3UX2A

Crystal structure of domain-swapped fam96a major dimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
124
Chain Sequence
b'SNARIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGDINKQINDKERVAAAMENPNLREIVEQCVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIP18 family protein FAM96A
publication title The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 124
sequence length 130
ec nomenclature
pdb deposition date 2011-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3ux2A00
3CQ2A 1XHJA 2CU6A 3UX2A 1WCJA 3CQ1A 3CQ3A 1TH5A 3UX3A 2M5HA 2Z51A 2JNVA 1VEHA 1UWDA 3LNOA 2M5OA
chains in the Genus database with same CATH superfamily
3N2QA 4YHHC 1MXAA 3KXWA 3O2EA 4DUZC 1ULTA 1NYEA 2Y27A 1N33C 1UWDA 5BURA 1XHJA 1BA3A 5AE3A 5AE1A 4RVOA 1P4EA 2ZM6C 2E8EA 5H9UA 4DV3C 1IB8A 3R44A 3S82A 3TDEA 1MDBA 3UOWA 4KHPC 2ASBA 5ADZA 2DHMA 2YWBA 2QVXX 2WP0C 1XNRC 4FUQA 5GTDA 4X62C 3PROC 4RMNA 1AMUA 4LF6C 2YCBA 2ATWA 1HNXC 2D27A 2D7VA 2P2BA 3A25A 3EERA 4I9GA 1GPMA 4ZLPA 4L7IA 1HR0C 4LFCC 2QVZX 4JI6C 4OX9C 5T8SA 4JI0C 3TUFA 4IZ6A 1USPB 3CQ3A 3ETOA 3R9WA 1PG4A 2ZZNA 3NPDA 4DG8A 4X66C 2KZFA 4KTVA 4BCAA 3AF6A 3K6RA 3FCEA 1IBLC 3IEUA 3CQ1A 4DCUA 2QL8A 2MCQA 4WV3A 5K85A 4JI3C 3TR3A 5BSWA 3RG2A 4BC7A 2VQFC 4FTFA 4GXRA 3AF5A 4DV6C 2QVYX 4NOZA 3NYRA 4PZPA 1PU1A 2WD9A 2E8CA 4RLQA 5BSTA 1HNZC 1MKYA 3DHVA 3T1HC 3H2TA 5KEIA 5LMNC 1UKKA 3IMLA 5LCIA 1L2FA 1KKGA 2P02A 3DAYA 4L2ZA 4WS9A 1XRAA 2PROA 3A9VA 4JYAC 1HNWC 4OXIA 3UZ0A 1RY2A 4DV4C 3IPLA 4D57A 4DR3C 4HPVA 2M5OA 4RM3A 3CQ2A 2E0GA 1V26A 2MM9A 4AQYC 2JNVA 3VNQA 1N2FA 3T1YC 2P2MA 1TH5A 1HH2P 2BJOA 4RLFA 2CY1A 2VSQA 4DCVA 4GKJC 2UUAC 4LF8C 4DR7C 1P4EC 2OO4A 3SO4A 2AYAA 1MDFA 3AY0A 2YWCA 1FLOA 4R1LA 3N54B 1IBMC 1NY8A 5A1IA 3PESA 1MXCA 2HHHC 2D1TA 4G1IA 4NXNC 2Y4OA 2E5LC 3RV2A 3A9UA 4YY3C 3A4IA 1ML8A 1VLAA 5JRHA 5K8FA 4JM1A 1V25A 4D56A 4DV2C 2D1RA 2BH1X 1MD9A 4D4GA 1V60A 1EGAA 4K0KC 4EATA 3B7WA 1WH9A 2P20A 2DYJA 3L95X 2M5HA 2CU6A 2UUCC 2UXCC 3NI2A 5FLXD 2KZ0A 5BUSA 4B3MC 1FUGA 4IR7A 3UEBA 3GPCA 4DR2C 1ZB8A 1WCJA 4JI2C 5AE2A 3L8CA 4OYCA 5IT9D 4BSZA 4X65C 5BSUA 4DUYC 5BSMA 4R1MA 4JV5C 4BC9A 1N34C 2KDNA 4LF4C 5IWAC 3IEVA 4DR5C 2UXBC 2ONFA 3J80D 3GR1A 1MXBA 2P2JA 2OPLA 3LNVA 4G36A 4GXQA 4D4IA 1ZB9A 1IBKC 4DR6C 3JAMD 2PT7G 1LCIA 2VQEC 4L4QA 4PUGA 4B3TC 1XS3A 4JI4C 1M6XA 1N32C 1O92A 2UUBC 4JI1C 1O90A 3GKUA 4LF7C 4DR4C 4LF9C 4PROC 2E8FA 4LF5C 1XMOC 4BBYA 5A2QD 4ISBA 3E7XA 3FCCA 3VNSA 4U5YD 4RVNA 5BR8C 3LGXA 3ETCA 3CJEA 1JOSA 3I07A 5E7QA 3LUSA 4LE5A 1VEHA 2XR1A 3EQ6A 2NCLA 4B3RC 1I94C 2D1QA 3C5EA 2YX1A 3GR0A 1WF3A 5BSRA 2Z51A 3TQIA 2EGTA 4X64C 2P2QA 2F4VC 2OBVA 4I9FA 2P2FA 2UXDC 3CW8X 1XMQC 4GS5A 1N36C 4DR1C 4PUIA 1LQLA 4ZJZA 5DV9A 2HJGA 4JI8C 5A1GA 1XRBA 3J81D 1PA4A 1J5EC 2Y4NA 1YJ7A 5KYTA 5KYVA 2MMAB 4R0MA 4TPSB 4XX2A 3LNOA 2VZEA 5LMUC 5T8TA 5IFIA 2DPLA 1PG3A 1K0RA 5BUQA 3DLPX 3NYQA 4NDNA 4LFBC 1QM4A 1USPA 1P7LA 3VNRA 3E7WA 5CZVA 3G7SA 4JI7C 1O93A 1T5HX 4MTNA 2E7GA 2ZZMA 2QW0X 2JMPA 4B3SC 4ODJA 1XNQC 4JI5C 5CZXA 4DV1C 5BSVA 1QWIA 3PBKA 3LAXA 2OPLB 2D1SA 4PHTA 4DCSA 4GKKC 4DV7C 4DV5C 5A19A 4KTTA 4MH4A 3OTOC 3A26A 1O9TA 4DG9A 3UX2A 4DCTA 3I08A 1RG9A 3R9XA 2V7BA 1FJGC 2CXCA 3UX3A 1XRCA 2UU9C 4LFAC 4DV0C 4RM2A 4K0BA 1M6XC 4NXMC 2PN2A 2D28C 1T5DX 3CW9A 4FUTA 4G37A 4PUHA
chains in the Genus database with same CATH topology
3CQ2A 1XHJA 2CU6A 3UX2A 1WCJA 3CQ1A 3CQ3A 1TH5A 3UX3A 2M5HA 2Z51A 2JNVA 1VEHA 1UWDA 3LNOA 2M5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQ2 A;  1XHJ A;  2CU6 A;  3UX2 A;  1WCJ A;  3CQ1 A;  3CQ3 A;  1TH5 A;  3UX3 A;  2M5H A;  2Z51 A;  2JNV A;  1VEH A;  1UWD A;  3LNO A;  2M5O A; 
#chains in the Genus database with same CATH topology
 3N2Q A;  4YHH C;  1MXA A;  3KXW A;  3O2E A;  4DUZ C;  1ULT A;  1NYE A;  2Y27 A;  1N33 C;  1UWD A;  5BUR A;  1XHJ A;  1BA3 A;  5AE3 A;  5AE1 A;  4RVO A;  1P4E A;  2ZM6 C;  2E8E A;  5H9U A;  4DV3 C;  1IB8 A;  3R44 A;  3S82 A;  3TDE A;  1MDB A;  3UOW A;  4KHP C;  2ASB A;  5ADZ A;  2DHM A;  2YWB A;  2QVX X;  2WP0 C;  1XNR C;  4FUQ A;  5GTD A;  4X62 C;  3PRO C;  4RMN A;  1AMU A;  4LF6 C;  2YCB A;  2ATW A;  1HNX C;  2D27 A;  2D7V A;  2P2B A;  3A25 A;  3EER A;  4I9G A;  1GPM A;  4ZLP A;  4L7I A;  1HR0 C;  4LFC C;  2QVZ X;  4JI6 C;  4OX9 C;  5T8S A;  4JI0 C;  3TUF A;  4IZ6 A;  1USP B;  3CQ3 A;  3ETO A;  3R9W A;  1PG4 A;  2ZZN A;  3NPD A;  4DG8 A;  4X66 C;  2KZF A;  4KTV A;  4BCA A;  3AF6 A;  3K6R A;  3FCE A;  1IBL C;  3IEU A;  3CQ1 A;  4DCU A;  2QL8 A;  2MCQ A;  4WV3 A;  5K85 A;  4JI3 C;  3TR3 A;  5BSW A;  3RG2 A;  4BC7 A;  2VQF C;  4FTF A;  4GXR A;  3AF5 A;  4DV6 C;  2QVY X;  4NOZ A;  3NYR A;  4PZP A;  1PU1 A;  2WD9 A;  2E8C A;  4RLQ A;  5BST A;  1HNZ C;  1MKY A;  3DHV A;  3T1H C;  3H2T A;  5KEI A;  5LMN C;  1UKK A;  3IML A;  5LCI A;  1L2F A;  1KKG A;  2P02 A;  3DAY A;  4L2Z A;  4WS9 A;  1XRA A;  2PRO A;  3A9V A;  4JYA C;  1HNW C;  4OXI A;  3UZ0 A;  1RY2 A;  4DV4 C;  3IPL A;  4D57 A;  4DR3 C;  4HPV A;  2M5O A;  4RM3 A;  3CQ2 A;  2E0G A;  1V26 A;  2MM9 A;  4AQY C;  2JNV A;  3VNQ A;  1N2F A;  3T1Y C;  2P2M A;  1TH5 A;  1HH2 P;  2BJO A;  4RLF A;  2CY1 A;  2VSQ A;  4DCV A;  4GKJ C;  2UUA C;  4LF8 C;  4DR7 C;  1P4E C;  2OO4 A;  3SO4 A;  2AYA A;  1MDF A;  3AY0 A;  2YWC A;  1FLO A;  4R1L A;  3N54 B;  1IBM C;  1NY8 A;  5A1I A;  3PES A;  1MXC A;  2HHH C;  2D1T A;  4G1I A;  4NXN C;  2Y4O A;  2E5L C;  3RV2 A;  3A9U A;  4YY3 C;  3A4I A;  1ML8 A;  1VLA A;  5JRH A;  5K8F A;  4JM1 A;  1V25 A;  4D56 A;  4DV2 C;  2D1R A;  2BH1 X;  1MD9 A;  4D4G A;  1V60 A;  1EGA A;  4K0K C;  4EAT A;  3B7W A;  1WH9 A;  2P20 A;  2DYJ A;  3L95 X;  2M5H A;  2CU6 A;  2UUC C;  2UXC C;  3NI2 A;  5FLX D;  2KZ0 A;  5BUS A;  4B3M C;  1FUG A;  4IR7 A;  3UEB A;  3GPC A;  4DR2 C;  1ZB8 A;  1WCJ A;  4JI2 C;  5AE2 A;  3L8C A;  4OYC A;  5IT9 D;  4BSZ A;  4X65 C;  5BSU A;  4DUY C;  5BSM A;  4R1M A;  4JV5 C;  4BC9 A;  1N34 C;  2KDN A;  4LF4 C;  5IWA C;  3IEV A;  4DR5 C;  2UXB C;  2ONF A;  3J80 D;  3GR1 A;  1MXB A;  2P2J A;  2OPL A;  3LNV A;  4G36 A;  4GXQ A;  4D4I A;  1ZB9 A;  1IBK C;  4DR6 C;  3JAM D;  2PT7 G;  1LCI A;  2VQE C;  4L4Q A;  4PUG A;  4B3T C;  1XS3 A;  4JI4 C;  1M6X A;  1N32 C;  1O92 A;  2UUB C;  4JI1 C;  1O90 A;  3GKU A;  4LF7 C;  4DR4 C;  4LF9 C;  4PRO C;  2E8F A;  4LF5 C;  1XMO C;  4BBY A;  5A2Q D;  4ISB A;  3E7X A;  3FCC A;  3VNS A;  4U5Y D;  4RVN A;  5BR8 C;  3LGX A;  3ETC A;  3CJE A;  1JOS A;  3I07 A;  5E7Q A;  3LUS A;  4LE5 A;  1VEH A;  2XR1 A;  3EQ6 A;  2NCL A;  4B3R C;  1I94 C;  2D1Q A;  3C5E A;  2YX1 A;  3GR0 A;  1WF3 A;  5BSR A;  2Z51 A;  3TQI A;  2EGT A;  4X64 C;  2P2Q A;  2F4V C;  2OBV A;  4I9F A;  2P2F A;  2UXD C;  3CW8 X;  1XMQ C;  4GS5 A;  1N36 C;  4DR1 C;  4PUI A;  1LQL A;  4ZJZ A;  5DV9 A;  2HJG A;  4JI8 C;  5A1G A;  1XRB A;  3J81 D;  1PA4 A;  1J5E C;  2Y4N A;  1YJ7 A;  5KYT A;  5KYV A;  2MMA B;  4R0M A;  4TPS B;  4XX2 A;  3LNO A;  2VZE A;  5LMU C;  5T8T A;  5IFI A;  2DPL A;  1PG3 A;  1K0R A;  5BUQ A;  3DLP X;  3NYQ A;  4NDN A;  4LFB C;  1QM4 A;  1USP A;  1P7L A;  3VNR A;  3E7W A;  5CZV A;  3G7S A;  4JI7 C;  1O93 A;  1T5H X;  4MTN A;  2E7G A;  2ZZM A;  2QW0 X;  2JMP A;  4B3S C;  4ODJ A;  1XNQ C;  4JI5 C;  5CZX A;  4DV1 C;  5BSV A;  1QWI A;  3PBK A;  3LAX A;  2OPL B;  2D1S A;  4PHT A;  4DCS A;  4GKK C;  4DV7 C;  4DV5 C;  5A19 A;  4KTT A;  4MH4 A;  3OTO C;  3A26 A;  1O9T A;  4DG9 A;  3UX2 A;  4DCT A;  3I08 A;  1RG9 A;  3R9X A;  2V7B A;  1FJG C;  2CXC A;  3UX3 A;  1XRC A;  2UU9 C;  4LFA C;  4DV0 C;  4RM2 A;  4K0B A;  1M6X C;  4NXM C;  2PN2 A;  2D28 C;  1T5D X;  3CW9 A;  4FUT A;  4G37 A;  4PUH A; 
#chains in the Genus database with same CATH homology
 3CQ2 A;  1XHJ A;  2CU6 A;  3UX2 A;  1WCJ A;  3CQ1 A;  3CQ3 A;  1TH5 A;  3UX3 A;  2M5H A;  2Z51 A;  2JNV A;  1VEH A;  1UWD A;  3LNO A;  2M5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...