1PA4A

Solution structure of a putative ribosome-binding factor from mycoplasma pneumoniae (mpn156)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
KERLENDIIRLINRTVIHEIYNETVKTGHVTHVKLSDDLLHVTVYLDCYNREQIDRVVGAFNQAKGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ribosome-binding factor A
publication title Solution structure of a putative ribosome binding protein from Mycoplasma pneumoniae and comparison to a distant homolog.
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Structural genomics, unknown function
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1pa4A00
5FLXD 1I94C 4DV5C 5A2QD 1XMQC 4GKKC 5LMUC 4DR6C 3IEUA 2D7VA 2E8FA 4YY3C 2UXBC 4JI3C 4DV3C 4B3TC 3I07A 2KZFA 4KHPC 2HHHC 1XNRC 2DYJA 3J81D 1N34C 4X65C 3JAMD 2ATWA 2E5LC 5LMNC 2EGTA 4JI2C 4DR1C 4JI6C 1QWIA 1K0RA 2QL8A 4LF9C 1N2FA 4B3RC 1WF3A 1UKKA 1VLAA 2OPLB 3T1YC 4OX9C 4DV4C 2PT7G 4AQYC 4LF7C 4DCVA 2F4VC 1HNZC 4BSZA 4XX2A 2UU9C 4YHHC 4LF5C 2CXCA 4DR4C 4NOZA 2HJGA 3T1HC 3GKUA 3OTOC 2VQEC 3EERA 3IEVA 1HNWC 4DUZC 1PA4A 1USPB 1J5EC 2YCBA 1WH9A 4JI0C 1EGAA 3LUSA 4DCSA 2BJOA 4MTNA 4B3MC 2E8EA 4B3SC 3J80D 4LF8C 3R9XA 4DR3C 1HR0C 4DV6C 2ASBA 1LQLA 1HNXC 4DV2C 5IWAC 4DR7C 1ML8A 1KKGA 2ONFA 4JI5C 4DCTA 2CY1A 1ZB8A 4LFAC 1XMOC 4JYAC 4JV5C 1HH2P 5IT9D 2UXDC 4NXNC 2UUAC 3CJEA 3AF6A 1FJGC 4JI7C 2XR1A 4NXMC 4X66C 4DCUA 4X62C 1N32C 4JI8C 2PN2A 2ZM6C 4X64C 1MKYA 2UUCC 4JI4C 1ZB9A 4MH4A 4LF4C 4DV0C 4DV1C 1N36C 4DR2C 2E8CA 2OPLA 1IBMC 1JOSA 3AF5A 4LF6C 2E7GA 1IBKC 1N33C 2JMPA 4DUYC 4K0KC 1USPA 2UUBC 1IBLC 4LFBC 4DR5C 5BR8C 4DV7C 4LFCC 2VQFC 1L2FA 1NYEA 1XNQC 3R9WA 2UXCC 4GKJC 4JI1C
chains in the Genus database with same CATH superfamily
1I94C 5A2QD 4DR6C 3IEUA 2QVYX 2E8FA 4YY3C 2UXBC 2OO4A 3K6RA 4B3TC 5AE3A 3CQ1A 5KYTA 2HHHC 2DYJA 3A9VA 1N34C 2EGTA 1VEHA 4PUHA 4R1MA 4L2ZA 3DHVA 2E0GA 5GTDA 3ETCA 1WF3A 2QVZX 3T1YC 4AQYC 4LF7C 4L7IA 4D4GA 4DR4C 4HPVA 4NOZA 4EATA 1V25A 3LNVA 3H2TA 4IZ6A 4RM2A 2VQEC 3IEVA 1J5EC 1WH9A 3CQ3A 4DCSA 4RVOA 3NI2A 3R9XA 3NYRA 4DV2C 4G36A 1XRAA 5K8FA 1KKGA 2ONFA 3CW9A 4G37A 2M5HA 4LFAC 1HH2P 3L95X 2OBVA 1V26A 5IT9D 2UXDC 4NXNC 4BC7A 2MM9A 2XR1A 3NPDA 4NXMC 3UX2A 4X62C 1N32C 2PN2A 4X64C 1PG4A 3CW8X 4BCAA 3UX3A 2MCQA 4DV1C 4L4QA 3RG2A 1PU1A 1T5DX 5JRHA 4GXQA 2DHMA 2WP0C 1IBLC 1NY8A 4DV7C 5BURA 4LFCC 5AE1A 1L2FA 5FLXD 2MMAB 4TPSB 4JI3C 4DV3C 3I07A 4KHPC 5BSUA 4OYCA 3J81D 4PUGA 4PROC 4X65C 2JNVA 4D57A 5K85A 1MXAA 1M6XA 1P4EA 2P2QA 2D1QA 1UKKA 2OPLB 4ZLPA 1WCJA 2F4VC 4PHTA 4BSZA 4XX2A 3SO4A 2CXCA 3GKUA 3EERA 3FCEA 4GXRA 4JI0C 2YX1A 1ULTA 1XS3A 1RG9A 5CZVA 1MXBA 4FUQA 4DV6C 1BA3A 1UWDA 4DR7C 4JI5C 1PG3A 4DCTA 5BUQA 4RM3A 3TQIA 4JYAC 2YWBA 3O2EA 4JI7C 5BSVA 2CU6A 4WS9A 4U5YD 3G7SA 3VNSA 2ZM6C 2UUCC 5ADZA 1ZB9A 4MH4A 4LF4C 1O93A 3E7XA 2QVXX 4DG9A 4BC9A 5IFIA 3AF5A 3FCCA 1IBKC 1N33C 2P02A 4DUYC 3PESA 4K0KC 1USPA 4ODJA 4DR5C 5BR8C 2DPLA 2ZZNA 4IR7A 1NYEA 1XNQC 3R9WA 4GKJC 5H9UA 2D1RA 4DV5C 2ZZMA 4GKKC 5LMUC 2D7VA 1RY2A 1O90A 5BSMA 3DAYA 1XNRC 1P7LA 1MD9A 1XRCA 3B7WA 3C5EA 4WV3A 3JAMD 3LAXA 5LMNC 4JI6C 2QL8A 1MXCA 4B3RC 4R1LA 4DV4C 1HNZC 3UOWA 1FUGA 4LF5C 1QM4A 5E7QA 2HJGA 3OTOC 5CZXA 5A1IA 1HNWC 4RVNA 2YCBA 1EGAA 3LUSA 3GPCA 2BJOA 5T8TA 4MTNA 4B3MC 2E8EA 4ISBA 4B3SC 3J80D 4DR3C 1HR0C 2ASBA 1LQLA 4PUIA 1HNXC 2WD9A 5IWAC 1ML8A 1LCIA 2D1TA 4G1IA 3S82A 1TH5A 3L8CA 1O92A 1XMOC 3NYQA 3LGXA 3CJEA 1FJGC 4BBYA 3R44A 1V60A 4DCUA 4LE5A 4R0MA 3DLPX 4FUTA 3UZ0A 4JI4C 2D28C 4PZPA 3TR3A 4DV0C 1N36C 2E8CA 2P2JA 3TUFA 4LF6C 2E7GA 3RV2A 4D56A 5DV9A 2JMPA 2KDNA 5KEIA 2V7BA 5AE2A 4OXIA 2M5OA 1MDBA 1AMUA 2VQFC 3I08A 4I9GA 1XMQC 5BSTA 2Y4NA 3IPLA 4RLFA 2KZFA 5BSWA 2D27A 1O9TA 2Z51A 2ATWA 4JM1A 2P2FA 1IB8A 3PROC 2E5LC 4JI2C 2P2BA 4DR1C 3A4IA 1QWIA 4FTFA 1K0RA 4LF9C 1N2FA 5A19A 1VLAA 3GR0A 3KXWA 4OX9C 3IMLA 2PT7G 3A25A 3A26A 4DCVA 2UU9C 5BSRA 3EQ6A 4YHHC 3T1HC 3N2QA 3CQ2A 2P20A 4DUZC 1PA4A 1USPB 3PBKA 5T8SA 5A1GA 4RMNA 2D1SA 2QW0X 2VSQA 5BUSA 4LF8C 3VNRA 4RLQA 4DG8A 4D4IA 2Y27A 4K0BA 2CY1A 1ZB8A 4JV5C 2YWCA 3LNOA 2UUAC 2KZ0A 3ETOA 4I9FA 1GPMA 2NCLA 3AF6A 3TDEA 4X66C 1FLOA 4KTTA 4ZJZA 4JI8C 1XHJA 2Y4OA 1MKYA 1XRBA 3AY0A 3VNQA 1YJ7A 2P2MA 4NDNA 4DR2C 2OPLA 5LCIA 1IBMC 1JOSA 5KYVA 3A9UA 2VZEA 1MDFA 3GR1A 2BH1X 3UEBA 2UUBC 4KTVA 1M6XC 1T5HX 3E7WA 1P4EC 4LFBC 4GS5A 2AYAA 2PROA 2UXCC 3N54B 4JI1C
chains in the Genus database with same CATH topology
1I94C 5A2QD 4DR6C 3IEUA 2QVYX 2E8FA 4YY3C 2UXBC 2OO4A 4B3TC 5AE3A 5KYTA 2HHHC 2DYJA 3A9VA 1N34C 2EGTA 4R1MA 4L2ZA 3DHVA 2E0GA 5GTDA 3ETCA 1WF3A 2QVZX 3T1YC 4AQYC 4LF7C 4L7IA 4D4GA 4DR4C 4HPVA 4NOZA 4EATA 1V25A 3LNVA 3H2TA 4IZ6A 4RM2A 2VQEC 3IEVA 1J5EC 1WH9A 4DCSA 4RVOA 3NI2A 3R9XA 3NYRA 4DV2C 4G36A 1XRAA 5K8FA 1KKGA 2ONFA 3CW9A 4G37A 4LFAC 1HH2P 3L95X 2OBVA 1V26A 5IT9D 2UXDC 4NXNC 4BC7A 2XR1A 3NPDA 4NXMC 4X62C 1N32C 2PN2A 4X64C 1PG4A 3CW8X 4BCAA 4DV1C 4L4QA 3RG2A 1T5DX 5JRHA 4GXQA 2WP0C 1IBLC 4DV7C 5BURA 4LFCC 5AE1A 1L2FA 5FLXD 4TPSB 4JI3C 4DV3C 3I07A 4KHPC 5BSUA 4OYCA 3J81D 4PROC 4X65C 4D57A 5K85A 1MXAA 2P2QA 2D1QA 1UKKA 2OPLB 4ZLPA 2F4VC 4PHTA 4BSZA 4XX2A 3SO4A 2CXCA 3GKUA 3EERA 3FCEA 4GXRA 4JI0C 1ULTA 1RG9A 5CZVA 1MXBA 4FUQA 4DV6C 1BA3A 4DR7C 4JI5C 1PG3A 4DCTA 5BUQA 4RM3A 3TQIA 4JYAC 2YWBA 4JI7C 5BSVA 4WS9A 4U5YD 3G7SA 3VNSA 2ZM6C 2UUCC 5ADZA 1ZB9A 4MH4A 4LF4C 1O93A 3E7XA 2QVXX 4DG9A 4BC9A 5IFIA 3AF5A 3FCCA 1IBKC 1N33C 2P02A 4DUYC 3PESA 4K0KC 1USPA 4ODJA 4DR5C 5BR8C 2DPLA 4IR7A 1NYEA 1XNQC 3R9WA 4GKJC 5H9UA 2D1RA 4DV5C 4GKKC 5LMUC 2D7VA 1RY2A 1O90A 5BSMA 3DAYA 1XNRC 1P7LA 1MD9A 1XRCA 3B7WA 3C5EA 4WV3A 3JAMD 3LAXA 5LMNC 4JI6C 2QL8A 1MXCA 4B3RC 4R1LA 4DV4C 1HNZC 3UOWA 1FUGA 4LF5C 1QM4A 5E7QA 2HJGA 3OTOC 5CZXA 5A1IA 1HNWC 4RVNA 2YCBA 1EGAA 3LUSA 3GPCA 2BJOA 5T8TA 4MTNA 4B3MC 2E8EA 4ISBA 4B3SC 3J80D 4DR3C 1HR0C 2ASBA 1LQLA 1HNXC 2WD9A 5IWAC 1ML8A 1LCIA 2D1TA 4G1IA 3S82A 3L8CA 1O92A 1XMOC 3NYQA 3LGXA 3CJEA 1FJGC 4BBYA 3R44A 4DCUA 4LE5A 4R0MA 3DLPX 4FUTA 3UZ0A 4JI4C 2D28C 4PZPA 4DV0C 1N36C 2E8CA 2P2JA 3TUFA 4LF6C 2E7GA 3RV2A 4D56A 5DV9A 2JMPA 5KEIA 2V7BA 5AE2A 4OXIA 1MDBA 1AMUA 2VQFC 3I08A 4I9GA 1XMQC 5BSTA 2Y4NA 3IPLA 4RLFA 2KZFA 5BSWA 2D27A 1O9TA 2ATWA 4JM1A 2P2FA 3PROC 2E5LC 4JI2C 2P2BA 4DR1C 3A4IA 1QWIA 4FTFA 1K0RA 4LF9C 1N2FA 5A19A 1VLAA 3GR0A 3KXWA 4OX9C 3IMLA 2PT7G 4DCVA 2UU9C 5BSRA 3EQ6A 4YHHC 3T1HC 3N2QA 2P20A 4DUZC 1PA4A 1USPB 3PBKA 5T8SA 5A1GA 4RMNA 2D1SA 2QW0X 2VSQA 5BUSA 4LF8C 3VNRA 4RLQA 4DG8A 4D4IA 2Y27A 4K0BA 2CY1A 1ZB8A 4JV5C 2YWCA 2UUAC 3ETOA 4I9FA 1GPMA 3AF6A 3TDEA 4X66C 4KTTA 4ZJZA 4JI8C 2Y4OA 1MKYA 1XRBA 3VNQA 1YJ7A 2P2MA 4NDNA 4DR2C 2OPLA 1IBMC 1JOSA 5KYVA 3A9UA 2VZEA 1MDFA 3GR1A 2BH1X 2UUBC 4KTVA 1T5HX 3E7WA 4LFBC 4GS5A 2AYAA 2PROA 2UXCC 3N54B 4JI1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX D;  1I94 C;  4DV5 C;  5A2Q D;  1XMQ C;  4GKK C;  5LMU C;  4DR6 C;  3IEU A;  2D7V A;  2E8F A;  4YY3 C;  2UXB C;  4JI3 C;  4DV3 C;  4B3T C;  3I07 A;  2KZF A;  4KHP C;  2HHH C;  1XNR C;  2DYJ A;  3J81 D;  1N34 C;  4X65 C;  3JAM D;  2ATW A;  2E5L C;  5LMN C;  2EGT A;  4JI2 C;  4DR1 C;  4JI6 C;  1QWI A;  1K0R A;  2QL8 A;  4LF9 C;  1N2F A;  4B3R C;  1WF3 A;  1UKK A;  1VLA A;  2OPL B;  3T1Y C;  4OX9 C;  4DV4 C;  2PT7 G;  4AQY C;  4LF7 C;  4DCV A;  2F4V C;  1HNZ C;  4BSZ A;  4XX2 A;  2UU9 C;  4YHH C;  4LF5 C;  2CXC A;  4DR4 C;  4NOZ A;  2HJG A;  3T1H C;  3GKU A;  3OTO C;  2VQE C;  3EER A;  3IEV A;  1HNW C;  4DUZ C;  1PA4 A;  1USP B;  1J5E C;  2YCB A;  1WH9 A;  4JI0 C;  1EGA A;  3LUS A;  4DCS A;  2BJO A;  4MTN A;  4B3M C;  2E8E A;  4B3S C;  3J80 D;  4LF8 C;  3R9X A;  4DR3 C;  1HR0 C;  4DV6 C;  2ASB A;  1LQL A;  1HNX C;  4DV2 C;  5IWA C;  4DR7 C;  1ML8 A;  1KKG A;  2ONF A;  4JI5 C;  4DCT A;  2CY1 A;  1ZB8 A;  4LFA C;  1XMO C;  4JYA C;  4JV5 C;  1HH2 P;  5IT9 D;  2UXD C;  4NXN C;  2UUA C;  3CJE A;  3AF6 A;  1FJG C;  4JI7 C;  2XR1 A;  4NXM C;  4X66 C;  4DCU A;  4X62 C;  1N32 C;  4JI8 C;  2PN2 A;  2ZM6 C;  4X64 C;  1MKY A;  2UUC C;  4JI4 C;  1ZB9 A;  4MH4 A;  4LF4 C;  4DV0 C;  4DV1 C;  1N36 C;  4DR2 C;  2E8C A;  2OPL A;  1IBM C;  1JOS A;  3AF5 A;  4LF6 C;  2E7G A;  1IBK C;  1N33 C;  2JMP A;  4DUY C;  4K0K C;  1USP A;  2UUB C;  1IBL C;  4LFB C;  4DR5 C;  5BR8 C;  4DV7 C;  4LFC C;  2VQF C;  1L2F A;  1NYE A;  1XNQ C;  3R9W A;  2UXC C;  4GKJ C;  4JI1 C; 
#chains in the Genus database with same CATH topology
 1I94 C;  5A2Q D;  4DR6 C;  3IEU A;  2QVY X;  2E8F A;  4YY3 C;  2UXB C;  2OO4 A;  3K6R A;  4B3T C;  5AE3 A;  3CQ1 A;  5KYT A;  2HHH C;  2DYJ A;  3A9V A;  1N34 C;  2EGT A;  1VEH A;  4PUH A;  4R1M A;  4L2Z A;  3DHV A;  2E0G A;  5GTD A;  3ETC A;  1WF3 A;  2QVZ X;  3T1Y C;  4AQY C;  4LF7 C;  4L7I A;  4D4G A;  4DR4 C;  4HPV A;  4NOZ A;  4EAT A;  1V25 A;  3LNV A;  3H2T A;  4IZ6 A;  4RM2 A;  2VQE C;  3IEV A;  1J5E C;  1WH9 A;  3CQ3 A;  4DCS A;  4RVO A;  3NI2 A;  3R9X A;  3NYR A;  4DV2 C;  4G36 A;  1XRA A;  5K8F A;  1KKG A;  2ONF A;  3CW9 A;  4G37 A;  2M5H A;  4LFA C;  1HH2 P;  3L95 X;  2OBV A;  1V26 A;  5IT9 D;  2UXD C;  4NXN C;  4BC7 A;  2MM9 A;  2XR1 A;  3NPD A;  4NXM C;  3UX2 A;  4X62 C;  1N32 C;  2PN2 A;  4X64 C;  1PG4 A;  3CW8 X;  4BCA A;  3UX3 A;  2MCQ A;  4DV1 C;  4L4Q A;  3RG2 A;  1PU1 A;  1T5D X;  5JRH A;  4GXQ A;  2DHM A;  2WP0 C;  1IBL C;  1NY8 A;  4DV7 C;  5BUR A;  4LFC C;  5AE1 A;  1L2F A;  5FLX D;  2MMA B;  4TPS B;  4JI3 C;  4DV3 C;  3I07 A;  4KHP C;  5BSU A;  4OYC A;  3J81 D;  4PUG A;  4PRO C;  4X65 C;  2JNV A;  4D57 A;  5K85 A;  1MXA A;  1M6X A;  1P4E A;  2P2Q A;  2D1Q A;  1UKK A;  2OPL B;  4ZLP A;  1WCJ A;  2F4V C;  4PHT A;  4BSZ A;  4XX2 A;  3SO4 A;  2CXC A;  3GKU A;  3EER A;  3FCE A;  4GXR A;  4JI0 C;  2YX1 A;  1ULT A;  1XS3 A;  1RG9 A;  5CZV A;  1MXB A;  4FUQ A;  4DV6 C;  1BA3 A;  1UWD A;  4DR7 C;  4JI5 C;  1PG3 A;  4DCT A;  5BUQ A;  4RM3 A;  3TQI A;  4JYA C;  2YWB A;  3O2E A;  4JI7 C;  5BSV A;  2CU6 A;  4WS9 A;  4U5Y D;  3G7S A;  3VNS A;  2ZM6 C;  2UUC C;  5ADZ A;  1ZB9 A;  4MH4 A;  4LF4 C;  1O93 A;  3E7X A;  2QVX X;  4DG9 A;  4BC9 A;  5IFI A;  3AF5 A;  3FCC A;  1IBK C;  1N33 C;  2P02 A;  4DUY C;  3PES A;  4K0K C;  1USP A;  4ODJ A;  4DR5 C;  5BR8 C;  2DPL A;  2ZZN A;  4IR7 A;  1NYE A;  1XNQ C;  3R9W A;  4GKJ C;  5H9U A;  2D1R A;  4DV5 C;  2ZZM A;  4GKK C;  5LMU C;  2D7V A;  1RY2 A;  1O90 A;  5BSM A;  3DAY A;  1XNR C;  1P7L A;  1MD9 A;  1XRC A;  3B7W A;  3C5E A;  4WV3 A;  3JAM D;  3LAX A;  5LMN C;  4JI6 C;  2QL8 A;  1MXC A;  4B3R C;  4R1L A;  4DV4 C;  1HNZ C;  3UOW A;  1FUG A;  4LF5 C;  1QM4 A;  5E7Q A;  2HJG A;  3OTO C;  5CZX A;  5A1I A;  1HNW C;  4RVN A;  2YCB A;  1EGA A;  3LUS A;  3GPC A;  2BJO A;  5T8T A;  4MTN A;  4B3M C;  2E8E A;  4ISB A;  4B3S C;  3J80 D;  4DR3 C;  1HR0 C;  2ASB A;  1LQL A;  4PUI A;  1HNX C;  2WD9 A;  5IWA C;  1ML8 A;  1LCI A;  2D1T A;  4G1I A;  3S82 A;  1TH5 A;  3L8C A;  1O92 A;  1XMO C;  3NYQ A;  3LGX A;  3CJE A;  1FJG C;  4BBY A;  3R44 A;  1V60 A;  4DCU A;  4LE5 A;  4R0M A;  3DLP X;  4FUT A;  3UZ0 A;  4JI4 C;  2D28 C;  4PZP A;  3TR3 A;  4DV0 C;  1N36 C;  2E8C A;  2P2J A;  3TUF A;  4LF6 C;  2E7G A;  3RV2 A;  4D56 A;  5DV9 A;  2JMP A;  2KDN A;  5KEI A;  2V7B A;  5AE2 A;  4OXI A;  2M5O A;  1MDB A;  1AMU A;  2VQF C;  3I08 A;  4I9G A;  1XMQ C;  5BST A;  2Y4N A;  3IPL A;  4RLF A;  2KZF A;  5BSW A;  2D27 A;  1O9T A;  2Z51 A;  2ATW A;  4JM1 A;  2P2F A;  1IB8 A;  3PRO C;  2E5L C;  4JI2 C;  2P2B A;  4DR1 C;  3A4I A;  1QWI A;  4FTF A;  1K0R A;  4LF9 C;  1N2F A;  5A19 A;  1VLA A;  3GR0 A;  3KXW A;  4OX9 C;  3IML A;  2PT7 G;  3A25 A;  3A26 A;  4DCV A;  2UU9 C;  5BSR A;  3EQ6 A;  4YHH C;  3T1H C;  3N2Q A;  3CQ2 A;  2P20 A;  4DUZ C;  1PA4 A;  1USP B;  3PBK A;  5T8S A;  5A1G A;  4RMN A;  2D1S A;  2QW0 X;  2VSQ A;  5BUS A;  4LF8 C;  3VNR A;  4RLQ A;  4DG8 A;  4D4I A;  2Y27 A;  4K0B A;  2CY1 A;  1ZB8 A;  4JV5 C;  2YWC A;  3LNO A;  2UUA C;  2KZ0 A;  3ETO A;  4I9F A;  1GPM A;  2NCL A;  3AF6 A;  3TDE A;  4X66 C;  1FLO A;  4KTT A;  4ZJZ A;  4JI8 C;  1XHJ A;  2Y4O A;  1MKY A;  1XRB A;  3AY0 A;  3VNQ A;  1YJ7 A;  2P2M A;  4NDN A;  4DR2 C;  2OPL A;  5LCI A;  1IBM C;  1JOS A;  5KYV A;  3A9U A;  2VZE A;  1MDF A;  3GR1 A;  2BH1 X;  3UEB A;  2UUB C;  4KTV A;  1M6X C;  1T5H X;  3E7W A;  1P4E C;  4LFB C;  4GS5 A;  2AYA A;  2PRO A;  2UXC C;  3N54 B;  4JI1 C; 
#chains in the Genus database with same CATH homology
 1I94 C;  5A2Q D;  4DR6 C;  3IEU A;  2QVY X;  2E8F A;  4YY3 C;  2UXB C;  2OO4 A;  4B3T C;  5AE3 A;  5KYT A;  2HHH C;  2DYJ A;  3A9V A;  1N34 C;  2EGT A;  4R1M A;  4L2Z A;  3DHV A;  2E0G A;  5GTD A;  3ETC A;  1WF3 A;  2QVZ X;  3T1Y C;  4AQY C;  4LF7 C;  4L7I A;  4D4G A;  4DR4 C;  4HPV A;  4NOZ A;  4EAT A;  1V25 A;  3LNV A;  3H2T A;  4IZ6 A;  4RM2 A;  2VQE C;  3IEV A;  1J5E C;  1WH9 A;  4DCS A;  4RVO A;  3NI2 A;  3R9X A;  3NYR A;  4DV2 C;  4G36 A;  1XRA A;  5K8F A;  1KKG A;  2ONF A;  3CW9 A;  4G37 A;  4LFA C;  1HH2 P;  3L95 X;  2OBV A;  1V26 A;  5IT9 D;  2UXD C;  4NXN C;  4BC7 A;  2XR1 A;  3NPD A;  4NXM C;  4X62 C;  1N32 C;  2PN2 A;  4X64 C;  1PG4 A;  3CW8 X;  4BCA A;  4DV1 C;  4L4Q A;  3RG2 A;  1T5D X;  5JRH A;  4GXQ A;  2WP0 C;  1IBL C;  4DV7 C;  5BUR A;  4LFC C;  5AE1 A;  1L2F A;  5FLX D;  4TPS B;  4JI3 C;  4DV3 C;  3I07 A;  4KHP C;  5BSU A;  4OYC A;  3J81 D;  4PRO C;  4X65 C;  4D57 A;  5K85 A;  1MXA A;  2P2Q A;  2D1Q A;  1UKK A;  2OPL B;  4ZLP A;  2F4V C;  4PHT A;  4BSZ A;  4XX2 A;  3SO4 A;  2CXC A;  3GKU A;  3EER A;  3FCE A;  4GXR A;  4JI0 C;  1ULT A;  1RG9 A;  5CZV A;  1MXB A;  4FUQ A;  4DV6 C;  1BA3 A;  4DR7 C;  4JI5 C;  1PG3 A;  4DCT A;  5BUQ A;  4RM3 A;  3TQI A;  4JYA C;  2YWB A;  4JI7 C;  5BSV A;  4WS9 A;  4U5Y D;  3G7S A;  3VNS A;  2ZM6 C;  2UUC C;  5ADZ A;  1ZB9 A;  4MH4 A;  4LF4 C;  1O93 A;  3E7X A;  2QVX X;  4DG9 A;  4BC9 A;  5IFI A;  3AF5 A;  3FCC A;  1IBK C;  1N33 C;  2P02 A;  4DUY C;  3PES A;  4K0K C;  1USP A;  4ODJ A;  4DR5 C;  5BR8 C;  2DPL A;  4IR7 A;  1NYE A;  1XNQ C;  3R9W A;  4GKJ C;  5H9U A;  2D1R A;  4DV5 C;  4GKK C;  5LMU C;  2D7V A;  1RY2 A;  1O90 A;  5BSM A;  3DAY A;  1XNR C;  1P7L A;  1MD9 A;  1XRC A;  3B7W A;  3C5E A;  4WV3 A;  3JAM D;  3LAX A;  5LMN C;  4JI6 C;  2QL8 A;  1MXC A;  4B3R C;  4R1L A;  4DV4 C;  1HNZ C;  3UOW A;  1FUG A;  4LF5 C;  1QM4 A;  5E7Q A;  2HJG A;  3OTO C;  5CZX A;  5A1I A;  1HNW C;  4RVN A;  2YCB A;  1EGA A;  3LUS A;  3GPC A;  2BJO A;  5T8T A;  4MTN A;  4B3M C;  2E8E A;  4ISB A;  4B3S C;  3J80 D;  4DR3 C;  1HR0 C;  2ASB A;  1LQL A;  1HNX C;  2WD9 A;  5IWA C;  1ML8 A;  1LCI A;  2D1T A;  4G1I A;  3S82 A;  3L8C A;  1O92 A;  1XMO C;  3NYQ A;  3LGX A;  3CJE A;  1FJG C;  4BBY A;  3R44 A;  4DCU A;  4LE5 A;  4R0M A;  3DLP X;  4FUT A;  3UZ0 A;  4JI4 C;  2D28 C;  4PZP A;  4DV0 C;  1N36 C;  2E8C A;  2P2J A;  3TUF A;  4LF6 C;  2E7G A;  3RV2 A;  4D56 A;  5DV9 A;  2JMP A;  5KEI A;  2V7B A;  5AE2 A;  4OXI A;  1MDB A;  1AMU A;  2VQF C;  3I08 A;  4I9G A;  1XMQ C;  5BST A;  2Y4N A;  3IPL A;  4RLF A;  2KZF A;  5BSW A;  2D27 A;  1O9T A;  2ATW A;  4JM1 A;  2P2F A;  3PRO C;  2E5L C;  4JI2 C;  2P2B A;  4DR1 C;  3A4I A;  1QWI A;  4FTF A;  1K0R A;  4LF9 C;  1N2F A;  5A19 A;  1VLA A;  3GR0 A;  3KXW A;  4OX9 C;  3IML A;  2PT7 G;  4DCV A;  2UU9 C;  5BSR A;  3EQ6 A;  4YHH C;  3T1H C;  3N2Q A;  2P20 A;  4DUZ C;  1PA4 A;  1USP B;  3PBK A;  5T8S A;  5A1G A;  4RMN A;  2D1S A;  2QW0 X;  2VSQ A;  5BUS A;  4LF8 C;  3VNR A;  4RLQ A;  4DG8 A;  4D4I A;  2Y27 A;  4K0B A;  2CY1 A;  1ZB8 A;  4JV5 C;  2YWC A;  2UUA C;  3ETO A;  4I9F A;  1GPM A;  3AF6 A;  3TDE A;  4X66 C;  4KTT A;  4ZJZ A;  4JI8 C;  2Y4O A;  1MKY A;  1XRB A;  3VNQ A;  1YJ7 A;  2P2M A;  4NDN A;  4DR2 C;  2OPL A;  1IBM C;  1JOS A;  5KYV A;  3A9U A;  2VZE A;  1MDF A;  3GR1 A;  2BH1 X;  2UUB C;  4KTV A;  1T5H X;  3E7W A;  4LFB C;  4GS5 A;  2AYA A;  2PRO A;  2UXC C;  3N54 B;  4JI1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...