1PA4A

Solution structure of a putative ribosome-binding factor from mycoplasma pneumoniae (mpn156)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
KERLENDIIRLINRTVIHEIYNETVKTGHVTHVKLSDDLLHVTVYLDCYNREQIDRVVGAFNQAKGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Probable ribosome-binding factor A
publication title Solution structure of a putative ribosome binding protein from Mycoplasma pneumoniae and comparison to a distant homolog.
pubmed doi rcsb
source organism Mycoplasma pneumoniae
total genus 15
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1pa4A00
1K0RA 4LF5C 1IBKC 4GKJC 1ZB8A 1XNRC 1MKYA 1HNXC 4LF8C 4DR1C 3R9XA 3JAMD 1N32C 2CXCA 1UKKA 5IWAC 1ZB9A 3T1HC 2UU9C 4LFCC 2PT7G 3J81D 4JI3C 4DCUA 2UXDC 4DV0C 2F4VC 2OPLA 1N34C 1L2FA 2BJOA 2JMPA 1IBMC 4B3SC 1USPA 4DV2C 3I07A 4DCTA 1JOSA 4X65C 4NXMC 4JI1C 4JI0C 1ML8A 2OPLB 1N2FA 4DUZC 2ATWA 4DV4C 3AF5A 4LF6C 1USPB 3T1YC 4JI5C 2UUCC 3R9WA 4DR2C 2E8CA 4LF7C 1PA4A 2E8EA 4XX2A 1VLAA 2PN2A 4B3RC 1XMQC 1WF3A 2DYJA 1EGAA 3IEUA 1KKGA 1XNQC 4K0KC 4BSZA 1NYEA 4JI6C 4X64C 4LF4C 4X62C 3CJEA 4NOZA 4DV3C 1HNZC 4DR6C 3GKUA 4DCVA 4JYAC 2ZM6C 2HJGA 3EERA 1N36C 2QL8A 3OTOC 2ASBA 4JI4C 4MTNA 4DCSA 2UUAC 4DUYC 2XR1A 2CY1A 2UXBC 4NXNC 2E8FA 1XMOC 2D7VA 5BR8C 2UXCC 4X66C 4DR3C 4YHHC 1FJGC 3J80D 2YCBA 4MH4A 3IEVA 4YY3C 1LQLA 3LUSA 1N33C 4KHPC 4DV5C 4DV1C 4AQYC 2EGTA 1WH9A 4DR7C 4LF9C 4B3TC 4LFAC 5IT9D 2VQFC 4JI7C 1HR0C 3AF6A 4JV5C 1IBLC 1I94C 4LFBC 1HNWC 4DR5C 4DV6C 2E7GA 1QWIA 1J5EC 4DV7C 2UUBC 4DR4C 5LMUC 4JI2C 2HHHC 5A2QD 4OX9C 2VQEC 1HH2P 2E5LC 4GKKC 2ONFA 4B3MC 5LMNC 2KZFA 5FLXD 4JI8C
chains in the Genus database with same CATH superfamily
5JRHA 4LF5C 2P2BA 3LNVA 5CZVA 2P2FA 5A1GA 3CW8X 3JAMD 2JNVA 1ULTA 4RMNA 4K0BA 2M5HA 2JMPA 4IR7A 4R1LA 4DV2C 4DCTA 4D57A 1ML8A 2OPLB 2D28C 1WCJA 2MM9A 3AF5A 3PROC 4JI5C 5E7QA 4DR2C 4LF7C 1VLAA 2D1RA 5ADZA 1WF3A 3RG2A 2DYJA 1KKGA 4X64C 4TPSB 4X62C 3CJEA 1GPMA 1QM4A 2P2JA 2VSQA 3IPLA 2QL8A 4DCSA 3DHVA 4G36A 4G37A 3PESA 4GXRA 4EATA 1XMOC 1XRCA 2D7VA 3TUFA 5BR8C 1P4EA 4YHHC 3S82A 3UX3A 2YCBA 3IEVA 5K8FA 3PBKA 3GR0A 3C5EA 3A25A 2QVZX 3CQ2A 2BH1X 5IT9D 4OXIA 4WS9A 1I94C 2QVYX 1MDFA 4DG8A 4PROC 1M6XC 1MD9A 4RVOA 3AY0A 3DAYA 3VNQA 4JI2C 3A26A 3O2EA 1IBKC 3LAXA 5H9UA 1T5DX 5IFIA 2OBVA 3NPDA 2YX1A 1ZB8A 1MKYA 1HNXC 1VEHA 2PT7G 3LNOA 2VZEA 3J81D 4DCUA 2Y4OA 1MXAA 1L2FA 2BJOA 2NCLA 2P02A 4L7IA 5KYTA 2V7BA 1JOSA 4X65C 4JI1C 1TH5A 4GS5A 4OYCA 4DV4C 4R0MA 3A4IA 4WV3A 1USPB 3T1YC 2UUCC 2E8EA 4B3RC 1EGAA 3IEUA 4K0KC 1NYEA 4LF4C 4D56A 3I08A 3FCCA 4DV3C 1HNZC 4RM2A 4DR6C 4DCVA 1PG4A 1O92A 2ZZMA 1LCIA 3CW9A 4DUYC 5BURA 1FUGA 2E8FA 3UOWA 3A9VA 1V60A 4X66C 4ZLPA 4DR3C 1M6XA 4MH4A 3NYRA 3UZ0A 1LQLA 3LUSA 4L2ZA 4D4IA 4U5YD 2KDNA 4DV5C 5AE1A 4AQYC 2EGTA 4DR7C 5BSMA 4LF9C 2MMAB 4B3TC 2VQFC 4JI7C 4JV5C 1HNWC 4DR5C 4RVNA 1XHJA 1J5EC 2D1TA 2P2QA 2E0GA 3ETCA 5AE2A 3CQ3A 4BC9A 5LMUC 2PROA 4BC7A 2VQEC 2E5LC 5LMNC 4ODJA 2KZFA 4PZPA 3L95X 5T8SA 1RG9A 5KYVA 3EQ6A 3R44A 1XNRC 4DR1C 1N32C 5IWAC 3N2QA 2UU9C 3E7WA 2D1QA 3VNRA 2WP0C 2D1SA 4DV0C 2OPLA 1IB8A 3IMLA 1IBMC 1RY2A 1YJ7A 2WD9A 3I07A 4R1MA 5KEIA 4FUTA 5A19A 1N2FA 2OO4A 3NYQA 2P2MA 3SO4A 2Y27A 2P20A 5AE3A 2Z51A 1XMQC 3NI2A 4BSZA 4JI6C 4KTVA 3DLPX 4NOZA 1NY8A 3TQIA 3GKUA 4JYAC 4FUQA 2ZM6C 2HJGA 5BUQA 1N36C 1MXCA 3TDEA 3OTOC 2Y4NA 4MTNA 2UUAC 2XR1A 3RV2A 3UX2A 4D4GA 2UXCC 3TR3A 3K6RA 1FJGC 1BA3A 2DHMA 3ETOA 5BSRA 4GXQA 1PU1A 4BCAA 4KHPC 4ISBA 4DV1C 4G1IA 1WH9A 3N54B 3UEBA 2QW0X 5GTDA 3VNSA 3GPCA 3AF6A 4LFBC 4DV6C 2E7GA 1QWIA 4LE5A 3GR1A 1AMUA 3E7XA 4DV7C 4OX9C 5A2QD 1HH2P 2ZZNA 4GKKC 2ONFA 4B3MC 5FLXD 1K0RA 5LCIA 2YWCA 1O90A 4GKJC 4LF8C 3R9XA 2CXCA 1UKKA 3T1HC 1ZB9A 4LFCC 4ZJZA 4I9GA 4JM1A 4JI3C 1XS3A 4RLQA 5BSTA 2UXDC 1XRAA 2F4VC 3B7WA 1N34C 4PUGA 4B3SC 1USPA 3FCEA 5K85A 3A9UA 4NXMC 4JI0C 1UWDA 3H2TA 4DG9A 4DUZC 2ATWA 3KXWA 2MCQA 5T8TA 4L4QA 4RLFA 4LF6C 1V25A 3R9WA 4RM3A 1P7LA 2E8CA 1PA4A 4XX2A 2PN2A 2CU6A 1XNQC 5BSWA 3EERA 1O9TA 3CQ1A 1MDBA 2ASBA 4JI4C 2DPLA 2UXBC 2CY1A 4PUHA 4NXNC 5BSVA 5BUSA 1XRBA 3LGXA 1FLOA 5CZXA 3J80D 4HPVA 4YY3C 4BBYA 1N33C 4I9FA 4IZ6A 2QVXX 5BSUA 4LFAC 3G7SA 1HR0C 4NDNA 1IBLC 1P4EC 2KZ0A 1MXBA 2YWBA 4PUIA 1O93A 1V26A 2UUBC 4DR4C 4KTTA 4PHTA 5DV9A 2D27A 2M5OA 1PG3A 2AYAA 2HHHC 4FTFA 1T5HX 3L8CA 5A1IA 4JI8C
chains in the Genus database with same CATH topology
5JRHA 4LF5C 2P2BA 3LNVA 5CZVA 2P2FA 5A1GA 3CW8X 3JAMD 1ULTA 4RMNA 4K0BA 2JMPA 4IR7A 4R1LA 4DV2C 4DCTA 4D57A 1ML8A 2OPLB 2D28C 3AF5A 3PROC 4JI5C 5E7QA 4DR2C 4LF7C 1VLAA 2D1RA 5ADZA 1WF3A 3RG2A 2DYJA 1KKGA 4X64C 4TPSB 4X62C 3CJEA 1GPMA 1QM4A 2P2JA 2VSQA 3IPLA 2QL8A 4DCSA 3DHVA 4G36A 4G37A 3PESA 4GXRA 4EATA 1XMOC 1XRCA 2D7VA 3TUFA 5BR8C 4YHHC 3S82A 2YCBA 3IEVA 5K8FA 3PBKA 3GR0A 3C5EA 2QVZX 2BH1X 5IT9D 4OXIA 4WS9A 1I94C 2QVYX 1MDFA 4DG8A 4PROC 1MD9A 4RVOA 3DAYA 3VNQA 4JI2C 1IBKC 3LAXA 5H9UA 1T5DX 5IFIA 2OBVA 3NPDA 1ZB8A 1MKYA 1HNXC 2PT7G 2VZEA 3J81D 4DCUA 2Y4OA 1MXAA 1L2FA 2BJOA 2P02A 4L7IA 5KYTA 2V7BA 1JOSA 4X65C 4JI1C 4GS5A 4OYCA 4DV4C 4R0MA 3A4IA 4WV3A 1USPB 3T1YC 2UUCC 2E8EA 4B3RC 1EGAA 3IEUA 4K0KC 1NYEA 4LF4C 4D56A 3I08A 3FCCA 4DV3C 1HNZC 4RM2A 4DR6C 4DCVA 1PG4A 1O92A 1LCIA 3CW9A 4DUYC 5BURA 1FUGA 2E8FA 3UOWA 3A9VA 4X66C 4ZLPA 4DR3C 4MH4A 3NYRA 3UZ0A 1LQLA 3LUSA 4L2ZA 4D4IA 4U5YD 4DV5C 5AE1A 4AQYC 2EGTA 4DR7C 5BSMA 4LF9C 4B3TC 2VQFC 4JI7C 4JV5C 1HNWC 4DR5C 4RVNA 1J5EC 2D1TA 2P2QA 2E0GA 3ETCA 5AE2A 4BC9A 5LMUC 2PROA 4BC7A 2VQEC 2E5LC 5LMNC 4ODJA 2KZFA 4PZPA 3L95X 5T8SA 1RG9A 5KYVA 3EQ6A 3R44A 1XNRC 4DR1C 1N32C 5IWAC 3N2QA 2UU9C 3E7WA 2D1QA 3VNRA 2WP0C 2D1SA 4DV0C 2OPLA 3IMLA 1IBMC 1RY2A 1YJ7A 2WD9A 3I07A 4R1MA 5KEIA 4FUTA 5A19A 1N2FA 2OO4A 3NYQA 2P2MA 3SO4A 2Y27A 2P20A 5AE3A 1XMQC 3NI2A 4BSZA 4JI6C 4KTVA 3DLPX 4NOZA 3TQIA 3GKUA 4JYAC 4FUQA 2ZM6C 2HJGA 5BUQA 1N36C 1MXCA 3TDEA 3OTOC 2Y4NA 4MTNA 2UUAC 2XR1A 3RV2A 4D4GA 2UXCC 1FJGC 1BA3A 3ETOA 5BSRA 4GXQA 4BCAA 4KHPC 4ISBA 4DV1C 4G1IA 1WH9A 3N54B 2QW0X 5GTDA 3VNSA 3GPCA 3AF6A 4LFBC 4DV6C 2E7GA 1QWIA 4LE5A 3GR1A 1AMUA 3E7XA 4DV7C 4OX9C 5A2QD 1HH2P 4GKKC 2ONFA 4B3MC 5FLXD 1K0RA 2YWCA 1O90A 4GKJC 4LF8C 3R9XA 2CXCA 1UKKA 3T1HC 1ZB9A 4LFCC 4ZJZA 4I9GA 4JM1A 4JI3C 4RLQA 5BSTA 2UXDC 1XRAA 2F4VC 3B7WA 1N34C 4B3SC 1USPA 3FCEA 5K85A 3A9UA 4NXMC 4JI0C 3H2TA 4DG9A 4DUZC 2ATWA 3KXWA 5T8TA 4L4QA 4RLFA 4LF6C 1V25A 3R9WA 4RM3A 1P7LA 2E8CA 1PA4A 4XX2A 2PN2A 1XNQC 5BSWA 3EERA 1O9TA 1MDBA 2ASBA 4JI4C 2DPLA 2UXBC 2CY1A 4NXNC 5BSVA 5BUSA 1XRBA 3LGXA 5CZXA 3J80D 4HPVA 4YY3C 4BBYA 1N33C 4I9FA 4IZ6A 2QVXX 5BSUA 4LFAC 3G7SA 1HR0C 4NDNA 1IBLC 1MXBA 2YWBA 1O93A 1V26A 2UUBC 4DR4C 4KTTA 4PHTA 5DV9A 2D27A 1PG3A 2AYAA 2HHHC 4FTFA 1T5HX 3L8CA 5A1IA 4JI8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0R A;  4LF5 C;  1IBK C;  4GKJ C;  1ZB8 A;  1XNR C;  1MKY A;  1HNX C;  4LF8 C;  4DR1 C;  3R9X A;  3JAM D;  1N32 C;  2CXC A;  1UKK A;  5IWA C;  1ZB9 A;  3T1H C;  2UU9 C;  4LFC C;  2PT7 G;  3J81 D;  4JI3 C;  4DCU A;  2UXD C;  4DV0 C;  2F4V C;  2OPL A;  1N34 C;  1L2F A;  2BJO A;  2JMP A;  1IBM C;  4B3S C;  1USP A;  4DV2 C;  3I07 A;  4DCT A;  1JOS A;  4X65 C;  4NXM C;  4JI1 C;  4JI0 C;  1ML8 A;  2OPL B;  1N2F A;  4DUZ C;  2ATW A;  4DV4 C;  3AF5 A;  4LF6 C;  1USP B;  3T1Y C;  4JI5 C;  2UUC C;  3R9W A;  4DR2 C;  2E8C A;  4LF7 C;  1PA4 A;  2E8E A;  4XX2 A;  1VLA A;  2PN2 A;  4B3R C;  1XMQ C;  1WF3 A;  2DYJ A;  1EGA A;  3IEU A;  1KKG A;  1XNQ C;  4K0K C;  4BSZ A;  1NYE A;  4JI6 C;  4X64 C;  4LF4 C;  4X62 C;  3CJE A;  4NOZ A;  4DV3 C;  1HNZ C;  4DR6 C;  3GKU A;  4DCV A;  4JYA C;  2ZM6 C;  2HJG A;  3EER A;  1N36 C;  2QL8 A;  3OTO C;  2ASB A;  4JI4 C;  4MTN A;  4DCS A;  2UUA C;  4DUY C;  2XR1 A;  2CY1 A;  2UXB C;  4NXN C;  2E8F A;  1XMO C;  2D7V A;  5BR8 C;  2UXC C;  4X66 C;  4DR3 C;  4YHH C;  1FJG C;  3J80 D;  2YCB A;  4MH4 A;  3IEV A;  4YY3 C;  1LQL A;  3LUS A;  1N33 C;  4KHP C;  4DV5 C;  4DV1 C;  4AQY C;  2EGT A;  1WH9 A;  4DR7 C;  4LF9 C;  4B3T C;  4LFA C;  5IT9 D;  2VQF C;  4JI7 C;  1HR0 C;  3AF6 A;  4JV5 C;  1IBL C;  1I94 C;  4LFB C;  1HNW C;  4DR5 C;  4DV6 C;  2E7G A;  1QWI A;  1J5E C;  4DV7 C;  2UUB C;  4DR4 C;  5LMU C;  4JI2 C;  2HHH C;  5A2Q D;  4OX9 C;  2VQE C;  1HH2 P;  2E5L C;  4GKK C;  2ONF A;  4B3M C;  5LMN C;  2KZF A;  5FLX D;  4JI8 C; 
#chains in the Genus database with same CATH topology
 5JRH A;  4LF5 C;  2P2B A;  3LNV A;  5CZV A;  2P2F A;  5A1G A;  3CW8 X;  3JAM D;  2JNV A;  1ULT A;  4RMN A;  4K0B A;  2M5H A;  2JMP A;  4IR7 A;  4R1L A;  4DV2 C;  4DCT A;  4D57 A;  1ML8 A;  2OPL B;  2D28 C;  1WCJ A;  2MM9 A;  3AF5 A;  3PRO C;  4JI5 C;  5E7Q A;  4DR2 C;  4LF7 C;  1VLA A;  2D1R A;  5ADZ A;  1WF3 A;  3RG2 A;  2DYJ A;  1KKG A;  4X64 C;  4TPS B;  4X62 C;  3CJE A;  1GPM A;  1QM4 A;  2P2J A;  2VSQ A;  3IPL A;  2QL8 A;  4DCS A;  3DHV A;  4G36 A;  4G37 A;  3PES A;  4GXR A;  4EAT A;  1XMO C;  1XRC A;  2D7V A;  3TUF A;  5BR8 C;  1P4E A;  4YHH C;  3S82 A;  3UX3 A;  2YCB A;  3IEV A;  5K8F A;  3PBK A;  3GR0 A;  3C5E A;  3A25 A;  2QVZ X;  3CQ2 A;  2BH1 X;  5IT9 D;  4OXI A;  4WS9 A;  1I94 C;  2QVY X;  1MDF A;  4DG8 A;  4PRO C;  1M6X C;  1MD9 A;  4RVO A;  3AY0 A;  3DAY A;  3VNQ A;  4JI2 C;  3A26 A;  3O2E A;  1IBK C;  3LAX A;  5H9U A;  1T5D X;  5IFI A;  2OBV A;  3NPD A;  2YX1 A;  1ZB8 A;  1MKY A;  1HNX C;  1VEH A;  2PT7 G;  3LNO A;  2VZE A;  3J81 D;  4DCU A;  2Y4O A;  1MXA A;  1L2F A;  2BJO A;  2NCL A;  2P02 A;  4L7I A;  5KYT A;  2V7B A;  1JOS A;  4X65 C;  4JI1 C;  1TH5 A;  4GS5 A;  4OYC A;  4DV4 C;  4R0M A;  3A4I A;  4WV3 A;  1USP B;  3T1Y C;  2UUC C;  2E8E A;  4B3R C;  1EGA A;  3IEU A;  4K0K C;  1NYE A;  4LF4 C;  4D56 A;  3I08 A;  3FCC A;  4DV3 C;  1HNZ C;  4RM2 A;  4DR6 C;  4DCV A;  1PG4 A;  1O92 A;  2ZZM A;  1LCI A;  3CW9 A;  4DUY C;  5BUR A;  1FUG A;  2E8F A;  3UOW A;  3A9V A;  1V60 A;  4X66 C;  4ZLP A;  4DR3 C;  1M6X A;  4MH4 A;  3NYR A;  3UZ0 A;  1LQL A;  3LUS A;  4L2Z A;  4D4I A;  4U5Y D;  2KDN A;  4DV5 C;  5AE1 A;  4AQY C;  2EGT A;  4DR7 C;  5BSM A;  4LF9 C;  2MMA B;  4B3T C;  2VQF C;  4JI7 C;  4JV5 C;  1HNW C;  4DR5 C;  4RVN A;  1XHJ A;  1J5E C;  2D1T A;  2P2Q A;  2E0G A;  3ETC A;  5AE2 A;  3CQ3 A;  4BC9 A;  5LMU C;  2PRO A;  4BC7 A;  2VQE C;  2E5L C;  5LMN C;  4ODJ A;  2KZF A;  4PZP A;  3L95 X;  5T8S A;  1RG9 A;  5KYV A;  3EQ6 A;  3R44 A;  1XNR C;  4DR1 C;  1N32 C;  5IWA C;  3N2Q A;  2UU9 C;  3E7W A;  2D1Q A;  3VNR A;  2WP0 C;  2D1S A;  4DV0 C;  2OPL A;  1IB8 A;  3IML A;  1IBM C;  1RY2 A;  1YJ7 A;  2WD9 A;  3I07 A;  4R1M A;  5KEI A;  4FUT A;  5A19 A;  1N2F A;  2OO4 A;  3NYQ A;  2P2M A;  3SO4 A;  2Y27 A;  2P20 A;  5AE3 A;  2Z51 A;  1XMQ C;  3NI2 A;  4BSZ A;  4JI6 C;  4KTV A;  3DLP X;  4NOZ A;  1NY8 A;  3TQI A;  3GKU A;  4JYA C;  4FUQ A;  2ZM6 C;  2HJG A;  5BUQ A;  1N36 C;  1MXC A;  3TDE A;  3OTO C;  2Y4N A;  4MTN A;  2UUA C;  2XR1 A;  3RV2 A;  3UX2 A;  4D4G A;  2UXC C;  3TR3 A;  3K6R A;  1FJG C;  1BA3 A;  2DHM A;  3ETO A;  5BSR A;  4GXQ A;  1PU1 A;  4BCA A;  4KHP C;  4ISB A;  4DV1 C;  4G1I A;  1WH9 A;  3N54 B;  3UEB A;  2QW0 X;  5GTD A;  3VNS A;  3GPC A;  3AF6 A;  4LFB C;  4DV6 C;  2E7G A;  1QWI A;  4LE5 A;  3GR1 A;  1AMU A;  3E7X A;  4DV7 C;  4OX9 C;  5A2Q D;  1HH2 P;  2ZZN A;  4GKK C;  2ONF A;  4B3M C;  5FLX D;  1K0R A;  5LCI A;  2YWC A;  1O90 A;  4GKJ C;  4LF8 C;  3R9X A;  2CXC A;  1UKK A;  3T1H C;  1ZB9 A;  4LFC C;  4ZJZ A;  4I9G A;  4JM1 A;  4JI3 C;  1XS3 A;  4RLQ A;  5BST A;  2UXD C;  1XRA A;  2F4V C;  3B7W A;  1N34 C;  4PUG A;  4B3S C;  1USP A;  3FCE A;  5K85 A;  3A9U A;  4NXM C;  4JI0 C;  1UWD A;  3H2T A;  4DG9 A;  4DUZ C;  2ATW A;  3KXW A;  2MCQ A;  5T8T A;  4L4Q A;  4RLF A;  4LF6 C;  1V25 A;  3R9W A;  4RM3 A;  1P7L A;  2E8C A;  1PA4 A;  4XX2 A;  2PN2 A;  2CU6 A;  1XNQ C;  5BSW A;  3EER A;  1O9T A;  3CQ1 A;  1MDB A;  2ASB A;  4JI4 C;  2DPL A;  2UXB C;  2CY1 A;  4PUH A;  4NXN C;  5BSV A;  5BUS A;  1XRB A;  3LGX A;  1FLO A;  5CZX A;  3J80 D;  4HPV A;  4YY3 C;  4BBY A;  1N33 C;  4I9F A;  4IZ6 A;  2QVX X;  5BSU A;  4LFA C;  3G7S A;  1HR0 C;  4NDN A;  1IBL C;  1P4E C;  2KZ0 A;  1MXB A;  2YWB A;  4PUI A;  1O93 A;  1V26 A;  2UUB C;  4DR4 C;  4KTT A;  4PHT A;  5DV9 A;  2D27 A;  2M5O A;  1PG3 A;  2AYA A;  2HHH C;  4FTF A;  1T5H X;  3L8C A;  5A1I A;  4JI8 C; 
#chains in the Genus database with same CATH homology
 5JRH A;  4LF5 C;  2P2B A;  3LNV A;  5CZV A;  2P2F A;  5A1G A;  3CW8 X;  3JAM D;  1ULT A;  4RMN A;  4K0B A;  2JMP A;  4IR7 A;  4R1L A;  4DV2 C;  4DCT A;  4D57 A;  1ML8 A;  2OPL B;  2D28 C;  3AF5 A;  3PRO C;  4JI5 C;  5E7Q A;  4DR2 C;  4LF7 C;  1VLA A;  2D1R A;  5ADZ A;  1WF3 A;  3RG2 A;  2DYJ A;  1KKG A;  4X64 C;  4TPS B;  4X62 C;  3CJE A;  1GPM A;  1QM4 A;  2P2J A;  2VSQ A;  3IPL A;  2QL8 A;  4DCS A;  3DHV A;  4G36 A;  4G37 A;  3PES A;  4GXR A;  4EAT A;  1XMO C;  1XRC A;  2D7V A;  3TUF A;  5BR8 C;  4YHH C;  3S82 A;  2YCB A;  3IEV A;  5K8F A;  3PBK A;  3GR0 A;  3C5E A;  2QVZ X;  2BH1 X;  5IT9 D;  4OXI A;  4WS9 A;  1I94 C;  2QVY X;  1MDF A;  4DG8 A;  4PRO C;  1MD9 A;  4RVO A;  3DAY A;  3VNQ A;  4JI2 C;  1IBK C;  3LAX A;  5H9U A;  1T5D X;  5IFI A;  2OBV A;  3NPD A;  1ZB8 A;  1MKY A;  1HNX C;  2PT7 G;  2VZE A;  3J81 D;  4DCU A;  2Y4O A;  1MXA A;  1L2F A;  2BJO A;  2P02 A;  4L7I A;  5KYT A;  2V7B A;  1JOS A;  4X65 C;  4JI1 C;  4GS5 A;  4OYC A;  4DV4 C;  4R0M A;  3A4I A;  4WV3 A;  1USP B;  3T1Y C;  2UUC C;  2E8E A;  4B3R C;  1EGA A;  3IEU A;  4K0K C;  1NYE A;  4LF4 C;  4D56 A;  3I08 A;  3FCC A;  4DV3 C;  1HNZ C;  4RM2 A;  4DR6 C;  4DCV A;  1PG4 A;  1O92 A;  1LCI A;  3CW9 A;  4DUY C;  5BUR A;  1FUG A;  2E8F A;  3UOW A;  3A9V A;  4X66 C;  4ZLP A;  4DR3 C;  4MH4 A;  3NYR A;  3UZ0 A;  1LQL A;  3LUS A;  4L2Z A;  4D4I A;  4U5Y D;  4DV5 C;  5AE1 A;  4AQY C;  2EGT A;  4DR7 C;  5BSM A;  4LF9 C;  4B3T C;  2VQF C;  4JI7 C;  4JV5 C;  1HNW C;  4DR5 C;  4RVN A;  1J5E C;  2D1T A;  2P2Q A;  2E0G A;  3ETC A;  5AE2 A;  4BC9 A;  5LMU C;  2PRO A;  4BC7 A;  2VQE C;  2E5L C;  5LMN C;  4ODJ A;  2KZF A;  4PZP A;  3L95 X;  5T8S A;  1RG9 A;  5KYV A;  3EQ6 A;  3R44 A;  1XNR C;  4DR1 C;  1N32 C;  5IWA C;  3N2Q A;  2UU9 C;  3E7W A;  2D1Q A;  3VNR A;  2WP0 C;  2D1S A;  4DV0 C;  2OPL A;  3IML A;  1IBM C;  1RY2 A;  1YJ7 A;  2WD9 A;  3I07 A;  4R1M A;  5KEI A;  4FUT A;  5A19 A;  1N2F A;  2OO4 A;  3NYQ A;  2P2M A;  3SO4 A;  2Y27 A;  2P20 A;  5AE3 A;  1XMQ C;  3NI2 A;  4BSZ A;  4JI6 C;  4KTV A;  3DLP X;  4NOZ A;  3TQI A;  3GKU A;  4JYA C;  4FUQ A;  2ZM6 C;  2HJG A;  5BUQ A;  1N36 C;  1MXC A;  3TDE A;  3OTO C;  2Y4N A;  4MTN A;  2UUA C;  2XR1 A;  3RV2 A;  4D4G A;  2UXC C;  1FJG C;  1BA3 A;  3ETO A;  5BSR A;  4GXQ A;  4BCA A;  4KHP C;  4ISB A;  4DV1 C;  4G1I A;  1WH9 A;  3N54 B;  2QW0 X;  5GTD A;  3VNS A;  3GPC A;  3AF6 A;  4LFB C;  4DV6 C;  2E7G A;  1QWI A;  4LE5 A;  3GR1 A;  1AMU A;  3E7X A;  4DV7 C;  4OX9 C;  5A2Q D;  1HH2 P;  4GKK C;  2ONF A;  4B3M C;  5FLX D;  1K0R A;  2YWC A;  1O90 A;  4GKJ C;  4LF8 C;  3R9X A;  2CXC A;  1UKK A;  3T1H C;  1ZB9 A;  4LFC C;  4ZJZ A;  4I9G A;  4JM1 A;  4JI3 C;  4RLQ A;  5BST A;  2UXD C;  1XRA A;  2F4V C;  3B7W A;  1N34 C;  4B3S C;  1USP A;  3FCE A;  5K85 A;  3A9U A;  4NXM C;  4JI0 C;  3H2T A;  4DG9 A;  4DUZ C;  2ATW A;  3KXW A;  5T8T A;  4L4Q A;  4RLF A;  4LF6 C;  1V25 A;  3R9W A;  4RM3 A;  1P7L A;  2E8C A;  1PA4 A;  4XX2 A;  2PN2 A;  1XNQ C;  5BSW A;  3EER A;  1O9T A;  1MDB A;  2ASB A;  4JI4 C;  2DPL A;  2UXB C;  2CY1 A;  4NXN C;  5BSV A;  5BUS A;  1XRB A;  3LGX A;  5CZX A;  3J80 D;  4HPV A;  4YY3 C;  4BBY A;  1N33 C;  4I9F A;  4IZ6 A;  2QVX X;  5BSU A;  4LFA C;  3G7S A;  1HR0 C;  4NDN A;  1IBL C;  1MXB A;  2YWB A;  1O93 A;  1V26 A;  2UUB C;  4DR4 C;  4KTT A;  4PHT A;  5DV9 A;  2D27 A;  1PG3 A;  2AYA A;  2HHH C;  4FTF A;  1T5H X;  3L8C A;  5A1I A;  4JI8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...