3UX2A

Crystal structure of domain-swapped fam96a major dimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
124
Chain Sequence
SNARIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGDINKQINDKERVAAAMENPNLREIVEQCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer
doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MIP18 family protein FAM96A
total genus 32
structure length 124
sequence length 130
ec nomenclature
pdb deposition date 2011-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3ux2A00
2JNVA 2CU6A 2M5OA 1XHJA 2Z51A 3CQ3A 3UX3A 1TH5A 1WCJA 1UWDA 3CQ2A 3LNOA 2M5HA 3CQ1A 1VEHA 3UX2A
chains in the Genus database with same CATH superfamily
5AE2A 2MMAB 5T8SA 4RMNA 4BBYA 1I94C 4LF8C 2E5LC 2ZZNA 2VZEA 5BR8C 1XMOC 3AF5A 3H2TA 5LMUC 4LFCC 1PU1A 4PUIA 4K0KC 1N33C 1P4EC 1MXBA 3B7WA 4FUTA 1KKGA 4WV3A 4MH4A 5BSTA 3LNVA 2AYAA 2NCLA 4B3TC 2E7GA 5JRHA 3KXWA 1V60A 5IT9D 3LNOA 1V25A 2PT7G 5BURA 4DR6C 4KTTA 3JAMD 2QW0X 4DV7C 1HR0C 4L7IA 1P7LA 3T1HC 4LF9C 3J80D 5LCIA 2Z51A 4EATA 4R1MA 1XMQC 1O93A 1UWDA 3AF6A 2P2JA 1QM4A 5KYTA 2ATWA 1ZB8A 4MTNA 4DR1C 3GPCA 3UEBA 2YCBA 3O2EA 4B3SC 2VSQA 2QVZX 1GPMA 1HH2P 4DG8A 2ONFA 5BSVA 1T5HX 1PA4A 2VQEC 2QVXX 2KZ0A 1FLOA 3EERA 1M6XA 5H9UA 3SO4A 4JYAC 2UXBC 4GS5A 5AE3A 3R9WA 5A1IA 3NYRA 2D27A 4JI7C 3S82A 2DPLA 4ISBA 3L95X 4RVOA 4LFBC 2OPLB 4K0BA 4JI1C 5IFIA 1O92A 3LGXA 1LQLA 4DV1C 4DCUA 4G1IA 4FTFA 3CJEA 2DYJA 3DAYA 5A2QD 1PG3A 2PN2A 1T5DX 4GXQA 2QL8A 4XX2A 1EGAA 3CQ1A 1V26A 2P2QA 3CW9A 4B3MC 4X65C 1XRAA 2D1RA 2E8FA 5E7QA 1VLAA 3J81D 4B3RC 5CZXA 4JI0C 4JI8C 2P20A 4RLQA 1O90A 4DR7C 2UXDC 2ASBA 2ZZMA 3UOWA 4BC7A 1RG9A 5T8TA 3GKUA 1K0RA 1FJGC 3FCEA 4D56A 3I08A 1AMUA 1N34C 4PUHA 1XRBA 4OYCA 2E0GA 2M5HA 3UX3A 2WP0C 4FUQA 4D4IA 4DR3C 3NYQA 1IB8A 4I9GA 2VQFC 2HHHC 3DHVA 3A25A 4JI3C 4OX9C 2OBVA 2WD9A 3RG2A 2PROA 1FUGA 3PBKA 3IPLA 1XNRC 1ULTA 1IBMC 3T1YC 2P2BA 1WCJA 3C5EA 3A26A 2YX1A 4RM2A 5KYVA 1MDBA 3NPDA 4LF6C 4DV0C 3PROC 3RV2A 2CXCA 1USPB 2D1SA 1PG4A 1USPA 5K85A 2E8EA 1HNZC 4PUGA 3UX2A 2JNVA 1MXAA 4DCSA 4OXIA 4DV2C 2YWCA 4JI6C 4PZPA 4NXMC 2KDNA 4G36A 4DV4C 2D1TA 4DG9A 3I07A 4D4GA 2XR1A 3GR1A 1MD9A 5A1GA 3AY0A 4R1LA 4L4QA 1HNWC 1XS3A 4GKKC 2CY1A 4TPSB 1XRCA 4NOZA 3FCCA 5BSRA 1LCIA 5KEIA 2M5OA 2E8CA 5BSUA 5GTDA 4AQYC 2ZM6C 2Y4NA 3CW8X 2UUCC 4PHTA 3N2QA 3OTOC 3TR3A 4D57A 1QWIA 1YJ7A 2CU6A 5BUQA 2MCQA 4LF4C 4ZJZA 2YWBA 4R0MA 4JI2C 4YHHC 4YY3C 1N2FA 4KTVA 4DUYC 2DHMA 4DR4C 2P2MA 4LFAC 4ZLPA 1NY8A 1L2FA 4KHPC 4I9FA 4IR7A 3GR0A 3R44A 2UU9C 4DCVA 4IZ6A 1BA3A 4U5YD 4RM3A 3N54B 4LF7C 2UUAC 4JI5C 4DV5C 2UXCC 4RLFA 5BUSA 3VNSA 5IWAC 4JI4C 4X62C 3IEUA 1RY2A 4NXNC 1IBKC 4LE5A 4PROC 2BJOA 2KZFA 3IEVA 1VEHA 1MXCA 1J5EC 5FLXD 3DLPX 2D28C 4DV6C 3K6RA 2F4VC 2OO4A 2Y27A 4DUZC 1NYEA 4ODJA 1MKYA 2MM9A 4RVNA 2OPLA 3L8CA 3PESA 3TUFA 5CZVA 2EGTA 3A9VA 4WS9A 2HJGA 2Y4OA 4X66C 3ETCA 1UKKA 5LMNC 1MDFA 3TQIA 4DR5C 1N36C 4G37A 3ETOA 4L2ZA 4GXRA 1TH5A 3LUSA 3UZ0A 3R9XA 3EQ6A 2V7BA 1XHJA 3IMLA 3A4IA 3LAXA 4LF5C 1ML8A 2D1QA 5BSMA 2JMPA 3TDEA 2P02A 4NDNA 5A19A 4GKJC 3E7XA 3E7WA 3CQ2A 1JOSA 1XNQC 1IBLC 4BSZA 5DV9A 1M6XC 5AE1A 1WF3A 4BCAA 1WH9A 4DR2C 1O9TA 3A9UA 3VNRA 4DV3C 1P4EA 4JV5C 5ADZA 4HPVA 5K8FA 1HNXC 4DCTA 1N32C 4JM1A 3VNQA 3NI2A 5BSWA 3CQ3A 2D7VA 2QVYX 2P2FA 3G7SA 2UUBC 4X64C 2BH1X 1ZB9A 4BC9A
chains in the Genus database with same CATH topology
2JNVA 2CU6A 2M5OA 1XHJA 2Z51A 3CQ3A 3UX3A 1TH5A 1WCJA 1UWDA 3CQ2A 3LNOA 2M5HA 3CQ1A 1VEHA 3UX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNV A;  2CU6 A;  2M5O A;  1XHJ A;  2Z51 A;  3CQ3 A;  3UX3 A;  1TH5 A;  1WCJ A;  1UWD A;  3CQ2 A;  3LNO A;  2M5H A;  3CQ1 A;  1VEH A;  3UX2 A; 
#chains in the Genus database with same CATH topology
 5AE2 A;  2MMA B;  5T8S A;  4RMN A;  4BBY A;  1I94 C;  4LF8 C;  2E5L C;  2ZZN A;  2VZE A;  5BR8 C;  1XMO C;  3AF5 A;  3H2T A;  5LMU C;  4LFC C;  1PU1 A;  4PUI A;  4K0K C;  1N33 C;  1P4E C;  1MXB A;  3B7W A;  4FUT A;  1KKG A;  4WV3 A;  4MH4 A;  5BST A;  3LNV A;  2AYA A;  2NCL A;  4B3T C;  2E7G A;  5JRH A;  3KXW A;  1V60 A;  5IT9 D;  3LNO A;  1V25 A;  2PT7 G;  5BUR A;  4DR6 C;  4KTT A;  3JAM D;  2QW0 X;  4DV7 C;  1HR0 C;  4L7I A;  1P7L A;  3T1H C;  4LF9 C;  3J80 D;  5LCI A;  2Z51 A;  4EAT A;  4R1M A;  1XMQ C;  1O93 A;  1UWD A;  3AF6 A;  2P2J A;  1QM4 A;  5KYT A;  2ATW A;  1ZB8 A;  4MTN A;  4DR1 C;  3GPC A;  3UEB A;  2YCB A;  3O2E A;  4B3S C;  2VSQ A;  2QVZ X;  1GPM A;  1HH2 P;  4DG8 A;  2ONF A;  5BSV A;  1T5H X;  1PA4 A;  2VQE C;  2QVX X;  2KZ0 A;  1FLO A;  3EER A;  1M6X A;  5H9U A;  3SO4 A;  4JYA C;  2UXB C;  4GS5 A;  5AE3 A;  3R9W A;  5A1I A;  3NYR A;  2D27 A;  4JI7 C;  3S82 A;  2DPL A;  4ISB A;  3L95 X;  4RVO A;  4LFB C;  2OPL B;  4K0B A;  4JI1 C;  5IFI A;  1O92 A;  3LGX A;  1LQL A;  4DV1 C;  4DCU A;  4G1I A;  4FTF A;  3CJE A;  2DYJ A;  3DAY A;  5A2Q D;  1PG3 A;  2PN2 A;  1T5D X;  4GXQ A;  2QL8 A;  4XX2 A;  1EGA A;  3CQ1 A;  1V26 A;  2P2Q A;  3CW9 A;  4B3M C;  4X65 C;  1XRA A;  2D1R A;  2E8F A;  5E7Q A;  1VLA A;  3J81 D;  4B3R C;  5CZX A;  4JI0 C;  4JI8 C;  2P20 A;  4RLQ A;  1O90 A;  4DR7 C;  2UXD C;  2ASB A;  2ZZM A;  3UOW A;  4BC7 A;  1RG9 A;  5T8T A;  3GKU A;  1K0R A;  1FJG C;  3FCE A;  4D56 A;  3I08 A;  1AMU A;  1N34 C;  4PUH A;  1XRB A;  4OYC A;  2E0G A;  2M5H A;  3UX3 A;  2WP0 C;  4FUQ A;  4D4I A;  4DR3 C;  3NYQ A;  1IB8 A;  4I9G A;  2VQF C;  2HHH C;  3DHV A;  3A25 A;  4JI3 C;  4OX9 C;  2OBV A;  2WD9 A;  3RG2 A;  2PRO A;  1FUG A;  3PBK A;  3IPL A;  1XNR C;  1ULT A;  1IBM C;  3T1Y C;  2P2B A;  1WCJ A;  3C5E A;  3A26 A;  2YX1 A;  4RM2 A;  5KYV A;  1MDB A;  3NPD A;  4LF6 C;  4DV0 C;  3PRO C;  3RV2 A;  2CXC A;  1USP B;  2D1S A;  1PG4 A;  1USP A;  5K85 A;  2E8E A;  1HNZ C;  4PUG A;  3UX2 A;  2JNV A;  1MXA A;  4DCS A;  4OXI A;  4DV2 C;  2YWC A;  4JI6 C;  4PZP A;  4NXM C;  2KDN A;  4G36 A;  4DV4 C;  2D1T A;  4DG9 A;  3I07 A;  4D4G A;  2XR1 A;  3GR1 A;  1MD9 A;  5A1G A;  3AY0 A;  4R1L A;  4L4Q A;  1HNW C;  1XS3 A;  4GKK C;  2CY1 A;  4TPS B;  1XRC A;  4NOZ A;  3FCC A;  5BSR A;  1LCI A;  5KEI A;  2M5O A;  2E8C A;  5BSU A;  5GTD A;  4AQY C;  2ZM6 C;  2Y4N A;  3CW8 X;  2UUC C;  4PHT A;  3N2Q A;  3OTO C;  3TR3 A;  4D57 A;  1QWI A;  1YJ7 A;  2CU6 A;  5BUQ A;  2MCQ A;  4LF4 C;  4ZJZ A;  2YWB A;  4R0M A;  4JI2 C;  4YHH C;  4YY3 C;  1N2F A;  4KTV A;  4DUY C;  2DHM A;  4DR4 C;  2P2M A;  4LFA C;  4ZLP A;  1NY8 A;  1L2F A;  4KHP C;  4I9F A;  4IR7 A;  3GR0 A;  3R44 A;  2UU9 C;  4DCV A;  4IZ6 A;  1BA3 A;  4U5Y D;  4RM3 A;  3N54 B;  4LF7 C;  2UUA C;  4JI5 C;  4DV5 C;  2UXC C;  4RLF A;  5BUS A;  3VNS A;  5IWA C;  4JI4 C;  4X62 C;  3IEU A;  1RY2 A;  4NXN C;  1IBK C;  4LE5 A;  4PRO C;  2BJO A;  2KZF A;  3IEV A;  1VEH A;  1MXC A;  1J5E C;  5FLX D;  3DLP X;  2D28 C;  4DV6 C;  3K6R A;  2F4V C;  2OO4 A;  2Y27 A;  4DUZ C;  1NYE A;  4ODJ A;  1MKY A;  2MM9 A;  4RVN A;  2OPL A;  3L8C A;  3PES A;  3TUF A;  5CZV A;  2EGT A;  3A9V A;  4WS9 A;  2HJG A;  2Y4O A;  4X66 C;  3ETC A;  1UKK A;  5LMN C;  1MDF A;  3TQI A;  4DR5 C;  1N36 C;  4G37 A;  3ETO A;  4L2Z A;  4GXR A;  1TH5 A;  3LUS A;  3UZ0 A;  3R9X A;  3EQ6 A;  2V7B A;  1XHJ A;  3IML A;  3A4I A;  3LAX A;  4LF5 C;  1ML8 A;  2D1Q A;  5BSM A;  2JMP A;  3TDE A;  2P02 A;  4NDN A;  5A19 A;  4GKJ C;  3E7X A;  3E7W A;  3CQ2 A;  1JOS A;  1XNQ C;  1IBL C;  4BSZ A;  5DV9 A;  1M6X C;  5AE1 A;  1WF3 A;  4BCA A;  1WH9 A;  4DR2 C;  1O9T A;  3A9U A;  3VNR A;  4DV3 C;  1P4E A;  4JV5 C;  5ADZ A;  4HPV A;  5K8F A;  1HNX C;  4DCT A;  1N32 C;  4JM1 A;  3VNQ A;  3NI2 A;  5BSW A;  3CQ3 A;  2D7V A;  2QVY X;  2P2F A;  3G7S A;  2UUB C;  4X64 C;  2BH1 X;  1ZB9 A;  4BC9 A; 
#chains in the Genus database with same CATH homology
 2JNV A;  2CU6 A;  2M5O A;  1XHJ A;  2Z51 A;  3CQ3 A;  3UX3 A;  1TH5 A;  1WCJ A;  1UWD A;  3CQ2 A;  3LNO A;  2M5H A;  3CQ1 A;  1VEH A;  3UX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...