2YX1A

Crystal structure of m.jannaschii trna m1g37 methyltransferase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
323
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hypothetical protein MJ0883
publication title Crystal structure of archaeal tRNA(m(1)G37)methyltransferase aTrm5.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 92
structure length 323
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yx1A01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2yx1A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2yx1A03
3UFBA 2AOWA 4LECA 2NP7A 3CKKA 5HEKA 3TM5A 2O57A 4AX8A 3O7WA 1XVAA 5EEGA 2GPYA 1BKYA 2QE6A 3MGGA 5DSTA 2UYOA 2AN5A 1EQAA 3O4FA 2YVLA 2O0LA 2EFJA 2P35A 1SQFA 5CCXA 1VP3A 2G8NA 1NV8A 1BOOA 3HP7A 3M4XA 2OZVA 3LL7A 3FRHA 3EEYA 3EPPA 5K05A 2EG5A 1SG9A 2B9EA 4RVGA 4E2WA 1JR4A 1YB2A 3B7PA 3HCAA 4DQ0A 1U2ZA 3P9KA 3T7TA 5LQAA 5FWDA 3DLIA 1R00A 3UA3A 3FTDA 3P9IA 3R0QA 1RJGA 3EGVA 5CVJA 5DM2A 4E70A 5FCDA 3GRZA 4PCLA 1H1DA 3SGLA 4XCXA 2ADMA 3T7SA 1G60A 4O29A 5DXJA 1I9GA 2QRVB 1G8SA 4FR0A 1QANA 1RI1A 3DMFA 3OCJA 4DA4A 2NXNA 3OZSA 3LCUA 3IYLW 3WSTA 4E2YA 2Z6UA 3G5TA 3IV6A 4R6WA 4YUZA 1FJXA 3PB3A 4BP3A 1OR8A 2BM9A 1PJZA 1WXXA 2C7QA 2FCAA 1KYWA 3FPJA 2I62A 3G89A 2AVDA 5F2KA 5GP1A 1P91A 3UJDA 3VC2A 4PYQA 5HOQA 4F86A 4PNEA 2OY0A 3UJ9A 2VP3A 1ZQ9A 5T64A 4KDRA 2G1PA 1G55A 2ZBQA 2AOXA 2ZLBA 3HCBA 1BHJA 1L3BA 2ZTHA 3OFJA 2YXEA 3HCFA 2ZIGA 2ZULA 4P7KA 2CWWA 1AQJA 1RJFA 5K0LA 1RI5A 1R74A 2B3TA 3M33A 2IPXA 1KHHA 1R8XA 2ZSUA 3A7DA 2PLWA 4RSRA 5CM2Z 2P3OA 5D1NA 5IH3A 1AF7A 5K03A 2UYQA 3CBGA 3R3HA 3A25A 1TW2A 3I5UA 4EMSA 3UJCA 4CXMA 4MWZA 2I6GA 3PS9A 3PTAA 3THSA 1G38A 3KPJA 3NMUF 2XVAA 1R18A 1XJ5A 5KVAA 1M0EA 1VBFA 4Z2YA 1HNNA 4RTKA 2PKWA 4PWYA 4WVLA 2Y1XA 5K0GA 4RTRA 2C7OA 4M7RA 3P8ZA 8MHTA 1VE3A 5EZQA 3NVMB 3BZBA 1ORHA 1NT2A 5K0BA 5M5BA 1M6YA 5DM1A 1F3LA 1WS6A 3LCVB 4CKCA 4E33A 4XUEA 3G2QA 1YUBA 3DMGA 1ZKDA 4YV1A 1QAQA 3UJ8A 4GBED 1VL5A 3HCCA 3BGVA 4KDCA 4PIMA 2Z6QA 2O05A 1RI2A 2BR3A 3P9CA 4YUXA 1JQDA 1WZNA 5ICEA 3MQ2A 5K0FA 4OX9Y 3DMHA 4OBXA 5EVJA 4C05A 1X1BA 2WA2A 3CJRA 4X41A 4AZTA 3EVDA 3VC1A 3BT7A 4KW7A 3E8SA 2CMHA 4LWPA 5ICFA 1VIDA 3I9FA 1XXLA 3HM2A 4QDKA 3R6TA 3UJAA 3FPHA 5E8JA 3M6WA 1X19A 1RI4A 1YZ3A 3LECA 3UJ7A 5LQCA 1ZGAA 4OA5A 2IH2A 4OBWA 3OPNA 2YTZA 4QTUB 4R05A 5EZSA 3U81A 5ICGA 2H00A 4BP1A 4G56A 5FQOA 4F85A 4MTLA 4PGHA 1KYZA 3C3PA 4R8SA 3FYDA 4PINA 1QYRA 2FYTA 3DP7A 5DTRA 5E1OA 5CD1A 3KR2A 1VQ1A 9MHTA 2WK1A 5ERGB 4RTMA 3CVOA 4HRAA 3FZGA 5F2NA 4RX1A 2GLUA 4ER7A 3MAGA 3MCTA 5FHQA 2YX1A 3L8DA 3MB5A 3QV2A 4PYLA 2YXLA 2CKDA 3M70A 1SVUA 3AXTA 3JWIA 2PXXA 4BLWA 1FP1D 4QDJA 3T0IA 4P7GA 5B1SA 4EKIA 2OO3A 5T67A 3UWPA 3H2BA 3NJRA 4E32A 1XDZA 5EGSA 5F2OA 2O07A 2GB4A 3CCFA 3CGGA 3KU1A 5HIIA 5GIOE 2AOTB 2K4MA 4GOLD 3A27A 3QOWA 4HGZA 1NW7A 1NBIA 3ORHA 4CTKA 2WA1A 5DPMA 1YF3A 2DULA 5DWQA 3KR1A 1KPHA 2ORED 4HG2A 4R8RA 2I9KA 2V7EA 3PT9A 3LX6A 4JXJA 2PT9A 4QPPA 4FSDA 3S68A 2FK7A 1I4WA 5FULA 2B78A 4MIKA 5T6BA 3I58A 5K0NA 3FPGA 5G02A 3EVFA 2Y1WA 5CCBA 4PYIA 4FT4A 1NKVA 1X1CA 5FUBA 3HA3A 1R6AA 3DUWA 2NYUA 5MHTA 3RW9A 3SXJA 4DMGA 2UZ4A 5FA5A 4KRGA 4OQEA 5HZMA 3G5LA 1IM8A 4U7PB 3MCZA 4HGYA 2JH9A 1G6Q1 3CC8A 2HMYB 1NBHA 3HCEA 3PX3A 4HSGA 4IV8A 5EKXA 5BXYA 3GWZA 3B89A 4PYKA 5LQJA 2PSSA 4GC9A 3M6VA 3GGDA 5DXAA 5C1IA 1Q0TA 2JJQA 1NV9A 5E9JA 2R6ZA 1TPYA 2G72A 2OB2A 4AZVA 4EKGA 4YMGA 5JR3A 2FRXA 2JHAA 3G88A 3KPYA 3LHDA 3UBTA 2C7PA 2HTEA 2EX4A 2H1RA 3EMBA 2BR5A 3SR4A 2QM3A 2ZZKA 3EVAA 4KWCA 3TR6A 5EIWA 3PFHA 3AWIA 3OZTA 5LQUA 3ER8A 3DTNA 4RTOA 2VDVE 4OQDA 4PYMA 4BLUA 3AJDA 3F4KA 4UOEA 3DH0A 1SUSA 3E7PA 2IGTA 4POOA 5JUWA 1MJFA 3AXSA 3LGAA 4E2XA 1PRYA 1XCLA 1FPQA 1DUSA 1P39A 3MTEA 2QY6A 3DOUA 4YV2A 5EG5A 4V0RA 5DRYA 5FWAA 1Y8CA 4ER0A 4RTLA 1N2XA 3LBFA 5CUQA 2QYOA 3ELDA 4GC5A 4RYLA 2N47A 3PLAE 3FPEA 4CKEA 5E2AA 1L3CA 3B3FA 2OPBA 4HC4A 3DULA 5DX0A 3UJBA 3I53A 5GIPE 1INLA 1QAMA 1D2HA 2I7CA 2XYQA 3REOA 5EMLA 3GRVA 4X60A 2NXJA 2P7HA 2ONYA 3ER9A 2AOUA 2AOTA 3M6UA 4RV9A 4DCMA 4RTNA 3D2LA 2PX4A 5DLYA 1B42A 3OU6A 4CWAA 1X1AA 5E2BA 2FHPA 5EQJB 3SVZA 2HNKA 4HTFB 2FPOA 3P71T 1SKMA 2IH4A 5KYGA 5KS2A 4IV0A 5CVVA 3BXOA 2PJDA 3A4TA 3FPFA 3R24A 1Q0SA 3EVBA 4GF5A 3RIEA 2JHPA 5CVEA 2Q41A 3C3YA 3NDJA 3R9XB 1EJ6A 1NW8A 3LDUA 5E1BA 3HA7A 3DR5A 4L7VA 5HIJA 2HWKA 5EIFA 5HIMA 3PX2A 3TQSA 4B17A 5ICCA 4U7TB 1O54A 4A6DA 4DF3A 4DCGA 4MHTA 2AOVA 3UA4A 4ER5A 3K6RA 2P8JA 4C03A 4MQ4A 3GCZA 1F38A 5IKMA 4RVDA 5EPEA 3GU3A 4AUKA 3G2PA 3C6KA 1WY7A 2P41A 4GEKA 3DXZA 2OXTA 5DRTA 5LQRA 2B2CA 3HNRA 3EMDA 3KQQA 3C0KA 1NW3A 5K0CA 4RVFA 3FUWA 2NXCA 3GO4A 3KHKA 5EMMA 2UYCA 1JSXA 2P7IA 1EJ0A 2QRVA 2VS1A 5CVUA 5H02A 3OE4A 4IKPA 3TLJA 4P7FA 2JH8A 1FBNA 2V74B 3TPZA 3GRYA 2R3SA 3P9NA 1YFJA 2YUIA 3EGEA 3T7RA 1G8AA 1EG2A 2ZVJA 3LDGA 2PT6A 1L3IA 3NWBA 4KIGA 1KR5A 4E2ZA 4EVIA 1MHTA 5EEHA 4A6EA 3BGDA 1V39A 2XYRA 3QOXA 4IWNA 2CL5A 5E9QA 3DXXA 2F8LA 3ELUA 5EMJA 5LSAA 4V0QA 2AS0A 4YUVA 1AQIA 3VSEA 3HVKA 3FUXA 1DL5A 5D1HA 5BW4A 3PVCA 3KKZA 4OA8A 5E8RA 2EJTA 2PV0A 3FUUA 3I64A 2EJUA 4KVZA 1UFKA 2G70A 5DT2A 1JG3A 3HA5A 2AN4A 3MTIA 2P3LA 4GQBA 2JG3A 2ESRA 3KPWA 3BWBA 4C04A 2HV9A 1TW3A 2ZIEA 5GM2A 1KPIA 1JTFA 4AZWA 4QPNA 2OB1A 1JG1A 3LKZA 5BW5A 3TFWA 5LQKA 4FZVA 1VPTA 1NE2A 2NXEA 3C6MA 3FUVA 3KPUA 3P2IA 5GOZA 3TKYA 3VYWA 4C06A 3EVEA 4PYNA 3GRUA 2E5WA 4R6XA 3NDIA 3ELYA 4X63A 3RODA 5DM0A 3NW9A 3SSMA 2H11A 2VZ9A 5DX8A 5FADA 5EMKA 4HTFA 5P8WA 3UZUA 2CMGA 4C07A 5E1DA 3E05A 3KQPA 4RWZA 1RI3A 1XCJA 2AVNA 2PX8A 2PWPA 3Q87B 3GRRA 4GOND 4P58A 3THRA 4X61A 4M38A 2UYHA 3GIWA 2ZFUA 4RVHA 2PXAA 3ANXA 3EVCA 3MERA 2G71A 3G8AA 2PY6A 3BKXA 1ORIA 3G7UA 5U4XA 5FQNA 3NTVA 4H0NA 3DLCA 2A14A 3V97A 4RTPA 7MHTA 4PGGA 2PVCA 4RTQA 2BZGA 5GM1A 4QTTB 2OYRA 3KQYA 2B25A 4YV0A 3EVGA 3G8BA 5DX1A 3A7EA 1O9HA 2ZIFA 2LD4A 1JQEA 3B5IA 2P40A 1KP9A 1P1CA 3KR9A 4QQNA 3V8VA 3JWJA 1BC5A 4GOMD 2ZZNA 2BM8A 3TKAA 3TRKA 1XTPA 1DCTA 3A26A 1D2GA 3SM3A 2ZBRA 10MHA 1VP9A 3BUSA 4DZRA 4PYOA 1L9KA 2P1DA 2VDUE 3OU2A 3SSOA 1N7IA 1XDSA 1X1DA 2OBFA 3P2EA 3OU7A 2Z6AA 5FHRA 3KQVA 1NW6A 2IDJA 5DM4A 5DTQA 1ZHFA 3SX0A 5E9WA 2FK8A 4EQZA 3P2KA 4FP9A 2DPMA 3KQTA 3NWEA 5HIKA 3GDHA 4RTSA 2IBTA 2ZWAA 3BWCA 3KR0A 4ER3A 4GUAA 4WXHA 2YR0A 3FTFA 2PWYA 2PBFA 4E31A 1KIAA 5K0EA 3GXOA 1SUIA 1QZZA 4ISCA 4XUDA 5EC8A 4E30A 1RJEA 3FRIA 4FSXA 4GOOD 2GS9A 1I1NA 2ZWVA 4ATNA 4M36A 4BY9E 3ELWA 4CTJA 5FA8A 3CJQA 4FS8A 2P3QA 5GWXA 1UWVA 3O31A 2PXCA 4HH4A 5LR6A 1WXWA 3OZRA 5KQSA 2YQZA 3KPVA 3KQSA 3LSTA 3FTEA 4YUWA 1T43A 3HVJA 1JG2A 3TM4A 2O06A 3DXYA 3K0BA 3LKDA 4P7JA 1FP2A 2ZBPA 2IFTA 3P97A 3SSNA 3BWMA 3OFKA 4FGZA 3GJYA 2JHCA 4KIFA 1JSZA 3TMAA 4LWOA 1AV6A 1ZG3A 2PX5A 3BKWA 1JG4A 2AR0A 5HFJA 2BH2A 4F84A 3LBYA 3JWGA 2NP6A 3KQMA 4C4AA 2KW5A 5K01A 4LG1A 5GINE 4Y2HA 1D2CA 3HTXA 2HR1A 2IIPA 3B3JA 3JWHA 4AZSA 2IDKA 4EK9A 3X0DA 5K09A 2GH1A 3KQWA 2IBSA 1KPGA 2ONZA 3GNLA 1HMYA 3LDFA 3LCCA 2XYVA 4FT2A 5C0OE 3IEIA 1QAOA 5LQNA 4DKJA 3IHTA 2ZW9A 2PX2A 1NW5A 3PFGA 4NECA 3UJ6A 4DM3A 4CKBA 2BR4A 4YUYA 2XBMA 3ERCA 3B3GA 3G2MA 4ZTBA 5KQRA 3KQOA 3AY0A 1R8YA 4K6MA 3NVKI 3FUTA 1IXKA 3OE5A 5K8VA 3EEOA 1YZHA 2GA9A 3MHTA 1O9GA 1SQGA 3HEMA 5E1MA 2ZZMA 3EVZA 4PONA 2IP2A 4PIPA 4ER6A 1N7JA 1EIZA 1EAMA 2PGXA 3E23A 1M6EX 2IH5A 4XUCA 2OKCA 1P1BA 1L1EA 4QVGA 4RTJA 5EKUA 1KXZA 1UIRA 2AZTA 2NNWB 5K0JA 2ERCA 3HVIA 1VLMA 1JTEA 2GAFA 3LPMA 3EGIA 5DSXA 3TOSA 5EOVA 5CIYA 3FTCA 2VDWA 4M37A 5CVDA 1JQ3A 2AN3A 4BLVA 3Q7EA 4C08A 3CJTA 3FYCA 3SMQA 2C7RA 1RJDA 1YFLA 1XDUA 3ME5A 4QQKA 4YMHA 1Z3CA 3G2OA 3BGIA 4PCAA 3HCDA 5EHGA 3M6XA 2ZCJA 3BWYA 5C9ZA 5BP7A 1ZGJA 2AOUB 2XVMA 3ID6C 4X1OA 4Y30A 5FTWA 2YXDA 4PYJA 5DTMA 1WG8A 1IY9A 3HVHA 5EHIA 5HILA 4QVKA
chains in the Genus database with same CATH superfamily
1YK1A 1U8ZA 1MO5A 5FV7A 1WMEA 2B92A 4QFMA 4F6RB 2R8RA 2XKBA 1VEHA 2NPOA 4E2WA 1JR4A 4AJEA 1EEXB 3KAQA 2ZYIA 5LQAA 3R0QA 2BM0A 1XNQJ 1E3WA 4MRMB 2COEA 4WUVA 1MENA 2XUDA 3WGHA 5A9SB 3H65A 1FD2A 2UXBB 1PZHA 2Y71A 1IWAA 1ZH5A 4PYQA 4WH0A 2GZOA 4BPBA 3FRJA 2ZKLA 3L0CA 5A1JA 3HYCA 2DETA 1HL6A 1T4BA 5IC6B 2O8EB 4M9ZA 1AU9A 3PS9A 1K86A 7GPBA 2ZE7A 5M2QA 3HQ4O 1XMVA 2ATEA 3OQNA 1J8FA 5JASA 4TV9A 1S6QB 3VR1A 2DFTA 3ESCA 2M6LA 1QVGR 3JWEA 3F7TA 2JNWA 3CMQA 1CE8B 3PFNA 4LV5B 4AQDA 2FWBA 4MSUA 1P2GA 2K1RA 4ED6A 2IAJB 1GN8A 2D2EA 4X1IB 3A37A 4BP1A 1HDXA 3OLQA 2BTQB 4MKBA 5DK4A 3GLKA 1FX0A 2OD6A 3ZCXA 4RPHA 4QNNA 5FFMA 2CQDA 3WLKX 3HDYA 2AEJA 1UZHA 2AV5A 3KK1B 5IAGA 1QGAA 1QDLB 3OEHA 3JD2A 5HYVA 4MGEA 3CGGA 3SFTA 4BQRA 4H6PA 1YZTA 4Q9JA 4MRVA 1CVLA 1DT5A 1K6IA 2NW6A 4H17A 4KACA 4YXFA 5T6BA 1JLEA 3FWNA 3WJ1A 2CK3A 1CERA 4LK3A 1EEHA 2CXRA 3EGXA 3DFKA 4H7JA 1ZFNA 2P2ZA 3SYLA 1IBLB 4ARBA 2V5VA 3QXJA 4Y2VA 1NDQA 1PS9A 2J1LA 1VPWA 4I4BA 4WHMA 2CWDA 4PSCA 2P5UA 4D0SA 1J8QA 3O2QB 1G5FA 4YRTA 3DUFA 2AWOA 3L01A 3OZTA 4DCUA 1RZMA 4B3MB 5ESDA 1C0TB 1FNBA 1KWMA 1N33B 1ZAYA 1D2NA 1EKXA 5C18A 2QA2A 1D6MA 3A6ZA 1NVGA 3JTOA 1QTQA 2PMDA 5A8RB 2D3ZA 1IATA 6LDHA 1S4EA 3BE6A 4CWAA 5B7PA 2D5AA 2HNKA 4F1KA 2WE7A 5P21A 2Y1OA 1VHJA 3RVBA 1N5MA 4L7VA 3PR3A 3C6UA 4DF3A 4MK9A 3ACDA 4DUYF 4I5FA 2AB0A 5AW6A 1NNSA 3V5NA 5KPJA 1PC4A 1ZUNA 4ZAGA 2EFNA 4ZVPB 1ML3A 5DW0A 3ICLA 1LUAA 3OFND 1YZNA 2PRKA 1VRQC 3VU3A 1N2BA 3UDCA 4PO9A 4RKEA 1RHKB 1SXJC 3OICA 2EFCB 5EMHA 1DLIA 2E5LC 4CF3A 5ITHA 1HFJA 3CRQA 2AA3A 3GAMA 3WL3A 2VFRA 4KSEB 1E2PA 1FEEA 5IK2D 1MV8A 2EVZA 2J6BA 4YC7A 3N0RA 2DITA 1PFQA 1RWNB 2WM9B 1HI8A 2A14A 2I2BA 1JF8A 2W2LD 1G1MA 2R8PA 2K1RB 3A6KA 4JQOA 4QQNA 3IV7A 1EK6A 4Z9AA 1JZQA 4MXDA 1G17A 3NCPA 4WXOA 4M87A 2HVEA 1EXMA 1TMOA 3Q6IA 2EEYA 1S1UB 3VJLA 2VTBA 4WXHA 2V7XA 4MUIA 4B6SA 3V1YA 2VXBA 3X2SA 3SFZA 4F4YA 2P3QA 1K98A 1S1MA 2BGMA 2XAAA 4IDKA 1RTDA 3CF0A 4QPCA 3K9HA 3NS7A 4NLDA 3T1AA 2PMWA 2VC1A 3B3JA 6CHYA 1KPGA 2VG8A 3AY3A 4ZHSA 3Q8LA 1RPNA 5H3CA 4B2PA 3KLHA 1S0VA 4R83A 3T95A 4ZTBA 3QFCA 4MICA 5E1MA 4DCJB 3BC1A 2D1CA 2RIJA 4BMYA 1SKWA 1UIRA 4WESB 5K0JA 2VSFA 3CNLA 1WTFA 1IZ0A 1JQ3A 3H6KA 4FDMA 2NPIA 4UTPA 4D9GA 3A4LA 3CR8A 4EY7A 4B3OA 5LFAA 4X1OA 1HQYE 3R8FA 5TMBA 4TRRA 3HVHA 3DVRX 2KL8A 1HTBA 5C1OA 2BE2A 2AN5A 1M6VB 5KO2A 2XQIA 3ZOZA 3C6UB 2NXWA 3EEYA 2QMOA 3PSAA 4FF4A 5BR1A 3V3KA 4DNQA 2U1AA 3G1UA 1RTIA 3S28A 2C9ZA 1K7EB 7REQB 3JCZA 2IYNA 4DV5C 3QZ8A 2BMWA 3ITNA 1YRWA 1NN5A 4ZOBA 2ONJA 5KOJA 2GEVA 4XQGA 3VC2A 1B23P 4GBJA 1IWPB 1XNRF 2ZFHA 1U28A 1SG6A 4RK4A 3IXQA 2ATWA 1BAPA 3OCYA 2GJAA 4B3MJ 2B3TA 2OBMA 1YOBA 4HI1A 3PQ2A 4KGDA 3PXBA 3DM2B 2JJ2D 2WSEC 1KI8A 1P7ZA 1VPEA 4H7KA 5KG1A 3T1HF 2R2SA 1O95C 2YS6A 1D6JA 3NVMB 1U48A 2Q3BA 6Q21A 1JFFB 2H1HA 2OCIA 4JHXA 4AIRA 2HHQA 3H9BA 4KSYA 2MKYA 1QOPB 5JROA 3CT9A 1H23A 3OPNA 5T8SA 1V6AA 2BR0A 3TTVA 1JHQA 3MWGA 3PYMA 4PLYA 2Q66A 4B9LA 2XEDA 5E1OA 1GU1A 1W52X 4HX5A 3V7FA 5AXBA 4JAVC 4OMCA 3IBGA 4QOTA 1NHVA 3W3ZB 1T9HA 4BKPA 3NBMA 1Y3HA 3FOZA 1Z82A 2ASDA 2JLRA 3OUUA 2VTBB 3BTVA 3QKRA 1JEAA 4BFWA 5MN4A 4B3SB 5DWQA 3FEXB 1ZISA 2A6PA 4IDNA 1EJ7L 3LYLA 2PZGA 2A88A 4NU5A 3CSKA 3CH6A 5KTPA 2WW8A 3WRVA 1FI4A 5A2QD 1R6AA 4BX8A 3PQ8A 2RGUA 3K0FA 3EX7C 3BGRA 3OR2A 4YK7A 2VBYA 4X62C 1FXUA 3VVUA 2PMWB 3A6DA 3PXXA 2XOKD 3RAGA 4HSGA 2BE7A 4C0WA 1OSDA 2F9JA 1O51A 2XRFA 2XQJA 4P83A 5JSUA 1JLLB 4CMEA 4R51A 2XNSA 2AE2A 4LT6A 3KLHB 1JA1A 3T1YJ 3ZJUA 1RXIA 3C3AA 5C7LO 2GZ1A 4E2XA 2O2XA 4BVJA 3PJDA 1GXSA 3QVLA 3PLAE 2X3GA 3RBVA 3I53A 3D5QA 2OHDA 4KGXA 3GFYA 3OQ1A 3M6UA 1DOZA 4B3OB 4M5IA 3RCBA 2CJKA 4ILMA 4D9IA 1Y3JA 2IXGA 1TL7B 3RU9A 5FDLA 3B6BA 3OFSA 1BJTA 3UH1A 3OV7A 2V6BA 3W5JA 3VHLB 1U8EA 3U4IA 4H15A 5IX8A 2O2CA 2W5UA 3ZS8A 2XS7A 2ST1A 3IGFA 1GZ3A 2RHQB 3UHFA 5KOJB 1ZN9A 1U0BB 4YOEA 1Z5ZA 4FKZA 4B8ZA 2DKOB 3WWDA 3RVQA 2H31A 3SBDA 4KCGA 3J81j 2HFNA 3EWGA 3UO0A 2IS4A 2QK4A 1BWEA 3IQIX 4I2NA 2GN0A 1SOMA 4B73A 5DS7A 1ZZGA 3T3MB 2DO0A 4HEA9 2BOPA 2NXEA 5KFBA 2YWKA 3TAUA 2RH5A 4HDHA 4IXWA 1XVUA 4IGFA 3TMYA 1M1KT 3CX8A 4BNHA 4OIXA 1VIAA 4EK2A 1J6UA 2DKNA 1HYSA 3M3HA 2B25A 1GCOA 2CFCA 3EVGA 5CVCA 4KTTA 5G4KA 2F1IA 3D9QX 1J2JA 2GHQA 3LM8A 3D6NB 2BUBA 3CKLA 3KE8A 1PEDA 3PCXA 2V63A 1CP2A 1KR2A 4YJ2F 2W9BA 4BJ5A 4P4TA 4DDUA 3GJQA 2R7WA 3R4VA 2C5GA 4IO1A 5TGDA 1XV5A 3L1KA 5GJBA 5IZCC 1MNQA 4IXNA 4K4SA 2BELA 1VYTA 5AK5A 3R0ZA 1XD2A 4NCBA 1ACMA 5BQ3A 3W2WA 5CB0A 5GZ1A 3GFFA 2WHEA 2IDKA 3KK2A 1QS0B 5HJ5A 2FZVA 5JVHQ 3BF7A 2A1UA 4OOFA 2QNRA 4LISA 2IPAB 4RY2A 3V32A 2EYUA 3HXTA 4WCVA 1W0KA 421PA 1NVKA 4WXPA 1M6EX 3JQQA 1L5KA 3VOBA 2JVOA 5C25A 1SKUB 2JI9A 2CVZA 4BO1A 1IOLA 2PX0A 4KGXB 2NQTA 1H1TA 4BGEA 4KQ9A 3ZE6A 5ETJA 2JAWA 4WBNA 3WIBA 3T5BA 4R1PA 3TSCA 5L53A 4KE6A 3MINA 1ID8A 1G9SA 2P02A 4B3SJ 4DV6J 3D3WA 2EQAA 5BR8J 1CULC 3NXZA 4AMGA 2RDIA 2DFNA 1RA7A 3OQIA 1PG2A 2KLHA 3POTA 4U5QA 4MV3A 4NZOA 3CIFA 4RU2A 1UDAA 5FWYB 2MLZA 1S77D 1N2SA 2DGDA 4HDNA 2K8GA 2B82A 2K3IA 1EFPB 4QCLA 4LC9A 4PWUA 2L69A 1TAUA 3DPIA 1KDYA 5ETKA 1LPSA 2FJBB 3IUSA 4OQZA 2I3GA 4ND8B 2IJNA 3GQVA 3S1AA 4CT4B 5HMXA 2ZS8A 4DR5F 2OFFA 1OMOA 1MA3A 1PKEA 1WCIA 4YT2A 5GZ6A 3SSRA 4UBOA 4RO0A 4LE2A 1ZUWA 4OHWA 4ACBA 2UV8G 2PFKA 3GGJA 2DNNA 1HYSB 3V2UC 4LCJA 2AFRA 3VVMA 1E79D 2J6TA 2E4WA 3GTYX 3I9OA 3BYPA 4J37A 1EHYA 5D6NA 3RRGA 4CQNA 2HRUA 4LPKA 2NVOA 1WB4A 1FP1D 2FPMA 1HD0A 1GPH1 3DZFA 1QHNA 1IUPA 1X7ZA 3VVCA 1QV7A 3FPCA 4BLSA 3D1OA 1ZDMA 5IHPA 4ARZA 2ZBVA 4EYOA 4CLUA 2NZ4A 2WT9A 1XXHB 5LLDA 2DEJA 1XD2B 3AQ4A 1YUMA 3KKNA 4YPVA 7FDRA 2ZI3A 3M8WA 2A2DA 4I4TA 2Q2OA 5I01A 4NRDA 1B2RA 2PROA 4UY85 4I55A 1S59A 1NFFA 5IBPA 3D4OA 3OT1B 3OIUA 5A05A 1LJ8A 2J4DA 3KUUA 1TUEA 3AQOA 1WUKS 3IBSA 4OLHA 3KDAA 2M4MA 3MB8A 2HHCA 2WTBA 3OTOF 2XSZA 3OVSA 1U2GC 2G4VA 1NKCA 3NCHA 3A6JA 3UPUA 5GVSA 4B87A 2GN2A 4KXWA 4Z9BA 4GF5A 3TWOA 3TGWA 2AHOB 2OD9A 1AB8A 1TVMA 2JAPA 3THWB 2H1YA 3WYCA 5JTUA 3J80Y 4PQUA 3D3WB 5IKMA 1L8AA 4KO8A 2GPSA 4CM7A 1M0SA 1CFJA 1QYIA 2PJZA 2XCIA 3S8SA 4L3KA 4R71A 3C4JA 1CPZA 4ZT4A 3I1YA 1ODIA 3DFIA 1GZVA 3NG8A 3ASUA 3D5EA 4ECUA 4G8CA 1S10A 4J9LA 1FCJA 1CJBA 5B0BA 4C04A 5C2GA 1UWCA 1Z62A 1SURA 4NYIR 1WKVA 3TD6A 3NOVA 3P4YA 4WAUA 1B2LA 4RMGA 4CIOA 4DR6C 4GPAA 1QH8A 3IUBA 5G53C 3E61A 3G6ES 4C20A 2CNNA 3KVYA 4YAJA 1E3EA 1TZBA 5I5EA 3QYYA 5M2PA 4HB0A 4RL6A 1ACLA 3QFFA 2A2ZA 1E5LA 1DTEA 2QTTA 1M5KC 4YRLA 3CZ5A 1P18A 1LK7A 4RE6A 4IG0A 3LVQE 2DTDA 5FNZA 3T5GA 3KR0A 1ML8A 3G0CA 2LEAA 2TECE 4JYCA 1SM4A 1X7ZB 3LYUA 4OKIA 3ASYA 1W2HA 3F1LA 1JEDA 5CT5A 4B6RA 3BQ9A 2IHNA 1FTGA 2W58A 3VR3D 5LZ2A 1UCNA 3EE3A 2B51A 4DA9A 1YRUA 1HG0A 1H4TA 5JXSA 2X22A 3LDFA 2FMTA 3SV4A 1P33A 4YI5A 2P0AA 3I0SB 2HNZB 3PFWO 1P9QC 4I55B 4R3WA 1GZ4A 3GA5A 1Q95A 4OYHA 2QLFA 1WABA 3KX2A 3UUWA 4QFDA 2IM0A 1KS9A 1WC6A 4BO9A 4NCNA 4MIWA 5A1IA 3G2OA 2DR7A 4TXJA 3PC2A 1NU4A 3KJFA 2XO6A 2RQKA 5L38A 2JFOA 3CKKA 2O57A 3O7WA 4ZVLA 3GPAA 4DDHA 3KTDA 2O0LA 1B0TA 5H81A 1BW9A 3C6YA 2A9PA 1JKXA 3K0CC 1E6CA 2HKIA 2IWRA 4N39A 4MOWA 4JR1A 2YHUA 4S2EA 2YNFB 5CLFA 4DA4A 1SXQA 4YWJA 4J1TC 2VL7A 3UN5A 3D7NA 4PPYA 3W2VB 4PAWA 2ZLBA 3VDQA 1P9LA 1Q21A 4N47A 5H9VA 1KMQA 2I55A 3CC2S 2VZLA 3UJCA 3ILSA 3QW4B 3L7AA 5KQLA 4L6V3 4UUXA 1GYPA 1I24A 4F4DA 5IWAF 2MKKA 1F3LA 1AA1B 3FPKA 3ZZYA 2ZVIA 4EHHA 1U6IA 4QDOA 4A2WA 4JKIA 3WLOA 2J9RA 3NLLA 5AE2A 1JBKA 2CNNB 4CV2A 5AVVA 2IH2A 1NP7A 2RHDA 2Z08A 4R05A 4JGIA 3UTCA 3ANMA 4E2FA 3OH8A 3PGLA 3DBRB 4JL6A 1QFYA 4MW1A 2LRHA 3V33A 3VRHA 2F43A 3PX7A 3CVOA 4M0CA 4AJIA 1TUGB 4L73A 2ZJOA 1CDEA 3QV2A 1E5VA 3PU6A 2EC2A 3PNIA 2ZYDA 3FCAA 3DZIA 4LGYA 5A6VA 3JYOA 4H4MA 4QAJA 3HP4A 3OD2A 2XGJA 1R16A 2XDAA 4OYRA 4RY8A 3V80A 3ZTWA 1NUSA 3AEKB 3CRVA 2NUTA 1A9OA 2R2GA 2DWPA 5KB3A 1L4FA 3WNQA 3L1UA 3RVJA 5HZMA 5DW3A 4DUGA 1IRXA 2HVHA 3GUYA 3IBFA 2BZ1A 4USHA 4GICA 3TIGA 1R27A 1E6YA 4REMA 2F4VF 4OUKX 4CLFA 1PKXA 4CUJA 1EXVA 4UOEA 2PHZA 5GY7A 5JVDF 1SQEA 3IP6A 1FPQA 1NDLA 1PJQA 4RTLA 4EAQA 3C8MA 3WZLA 4FR5A 1Z74A 2E7GA 3ZHBA 1XMOF 3HMKA 1XMQJ 1IR2A 2ILVA 4BMNA 5JAHA 3LY8A 2JNVA 1PZMA 1A7AA 4QOHA 2OQVA 1MB0A 3DVAB 1KFSA 4AZ3B 1BW9B 4MQ4A 4BUCA 4FOTA 3BGUA 4FDVA 1BVUA 5HG0A 4DJBA 3W1WA 3QYPA 3VGPA 1G7SA 1U0OC 5T8KC 3IP5A 4NXMB 5CZVA 1GFWB 3KD2A 3OZCA 5HDBB 5IMSA 4FKXA 2GT1A 1SK8A 3RIYA 4KR3A 5KNDH 1V26A 3CUSA 2EBWA 3AJRA 2EW8A 3PJRA 1B14A 4WOBA 2C29D 3BICA 1J0CA 2AX4A 4R7ZA 1FFXB 3NASA 1W6RA 5A5DA 2X86A 3DMDA 3AKYA 1VGYA 5LKAA 2B4TO 3A36A 4RWZA 4WLNA 1KBOA 1AE1A 1E4EB 4U2FA 3R3WA 1EAYA 1E60A 1U5BA 1SCKA 3J7TA 1S3SA 4AM8A 2WBLC 4RU1A 4ZVQA 5A71A 3WL4A 3WGKA 2Z6AA 3URMA 2MCQA 3B60A 2CQHA 2COLA 3SE7A 2YVAA 2OXFA 1W2BR 1CULA 3CNNA 4QQRA 3W5CA 4H4MB 3A9SA 5K0EA 1CS0B 4HJXA 2C2BA 4XUDA 2I99A 5K8MA 3JARB 3PNSA 2QZ8A 1U8FO 4ZOAA 1I10A 5JDCA 4DGSA 4QJ4A 4JI7F 3Q86A 3GWGA 5HFJA 4QTXA 1Q81T 2R48A 3UCEA 4C0BA 2J08A 3T9CA 3RK4A 1S1CA 5CA0A 5CA1A 2GZHA 4WKGA 2IF2A 1SV5B 3WLHA 3RJTA 4V3BA 4C7OA 4AJLA 3I52A 5FBVB 2YMPA 2JZOA 1HYEA 3QF7A 5B0AA 1T9DA 3DE5X 2VP2A 2VTVA 1QO0A 2G9RA 3VAIA 3NAQA 3O82A 2MZ1A 4BNYA 3ZV5A 3PO4A 4RJLA 3BSWA 4DZTA 1NNEA 3AJ8A 1K89A 1TVEA 5EHZA 2D28C 4EU0A 3OZUA 3RYTC 1RLJA 1YB2A 3B7PA 4J43A 1WD6A 3AETB 2BAGA 4A16A 1X15A 2OC9A 4B3RJ 4JI4C 4FEGA 5HF6A 1NRJB 2Q6BA 4ZQHA 3ZDBA 1UQUA 4HO1X 1GYQA 4MUBA 1UPAA 2G6TA 5F35A 2NUHA 2NU6A 1S6PA 1XWLA 5I9LA 3RJZA 3OTHA 3ENAA 1D1UA 2WM8A 2WT4A 4DUZF 2WFZA 1M1XB 2YVKA 2HMUA 5KKNB 2CQBA 1C30A 1O96A 2QTLA 1E1KA 1M1ZA 5BY2A 1BMQB 4DMLA 4KU4A 2EG2A 4L27A 4CF6A 3CEDA 4LR7A 3R5DA 4LXUA 3ROFA 2QT9A 1T9UA 5CCMA 1NT2A 2EX1A 4EYGA 4DEYA 4MS3A 4DCVA 1DIOB 4TTSA 4J2TA 1KYQA 2UP1A 2CT8A 4IIJA 4AE5A 1QYDA 3JQ8A 3MWLA 2PYDA 1RWXB 1ZN2A 2QD4A 1MF7A 5HJ7A 4PZ0A 4AMZA 4JEIA 5TPZA 3O8QA 4WQMA 3HHLA 4G9GA 2XOEA 4CM0A 3QOFA 2C7BA 2D2IA 5EJ4A 1WKLA 1AKMA 5FP0A 3KOWA 1Q15A 4E5YA 1E2IA 3E01B 1Y6JA 5HJXA 1I5EA 3EPHA 1JX4A 1MGPA 4XD7D 3I9JA 2A6OA 1P4EA 1MQSA 2M70A 1XEZA 1JLSA 5BMOA 3RKRA 1H1LB 4IFVA 1NF3A 4JA2A 1M8GA 4E5SA 1H4VB 1JLGA 1MAUA 3GLHB 2FUG1 4FGLA 4UUOA 4CO1A 1H2EA 2YW9A 1PNTA 2WU1A 1RYDA 3H3JA 3IQGX 4C7OB 1OXSC 3AFNA 3DZDA 1FRQA 1GMWD 2AZDA 1CSEE 1E96A 1QONA 1QUPA 2G40A 3ZKAA 2HQDA 5YASA 3JATA 2QP9X 4HDKB 3DE1X 3BJZA 2H3EB 5FWAA 3PDIB 4K7QA 2HHHJ 1KRWA 2WM2A 2QX4A 2WF8A 3MCWA 5AUQA 3C46A 4DM4A 4IV0A 5BOVA 1JMTA 1KJQA 1DBSA 3E1SA 1OFUA 5ICCA 2UZIR 1D0EA 2VF8A 4H1HA 5AHWA 4CMIB 2CY0A 1NK7A 1UDWA 3S99A 3PYEA 2C9YA 5IT9Y 4U5XA 2Q5QA 2O01C 5L3QB 1XEFA 5ESWA 1VSTA 4X65F 2FKNA 3F67A 1UOQA 1WSDA 2NU6B 2EKNA 2HNDA 4O4IF 4KPYA 2D3TA 3AB8A 4N3AA 4KXLA 3H5YA 4GZLA 1I51B 2QX8A 2GYUA 1O96B 3PDCA 3S70A 2BJ8A 1JYFA 1GT8A 1UMBA 3OF2A 1TFUA 3ADBA 1Z6AA 2O6LA 3QSIA 5GOZA 2X8LA 4RK5A 5JHHB 4J9PA 3I3SR 2BYCA 1QLWA 2MKCA 3ZD9A 4WJLA 4YECA 4OXNA 1XQIA 5EN1A 2AN9A 3WVNA 4ND5A 4TMFA 2PXAA 5F1KA 4FI3C 2I2DA 4ERXA 2GK6A 2QA4S 1K0UA 1BDIA 1JQEA 2HTFA 2DY0A 3ST7A 2A8YA 4JENA 2KZ0A 4PW0A 2P62A 4MA4A 3FR8A 3QRQA 2BW0A 1SVKA 4BU1A 5G1NA 5E95A 4OL8A 7ADHA 2I3BA 2B43A 2FZWA 1IBLC 2AYZA 4EDHA 1LSOA 3B53X 5A1GA 1O7JA 5DLQC 4M1KA 3ABOB 3CNBA 1HL7A 1SKRA 1LBQA 1P8GA 1NN3A 1KJ8A 3DWFA 5FD1A 1NZJA 2QL6A 4F5WA 1QVVA 2OPLB 3ZXSA 3B1ZA 4IXTA 1CJSA 4NLWA 2V7QA 4J1TA 1N33C 4KPGA 5ITWA 3BTUA 1DWQA 1JLGB 5CYFA 5K01A 4FCTA 3S6EA 2HA5A 2F3TA 2JNJA 2JGMA 2FOLA 4CHGA 2ZUSA 4H9GA 3KYDB 1OIVA 4NECA 2I87A 3O1HB 4JNCA 3AEXA 4NFYA 4PAOA 3OJSA 3NAHA 5C3MA 4R0NA 2ECKA 1EAMA 2JCSA 1AQUA 4ZAXA 1JXQA 3KAKA 4B9NA 4NR0A 3QMMA 2QUIA 5CIYA 1Z15A 3N01A 5GOTA 1PGNA 2C2XA 3H5VA 4URQU 4WGFA 3RKSA 5HZHA 4HEHA 1BH2A 3RJ5A 4P6VF 5CABA 3OZGA 1O0PA 3G2JA 4XX0A 3BEOA 5J4VA 2E89A 3FVTA 4N8DA 3T3HA 1RC0A 4ILLA 5THQA 4M9SA 2WTAA 2ZPAA 1D5CA 1EYZA 3KHRA 1TL3B 2XODA 1E99A 4FFMA 3WYDA 4CI9A 1N6QB 3JZFA 1NE7A 4H3VA 3NZEA 1CVJA 5KDOA 3WYEA 1QV9A 4FHEA 2ZJ6A 5ALDA 4M76B 3VR2A 2HNDB 1VBNA 1WRBA 2VBCA 3BERA 3NHKA 2AOXA 4G1MB 3FJ2A 4MVWA 3REFA 4DLUA 2VPXA 1DAXA 3MN1A 1UZLA 4EGCB 4W5HA 4MWZA 1OVGA 3GJ7A 4P3XA 1HNXB 4OJYA 1JB9A 1VL6A 2XBUA 3TJ9A 3O6VA 3BPDA 2WTFA 3ACCA 5MFPA 4KNYA 1ZM7A 2HADA 3T4XA 5D5PA 1X80B 3VR6A 4L3VA 3MQ2A 3TVTA 4FSHA 1Z1ZA 3AB7A 5IJ9B 4UUWA 5CD9A 1UMKA 1SC4A 4OBWA 4LF8F 1S8FA 5T4EA 3JR3A 1LA2A 2PVSA 4DJEC 4AYXA 4BEJA 3MJ4A 1ADBA 4QC2A 4ZHRB 5IVIA 4KV7A 3TR5A 5FHQA 4G0YA 3M30A 1RLOA 3LLVA 5LXTB 4HUQA 1WBBA 4RDIA 2HFZA 4YLGA 4LIPD 3IGNA 2VB6A 3OM8A 4ECSA 5T8KA 3FLAA 4WW0A 3FBGA 5DZSA 4KMMA 1NVWQ 3T12A 3VAFA 2W70A 1Z37A 4TSRA 4U7PB 2J7PD 1MX5A 4OGGA 2PZ8A 4ED9A 3R9LA 2I4IA 2RHOA 3R5AA 5J2PB 2BPOA 4JC8A 3AU8A 1ZBDA 4WADA 2QQEA 3IMLA 4JFAA 2QMZA 4RTOA 2Q07A 4PYMA 4P3OA 5FOQA 5F3TA 3S2YA 2W93A 3GFSA 1XC9A 4X4QA 4JN6B 3AFHA 3GT4A 2W2PA 1N5JA 1F4PA 5LIPA 2EC5A 1PJAA 1PL6A 1JHOA 1PHRA 3U16A 4TKUA 1YH3A 4NPAA 4QXOA 3TQHA 2FJDB 3RUFA 2DH7A 3E70C 4TM7A 5TEVA 1F9AA 3QE0A 5GV8A 4RFLA 4DPLA 2A9FA 1TLFA 1VQ9S 4DVGA 2RS2A 3JYTB 4DQRA 1S5ZA 5JS8A 4NU6A 1TUWA 5IV3A 1YTLA 5CLGA 1Y63A 4MVXA 5DG7A 4YDSA 3VA7A 5H1YA 3D6FB 1GARA 1QGDA 3CJ8A 2NO0A 3OQOA 3AR5A 1RZ3A 1VQSA 4HJRA 1BX0A 1P45A 2HX1A 3TYTA 3IKVA 3FVVA 4XO0A 2XZDA 2VPXB 1RJ9B 2OCBA 4CIXA 1EINA 2QL9A 4C4OA 4IFBA 5DYYA 1KPIA 1HO3A 3D3EA 2G0JA 4MLDA 1T2CA 2EJVA 4TXHA 4BO3A 1EPUA 2YJ6A 5JMWA 1SA0B 1CQJB 1IHPA 1YUNA 3PEYA 2VYQA 4Q34A 4DQKA 4PYAA 1RJWA 5K8FA 2FQQA 3JTMA 4O4GA 4IZOA 2J0SD 1KMIY 4R31A 4AD6A 2Q5JA 4CKBB 4YFUA 2ZROA 4BDTA 3QUSA 3WHLA 1Q1KA 2GIQA 4Y3UA 3IOMA 3TKAA 3SBOA 5GONA 4DR1B 2CBGA 2IF0A 1JXOA 2CDCA 3RU2A 1NWHA 4I2QB 2EGTA 4WXWA 3SF0A 4FXPA 2PH3A 5LD2C 5ITSA 3LUKA 3QITA 2IHKA 4GL2A 4HUQB 1PN3A 5GJWC 4BGUA 1XZFA 2QJ3A 1VE9A 3UG6A 4W4TA 3PI6A 1E7WA 4RMNA 5DLEA 2GBLA 3DMYA 4XB2A 1YKGA 2ZM5A 2DT9A 4PHCA 1FMCA 4Z37A 4JZYA 4OUDB 4MCIA 4AKEA 2C97A 4JC0A 4P4UA 5DJ5A 5CT8A 3HJTA 4LG1A 3IO5A 3DDIA 3CLSD 3UGQA 3FFAA 4Y2XA 3O74A 5J1TB 1LXNA 4ZAZA 4WOPA 2J3HA 3TOXA 5KYWA 2XTAA 2F55A 2RBEA 2WIFA 1OIXA 2ISQA 3A1YG 3QXCA 4UOFA 4WIIA 4ANCA 1HQUB 2WZCA 3CEMA 3KLBA 1XB2A 4L22A 2KT3A 3N8IA 4MCJA 4TKTA 2KYRA 2ROPA 4G5YA 5M2UA 5F8JA 3AKDA 3M6XA 1KZHA 2QV6A 4DV7B 3GG2A 2AX3A 1T3SA 4M0PA 5ALEA 1PSWA 4NBNA 2WWVD 4PC3A 4BNTA 2YQ1A 5AESA 1WZEA 4F6CA 3C16A 4JI5F 4XKJA 3G2NA 1UOEA 2IVFA 3KYCA 4DQ0A 1U28C 3RW7A 4RW7B 3O7MA 4OZ5A 2WYUA 4ONEA 2BEVA 4FGKA 1Z5NA 1IKWA 4EBFA 3CNOA 1MT0A 1G60A 1WCWA 1GADO 5JECA 2FKAA 1ONNA 3R09A 5D6GA 1RABA 3WJAA 1N34J 3UQZA 2I67A 5C1BA 4MRRA 4D1YA 1M2VA 2AI1A 4KQGA 4OLJA 2AZXA 2V5UA 1BWVA 1SUBA 4RSRA 4EQ6B 3KZVA 2PYIA 4EMSA 4OYWA 3HSDA 2QYTA 3TZKA 4TWIA 1BRMA 1GPNA 2H9AA 5DOZA 1IBSA 4RY9A 4WX2B 3CT6A 1WDMA 1D9FA 1ZXBA 1TE2A 5AM4A 4YV1A 4H18A 3VVBA 3WL7A 1QTNA 1T2DA 3SCKE 4I0WB 4C05A 4FJ2A 4OYOA 4PHGA 3G0HA 2V2KA 4R5HA 4EVQA 1SBNE 1RPJA 2QZPA 1KRXA 3ZK7A 1UZUA 3O73A 3KL2A 1X9IA 2PT7A 1VLYA 5ICGA 1S02A 5A7GA 5FQOA 2GMWA 4MRMA 5GONB 2CADA 3MFIA 4IQMA 5A9SA 3QUBA 2OI2A 3LUPA 5HK9A 5A4FS 1UJ2A 3VTZA 3TZWA 4P7TA 4GRSA 1XP8A 1KZ4A 4U9HS 1JLFB 2VQFF 4AF6A 5CFPA 2IY9A 4OKSA 1G20E 5LBTA 3RSHA 1IG0A 5IC6A 3H98A 1SC6A 3UG7A 4MIKA 1T8SA 4NI5A 1Z6YA 2XGQA 4LDAA 4DMGA 5FYQA 4PBSA 3QU7A 1Y9DA 3MCZA 1S6QA 5TF4A 2D13A 1JKIA 1CE8A 2ZTSA 2Y2UA 4RAOA 2VJBA 5BJRA 1BQNB 2VYND 3VWSA 4BV3A 3A6HA 1PFVA 3UAVA 2BTQA 3C3EA 3H17A 1P1LA 3C6TB 5J5AA 4C9BA 1PHPA 2UDPA 1U6BA 4DR1J 2QRKA 1B76A 2I6XA 5C4MA 3KK1A 1W7AA 1XAIA 4I50B 4M94A 4XSHA 2XJ4A 4BBJA 3ZQ4A 3IXLA 4HHUA 4KHZA 3D0OA 2BGLA 2OTLS 1GUDA 3BGSA 4ZKDA 1KVJA 3R7NA 1CJCA 4EPVA 3DR5A 5EE9A 1IC6A 2UXCF 4A9AA 2D6FA 2YS7A 2HIGA 3G2PA 3C16B 1RWKB 3C24A 4NLQA 3KYCB 3ROTA 2CMDA 3SX4A 4GC7A 5JI2E 1XZPA 1O4WA 4BC0A 5AM2A 3GRCA 3A8KA 4HB3A 3MPWA 1L3IA 3EWAA 1C41A 3I9LA 4AZ0A 3FWKA 3QOXA 4Y2YA 2E4YA 2UKDA 2FFBA 4FS1A 3U7QB 3ECAA 1DEOA 4DHEA 4AAYA 2XNDD 2V7PA 3DAYA 1XAJA 1JE0A 4CCAA 4MKZA 1P1FA 1U7UA 3BGOP 4MQFA 3UZUA 1T9WA 2RF2B 4K9LA 1V3RA 1QTNB 1GK8A 1HH4A 5E2IA 3SO4A 4DV7J 1GNRA 3QE4A 4WY5A 1G7RA 1W5TA 3OSPA 4N54A 3N6LA 3ENKA 3NIFB 3RG6A 1J5PA 2BVNA 4ZVPA 3ROXA 3GR1A 1LK0A 1QB8A 3HYNA 1KO8A 3GFHA 3PEEA 1MG7A 1RHKA 5KDLA 4DG1B 4ZQFA 4O2BF 1W8DA 2Q6KA 2NR0A 1IFXA 3DZJA 1R64A 3AXKA 3VAMA 4C89A 2I66A 2OV8A 2VPIA 1YBMA 4HGQA 3EQZA 2KVIA 4TTQA 3GD7A 2RB7A 2QL8A 1OXTA 2HR1A 3DR3A 3RC9A 1EESA 2Q1WA 1U02A 1YL6A 4PZYA 1RWNA 2BL4A 2QS9A 2QPTA 2BR4A 4RW8A 2UVDA 4XGNA 4YJ3A 4AL4A 1LVUA 2CXNA 2SICE 5FH9A 4X93A 4XZ3A 1RG9A 3NR2A 2YXNA 1U2FA 4TL7A 3ZWOA 4OJGA 1S1UA 2QUKA 2IK8A 4UUPA 1JJVA 4JUBA 2FLKA 4XIUA 4AVYA 4LJMA 1GO2A 1E69A 3E7FA 4Z0HO 3OPXA 4NY1A 4RE5A 2QWXA 5JYDA 4K6CA 3R7NB 5FL7D 2FFHA 4JI2F 4QELA 1ZUD1 1FFBA 4AQ7A 2R65A 1NFRA 3M2VB 3LT1A 3P9KA 1RSCA 1GA4A 4NU8X 3WWCA 2FSFA 3KG2A 1PQPA 3D8NA 1C80A 3GEMA 4BNIA 1HWLA 3OZAA 2F8MA 4GXNA 1Z6TA 2BJVA 3X1ZA 5KOIA 4AZ0B 5MGBA 4DCJA 1WNTA 2P9CA 1SJRA 1XMIA 2CVIA 1XRPA 2WJIA 4WESA 4FQ5A 2SECE 2WF5A 1TW2A 2NZYA 1RI7A 3H8WA 4DQIA 2Q5EA 2ZR9A 3P8ZA 4UHCA 4FWIB 4PHTA 2Y0CA 1QQTA 4C0LA 3O4GA 4MQFB 4Q1BA 3U6BA 2ZIZA 2ALYB 2M52A 2DNQA 1M6VA 4NDAA 2XR1A 3HM2A 4RWXA 5KFVA 1ZXLA 1R0CB 4QTUB 4LZZA 4S0ZA 7REQA 5CD1A 3RSLA 3AJ2A 5TQVA 2IV7A 5AVYA 3RRBA 1KJNA 3O26A 2D7DA 4UMEA 2E48A 4Q3OA 1W88B 1XDZA 5HLFA 2RRBA 2IJFA 1GG8A 3Q41A 3LKBA 1N5VA 2I9KA 1EFCA 1BEEA 3DM2A 2JAXA 1XR5A 5K3BA 3WWEA 3EVTA 1VSQA 2LQBA 1YDFA 4FT4A 4M9XA 4P73A 1T03B 2PFFB 4TVSA 1JFFA 2LVWA 4JV0A 2OGWA 4UD6A 2ASJA 1RCFA 1YZFA 3NKLA 4IX9A 1B6TA 1O97C 2WVHA 2O3DA 4BGDA 3GP5A 3T1YB 2XMDA 1CG2A 1ZK1A 3BH6A 1TFRA 3PF9A 3TDMA 4RW8B 1ZZNA 3RE1A 2B4VA 1QAJA 1E9AA 4YJ3B 3UK2A 3OWHA 3MSXA 1JXLA 4Y6SA 1GUYA 3D0QA 4YY3J 3IOEA 4WOCA 5KFSA 3HBMA 2ACVA 3BJMA 1E58A 4MI6A 2A5FA 3GRVA 3MXHP 1C9YA 5D7BA 4BMDA 4H7EA 4M5DA 2OD4A 1C4CA 5F9LA 3UHPA 1KA9H 1UWAA 5KYGA 3L93A 4DQSA 3GCDA 2CNDA 3NHWA 2CB0A 4K0KF 3A13A 3QI7A 2DR9A 1BDBA 4M9CA 1GV1A 4OGKA 4F50A 1UAGA 4LHEA 3NOGA 1IB8A 1CY0A 3UHJA 2R5FA 2VS1A 5LP1A 4IH1A 4BLRA 4XEUA 4ZYWA 1JLLA 1AYEA 1FBNA 1YJBA 4TMTA 2C88A 1ORTA 3EWSA 3RVMA 4LF9F 2V7TA 3HHKA 4J1NA 3DT8A 3O3OB 3GP3A 1DURA 1R8JA 4UJ3A 1YQQA 1JR3D 1HL3A 4Q3NA 4U2KA 3HB1A 5AW3A 4LIWA 3PXEA 1GZUA 5AVOA 2DPJA 5LZ7A 1OQ6A 1YA6A 1OKKD 2KXHA 3GA0A 2H6EA 2B83A 4DLPA 3SSMA 3GDOA 3U3OA 2R11A 1GX6A 2RC6A 1P4GA 5IYZF 2TMKA 4IG3B 1ARZA 2WV9A 4D98A 2HU5A 4MCHA 1Z4MA 3T15A 1TL7A 3G8QA 3HCXA 2OFPA 3S1SA 1GU0A 2HLDA 5JNLA 2PKXA 3A7EA 4F72A 4E7OA 3ZGXA 2CUZA 5CLJA 2HCTA 1ILWA 2VAMA 3UK0A 3ZLBA 2C0QA 1KERA 1X1DA 2VNAA 3M8RA 2FGKA 4U7FA 4JJ7A 2Q5IA 3HLUA 2DPMA 2CQ1A 4D45A 1M10A 2BWJA 4OQYA 4QREA 3K9WA 2DKOA 1GRCA 2DVIA 5HLFB 3CFYA 1DQSA 2QRJA 1WXDA 3IR7B 4ZO6A 4EYKA 1N4LA 1U4NA 2XKJE 4DV1J 3TIVA 1U81A 5KQSA 3DFMA 3LZCA 1RQ0A 1UKUA 2OKQA 1CUHA 2D4AA 3S2FA 4QHYA 4F84A 1OWLA 3FNHA 4JVOA 3MMSA 2QI9F 2ONZA 3V8QA 3QYJA 2RONA 1X0XA 2VFAA 3KTFA 3BH6B 2IJGX 3D3KA 2VQ3A 3T5HA 1AMNA 3R0IA 3FF4A 3COVA 1I2BA 2VCYA 5T4BA 3LCJA 4FXOA 5WRFA 1ZJYA 3FBEA 4OHZA 1VISA 4WCEQ 3C7TA 2TMDA 3ZWMA 3H0EA 4M5DB 4MR9B 1T1GA 3RUHA 3W2TA 3W3AA 3I31A 4DV6B 4Z0PA 4NXMC 5BR8B 4IH7A 2E6KA 3FY4A 1SXPA 4L6AA 3UV6A 2R6HA 3COWA 5FLXD 3ZCRA 3DC7A 2I3AA 1RJGA 3EGVA 3LW7A 1QTRA 4ZCLA 3LVBA 2F3RA 4RZ2A 1QS0A 1U3DA 4ZZ1A 2MYFA 2Q4BA 3CE9A 3WGTA 1TEZA 4KEAA 1ZD2P 2N7CA 4HN9A 5IAEA 3VX4A 1FKOB 2R7XA 3DWEX 2G2OA 4F93B 1SKUA 5ESRA 2A1TR 3LBAA 2XWBF 2XH8A 4ED7A 1DZ3A 4DX8H 1I36A 1TQ2A 3ODGA 4LJ5A 5IAJA 4BNZA 5KG4A 2BFMA 5IQQA 1BQXA 2ZE8A 4R9SA 4INJA 1M8JA 2RU3A 4CI0B 4MLPA 1S1TB 5CCEA 3GFZA 4RPFA 5KCZA 1MQ9A 1J8YF 3UPTA 1PVOA 2WHOA 3HRIA 2KB0A 4OZNA 1KTVA 3EH2A 1L4BA 2I4NA 1TAHA 2XYGB 1ZINA 3UMJA 1NMSA 1UKAA 3MJCA 3UDEA 4DGQA 6ADHA 5D0RA 4BWMA 2ZJRQ 3UQYS 3QEMB 5FWYA 4MVCA 3AVUA 1HWJA 3H8JA 3U7JA 4R2MA 4HKQA 4P7GA 1X8KA 1EFPA 2KM8C 5EKSA 1L5VA 1KQ3A 3F9RA 1Z8HA 9ATCA 3MYYA 4Q1CA 4YCBA 2LLZA 3OFNA 4OJNA 4ND8A 3RRHA 4RCVA 1UK6A 5FORA 3KVVA 2QLJA 1E3LA 2RT3A 3FEZA 1KOJA 3DCNA 3IJRA 2OECA 4MH8A 1BH6A 4UVGA 2BQ3A 3RVSA 5EUBA 3RVLA 4BWGA 2YNHB 16PKA 1Y1SA 2HWWA 1I2AA 2IBOA 3VU0A 2YKQA 3OTCA 4OHFA 3O92A 5IK2A 5H9EJ 4I1OA 2G9UA 2FWIA 1L7VC 3NOXA 2FPSA 2W2LA 2AMVA 1VGQA 3L09A 2X3UA 3Q8KA 4NHEA 1YMUA 4ON9A 2I1LA 2Z2ZA 3L92A 1HURA 2IEBA 1ZYUA 4XVQA 1WKJA 1VMAA 3MF5A 4DSTA 1RJJA 3UM9A 1BROA 1RYFA 3PHHA 1C4XA 2XX3A 1MLDA 2QSJA 1XXHA 1MD9A 2E1MC 1WF1A 3I6MA 4ZS6A 1VG8A 2FU5C 2CYAA 1DQZA 4R1TA 4YS2A 2DHAA 2OCYC 4ZPDA 3OT1A 2IS6A 4BIIA 1TZ2A 4LREA 2Z8XA 1T94A 1AQIA 2GYVA 3VAYA 3H2UB 3T0FA 2MMGA 3D8RA 2IQ5A 3WGJA 4Q9LA 1FUIA 3OIDA 1SIUA 2OV6A 1EAYC 3P9QA 2JS7A 2YV3A 3QUTA 1DADA 3J7AC 3SQGB 4CR6A 2LKDA 4FDFA 4IP0A 2R751 4CMCA 2AHOA 3W6PA 2R4QA 3THWA 4PQEA 5DDIP 2VK1A 1DOHA 1G21B 4RTQA 1EP2B 4EUVA 4QTTB 1P5RA 3ZNPA 3KOUA 2VPWB 2QUAA 4GL4A 1TKTB 2RGEA 4WKNA 4LXHA 1H2FA 2HFVA 1JJIA 1YASA 2B21A 2OAUA 1W26A 5JDCC 4ZJLA 1RKJA 3SIWA 4RIGA 3REQA 3WADA 4M46A 4U6QA 4DV0F 4P71A 2WWGA 4A10A 1ODJA 3GMIA 5HNKA 1EP1B 1QH1B 2H1OA 2PMBA 1IUKA 2R60A 1UW4A 4J0KA 9ATCB 2WHPB 1JWAB 2DPIA 3JSRA 4R8UB 3ZTYA 3NI2A 3D28A 3OTBA 3NBUA 3B85A 4BLOA 5JSYA 2QLJB 1BX1A 1TQ8A 3H0KA 4Y2MA 3B13B 2EFOA 1JJFA 1Z38A 2Q5LA 4Q05A 2JJ2A 4ZAWA 3SKYA 2MYTA 2VRCD 4YHHC 1Y4UA 4KQCA 4W7SA 3IA0A 4NYZA 3H86A 4TVAB 2C4VA 2EXUA 5KNDD 1G3QA 2XB6A 2PD4A 5KHOC 3DB2A 4YYEA 2AZTA 3OF5A 2H3HA 5I9IA 2BMJA 3BK2A 5KT4A 2HIQA 4DDMA 1HLWA 1O93A 2AYBA 4BE4A 4YMHA 4L4SA 3J81Y 3NQ41 4YRCA 4LHVA 4Q93A 3S1TA 1VYVA 3G6XA 2AOWA 3V1MA 1TIPA 4OHRA 2BCJQ 1BKYA 5CM8B 1S97A 2G8NA 4MV4A 3NBXX 3LD9A 5BMVB 2HRQA 3PXGA 3C5EA 3UI3A 3VJKA 4B46A 2J5RA 1K66A 3SGLA 3G2KA 2ZR7A 1SQ6A 3T9BA 1NSAA 3I0SA 4B6QA 2HNZA 4L9SA 2EL9A 1WMFA 4EF6A 5A2QA 5JAOA 4USUA 1WA5A 2AXEA 1V0JA 1NKSA 2ZBQA 4FC7A 3MGBA 4NWIA 2XOKA 3U49A 4QO7A 4JL5A 4NBRA 2QM0A 3TQRA 3JSYA 4W9RA 4GAEA 4IF6A 4BNJA 3TUPA 2D5BA 2Y3YA 5K0GA 4ECVA 2QU7A 4KN5A 4XUEA 1ZKDA 3H99A 4DU7A 1UKYA 1ZOOA 2X13A 3HHLC 2OOKA 4Q1EA 5JRZA 2LFVA 1SZDA 2Q2NA 4P74A 3TSOA 2A84A 4G25A 1VRCA 4ILRA 2HXSA 3LBNA 4YGXB 3CT4A 3RHTA 3T34A 2HF8A 2PQ0A 5B0EA 3EXYA 2YNFA 1P4EC 1KFBB 1O08A 3ZWVA 2BKOA 2OG1A 4F4IA 2AEMA 1BU5A 4ZC8A 4DA0A 1NQXA 3REQB 1FKPA 2WWTA 3TAQA 3W2VA 1DAFA 2C3UA 1Y7LA 2WB4A 4G63A 4BB6A 1QB7A 2N3ZA 1XCOA 1RK8A 2YDYA 4IV5A 1ONSA 2IHVA 3UJ3X 4NBVA 4DV4B 2ZM6F 3DYAB 5GMEA 4IVQA 5LJ5Y 3EIXA 4QUAA 3NIBA 1KYVA 1PFUA 1ZD3A 3HJBA 5A1TA 1JSRA 2R8EA 2VFVA 4RW6B 3VF0B 3B89A 2K7ZA 3AQIA 3GUCA 4TQGA 3ISVA 1GX5A 5E7OB 2R8YA 2CLEB 4BLUA 4N7TA 2VK8A 3DBRA 1JLAA 2R8OA 3H5XA 3BGLA 1MX9A 1JAIA 3KNGA 1Y8CA 2F9FA 1TUGA 5IM4F 2A2CA 4IH6A 2C2HA 5ETPA 1XMQB 4X5OA 3LY9A 5T5QA 4BVKA 2LDBA 1Q5YA 3LUCA 4MW7A 1U0LA 3DDSA 4KO3S 2IWHA 1QOQB 2OPQB 5C8DA 1L2TA 1SG0A 4C3UA 3AEKA 2HQSA 1GHTA 1VQOS 2DY1A 4UNPA 4Z7OB 4MW5A 1CUCA 3KOOA 3I4LA 2REQB 4A6DA 3DU6A 1TEVA 1X7XB 1BHSA 1NW9B 1C7QA 4IL5A 1NPYA 1L5QA 2A67A 3L2OB 3PGA1 5SY4A 2EFYA 4BO5A 5I7UA 3A11A 1HNXC 1T2FA 1T2EA 1KBQA 4NBKA 2Q4DA 1RZRD 2P8SA 3DJYA 3JAMD 2BKEA 4DLYA 1MHTA 3TIFA 1FTQA 1E61A 4IWNA 2D1YA 3PXUA 2IITA 5LSAA 5FT9A 4YMUA 2V4MA 3E35A 3B78A 1CRWG 3MM6B 3N9IA 3GJ3A 1JJBA 2C4KA 3EY9A 1SQ0A 4P3PA 1B0ZA 3WLPA 1EJBA 1T1SA 3CF5Q 4UCWA 1APBA 3I32A 3SXLA 3GIRA 5I8ZA 4RVHA 4MV1A 3T19A 3DVAA 2ZIWB 2XUGA 2XIQA 4AZ3A 4B2LA 4ITRC 2MINB 5AM1A 2ONKA 5A4IS 4PLWA 2FZ5A 4RULA 2V8PA 2YKPA 1BC5A 3P0IA 4LF5J 5KOYA 1FVSA 1H2WA 3B7GA 4W5WA 2V96A 5DYIA 2G5CA 2AR7A 1ZEJA 3M8ZA 1GFWA 4YIHA 2F1OA 2QTVB 2CYYA 1FKPB 2ZJ5A 1GQ2A 2JHEA 2G88A 2BLLA 2BEKA 5SV2A 1CIJA 1P6UA 2CQ3A 4PPGA 1MORA 6ABPA 3NT2A 1FFXA 3FTEA 4YUWA 1YBFA 1JG2A 3C8HA 2JHCA 1VC5A 3SZ2A 3LK6A 4AMVA 3JYNA 2QA1A 4KWIA 3PPWA 4ICIA 2GD1O 1E4EA 4QWEA 1TZJA 3NGUA 2ID7A 4IUYA 1A5SB 4ZVRA 4N6OA 1R7RA 1HNZJ 4MYRA 1H8EA 2DFKB 3FFBA 2WDZA 5DK6A 1JLAB 2N75A 3HBAA 3QPAA 2WD9A 3ASZA 2F8EX 4EMBA 3DC2A 3TZLA 1F8FA 4DBZA 4B3IA 1OZGA 3F3SA 4I08A 2L2QA 3KWJA 3PBKA 1KJYA 1U2RA 2NZ2A 1XFDA 1CS0A 4G5SA 1E79A 5DNEA 1PF7E 1W8IA 3JARA 5B6IA 5JPDA 4CDIA 4FU0A 4DSIA 3AB3A 3KLEA 2ZRMA 2GJ4A 1H65A 2OAGA 4Z3OA 1A95A 4O33A 4GKJC 3GCXP 5LUBA 1EUCB 3BB1A 4D0NA 4B3RB 2VRWA 4DV4J 5JZMA 1R00A 4E70A 3AOBA 3E5NA 3CU5A 1KKHA 1DEAA 1SV5A 2CB9A 5FPTA 2FX5A 2C54A 2NAFA 3IEUA 5CB6A 5C53B 1EVJA 3IO1A 1AY0A 1H22A 2FWMX 3DZ8A 3IVGA 4M3NA 5GP1A 4XWOA 1C3VA 3EZNA 4C8MA 5JRDS 2BFFA 4MPTA 4KQIA 5BPHA 3AP2A 3JRNA 1WV0A 1RKXA 2IPXA 1XX6A 5KOXA 4HMPA 1E3SA 4P52A 3V7NA 1CUFA 3MW8A 5I45A 5KG0A 5DJBA 1WM1A 1RM4A 1YR8A 2WHXA 4PWYA 2HXYA 4TV8F 4L08A 3GZ7A 1EX9A 1C7RA 1L7NA 5JNTA 1P9RA 3Q23A 5K0FA 2BSAA 4XPEA 1HUQA 2A0UA 3ESDA 4D7AA 4E22A 2F3PA 2FH5B 3AETA 4GM1A 4R1UA 2MXYA 2B30A 2CQ4A 4KR7A 4JLPA 4HYEA 3GLGB 2POQX 5ALRA 4PVDA 3P9SA 4L95C 2IT1A 3WGIA 2XGMA 3BWVA 1TQHA 1S76D 3LSYA 4NA3A 1TQDA 5KKAA 3MS4A 2YKMB 3UWPA 5KTSA 2HMAA 1QIKA 1CC8A 1BMQA 4JXJA 2J7KA 4B3TJ 3KQUA 3D4JA 3CDUA 3KG4A 3O2IA 4J4BA 5CD4A 4UUBA 3L0DA 1YJ8A 1Q0PA 3AY6A 2IHUA 3I3OA 4H6VA 5EKXA 4MWBA 3OFFA 1W34A 3OTIA 1UPUA 2VF3A 4R01A 2NREA 4WFNQ 1JXVA 2WIBA 3UAYA 1RWXA 2VPYB 4ZVRB 2Y1GA 3RBXA 4DX7A 3NGLA 3E9EA 4A1OA 2HK3A 4Y6IA 2HHHB 5AOAA 5ANRB 1Z5UA 4KJIA 2LCIA 3TVZA 5K8LA 1Y0BA 1KQKA 4KGZB 3HFJA 3FW1A 1XNQC 3WL6A 1D2HA 3UMYA 1ABEA 4GPZA 3RSFA 2ECPA 1V7PC 4WWHA 3E01A 3MAAB 4FFRA 4O8ZA 4HPVA 4CCSA 4WNAB 4BFTA 1SKMA 3GQBB 1MDBA 2G9QA 4PZDA 1M5UA 3OZWA 4B85A 2P3SA 3KLEB 3IOBA 3RIXA 3TZBA 4E94A 3W62A 2GZMA 3AINA 4HGNA 1H1LA 3MSCA 2IUSA 4RVUA 5EPEA 4NZ0A 4LWZA 5DI3A 3GLHA 2BCGY 4RVFA 4CG3A 3KCNA 2VF4X 1JDJA 3R2JA 3ICVA 1ZPDA 1ENYA 4AO7A 3ZWPA 4OX8A 4FDUA 3TOQA 4JMPA 2ZVJA 4ESHA 3NHSA 4Q2MA 2BOAA 2DWCA 3VR3A 3EXIB 3TJMA 4KGMA 2BFFB 4HDKA 2OM2A 2H3EA 3OKPA 2XNRA 1PR5A 3M5DA 3PDIA 2RI1A 2MTBA 1KVIA 1RXWA 4FS3A 4EDFA 2G0AA 4YMIA 3DXSX 2BZ2A 4L3OA 4S04A 4LJ4A 1GAXA 1UAAA 2MGZA 1KC8T 1VE1A 4M0LA 3JQKA 3L0PA 2D8AA 3WO0A 4QGSA 2XTJP 2BHRA 3OEED 4KNWA 4A4JA 4DN9A 4CTAB 2KB2A 4FN5A 2ZT6A 1NVVR 1X4FA 4DIBA 1Y3FE 1TD9A 5LP6F 1FDIA 4BMPB 4CMIA 1ULAA 5A5FA 4OYMA 4KGKA 2VFTA 2I7VA 1VP9A 2ZSKA 5L3QA 4DZRA 2IIQA 2GBLC 2KRBA 2GCPA 2IXFA 1E5DA 3DEHA 3CC7S 4JYAF 3RH0A 2N4DA 4H31A 4WE1A 3RHFA 3GDHA 4EJ0A 3TXAA 4ANEA 5I8WA 2IMOA 1QF6A 2VVTA 1I51A 4O4JB 4N6GA 5HF9A 1I1NA 4F3MA 5EJFA 3DZBA 3E3AA 5ELMA 3FFXA 5L9NA 1CJKB 1BNCA 2R00A 3DDWA 3U4MA 2ZBPA 1Q12A 2AF6A 2AMCB 4C8LA 1K4KA 3I9ZA 4LFBF 1THTA 4WOKA 3OOJA 2NTJA 5JYCA 3HVWA 1QAOA 1ZD4A 2HHXA 1WCXA 4K46A 5A9TA 4UPEA 3RRKA 2ZEJA 3SHTA 3KO8A 4ZPJA 4RM2A 2ZRIA 3U61B 3NTUA 1EXDA 2CCGA 1F12A 5I7SA 3R5SA 4LJ8A 1ZKMA 3ORQA 5DH9A 4Q4HB 2VPZB 3C16C 1VXOA 4OLAA 5GAGI 2VBWA 2OO7A 1GYRA 2N46A 5AI0A 1OD6A 5FXMA 4BN4A 1P75A 4F45A 1CUUA 1EDEA 3LGNA 3OA2A 1NDCA 2E9ZA 3VYRB 2ZQ5A 2OPLA 3ZU6A 2EFJA 3K9CA 1GUAA 2CPYA 5ALTA 1Q0NA 2R2TA 4QG7A 1JEEA 2Q5HA 5DI3B 1HW8A 2LYVA 3WFJA 4W8GA 5DXJA 4DQXA 5DETA 1J7KA 4L0DA 3KYDA 4TLRA 2VUSA 2CV1A 2HHPA 2Q3MA 5F1OA 3R6DA 3OJUA 1ZMRA 3SKVA 4PC6A 1JEYB 2HK9A 1XYYA 1EGMB 2OYCA 4RENA 2P2GA 4DC1A 1QFSA 1QBGA 4R1MA 1ZD9A 3MBKA 3IS9B 4LVNP 2PA3A 5D1NA 1IEQA 4RHCA 1GPBA 1YZUA 4L9RA 1LS6A 2ZP1A 3FQKA 1G2OA 3MUEA 2V03A 2OLWA 3P4UA 1XJWB 2MGZB 3IGVA 4JVNA 2VDMB 2H1SA 4FE3A 3NALA 4BU0A 2UXBC 4ZK6A 4IO0A 3I92A 4BCAA 3F5QA 1EHWA 4OQLA 2C5EA 1FSSA 3FCUB 3UB3A 2R0QC 1QIEA 2YICA 1TL3A 2XADA 4FEAA 5CLLA 5EAIA 3GH3A 5DTRA 1N6QA 1LZLA 4FDAA 5F2NA 1WOOA 1C14A 1RU2A 1D6NA 2W2NA 4WE1B 1WMBA 3QXXA 1NVDA 2ZYSA 3WZ0A 2CKMA 3EGZA 3QIDA 2FGJA 2QZJA 4TVOA 2W37A 4EI2A 4QGFA 3TLCA 1M67A 2OHOA 5G0UA 2ORED 3ZLJA 2V7EA 1IPEA 3LDHA 3VNVA 1NK8A 2XUQA 1UJMA 3LPAA 3SV3A 2RGCA 2CLHB 4NEGA 2EZ8A 3RU7A 2B8TA 3DRYA 1X80A 1W581 1U9JA 5EUCA 2CPIA 5BV7A 5CZXA 1JHPA 5IJ9A 5KVVA 1Y9AA 1VL0A 5FD8A 4TMYA 2MYPA 3T99A 5EX0A 1PV1A 1TKXA 1HNWF 2NZJA 3FMWA 3LZDA 1IBKF 4ZHRA 3BCRA 1G8GA 2AFHB 1AHNA 2OPBA 5K4GA 5LXTA 5BSKA 1Q1EA 5KMGB 2G4CA 1NR1A 3HXQA 1IBMF 2G9NA 3WKCA 2HDNB 4WJBA 2JVIA 3K6KA 2D9OA 5F8MA 1G3IA 4FFWA 2R5NA 1GRVA 3P2YA 2QP3A 4AF7A 4B3MC 4R0MA 4JI6F 4S0XA 1BO6A 1USVA 1RAHB 4IRMA 1N6RA 5FO0A 2QJOA 5HK4A 3AM5A 5J2PA 1FYWA 3CW9A 4ZJQA 1KK3A 3WKBA 2H1WA 3IKJA 5DNWA 2FPUA 4OKNA 3BM7A 4R8KA 4RNMA 1NWCA 1UC5B 5JBNA 5JS7A 2ZDGA 1FWKA 4H0CA 4MVJF 3C6QA 5J47A 3IP9A 2FHJD 2GZAA 3CRW1 2V7VA 2ESRA 5REQB 2QV0A 4JGGA 3FBCA 3TTXA 1NRIA 2IYTA 3PHTA 5AVKA 2WF9A 3P4UB 3D6VA 3MTDA 2FW0A 4JI1F 4MB6A 1E6KA 3WY9A 3HKCB 3ZK9A 2R7NA 1O5IA 3JYTA 1FE8A 1M7BA 1FVQA 3V4RA 1UBKS 4UMFA 3IKMB 4KAJA 3UX2A 4P75A 2HCBA 1A7GE 3VV2A 5CFOA 2HU8A 3LX4A 1W7WA 1U5CA 3D6FA 4LWQA 4YP5A 1V4NA 2HK2A 4JT4A 3PA8A 4OYBA 2OUIA 5JAPA 2YFQA 1QHFA 1DJOA 1PWHA 3CVWA 1S6YA 2ADCA 2OMEA 1RM3A 3CD0A 1XN9A 3PKYA 1RJ9A 1A9ZA 2EZUA 4KZKA 3T1YC 4KQKA 4L72B 5B08A 2X7JA 3IAS9 1DLOB 3MR7A 4XDDA 3F7NA 3VR5H 3ZJTA 3AUJB 4R0VA 3BWMA 1VI5A 1WORA 2FJEB 2VDNB 1SA0A 1CQJA 3JB9k 1OYVA 2NP6A 1D1QA 4WV3A 4Y2HA 5IXYA 1H2AS 1HFKA 5CT9A 4C22A 4E3ZA 5C0OE 2HFKA 4CKBA 1MA0A 2FXVA 3EEOA 3WFZA 1S79A 1U0RA 1TKXB 4XWWA 5F1YA 4I2QA 2ZH4A 4FBGA 4R68A 1XQ1A 4TROA 3LFUA 3AFGA 5DSXA 1UEVA 1FBTA 3M7IA 3K2QA 4I1RA 2MSLA 4PV7A 2QG4A 4HNAB 4MITA 3L8GA 3F6CA 2W2MA 4HLCA 4UPDA 2L17A 2DTEA 3VR4H 4M1WA 3U5TA 4LXYA 4OUDA 3IPRA 3E8OA 4TYPA 2BHSA 4RBVA 1VJ1A 1VYUA 1SVOA 5D0GA 4K6OA 4MS4B 1X2EA 4JOQA 1K97A 1NZDA 3GRZA 4XD7A 1M6HA 4H4DA 1N34B 2CL6X 1GNVA 4QLAA 4JQSA 2F5GA 1FK8A 5EWLA 3GLQA 3R5JB 4CNYA 1HQUA 4P7KA 4J3NA 4EMDA 5IH3A 4XLZA 3ETOA 3KPJA 3ZWQA 1EFVA 5IARA 4JV1A 1X1RA 3UJ8A 4KIAA 1UVNA 3FKSD 1OBFO 3EVDA 5KI6A 3VC1A 4LOKA 3ISTA 5ICFA 3E18A 3MM8B 3UNYA 5ALOA 4RW7A 2Q9BA 1XDBA 4G6ZA 1YRLA 3VV2B 2YYAA 3MS2A 4H7IA 1GGEA 4HRAA 4INAA 1KHVA 3KEQA 5A06A 2IOHA 2WZBA 2O1EA 2Z43A 3KU1A 3A8TA 3LWNA 2WLSA 3D67A 4JV5F 4F4CA 1KPHA 4EQ6A 5FO1A 4TOIA 2RDJA 5HR5A 2V69A 1Y33E 2GM3A 1BFUA 1HDOA 1ORDA 2BDUA 3GLRA 2NN3C 1WZ2A 3HI4A 1LPNA 1VZ3A 1L2FA 4FEYA 3LKVA 4BZQA 4CM2A 3DLAA 1ZM3A 2VG6B 4ENVA 4I0WA 4U2BA 1A7UA 3GIKA 1KVKA 1CZKA 2BBWA 2ZOMA 1AKNA 5E4YA 4JI3J 1JJAA 2B1QA 3AZOA 3KV1A 4FGUA 4B3SC 3WOHA 1VLJA 2AC4A 5E0KB 1XCLA 4KAAA 5BR8C 1NMEA 3IMKA 4TYMA 3VV3A 1AVTA 1A8IA 3E03A 2XT0A 1NLKL 1M33A 1RM0A 2AE1A 1JLFA 4OYAA 1U3WA 3ER9A 4DLBA 5K7SA 5ALSA 4D9FA 5DLGA 1Z2NX 4DSEA 1FW6A 4JU9A 2IRWA 3OJXA 1S4FA 1GH8A 1Q44A 2DM6A 4Z0TA 1UBOS 4RS3A 3OPQA 1JU4A 3F9CA 5IW8A 3FTPA 1H69A 4Y2AA 1S9FA 3SLGA 3IDSA 2OZEA 3PRBA 1OX5A 1NBME 1YB5A 2R86A 5H02A 3BO2A 2CXHA 1BQNA 5GGYA 4UTOA 3OCUA 2VJVA 1H2YA 3E9NA 3QXHA 3TZEA 3UMMA 4JMLA 4B3XA 2CQPA 4Z5XA 2MSEB 1YK9A 4YAOA 5EWLB 4G3IA 3C6TA 3MCVA 1ZH2A 2PZMA 2A10A 3G13A 1TL7C 4GOXA 4RJVA 2JGAA 1RRVA 2IXBA 3DHVA 5SZKB 4OZ2A 1XHFA 4I50A 4GPBA 4J2OA 5KYVA 5LDGA 2X4LA 2POKA 1EFVB 4MO9A 1RC8A 2E7VA 2PSEA 3N75A 1K6XA 3I0ZA 4R2KA 3GMSA 3TBHA 3MERA 4CEHA 5BN3A 1VKZA 1JZTA 3IELA 3D54D 1GG5A 5GM1A 1RWKA 4GWGA 4LF6F 1XRBA 2AYMA 3NIDB 3IP0A 2E7ZA 2Z58A 2W48A 1E7QA 1XU7A 1CUDA 2LP4A 2YKNB 1HQEB 1OT3A 3VPGA 1R89A 3P2EA 5AXKA 2CJ9A 4EQZA 5JZOA 5A6PA 1Y9OA 2PSDA 3M83A 4U2DA 3CVUA 1M1YB 1QK4A 3WHPA 5KT2A 2ALJA 4PS0A 3U7QA 1TC2A 3RIMA 1UBJS 4W63A 1GT6A 2BJ3A 2X5KO 2UUAF 1U98A 3QAUA 3TMKA 3FWZA 3AW8A 3CJEA 4ZI7F 3M7VA 3K8QA 5H1SV 4HGPA 1CJTA 4RLEA 4AQYF 1EWVA 2Z8YA 4X66F 1OJLA 2WPDD 2ADOA 3OHBA 5FUWA 3WWZA 4F9EA 2RF2A 3LA0A 1U6KA 3PYGA 1YRHA 1EFKA 3QPVA 2CFXA 4HN4B 1EM6A 1UBEA 5AKIA 1ZM9A 1WI8A 4IF4A 3OETA 1VQMS 2X6TA 1W0JD 3NL0A 3T5MA 4C48A 4YN3B 1TKCA 2A33A 2FEKA 1KI2A 4EUNA 1XAGA 4HQOA 4DQUA 3HUUA 2UUBJ 1NMEB 3CJKB 9RUBA 3ZHQA 5EINA 2IX3A 2G09A 2Q6OA 3U2QA 2OTJS 2JLFA 3Q7EA 2VIIA 3AYZB 1V6SA 3OTEA 4GGOA 4DG1A 3OC0A 2DAPA 3UFBA 3HJNA 3JVVA 4S35A 4QYRA 4EHDA 3V1UA 3TNDA 2DH9A 1SG9A 3ZLTA 2GERA 3L8EA 4MK8A 1V3ZA 2Y8WA 3VYSB 3TRGA 1PTJA 2WTMA 4TKLA 4NZMA 2FR8C 5JC8A 5B0FA 3P2JA 3KV3O 3OZSA 1EBFA 1A5AB 5COAA 2CDQA 1TU4A 3ON5A 2PH1A 4J1QA 2IA5A 3C98A 3DNPA 5KX5B 5TARA 2JFBA 4F3QA 1FF2A 1T8TA 2J7PA 5KNBH 3CSDA 1FYFA 4LDJA 2WFAA 1G9TA 1IXRC 1OTYA 4EX6A 1A8HA 4DUPA 3ZDDA 2ZYVX 3Q2IA 3IT2A 3SFUA 3HJCA 1VLAA 4JLOA 2VDLB 4GWKA 2WJHA 1Z33A 1HBJA 3SFVA 3RSGA 2D06A 2AJ2A 4CEHB 5BN3B 1XXLA 2YN2A 1BUXA 3M2VA 4IDFA 3IUPA 1ZK0A 5CPFA 2Z58B 2ISCA 5I4KA 4TN2A 3K73O 4NCKA 1C2TA 3ER6A 1JA0A 2P9BA 121PA 1Z16A 2Q8PA 3HBNA 5HKOA 2IYXA 3KSDO 3PJXA 3LPNA 4ALZA 1UXGA 5K0NA 1KQFB 4F11A 8ADHA 3TO8A 4Z99A 3PX6A 1CJTB 4YAUA 5M2RA 5KT3A 3RW9A 4KRGA 4ODJA 1RZUA 4JL8A 3ZX4A 4RZRA 5CDGA 4QJ5A 3THVA 1A2KC 1CR6A 1T3GA 3NHBA 1N2IA 1PDVA 5HUJA 1X2BA 5T14A 3IAFA 1KWGA 1Y7HA 2Q1SA 3RVRA 3K72B 2R6ZA 4AZVA 3DFFA 1RTKA 4KAXA 4INOA 2Y05A 1R0CA 4OZ1A 4YY3B 2LDIA 1PS0A 4Y6OA 5I9NA 1RT1B 4WS9A 2ASLA 2R7VA 1FTWA 4E5NA 1FJ7A 3DKPA 4HNGA 4L5JA 2VF7A 4X3OA 4G1VA 1R0YA 1BKSB 5EFZA 4EMTA 1Z6PA 2OCPA 3MCMA 1W88A 5LA6F 1N9KA 1FXRA 1GSOA 5B7QA 3EGDB 2Q27A 4Y2KA 3LNCA 5TQ2A 3ENNA 1EJ6A 3KJIA 3MMNA 1W2WB 1T03A 5CYGA 4YJGB 3GYNA 4RPJA 1MN7A 4Q00A 1XMXA 1KEVA 3LHFA 3BXXA 4QHSA 3M1VB 4AN1A 4FQ7A 4HX9A 1OJ7A 3PWSA 1X92A 3FC9A 4KVAA 1PI3A 3DXXA 3PUYA 1BFKA 3ELUA 2I03A 2JHGA 1A9RA 3AVQA 1I6MA 1CHNA 1VIVA 1U2SA 1BD4A 2P4SA 3GJ0A 4PAGA 2JZ5A 3R40A 2AX1A 1K92A 2XGOA 5HWSA 3EM1A 2PWPA 3LX8A 1OWNA 1F5SA 4Z2AA 2UZAA 3KHUA 1E1LA 3IPYA 1YA8A 1U7TA 2PUWA 2V9PA 3H1TA 1WXIA 3X3HA 3N70A 1PT7A 3WLNA 1GRQA 2HHVA 1C2YA 4BBZA 4ERDA 3NCRA 1QGUB 2QYCA 4WKPA 1VKHA 1L9KA 2VDUE 1DNPA 5CK4A 2CUTA 3GU0A 4XASA 4ROSA 3ZFVA 3R9IA 1TU0A 1ZMOA 4YFYA 1HR0F 2XCTB 4LGMA 2NUPB 3OTQA 4O4HF 3SYNA 2X41A 1JIJA 5HTOA 2PBFA 4UHBA 5HMLA 4DV1B 3BQMB 3FTQA 4GOOD 1THMA 3M3PA 5GWXA 1UWVA 2P9JA 2PXCA 4I4IA 4HDMB 2YJ5A