1PA4A

Solution structure of a putative ribosome-binding factor from mycoplasma pneumoniae (mpn156)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
KERLENDIIRLINRTVIHEIYNETVKTGHVTHVKLSDDLLHVTVYLDCYNREQIDRVVGAFNQAKGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a putative ribosome binding protein from Mycoplasma pneumoniae and comparison to a distant homolog.
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords Probable ribosome-binding factor A
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1pa4A00
4DR2C 2VQFC 4DR3C 5A2QD 4DV0C 2OPLB 4DR7C 4X62C 5IT9D 1XNRC 1XMOC 3J81D 1ML8A 2YCBA 3AF6A 3T1YC 2PT7G 4LF4C 3J80D 4DR6C 1VLAA 2QL8A 4YHHC 4JYAC 2CY1A 4NXMC 2OPLA 3IEUA 4LF7C 4JI0C 1N33C 1JOSA 1XMQC 2E8CA 4K0KC 1N36C 1HNWC 4JI3C 4DV1C 4JI5C 4DV5C 1K0RA 4GKJC 4XX2A 1WF3A 4OX9C 4X65C 1ZB8A 3IEVA 4MH4A 1WH9A 4X64C 4MTNA 3I07A 2E7GA 3OTOC 1IBLC 1HNXC 2E5LC 1L2FA 3GKUA 3LUSA 1IBKC 4LF8C 2F4VC 3CJEA 1USPA 1XNQC 2UU9C 2UUAC 4LF6C 2VQEC 2JMPA 4YY3C 4DR5C 3R9XA 4LFBC 2UXDC 4B3MC 1I94C 1IBMC 1N32C 1HR0C 4DV3C 1NYEA 2CXCA 1HNZC 1PA4A 2UUCC 1USPB 2E8EA 5FLXD 2UUBC 1FJGC 1LQLA 2ONFA 3JAMD 4DCTA 2ZM6C 2UXBC 2HHHC 4KHPC 1UKKA 2ATWA 4JV5C 4JI6C 4GKKC 2HJGA 1MKYA 1ZB9A 4B3TC 4X66C 2XR1A 4BSZA 3R9WA 4DR4C 4JI2C 2KZFA 1KKGA 5LMNC 4DV6C 4JI7C 2BJOA 2UXCC 4LFAC 5IWAC 1J5EC 1EGAA 2E8FA 4NXNC 2D7VA 3EERA 4B3RC 4DV2C 4JI4C 4DCVA 1HH2P 4JI1C 2DYJA 4NOZA 2ASBA 4AQYC 4LFCC 1N34C 4DCUA 3AF5A 4DUYC 2EGTA 4JI8C 4LF5C 3T1HC 4DV4C 4B3SC 4LF9C 1QWIA 1N2FA 4DUZC 4DR1C 5BR8C 4DCSA 4DV7C 5LMUC 2PN2A
chains in the Genus database with same CATH superfamily
3A25A 1T5DX 1V25A 3VNSA 2OPLB 4DR7C 2VSQA 1MDBA 4WS9A 3NYRA 1ML8A 2PT7G 2MMAB 2QL8A 4G36A 3E7WA 2YWCA 2WP0C 1O90A 4LF7C 3CQ1A 5K85A 2P2MA 1PG4A 1M6XC 4K0KC 5ADZA 1N36C 4PUHA 4WV3A 4JI3C 1BA3A 5BUQA 2P02A 5K8FA 2Y4NA 4XX2A 2QVYX 5BSRA 4FTFA 1RY2A 4X65C 4MH4A 3I07A 3FCCA 3LAXA 2OBVA 3TQIA 3LNOA 4D4GA 1P4EC 2F4VC 3KXWA 5A1GA 3CJEA 1USPA 3CQ3A 1TH5A 2YX1A 2JMPA 4G37A 4DR5C 1ULTA 3NPDA 1HR0C 4DV3C 4L2ZA 1HNZC 5AE3A 3S82A 2QW0X 4D4IA 1O93A 3GR1A 2KDNA 3JAMD 3TUFA 2UXBC 2HHHC 4GKKC 4KTVA 2MCQA 4X66C 4NDNA 5CZVA 4JI2C 5LMNC 1QM4A 2BJOA 4LFAC 5A1IA 4RM2A 2D7VA 3H2TA 2P2JA 4OXIA 5KYTA 4NOZA 2ASBA 1YJ7A 4K0BA 2EGTA 2Y4OA 3N54B 4LF5C 3T1HC 5JRHA 4I9FA 2PROA 5BR8C 5T8TA 2VQFC 4DR3C 3N2QA 4X62C 2D1QA 4R1MA 3J81D 1RG9A 4LF4C 1VLAA 5GTDA 2CY1A 4OYCA 1T5HX 2D27A 3RV2A 3ETCA 2KZ0A 1K0RA 2DHMA 2ZZMA 4GKJC 4GXQA 4R0MA 2CU6A 2QVZX 1WH9A 4X64C 3EQ6A 3OTOC 1IBLC 2E5LC 1PU1A 5IFIA 3LUSA 3A9VA 3TR3A 5BURA 3CW8X 3VNRA 5BSUA 2UU9C 4LF6C 2VQEC 4YY3C 3UOWA 2UXDC 1MXCA 3A26A 1GPMA 5BUSA 1N32C 5H9UA 2UUCC 3PROC 4IZ6A 2UUBC 1LQLA 3PBKA 2ATWA 4JI6C 1VEHA 4B3TC 2XR1A 4DR4C 2Z51A 1XRBA 3R44A 2KZFA 3ETOA 3NI2A 4JI7C 5AE1A 2E8FA 4NXNC 4B3RC 4DV2C 2P2FA 1HH2P 4JI1C 1FLOA 4AQYC 1MXBA 1O9TA 4DUYC 4RLQA 1XHJA 3NYQA 4TPSB 4D57A 4DUZC 4DR1C 3K6RA 3DLPX 2PN2A 4GS5A 4PROC 5A2QD 4BC9A 3UX2A 4DV0C 2P20A 4D56A 5IT9D 2E0GA 1XNRC 1XMOC 4PHTA 4ISBA 3T1YC 1FUGA 1MXAA 4KTTA 3RG2A 4DR6C 4YHHC 4JYAC 4L7IA 1NY8A 3CQ2A 2OPLA 2DPLA 3AY0A 4ZLPA 4DV1C 4JI5C 3GPCA 4DV5C 4OX9C 1P7LA 4RLFA 1V26A 2E7GA 3DHVA 5CZXA 3A4IA 1IB8A 1XS3A 1M6XA 2QVXX 3DAYA 3R9XA 5BSMA 3A9UA 1UWDA 3IMLA 1XRCA 2M5OA 5A19A 4U5YD 1NYEA 2CXCA 4HPVA 1PA4A 3CW9A 3E7XA 3O2EA 1USPB 2E8EA 2AYAA 2D28C 3IPLA 3UZ0A 5DV9A 2M5HA 2ZM6C 1MD9A 1UKKA 4JV5C 4IR7A 1MKYA 1ZB9A 2MM9A 3VNQA 1V60A 4DV6C 2UXCC 1J5EC 3I08A 2D1TA 1EGAA 5T8SA 3EERA 5AE2A 2DYJA 1PG3A 4LE5A 4BC7A 1N34C 4DCUA 5BSWA 4DG8A 4PUIA 4JI8C 2ZZNA 4BCAA 3FCEA 4DV4C 2P2BA 4B3SC 4LF9C 4RVOA 1QWIA 4RVNA 3GR0A 2D1RA 3LGXA 4JM1A 4DCSA 4DV7C 5LMUC 4ZJZA 4DR2C 1MDFA 4FUQA 3B7WA 3PESA 2WD9A 2YCBA 3AF6A 5LCIA 4FUTA 3UX3A 3J80D 3L8CA 3TDEA 1XRAA 4NXMC 4L4QA 5BSVA 3IEUA 3L95X 4JI0C 1N33C 1JOSA 1XMQC 2E8CA 5KEIA 2YWBA 1HNWC 2P2QA 4I9GA 1WF3A 2JNVA 1ZB8A 3IEVA 3C5EA 4MTNA 1HNXC 1L2FA 3GKUA 1IBKC 4LF8C 3SO4A 4GXRA 1XNQC 2UUAC 4BBYA 4RM3A 4LFBC 4ODJA 2NCLA 4B3MC 1I94C 1IBMC 1LCIA 5FLXD 4R1LA 1FJGC 5E7QA 2ONFA 4DCTA 4KHPC 2HJGA 4DG9A 4BSZA 3R9WA 1WCJA 3UEBA 5BSTA 2VZEA 1P4EA 1KKGA 5IWAC 4G1IA 4RMNA 3G7SA 1AMUA 4PUGA 4JI4C 4DCVA 4PZPA 5KYVA 4EATA 4LFCC 3LNVA 3AF5A 2OO4A 2BH1X 2D1SA 2Y27A 2V7BA 1N2FA 1O92A
chains in the Genus database with same CATH topology
1T5DX 1V25A 3VNSA 2OPLB 4DR7C 2VSQA 1MDBA 4WS9A 3NYRA 1ML8A 2PT7G 4G36A 2QL8A 3E7WA 2YWCA 2WP0C 1O90A 4LF7C 5K85A 2P2MA 1PG4A 4K0KC 5ADZA 1N36C 4WV3A 4JI3C 1BA3A 5BUQA 2P02A 5K8FA 2Y4NA 4XX2A 2QVYX 5BSRA 4FTFA 1RY2A 4X65C 4MH4A 3I07A 3FCCA 3LAXA 2OBVA 3TQIA 4D4GA 2F4VC 3KXWA 5A1GA 3CJEA 1USPA 2JMPA 4G37A 4DR5C 1ULTA 3NPDA 1HR0C 4DV3C 4L2ZA 1HNZC 5AE3A 3S82A 2QW0X 4D4IA 1O93A 3GR1A 3JAMD 3TUFA 2UXBC 2HHHC 4GKKC 4KTVA 4X66C 4NDNA 5CZVA 4JI2C 5LMNC 1QM4A 2BJOA 4LFAC 5A1IA 4RM2A 2D7VA 3H2TA 2P2JA 4OXIA 5KYTA 4NOZA 2ASBA 1YJ7A 4K0BA 2EGTA 2Y4OA 3N54B 4LF5C 3T1HC 5JRHA 4I9FA 2PROA 5BR8C 5T8TA 2VQFC 4DR3C 3N2QA 4X62C 2D1QA 4R1MA 3J81D 1RG9A 4LF4C 1VLAA 2CY1A 5GTDA 4OYCA 1T5HX 2D27A 3RV2A 3ETCA 1K0RA 4GKJC 4GXQA 4R0MA 2QVZX 1WH9A 4X64C 3EQ6A 3OTOC 1IBLC 2E5LC 5IFIA 3LUSA 3A9VA 5BURA 3CW8X 3VNRA 5BSUA 2UU9C 4LF6C 2VQEC 4YY3C 3UOWA 2UXDC 1MXCA 1GPMA 5BUSA 1N32C 5H9UA 2UUCC 3PROC 4IZ6A 2UUBC 1LQLA 3PBKA 2ATWA 4JI6C 4B3TC 2XR1A 4DR4C 1XRBA 3R44A 2KZFA 3ETOA 3NI2A 4JI7C 5AE1A 2E8FA 4NXNC 4B3RC 4DV2C 2P2FA 1HH2P 4JI1C 4AQYC 1MXBA 1O9TA 4DUYC 4RLQA 3NYQA 4TPSB 4D57A 4DUZC 4DR1C 3DLPX 2PN2A 4GS5A 4PROC 5A2QD 4BC9A 4DV0C 2P20A 4D56A 5IT9D 2E0GA 1XNRC 1XMOC 4PHTA 4ISBA 3T1YC 1FUGA 1MXAA 4KTTA 3RG2A 4DR6C 4YHHC 4JYAC 4L7IA 2OPLA 2DPLA 4ZLPA 4DV1C 4JI5C 3GPCA 4DV5C 4OX9C 1P7LA 4RLFA 1V26A 2E7GA 3DHVA 5CZXA 3A4IA 2QVXX 3DAYA 3R9XA 5BSMA 3A9UA 3IMLA 1XRCA 5A19A 4U5YD 1NYEA 2CXCA 4HPVA 1PA4A 3CW9A 3E7XA 1USPB 2E8EA 2AYAA 2D28C 3IPLA 3UZ0A 5DV9A 2ZM6C 1MD9A 1UKKA 4JV5C 4IR7A 1MKYA 1ZB9A 3VNQA 4DV6C 2UXCC 1J5EC 3I08A 2D1TA 1EGAA 5T8SA 3EERA 5AE2A 2DYJA 1PG3A 4LE5A 4BC7A 1N34C 4DCUA 5BSWA 4DG8A 4JI8C 4BCAA 3FCEA 4DV4C 2P2BA 4B3SC 4LF9C 4RVOA 1QWIA 4RVNA 3GR0A 2D1RA 3LGXA 4JM1A 4DCSA 4DV7C 5LMUC 4ZJZA 4DR2C 1MDFA 4FUQA 3B7WA 3PESA 2WD9A 2YCBA 3AF6A 4FUTA 3J80D 3L8CA 3TDEA 1XRAA 4L4QA 4NXMC 5BSVA 3IEUA 3L95X 4JI0C 1N33C 1JOSA 1XMQC 2E8CA 5KEIA 2YWBA 1HNWC 2P2QA 4I9GA 1WF3A 1ZB8A 3IEVA 3C5EA 4MTNA 1HNXC 1L2FA 3GKUA 1IBKC 4LF8C 3SO4A 4GXRA 1XNQC 2UUAC 4BBYA 4RM3A 4LFBC 4ODJA 4B3MC 1I94C 1IBMC 1LCIA 5FLXD 4R1LA 1FJGC 5E7QA 2ONFA 4DCTA 4KHPC 2HJGA 4DG9A 4BSZA 3R9WA 5BSTA 2VZEA 1KKGA 5IWAC 4G1IA 4RMNA 3G7SA 1AMUA 4JI4C 4DCVA 4PZPA 5KYVA 4EATA 4LFCC 3LNVA 3AF5A 2OO4A 2BH1X 2D1SA 2Y27A 2V7BA 1N2FA 1O92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 C;  2VQF C;  4DR3 C;  5A2Q D;  4DV0 C;  2OPL B;  4DR7 C;  4X62 C;  5IT9 D;  1XNR C;  1XMO C;  3J81 D;  1ML8 A;  2YCB A;  3AF6 A;  3T1Y C;  2PT7 G;  4LF4 C;  3J80 D;  4DR6 C;  1VLA A;  2QL8 A;  4YHH C;  4JYA C;  2CY1 A;  4NXM C;  2OPL A;  3IEU A;  4LF7 C;  4JI0 C;  1N33 C;  1JOS A;  1XMQ C;  2E8C A;  4K0K C;  1N36 C;  1HNW C;  4JI3 C;  4DV1 C;  4JI5 C;  4DV5 C;  1K0R A;  4GKJ C;  4XX2 A;  1WF3 A;  4OX9 C;  4X65 C;  1ZB8 A;  3IEV A;  4MH4 A;  1WH9 A;  4X64 C;  4MTN A;  3I07 A;  2E7G A;  3OTO C;  1IBL C;  1HNX C;  2E5L C;  1L2F A;  3GKU A;  3LUS A;  1IBK C;  4LF8 C;  2F4V C;  3CJE A;  1USP A;  1XNQ C;  2UU9 C;  2UUA C;  4LF6 C;  2VQE C;  2JMP A;  4YY3 C;  4DR5 C;  3R9X A;  4LFB C;  2UXD C;  4B3M C;  1I94 C;  1IBM C;  1N32 C;  1HR0 C;  4DV3 C;  1NYE A;  2CXC A;  1HNZ C;  1PA4 A;  2UUC C;  1USP B;  2E8E A;  5FLX D;  2UUB C;  1FJG C;  1LQL A;  2ONF A;  3JAM D;  4DCT A;  2ZM6 C;  2UXB C;  2HHH C;  4KHP C;  1UKK A;  2ATW A;  4JV5 C;  4JI6 C;  4GKK C;  2HJG A;  1MKY A;  1ZB9 A;  4B3T C;  4X66 C;  2XR1 A;  4BSZ A;  3R9W A;  4DR4 C;  4JI2 C;  2KZF A;  1KKG A;  5LMN C;  4DV6 C;  4JI7 C;  2BJO A;  2UXC C;  4LFA C;  5IWA C;  1J5E C;  1EGA A;  2E8F A;  4NXN C;  2D7V A;  3EER A;  4B3R C;  4DV2 C;  4JI4 C;  4DCV A;  1HH2 P;  4JI1 C;  2DYJ A;  4NOZ A;  2ASB A;  4AQY C;  4LFC C;  1N34 C;  4DCU A;  3AF5 A;  4DUY C;  2EGT A;  4JI8 C;  4LF5 C;  3T1H C;  4DV4 C;  4B3S C;  4LF9 C;  1QWI A;  1N2F A;  4DUZ C;  4DR1 C;  5BR8 C;  4DCS A;  4DV7 C;  5LMU C;  2PN2 A; 
#chains in the Genus database with same CATH topology
 3A25 A;  1T5D X;  1V25 A;  3VNS A;  2OPL B;  4DR7 C;  2VSQ A;  1MDB A;  4WS9 A;  3NYR A;  1ML8 A;  2PT7 G;  2MMA B;  2QL8 A;  4G36 A;  3E7W A;  2YWC A;  2WP0 C;  1O90 A;  4LF7 C;  3CQ1 A;  5K85 A;  2P2M A;  1PG4 A;  1M6X C;  4K0K C;  5ADZ A;  1N36 C;  4PUH A;  4WV3 A;  4JI3 C;  1BA3 A;  5BUQ A;  2P02 A;  5K8F A;  2Y4N A;  4XX2 A;  2QVY X;  5BSR A;  4FTF A;  1RY2 A;  4X65 C;  4MH4 A;  3I07 A;  3FCC A;  3LAX A;  2OBV A;  3TQI A;  3LNO A;  4D4G A;  1P4E C;  2F4V C;  3KXW A;  5A1G A;  3CJE A;  1USP A;  3CQ3 A;  1TH5 A;  2YX1 A;  2JMP A;  4G37 A;  4DR5 C;  1ULT A;  3NPD A;  1HR0 C;  4DV3 C;  4L2Z A;  1HNZ C;  5AE3 A;  3S82 A;  2QW0 X;  4D4I A;  1O93 A;  3GR1 A;  2KDN A;  3JAM D;  3TUF A;  2UXB C;  2HHH C;  4GKK C;  4KTV A;  2MCQ A;  4X66 C;  4NDN A;  5CZV A;  4JI2 C;  5LMN C;  1QM4 A;  2BJO A;  4LFA C;  5A1I A;  4RM2 A;  2D7V A;  3H2T A;  2P2J A;  4OXI A;  5KYT A;  4NOZ A;  2ASB A;  1YJ7 A;  4K0B A;  2EGT A;  2Y4O A;  3N54 B;  4LF5 C;  3T1H C;  5JRH A;  4I9F A;  2PRO A;  5BR8 C;  5T8T A;  2VQF C;  4DR3 C;  3N2Q A;  4X62 C;  2D1Q A;  4R1M A;  3J81 D;  1RG9 A;  4LF4 C;  1VLA A;  5GTD A;  2CY1 A;  4OYC A;  1T5H X;  2D27 A;  3RV2 A;  3ETC A;  2KZ0 A;  1K0R A;  2DHM A;  2ZZM A;  4GKJ C;  4GXQ A;  4R0M A;  2CU6 A;  2QVZ X;  1WH9 A;  4X64 C;  3EQ6 A;  3OTO C;  1IBL C;  2E5L C;  1PU1 A;  5IFI A;  3LUS A;  3A9V A;  3TR3 A;  5BUR A;  3CW8 X;  3VNR A;  5BSU A;  2UU9 C;  4LF6 C;  2VQE C;  4YY3 C;  3UOW A;  2UXD C;  1MXC A;  3A26 A;  1GPM A;  5BUS A;  1N32 C;  5H9U A;  2UUC C;  3PRO C;  4IZ6 A;  2UUB C;  1LQL A;  3PBK A;  2ATW A;  4JI6 C;  1VEH A;  4B3T C;  2XR1 A;  4DR4 C;  2Z51 A;  1XRB A;  3R44 A;  2KZF A;  3ETO A;  3NI2 A;  4JI7 C;  5AE1 A;  2E8F A;  4NXN C;  4B3R C;  4DV2 C;  2P2F A;  1HH2 P;  4JI1 C;  1FLO A;  4AQY C;  1MXB A;  1O9T A;  4DUY C;  4RLQ A;  1XHJ A;  3NYQ A;  4TPS B;  4D57 A;  4DUZ C;  4DR1 C;  3K6R A;  3DLP X;  2PN2 A;  4GS5 A;  4PRO C;  5A2Q D;  4BC9 A;  3UX2 A;  4DV0 C;  2P20 A;  4D56 A;  5IT9 D;  2E0G A;  1XNR C;  1XMO C;  4PHT A;  4ISB A;  3T1Y C;  1FUG A;  1MXA A;  4KTT A;  3RG2 A;  4DR6 C;  4YHH C;  4JYA C;  4L7I A;  1NY8 A;  3CQ2 A;  2OPL A;  2DPL A;  3AY0 A;  4ZLP A;  4DV1 C;  4JI5 C;  3GPC A;  4DV5 C;  4OX9 C;  1P7L A;  4RLF A;  1V26 A;  2E7G A;  3DHV A;  5CZX A;  3A4I A;  1IB8 A;  1XS3 A;  1M6X A;  2QVX X;  3DAY A;  3R9X A;  5BSM A;  3A9U A;  1UWD A;  3IML A;  1XRC A;  2M5O A;  5A19 A;  4U5Y D;  1NYE A;  2CXC A;  4HPV A;  1PA4 A;  3CW9 A;  3E7X A;  3O2E A;  1USP B;  2E8E A;  2AYA A;  2D28 C;  3IPL A;  3UZ0 A;  5DV9 A;  2M5H A;  2ZM6 C;  1MD9 A;  1UKK A;  4JV5 C;  4IR7 A;  1MKY A;  1ZB9 A;  2MM9 A;  3VNQ A;  1V60 A;  4DV6 C;  2UXC C;  1J5E C;  3I08 A;  2D1T A;  1EGA A;  5T8S A;  3EER A;  5AE2 A;  2DYJ A;  1PG3 A;  4LE5 A;  4BC7 A;  1N34 C;  4DCU A;  5BSW A;  4DG8 A;  4PUI A;  4JI8 C;  2ZZN A;  4BCA A;  3FCE A;  4DV4 C;  2P2B A;  4B3S C;  4LF9 C;  4RVO A;  1QWI A;  4RVN A;  3GR0 A;  2D1R A;  3LGX A;  4JM1 A;  4DCS A;  4DV7 C;  5LMU C;  4ZJZ A;  4DR2 C;  1MDF A;  4FUQ A;  3B7W A;  3PES A;  2WD9 A;  2YCB A;  3AF6 A;  5LCI A;  4FUT A;  3UX3 A;  3J80 D;  3L8C A;  3TDE A;  1XRA A;  4NXM C;  4L4Q A;  5BSV A;  3IEU A;  3L95 X;  4JI0 C;  1N33 C;  1JOS A;  1XMQ C;  2E8C A;  5KEI A;  2YWB A;  1HNW C;  2P2Q A;  4I9G A;  1WF3 A;  2JNV A;  1ZB8 A;  3IEV A;  3C5E A;  4MTN A;  1HNX C;  1L2F A;  3GKU A;  1IBK C;  4LF8 C;  3SO4 A;  4GXR A;  1XNQ C;  2UUA C;  4BBY A;  4RM3 A;  4LFB C;  4ODJ A;  2NCL A;  4B3M C;  1I94 C;  1IBM C;  1LCI A;  5FLX D;  4R1L A;  1FJG C;  5E7Q A;  2ONF A;  4DCT A;  4KHP C;  2HJG A;  4DG9 A;  4BSZ A;  3R9W A;  1WCJ A;  3UEB A;  5BST A;  2VZE A;  1P4E A;  1KKG A;  5IWA C;  4G1I A;  4RMN A;  3G7S A;  1AMU A;  4PUG A;  4JI4 C;  4DCV A;  4PZP A;  5KYV A;  4EAT A;  4LFC C;  3LNV A;  3AF5 A;  2OO4 A;  2BH1 X;  2D1S A;  2Y27 A;  2V7B A;  1N2F A;  1O92 A; 
#chains in the Genus database with same CATH homology
 1T5D X;  1V25 A;  3VNS A;  2OPL B;  4DR7 C;  2VSQ A;  1MDB A;  4WS9 A;  3NYR A;  1ML8 A;  2PT7 G;  4G36 A;  2QL8 A;  3E7W A;  2YWC A;  2WP0 C;  1O90 A;  4LF7 C;  5K85 A;  2P2M A;  1PG4 A;  4K0K C;  5ADZ A;  1N36 C;  4WV3 A;  4JI3 C;  1BA3 A;  5BUQ A;  2P02 A;  5K8F A;  2Y4N A;  4XX2 A;  2QVY X;  5BSR A;  4FTF A;  1RY2 A;  4X65 C;  4MH4 A;  3I07 A;  3FCC A;  3LAX A;  2OBV A;  3TQI A;  4D4G A;  2F4V C;  3KXW A;  5A1G A;  3CJE A;  1USP A;  2JMP A;  4G37 A;  4DR5 C;  1ULT A;  3NPD A;  1HR0 C;  4DV3 C;  4L2Z A;  1HNZ C;  5AE3 A;  3S82 A;  2QW0 X;  4D4I A;  1O93 A;  3GR1 A;  3JAM D;  3TUF A;  2UXB C;  2HHH C;  4GKK C;  4KTV A;  4X66 C;  4NDN A;  5CZV A;  4JI2 C;  5LMN C;  1QM4 A;  2BJO A;  4LFA C;  5A1I A;  4RM2 A;  2D7V A;  3H2T A;  2P2J A;  4OXI A;  5KYT A;  4NOZ A;  2ASB A;  1YJ7 A;  4K0B A;  2EGT A;  2Y4O A;  3N54 B;  4LF5 C;  3T1H C;  5JRH A;  4I9F A;  2PRO A;  5BR8 C;  5T8T A;  2VQF C;  4DR3 C;  3N2Q A;  4X62 C;  2D1Q A;  4R1M A;  3J81 D;  1RG9 A;  4LF4 C;  1VLA A;  2CY1 A;  5GTD A;  4OYC A;  1T5H X;  2D27 A;  3RV2 A;  3ETC A;  1K0R A;  4GKJ C;  4GXQ A;  4R0M A;  2QVZ X;  1WH9 A;  4X64 C;  3EQ6 A;  3OTO C;  1IBL C;  2E5L C;  5IFI A;  3LUS A;  3A9V A;  5BUR A;  3CW8 X;  3VNR A;  5BSU A;  2UU9 C;  4LF6 C;  2VQE C;  4YY3 C;  3UOW A;  2UXD C;  1MXC A;  1GPM A;  5BUS A;  1N32 C;  5H9U A;  2UUC C;  3PRO C;  4IZ6 A;  2UUB C;  1LQL A;  3PBK A;  2ATW A;  4JI6 C;  4B3T C;  2XR1 A;  4DR4 C;  1XRB A;  3R44 A;  2KZF A;  3ETO A;  3NI2 A;  4JI7 C;  5AE1 A;  2E8F A;  4NXN C;  4B3R C;  4DV2 C;  2P2F A;  1HH2 P;  4JI1 C;  4AQY C;  1MXB A;  1O9T A;  4DUY C;  4RLQ A;  3NYQ A;  4TPS B;  4D57 A;  4DUZ C;  4DR1 C;  3DLP X;  2PN2 A;  4GS5 A;  4PRO C;  5A2Q D;  4BC9 A;  4DV0 C;  2P20 A;  4D56 A;  5IT9 D;  2E0G A;  1XNR C;  1XMO C;  4PHT A;  4ISB A;  3T1Y C;  1FUG A;  1MXA A;  4KTT A;  3RG2 A;  4DR6 C;  4YHH C;  4JYA C;  4L7I A;  2OPL A;  2DPL A;  4ZLP A;  4DV1 C;  4JI5 C;  3GPC A;  4DV5 C;  4OX9 C;  1P7L A;  4RLF A;  1V26 A;  2E7G A;  3DHV A;  5CZX A;  3A4I A;  2QVX X;  3DAY A;  3R9X A;  5BSM A;  3A9U A;  3IML A;  1XRC A;  5A19 A;  4U5Y D;  1NYE A;  2CXC A;  4HPV A;  1PA4 A;  3CW9 A;  3E7X A;  1USP B;  2E8E A;  2AYA A;  2D28 C;  3IPL A;  3UZ0 A;  5DV9 A;  2ZM6 C;  1MD9 A;  1UKK A;  4JV5 C;  4IR7 A;  1MKY A;  1ZB9 A;  3VNQ A;  4DV6 C;  2UXC C;  1J5E C;  3I08 A;  2D1T A;  1EGA A;  5T8S A;  3EER A;  5AE2 A;  2DYJ A;  1PG3 A;  4LE5 A;  4BC7 A;  1N34 C;  4DCU A;  5BSW A;  4DG8 A;  4JI8 C;  4BCA A;  3FCE A;  4DV4 C;  2P2B A;  4B3S C;  4LF9 C;  4RVO A;  1QWI A;  4RVN A;  3GR0 A;  2D1R A;  3LGX A;  4JM1 A;  4DCS A;  4DV7 C;  5LMU C;  4ZJZ A;  4DR2 C;  1MDF A;  4FUQ A;  3B7W A;  3PES A;  2WD9 A;  2YCB A;  3AF6 A;  4FUT A;  3J80 D;  3L8C A;  3TDE A;  1XRA A;  4L4Q A;  4NXM C;  5BSV A;  3IEU A;  3L95 X;  4JI0 C;  1N33 C;  1JOS A;  1XMQ C;  2E8C A;  5KEI A;  2YWB A;  1HNW C;  2P2Q A;  4I9G A;  1WF3 A;  1ZB8 A;  3IEV A;  3C5E A;  4MTN A;  1HNX C;  1L2F A;  3GKU A;  1IBK C;  4LF8 C;  3SO4 A;  4GXR A;  1XNQ C;  2UUA C;  4BBY A;  4RM3 A;  4LFB C;  4ODJ A;  4B3M C;  1I94 C;  1IBM C;  1LCI A;  5FLX D;  4R1L A;  1FJG C;  5E7Q A;  2ONF A;  4DCT A;  4KHP C;  2HJG A;  4DG9 A;  4BSZ A;  3R9W A;  5BST A;  2VZE A;  1KKG A;  5IWA C;  4G1I A;  4RMN A;  3G7S A;  1AMU A;  4JI4 C;  4DCV A;  4PZP A;  5KYV A;  4EAT A;  4LFC C;  3LNV A;  3AF5 A;  2OO4 A;  2BH1 X;  2D1S A;  2Y27 A;  2V7B A;  1N2F A;  1O92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...