2YX1A

Crystal structure of m.jannaschii trna m1g37 methyltransferase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
323
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of archaeal tRNA(m(1)G37)methyltransferase aTrm5.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Hypothetical protein MJ0883
total genus 92
structure length 323
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yx1A01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2yx1A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2yx1A03
3A25A 3GU3A 4PCLA 3P71T 4H0NA 3RODA 5BXYA 1M6EX 5EKXA 3OCJA 5F2KA 3SVZA 2YQZA 2YXDA 3OU2A 2NXEA 3KR1A 3KQQA 4R6WA 1JQEA 4C03A 2YUIA 1SVUA 3FTFA 2ZZKA 4QDKA 3R0QA 4XUCA 3KPVA 1YB2A 3LSTA 5EHIA 2AOTA 3PT9A 2I9KA 4X41A 3A26A 4RWZA 3KQSA 1M6YA 1P1BA 3AXSA 2NP7A 3C6MA 5EKUA 1Q0SA 3ER8A 3BXOA 1X1CA 2NXNA 3OU6A 3OZSA 3FPGA 1WXWA 3PX2A 3LDGA 4AZTA 3BWBA 4RTNA 4QPNA 1SKMA 4YUXA 2VP3A 3FPEA 3Q7EA 5EZQA 2C7OA 1O9HA 5HILA 5EG5A 3HCBA 5BW5A 4QQNA 3OE5A 2AR0A 5CVDA 5GM2A 1WXXA 4E33A 1XCLA 3R6TA 3VSEA 5LQCA 3GXOA 4AZSA 1FBNA 2QY6A 3KR0A 5LQNA 1L9KA 3EVCA 3FPFA 3FZGA 3A7DA 4QVKA 4OBWA 1AV6A 2QRVA 2GA9A 5DXJA 4DMGA 4QTUB 3GNLA 3DXYA 3OFKA 3BWCA 5EPEA 3SR4A 3TRKA 3UJDA 5KVAA 1NW3A 1D2GA 5HEKA 3LKZA 2EJUA 4DA4A 4OBXA 4CKBA 1N7IA 2OB2A 4HC4A 5K09A 3DH0A 1EJ6A 1T43A 3A27A 5HZMA 4BP3A 3OE4A 3DLCA 4KRGA 3TM5A 3MTEA 4PYJA 2XVAA 2ZIFA 4DF3A 1XTPA 3KQMA 3MCTA 1IM8A 3PX3A 3V8VA 3HCEA 2PX8A 3PVCA 1ZGAA 2UYCA 3P9IA 5IKMA 3KQTA 3PLAE 3EVBA 5EIFA 2O06A 2PKWA 2PGXA 1IY9A 4BLWA 1YUBA 3LKDA 2OO3A 5MHTA 1V39A 1R6AA 3LHDA 1BKYA 3BKWA 1DL5A 3PTAA 1AF7A 2PWPA 3DTNA 1EAMA 1VP3A 3B3FA 3LDFA 3NWBA 5EQJB 5E9JA 3RW9A 2BH2A 4PONA 2ZCJA 1JG1A 2Q41A 3PB3A 3BGIA 3DLIA 2FYTA 2O57A 1XXLA 2EJTA 3CBGA 3KQYA 4RVDA 4ER7A 2IIPA 3I64A 4FSXA 4GC5A 4U7PB 2QRVB 2B9EA 2CMGA 2EFJA 3P9NA 4PIPA 3R9XB 5DLYA 8MHTA 2C7QA 4OA5A 4P7FA 5C1IA 10MHA 3BT7A 3DR5A 4Y2HA 1KPIA 3HVJA 3MCZA 5EC8A 5FA8A 1JSZA 3BZBA 3I58A 3R24A 3PFHA 3FTDA 5FQNA 2R3SA 5F2NA 3K6RA 2LD4A 3Q87B 3DUWA 3D2LA 1TPYA 2HNKA 5EGSA 1PJZA 2OB1A 5K0CA 3TM4A 2K4MA 3IYLW 3TKAA 2GPYA 2NYUA 3BWYA 1F3LA 3B89A 4MQ4A 4X60A 4YUYA 3LX6A 4PYNA 2AN4A 3B5IA 3AXTA 5GP1A 3KQPA 2YTZA 1RI2A 4OQDA 3LBFA 4YUVA 1QYRA 4CTKA 3CC8A 1KPGA 5FWAA 4ER3A 4RTPA 1ORHA 1VE3A 3EMBA 3LGAA 2P3QA 2XYQA 5DRYA 9MHTA 2PLWA 3GRVA 5HIKA 2IFTA 5D1HA 1RJEA 1R18A 3ME5A 5EMJA 2FK8A 2XBMA 5FA5A 1JSXA 3LCUA 3G5LA 2QM3A 5K8VA 2V74B 4X61A 5FUBA 3NMUF 4E2ZA 4GQBA 1AQIA 2ZIEA 3H2BA 5E8RA 1ORIA 1YZ3A 3FRIA 4RSRA 5P8WA 2PXAA 5FQOA 3MB5A 4PYMA 3T0IA 5ICFA 4YMHA 3ELWA 3EGVA 3P8ZA 3R3HA 5K0JA 1UIRA 4DQ0A 4QVGA 3E7PA 2BR3A 5K05A 2NXJA 3KHKA 5ICGA 4PWYA 2IGTA 2AVDA 3EVGA 3P2EA 1RJDA 2OPBA 3M6UA 3UJ9A 5FADA 4KWCA 2C7RA 3B7PA 4CKCA 3O7WA 4YV1A 4QPPA 2JJQA 3CJQA 1DUSA 3I5UA 3B3GA 3PFGA 3S68A 3NVMB 4X63A 2PX5A 5FTWA 1QANA 2NNWB 2ZWAA 5LR6A 2XYRA 3CGGA 3BKXA 4IV0A 4R6XA 1QAOA 2GLUA 3P2KA 4PIMA 4RTOA 4YV2A 3P2IA 5CUQA 5GOZA 4XCXA 3BWMA 2NP6A 2ZIGA 1SQFA 4JXJA 1XDSA 1I9GA 1SUSA 1B42A 3GRYA 3OZTA 3GWZA 4P7GA 3TFWA 3FTEA 4UOEA 1X1DA 5K0LA 3P9CA 2CKDA 3DP7A 3O4FA 2XYVA 4IKPA 1NW7A 4PYLA 5CVUA 2P3LA 3HTXA 2IDJA 2ZZNA 3F4KA 3SGLA 1NE2A 3CJRA 2ZFUA 3VYWA 3THSA 4OX9Y 5C9ZA 4CTJA 2ZSUA 4RV9A 2PBFA 3O31A 4HG2A 4PYKA 1NT2A 4WXHA 3QV2A 4EQZA 5JUWA 1RI1A 1VL5A 3MERA 4KDRA 1BC5A 2ONYA 3G89A 3DMHA 3NW9A 1SUIA 4EKGA 4PYQA 3OZRA 3SSOA 4GOOD 5K0NA 5U4XA 4IV8A 5DX0A 3DMGA 4PYOA 3T7RA 5E1OA 1VQ1A 1XVAA 3EVFA 1JTFA 4RYLA 2N47A 3UA4A 2ONZA 4PNEA 3EVEA 3EVAA 5CVEA 5E2AA 4DCGA 3FUVA 3KQOA 2ZZMA 1RJGA 4HTFA 2EG5A 3TPZA 7MHTA 1D2HA 2GB4A 2ZWVA 3C0KA 3KR2A 4IWNA 2P41A 4G56A 4GBED 5DM4A 3P9KA 4E2WA 3PS9A 4K6MA 2P7IA 1SQGA 4AZVA 3DXXA 3DULA 2IBSA 2H1RA 1U2ZA 3VC1A 2PT6A 1XDZA 3BGDA 3M4XA 4DCMA 1I4WA 2FRXA 2ERCA 2VDUE 3EGEA 3MQ2A 5DM2A 1HNNA 1JG4A 1O54A 2PY6A 1NV8A 3HCDA 2PV0A 1F38A 1G60A 3IHTA 1PRYA 4QQKA 2BM9A 4RTLA 5FULA 3SSNA 3NDJA 2AOUB 4DKJA 2B2CA 3G8AA 2XVMA 3UZUA 2KW5A 3EMDA 1XJ5A 1KPHA 2FK7A 5DM0A 3ER9A 2G8NA 5HIMA 4FT2A 1VP9A 2UYOA 3FUTA 2HV9A 2QE6A 5JR3A 2V7EA 3ELDA 5FCDA 3E05A 3FYCA 5FHQA 4PINA 3CJTA 3NJRA 3GIWA 2P40A 2ZLBA 5EOVA 4R05A 4AZWA 5DTQA 2P7HA 2ZBPA 1VIDA 3GDHA 2AS0A 3FPHA 2AN3A 4RTJA 1R8YA 4M37A 5FHRA 2IH2A 3UJ6A 2B78A 5ICCA 3HVKA 2HWKA 5LQJA 2R6ZA 1JQ3A 1BHJA 4ATNA 4BLVA 5EEHA 2G70A 4KIFA 5LSAA 5CIYA 2ZULA 2OKCA 1G6Q1 4PYIA 5GM1A 3EPPA 3KPJA 3SXJA 4B17A 5M5BA 4EKIA 3FUXA 4FR0A 3FTCA 4E2YA 2OYRA 1ZKDA 2IH4A 4F85A 3G7UA 4ISCA 1QAQA 4RVGA 3NWEA 3KR9A 2PWYA 1RI4A 3I53A 1UFKA 5HIIA 2IDKA 4V0QA 4RTKA 3TMAA 4RTSA 3IEIA 1FP1D 3KU1A 4C4AA 1EIZA 2Y1WA 3A4TA 2VDVE 5GIPE 1XCJA 4R8SA 4YMGA 5K01A 3G8BA 4MWZA 5GIOE 4POOA 2JH8A 1WS6A 2GAFA 2ZW9A 4GEKA 4P7JA 5B1SA 1OR8A 2ZBRA 3HEMA 4WVLA 3GJYA 2IH5A 2B3TA 1P39A 3E8SA 4HRAA 5K03A 2JH9A 2VDWA 2F8LA 1INLA 3UBTA 1R00A 3QOWA 3LBYA 1N2XA 3MAGA 4FGZA 4ER5A 3GGDA 1MHTA 1JTEA 1HMYA 1WG8A 3OFJA 1G55A 3SX0A 5K0GA 5KQSA 1R74A 2UZ4A 3JWIA 3SSMA 4BY9E 4M36A 4YUWA 1NW8A 3G88A 3JWHA 3M6VA 2G1PA 1KP9A 1NW6A 1QAMA 4FSDA 5EZSA 1KR5A 4YV0A 5E2BA 1Y8CA 3HVHA 1YZHA 4QDJA 4U7TB 1X1BA 3KPUA 3NTVA 1ZGJA 1Q0TA 3EVDA 3ERCA 3NVKI 1P1CA 5DRTA 3GRUA 4EMSA 3G2PA 4M38A 5EEGA 2PT9A 5EIWA 1TW2A 4XUEA 5HIJA 4C06A 5K0FA 4NECA 2WA1A 1FJXA 5T64A 4OA8A 4GOND 5DTMA 5DSTA 4A6DA 4CWAA 3FPJA 4LECA 5CD1A 4FP9A 2WK1A 3LCVB 4PGHA 2FCAA 3DXZA 1TW3A 1NV9A 4RVFA 4BP1A 2CMHA 5DM1A 3U81A 4LG1A 2DPMA 3ORHA 2AN5A 1H1DA 1BOOA 3HCFA 2AOUA 3C3PA 5DX1A 3OPNA 4E70A 3KKZA 4HH4A 3HVIA 5DT2A 3T7SA 4E2XA 5EVJA 3WSTA 4ZTBA 2YXLA 5EHGA 3P97A 5CM2Z 3SMQA 2OBFA 1X19A 2PJDA 3GRZA 1RI3A 4EVIA 1WZNA 3MHTA 5F2OA 3UJCA 3OU7A 2H00A 3HNRA 3B3JA 4GUAA 3AY0A 1P91A 2I6GA 3L8DA 3NDIA 5E1MA 3ANXA 3C3YA 2PXCA 2P3OA 2IPXA 5E1DA 4F84A 5BW4A 3VC2A 4EK9A 1EJ0A 3EVZA 2IP2A 3SM3A 5EMKA 2JHCA 2I62A 1DCTA 2OY0A 3LL7A 3ELUA 5KS2A 1G38A 4DZRA 2PVCA 3LECA 5DXAA 1KYZA 4E30A 1JQDA 3AWIA 2VZ9A 2O07A 3ELYA 3KQWA 2BZGA 3HM2A 4L7VA 2AOTB 4MIKA 1NBHA 3FUWA 1L3IA 2FHPA 3CCFA 2JHAA 3KPYA 2Z6QA 2HMYB 5T6BA 5HFJA 1ZQ9A 2AOWA 1M0EA 2PXXA 3LPMA 3FYDA 1L1EA 3FRHA 2G72A 4HGYA 1QZZA 3MGGA 2GH1A 1L3BA 1X1AA 3BUSA 5E1BA 5K0EA 5LQUA 5LQKA 5LQRA 1EG2A 2BM8A 4HTFB 2O0LA 1Z3CA 4GF5A 4LWOA 2JG3A 5ICEA 2UYQA 3LCCA 2Z6AA 3V97A 1G8AA 1YFJA 1NBIA 1VBFA 1ZG3A 3HA5A 3TOSA 2OZVA 2BR4A 4M7RA 1VPTA 3QOXA 2A14A 2G71A 2YR0A 4RTMA 3TQSA 4E31A 1SG9A 3UJAA 4KW7A 5GWXA 5E9QA 2OXTA 2GS9A 3UJ8A 4C04A 1I1NA 3X0DA 3I9FA 3GCZA 4GOLD 1EQAA 2FPOA 5DWQA 2NXCA 3KPWA 4PGGA 1KXZA 3A7EA 1WY7A 2P1DA 3M33A 3EGIA 3GRRA 3UJ7A 3IV6A 1KIAA 5E9WA 2B25A 2WA2A 3CKKA 2YX1A 2CL5A 5CCXA 2P8JA 4FS8A 3HA7A 3REOA 3LDUA 5BP7A 4PCAA 2PX2A 5C0OE 3E23A 2CWWA 4ER0A 4XUDA 4RVHA 4X1OA 2QYOA 5K0BA 4A6EA 4OQEA 3HCAA 2ZVJA 5EMLA 2E5WA 1UWVA 3M6WA 3MTIA 4R8RA 2ESRA 5DPMA 4AX8A 1JG3A 3G2QA 3JWGA 4YUZA 2ZTHA 4E32A 2I7CA 3M6XA 5FWDA 2PSSA 1JG2A 2BR5A 3G2MA 5HOQA 1AQJA 3EEOA 4O29A 1NKVA 2HR1A 1YFLA 2ZBQA 4RTQA 3THRA 2VS1A 3AJDA 3TR6A 4C07A 4FT4A 1MJFA 5H02A 2DULA 5ERGB 1L3CA 3HP7A 5D1NA 4CXMA 2Z6UA 1FP2A 1G8SA 2HTEA 3JWJA 3KQVA 5IH3A 3BGVA 3T7TA 3GO4A 3UA3A 4BLUA 1D2CA 3TLJA 2IBTA 1O9GA 5DX8A 5KQRA 2AVNA 2EX4A 4GC9A 3C6KA 4QTTB 4AUKA 1KHHA 4C05A 2UYHA 2AOXA 3EEYA 4Z2YA 1NW5A 4KVZA 5EMMA 3CVOA 2AZTA 1KYWA 4HGZA 1ZHFA 3K0BA 5CVVA 3HA3A 4DM3A 4RTRA 5LQAA 1VLMA 1R8XA 5T67A 4F86A 4MHTA 2AOVA 2YVLA 5E8JA 3UJBA 3G5TA 1YF3A 2H11A 3RIEA 4KDCA 2JHPA 2P35A 4CKEA 5GINE 4P7KA 4LWPA 1JR4A 1RJFA 3FUUA 2O05A 4Y30A 3UFBA 4C08A 1FPQA 1RI5A 4GOMD 3UWPA 5CCBA 2PX4A 3DOUA 4KIGA 3M70A 5KYGA 2YXEA 4HSGA 1IXKA 1N7JA 4FZVA 2ORED 5CVJA 5DSXA 4ER6A 2C7PA 5DTRA 2ADMA 3DMFA 3HCCA 2Y1XA 1XDUA 3G2OA 4V0RA 5G02A 4P58A 4RX1A 3TKYA 3ID6C 4MTLA
chains in the Genus database with same CATH superfamily
4IDOA 1PL7A 3U6KA 3COJA 4MMYB 2A0FA 2PFSA 3DI6A 3LP0B 5DNAA 4Q15A 1PWHA 2FW8A 1J97A 3CDBA 3NCHA 1KVUA 1K2WA 2YHIA 1RA7A 3C15A 4AZSA 4WCFA 5DN6A 2BXJA 3ROPA 4HLUA 4ESVA 4WZAB 1IONA 4FW8A 4HACB 1QIMA 3JQ8B 3NH9A 4EJMA 1PC4A 1R4NB 3L8MA 2ODWA 3N2GA 3ZQUA 4DB4A 2R2SA 2XR1A 2PX8A 1P3Y1 3TLMA 5C2GA 1YDWA 3TVDA 3C14B 2FN3A 1TUEA 4LSLB 1S9HA 1XRLA 5JJBA 1R37A 3JQFA 3B82A 5COQA 4TL6A 4NULA 2BKXA 3TAQA 3G0CA 1PFKA 4EVSA 3R9XB 4M1TA 3AESA 1OWNA 3JQBA 3MCZA 3R24A 3CZ9A 1N5QA 3ZXYA 2WSCC 1IZYA 3PX0A 2CNOA 2D4HA 3BTUA 1O51A 4FDLA 4Z7NB 4DQPA 4Q1VA 3WBJA 3EMBA 3IH5A 3PPWA 4X65J 4CKWB 1TNDA 3SDSA 1ORIA 4BPBA 3EGVA 1GTHA 1EFCA 5F0WA 2IHR1 2OCIA 2MT9A 3RB0A 2VHUA 1N32F 3BMXA 2OHOA 3T1OA 3FZ2A 2ROPA 5C3MA 4WAUA 3NTUA 2G5TA 1PYSB 2A8YA 4Z3KA 3HV2A 2ALZA 1DTWB 2GS8A 5E7QA 2GM5A 5KHLB 1I1HA 1NATA 1RWKB 1RMTA 4KQCA 2DT9A 3P9CA 5LPNA 3SWWA 3I2YX 3FGVA 1ZYQA 1JJ7A 2D3OR 1QIDA 4BU0A 5I7FA 1TA4A 3WQBA 4UNSA 3WYNA 2IYFA 4I5DA 4EMDA 1KZYC 4F3RA 4Y3CA 4M1OA 1QRTA 1U1EA 3T99A 3V1NA 1BG6A 2MSDB 3GDFA 3KX2A 2N47A 4F9GA 4PAQA 4C2UA 1QF6A 1JLCB 2XAUA 2P41A 4G56A 3MCUA 4IMJB 4LGYA 2QTHA 3NS5A 3KTAB 5LP6B 2L2QA 3PYDA 2E9RX 3TSAA 1ZESA 2BM9A 3NEYA 5FULA 2ZBFA 4R7TA 1XZQA 3N6XA 4HDGA 2HK7A 3WB9A 3ODPA 3WRXC 1UFVA 3OT5A 3ZCVA 2ERRA 1T3ZA 4AZ3B 4JYAB 3D3QA 2KFNA 2GVZA 4UZSA 3ONVA 1JAIA 1VIXA 1DQ9A 3PUYA 1G2OA 4MUAA 2ZUWA 4B3OA 3ROQA 3WYFA 2C22A 1SXLA 3UMGA 4V0QA 4D6YA 1EWQA 4QYIA 4MMOA 2YKNA 3ZIDA 4TU9A 4N18A 4POOA 3WDSA 1IKYA 4TV9A 1XALA 3DQQA 2XG8A 1K7XB 3IR6B 4NZ0A 4DC1A 2VQ6A 2ZIXB 1C1DA 1WC5A 3HG7A 5KBYA 5DW3A 5H4GA 3Q89A 1E69A 1W36C 4DYDA 5KYXB 4BMPB 5BN5B 1UPTA 3OKCA 1COWA 4TWRA 1UFLA 4BC0A 3MD9A 5IC6B 2P2ZA 2E44A 5B1IA 4DSFA 3ABIA 1Z0SA 1XTIA 4U9IS 3HCFA 5HN0A 4EKYA 3RC2A 2QA4G 2WMOB 4JI4F 5JAQA 2B1RA 4GUAA 4A0RA 4DPYA 4FBMA 3GFXA 3G86A 3FDJA 1UKAA 1P3JA 5DXAA 4C8KA 1GL3A 2LRHA 5KFCA 1T0HB 5CBPB 1VSVA 2O1SA 2IYQA 5M3BA 2HLPA 2X5JO 2RUGA 1EG2A 1U7ZA 2GSWA 2FEAA 1RKUA 1GITA 2AX0A 3N6MA 3UG7A 4CLTA 4C04A 2AUTA 5JANA 2BE7A 4Q44A 5DWQA 4GG1A 3TECE 1AT1B 2V7VA 4JLOA 4XWOA 3BGFA 2HZVA 2HF8A 4PZDA 4B7XA 3M9MB 2R8KA 4R51A 4RLSA 4PUIA 1NHKL 5HMYA 3B36A 3GIJA 4QRIA 1RT6B 4XGNA 1QBKC 2IU4A 4EYSA 1HHSA 2NSHA 2ZBQA 3U1NA 4B9UA 2CF6A 5T41A 4GZ5A 3QIVA 3E53A 2VP0A 5D78A 4J37A 5KFUA 3RGGA 3INNA 4DV6B 1NVXQ 2RS2A 1XKTA 3BZWA 5J1PA 4NMWA 2YJNA 3BQMB 3BL5A 2HJWA 4TLDA 4Q3AA 5F41A 1EVYA 2FVXA 4J3NA 4LFBF 4B02A 3NGTA 2NREA 4OZ5A 2X14A 2IE8A 1YDEA 1N56A 3I0NA 1NQOA 2ETVA 2YUIA 1IDOA 1SVUA 3BBPA 2V59A 1PT9A 1A1SA 3FPGA 4TS4A 3I12A 4QVIA 4HI2A 4QIVA 4MQFB 2BMBA 4A0HA 4EY8A 4K7JA 3N74A 5BW5A 4NV0A 1HDYA 4UU0A 2QUZA 4XOIA 2WJVA 1WBBA 4NFYA 3HHDA 1C0UB 4ZVPA 2CSUA 2BHNA 4R1UA 1B6SA 4XEHA 4RW7A 4E5UA 5KPDA 4X4SA 3E48A 4DVGA 5ECDA 1EJ6A 2YBVA 1YTYA 3CLSD 3AV0B 1T26A 4MV3A 2HLTA 1VQMS 3QPDA 1Q0LA 1PUXA 4J9OA 4R1TA 4W8OA 3O8LA 3ICLA 1NYTA 2Q0SA 2HCRA 2DNGA 3JAMA 1XMQC 1CJVA 4FR2A 3C70A 2AI2A 4V0KA 1FRXA 2R3SA 3HN2A 4K8RA 3KUKA 3BXHA 1WDLA 1JH9A 2WP0A 4DLGA 3DLTA 1E7MA 4EM6A 3OTHA 1B73A 4GKJF 5GVQA 1FVQA 1E1DA 1FRLA 4Q9NA 1NKCA 3F9CA 4N40A 5COAA 4XH9B 4IFBA 5FA5A 2WJ4A 2QM3A 3G5LA 4M54A 1YFZA 3EPLA 3PHCA 2UXDF 3RB6A 5A4KA 2OG2A 3EULA 1II9A 3DRPA 2OUIA 4GM0A 4Q39A 3M8YA 1T5IA 1MLAA 4X6YA 2R2UA 2AMCB 3M81A 4QQ8A 1NRKA 1SUSA 4UW9A 1U0SY 2GSDA 5LC1A 1W76A 4B32A 1ZB9A 4XQ0A 2PN6A 4RUHA 1UW4A 3OZ7A 3I2GA 1HDOA 1AK1A 1GGNA 5L6LB 1I51A 4QXOA 4GRDA 1EUCA 3IAUA 1E79A 1R4NA 4DQKA 2WSIA 4LRUA 2XHCA 2I1RA 3F71A 4ZLNA 3WLPA 3E7FA 3ZIUA 1W87A 4I19A 5IFLA 4B4VA 1V0JA 2P5SA 4AWAA 3RSOA 5HM6A 3PEHA 6ADHA 2PY6A 2PUBA 1QC5B 3PPXA 1AKWA 2PGCA 3DVLA 2PZAA 1VPVA 2TSYB 3B70A 3TQHA 4RNCA 2CNOB 3IE1A 3ELDA 4MFBA 4CW7A 2DJWA 4ZITA 4S05A 3AZOA 2G1UA 2IHKA 1KTQA 1X92A 2PLNA 2BFEA 5E3CA 5SZJA 1TVCA 3DBLA 3LIPA 1T9GR 1WZEA 3FTCA 1GAOA 4CLOB 2V7WA 3GLHB 5KFXA 4H3SA 3NIDB 5BSFA 3GP5A 4EPVA 3DL7A 3QVUA 3FYHA 1EPUA 3UMBA 1HNVA 1U98A 1LPPA 5EUCA 3MF5A 3JWHA 1BS2A 4Q34A 2HJGA 2ZDGA 4R2XA 3GRUA 2MSCB 2PT9A 3ETOA 4C06A 4IJMA 3HJGA 2WRMA 4Q2MA 2ZAMA 1CIVA 1H6AA 3QUTA 3N07A 2JIDA 1ECFA 3G8YA 1O0BA 1VQOS 4K4UA 1NKTA 1FFAA 4Z0TA 2F40A 2J30A 3D3KA 3FETA 2XT9A 3KLNA 2AZMA 4KMRA 5JXSA 2HLNA 2PRKA 1C1BB 4GO1A 1SWWA 3ZLBA 3PEWA 4C2BA 1KH3A 2OFWA 4L7VA 5CZVA 1FFCA 3DFZA 3AP1A 4PLHA 4YR3A 1KLMB 5TJHA 3UKJA 2W9XA 1M75A 4DV6F 3K71B 3R9IA 1SC3B 4EVQA 3WO0A 3BWXA 4NEYA 4QYZJ 4P2SA 4LK3A 3PE3A 2A14A 3NBXX 1BU8A 2XUPA 3OD5A 3DM2B 2YN4A 4E8UA 1EQAA 4DX5A 4I7EA 3UO0A 1SCIA 3I61A 3EVMA 4HYKA 5FRDA 3LZCA 4CLFA 4IFIA 1Z0KA 2ZJQQ 3ZZMA 2C9ZA 4RD2A 3QWHA 4B9TA 2DX7A 1I3LA 2I7CA 3CC2S 4OHBA 4HX5A 4RVSA 4RMGA 2RCYA 1QFMA 3W62A 2KFYA 3L7NA 4P2XA 4Q03A 5DX8A 3F7MA 2H4WA 1YJCA 3FIJA 4UM9B 1VHWA 1NU8A 4G23A 2V8PA 1JFFB 3K5NA 3L7OA 1L8XA 2H65B 5BMVF 2R8JA 2KT2A 5FEUA 1M5SA 5FI5A 1C4OA 5BNTA 5I3UA 4RW4B 1XJCA 1W2IA 4AQ7A 3INGA 2VG6A 1NSFA 1YI0A 3QKTA 5J3JA 4HQOA 1GGMA 2ZPUA 4LHZA 2WOJA 1A3CA 1GSOA 2PL1A 4U0JA 3CRMA 4ZT3A 3KQSA 2H2WA 2X1MA 4QYSA 3GN1A 4BX2A 3ENNA 2QN1A 2KHZA 3LLCA 5AI8A 4UQGA 3P7MA 2VXBA 2P69A 4DFPA 5LU9A 4WKOA 1QRSA 2FMTA 3A1TA 3FFIB 4D96A 5I3QA 1CS4A 2I6UA 4MWGA 3AP2A 2IBKA 1SM4A 2XS7A 3G0DA 3H5OA 1W1IA 2QRGA 1T43A 2QVGA 2EBEA 4H6VA 3V3TA 1I4TD 3HLKA 4WZBB 4S35A 2RHOA 3IXLA 2RDDA 3TZQA 1Z5VA 5ARCA 5IKMA 5DJ5A 1Z4MA 4UMDA 2HPZA 1TL1B 3TRGA 1SI9A 2XSFA 2OCBA 4IQGA 1NL3A 3WJ1A 4GFDA 2ZCJA 3KLFB 4F3KA 2O57A 3ZDYB 2AEMA 1T1EA 3AC0A 4CDNA 3FMOB 1M2GA 3FWYA 4HN2A 1Y1PA 3ASUA 1HZJA 1GPDG 3ANLA 1ZXLA 4H4MA 2B8EA 3B6ZA 5FTKA 2AGVA 4RIIA 2GQQA 4F02A 3SYTA 1DRWA 3IT2A 3U4DA 3N53A 2RAPA 4KGZB 1D7AA 4YRTA 1PYGA 5ES3A 5FADA 4F4CA 3CJQA 1QK4A 3LKVA 2DNYA 1I2ZA 2XT6A 1T13A 3VR5H 5AW4A 1JLAA 5JYBA 1SO8A 5KSPA 3ILVA 5GVRA 3A9SA 4Q9HA 2QX9A 5GOZA 4Z6KA 4U7JA 1DLIA 2Y1OA 4I7FA 4CNBA 1I9GA 4USTA 1EK6A 1BLUA 2F8HA 4BASA 2GTHA 2SBTA 1YBFA 2YPYA 2A9JA 4LF4F 4L3KA 5I7RA 1CY4A 4AXJA 3K4PA 4RHYA 4KDRA 4XR4A 3GWGA 1N32B 3WLAA 4TTPA 3EGDA 2GZSA 1RZRD 3GMSA 2PLFA 2VA3A 4GM4A 2XTJP 2I3DA 1DT3A 4DR7C 1PIEA 3EVEA 3DOKA 4MLZA 7MHTA 4KGXB 3GHHA 3GEHA 4P4TA 4JB3A 3VUFA 7AT1B 3K2IA 3L7IA 2VWHA 4NG4A 3AVXA 3WZ0A 1YONA 3ZOKA 2V9WA 1ECLA 3VQSA 2JWNA 2J6SA 2CKMA 2FR8A 5CA1F 2PQMA 1AZTA 3WFIA 2F1FA 5AT1A 1WR8A 3UKDA 1IULA 2VPZB 3KJNB 3I2IA 4N8OA 4LJ9A 1NKSA 3O38A 4WLOA 4M0DA 3L0BA 4K0KF 2D27A 3QO9B 1WVGA 2VJLA 3OX2A 2O7QA 3SSQA 4ISCA 3S28A 3HCOA 1AH2A 4JV5J 1MGPA 4CHGA 1ZX1A 1QH0A 5B1SA 1N5JA 2HYDA 1R00A 4H77A 5LLDA 2QN9A 4XTTA 1IOZA 1Y8CA 3AF5A 2M7SA 1ONPA 4TTSA 1W30A 2YKMB 4DR3F 5LBUA 5E4JA 1JDBB 2PR2A 2P6UA 3BJIC 5JSKA 3Q72A 3CNQP 2PSEA 1OXSC 2V6IA 3S2YA 1YI1A 5AKJA 3VAIA 3V7FA 2KYZA 1CB7A 4QR0A 3P97A 3R2JA 3V6LA 3GCGA 3Q7QA 1ZVMA 1TUGB 3EPIA 1WUHS 1DUVG 1VYTA 5D51S 5ICSA 3CX7A 2JJ4D 4RS3A 4G24A 3Q3VA 1B8VA 4LX0A 1H3FA 3EGZA 3KYBA 3FKQA 1E3WA 1FFSA 2RB7A 2K7FA 4Q4CA 5KO2A 1TLFA 3SDBA 5AR1A 1HFKA 2CEKA 2J5BA 2LA6A 2JFOA 1SL0A 3ZE8A 1N36J 1JYSA 1FPMA 4U7UK 1NMZA 3H0EA 2H9IA 3I9V9 5ALKA 4PHHA 2VSYA 4DJTA 5I8WA 2RI0A 3ZVRA 2Z1NA 1N9KA 4E5YA 1FF9A 3PW7A 4JBXA 1SC4A 3Q9SA 4CN8A 3DLKA 3TEHB 3IP3A 1XR6A 4CM8A 1XMQB 4DN6A 2BR5A 4UM8B 1I01A 1Z29A 4D74A 3EYZA 1OQAA 4L4SA 4C0HA 1Y11A 1U1OA 3TLJA 3CIMA 3DP9A 4DUYC 3I92A 3G4SS 3IE2A 1UXJA 4R8MA 3LOQA 4XYMA 3ET6A 2HEGA 2F3SA 2VH2A 4PCUA 1LQ9A 1HNWF 4C08A 5CCBA 4KIGA 4A1FA 1VG1A 4DAOA 5DSXA 3VR4H 2XHWA 1VKOA 3H5XA 5HA5A 3B9PA 5B0EA 4UBOA 3UDVA 5EUBA 3OCJA 1IN6A 3K70C 2Y0SD 4AN1A 1JQGA 3ZV7A 1PNOA 2PD6A 1VBYA 4O23A 4PCQA 4B08A 1NWCA 2ZOGA 1C2PA 1F3VA 4B09A 4KKOB 2KJWA 4AL7A 3PR1A 3QLHB 1SU7A 1M8JA 3ZE2B 2PGNA 3A9VA 5EP3A 4RUBA 4TU8A 1LS1A 1UEUA 1U02A 4P2FA 1P4HA 4MW9A 4X7RA 4CMKA 2C7GA 2PSJA 3C7KA 3NNAA 3BWEA 4MS4A 5SY4A 2LXUA 1O5OA 5K8NA 4B0OA 3BCHA 1OASA 4ZODA 3OXLA 4C4WA 2RDMA 1RQPA 2ZJ7A 4G25A 1UBSB 1NF8A 5EX0A 2PA8D 5KNCD 1L5UA 2EC0A 1PVVA 1Q8KA 2XCQA 1TF5A 5ALWA 1HTWA 2JGEA 3VVCA 1CQPA 4NYMQ 2ZSEA 2IOHA 2I2DA 1U28A 4ZVKA 1PNRA 1GDDA 1URNA 3KLFA 3CO0P 1SKSA 1R3UA 4QXAA 2VPXA 1FO1A 2ROEA 4RHUA 5F3ZA 3IMKA 3DFIA 3MUFA 4EJ0A 2FEOA 5K8JB 2O48X 5FWAA 1RLCL 1YG0A 5DRYA 3KBOA 4MR7B 4Q19A 5IAKA 2K06A 4JJGA 2RAVA 2Y1LB 4EP1A 4K28A 1I1GA 4QVGA 5BSTA 4YYEA 1F4LA 3LC0A 3WGLA 5AJZA 4DV5B 1HKUA 2GLUA 3ET5A 3LUYA 3BF4A 2Z4TA 4L4ZA 4ZPTR 4ARSA 2DHAA 3ZHVA 3JQKA 1DOZA 4EA9A 5EXPA 5CK4A 5CXXA 1W0JD 1WH9A 1O93A 3NALA 3DLLQ 3KKQA 1YBVA 4I56A 2PZLA 4FFVA 3A1UA 3N6VA 5HK9A 5CQGA 4XIGS 3GLVA 3SJBA 4RZUA 2JFQA 1SOAA 3H8YA 2ZZMA 4IOJA 1K7FB 2R2AA 3AW9A 4GBED 1W85A 2DEIA 1EP3B 1SQGA 3AUUA 3CWQA 1TU4A 1VMEA 1R64A 4WBNF 2HAFA 4D0SA 1XMPA 1W0CA 2W4QA 3FEYB 1WF2A 4AZ0B 5CCEA 4GDFA 5K5MA 1YBMA 4ZCKA 3WNDA 5D0RA 2HVIA 4FDUA 5HIMA 4ZK7M 4EH1A 5AJYA 4BFYA 3GMGA 2UZ0A 3GFYA 3IMCA 2GNOA 2HBYA 4D56A 5DKFA 4AICA 4BB6A 2AKYA 1KSGA 3LGMA 1SKWA 2JL9A 2ZEJA 1U5BA 1NQTA 2G7ZA 3HF5A 4JV0A 4RU1A 4G67A 1V8PA 2PWYA 1PJCA 2V4JA 3V8EA 4BNZA 1JX6A 1KE1A 4Q4AA 5JZOA 1M2EA 1CY1A 3ZV3A 4JJ7A 2BE9B 1VR6A 2C3OA 3LTOA 3B54A 3A3NB 1EVZA 1QVZA 3GMIA 1R2QA 3W4KA 4C0XA 4NCGA 2MYPA 3LO8A 4HNQA 2MZQA 3B78A 2KMLA 4DSIA 5D15A 2HK2A 1TJ3A 3VCDA 1A76A 4MR9A 2WD9A 5TLSA 5IWAB 1Z4QA 3SEOA 4Y2IA 3BDVA 1X19A 3CWJA 3S6EA 3W8NA 4BKMA 4Z7JA 5B4UA 3ROGA 4LTMA 4UHHA 2F9FA 3JS9A 1K8YB 2RG1A 4XWKA 4QAQA 3ZBUA 2HA6A 5HBRA 1MWYA 3K6SA 3E9ZA 3TB4A 2J4DA 4KGVB 4XTCS 1VZ3A 3H9JA 1FJ2A 3LCCA 1O6GA 1YFJA 4OTZA 1WMEA 4P7VA 3PFNA 2JFVA 2EG1A 3GJSA 4N01A 2G9RA 5IT0A 3GSIA 1H69A 2AT1B 1PEAA 4J7CA 3EAQA 4ZOSA 1KWMA 1DKMA 1UKCA 4RADA 2LXIA 1G4HA 1WDMA 3TXAA 3IUJA 5A4IS 4FGJA 4A6EA 4R8RA 1YZQA 1ZAWA 3TQQA 3A1WA 3ETDA 4FFBA 3Q3JB 5JXGA 2FG6C 4NH4A 3CZRA 2VG6B 3PRBA 1VIOA 4PLYA 1V3QE 4YB6A 4J03A 4QJ3A 1Y1SA 2HZBA 3M8PA 2BX6A 1J33A 1BQNB 3HABA 521PA 2XSZD 5HZKA 4MKAA 1LQLA 1IPHA 3RVQA 5KG2A 3SQWA 1T2DA 5KFAA 2H51B 3GZNA 3PYMA 2D74A 3I30X 1DS6A 3CA8A 4IRUB 5KYXA 3LHIA 1U7PA 2RGAA 3BXXA 1C9DB 5K5EA 4LC1A 4Q02A 2P9GA 1WUKS 1YZTA 1F0XA 5A8RB 3BGUA 4YAOA 1IVYA 2NP7A 3GFHA 4OMDA 2LV8A 2V4QA 1FBTA 4XD7D 4CMIA 1Z22A 3S70A 5FNVF 1ISIA 3ULHA 2DMRA 4QQNA 3CUUA 3QMMA 3QA3E 4OQMA 1KMQA 5KU1A 2ZYSA 4JJKA 1N2CB 2OELA 1DJ0A 2YINC 2RCNA 1O9TA 1Z0IA 5EHQA 4OCZA 3EUAA 1HO3A 2PGDA 4RFVA 1NVGA 3WHLA 3QWUA 1W59A 3D81A 1Q86T 4JUIA 3HRHA 1DQAA 3JSRA 2GCOB 4KQMA 4TWAA 3I1JA 2P78A 2QMEA 4N8DA 2YRXA 1QYWA 1HHTP 2JGFA 2W2QP 1F0NA 4L6CA 1CVIA 2KM1A 1E2DA 4ZHSA 2Q5JA 1MMNA 4MKRA 1UBGA 2PHZA 3CGIA 5AVWA 4OYLA 3SYLA 2Z57B 3Q2SC 1Q5YA 5MF6A 4BRWA 4RNMA 4MUYA 4AKSA 1QB7A 4DR2F 1T95A 2XKKA 2BKAA 3PFIA 3C8UA 2CQ2A 3ENWA 2BOVA 5J4HA 1WZ2A 1T9ZA 2FU5C 4JI6B 2RHMA 2PFGA 5D1HA 3ME5A 2XA9A 4X61A 3LUDA 2HMTA 1YOVB 1LTKA 2NQTA 4M1EA 2UUAB 2NWQA 5LB2A 3UPDA 5CA1B 4KXYA 4DQ0A 4XB2A 4KWCA 3UJPA 4I9UA 1KAGA 1TKTA 5EKDA 4B6GA 5EIXA 2D06A 3GFVA 3CGGA 2OO5A 3P2KA 4X4NA 3VDRA 3AK4A 3GPDG 4J9QA 3ZH9B 4AY6A 4QJVA 3R8XA 4I8XA 2CNNB 1A50B 2WT4A 1BMFA 1C3OB 3VVMA 4CCWA 2R7TA 4BQEA 4DLRA 2VQFF 3OFFA 4JT9A 1E6VA 4I55A 2WKWA 4DY6A 4J9NA 3VYVA 3CDAA 4F96A 2IYZA 4IIJB 1W9MA 2PC6A 4QLOA 4YAEA 4UM5A 3FFAA 1JTFA 3UK1A 2J6CA 1P19A 3MT8A 3IJPA 4GICA 5A8RA 5LXYA 4H1TA 3LX8A 3U48A 1E9AA 3I2JA 4MXDA 5J2MA 1L5MA 4BVBA 2W4DA 4FUQA 4WXYB 1YGYA 1ZAKA 2ABWA 3QEJA 4JYAC 4GL2A 4M0KA 3E05A 3ZLJA 4R05A 3IAS6 2EP5A 5CVTA 4C11B 3JVIA 6CHYA 3LY5A 2WNIA 1YRAA 2VBYA 3SKYA 2WE7A 1XZPA 3Q86A 5ULLA 4BP9A 4E09A 2WONA 3TARA 1CZHA 4HI1A 2D8MA 4W5NA 2UXDB 4KE5A 5KFSA 4IH4A 3MTQA 4M53A 3PEEA 2YIVX 1YDMA 2II6A 3BPSA 1H0KA 4IQMA 5K0GA 1RXVA 2NU9B 2ZJ1A 5DYYA 2B34A 1XEZA 1KE2A 3NEJA 2LXFA 4NMXA 5D4OA 2OMEA 1J7JA 1KHWA 5KVCA 1VSUA 5ALQA 4JI3J 3OECA 5KJEA 1FJXA 5KIAA 4RFSA 4R7GA 3T3FA 2HNZB 1ZOOA 3VAJA 4H3KB 4PX9A 5EYPB 4KFCA 2XX3A 1YDHA 4LVUA 1BOOA 5KTSA 2F8TA 3H9EO 3I96A 4W1SA 4HYTA 5HKAA 4DDHA 1O4WA 4N9WA 1TYAE 5HJ5A 1ZIYA 1F2TB 3RKSA 3SM3A 1H9AA 1Y48E 4JI1F 4Q2LA 3QNUA 1WLSA 3HE3A 1G5PA 4OKSA 2HN9A 4J49A 2Y0BA 5B12A 1L4NA 4MGKR 4C21A 4FWBA 1ZJWA 2VRCA 2CQ0A 4URSA 1J8MF 1XMJA 5KT4A 1UFQA 3FRHA 1CFJA 2GCIA 5E1BA 2XWBF 3MOZA 3ZY4A 5JPDA 2VSXA 2AQIA 1ZG3A 2NPFA 2NUAA 4Q4DA 2Q3DA 2A67A 5EKTA 1I80A 1ZI8A 2VONA 1OY9A 1OFHA 3DGEC 4ZVSB 1KIAA 3SJCA 1NNUA 4W5QA 3DGVA 2C2ZA 2J8ZA 2QJFA 3KYDB 1X3SA 3QIPA 1SN7A 3D8RA 5EMLA 2GKSA 4C76A 3W9UA 4FNMA 2FDXA 5M34A 4RJIA 2PQ6A 4IFEA 2BMEA 2FLKA 4WZQA 2QTWA 1QQTA 4G0ZA 3THRA 2Y1JA 3RUPA 1VDMA 4EUKA 2CFXA 1NUAA 5KTOA 1BVRA 2W11A 4R9VA 1E9SA 1P2GA 2HNAA 5FWXA 2Z58B 5H16A 4FK8A 4C97A 3A4NA 4IJUA 2Y1KA 1ZGBA 1CD5A 1H8EA 3S4YA 1BXNA 1R0CA 3ENZA 1Z7WA 4N41A 1ZAXA 2HIQA 2VQEF 2ROQA 2VDMB 4DR1J 1Z88A 4OREX 4K4ZA 1KK0A 2ONCA 2QX8A 3OFEA 4EGAA 2NSBA 4OBEA 2PO7A 4ME6A 1RTHA 1Y6RA 2BFCA 4QXRA 4OH7A 2QG9A 4B3MJ 3FZQA 1HYBA 4WKCA 4RX6A 4B3XA 5JNWA 1ZN8A 2XEXA 5BV7A 3T1HB 3LLMA 2DYKA 3KOAA 2OHHA 2OT3B 3Q5DA 4YRBA 4ND5A 2AC4A 4BKPA 3S44A 2A6OA 1S57A 1L5VA 1TYEB 5JO9A 3UN5A 3TD9A 1Q0PA 2FETA 1M7BA 2MHEA 4DA4A 1QP0A 5A2QU 4ALIA 3T7KA 4KO4S 2DKOA 3J81j 2JBAA 1KC1A 1SH2A 2O7SA 1ZH8A 4WXRA 4X64C 3A3OB 1KJ9A 3ZK7A 3DBOB 2VCEA 5CXTA 4BLWA 1GQEA 3ZDXB 1I2CA 2Y0PA 4EF5A 3PTAA 3ZH2A 3MM9A 5EQJB 4HMPA 5JAZA 4AP6A 3DLIA 4QATA 4RVDA 3CULA 2WJPA 2PZ8A 2B35A 6PFKA 5A06A 1ULAA 4YAIA 3R97A 1GTL1 2PMDA 2TMGA 4EMUA 4HDAA 4I50F 5G3YA 3EICA 4JI0F 2R8RA 1FLDA 3OTOF 5CD4H 1K6IA 1T2FA 3LWZA 3Q12A 1DRZA 2CYCA 4C5AA 1SIWA 1XA4A 2V4UA 1TYCA 3EY4A 1Z4OA 3A3KA 1ZINA 1WUYA 4QOGA 1Z6QA 2CFRA 1PZGA 4BGDA 5ICGA 2M5YA 1X9WA 3EWAA 3VA7A 1IN4A 2O8BA 1HH4A 3NTLA 4NSNA 3AHIA 3Q83A 3GAMA 4O2RA 1ZGGA 3NCQA 5G0UA 4KVGA 2HLHA 2BI4A 2X9VA 1FEHA 4ZVTB 4HG2A 2RHJA 3PJRA 2V7PA 5BWBA 1RYSA 1YL6A 3S2ZA 4UF4A 1TT7A 4IUBS 1F4PA 5A3SA 1DAMA 4LHSA 2Y67A 2GK3A 1DTSA 4A0SA 1S1UA 3UN1A 3LOUA 4DWJA 2R8ZA 3OEED 2BGIA 4MX8A 2I8LA 4EF6A 2Y6VA 2X0DA 5J2QB 3WNQA 3BAZA 4ZMSA 5J4KA 4YBRA 1RBOB 4XFDA 1HNZC 2ZLBA 1ML8A 3WWPA 3GA7A 1KJYA 2O20A 1S7GA 2HY7A 2EWHA 2OV3A 1P18A 2QVLA 1IB8A 1RU2A 4GYJA 1KK2A 3TQIA 2LGJA 4MR8A 5BNIA 4V19J 1ISFA 4DUTA 2HA7A 3MUNA 1NF2A 3N7UA 2G4VA 1ADBA 1GADO 3I0RB 1W4AA 1N8KA 2I1QA 2DRAA 1ACMB 5F8NA 3PO5A 2CXHA 3M7IA 5F78A 3TVYA 1KMIY 3OIFA 3CH5A 2HQ3A 4P5EA 4CO1A 4UUOA 3D43A 2ADFA 2B0CA 3ILYA 1SVSA 3MMBA 2DPYA 4L16A 5CD1A 4TN5A 1R0SA 3EXIA 4B75A 4OB7A 3JAMU 2W4MA 4WEQA 3CZAA 2AI3A 3I5MA 1TKCA 3FMGA 1EXNA 4E2FA 2M5HA 4RFLA 1SXJC 3NYQA 2Q3EA 2ASLA 1V5WA 2XGQA 3KOOA 4CM1A 5KS2A 5MFZA 5JZVA 4JOUA 2CHGA 4Q16A 4RW6A 2P5VA 1DIRA 4CM0A 1T9UA 2WTXA 5DISB 1M6XC 2XCIA 3OEYA 2QMUA 4UY85 1Q50A 1DY3A 1NI4B 3LBAA 2ZH7A 2AG1A 2M6RA 5FWNA 4UCXA 2FHOB 3FJOA 2FPRA 4H1WA 4ND3A 3GRCA 2GBLC 4E4RA 1XLTA 1Z34A 4H4MB 1D1UA 1BA3A 4A0FA 1B00A 1XCOA 3CKKA 1F8GA 4Y6LA 4PAAA 4F3QA 2XUKA 4CO5A 4BMSA 3PX7A 1KKGA 4N54A 5J5AA 1KC8T 3OL8A 4GS5A 1ETUA 4NXNB 1GXLA 4B9LA 5H3HA 3NGXA 1ZBDA 5J4YA 4GI1A 1YZUA 5HMLA 2X2EA 3NATA 3UF0A 4LF7B 1K9SA 3RS5A 5KFIA 3LT0A 2W42A 3IIJA 3E5HA 4EFLA 1FYWA 3PNQA 2HNZA 1LWNA 1ZHFA 2P2DA 3YASA 3PNOA 4EJ6A 4EL0A 1OYOA 1N7JA 1L2TA 1O58A 4JL8A 5M29A 3DMFA 5JSHA 2HPAA 1C4KA 1XZFA 2JIMA 2AG8A 4UUQA 1KQOA 3Q5GA 1YIDA 1IM5A 2IHZA 5EJAA 3TI9A 2ZB8A 2QD4A 1FWKA 4I4NA 6FD1A 2QE7D 4I0WB 2YTCA 1FTQA 5EKUA 3N9IA 2Z9DA 1UCFA 3FDFA 4ZC1A 3OF3A 1H2WA 5KFQA 5CRIA 3C4VA 1RWVB 4TTQA 1XVLA 3HDTA 3VV2B 3A6LA 4OLAA 3L7DA 2BUCA 5GGXA 2DBZA 3PL5A 2HWHA 4QZVA 2REQB 3BXGA 4QPZA 2Q2QA 5H3CA 3GUHA 2GZOA 3AJ2A 3ZXUB 2GBCA 4MCIA 3MTEA 1HSOA 3VAMA 3DYBA 4JVLA 3HXOA 4WK3A 1G0NA 4GI5A 1S0MA 1XWIA 3KLPX 1UC8A 3LKDA 4U2FA 2BH1X 2FSUA 2RQ4A 3LT2A 2WICA 4MUIA 5KG5A 4L27A 4P3YA 5LKRA 1LNSA 4FYJA 4O4JF 4JUDX 1TMKA 4PIPA 1XMVA 2C7QA 2W8BB 4DGQA 5JJIA 1N8SA 3QBJA 3FHOA 4XE5A 3O91A 4EY6A 2XMGA 2FP4A 2CNKB 3V34A 3ZU3A 3WL4A 1IKYB 2P2BA 3BA6A 3KCQA 5J63A 3I9V1 4P4GA 4W7SA 1HMPA 5L7WA 2GXAA 1S97A 1BUXA 4PG4A 4DOMA 4FKYA 1X4EA 4R2LA 2XMKA 2A7QA 1EYZA 4XA8A 3SCJE 2HNDA 5EZYA 3I4PA 5T3YA 1AD2A 1F5BA 2X2OA 3QMQA 1UMBA 3D1OA 5E6UB 5LP6A 4YHBA 3PRJA 2POQX 2IU3A 3WDLA 5ETPA 1RLJA 4WFNQ 2CLOB 3TOVA 3W1EA 3V9AA 1VC0A 3THPA 4CM4A 1A98A 5F76A 2CVIA 2WI8A 3TF5A 3FK4A 1AY0A 1T03A 3EODA 1I14A 5JDIA 1XAGA 2XUQA 3A1YG 4RQAA 1BMTA 2VYQA 2GBLA 5J4LA 1D9ZA 1UKEA 3B2QA 3QG1A 2GB4A 2WSBA 3UEOA 5MAOA 2N0SA 4G1CA 2VOEA 1KR2A 1C7ZA 4RA6A 4WN3A 1QQ6A 1VCNA 2GEJA 2Q99A 4JAVC 4B80A 1OLOA 4ZU3A 2NZXA 4DR2B 1W5TA 4UNPA 4UVEA 3Q8WA 3DKDA 1E60A 2Q49A 4LJ6A 1YB6A 4HYQA 3VHQA 3AJAA 2RF2A 5LA6B 3ZDCA 3PYGA 2ILTA 2REBA 1Y3CE 1K73T 4YVFA 4J1TC 4BGIA 4A4DA 2G5PA 1G6Q1 4S2EA 3M6FA 1DBQA 1XROA 3J81U 2ECKA 2GPAA 5SICE 4YY3J 1L4KA 3KSUA 3KSAC 3AM3A 1VDHA 1UM9A 1IQZA 2O3JA 2ST1A 1USVA 4GE0A 1P39A 5JAMA 2RGDA 3QOWA 5COBA 5HR5A 1GTSA 5AVOA 4JJEA 4TLBA 1N3LA 2BCEA 4OHVA 3FMPB 4HWOA 3ADPA 1K75A 3SF8B 2AGPA 1HBJA 1UZUA 3MR6A 2QT1A 1M8GA 4KFTA 1G7RA 3OPKA 1QE1B 4PGHA 2Q4TA 3FNEA 1DBDA 1JQJC 5FV4A 3WZMA 3TLZA 2IA5A 1LNQA 4IWXA 4TVBA 1VDZA 4QWCA 4ZQGA 4ZMBA 4C4RA 2P20A 3D6FA 1JEQB 1YS6A 5TPWA 2IP1A 4OXKA 1TL4A 1K4YA 2Q9AA 5E1DA 3H11A 1NXWA 4E30A 1O7JA 2QS9A 3GCWP 3ER6A 1K1QA 1PR0A 4I5EA 2VK1A 5I7UA 1NM5A 3PHJA 2RS8A 1BYUA 2ZBUA 4IUDS 3CCCA 4QW9A 1WUJS 2Z30B 5D00A 2GT1A 3ABQB 1E2MA 1SIUA 3L5KA 3QGGA 1GA4A 4DJ5X 3H6HA 5ILQA 4X64B 3NEPX 1GZSA 4BXOB 5KC9A 1Z7BA 5EJEA 1CQNA 4ONEA 5K3OA 3GFGA 1V5IB 3AR7A 1XEWY 4INZA 2ORVA 4MR8B 5HANA 4DPLA 3CF6R 4TYAA 3PYEA 2YZMA 1ZIOA 3JWGA 2C4NA 5BQXA 1C9NA 2W6MA 5CNKA 2NTYC 5HROB 1XLUA 2VBGA 3AFNA 2R96A 2DF8A 3DNFA 1GT6A 1DELA 2BN4A 3AGQA 1MJFA 4I2NA 4HT5A 1UKKA 4F4JA 3VRHA 2Y1RI 3PITA 1GPAA 4H1VA 3HKDB 2JCVA 1Y7LA 1WULS 3F2IA 1ISMA 4MHTA 4CCYA 3A9RA 4TKUA 2BBEA 3ZLUA 5FI3A 3H17A 5CVJA 3AL3A 3PIRA 5DTRA 4QU0A 3VAAA 3HCCA 1X8KA 1WXQA 3W90A 1I1QB 2MMYA 4RZXA 3TTVA 1HI9A 1YQTA 2XXBA 2XGPA 1YUMA 2DPHA 3BX1A 4ZVLA 1V2GA 5EJ8A 3JSMA 5U1PA 5KUTA 3MEGA 3HBNA 4C3OB 1V6SA 3ZTPA 4LF9B 4TZ6A 1BAPA 1Z2NX 3ESDA 4R0EA 5H9UA 5LQNA 4DR4B 3U09A 2CNWD 1T8UA 2FH5B 1THTA 2AYMA 1YDLA 1LK5A 1FDUA 1ENZA 3RSGA 1CJUC 1U0BB 4U7FA 4PC2A 4GVXA 1L7VC 1E6VB 3A8EA 1JFRA 5KQPA 2DVMA 1ZZEA 4E1BA 1UZHA 3BJEA 2JVIA 4CMBA 3H05A 3IR5A 4I1VA 4PXDA 1B7YB 4MP8A 1UZLA 4HJRA 3GGPA 4DV2J 4DV0J 3EB9A 4D3XA 1IK4A 1YGPA 2E5GA 3L09A 5I9IA 2UVQA 3D4PA 4J4TA 1T35A 3MS2A 3IRUA 4AXBA 2OV4A 4ER7A 5T4FA 4DV3B 5C18A 3G9CA 2IHBA 3SJ7A 2ATXA 4HS9A 3TKAA 4KX3A 2EEZA 2ZCUA 4K6GA 1QP8A 4OI1A 1ZZFA 2BKEA 2YTZA 3RVRA 4X66B 4QPJC 2NVBA 3W7AA 4AQYF 3OZEA 4UBJA 3T9CA 3R7SA 3THYB 1RM0A 1PBTA 3E51A 1OMSA 1PILA 3VH4A 1UIRA 3ROZA 2W6OA 3AKCA 2Q4BA 3K8YA 2PA3A 2OHJA 1DJMA 1TGYA 4NCJA 1VI5A 3QJYA 1G6OA 4PQUA 3NANA 4JQSA 1RHRA 5B3JA 1WHXA 4XIJA 3HX9A 4NA1A 4JXJA 3OZTA 3H2ZA 1FLVA 2MGZA 3REFA 4IJVA 2HH9A 1NY5A 1W6RA 4USMA 2XZTB 1NK4A 2MQPA 4H7FA 1L7MA 1D0VA 3QK7A 1QRRA 2DR8A 4WHMA 4S1TA 5CITA 1V8FA 3ITKA 4ZCSA 4EARA 1RQRA 3L05A 2GVDB 1LC3A 3FUVA 3BD8A 4XUGB 2GVZB 3EMVA 3ZWXA 5CHCB 1B2LA 1NSYA 3DHYA 1C30B 4K6CA 3V55A 3EGEA 4C0OC 4PWDA 4ARBA 3K89A 1MENA 1XU9A 1V3RA 5ELLA 2IIBA 4LT6A 4LPSA 1K4KA 4Q6WA 2QLNA 3QEAZ 2J76E 1DQNA 1VLQA 1V5FA 2WK4A 3EOBI 5CA5A 2UUBJ 4ZQCB 2EBWA 4IUFA 3NT4A 4HTAA 4HHJA 1TIKA 4FW9A 4NLTA 3BIOA 3O8QB 4BLVA 4EABA 4BJ6A 3EZYA 2EFGA 2HIYA 4G8BA 3Q9NA 1D0EA 4KTTE 1RDRA 2XYHB 4M55A 5T8KC 1DKQA 2CBXA 3DC7A 3M2VA 1W6UA 1S9EB 3B4MA 2P4SA 5K0CA 3ZXIA 3GJYA 3MR3A 3Q0AA 3CSDA 4LF6B 4P2GA 1QAIA 4RS4A 1AS0A 2DGVA 1KMCA 3PPVA 4G41A 3UMJA 3BV8A 2FZCA 4DR6F 4EU0A 4YDQA 4JBHA 3CURA 2NO6A 3W3SA 3RTEA 4K5SA 4ECTA 5JMTA 5KFGA 4YR2A 1XNQJ 1SC9A 1DQ8A 2B0GA 1M1ZA 4YRAA 3AR8A 2K2WA 3CYFA 4ZO9A 2V4RA 5TXGA 2CJYA 1CRZA 2WKQA 4V0LA 4WKRA 2F3JA 3ORQA 4DZRA 4J9MA 5EERA 5E3QA 3DGPB 4PS1A 4RGVA 4BKUA 2NTJA 4QYXA 2IPLA 1SB8A 4PXBA 3D8UA 4TQSA 1THGA 2WM9B 3W4IA 1GLVA 2WSSD 4JA2A 4ENOA 4FMDF 2R66A 2Z3VA 4KEAA 4M7RA 5FBVB 4LREA 3H99A 2I33A 2FPPA 4XPIA 3MBIA 2XA1A 2E18A 3HP4A 2EBGA 1RWWA 2ZS8A 3I4CA 4YQYA 5EJGA 4LFAJ 5HQ3A 3NHFA 4NX9A 3M6WA 5DOZA 3AR4A 3I9V6 3F4LA 4QT0A 1RAAB 3HI4A 3MVEA 3QXHA 2LLZA 3CNHA 3TR6A 3WB1A 4E5PA 3R5DA 3UY4A 3D2WA 2P4HX 4UMVA 1UVLA 2FPIB 3PU6A 5C32A 1U1GA 3H2IA 4AG3A 1JJ2R 4LZOA 4WFKA 3BOSA 3UGJA 3EXHA 2YV1A 3SZ3A 1EBBA 4XQGA 4F4HA 4X1YA 3PEUA 4HR2A 3O47A 2WJ6A 1E6YA 1W1UA 2GHPA 3QW4B 4Q3NA 2XNDA 4RFSB 5A1IA 2B1GA 3L4EA 1MFPA 2A5JA 2P6MA 4B5KA 3I04A 4NOHA 4C4PA 3AUXA 4XSVA 2VO1A 1XRQA 3PT9A 3HHLC 4DSLA 1OOEA 3I6IA 7ADHA 5HZGA 3RYCB 1F5CA 4MVJD 1NRWA 4GMGA 5EG5A 1HBUA 2ZYIA 2FEKA 1VG9B 3CRRA 5LVAA 1ZPVA 3WLIA 3K32A 1J2RA 4N8SA 1Z5OA 3FZNA 4OU5A 4KRGA 4H4KC 4EHAA 2OZPA 2CCJA 1ZD5A 1CVLA 2IEZA 5KOXA 4L95C 4I1OA 1NDUA 4JUZA 2OHGA 1UADA 3PLAE 1Q5VA 2MY7A 1OAKA 3CLSC 3HCWA 3GHYA 4TTIA 2MLXA 5H9VA 2BELA 2CLFB 4EJSC 1JR2A 4UDOA 4KN9S 4F67A 1PK9A 3UWSA 3NXZA 2IEBA 1QYDA 5IAGA 4A2PA 5LMUJ 3GJ8A 2PS1A 3AXTA 4PEVA 4V0MA 4UOHA 1HZZC 3QFSA 4L5CA 5HIKA 1H1LA 4YRIA 4KPFC 4PXSA 2JCGA 5FQOA 3EXEA 2FPUA 3L8CA 3BXPA 4PWYA 4PUHA 1IBMB 2YJZA 2C2HA 3AVWA 4AJJA 3EZOA 3RBEA 4DI6A 4EELA 1JRLA 3CLKA 2MSTA 4U8YA 1UA1A 3M5WA 4U1RA 1TYDE 4UZFA 3O8BA 4B3OB 3R3VA 4EI2A 4CF7A 1N0VC 3F4KA 2QSJA 2DH7A 4WL0A 5IDXA 4PE5B 1LRLA 1CB0A 4AX4A 1G8JA 2VNKA 5IYZF 2WYOA 3N8NA 4N49A 1CX9B 1KJIA 1ZN7A 1XP8A 1PU2A 3TFQA 3U62A 4YS2A 1C9EA 1NOJA 1PV2A 4B9SA 3GXBA 1DP4A 2ADOA 4PTLA 4TMXA 3AQPA 1YWGO 1NBME 5DGIA 2BGLA 4R69A 4OYOA 2OGZA 3WGKA 3K4QA 5JD3A 1A9OA 1U3VA 2Q46A 1Y6FA 5DM0A 4NHEA 4HMOA 3A1FA 3EC1A 4RMHA 4DQLA 4CT8A 3F46A 2XV1A 2DGUA 4EYGA 5ETOA 3UDEA 3LA8A 1QVGR 4WNAA 2MKYA 4RANA 4C0LA 4MW5A 2X0IA 1UQRA 1ZA1A 4ETMA 5CFQA 2O2YA 4REOA 5F8HA 3PFBA 4BN0A 2BJ8A 2AJTA 3A4TA 2YMMA 2QPAA 2CUKA 3IAM9 4B6JA 2CZCA 3T35A 3Q2KA 4BQPA 2R00C 1YZGA 4WV3A 1Y4ZB 2MYFA 4MINA 2VL7A 3RBZA 3MECB 5F21A 1X1BA 4RSGA 3NPMA 5I9MA 4TXJA 3WGTA 1LUAA 2OGTA 3DRYA 4LJLA 4CI0B 2J3QA 3O2IA 1T4CA 3N2ZB 5I4KA 4TS1A 3TCNA 2EL7A 2Z56A 3NNSA 1T0IA 3OH8A 4HDKA 3WQHA 2XTZA 4EVIA 3OTIA 3PRKE 5FL3A 2QV0A 4H2DA 4DZTA 4GKKB 4ED9A 3HNRA 3SPXA 3QFRA 2XOKA 5J2TF 1QH1B 2AWNA 1K8AT 2UXCC 1X1TA 2PTHA 1GPJA 2BLNA 3JATA 4US2R 1HBOA 4NBNA 1XRJA 2QVBA 3W05A 2B9XA 2NAPA 2Z6QA 5HFJA 1ZQ9A 3FI9A 3E3OA 2TYSB 1GFWA 1VE9A 4HXYA 4RQUA 1UP1A 5KCMA 9LDTA 1U48A 2IUTA 2IPAB 3UCUP 1ZB8A 3A6PC 5H1YA 1I1NA 4F04A 2JCXA 1A9TA 2M5OA 2DCUB 3CKLA 2VDNB 2VWGA 4PGMA 4Q47A 2VDKB 3GLGA 3IMQJ 2FDNA 5AK4A 2D7JA 5BP7A 4O2BB 1X8LA 4QBTA 5CDYA 2MOKA 1M3SA 3ETEA 3G2QA 3SQGB 4DCPA 1DAKA 1PX2A 3GRKA 4OAOA 3VJMA 1WG1A 4PPQA 4FT4A 2MQNA 1OPIA 3SSSA 1L3CA 1KY2A 1SL2A 3M3HA 1X9MA 3PK0A 1WW2A 4ZOAA 1S8NA 4D26A 2VSQA 1XEWX 3LH5A 4X1IB 5ESRA 3HZOA 4EUEA 4Z7QB 5C8DA 3SZMA 1TZKA 2W9CB 3JD2A 4LAFA 1U0FA 3TL6A 1QQAA 4NDNA 1GSAA 5KYGA 3NYIA 3LL4A 3LRPA 4ZIVA 3MCSA 3BTVA 2QU7A 2GYWA 4RKYA 4XRRA 1JHRA 3P1JA 1IB0A 1CZKA 4Q18A 4KLAA 3KQQA 5B6PA 3DE0X 4X4OA 2C2RA 1S2IA 3U49A 2COUA 3H0KA 3QYPA 2QAJA 4EF4A 1C1CA 2QG9B 4JI8B 5H7XA 4V0SA 2CXTA 3WGZA 3EGXB 1YJWS 3IDFA 1R8JA 2SCUB 3OFKA 5AW9A 3U9LA 1E4YA 1WEXA 1SBHA 4A8OA 5CDTA 3ONQA 2PFDA 5FJIA 3LOPA 2R6HA 4QR1A 4ENSA 3W5AA 1G8PA 3PTLA 1EB0A 1ZGAA 1E3EA 3DEZA 2PKWA 3G0IA 4I9HA 1YA6A 4PXCA 1TR0A 5AHOA 3DL4A 3WDMA 2R2TA 2OG1A 3JQCA 4OL9A 2OFPA 4GMKA 3MTKA 2Y1CA 5FUXA 1T25A 1F1BB 3O4HA 1O6CA 1M2FA 2DR0A 4DWWA 3LQKA 1FFGA 3VU9A 3PFHA 5DHUA 3DZCA 2GLTA 1F3LA 3KSBC 1P2SA 4BMCA 1VKJA 1ORHA 2JARA 2HIHA 3FMWA 2VAMA 3EF1A 1BN6A 5A5FA 3IVMA 3GI1A 4BC9A 5EXSA 4HN9A 5BSHA 2Z6AA 1OBCA 1PD0A 5AVSA 2FZKB 2Q8NA 5DH9A 5LDDC 3TR5A 1BE8A 4X63A 2DLDA 5AQEA 3IJ5A 3LXMA 1PYDA 3ZZUA 1G9XA 3STTA 4GQAA 2B6HA 2J9DE 2VQEB 1L4HA 5K0LA 1EWTA 4H15A 3AR5A 1AHIA 3REQB 5JAOA 3JQBC 1MQ9A 2QL8A 3JD4A 3FF4A 3JAMD 4PXAA 5LMNC 5HVHA 1YRYE 2HSJA 1E1RD 1E3QA 2GMJA 3K53A 4XASA 3I1IA 3H2UB 4ZVOB 3HSSA 1XTUA 2XAAA 4JNKA 1DXYA 3D6MB 1KFDA 1CG6A 4MWEA 2J0UA 4A26A 3JSBA 5L1KA 2C00A 1TKZB 2E4AA 4HSEA 4I5GA 1LFDB 4LF7C 4PC3A 2R8BA 3IC5A 4J9PA 1RHUA 1Z4IA 2A1UB 5JSUA 1P5JA 4D9CA 3J81D 4X84A 5ETVA 3F6CA 2GWHA 1QHYA 3OWHA 4Q7EA 2R6JA 2CVQA 3EK2A 4MVXA 4ATNA 1J4AA 1GY8A 1ZKDA 3DRSB 3C3BA 1L7AA 3DPUA 4MKXA 5IWAC 2ICAA 5EFZA 1AMOA 2BEUB 3KZOA 4HF7A 1Z5GA 4J0GA 3C2QA 4FMDB 5M04A 5JEEA 1OYDA 1TAUA 5ALVA 1XMOF 3JB9k 4CEHA 1RMQA 4M76B 1WI6A 2B94A 4X6LA 4G1QA 1CUAA 2ASEA 3AY6A 4PXEA 1JDBC 4M0PA 2P9CA 3ERCA 2RE8A 2FJVA 1Z5WA 3MECA 1BGWA 1Q7BA 4ETZA 4U7UD 4BVJA 2DPMA 3JQQA 5FOXA 4YUAA 5EHGA 2H5JA 2QQ5A 2ZRQA 5H3LA 4HDKB 1UKBA 1Z5UA 4YN3A 4TLRA 3RRBA 1KZGB 1CF4A 1VFJA 2F3QA 1RWOB 3K96A 3KK0A 1ILWA 1LWXA 4RW4A 3GYNA 3A8JA 4EO8A 3G17A 4KLCA 1CY2A 3CEDA 4GOLD 1U1LA 2BBTA 3BMQB 4MNTA 3TEFA 2QUJA 3M32B 2H31A 2C5FA 3MJTA 4F06A 4LRTB 1P80A 2WIJA 1PWXA 2YIJA 2ZVJA 4PO1A 2SICE 4Y6QA 2ZTHA 3LRXA 1Y8RB 1RA6A 3SCLE 1U31A 1L3SA 5GZ6A 1VB5A 2X9QA 1MD9A 1QLNA 1ZXXA 3E9YA 4NAUA 2VV5A 4YHHJ 3SYRA 2R3VA 5AUPB 2UYHA 3RYCA 2H1IA 1D9FA 2AKWB 5KJCA 2XQKA 2BJ9A 3Q6IA 2Q6VA 2DHEA 2DWCA 1TZMA 3FGNA 1D04A 5ALLA 2H2FA 2AI1A 3R9LA 4LQLA 3U37A 5IUKC 3WICA 3RRJA 2MB0B 4L5JA 2DFKB 5I7VA 3CCES 3UT5B 2V98A 3M4JA 5EXEA 3KYCB 1KVJA 2I80A 2C2NA 3JTNA 4JI6F 1GUAA 2OAP1 1NJ6A 2UUCJ 5IXUA 4X0EA 5JRHA 1OKKD 1OU4A 4HWSA 2NN3C 3IA7A 3PUJA 1Z6AA 3JQ9A 4NJMA 5LU8A 3WC0A 4X8MA 1L7RA 1WUIS 4HYEA 3FBWA 1Z7YA 3C6TA 1UBFA 2RFLA 3SR4A 3ICVA 4RIGA 3OZAA 4F4UA 1DBPA 2VZLA 2JAQA 2AD9A 2XVAA 3LQ4A 2P5TB 4ZA2A 2UXBB 3CCTA 3O4GA 1USPA 5AFSA 5E3RA 2B92A 3MMNA 2AFIE 1JU3A 4P3OA 4KH1B 4LDJA 5CYQA 2YVAA 1HEUA 4F6CA 4IFYB 1RCOB 1DFIA 5FI0B 4OAQA 2RC6A 1A8UA 1LOUA 4URUR 2IIPA 1XZEA 3U5ZB 5D86A 2C2BA 4X1IA 5HBMA 4I81A 3GUVA 4FC6A 4M99A 4ZQFA 3CD0A 2PUEA 3P96A 2E3JA 5F23A 1KDZA 3DLBA 4M0CA 4YPFA 3JYPA 8RUCA 2Y1IA 4B3TC 4PSVA 5ICFA 2HNBA 3N0VA 4OQZA 3W61A 2VUSA 1KQSR 1U65A 3GDOA 3T9ZA 4F38A 2NOAA 4ZIRA 2XYRA 5HVFA 4U96A 1T8YA 5HF6A 5IOLA 3BWMA 2Z5GA 3VJLA 4OIMA 5KNDD 3LT5A 2PR7A 1KXJA 3T9AA 4IMPA 5IT9A 2PUHA 3AOAA 3K1ZA 1GA1A 2SCUA 5AJ3J 2ZVSA 1H7WA 5CLQA 3SQOP 1NT2A 5KNCH 5BY2A 3MCOA 3BF7A 2PPLA 3IALA 2ONYA 4O0LA 3SSOA 1FX2A 4PYOA 4F21A 5DMXA 1ZK0A 4IDHA 3FSGA 1ISHA 2F43A 3VKFA 4YLYA 4IIHA 2E66A 1F38A 3ZWYA 1F5SA 3OW2R 4WOKA 4U7GA 5EI5A 3VI4B 2VTBA 2J1LA 3DV0A 4UOZA 2MJUA 2P9FA 3DD5A 4I08A 5FIIA 3ZX5A 1Z6TA 4KBGA 2DXEA 4W9NA 4Z2AA 1UDAA 1VJCA 3FPHA 1ZWKA 5ICCA 4KN6A 4KIFA 2YCBA 3ZYZA 4RJVA 2L42A 2ZPAA 3QGIA 1S6YA 1BY9A 4FR0A 4B6RA 4ZP6A 3ILSA 4X8OA 4BLRA 5CYQB 1HWYA 5A3QA 4H7JA 4Y9RA 3ZC4A 4JC0A 3ZHUA 1FP1D 3N8KA 4GWLA 4G4JA 3UYKA 3H19A 5IK2A 1YZLA 3E8SA 5LDHA 4LYGA 1N2XA 3AKDA 1ZITA 1V11A 2WU0A 4ZREA 3B5JA 5BV8A 2I99A 3PQ4A 1EUDA 2ZSIA 4OJKA 4W4MA 1C29B 2YVQA 2WA1A 4ZDNA 4LECA 2Y1EA 1U9YA 5G41A 5HSGA 4N82A 1XRBA 1JLLB 3UWOA 3F9IA 4NAHA 2AJ8A 4B3SJ 3SF8A 2QYHA 4TX1A 3ZDQA 2M52A 2HNYB 4CQLA 4UQOA 3N58A 3NDIA 4PW0A 1R0BG 1Z5NA 3GE9A 4JR0A 3CF2A 4QUEA 4FFMA 4LRBA 3T7AA 1NZJA 4WXWA 4MV8A 5T6BA 1T1GA 4E08A 2IKSA 5CYFA 1V6HA 2GH1A 2UVUA 1N2SA 2QLFB 4UNQA 1U1IA 4AP5A 2Z5VA 2N75A 2DT8A 1E0SA 3DCIA 1UK7A 2GS9A 4PYAA 4PN7A 1TKDA 4B48A 2O2GA 2KM8C 2HMWA 2JKVA 4IRKA 4ZVFA 1KD1T 1ILEA 3E9DA 4HNVA 1MV5A 3I31A 3ZE1B 2DBRA 1QVRA 5TV2A 2EFNA 2BY4A 2H3HA 4BO9A 1KZ1A 4YT8A 621PA 4YHHF 1RWXA 3IODA 4RETA 2O5EA 5D1NA 4UAVA 2V50A 2P5YA 3GO4A 3A1DA 1NSKL 1YR3A 2ZE8A 2QD3A 3QFHA 3UV7A 3IP6A 1T36A 4F86A 3AVPA 5GONA 4U2DA 1KLMA 2OFFA 1MJGM 4B3RC 2A18A 4WNCA 2DGXA 2DBBA 3DEAA 2YVUA 1XZNA 3GU3A 1BHSA 3M83A 1A0OB 2EF0A 1G66A 1QRDA 5TMBA 3NOOA 5JATA 3A3OA 1EUCB 2VPYB 3QKRB 1U3WA 3QPWA 2OK7A 3JQJA 1NBEA 2OFHX 3RUCA 2AR0A 3DFFA 1LWEB 5DJBA 2PZKA 2EC5A 5DZ6A 5IFMA 4O0MA 2HREA 2E82A 1CLFA 1ENOA 3RYIB 1E3JA 5DTIA 2HBZB 1D3AA 1VLYA 3DEKA 1QHFA 2M8HA 3W6UA 4HC4A 1GXSA 5ILGA 5LOVF 5B09A 4ZVRA 1QB8A 5CGQB 2VPTA 1KQGB 1R8HA 4KYTA 1FU4A 4RR5A 4BJ1A 2D2XA 3C3CA 4H0FA 2GEDA 5F33A 5JCOA 3AFMA 2AZ1A 1RE1A 2OAGA 5KEIA 4C0KA 5TNXA 4YO7A 4N3NA 3M6LA 5C51B 3OESA 5JNTA 3DS8A 3TIGA 3KK2B 5KDDA 4DIUA 4NJEA 4OHCA 1LW2A 4KR7A 3WQRA 1P9NA 3WYBA 3K9NA 1ZUIA 4RKQA 3FCOA 1I30A 3AF2A 1ML3A 3QMVA 4ENWA 5CH5A 4RGYA 1VS3A 2BEFA 5IC4A 4IHKA 4JL6A 4WKGA 3JSMB 3KJXA 4OAPA 3G6ES 2V7GA 2IZ6A 1KPGA 2OCYC 3BTSA 5SV2A 5BQPA 1NYRA 2CDAA 3D3NA 2PFKA 5E8RA 4D9HA 1S7IA 4OMUA 1RY2A 4YMHA 1IQUA 4AQYB 2HHQA 1CJKB 4WY2A 2CYAA 4IM7A 2F1KA 3S8SA 3T5GA 5KTKA 3RTGA 3O3MB 5G1OA 1B0UA 1XYGA 5FX2A 4GPIB 3NIFB 1E92A 1J00A 3NRJA 4ZP1A 4GAEA 4F6RB 3PHBE 1VMAA 1X86B 4ZZ0A 3TMKA 2XGGA 1EWYA 2JIOA 1Q1ZA 2B9VA 1G7CA 3LKBA 3CZ4A 4LJAA 3KKFA 2OTCA 3KHGA 2VK8A 4DR4F 2YV2A 5DASA 1KQ3A 1LV7A 2NQPA 2FVPA 4DV0C 3JSXA 1LWEA 4JHLA 3QVLA 2EGTA 1RU1A 3R3YA 2YMPA 3FDZA 1FEEA 4RPJA 4E1VA 5JVDF 3RK0A 1VISA 4QRDA 3GIWA 4I2VA 1VIDA 1WTCA 5FUWA 4NMXB 4RPFA 1V5GA 2FWNA 2FMFA 3L95X 1KQGA 2AX4A 2VH7A 3PFWO 2PNFA 4CM6A 5I9LA 3DEJA 1SG0A 3Q0EA 3G59A 4LSNA 2BJ3A 3QEBZ 1KO4A 3UGTA 3LAMA 2HFVA 1EDDA 3N9UC 3WHKA 5DCUA 4PIVA 4FTFA 1G1AA 5DYIA 3HVHA 4NDAA 4QDJA 5JZ9A 4DLLA 3FC9A 2FE1A 1HARA 4BMYA 2K5UA 3QLEA 3SNHA 1PDVA 3LCVB 2BW0A 3OIGA 2ZJYA 4KLNA 3JQ7B 4R0VA 2O2IA 1ZUWA 2VYND 3TYXA 3IOEA 2PMWA 2DRIA 3RUFA 4K03A 1CY0A 3VTKA 4RNDB 1ORWA 3TA2A 4FB4A 3LHKA 4MQ5A 1N6PA 3MM7A 4Y7DA 4O2AA 4JELA 4S24A 1WBDA 3DO6A 2WAOA 2RE1A 4DQUA 2WKSA 1K5DA 1N34B 1MTZA 5A4MS 3IPLA 2GQ2A 1WXFA 3G3EA 3SKXA 3JD3A 2DBVO 1SPBP 1WTBA 3EVNA 4GGPA 1TTQB 1W581 4Z9AA 1G8AA 3CJ4A 4YAUA 1LW6E 3EJ6A 5BURA 4YCSA 3RASA 3DWIA 1W5SA 3FGPA 2KRBA 4ZCQA 3UFXB 5KB3A 1M5PC 2P8JA 1ODCA 1L7OA 2P5UA 5J2QA 5HE9A 3T5BA 4BKQA 4MO2A 1CJUA 4DV3C 2WYVA 5DPMA 1JG3A 1ZA1B 1CHDA 3DL2A 3NHPA 1RAJA 1C1YA 5I6DA 3E7DA 1QIFA 4D7AA 2G25A 1EEXB 1ZHOA 1EUDB 2CWXA 2AEJA 3JYHA 1GPKA 3ML1A 1KWGA 3F44A 5AK0A 3CLUC 1M7GA 5HAOA 3QYYA 2GASA 2P9QA 3DE1X 2WQ7A 1L1RA 2P3SA 4IXMA 3ROMA 4O3SA 1RJFA 2FPIA 1PLKA 3CEPB 5KMGB 2BWJA 2V2QA 3A36A 1EQ2A 1MC8A 4FBLA 4C5BA 3QA9A 3FNHA 1X7HA 1SFRA 3K5OA 3FI0A 2BANA 2FSSA 4HDRB 4ZVUA 4DPXA 2VF8A 3BBFA 3PX2A 1WXWA 3OVMA 2JC0A 3ZE7A 3G02A 1DC7A 1BFDA 1NPTO 4DEYA 3WZ2A 3IBTA 2W70A 2PO5A 5TIIA 4TPKA 4XVQA 5CABA 1M90T 1P77A 3ZNQA 1EU1A 5DZSA 3UJDA 2VT3A 3KQNA 4CKBA 4DE5A 4PYJA 2YKQA 3NXSA 3D4JA 3VQTA 3OQMA 2CJPA 4O4IB 2X9LA 2VPWB 2W25A 4X8LA 2XWXA 1MAWA 3RAXA 1QNLA 5CB4A 1B14A 5JQGA 3PHLA 3ZWAA 3W06A 3OOSA 4F26A 5JSQA 5JHGB 4PPFA 2DIVA 4P82A 3FHLA 1L5GB 4EPXA 2G09A 3AW8A 4TTAA 2JGKA 3H25A 3EPHA 5KFTA 2CZ4A 4HT7A 3SSAA 2G04A 1S1MA 1CP3A 5CURA 3FGZA 2WAQD 4DS5A 2WTUA 4W4TA 3MGJA 3MLEA 1M5OC 3SYNA 1FLOA 3BEGB 5IEJA 1WDWB 3RTDA 4Q9KA 4NCIA 1EK0A 1CJKC 1OREA 1N1EA 5A7FA 1OT5A 3B7PA 3MT7A 1V37A 1NLYA 4KZKA 4MKIA 2GETA 1RRVA 1IR2A 2CDRA 4Z9YA 3T4PA 4OHYA 4G97A 3PGXA 5K20B 3NKYA 2H8GA 3HMJG 3CLVA 3STYA 2H7XA 3Q7SA 5CVUA 5FEMA 4A15A 5KCZA 3O8RA 4PLTA 1NE2A 5B6IA 2W93A 4YP1A 4WK0B 4I0WA 2CV1A 4P10A 5DP2A 1DQZA 3EISA 3U0VA 3WXMA 2VG5B 2KH9A 1CQMA 1QZUA 4KVFA 3MOGA 2CIMA 5BXIA 3A6FA 1OYWA 1FP7A 3LK6A 1D4AA 5K3CA 1YRWA 4NXNC 4R40A 4F6RA 2X0JA 5LZ2A 2YBEA 3RFTA 3JQ9C 3VMMA 3FCYA 4J9RA 3EGNA 1N2JA 3H9QA 1T6NA 4LBVA 1GU0A 3O21A 4G0WA 2QL9B 2WIFA 3DL0A 4RHXA 1E9BA 3PEVA 1ZUNA 3HMKA 4X66F 3MG9A 3BD9A 5D3MB 5TQVA 3SLGA 5LQJA 2AEFA 3OHAA 1V7CA 2AG6A 4JLSA 3EF0A 2V9CA 3TBFA 4XIYA 1QYCA 5FUMA 4NMLA 3L6CA 1QU3A 3R5AA 3R3ZA 3KOMA 4CDMA 4PHCA 1QF9A 3T34A 3AOEA 4E2FB 3USES 1OR8A 2JI7A 2OPQB 1TTTA 4I4TF 5DGDA 3OR1A 2JLZA 4QJ4A 2F1IA 1TFYA 3KHUA 3O94A 3GH3A 3W3AD 4EBFA 1L5KA 1GQ2A 1TVEA 5A0YA 4BDSA 4AS3A 1A9XB 1PCAA 3SHVA 3VTZA 1J5XA 1Y4ZA 3OQJA 2HWTA 1SH0A 1AXRA 5EAIA 2LDBA 3OMLA 5AXCA 4AZ0A 3E01B 4O5AA 4ZJUA 1PNVA 2R7WA 2FRDC 5ETLA 4IQ4A 5ALEA 4YJFA 3FBGA 1CRLA 3KTDA 5IAAA 1ZUD1 1N5YB 3PQ3A 1A97A 5CHEA 2BDUA 4G26A 5AKLA 1PJTA 1VYAA 3ZY5A 2GC8A 2HS4A 3GR6A 4IHJB 2G1KA 2VHXA 2WY2D 3FYDA 1L3BA 3BGWA 2E4VA 5TB5A 4MJ7A 3ORFA 5K85A 1S4FA 3QE9Y 4OM7A 1JXAA 4HAXA 3DD1A 1JLFB 1XTTA 3IAHA 5EN4A 2GN0A 1ESNA 2UZ1B 2QPTA 2C2OB 4ID8A 2XUJA 3DT6A 4IW3B 4FOLA 5DG9A 3D8SA 4ZKDA 4CM3A 2CPFA 1QVVA 2RHRA 3MTIA 1MWZA 4ANEA 1KDNA 4WEOA 1QX4A 5HOQA 1BWVA 4NZMA 3GVPA 2V7QD 3DRSA 1ECPA 1IQ0A 1NIPA 3HYNA 3HP7A 3BS9A 3O8DA 1YS9A 3UE2A 3T5HA 3MOJB 3STWA 1VJTA 1ZYUA 4R5PB 4LBZA 3KC2A 3RFCA 1SKBA 3MXOA 1QXSA 4JSYA 5EMMA 3BZUA 2P30A 4QGFA 1XPOA 3O2QB 1KBQA 2HSZA 1JR4A 1D1TA 2G82A 1A88A 2IS6A 3C3LA 4CR6A 4XDDA 2HIGA 3FNQA 2QROA 2Y3IA 1AN0A 1XTBA 3QI7A 4JENA 2QL6A 3N2LA 1VRQC 1MCZA 2XLBA 4DAEA 3UX3A 4JWKA 2C7OA 1AQUA 4QECA 1KOLA 1L1FA 1MJNA 2MSEB 4M0LA 1IWGA 5IMBA 2VDIA 3TI7A 2ACWA 3A6EA 2LIPA 3TH5A 1HBUB 2GEFA 4M9UA 3B6KA 2RT3A 3NIWA 5HZMA 3O4IA 4HLQB 4JKIA 4DILA 5G0WA 1I1OA 3KAJA 1H8ED 2RKBA 2IEDA 4Y3UA 1VCIA 3UN3A 1BQNA 4CM5A 1JBKA 1DQYA 2HRZA 1A2OA 1YL7A 1YRLA 3CN9A 4CQMA 3UR0A 1FTWA 3EIFA 4Q3BA 1NHGA 2B9EA 3Q2OA 4EITA 1SHZA 3E1SA 4LYYA 1Y1TA 2O8EB 3NAGA 5IJWA 2P8SA 4QASA 5GP1A 2V1XA 5CB8A 2J46A 1QD1A 1S9GA 2PLWA 1WU7A 1WOOA 2BT4A 4O1HA 3NT5A 4C0WA 2XBMA 1VLHA 4E3WA 5J2PA 4ICLA 3FRIA 2EX0A 2A0FB 1R0XA 2MSWA 3AT1A 3EXFA 3IR7A 3PC8A 1E6UA 4ZQEA 5CYMB 5H82A 1R0KA 2XI2A 2O3QA 2PX5A 2R8OA 4TXMA 1CEYA 1VSQA 3UK2A 4RTOA 3WIDA 3GAFA 3AU8A 4RJTA 1CQJB 1Q2UA 1QWOA 4TLQA 5BNWA 1F6WA 3RARA 4PLGA 4GKVA 3NAHA 1S3IA 2PAAA 3ZHXA 2PSFA 3O31A 4YR9A 2H6EA 2VFAA 2Y1LA 3VOAA 5CA0F 4Y1GA 4ODIA 1CZNA 2GHRA 4IV8A 4CFYA 4DR5J 3PGA1 3GLUA 1YASA 4XPEA 1JXLA 3NCTA 3EVFA 1B0AA 2F4NA 4J0DA 4I1YA 5DBOA 2CB9A 1DAPA 1CUEA 3BN7A 3K0SA 4QZVB 3IEVA 1KP2A 4DR2C 2GJKA 4RDIA 4DPKA 3BFKA 2DLCX 1PRYA 4EQ6B 1QIEA 2VJVA 1NNLA 5BMVB 1E2LA 4MUHA 4YO8A 1RT2B 1YDGA 3OF5A 4DCUA 4F56A 4KSCA 4AZWA 3QE2A 2ZKTA 1DZ5A 3CCWA 3GW8A 1PZHA 3PJDA 1BJKA 1N36C 2DNNA 1TELA 5DYNA