3UX2A

Crystal structure of domain-swapped fam96a major dimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
124
Chain Sequence
SNARIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGDINKQINDKERVAAAMENPNLREIVEQCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIP18 family protein FAM96A
publication title The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 124
sequence length 130
ec nomenclature
pdb deposition date 2011-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3ux2A00
3CQ2A 2M5OA 3CQ3A 2Z51A 3CQ1A 1XHJA 1TH5A 1WCJA 2JNVA 2M5HA 1UWDA 1VEHA 2CU6A 3LNOA 3UX3A 3UX2A
chains in the Genus database with same CATH superfamily
3UEBA 3TQIA 1XRBA 4AQYC 5CZXA 4EATA 4ZLPA 2E5LC 1NYEA 4GKKC 2VZEA 2M5OA 2Z51A 3UOWA 5BUQA 2WD9A 4OX9C 1N36C 2D27A 4R0MA 4B3TC 1HNWC 4LF6C 3AF6A 4LE5A 1IBMC 2E8CA 1N33C 1RY2A 2YX1A 1NY8A 3H2TA 2OBVA 5BSWA 4ODJA 1XNRC 2MCQA 1LCIA 2YCBA 4ISBA 1XHJA 4PZPA 4BC7A 3A26A 3FCEA 1BA3A 4YY3C 3R9WA 4XX2A 4BBYA 4L7IA 3JAMD 4DV2C 5CZVA 4L2ZA 4L4QA 2JNVA 4JI7C 2D7VA 3IMLA 3NPDA 5KEIA 3KXWA 1HH2P 2HHHC 4GS5A 3G7SA 4NOZA 2ZZNA 5IWAC 1JOSA 5BSTA 1O9TA 2V7BA 3CW9A 3PESA 3TDEA 1T5HX 5A1GA 1I94C 4DR1C 1MD9A 3I08A 4BC9A 2Y4NA 1MDFA 2ATWA 2CU6A 1V25A 3SO4A 4DR6C 1N32C 4B3SC 3R9XA 4K0BA 1N34C 3UX2A 1ML8A 4X65C 4RMNA 4DV5C 3T1HC 4RM2A 3PROC 2OPLB 2D1TA 2JMPA 3GPCA 3AF5A 1O92A 3UZ0A 3K6RA 4LFAC 2QL8A 5BSRA 2MMAB 5LMUC 2VSQA 1WH9A 2NCLA 1XMQC 4JI4C 4PROC 4DV4C 2DPLA 2OPLA 4JI0C 5GTDA 4PUGA 2QVYX 3B7WA 5BUSA 4G1IA 4DCTA 4R1MA 5IT9D 2WP0C 4RVOA 2QVXX 4LF4C 3IPLA 1QM4A 1KKGA 5AE2A 3IEVA 3A9VA 4KHPC 4D56A 2D1SA 2UXBC 1MDBA 1O90A 2KDNA 3LAXA 4DCUA 4MTNA 3EQ6A 2KZ0A 3IEUA 2CXCA 3R44A 4JYAC 3S82A 5T8TA 2QW0X 4GXRA 4DV0C 4LF7C 3LUSA 5LCIA 5ADZA 4I9GA 2Y4OA 3VNSA 1MXCA 5BSVA 4NDNA 2PROA 3DAYA 1MKYA 4X64C 2QVZX 1RG9A 4PHTA 4GXQA 5DV9A 4X66C 2ASBA 3FCCA 1EGAA 3J80D 2XR1A 1XS3A 1P7LA 2PN2A 5AE1A 3GKUA 2P02A 3ETOA 4NXNC 3ETCA 3L8CA 2BH1X 2UXCC 1N2FA 1TH5A 4G37A 1LQLA 5A19A 1PG3A 1ULTA 1O93A 4TPSB 5E7QA 1YJ7A 2UU9C 1XNQC 4RM3A 5JRHA 4DV3C 3CQ2A 3GR0A 1XMOC 1UWDA 1IBLC 1IB8A 4NXMC 2E0GA 4G36A 1HNXC 2UXDC 5A1IA 4DR7C 2P2MA 1WF3A 3UX3A 4ZJZA 3A25A 1HNZC 2VQFC 2OO4A 1MXAA 4D4IA 3CQ1A 4DR2C 2VQEC 1VEHA 4DV7C 5AE3A 5BURA 3OTOC 3J81D 3L95X 2E8FA 4JI5C 1FUGA 1V26A 2D1RA 3RV2A 1M6XA 3NYQA 4IZ6A 3N2QA 1USPB 3C5EA 3VNQA 4LFCC 2P20A 4LF9C 2DYJA 1AMUA 4DR3C 1K0RA 4D4GA 1PG4A 3A4IA 1P4EC 3VNRA 4I9FA 2UUBC 1USPA 4YHHC 2Y27A 3DHVA 3LNOA 2E7GA 5BSUA 1J5EC 1L2FA 4DV6C 1ZB8A 1V60A 1HR0C 1PU1A 2ZM6C 4JI8C 4DUYC 3NYRA 1UKKA 4X62C 4B3RC 1M6XC 4JI6C 4FTFA 2KZFA 4DV1C 4MH4A 3TUFA 3A9UA 4RLFA 3RG2A 3T1YC 4JI1C 4RVNA 2EGTA 1ZB9A 4FUQA 5H9UA 4K0KC 2UUCC 4HPVA 4KTTA 5KYTA 4IR7A 4JI3C 2AYAA 3CW8X 1XRCA 4FUTA 4DR4C 2E8EA 2P2FA 4LF8C 4D57A 2CY1A 1VLAA 1PA4A 4JI2C 4JM1A 2YWCA 4DR5C 2F4VC 3O2EA 2UUAC 2D1QA 5LMNC 2P2QA 3NI2A 1XRAA 4RLQA 4WV3A 1P4EA 4WS9A 1WCJA 2DHMA 5T8SA 4OXIA 4GKJC 3EERA 4BSZA 2HJGA 4B3MC 1FLOA 3LGXA 3LNVA 4DUZC 3E7XA 2PT7G 5BR8C 4R1LA 1QWIA 2M5HA 1FJGC 1IBKC 2ZZMA 4U5YD 1T5DX 3GR1A 1MXBA 5FLXD 4PUIA 2BJOA 3DLPX 3I07A 4KTVA 5KYVA 2P2BA 4DG9A 4LF5C 4JV5C 4LFBC 4BCAA 3TR3A 3AY0A 5IFIA 5K85A 4OYCA 4DCVA 2MM9A 3E7WA 2P2JA 2ONFA 3CJEA 3N54B 5A2QD 5K8FA 2D28C 2YWBA 1GPMA 5BSMA 4DG8A 3PBKA 3CQ3A 4DCSA 4PUHA
chains in the Genus database with same CATH topology
3CQ2A 2M5OA 3CQ3A 2Z51A 3CQ1A 1XHJA 1TH5A 1WCJA 2JNVA 2M5HA 1UWDA 1VEHA 2CU6A 3LNOA 3UX3A 3UX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQ2 A;  2M5O A;  3CQ3 A;  2Z51 A;  3CQ1 A;  1XHJ A;  1TH5 A;  1WCJ A;  2JNV A;  2M5H A;  1UWD A;  1VEH A;  2CU6 A;  3LNO A;  3UX3 A;  3UX2 A; 
#chains in the Genus database with same CATH topology
 3UEB A;  3TQI A;  1XRB A;  4AQY C;  5CZX A;  4EAT A;  4ZLP A;  2E5L C;  1NYE A;  4GKK C;  2VZE A;  2M5O A;  2Z51 A;  3UOW A;  5BUQ A;  2WD9 A;  4OX9 C;  1N36 C;  2D27 A;  4R0M A;  4B3T C;  1HNW C;  4LF6 C;  3AF6 A;  4LE5 A;  1IBM C;  2E8C A;  1N33 C;  1RY2 A;  2YX1 A;  1NY8 A;  3H2T A;  2OBV A;  5BSW A;  4ODJ A;  1XNR C;  2MCQ A;  1LCI A;  2YCB A;  4ISB A;  1XHJ A;  4PZP A;  4BC7 A;  3A26 A;  3FCE A;  1BA3 A;  4YY3 C;  3R9W A;  4XX2 A;  4BBY A;  4L7I A;  3JAM D;  4DV2 C;  5CZV A;  4L2Z A;  4L4Q A;  2JNV A;  4JI7 C;  2D7V A;  3IML A;  3NPD A;  5KEI A;  3KXW A;  1HH2 P;  2HHH C;  4GS5 A;  3G7S A;  4NOZ A;  2ZZN A;  5IWA C;  1JOS A;  5BST A;  1O9T A;  2V7B A;  3CW9 A;  3PES A;  3TDE A;  1T5H X;  5A1G A;  1I94 C;  4DR1 C;  1MD9 A;  3I08 A;  4BC9 A;  2Y4N A;  1MDF A;  2ATW A;  2CU6 A;  1V25 A;  3SO4 A;  4DR6 C;  1N32 C;  4B3S C;  3R9X A;  4K0B A;  1N34 C;  3UX2 A;  1ML8 A;  4X65 C;  4RMN A;  4DV5 C;  3T1H C;  4RM2 A;  3PRO C;  2OPL B;  2D1T A;  2JMP A;  3GPC A;  3AF5 A;  1O92 A;  3UZ0 A;  3K6R A;  4LFA C;  2QL8 A;  5BSR A;  2MMA B;  5LMU C;  2VSQ A;  1WH9 A;  2NCL A;  1XMQ C;  4JI4 C;  4PRO C;  4DV4 C;  2DPL A;  2OPL A;  4JI0 C;  5GTD A;  4PUG A;  2QVY X;  3B7W A;  5BUS A;  4G1I A;  4DCT A;  4R1M A;  5IT9 D;  2WP0 C;  4RVO A;  2QVX X;  4LF4 C;  3IPL A;  1QM4 A;  1KKG A;  5AE2 A;  3IEV A;  3A9V A;  4KHP C;  4D56 A;  2D1S A;  2UXB C;  1MDB A;  1O90 A;  2KDN A;  3LAX A;  4DCU A;  4MTN A;  3EQ6 A;  2KZ0 A;  3IEU A;  2CXC A;  3R44 A;  4JYA C;  3S82 A;  5T8T A;  2QW0 X;  4GXR A;  4DV0 C;  4LF7 C;  3LUS A;  5LCI A;  5ADZ A;  4I9G A;  2Y4O A;  3VNS A;  1MXC A;  5BSV A;  4NDN A;  2PRO A;  3DAY A;  1MKY A;  4X64 C;  2QVZ X;  1RG9 A;  4PHT A;  4GXQ A;  5DV9 A;  4X66 C;  2ASB A;  3FCC A;  1EGA A;  3J80 D;  2XR1 A;  1XS3 A;  1P7L A;  2PN2 A;  5AE1 A;  3GKU A;  2P02 A;  3ETO A;  4NXN C;  3ETC A;  3L8C A;  2BH1 X;  2UXC C;  1N2F A;  1TH5 A;  4G37 A;  1LQL A;  5A19 A;  1PG3 A;  1ULT A;  1O93 A;  4TPS B;  5E7Q A;  1YJ7 A;  2UU9 C;  1XNQ C;  4RM3 A;  5JRH A;  4DV3 C;  3CQ2 A;  3GR0 A;  1XMO C;  1UWD A;  1IBL C;  1IB8 A;  4NXM C;  2E0G A;  4G36 A;  1HNX C;  2UXD C;  5A1I A;  4DR7 C;  2P2M A;  1WF3 A;  3UX3 A;  4ZJZ A;  3A25 A;  1HNZ C;  2VQF C;  2OO4 A;  1MXA A;  4D4I A;  3CQ1 A;  4DR2 C;  2VQE C;  1VEH A;  4DV7 C;  5AE3 A;  5BUR A;  3OTO C;  3J81 D;  3L95 X;  2E8F A;  4JI5 C;  1FUG A;  1V26 A;  2D1R A;  3RV2 A;  1M6X A;  3NYQ A;  4IZ6 A;  3N2Q A;  1USP B;  3C5E A;  3VNQ A;  4LFC C;  2P20 A;  4LF9 C;  2DYJ A;  1AMU A;  4DR3 C;  1K0R A;  4D4G A;  1PG4 A;  3A4I A;  1P4E C;  3VNR A;  4I9F A;  2UUB C;  1USP A;  4YHH C;  2Y27 A;  3DHV A;  3LNO A;  2E7G A;  5BSU A;  1J5E C;  1L2F A;  4DV6 C;  1ZB8 A;  1V60 A;  1HR0 C;  1PU1 A;  2ZM6 C;  4JI8 C;  4DUY C;  3NYR A;  1UKK A;  4X62 C;  4B3R C;  1M6X C;  4JI6 C;  4FTF A;  2KZF A;  4DV1 C;  4MH4 A;  3TUF A;  3A9U A;  4RLF A;  3RG2 A;  3T1Y C;  4JI1 C;  4RVN A;  2EGT A;  1ZB9 A;  4FUQ A;  5H9U A;  4K0K C;  2UUC C;  4HPV A;  4KTT A;  5KYT A;  4IR7 A;  4JI3 C;  2AYA A;  3CW8 X;  1XRC A;  4FUT A;  4DR4 C;  2E8E A;  2P2F A;  4LF8 C;  4D57 A;  2CY1 A;  1VLA A;  1PA4 A;  4JI2 C;  4JM1 A;  2YWC A;  4DR5 C;  2F4V C;  3O2E A;  2UUA C;  2D1Q A;  5LMN C;  2P2Q A;  3NI2 A;  1XRA A;  4RLQ A;  4WV3 A;  1P4E A;  4WS9 A;  1WCJ A;  2DHM A;  5T8S A;  4OXI A;  4GKJ C;  3EER A;  4BSZ A;  2HJG A;  4B3M C;  1FLO A;  3LGX A;  3LNV A;  4DUZ C;  3E7X A;  2PT7 G;  5BR8 C;  4R1L A;  1QWI A;  2M5H A;  1FJG C;  1IBK C;  2ZZM A;  4U5Y D;  1T5D X;  3GR1 A;  1MXB A;  5FLX D;  4PUI A;  2BJO A;  3DLP X;  3I07 A;  4KTV A;  5KYV A;  2P2B A;  4DG9 A;  4LF5 C;  4JV5 C;  4LFB C;  4BCA A;  3TR3 A;  3AY0 A;  5IFI A;  5K85 A;  4OYC A;  4DCV A;  2MM9 A;  3E7W A;  2P2J A;  2ONF A;  3CJE A;  3N54 B;  5A2Q D;  5K8F A;  2D28 C;  2YWB A;  1GPM A;  5BSM A;  4DG8 A;  3PBK A;  3CQ3 A;  4DCS A;  4PUH A; 
#chains in the Genus database with same CATH homology
 3CQ2 A;  2M5O A;  3CQ3 A;  2Z51 A;  3CQ1 A;  1XHJ A;  1TH5 A;  1WCJ A;  2JNV A;  2M5H A;  1UWD A;  1VEH A;  2CU6 A;  3LNO A;  3UX3 A;  3UX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...