1PA4A

Solution structure of a putative ribosome-binding factor from mycoplasma pneumoniae (mpn156)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
KERLENDIIRLINRTVIHEIYNETVKTGHVTHVKLSDDLLHVTVYLDCYNREQIDRVVGAFNQAKGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a putative ribosome binding protein from Mycoplasma pneumoniae and comparison to a distant homolog.
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords Probable ribosome-binding factor A
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1pa4A00
1IBLC 1N34C 4DCSA 4JI8C 2E8FA 4GKKC 2VQEC 1N32C 2JMPA 1VLAA 1JOSA 5IWAC 4DV1C 4DR4C 4X66C 1HNWC 4JV5C 4NXMC 3R9WA 5LMUC 1KKGA 4DCUA 2PT7G 1XNQC 1N2FA 4YY3C 5A2QD 4JI0C 4JYAC 1K0RA 3IEUA 3IEVA 4LF4C 1I94C 3T1YC 2KZFA 4LFBC 2UUCC 4DV5C 2UXDC 3AF5A 4LF6C 1N36C 3R9XA 1LQLA 2XR1A 1USPB 4BSZA 4YHHC 1XNRC 2E8CA 1MKYA 2PN2A 4B3TC 2F4VC 5BR8C 2UU9C 4KHPC 1FJGC 4LF8C 1NYEA 1USPA 3EERA 2QL8A 4LF9C 2OPLA 2ONFA 5FLXD 1WF3A 4X64C 1EGAA 1ML8A 2DYJA 3JAMD 4LFCC 2CY1A 4B3RC 1ZB9A 4DR5C 4X65C 4LF5C 1HNXC 5IT9D 4B3MC 3AF6A 4DUZC 4DV0C 4JI4C 1IBKC 4DUYC 2BJOA 4LFAC 4OX9C 4LF7C 4X62C 2UXBC 4DCVA 4AQYC 2UUAC 4GKJC 2VQFC 4DR1C 1N33C 4DV3C 4DR2C 1J5EC 2UUBC 4DR6C 4K0KC 2UXCC 2OPLB 4DV4C 1IBMC 4JI6C 1XMOC 4B3SC 2YCBA 3CJEA 4MTNA 2EGTA 1L2FA 4JI7C 4NXNC 2ASBA 1UKKA 2HJGA 4JI1C 2E7GA 3GKUA 2E5LC 3J80D 4DR3C 4JI3C 4JI5C 4NOZA 3OTOC 3I07A 4DCTA 4DV7C 1HR0C 2HHHC 2ATWA 1HH2P 4MH4A 1XMQC 2CXCA 2D7VA 1PA4A 1QWIA 4XX2A 1HNZC 4DR7C 3LUSA 1WH9A 4JI2C 4DV6C 5LMNC 3J81D 3T1HC 2E8EA 2ZM6C 4DV2C 1ZB8A
chains in the Genus database with same CATH superfamily
2DHMA 3GR1A 1O9TA 4DCSA 2P20A 2E8FA 5BUQA 5A1IA 4I9FA 2ZZMA 3IPLA 1JOSA 5IWAC 1FUGA 3O2EA 1KKGA 4L4QA 4RVOA 1XNQC 1M6XA 5A2QD 4PHTA 4EATA 1VEHA 2E0GA 4LF4C 2QW0X 4BBYA 1I94C 3TQIA 2P02A 2UXDC 3R9XA 4BCAA 1LQLA 5AE3A 2XR1A 5DV9A 1QM4A 4HPVA 2F4VC 1FJGC 5K8FA 3TR3A 3A9VA 3EERA 2ONFA 2WP0C 1WF3A 2OBVA 3C5EA 3ETOA 3GR0A 3B7WA 4LFCC 3IMLA 4R0MA 3L8CA 5IT9D 5A19A 4DUZC 4L7IA 4D56A 4LFAC 3A4IA 4LF7C 4IZ6A 4X62C 2UXBC 3N2QA 3TUFA 2UUAC 2Y4NA 4DR1C 3NPDA 2UUBC 2KZ0A 2UXCC 1IBMC 4JI6C 4PUHA 2YCBA 1MXBA 3G7SA 4R1MA 1MXCA 4JM1A 2E7GA 4ISBA 3J80D 3GPCA 1PG4A 2VZEA 3OTOC 1XMQC 1PG3A 4OXIA 3N54B 3PROC 1P4EA 3J81D 3T1HC 2E8EA 1O90A 2ZM6C 1IB8A 4DV2C 1ZB8A 2V7BA 5K85A 1N34C 4JI8C 3VNQA 3CW9A 2M5OA 3S82A 4GKKC 1LCIA 1N32C 1MXAA 4D4GA 3LGXA 4DV1C 5CZXA 1XS3A 1HNWC 1M6XC 3ETCA 4L2ZA 4GS5A 4TPSB 4DG9A 3R9WA 4DCUA 2CU6A 3AY0A 3NYRA 5ADZA 4JYAC 1V26A 1K0RA 3IEUA 2ZZNA 2UUCC 3UOWA 3LNOA 3VNRA 5BSMA 2JNVA 1N36C 2D1RA 3NYQA 5BSUA 1USPB 4BSZA 4KHPC 4RMNA 3E7WA 2UU9C 1USPA 2P2JA 2QL8A 2OPLA 5FLXD 2YWCA 3H2TA 4ZLPA 4X64C 3I08A 3DHVA 3CW8X 2DYJA 2CY1A 4B3RC 5KEIA 4G37A 1ZB9A 4X65C 4LF5C 4LE5A 5T8SA 4ZJZA 3AF6A 1MDFA 4GXQA 2BJOA 3A26A 2Y4OA 4GXRA 4OYCA 4DV3C 1J5EC 5BSVA 1RY2A 4K0KC 4PUIA 1GPMA 2OO4A 3CJEA 1L2FA 2E5LC 4JI3C 2KDNA 3R44A 2P2FA 4U5YD 5AE1A 3L95X 4MH4A 2D7VA 1P7LA 1QWIA 1HNZC 4RLQA 1WH9A 4IR7A 4RM3A 1IBLC 3RV2A 4KTVA 2D1QA 3PBKA 2MM9A 4DR4C 1T5DX 2MCQA 5A1GA 4NXMC 4FUQA 1N2FA 4YY3C 2WD9A 4PZPA 1XHJA 3IEVA 4LFBC 1O92A 1O93A 4NDNA 4ODJA 4K0BA 4LF6C 1V25A 3KXWA 4YHHC 4FTFA 2PN2A 1MKYA 1FLOA 5BR8C 3A9UA 1NYEA 1MD9A 3FCEA 4G36A 1EGAA 3DAYA 3JAMD 3TDEA 5GTDA 3LNVA 5BSTA 4DR5C 2P2MA 1HNXC 2D27A 5KYVA 4B3MC 4D4IA 4RM2A 4I9GA 4JI4C 4DUYC 3UX2A 4OX9C 1TH5A 4DCVA 4AQYC 4GKJC 3DLPX 3CQ1A 4PROC 4DR2C 4DR6C 3PESA 2OPLB 1NY8A 2D1TA 4DV4C 1XMOC 4B3SC 4FUTA 2Z51A 3E7XA 1PU1A 3LAXA 4MTNA 4JI7C 4NXNC 3NI2A 2ASBA 2BH1X 1UKKA 2HJGA 4DR3C 4JI5C 3I07A 4DV7C 1RG9A 2HHHC 1HH2P 2CXCA 2PROA 1PA4A 4XX2A 3A25A 3FCCA 2NCLA 4JI2C 4DV6C 1YJ7A 1WCJA 4KTTA 4RVNA 5T8TA 1P4EC 3RG2A 2QVZX 2D1SA 5BURA 2VQEC 2MMAB 2JMPA 4WS9A 1XRCA 5H9UA 1VLAA 1T5HX 2AYAA 4RLFA 4X66C 3K6RA 4JV5C 2QVYX 5LMUC 2PT7G 3UEBA 4JI0C 3T1YC 2KZFA 2P2QA 3VNSA 4DV5C 1BA3A 2Y27A 3AF5A 4DG8A 2D28C 2YX1A 1XNRC 2E8CA 5AE2A 4B3TC 3SO4A 4LF8C 1XRBA 4LF9C 5KYTA 4WV3A 4BC7A 2M5HA 1ML8A 1MDBA 3CQ2A 2VSQA 5IFIA 4R1LA 4PUGA 3UX3A 1AMUA 1XRAA 4DV0C 1IBKC 1UWDA 3EQ6A 2P2BA 5JRHA 2VQFC 1N33C 1V60A 2DPLA 5E7QA 5BSRA 2EGTA 2QVXX 4BC9A 4JI1C 3GKUA 5LCIA 4NOZA 5BUSA 2YWBA 4DCTA 1HR0C 2ATWA 4D57A 4DR7C 1ULTA 3LUSA 4G1IA 5BSWA 3CQ3A 5LMNC 5CZVA 3UZ0A
chains in the Genus database with same CATH topology
3GR1A 1O9TA 4DCSA 2P20A 2E8FA 5BUQA 5A1IA 4I9FA 3IPLA 1JOSA 5IWAC 1FUGA 1KKGA 4L4QA 4RVOA 1XNQC 5A2QD 4PHTA 4EATA 2E0GA 4LF4C 2QW0X 4BBYA 1I94C 3TQIA 2P02A 2UXDC 3R9XA 4BCAA 1LQLA 5AE3A 2XR1A 5DV9A 1QM4A 4HPVA 2F4VC 1FJGC 5K8FA 3A9VA 3EERA 2ONFA 2WP0C 1WF3A 2OBVA 3C5EA 3ETOA 3GR0A 3B7WA 4LFCC 3IMLA 4R0MA 3L8CA 5IT9D 5A19A 4DUZC 4L7IA 4D56A 4LFAC 3A4IA 4LF7C 4IZ6A 4X62C 2UXBC 3N2QA 2UUAC 3TUFA 2Y4NA 4DR1C 3NPDA 2UUBC 2UXCC 1IBMC 4JI6C 2YCBA 1MXBA 3G7SA 4R1MA 1MXCA 4JM1A 2E7GA 4ISBA 3J80D 3GPCA 1PG4A 2VZEA 3OTOC 1XMQC 1PG3A 4OXIA 3N54B 3PROC 3J81D 3T1HC 2E8EA 1O90A 2ZM6C 4DV2C 1ZB8A 2V7BA 5K85A 1N34C 4JI8C 3VNQA 3CW9A 3S82A 4GKKC 1LCIA 1N32C 1MXAA 4D4GA 3LGXA 4DV1C 5CZXA 1HNWC 3ETCA 4L2ZA 4GS5A 4TPSB 4DG9A 3R9WA 4DCUA 3NYRA 5ADZA 4JYAC 1V26A 1K0RA 3IEUA 2UUCC 3UOWA 3VNRA 5BSMA 1N36C 2D1RA 3NYQA 5BSUA 1USPB 4BSZA 4KHPC 4RMNA 3E7WA 2UU9C 1USPA 2P2JA 2QL8A 2OPLA 5FLXD 2YWCA 3H2TA 4ZLPA 4X64C 3I08A 3DHVA 3CW8X 2DYJA 2CY1A 4B3RC 5KEIA 4G37A 1ZB9A 4X65C 4LF5C 4LE5A 5T8SA 4ZJZA 3AF6A 1MDFA 4GXQA 2BJOA 2Y4OA 4GXRA 4OYCA 4DV3C 1J5EC 5BSVA 1RY2A 4K0KC 1GPMA 2OO4A 3CJEA 1L2FA 2E5LC 4JI3C 3R44A 2P2FA 4U5YD 5AE1A 3L95X 4MH4A 2D7VA 1P7LA 1QWIA 1HNZC 4RLQA 1WH9A 4IR7A 4RM3A 1IBLC 3RV2A 4KTVA 2D1QA 3PBKA 4DR4C 1T5DX 5A1GA 4NXMC 4FUQA 1N2FA 4YY3C 2WD9A 4PZPA 3IEVA 4LFBC 1O92A 1O93A 4NDNA 4ODJA 4K0BA 4LF6C 1V25A 3KXWA 4YHHC 4FTFA 2PN2A 1MKYA 5BR8C 3A9UA 1NYEA 1MD9A 3FCEA 4G36A 1EGAA 3DAYA 3JAMD 3TDEA 5GTDA 3LNVA 5BSTA 4DR5C 2P2MA 1HNXC 2D27A 5KYVA 4B3MC 4D4IA 4RM2A 4I9GA 4JI4C 4DUYC 4OX9C 4DCVA 4AQYC 4GKJC 3DLPX 4PROC 4DR2C 4DR6C 3PESA 2OPLB 4DV4C 2D1TA 1XMOC 4B3SC 4FUTA 3E7XA 3LAXA 4MTNA 4JI7C 4NXNC 3NI2A 2ASBA 2BH1X 1UKKA 2HJGA 4DR3C 4JI5C 3I07A 4DV7C 1RG9A 2HHHC 1HH2P 2CXCA 2PROA 1PA4A 4XX2A 3FCCA 4JI2C 4DV6C 1YJ7A 4KTTA 4RVNA 5T8TA 3RG2A 2QVZX 2D1SA 5BURA 2VQEC 2JMPA 4WS9A 1XRCA 5H9UA 1VLAA 1T5HX 2AYAA 4RLFA 4X66C 4JV5C 2QVYX 5LMUC 2PT7G 4JI0C 3T1YC 2KZFA 2P2QA 3VNSA 4DV5C 1BA3A 2Y27A 3AF5A 4DG8A 2D28C 1XNRC 2E8CA 5AE2A 4B3TC 3SO4A 4LF8C 1XRBA 4LF9C 5KYTA 4WV3A 4BC7A 1ML8A 1MDBA 2VSQA 5IFIA 4R1LA 1AMUA 1XRAA 4DV0C 1IBKC 3EQ6A 2P2BA 5JRHA 2VQFC 1N33C 2DPLA 5E7QA 5BSRA 2EGTA 2QVXX 4BC9A 4JI1C 3GKUA 4NOZA 5BUSA 2YWBA 4DCTA 1HR0C 2ATWA 4D57A 4DR7C 1ULTA 3LUSA 4G1IA 5BSWA 5LMNC 5CZVA 3UZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL C;  1N34 C;  4DCS A;  4JI8 C;  2E8F A;  4GKK C;  2VQE C;  1N32 C;  2JMP A;  1VLA A;  1JOS A;  5IWA C;  4DV1 C;  4DR4 C;  4X66 C;  1HNW C;  4JV5 C;  4NXM C;  3R9W A;  5LMU C;  1KKG A;  4DCU A;  2PT7 G;  1XNQ C;  1N2F A;  4YY3 C;  5A2Q D;  4JI0 C;  4JYA C;  1K0R A;  3IEU A;  3IEV A;  4LF4 C;  1I94 C;  3T1Y C;  2KZF A;  4LFB C;  2UUC C;  4DV5 C;  2UXD C;  3AF5 A;  4LF6 C;  1N36 C;  3R9X A;  1LQL A;  2XR1 A;  1USP B;  4BSZ A;  4YHH C;  1XNR C;  2E8C A;  1MKY A;  2PN2 A;  4B3T C;  2F4V C;  5BR8 C;  2UU9 C;  4KHP C;  1FJG C;  4LF8 C;  1NYE A;  1USP A;  3EER A;  2QL8 A;  4LF9 C;  2OPL A;  2ONF A;  5FLX D;  1WF3 A;  4X64 C;  1EGA A;  1ML8 A;  2DYJ A;  3JAM D;  4LFC C;  2CY1 A;  4B3R C;  1ZB9 A;  4DR5 C;  4X65 C;  4LF5 C;  1HNX C;  5IT9 D;  4B3M C;  3AF6 A;  4DUZ C;  4DV0 C;  4JI4 C;  1IBK C;  4DUY C;  2BJO A;  4LFA C;  4OX9 C;  4LF7 C;  4X62 C;  2UXB C;  4DCV A;  4AQY C;  2UUA C;  4GKJ C;  2VQF C;  4DR1 C;  1N33 C;  4DV3 C;  4DR2 C;  1J5E C;  2UUB C;  4DR6 C;  4K0K C;  2UXC C;  2OPL B;  4DV4 C;  1IBM C;  4JI6 C;  1XMO C;  4B3S C;  2YCB A;  3CJE A;  4MTN A;  2EGT A;  1L2F A;  4JI7 C;  4NXN C;  2ASB A;  1UKK A;  2HJG A;  4JI1 C;  2E7G A;  3GKU A;  2E5L C;  3J80 D;  4DR3 C;  4JI3 C;  4JI5 C;  4NOZ A;  3OTO C;  3I07 A;  4DCT A;  4DV7 C;  1HR0 C;  2HHH C;  2ATW A;  1HH2 P;  4MH4 A;  1XMQ C;  2CXC A;  2D7V A;  1PA4 A;  1QWI A;  4XX2 A;  1HNZ C;  4DR7 C;  3LUS A;  1WH9 A;  4JI2 C;  4DV6 C;  5LMN C;  3J81 D;  3T1H C;  2E8E A;  2ZM6 C;  4DV2 C;  1ZB8 A; 
#chains in the Genus database with same CATH topology
 2DHM A;  3GR1 A;  1O9T A;  4DCS A;  2P20 A;  2E8F A;  5BUQ A;  5A1I A;  4I9F A;  2ZZM A;  3IPL A;  1JOS A;  5IWA C;  1FUG A;  3O2E A;  1KKG A;  4L4Q A;  4RVO A;  1XNQ C;  1M6X A;  5A2Q D;  4PHT A;  4EAT A;  1VEH A;  2E0G A;  4LF4 C;  2QW0 X;  4BBY A;  1I94 C;  3TQI A;  2P02 A;  2UXD C;  3R9X A;  4BCA A;  1LQL A;  5AE3 A;  2XR1 A;  5DV9 A;  1QM4 A;  4HPV A;  2F4V C;  1FJG C;  5K8F A;  3TR3 A;  3A9V A;  3EER A;  2ONF A;  2WP0 C;  1WF3 A;  2OBV A;  3C5E A;  3ETO A;  3GR0 A;  3B7W A;  4LFC C;  3IML A;  4R0M A;  3L8C A;  5IT9 D;  5A19 A;  4DUZ C;  4L7I A;  4D56 A;  4LFA C;  3A4I A;  4LF7 C;  4IZ6 A;  4X62 C;  2UXB C;  3N2Q A;  3TUF A;  2UUA C;  2Y4N A;  4DR1 C;  3NPD A;  2UUB C;  2KZ0 A;  2UXC C;  1IBM C;  4JI6 C;  4PUH A;  2YCB A;  1MXB A;  3G7S A;  4R1M A;  1MXC A;  4JM1 A;  2E7G A;  4ISB A;  3J80 D;  3GPC A;  1PG4 A;  2VZE A;  3OTO C;  1XMQ C;  1PG3 A;  4OXI A;  3N54 B;  3PRO C;  1P4E A;  3J81 D;  3T1H C;  2E8E A;  1O90 A;  2ZM6 C;  1IB8 A;  4DV2 C;  1ZB8 A;  2V7B A;  5K85 A;  1N34 C;  4JI8 C;  3VNQ A;  3CW9 A;  2M5O A;  3S82 A;  4GKK C;  1LCI A;  1N32 C;  1MXA A;  4D4G A;  3LGX A;  4DV1 C;  5CZX A;  1XS3 A;  1HNW C;  1M6X C;  3ETC A;  4L2Z A;  4GS5 A;  4TPS B;  4DG9 A;  3R9W A;  4DCU A;  2CU6 A;  3AY0 A;  3NYR A;  5ADZ A;  4JYA C;  1V26 A;  1K0R A;  3IEU A;  2ZZN A;  2UUC C;  3UOW A;  3LNO A;  3VNR A;  5BSM A;  2JNV A;  1N36 C;  2D1R A;  3NYQ A;  5BSU A;  1USP B;  4BSZ A;  4KHP C;  4RMN A;  3E7W A;  2UU9 C;  1USP A;  2P2J A;  2QL8 A;  2OPL A;  5FLX D;  2YWC A;  3H2T A;  4ZLP A;  4X64 C;  3I08 A;  3DHV A;  3CW8 X;  2DYJ A;  2CY1 A;  4B3R C;  5KEI A;  4G37 A;  1ZB9 A;  4X65 C;  4LF5 C;  4LE5 A;  5T8S A;  4ZJZ A;  3AF6 A;  1MDF A;  4GXQ A;  2BJO A;  3A26 A;  2Y4O A;  4GXR A;  4OYC A;  4DV3 C;  1J5E C;  5BSV A;  1RY2 A;  4K0K C;  4PUI A;  1GPM A;  2OO4 A;  3CJE A;  1L2F A;  2E5L C;  4JI3 C;  2KDN A;  3R44 A;  2P2F A;  4U5Y D;  5AE1 A;  3L95 X;  4MH4 A;  2D7V A;  1P7L A;  1QWI A;  1HNZ C;  4RLQ A;  1WH9 A;  4IR7 A;  4RM3 A;  1IBL C;  3RV2 A;  4KTV A;  2D1Q A;  3PBK A;  2MM9 A;  4DR4 C;  1T5D X;  2MCQ A;  5A1G A;  4NXM C;  4FUQ A;  1N2F A;  4YY3 C;  2WD9 A;  4PZP A;  1XHJ A;  3IEV A;  4LFB C;  1O92 A;  1O93 A;  4NDN A;  4ODJ A;  4K0B A;  4LF6 C;  1V25 A;  3KXW A;  4YHH C;  4FTF A;  2PN2 A;  1MKY A;  1FLO A;  5BR8 C;  3A9U A;  1NYE A;  1MD9 A;  3FCE A;  4G36 A;  1EGA A;  3DAY A;  3JAM D;  3TDE A;  5GTD A;  3LNV A;  5BST A;  4DR5 C;  2P2M A;  1HNX C;  2D27 A;  5KYV A;  4B3M C;  4D4I A;  4RM2 A;  4I9G A;  4JI4 C;  4DUY C;  3UX2 A;  4OX9 C;  1TH5 A;  4DCV A;  4AQY C;  4GKJ C;  3DLP X;  3CQ1 A;  4PRO C;  4DR2 C;  4DR6 C;  3PES A;  2OPL B;  1NY8 A;  2D1T A;  4DV4 C;  1XMO C;  4B3S C;  4FUT A;  2Z51 A;  3E7X A;  1PU1 A;  3LAX A;  4MTN A;  4JI7 C;  4NXN C;  3NI2 A;  2ASB A;  2BH1 X;  1UKK A;  2HJG A;  4DR3 C;  4JI5 C;  3I07 A;  4DV7 C;  1RG9 A;  2HHH C;  1HH2 P;  2CXC A;  2PRO A;  1PA4 A;  4XX2 A;  3A25 A;  3FCC A;  2NCL A;  4JI2 C;  4DV6 C;  1YJ7 A;  1WCJ A;  4KTT A;  4RVN A;  5T8T A;  1P4E C;  3RG2 A;  2QVZ X;  2D1S A;  5BUR A;  2VQE C;  2MMA B;  2JMP A;  4WS9 A;  1XRC A;  5H9U A;  1VLA A;  1T5H X;  2AYA A;  4RLF A;  4X66 C;  3K6R A;  4JV5 C;  2QVY X;  5LMU C;  2PT7 G;  3UEB A;  4JI0 C;  3T1Y C;  2KZF A;  2P2Q A;  3VNS A;  4DV5 C;  1BA3 A;  2Y27 A;  3AF5 A;  4DG8 A;  2D28 C;  2YX1 A;  1XNR C;  2E8C A;  5AE2 A;  4B3T C;  3SO4 A;  4LF8 C;  1XRB A;  4LF9 C;  5KYT A;  4WV3 A;  4BC7 A;  2M5H A;  1ML8 A;  1MDB A;  3CQ2 A;  2VSQ A;  5IFI A;  4R1L A;  4PUG A;  3UX3 A;  1AMU A;  1XRA A;  4DV0 C;  1IBK C;  1UWD A;  3EQ6 A;  2P2B A;  5JRH A;  2VQF C;  1N33 C;  1V60 A;  2DPL A;  5E7Q A;  5BSR A;  2EGT A;  2QVX X;  4BC9 A;  4JI1 C;  3GKU A;  5LCI A;  4NOZ A;  5BUS A;  2YWB A;  4DCT A;  1HR0 C;  2ATW A;  4D57 A;  4DR7 C;  1ULT A;  3LUS A;  4G1I A;  5BSW A;  3CQ3 A;  5LMN C;  5CZV A;  3UZ0 A; 
#chains in the Genus database with same CATH homology
 3GR1 A;  1O9T A;  4DCS A;  2P20 A;  2E8F A;  5BUQ A;  5A1I A;  4I9F A;  3IPL A;  1JOS A;  5IWA C;  1FUG A;  1KKG A;  4L4Q A;  4RVO A;  1XNQ C;  5A2Q D;  4PHT A;  4EAT A;  2E0G A;  4LF4 C;  2QW0 X;  4BBY A;  1I94 C;  3TQI A;  2P02 A;  2UXD C;  3R9X A;  4BCA A;  1LQL A;  5AE3 A;  2XR1 A;  5DV9 A;  1QM4 A;  4HPV A;  2F4V C;  1FJG C;  5K8F A;  3A9V A;  3EER A;  2ONF A;  2WP0 C;  1WF3 A;  2OBV A;  3C5E A;  3ETO A;  3GR0 A;  3B7W A;  4LFC C;  3IML A;  4R0M A;  3L8C A;  5IT9 D;  5A19 A;  4DUZ C;  4L7I A;  4D56 A;  4LFA C;  3A4I A;  4LF7 C;  4IZ6 A;  4X62 C;  2UXB C;  3N2Q A;  2UUA C;  3TUF A;  2Y4N A;  4DR1 C;  3NPD A;  2UUB C;  2UXC C;  1IBM C;  4JI6 C;  2YCB A;  1MXB A;  3G7S A;  4R1M A;  1MXC A;  4JM1 A;  2E7G A;  4ISB A;  3J80 D;  3GPC A;  1PG4 A;  2VZE A;  3OTO C;  1XMQ C;  1PG3 A;  4OXI A;  3N54 B;  3PRO C;  3J81 D;  3T1H C;  2E8E A;  1O90 A;  2ZM6 C;  4DV2 C;  1ZB8 A;  2V7B A;  5K85 A;  1N34 C;  4JI8 C;  3VNQ A;  3CW9 A;  3S82 A;  4GKK C;  1LCI A;  1N32 C;  1MXA A;  4D4G A;  3LGX A;  4DV1 C;  5CZX A;  1HNW C;  3ETC A;  4L2Z A;  4GS5 A;  4TPS B;  4DG9 A;  3R9W A;  4DCU A;  3NYR A;  5ADZ A;  4JYA C;  1V26 A;  1K0R A;  3IEU A;  2UUC C;  3UOW A;  3VNR A;  5BSM A;  1N36 C;  2D1R A;  3NYQ A;  5BSU A;  1USP B;  4BSZ A;  4KHP C;  4RMN A;  3E7W A;  2UU9 C;  1USP A;  2P2J A;  2QL8 A;  2OPL A;  5FLX D;  2YWC A;  3H2T A;  4ZLP A;  4X64 C;  3I08 A;  3DHV A;  3CW8 X;  2DYJ A;  2CY1 A;  4B3R C;  5KEI A;  4G37 A;  1ZB9 A;  4X65 C;  4LF5 C;  4LE5 A;  5T8S A;  4ZJZ A;  3AF6 A;  1MDF A;  4GXQ A;  2BJO A;  2Y4O A;  4GXR A;  4OYC A;  4DV3 C;  1J5E C;  5BSV A;  1RY2 A;  4K0K C;  1GPM A;  2OO4 A;  3CJE A;  1L2F A;  2E5L C;  4JI3 C;  3R44 A;  2P2F A;  4U5Y D;  5AE1 A;  3L95 X;  4MH4 A;  2D7V A;  1P7L A;  1QWI A;  1HNZ C;  4RLQ A;  1WH9 A;  4IR7 A;  4RM3 A;  1IBL C;  3RV2 A;  4KTV A;  2D1Q A;  3PBK A;  4DR4 C;  1T5D X;  5A1G A;  4NXM C;  4FUQ A;  1N2F A;  4YY3 C;  2WD9 A;  4PZP A;  3IEV A;  4LFB C;  1O92 A;  1O93 A;  4NDN A;  4ODJ A;  4K0B A;  4LF6 C;  1V25 A;  3KXW A;  4YHH C;  4FTF A;  2PN2 A;  1MKY A;  5BR8 C;  3A9U A;  1NYE A;  1MD9 A;  3FCE A;  4G36 A;  1EGA A;  3DAY A;  3JAM D;  3TDE A;  5GTD A;  3LNV A;  5BST A;  4DR5 C;  2P2M A;  1HNX C;  2D27 A;  5KYV A;  4B3M C;  4D4I A;  4RM2 A;  4I9G A;  4JI4 C;  4DUY C;  4OX9 C;  4DCV A;  4AQY C;  4GKJ C;  3DLP X;  4PRO C;  4DR2 C;  4DR6 C;  3PES A;  2OPL B;  4DV4 C;  2D1T A;  1XMO C;  4B3S C;  4FUT A;  3E7X A;  3LAX A;  4MTN A;  4JI7 C;  4NXN C;  3NI2 A;  2ASB A;  2BH1 X;  1UKK A;  2HJG A;  4DR3 C;  4JI5 C;  3I07 A;  4DV7 C;  1RG9 A;  2HHH C;  1HH2 P;  2CXC A;  2PRO A;  1PA4 A;  4XX2 A;  3FCC A;  4JI2 C;  4DV6 C;  1YJ7 A;  4KTT A;  4RVN A;  5T8T A;  3RG2 A;  2QVZ X;  2D1S A;  5BUR A;  2VQE C;  2JMP A;  4WS9 A;  1XRC A;  5H9U A;  1VLA A;  1T5H X;  2AYA A;  4RLF A;  4X66 C;  4JV5 C;  2QVY X;  5LMU C;  2PT7 G;  4JI0 C;  3T1Y C;  2KZF A;  2P2Q A;  3VNS A;  4DV5 C;  1BA3 A;  2Y27 A;  3AF5 A;  4DG8 A;  2D28 C;  1XNR C;  2E8C A;  5AE2 A;  4B3T C;  3SO4 A;  4LF8 C;  1XRB A;  4LF9 C;  5KYT A;  4WV3 A;  4BC7 A;  1ML8 A;  1MDB A;  2VSQ A;  5IFI A;  4R1L A;  1AMU A;  1XRA A;  4DV0 C;  1IBK C;  3EQ6 A;  2P2B A;  5JRH A;  2VQF C;  1N33 C;  2DPL A;  5E7Q A;  5BSR A;  2EGT A;  2QVX X;  4BC9 A;  4JI1 C;  3GKU A;  4NOZ A;  5BUS A;  2YWB A;  4DCT A;  1HR0 C;  2ATW A;  4D57 A;  4DR7 C;  1ULT A;  3LUS A;  4G1I A;  5BSW A;  5LMN C;  5CZV A;  3UZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...