3UX2A

Crystal structure of domain-swapped fam96a major dimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
124
Chain Sequence
SNARIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGDINKQINDKERVAAAMENPNLREIVEQCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer
doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MIP18 family protein FAM96A
total genus 32
structure length 124
sequence length 130
ec nomenclature
pdb deposition date 2011-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3ux2A00
2JNVA 3CQ2A 3LNOA 1XHJA 3UX2A 1WCJA 3CQ3A 3UX3A 3CQ1A 2M5OA 2M5HA 2Z51A 1TH5A 1VEHA 1UWDA 2CU6A
chains in the Genus database with same CATH superfamily
4DV2C 3IEUA 4NXNC 5BSUA 4DG9A 4YHHC 1O92A 2MCQA 1VEHA 2M5HA 1IBMC 3NYRA 3LNOA 1LCIA 1T5HX 4DUZC 4XX2A 1IBLC 5BUQA 2P2BA 1XRBA 3RG2A 1GPMA 4RMNA 1WH9A 2ONFA 4PUIA 3VNSA 5ADZA 4GKKC 1RY2A 4D4GA 5BSWA 2QW0X 3A9VA 4GXQA 5BSMA 1MD9A 4JI1C 5E7QA 4LF7C 5CZXA 2Y4NA 1WF3A 4KTVA 2QVXX 5BSTA 3E7XA 2VQFC 4JI0C 4I9FA 4X65C 1AMUA 1PG4A 2D27A 2MM9A 1MXCA 3CQ1A 1M6XA 4KHPC 1FUGA 4X62C 4RVOA 2E7GA 4JI8C 1P4EC 3FCCA 5LMNC 3A26A 1FJGC 5AE2A 3PESA 5CZVA 3GKUA 3GR0A 2E8FA 2Z51A 2E0GA 4RM2A 3EQ6A 4LF9C 4L2ZA 2P2FA 2VSQA 5IT9D 5BUSA 4BC7A 1IB8A 4ISBA 2AYAA 3KXWA 3UX3A 1K0RA 4JM1A 3CW8X 4B3TC 3DLPX 4JI5C 3IEVA 2KZFA 4LE5A 5BSVA 4MTNA 3VNQA 4X66C 2NCLA 4HPVA 3B7WA 3A25A 4DV4C 3LNVA 2KDNA 4DUYC 1QWIA 3OTOC 1USPB 4NXMC 2D1RA 4DR6C 2D1TA 2CXCA 1MDBA 3UOWA 1EGAA 5GTDA 1HNXC 2CU6A 4ZLPA 5A1GA 1LQLA 4PUHA 4DCUA 4GXRA 5H9UA 3FCEA 2PN2A 4G37A 2OBVA 3UEBA 4DV7C 2YX1A 3T1HC 4JI4C 2D7VA 3DHVA 4DV3C 1O9TA 3PROC 1YJ7A 1XS3A 1HR0C 2XR1A 4R0MA 3TDEA 4DCSA 1ULTA 2JNVA 4AQYC 4BSZA 4L4QA 1O93A 1ZB8A 2P2QA 2F4VC 1HH2P 3DAYA 3H2TA 2M5OA 3PBKA 4DV6C 4B3SC 1PG3A 5A19A 3UZ0A 3VNRA 2UUAC 2UU9C 2ZZNA 3I08A 2BH1X 4DV0C 3GPCA 3J80D 1N36C 4X64C 2HHHC 4BCAA 4EATA 1RG9A 5IFIA 1J5EC 1XNRC 4LFAC 2KZ0A 2WP0C 4WS9A 4LFCC 3IMLA 3T1YC 3R44A 1XHJA 3LUSA 5T8TA 5KYTA 4DV5C 3AY0A 4K0KC 3EERA 2ZM6C 1N32C 5KYVA 2JMPA 3AF5A 3TUFA 5FLXD 1TH5A 2ASBA 2PROA 2ATWA 1XRAA 4FUTA 4DR1C 4JV5C 3N54B 4LF4C 4D56A 2OPLB 1KKGA 4G36A 1V25A 3TR3A 3L8CA 5AE1A 2VQEC 3CQ2A 4GKJC 1VLAA 4B3MC 3NPDA 2QVZX 2DYJA 1P4EA 3A9UA 2Y27A 1MXBA 2WD9A 3ETCA 3I07A 2D1SA 5A1IA 5IWAC 4JYAC 4NDNA 2UXDC 5K85A 2Y4OA 2HJGA 4WV3A 1USPA 4RLQA 1XMQC 4JI7C 2DHMA 1PA4A 4RM3A 3C5EA 4PUGA 1ML8A 2UXCC 4PROC 4DR2C 4KTTA 2P2MA 4ZJZA 2MMAB 3JAMD 1HNZC 1ZB9A 4G1IA 5LCIA 4DCVA 4L7IA 2PT7G 3NYQA 4DCTA 1N33C 5BR8C 1XMOC 4DR5C 4DG8A 1BA3A 4FUQA 2P20A 2OO4A 5BSRA 1UWDA 3SO4A 1XNQC 4RLFA 4LFBC 2E8CA 2P02A 1V26A 4LF6C 2YWBA 1NY8A 3GR1A 3CQ3A 2EGTA 1HNWC 4YY3C 4TPSB 5BURA 2QL8A 4D57A 5KEIA 2DPLA 4DV1C 3IPLA 2BJOA 4R1LA 4JI2C 4OXIA 4LF8C 1L2FA 3CW9A 3ETOA 5T8SA 1JOSA 1MKYA 4DR3C 4RVNA 5AE3A 4GS5A 4ODJA 2E8EA 1T5DX 3RV2A 2ZZMA 4DR7C 4BBYA 3LAXA 3TQIA 5JRHA 3L95X 3E7WA 1WCJA 4PZPA 1UKKA 2V7BA 1P7LA 5A2QD 4D4IA 1FLOA 1MDFA 2D28C 4FTFA 1N2FA 4DR4C 5K8FA 3K6RA 3R9XA 4IZ6A 3R9WA 2E5LC 1O90A 3O2EA 4OX9C 1XRCA 2UUBC 3CJEA 2D1QA 4NOZA 4K0BA 4OYCA 1I94C 2YCBA 3S82A 3N2QA 1M6XC 2UXBC 3LGXA 1PU1A 5LMUC 4I9GA 4JI3C 2VZEA 1V60A 2CY1A 4R1MA 3AF6A 2YWCA 3UX2A 3J81D 4U5YD 3NI2A 5DV9A 4PHTA 2OPLA 1QM4A 4IR7A 3G7SA 4MH4A 4B3RC 1MXAA 2UUCC 1N34C 4JI6C 2QVYX 4LF5C 1IBKC 1NYEA 2P2JA 4BC9A 3A4IA
chains in the Genus database with same CATH topology
2JNVA 3CQ2A 3LNOA 1XHJA 3UX2A 1WCJA 3CQ3A 3UX3A 3CQ1A 2M5OA 2M5HA 2Z51A 1TH5A 1VEHA 1UWDA 2CU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNV A;  3CQ2 A;  3LNO A;  1XHJ A;  3UX2 A;  1WCJ A;  3CQ3 A;  3UX3 A;  3CQ1 A;  2M5O A;  2M5H A;  2Z51 A;  1TH5 A;  1VEH A;  1UWD A;  2CU6 A; 
#chains in the Genus database with same CATH topology
 4DV2 C;  3IEU A;  4NXN C;  5BSU A;  4DG9 A;  4YHH C;  1O92 A;  2MCQ A;  1VEH A;  2M5H A;  1IBM C;  3NYR A;  3LNO A;  1LCI A;  1T5H X;  4DUZ C;  4XX2 A;  1IBL C;  5BUQ A;  2P2B A;  1XRB A;  3RG2 A;  1GPM A;  4RMN A;  1WH9 A;  2ONF A;  4PUI A;  3VNS A;  5ADZ A;  4GKK C;  1RY2 A;  4D4G A;  5BSW A;  2QW0 X;  3A9V A;  4GXQ A;  5BSM A;  1MD9 A;  4JI1 C;  5E7Q A;  4LF7 C;  5CZX A;  2Y4N A;  1WF3 A;  4KTV A;  2QVX X;  5BST A;  3E7X A;  2VQF C;  4JI0 C;  4I9F A;  4X65 C;  1AMU A;  1PG4 A;  2D27 A;  2MM9 A;  1MXC A;  3CQ1 A;  1M6X A;  4KHP C;  1FUG A;  4X62 C;  4RVO A;  2E7G A;  4JI8 C;  1P4E C;  3FCC A;  5LMN C;  3A26 A;  1FJG C;  5AE2 A;  3PES A;  5CZV A;  3GKU A;  3GR0 A;  2E8F A;  2Z51 A;  2E0G A;  4RM2 A;  3EQ6 A;  4LF9 C;  4L2Z A;  2P2F A;  2VSQ A;  5IT9 D;  5BUS A;  4BC7 A;  1IB8 A;  4ISB A;  2AYA A;  3KXW A;  3UX3 A;  1K0R A;  4JM1 A;  3CW8 X;  4B3T C;  3DLP X;  4JI5 C;  3IEV A;  2KZF A;  4LE5 A;  5BSV A;  4MTN A;  3VNQ A;  4X66 C;  2NCL A;  4HPV A;  3B7W A;  3A25 A;  4DV4 C;  3LNV A;  2KDN A;  4DUY C;  1QWI A;  3OTO C;  1USP B;  4NXM C;  2D1R A;  4DR6 C;  2D1T A;  2CXC A;  1MDB A;  3UOW A;  1EGA A;  5GTD A;  1HNX C;  2CU6 A;  4ZLP A;  5A1G A;  1LQL A;  4PUH A;  4DCU A;  4GXR A;  5H9U A;  3FCE A;  2PN2 A;  4G37 A;  2OBV A;  3UEB A;  4DV7 C;  2YX1 A;  3T1H C;  4JI4 C;  2D7V A;  3DHV A;  4DV3 C;  1O9T A;  3PRO C;  1YJ7 A;  1XS3 A;  1HR0 C;  2XR1 A;  4R0M A;  3TDE A;  4DCS A;  1ULT A;  2JNV A;  4AQY C;  4BSZ A;  4L4Q A;  1O93 A;  1ZB8 A;  2P2Q A;  2F4V C;  1HH2 P;  3DAY A;  3H2T A;  2M5O A;  3PBK A;  4DV6 C;  4B3S C;  1PG3 A;  5A19 A;  3UZ0 A;  3VNR A;  2UUA C;  2UU9 C;  2ZZN A;  3I08 A;  2BH1 X;  4DV0 C;  3GPC A;  3J80 D;  1N36 C;  4X64 C;  2HHH C;  4BCA A;  4EAT A;  1RG9 A;  5IFI A;  1J5E C;  1XNR C;  4LFA C;  2KZ0 A;  2WP0 C;  4WS9 A;  4LFC C;  3IML A;  3T1Y C;  3R44 A;  1XHJ A;  3LUS A;  5T8T A;  5KYT A;  4DV5 C;  3AY0 A;  4K0K C;  3EER A;  2ZM6 C;  1N32 C;  5KYV A;  2JMP A;  3AF5 A;  3TUF A;  5FLX D;  1TH5 A;  2ASB A;  2PRO A;  2ATW A;  1XRA A;  4FUT A;  4DR1 C;  4JV5 C;  3N54 B;  4LF4 C;  4D56 A;  2OPL B;  1KKG A;  4G36 A;  1V25 A;  3TR3 A;  3L8C A;  5AE1 A;  2VQE C;  3CQ2 A;  4GKJ C;  1VLA A;  4B3M C;  3NPD A;  2QVZ X;  2DYJ A;  1P4E A;  3A9U A;  2Y27 A;  1MXB A;  2WD9 A;  3ETC A;  3I07 A;  2D1S A;  5A1I A;  5IWA C;  4JYA C;  4NDN A;  2UXD C;  5K85 A;  2Y4O A;  2HJG A;  4WV3 A;  1USP A;  4RLQ A;  1XMQ C;  4JI7 C;  2DHM A;  1PA4 A;  4RM3 A;  3C5E A;  4PUG A;  1ML8 A;  2UXC C;  4PRO C;  4DR2 C;  4KTT A;  2P2M A;  4ZJZ A;  2MMA B;  3JAM D;  1HNZ C;  1ZB9 A;  4G1I A;  5LCI A;  4DCV A;  4L7I A;  2PT7 G;  3NYQ A;  4DCT A;  1N33 C;  5BR8 C;  1XMO C;  4DR5 C;  4DG8 A;  1BA3 A;  4FUQ A;  2P20 A;  2OO4 A;  5BSR A;  1UWD A;  3SO4 A;  1XNQ C;  4RLF A;  4LFB C;  2E8C A;  2P02 A;  1V26 A;  4LF6 C;  2YWB A;  1NY8 A;  3GR1 A;  3CQ3 A;  2EGT A;  1HNW C;  4YY3 C;  4TPS B;  5BUR A;  2QL8 A;  4D57 A;  5KEI A;  2DPL A;  4DV1 C;  3IPL A;  2BJO A;  4R1L A;  4JI2 C;  4OXI A;  4LF8 C;  1L2F A;  3CW9 A;  3ETO A;  5T8S A;  1JOS A;  1MKY A;  4DR3 C;  4RVN A;  5AE3 A;  4GS5 A;  4ODJ A;  2E8E A;  1T5D X;  3RV2 A;  2ZZM A;  4DR7 C;  4BBY A;  3LAX A;  3TQI A;  5JRH A;  3L95 X;  3E7W A;  1WCJ A;  4PZP A;  1UKK A;  2V7B A;  1P7L A;  5A2Q D;  4D4I A;  1FLO A;  1MDF A;  2D28 C;  4FTF A;  1N2F A;  4DR4 C;  5K8F A;  3K6R A;  3R9X A;  4IZ6 A;  3R9W A;  2E5L C;  1O90 A;  3O2E A;  4OX9 C;  1XRC A;  2UUB C;  3CJE A;  2D1Q A;  4NOZ A;  4K0B A;  4OYC A;  1I94 C;  2YCB A;  3S82 A;  3N2Q A;  1M6X C;  2UXB C;  3LGX A;  1PU1 A;  5LMU C;  4I9G A;  4JI3 C;  2VZE A;  1V60 A;  2CY1 A;  4R1M A;  3AF6 A;  2YWC A;  3UX2 A;  3J81 D;  4U5Y D;  3NI2 A;  5DV9 A;  4PHT A;  2OPL A;  1QM4 A;  4IR7 A;  3G7S A;  4MH4 A;  4B3R C;  1MXA A;  2UUC C;  1N34 C;  4JI6 C;  2QVY X;  4LF5 C;  1IBK C;  1NYE A;  2P2J A;  4BC9 A;  3A4I A; 
#chains in the Genus database with same CATH homology
 2JNV A;  3CQ2 A;  3LNO A;  1XHJ A;  3UX2 A;  1WCJ A;  3CQ3 A;  3UX3 A;  3CQ1 A;  2M5O A;  2M5H A;  2Z51 A;  1TH5 A;  1VEH A;  1UWD A;  2CU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...