3UX2A

Crystal structure of domain-swapped fam96a major dimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
124
Chain Sequence
SNARIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGDINKQINDKERVAAAMENPNLREIVEQCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MIP18 family protein FAM96A
publication title The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer
doi rcsb
source organism Homo sapiens
total genus 32
structure length 124
sequence length 130
ec nomenclature
pdb deposition date 2011-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3ux2A00
1XHJA 1UWDA 1WCJA 2M5HA 3UX2A 2M5OA 2CU6A 1VEHA 3UX3A 3CQ1A 2Z51A 1TH5A 3CQ3A 3LNOA 2JNVA 3CQ2A
chains in the Genus database with same CATH superfamily
4LF5C 4DUYC 2E5LC 4NXNC 1USPB 2Y4NA 5A1IA 3G7SA 1QWIA 5JRHA 4RM3A 4JYAC 4RMNA 1MDBA 4EATA 3DAYA 3L8CA 2QW0X 1RG9A 3UX3A 1MXCA 5A19A 3N2QA 1UKKA 3AF5A 3H2TA 4D4GA 1N2FA 2EGTA 5LMUC 1FLOA 4K0BA 5GTDA 1UWDA 3K6RA 3GR0A 3AF6A 1XS3A 3CW9A 4ISBA 3FCCA 5BURA 2P2FA 1GPMA 2BJOA 1V60A 3UZ0A 2D7VA 5K85A 5AE3A 1ZB8A 5IWAC 1IBKC 3KXWA 1YJ7A 1HNWC 2VQEC 3NYQA 4LE5A 1XMQC 2UUCC 4RM2A 4YY3C 4DR4C 2PT7G 1V25A 2WP0C 5AE1A 3R9XA 5LMNC 1JOSA 4DV1C 2MM9A 2JNVA 4KTVA 1XNQC 4KTTA 5CZVA 4JI7C 3JAMD 1AMUA 5H9UA 4R0MA 2HJGA 1O92A 4DG8A 2VZEA 4B3SC 5BSMA 5AE2A 3UEBA 4X62C 4B3MC 1LCIA 3PESA 2CU6A 1RY2A 1IB8A 3UX2A 1O9TA 5BUSA 4KHPC 4NOZA 3E7XA 4IR7A 4D4IA 1P7LA 5A2QD 3LUSA 2YX1A 1ML8A 4OYCA 4PUIA 1L2FA 5T8TA 1N33C 2YWBA 4WS9A 4G37A 2NCLA 3R9WA 2M5OA 1PA4A 4PUHA 3IEUA 3S82A 4LF9C 3NYRA 2ZZNA 5BUQA 1NY8A 4PHTA 1FJGC 1XHJA 3J80D 5DV9A 2DYJA 3ETCA 4WV3A 1MD9A 2JMPA 5KEIA 4IZ6A 4X66C 2D1TA 4JI2C 3IEVA 2UXCC 1IBMC 3TQIA 2QVXX 3VNRA 4X64C 1N32C 5IT9D 3VNQA 4DCUA 1NYEA 5CZXA 1WF3A 2UUBC 4DR5C 4LF8C 2F4VC 2E0GA 2Y27A 4OXIA 2VSQA 5BR8C 4GKJC 2VQFC 3IPLA 4DV2C 4RVNA 4FUQA 4TPSB 1MDFA 3I07A 5IFIA 2QL8A 4RLQA 1WCJA 2OPLB 4LF6C 4LF4C 3CQ3A 3CQ2A 4JI6C 5T8SA 3SO4A 4LFBC 1VLAA 2V7BA 3LNVA 2MCQA 4GXQA 2Y4OA 2CY1A 1FUGA 2D1QA 1J5EC 2KZFA 1IBLC 4L7IA 2XR1A 2QVZX 1HH2P 4DR7C 3ETOA 3LNOA 3UOWA 4BBYA 5A1GA 1KKGA 2P2JA 4DUZC 2D28C 2D1RA 2M5HA 3FCEA 4D56A 4JI0C 1P4EC 2ZM6C 4GS5A 5KYTA 1K0RA 5LCIA 1T5DX 1PU1A 2D1SA 4FTFA 2ONFA 2WD9A 1MXAA 3C5EA 3E7WA 4G1IA 4DV7C 3OTOC 2ZZMA 4DR3C 4L2ZA 3A26A 4BC7A 5BSVA 5E7QA 3T1YC 1I94C 4DCVA 2P2QA 4D57A 5FLXD 3PROC 4LFAC 2E8EA 3NI2A 3R44A 4DCSA 1N34C 4DV0C 4U5YD 4XX2A 4JI1C 2E8FA 3GKUA 1HNXC 2P20A 4LF7C 4B3TC 4DCTA 5K8FA 3L95X 1VEHA 4JI5C 3O2EA 5BSWA 3T1HC 1XRAA 3LGXA 4I9FA 4PUGA 2ATWA 2Z51A 4NXMC 1EGAA 4NDNA 2PN2A 4OX9C 2P2BA 4AQYC 3TR3A 1M6XC 2E7GA 3DHVA 1HNZC 2E8CA 4PZPA 3RV2A 1XRBA 3EQ6A 1PG4A 1ULTA 1MKYA 2KZ0A 1QM4A 1XRCA 1USPA 4HPVA 4R1LA 1XMOC 4G36A 2QVYX 4ZLPA 3CQ1A 4RVOA 3VNSA 5BSUA 3EERA 2ASBA 3GPCA 2P2MA 3GR1A 3A4IA 3LAXA 3PBKA 4DV4C 1LQLA 4JI4C 4RLFA 2DPLA 4FUTA 4PROC 4JV5C 1N36C 4R1MA 2OBVA 4BC9A 4I9GA 4JI8C 4ZJZA 3N54B 2DHMA 4DV6C 2AYAA 2UU9C 1P4EA 4BCAA 2HHHC 3A25A 3TUFA 1XNRC 4DR6C 4L4QA 2MMAB 2YCBA 1HR0C 2OPLA 3CW8X 1TH5A 4DR1C 4DV3C 4B3RC 1O90A 2OO4A 4ODJA 4MH4A 2YWCA 2UUAC 1ZB9A 3TDEA 4X65C 3AY0A 3IMLA 1PG3A 3CJEA 3NPDA 4DV5C 2P02A 3I08A 1T5HX 4JM1A 2D27A 5KYVA 4YHHC 4MTNA 5BSTA 3A9UA 1O93A 4K0KC 4JI3C 3B7WA 2UXBC 4DG9A 4LFCC 3RG2A 1MXBA 2PROA 2UXDC 2KDNA 3A9VA 2CXCA 3DLPX 4GKKC 4GXRA 1WH9A 4BSZA 2BH1X 5ADZA 1V26A 4DR2C 1M6XA 5BSRA 1BA3A 3J81D
chains in the Genus database with same CATH topology
1XHJA 1UWDA 1WCJA 2M5HA 3UX2A 2M5OA 2CU6A 1VEHA 3UX3A 3CQ1A 2Z51A 1TH5A 3CQ3A 3LNOA 2JNVA 3CQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHJ A;  1UWD A;  1WCJ A;  2M5H A;  3UX2 A;  2M5O A;  2CU6 A;  1VEH A;  3UX3 A;  3CQ1 A;  2Z51 A;  1TH5 A;  3CQ3 A;  3LNO A;  2JNV A;  3CQ2 A; 
#chains in the Genus database with same CATH topology
 4LF5 C;  4DUY C;  2E5L C;  4NXN C;  1USP B;  2Y4N A;  5A1I A;  3G7S A;  1QWI A;  5JRH A;  4RM3 A;  4JYA C;  4RMN A;  1MDB A;  4EAT A;  3DAY A;  3L8C A;  2QW0 X;  1RG9 A;  3UX3 A;  1MXC A;  5A19 A;  3N2Q A;  1UKK A;  3AF5 A;  3H2T A;  4D4G A;  1N2F A;  2EGT A;  5LMU C;  1FLO A;  4K0B A;  5GTD A;  1UWD A;  3K6R A;  3GR0 A;  3AF6 A;  1XS3 A;  3CW9 A;  4ISB A;  3FCC A;  5BUR A;  2P2F A;  1GPM A;  2BJO A;  1V60 A;  3UZ0 A;  2D7V A;  5K85 A;  5AE3 A;  1ZB8 A;  5IWA C;  1IBK C;  3KXW A;  1YJ7 A;  1HNW C;  2VQE C;  3NYQ A;  4LE5 A;  1XMQ C;  2UUC C;  4RM2 A;  4YY3 C;  4DR4 C;  2PT7 G;  1V25 A;  2WP0 C;  5AE1 A;  3R9X A;  5LMN C;  1JOS A;  4DV1 C;  2MM9 A;  2JNV A;  4KTV A;  1XNQ C;  4KTT A;  5CZV A;  4JI7 C;  3JAM D;  1AMU A;  5H9U A;  4R0M A;  2HJG A;  1O92 A;  4DG8 A;  2VZE A;  4B3S C;  5BSM A;  5AE2 A;  3UEB A;  4X62 C;  4B3M C;  1LCI A;  3PES A;  2CU6 A;  1RY2 A;  1IB8 A;  3UX2 A;  1O9T A;  5BUS A;  4KHP C;  4NOZ A;  3E7X A;  4IR7 A;  4D4I A;  1P7L A;  5A2Q D;  3LUS A;  2YX1 A;  1ML8 A;  4OYC A;  4PUI A;  1L2F A;  5T8T A;  1N33 C;  2YWB A;  4WS9 A;  4G37 A;  2NCL A;  3R9W A;  2M5O A;  1PA4 A;  4PUH A;  3IEU A;  3S82 A;  4LF9 C;  3NYR A;  2ZZN A;  5BUQ A;  1NY8 A;  4PHT A;  1FJG C;  1XHJ A;  3J80 D;  5DV9 A;  2DYJ A;  3ETC A;  4WV3 A;  1MD9 A;  2JMP A;  5KEI A;  4IZ6 A;  4X66 C;  2D1T A;  4JI2 C;  3IEV A;  2UXC C;  1IBM C;  3TQI A;  2QVX X;  3VNR A;  4X64 C;  1N32 C;  5IT9 D;  3VNQ A;  4DCU A;  1NYE A;  5CZX A;  1WF3 A;  2UUB C;  4DR5 C;  4LF8 C;  2F4V C;  2E0G A;  2Y27 A;  4OXI A;  2VSQ A;  5BR8 C;  4GKJ C;  2VQF C;  3IPL A;  4DV2 C;  4RVN A;  4FUQ A;  4TPS B;  1MDF A;  3I07 A;  5IFI A;  2QL8 A;  4RLQ A;  1WCJ A;  2OPL B;  4LF6 C;  4LF4 C;  3CQ3 A;  3CQ2 A;  4JI6 C;  5T8S A;  3SO4 A;  4LFB C;  1VLA A;  2V7B A;  3LNV A;  2MCQ A;  4GXQ A;  2Y4O A;  2CY1 A;  1FUG A;  2D1Q A;  1J5E C;  2KZF A;  1IBL C;  4L7I A;  2XR1 A;  2QVZ X;  1HH2 P;  4DR7 C;  3ETO A;  3LNO A;  3UOW A;  4BBY A;  5A1G A;  1KKG A;  2P2J A;  4DUZ C;  2D28 C;  2D1R A;  2M5H A;  3FCE A;  4D56 A;  4JI0 C;  1P4E C;  2ZM6 C;  4GS5 A;  5KYT A;  1K0R A;  5LCI A;  1T5D X;  1PU1 A;  2D1S A;  4FTF A;  2ONF A;  2WD9 A;  1MXA A;  3C5E A;  3E7W A;  4G1I A;  4DV7 C;  3OTO C;  2ZZM A;  4DR3 C;  4L2Z A;  3A26 A;  4BC7 A;  5BSV A;  5E7Q A;  3T1Y C;  1I94 C;  4DCV A;  2P2Q A;  4D57 A;  5FLX D;  3PRO C;  4LFA C;  2E8E A;  3NI2 A;  3R44 A;  4DCS A;  1N34 C;  4DV0 C;  4U5Y D;  4XX2 A;  4JI1 C;  2E8F A;  3GKU A;  1HNX C;  2P20 A;  4LF7 C;  4B3T C;  4DCT A;  5K8F A;  3L95 X;  1VEH A;  4JI5 C;  3O2E A;  5BSW A;  3T1H C;  1XRA A;  3LGX A;  4I9F A;  4PUG A;  2ATW A;  2Z51 A;  4NXM C;  1EGA A;  4NDN A;  2PN2 A;  4OX9 C;  2P2B A;  4AQY C;  3TR3 A;  1M6X C;  2E7G A;  3DHV A;  1HNZ C;  2E8C A;  4PZP A;  3RV2 A;  1XRB A;  3EQ6 A;  1PG4 A;  1ULT A;  1MKY A;  2KZ0 A;  1QM4 A;  1XRC A;  1USP A;  4HPV A;  4R1L A;  1XMO C;  4G36 A;  2QVY X;  4ZLP A;  3CQ1 A;  4RVO A;  3VNS A;  5BSU A;  3EER A;  2ASB A;  3GPC A;  2P2M A;  3GR1 A;  3A4I A;  3LAX A;  3PBK A;  4DV4 C;  1LQL A;  4JI4 C;  4RLF A;  2DPL A;  4FUT A;  4PRO C;  4JV5 C;  1N36 C;  4R1M A;  2OBV A;  4BC9 A;  4I9G A;  4JI8 C;  4ZJZ A;  3N54 B;  2DHM A;  4DV6 C;  2AYA A;  2UU9 C;  1P4E A;  4BCA A;  2HHH C;  3A25 A;  3TUF A;  1XNR C;  4DR6 C;  4L4Q A;  2MMA B;  2YCB A;  1HR0 C;  2OPL A;  3CW8 X;  1TH5 A;  4DR1 C;  4DV3 C;  4B3R C;  1O90 A;  2OO4 A;  4ODJ A;  4MH4 A;  2YWC A;  2UUA C;  1ZB9 A;  3TDE A;  4X65 C;  3AY0 A;  3IML A;  1PG3 A;  3CJE A;  3NPD A;  4DV5 C;  2P02 A;  3I08 A;  1T5H X;  4JM1 A;  2D27 A;  5KYV A;  4YHH C;  4MTN A;  5BST A;  3A9U A;  1O93 A;  4K0K C;  4JI3 C;  3B7W A;  2UXB C;  4DG9 A;  4LFC C;  3RG2 A;  1MXB A;  2PRO A;  2UXD C;  2KDN A;  3A9V A;  2CXC A;  3DLP X;  4GKK C;  4GXR A;  1WH9 A;  4BSZ A;  2BH1 X;  5ADZ A;  1V26 A;  4DR2 C;  1M6X A;  5BSR A;  1BA3 A;  3J81 D; 
#chains in the Genus database with same CATH homology
 1XHJ A;  1UWD A;  1WCJ A;  2M5H A;  3UX2 A;  2M5O A;  2CU6 A;  1VEH A;  3UX3 A;  3CQ1 A;  2Z51 A;  1TH5 A;  3CQ3 A;  3LNO A;  2JNV A;  3CQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...