 1DZ3A 3KJIA 3L0IB 2QDXA 4AWAA 5KVAA 2F9JA 4UTOA 1M73E 2J85A 1XB2A 4D9JA 2IIVA 1Z47A 2L3MA 2YFQA 3O47A 2CT8A 1RAGB 2XA9A 5JSKA 5C7IO 4AU1A 4LF4F 2PPLA 2OMKA 2GRAA 1ABBA 2IPOA 2Q6BA 2DY0A 4IZIA 2G13A 4FWIB 4GWKA 3PT9A 2BABA 1MQSA 2ZC3A 3S68A 4PZZA 4JYAJ 3IMLA 2GEUA 2PV7A 3EWSA 3PQ3A 1KMHB 5ISMA 2Y77A 4QBUA 1I4DD 3T7DA 3OZAA 5HZHA 2HK3A 2GH1A 3PGVA 2MQMA 1ZXXA 5B7NA 4HVLA 4P0PB 3KWMA 1WXWA 3ONEA 1T24A 4S0XA 4AS3A 3JYTB 2FZCA 4J1TA 3RREA 2QI9F 2NUHA 4BVBA 5TDHA 2A0WA 5DKFA 2Y1OA 4HJRA 1N33F 2A0XA 3FPHA 1YZKA 4ZOLA 1KEPA 3LO3A 2B2NA 2R84A 4DDWA 2BE9A 5KYWA 3HJHA 4B3SF 2ZI7A 5GGXA 1U3GA 1V7PC 5LMNB 3IERA 5FIUA 3OU7A 3CC7S 2I34A 4WEOA 4RWXA 4TLEA 5AMXA 1OHHA 1J97A 1AS0A 1R0ZA 3B8EA 1L5FA 3K5WA 1YASA 5B1SA 1KAHA 4K9NA 4RVCA 3KLNA 3PPYA 1S12A 1HH2P 1PNTA 2CC2A 1A4UA 4N40A 5BSMA 3FYTA 1UMKA 5ECYA 5CBPA 3MNFA 3NEAA 4R4JA 4KBYA 2ZBVA 1VYVA 4Y2MA 1O5IA 5ER6A 3Q6NA 4MW5A 4DG1A 2FN3A 3Q3HA 4UNQA 4TKLA 5JZSA 4X64F 4B6SA 3I45A 1JMKC 1KBZA 1OZGA 5BVGA 3MT7A 4J9UE 2C2ZA 3CMMA 1WRBA 4LHXA 4DV2J 2M6LA 2OZKA 3FTPA 3RADC 3CJKB 1E8MA 4PHHA 1IWAA 4TLLB 5ICMA 1SMKA 4DJ5X 3GJXC 4L8LA 3LG2A 1HFJA 2RHQB 4G4SO 3D8NA 5KTSA 1L5NA 3NW9A 4MDYA 4PSVA 1VQYA 3F6EX 4QBTA 4BZWA 4B31A 3PVSA 1UADA 1BW9B 3GEEA 1MWYA 4LNUB 2MLZA 3ESCA 1VIOA 2EJBA 4BKOA 1FX2A 3D6NB 3RR2A 3BCSA 3TEHB 4B0OA 3EDMA 2XV1A 2Q4BA 3NY0A 4KGDA 4ILEA 4ZC8A 4NMXB 2YVUA 5DYTA 3JAMA 3EEFA 2O2YA 5CDFE 1X38A 3G2PA 3PFOA 2DMRA 2O8BA 4LW8A 1KC3A 4OQYA 3U19A 3OFKA 1KSJA 2IM3A 2P1DA 1GPKA 3DYVA 1DRVA 3A1NA 3D3QA 4R3NA 3DHWC 4XWOA 2V3VA 4FDVA 3DAOA 2IDEA 3WX8A 3MWGA 1GRRA 3O7WA 2F6RA 1Y1RA 1EBUA 1HI8A 1Q79A 5D3ZA 1F60A 1Y8QA 3P5SA 2P2LA 1F60B 5C5JA 2VK8A 1Z5UA 3HD1A 5JRJA 3HP1A 3TTVA 2GO9A 4W98A 4LI3X 3NOXA 3KZ1E 2B4RO 3ZGNA 1WXGA 4I64A 1HNXC 2A84A 4MDFA 3M3PA 2I2YA 2W6QA 3GB0A 3W4IA 2Z9BA 4Y7CA 3V2IA 1M1YA 1X7WA 4HBGA 3ZZ0A 1WXDA 3SC2A 4UM9D 4HLCA 1LLCA 3U9TA 2HHHF 2WAAA 4EOGA 1DTWB 4HZUA 1ACJA 3DTVD 2CG8A 4G0ZA 3THSA 5AVQA 3GDHA 1VQSA 4DV3F 1Z0FA 5JJLA 2AEFA 2WF8A 1MT0A 1RRFA 1TPYA 1U6JA 3GZ4A 4XIFA 1URNA 2E5FA 1NL3A 5J2TB 1PUXA 2VG5A 3AERA 3L3CA 5AVWA 4K8RA 3IEIA 4W1PA 2HEKA 2FG7C 3L0DA 1VC5A 2BGWA 1ZMBA 1ZGZA 4RKQA 4IIFA 5KX5B 4UEOA 3B78A 2H18A 4LXTA 3USZA 2AB0A 1DIGA 4NJEA 4X3PA 6AT1A 2ACVA 2BFDB 4KY3A 1VQ9S 5KYUA 5BY2A 1EZZB 3O4RA 4PZAA 3OPYA 1GD1O 2P4QA 3TUFA 1P2TA 3F6CA 1N1MA 1NF2A 1N36B 2I33A 3THRA 4Y0FA 1QQ7A 1Q0HA 2HJHA 3UMJA 4IFYB 3FPKA 4K9SA 3N7UA 2QL6A 2OFHX 3UIEA 4MLPA 1H6AA 1FOEB 4RTKA 2QIFA 1KS9A 2CQ3A 3QPUA 1NPDA 1QJHA 3WJ7A 4IEIA 1VKNA 3REQA 4QQBA 2C9BA 1PK8A 1XEWY 5JS2A 2W2LD 4QZVA 1Z4JA 2R7QA 1VRUB 1H0HA 4RNFA 1QTMA 3G6VA 3EUEA 2GZ2A 1W59A 3ADKA 1U2FA 2CXQA 1LQ2A 3OIGA 2L18A 4PRZA 4B47A 1JEQA 1EFPA 1LQLA 3WTBA 4PCLA 4WP3A 521PA 1QWIA 4XX0B 3DZ8A 2J9GA 1YQ9A 4XX0A 4CQNA 2EFGA 4KIFA 4IV5A 4M8IA 4AMVA 1S0NA 5DI3A 3FDZA 4OQEA 4RVUA 4UC0A 3JQCA 3BVPA 4NFSA 4GECA 1VYHA 1V7CA 1Z0AA 4NEYA 2D7CA 4C8LA 3DB2A 1N5YA 3KAQA 2WJYA 2JLSA 5A7GA 2XCRB 3WGNA 1GAXA 1RWXB 3MEDA 4U8HA 2XYPA 3MM7B 4FGKA 4XSHA 4MP8A 2GN2A 1L4FA 4I1IA 2YN2A 2BUBA 5LJIA 1YCFA 4U02A 3FTEA 2B8QA 3GH1A 1O95C 2QPOA 1J33A 1M2FA 3KTAB 3WLTA 2BGGA 2H4XA 2VPQA 1LBIA 3HCWA 1X1AA 1Z6YA 3HN7A 3EQ7A 3OJWA 1Y4UA 4UHBA 1KONA 5A1JA 2I6FA 1P4EC 3D3CJ 3C2PA 1BIFA 4LBYA 2XI3A 5SZHB 2P9QA 3MM5B 3PCXA 4WTOB 1FTNA 5AOCA 3UA4A 2I78A 4GC6A 2HRQA 5HQ8A 2VCYA 4IGAA 3CA8A 1OHHD 1N2GA 2JH3A 2CRLA 5JPCA 2LUOA 3TA1A 2NIPA 3TOSA 2V9CA 2P2DA 4ILMA 1X1QA 1EETA 4I14A 3DLCA 1WG1A 4FHEA 2ZJYA 2JIPA 3T15A 4B3SB 1GQYA 4CNYA 1AM4D 2VIHA 4OMCA 3AUFA 5KYTA 5AE2A 3H4IA 3UR0A 2L41A 5HA5A 5J4YA 3B36A 5DLGA 4LS3A 1G20A 2A0FB 3ASZA 1E4EA 4JLKA 2ORYA 4F7WA 4L6AA 4DADA 2D74B 1HDIA 1L1QA 4FZVA 3TZEA 5C4MA 3QVOA 3VHXB 3A9CA 2F9FA 2XEXA 4MSUA 3O2QB 5DM70 4X4TA 4ZQGA 3MEGB 3JSYA 1JS1X 1XRNA 1H9AA 5EMLA 4KDFA 4JI2F 1E6YB 2WJ6A 3QOFA 3VH2A 1TK0A 2XNQA 2WKSA 3SIRA 3FBBA 3ZCVA 2J41A 4YDXA 3DPUA 2HV8A 4XPIA 1RWPB 3QRRA 2J9FB 3DHNA 1FDBA 2X77A 4F2PA 4MPRA 1TD1A 1TL4A 1GAJA 5K4AA 1DKUA 3VNAA 4K87A 1C3OB 1YRXA 2BGKA 2RHTA 3L0YA 3QEBZ 1W94A 3PLRA 4F45A 4G3IA 4X92A 5FL7D 3TRDA 4XWKA 2P0AA 4CT8A 4UD6A 4O2AF 5J4HA 2LPMA 1QFZA 3NDPA 1H8EA 5L51A 5C8ZA 3J81D 2HLHA 3SOZA 1QQ5A 1LBTA 5HMXA 4EB6B 3KQOA 4MARA 3NX4A 4KH0B 3TINA 4IYRA 3UXYA 1H0SA 4KVZA 1NRXA 2ZIAA 4DDHA 1B23P 2H5IA 1O9TA 2HHVA 4AQYC 1RHUA 1SAYA 5K9FA 2GCOA 1OE0A 3RC3A 4E07A 5BOSA 2VG7B 1QV9A 1XCLA 4LZOA 1JJIA 5FBRB 5H1YA 4ZXFA 4NENA 3T35A 3W9YA 1M5KC 5FTLA 4NCGB 1R8YA 3IBFA 4GZ6A 3L4JA 4BV3A 4NCGA 2B98A 1NLZA 4IM7A 2XMVA 4DDKA 4MVCA 3HHLC 2PBLA 4KHPB 2WINI 4G1IA 1SJ1A 4QAQA 1E9VA 2BFFA 4A8JC 1GX6A 5L4SA 4YECA 3U1MA 2J9RA 5L95A 1XWLA 1M34E 4KYUA 1YSCA 1JQDA 2E7GA 1Z1ZA 5GVSA 1H94A 2R1ZA 4U9IS 2G1PA 1HQYE 3F49S 4HJXA 3R3XA 2XZLA 3JQ8B 2E66A 5HANA 1CSJA 4ZVTB 4JGGA 4M3NA 3IR5B 2XBMA 1FTWA 4YEAA 4EY4A 3HB0A 5CP8A 2WWHA 1GFIA 1G9TA 4KRXA 2XGSA 3IP8A 2FW6A 3FG9A 4GM4A 3MXOA 5LZ9A 1HX7A 5DM6Q 1UOQA 4JJIA 4X6XA 1WW2A 4FOPA 5A3SA 2PQ2A 3QUTA 2HLUA 5BV7A 4Y2IA 2CLDX 5HIKA 4G8BA 5KX5F 1KDTA 1SC4B 1V3QE 2GETA 1B7FA 3LP8A 2PUDA 2AHOA 2OO3A 3LH2S 3I37X 5JE8A 1HG0A 1WSRA 2WG0A 2AEJA 5KFUA 1O96A 1N5TA 4NHEA 5K99A 2O2DA 2ONKA 4J6EA 5EG5A 5MN4A 6FD1A 1I2CA 1D1UA 2PRZA 3OUYA 2CB0A 3H25A 4IUCS 5GMDA 2OZVA 4NCAA 2OM6A 4JHLA 4FYWA 3HSKA 3T0IA 1XTQA 2VHJA 1IDOA 1ZJ6A 1KHTA 1RC0A 2CVEA 1P81A 2X4IA 3A1TA 1Y4ZA 3JQ9A 3VSBA 1Y7LA 3M9WA 3DF9A 1W0JA 5IJAA 4Q12A 2I0XA 5HMLA 4IUFA 4CU5A 2GGPB 1HTWA 2BZ1A 4EENA 4JYAC 2ATLA 4TRJA 1QWSA 1R3UA 1ZH0A 1YDFA 2WP0A 3G79A 1NC1A 1MHPA 4D42A 4MCJA 4RVSA 3E22B 2BM1A 4HC4A 2B5OA 2OBMA 2IYZA 3BN4A 4JC5A 3ZWQA 1C4AA 4Q1BA 5IDXA 1YR1A 1CT9A 2PNJA 3W8PA 5ECGC 1PAUB 2HLDA 1WXXA 3MLAA 3M8PA 5EWEA 1N1GA 1PYOA 1FTSA 4EF6A 3ANLA 1MB2A 5JQGF 2BLLA 1JHAA 1GYRA 3UWSA 1MJHA 1K8XB 1NG1A 4ZIRA 1KR2A 4C0QC 1E3QA 1GX5A 2HWHA 3HLTA 4W7HA 1I94B 3L82B 3NBZC 2AI1A 3RV3A 4J49A 1TAUA 3AILA 1QKJA 4NOMA 4WA7A 2H2IA 2V4QA 1QHIA 2HCBA 2BE9B 4DNOA 3WHPA 1Y1TA 4G1UC 4BV8A 3CE8A 2BI4A 4FR5A 1VC6A 2CF5A 5LMZA 4G36A 3DHXA 1EQMA 1E0KA 2I1LA 1QORA 4DDVA 3BRCA 2HWKA 3LPYA 1IZYA 4QSHA 4HLBA 2C84A 4B9SA 1YACA 3MELA 4JYCA 4F0HA 4RMJA 3RS8A 3ZZPA 4LXIA 5KFDA 4MDHA 4R69A 4FFMA 4EKDA 3TLMA 2DYJA 3TSAA 1H38A 1WKBA 3IP0A 2Q99A 3S99A 1AY0A 2EGUA 1L6IA 3K0BA 8GPBA 3FCVA 2ECKA 1GKLA 4BYGA 4P74A 2IC5A 3TBKA 5FBQB 3NGLA 4WI1A 1MR3F 1NK5A 3RRFA 2BOVA 2BDUA 4XRRA 1AUXA 2OCXA 3BB3A 5DSXA 1XNQC 4JIMA 1KSGA 4CW7A 2XHWA 1ULRA 2IAJA 3OVAA 4HRVA 4XPIB 1HNWB 4YY3B 2HK8A 3R7NB 1C14A 3BKXA 3F71A 1XSEA 4MWZA 4K3UA 2LVWA 1MO6A 4JI7B 4DG8A 1IE3A 5FPPA 3H5TA 4QQKA 5EMKA 2GZRA 5IBCA 3NS5A 5KAMA 2Z9CA 2CXCA 1MX1A 3A8JA 2Z2KA 4RELA 3U40A 4ZCSA 4DL0C 4BS9A 1OCEA 2HA0A 2ZULA 1OGIA 1ILEA 4B76A 4YB7A 5JISA 3KDSE 1FRZA 3I72A 3PDJA 2ZTLA 4RYLA 1DOZA 2Y3YA 1VE6A 1NAQA 2AC2A 5F7ZA 3MM9A 3WLNA 5DZ6A 1X74A 1U4SA 2H17A 5BSGA 4J37A 4M5DA 2BM8A 1RWMB 2MYUA 3MRVA 3VR3A 5T4FA 3QJJA 3ZS9A 2WZBA 1JAIA 3O4VA 3OQPA 3DBIA 3OHPA 1L5MA 1GTG1 4OYPA 1DTSA 4X1KB 2MQOA 3AY7A 5JJCA 5K2OA 4FXWA 4L51A 3VJKA 3MXTA 4RLHA 2PRKA 3V1LA 3V4PB 2YJ6A 2YFKA 4M0DA 2ZIVB 4G1QB 1RI7A 1VKRA 4F2RA 2CMKA 3KVRA 1VLHA 4YRMA 2QAJA 1PEKE 4F67A 2YXNA 5FB3A 4LDJA 2H1OA 3U1VA 2V7BA 1NU4A 4UCFA 4BX9A 4QOFA 4MTPA 1EVYA 4CMBA 3UH0A 4BHQA 2W6ID 2J07A 3HWX1 2X7HA 4UY8T 4IMJB 2OEKA 4Q9DA 2G0CA 5FUWA 2WIGA 4DR4B 3FE2A 1D8ZA 3OF2A 5ALDA 3I5AA 1X4GA 4EP1A 5LLSA 5LQKA 4NICA 4DX7A 3EIOA 5FTNA 2IUFA 4G5OA 1TCUA 2HVEA 4GPBA 1W5FA 2M52A 3KQWA 5AJVB 1FDAA 3FPSA 3U7QA 2HXYA 3DRRB 2CYYA 1OQAA 4ILKA 5T64A 4ZPDA 1PWEA 1EDZA 2BR5A 2O1WA 4O4RA 3VSEA 1ZJ4A 4H27A 4RY9A 4PLTA 4DSOA 1AKNA 3A70A 2BEVA 1XF9A 4MUEA 4Q34A 3R0JA 4B08A 2P9BA 3TUZC 1ZCAA 4AZ3B 1AZSB 3H6HA 2MHEA 2GFQA 1U2ZA 3QKIA 3ZY5A 2VOJA 4NOJA 1XCMA 4MR9B 1PJRA 3DZIA 2OG2A 4NASA 2GZMA 2O8EB 2BRUA 4JJZA 4A4JA 1ZC4A 3EVBA 4Q1CA 4WJKB 1ZA1B 1S0MA 1TNDA 3INTA 4J3NA 4C48A 4OV1A 4QYMA 2K5UA 3TRKA 4ZI7F 2ZBDA 3FLMA 2XS5A 5EKDA 2GD6A 3FSXA 1PAEX 1U1FA 4QTXA 4MIOA 2Q3JA 1KK0A 1NHUA 4ZOLF 1K86A 4YDHB 4MS1B 4JLSA 1ETUA 4CKEA 3CLVA 1Q1GA 4DMCA 3G5AA 3AR2A 4PLVA 1RT3B 4HWGA 2JHAA 2YICA 5M29A 2ERRA 1UKUA 2RKIB 1KY5A 1RCXB 5ELLA 1XD2B 1KSFX 3U2QA 5A0VA 3EBPA 2BE2A 1VCNA 4KVFA 3KPUA 5CAEA 3PFWO 4RJIA 4RZXA 2DJ5A 2W2XA 5DISB 4LAFA 2BF4A 2JCGA 1ZK4A 1FQJA 1Y1LA 4B7UA 1T2CA 2QA5A 3EK2A 1RRPA 3KLIB 4QOTA 4OHRA 3DKRA 3NJRA 4OREX 3CWCA 2LXFA 1IHUA 1T3ZA 1IL0A 3WRXA 2NUTB 2DBYA 3L6EA 3AP2A 2HHJA 4EMBA 4OX9F 2ZT5A 2Y4NA 4DV2F 4GLFA 4PWYA 4W8OA 3JQRA 1HM5A 3IDZA 1KSHA 3EXHC 1T9YA 2AMCB 2R6HA 3KVNA 3FNFA 2QV7A 1E7QA 3JQFC 2ARKA 2QORA 1X80B 4KSBA 4ENPA 1XXHA 2QGZA 2CCKA 3FZGA 4D96A 3UX3A 1N5RA 3WMRA 3M70A 2I7TA 5ALTA 1YR2A 1DFIA 3VDMA 1XDSA 4RPLA 1G2QA 3A1UA 2IPAB 2ZRIA 3TSCA 4V38A 1RP5A 2QX4A 5EFOA 1CEYA 1PFVA 1LW6E 5BMVA 4DV1C 2QX8A 4G1BA 2VZLA 2OTCA 5IJ9A 3HP6A 3NGXA 3NNDA 3CJ3A 4NULA 1SO8A 1GPJA 3GN2A 4M53A 2I3BA 5C1OA 2PGIA 4OZ0A 4GLLA 1S89A 4LOLA 3ONWA 4XWWA 3UUEA 4LMAA 3E8MA 3EULA 5LMCA 2HEGA 1JHRA 1GZ3A 4PCQA 1S6PA 3T7TA 5GZ3A 2HWTA 4LG1A 2FVQA 1P2DA 3TX6A 3P32A 1D2CA 3PG9A 1DS6A 4BNLA 4OHOA 1FFHA 1DL5A 5LQRA 4AJJA 4QGGA 4QJ3A 1G8GA 4HK4A 2GWRA 4CHTA 2H0QA 1PK7A 4EYIB 2R44A 3W5SA 2PL1A 1ML8A 4QA9A 2J3JA 5ETRA 2LIPA 5JNTA 1SOWA 2VH1A 3JQAB 3AXKA 1X1BA 3OWXA 4JOSA 3VPFA 2EHJA 4CM8B 2C2YA 4LZNA 1WG5A 2WLTA 4GZ3A 2VQEF 1GCUA 3HCFA 3Q72A 3EWAA 1CR4A 3N3BC 2V2KA 3W7AA 2GPJA 5A1GA 1KDPA 3B1JA 2RVJA 1KYZA 1N1DA 5B0GA 1IBKC 1WCYA 3A3NB 4NZ9A 3TGWA 5E3AA 3KJHA 4IF4A 3HF5A 3W3SA 3I5CA 1T9TA 4Q7AA 4I6EA 5EZYF 3ZW7A 4Z1MA 1UOPA 2G5GX 2OUIA 5DG9A 5TS3A 3F4BA 5I7WA 2YFHA 1Q0SA 4YJHB 5ALZA 2RGWA 4I4IA 4LFCF 3HYNA 1RISA 1YONA 3I01A 3NASA 4IJQA 3N8IA 2WAYA 4RHUA 1SVLA 2HSWA 2NO0A 4AMZA 2AG5A 2DR2A 3LECA 2J87A 1FJGJ 2DC1A 1XQXA 3OR2B 5FL7A 1RACB 5T4EA 5ILQA 3H20A 4MV7A 2QT0A 4ZI5A 3LS2A 1OX4B 3QJPA 2XUZA 2WHPA 1RTZA 1S9EA 4HTFA 4DV5B 4PYLA 2XG8A 3HYLA 3E0XA 3DUFB 3UAZA 3ESBA 1W2BR 1U2EA 5A8RA 4KCGA 3GDGA 2EFJA 1BU5A 1FKOB 1IBRA 2VG7A 3MMJA 3DTVA 4BO7A 1HYSB 4FCTA 2QEQA 2AN4A 1IPHA 4ZPXA 4RLQA 4ZPBA 1NLMA 4IQFA 4BY9E 4P4NA 2G7ZA 1E5XA 1ATIA 1WHTA 3QVGB 2FP4B 2TSYB 2VHVA 1GGFA 3DN9A 2NO9A 1GGEA 3LNTA 4JI3J 4XVRA 1W5TA 3DVSX 4GI5A 4KK3A 3NWRA 3ND7A 4FEEA 4K4WA 2X8LA 4NYMR 1MZVA 1T8SA 2YYZA 1KERA 2A9FA 4FS1A 2J8ZA 4E5NA 3EIFA 1YOVB 3CG0A 2PJDA 4BV2A 1YGPA 2CLIB 5IN5A 5HM8A 2ANBA 5BSKA 5JNVA 1HMYA 2YY3A 2PXHA 1RT9A 3F67A 1T8WA 1JXAA 1HNWJ 2QAGC 2VQSA 2CXHA 3OPYB 1B7GO 3IBCA 2JI7A 3IDSA 4OHUA 2V74B 4FUTA 5HQLA 2HHHB 1HZZC 1HEUA 3SDEB 3DEZA 1C29B 2W4IA 3AB8A 1P7YA 1HWLA 4BLPA 1L4BA 5KKNB 2QLFB 1STOA 5J9FA 3P9CA 1GNVA 5U9CA 4OKNA 4UHKA 2D1TA 4RD0A 1TMMA 2KFZA 1GQFA 2QTHA 1M7GA 2FYXA 1ZM2A 5D77A 2DTXA 3TS1A 4IDAA 1KTQA 3FUTA 1D9AA 1FWPA 1CYDA 4E09A 1PD0A 3EUAA 4WPGA 4ECEA 1J5EF 4RZUA 5EJEA 3LPLA 2VODA 1TTPB 1J8MF 1TUIA 1L8OA 2WKRA 3W3AH 3AEXA 2ZE8A 1CUCA 3VPSA 2OPSA 1B2RA 2PN1A 4URHA 5B55A 1I51B 3NWEA 4UXJA 4BMSA 4KJZA 3VYUB 1UQTA 4QM6A 3IULA 3QAUA 2VUGA 2RUSA 1SCNE 2ZFUA 5EUMA 3K4QA 3G1WA 4XM2A 4FOOA 4UVGA 3AL0C 2X3DA 2HRCA 4ILRA 3A1FA 3ZH9B 1V47A 4MINA 1XYGA 3KSDO 3R6LA 1S0VA 3QU2A 3BR8A 3VR2A 2VQ3A 1C4CA 5L8RC 1C4OA 2HLPA 4U2DA 4BEWA 1BMFA 1JG6A 1G6HA 3G82A 1K3FA 3QWFA 3E8SA 2XODA 5THXA 2XA2A 3K73O 1BDIA 1QSYA 3OQJA 1JLFB 4MVWA 3A6PC 2UUBC 1RJWA 2FZ4A 4DCVA 2AOTA 3TQSA 4KO3S 1Q7LB 1TF2A 2AFHA 4E14A 4RHCA 1RAHB 3UHPA 2ZIFA 1INLA 5HROB 5JD3A 5F7JA 4Y8VA 2E1RA 4LFAC 1OQ3A 1M5VC 4CDNA 2JGMA 5EINA 2FDCA 1YITS 3L1VA 1H7XA 5B0EA 1DTEA 1VQ8S 1U8YA 1N1EA 2JNVA 3CC4S 2LNDA 2YJNA 5AJZA 5KJ1A 2NZYA 3AKZA 4EJSA 5GVRA 3I52A 1Y5LA 5KG3A 2BJ8A 3VZPA 1RYHA 1Y5RA 5AVSA 5CK4A 3RU7A 4EF5A 3PR1A 1TCVA 3PTAA 1N7JA 3M8QA 5E2AA 5ABPA 2KI5A 3STHA 1SK8A 3N54B 5PNTA 1JLBB 3N7TA 2LIVA 2GI4A 2JZ5A 4DSFA 1O6ZA 3FOBA 1RAAB 5DOZA 1UZHA 2BPOA 1M76A 3CKYA 1ZQ9A 4GI2A 5BSRA 3FX2A 3KJFA 3MCSA 1KA9H 4EMDA 3H9BA 2C7BA 1NCLA 1X7YB 2NU7A 3QY9A 1HPZB 1YAJA 2ZSEA