1JOSA

Ribosome binding factor a(rbfa)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
b'RSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHDEMAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME-BINDING FACTOR A
publication title The 1.7-A Crystal Structure of HI1288 - Ribosome Binding Factor A (rbfA), a Cold Response Protein
rcsb
source organism Haemophilus influenzae
molecule tags Rna binding protein
total genus 27
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1josA00
2UUAC 1N33C 1WF3A 1JOSA 4JI5C 3EERA 4XX2A 1K0RA 4GKJC 4AQYC 4B3MC 2KZFA 3GKUA 5LMUC 1IBLC 4DUZC 4GKKC 1PA4A 1N34C 1I94C 4LF5C 4DR3C 4JI4C 2PT7G 2UUCC 4NXNC 1N2FA 1WH9A 1N32C 4X62C 4DV4C 4JI8C 1MKYA 2ASBA 4BSZA 4JI1C 2JMPA 4JI2C 4DR7C 1XNQC 2VQFC 2HJGA 3LUSA 2YCBA 1J5EC 4X64C 1NYEA 4DV0C 1IBKC 4MTNA 4DR1C 4JYAC 3T1HC 3OTOC 4LF9C 1N36C 2VQEC 2CXCA 5FLXD 3J80D 3J81D 1XNRC 2D7VA 1HR0C 4DCSA 4B3TC 1FJGC 4LFCC 2UXDC 1ML8A 1EGAA 4DV6C 2XR1A 1USPA 1ZB8A 4DV3C 4X66C 2CY1A 2E7GA 1USPB 4DCUA 5LMNC 3T1YC 1UKKA 1IBMC 4LF8C 4B3SC 2E5LC 4DV1C 2E8CA 2DYJA 2E8EA 4DV7C 4DR6C 2UUBC 2HHHC 4DR5C 4MH4A 4DCTA 4OX9C 2OPLA 3IEVA 4LF4C 1HNWC 3I07A 4DUYC 4YHHC 2OPLB 1L2FA 1HNXC 4LF7C 2ZM6C 1ZB9A 4B3RC 4JV5C 4X65C 4JI6C 3CJEA 2UU9C 4YY3C 2EGTA 4DCVA 3JAMD 4JI0C 1VLAA 3R9XA 5BR8C 4DR4C 4K0KC 1LQLA 1KKGA 2E8FA 4LFAC 2F4VC 4DR2C 4LF6C 4LFBC 2UXCC 3AF6A 1HH2P 5A2QD 2ATWA 2BJOA 3R9WA 1HNZC 4KHPC 2UXBC 2QL8A 4JI3C 4NXMC 4NOZA 3IEUA 2PN2A 1XMQC 4DV2C 4JI7C 2ONFA 1QWIA 5IT9D 5IWAC 1XMOC 4DV5C 3AF5A
chains in the Genus database with same CATH superfamily
2UUAC 1WF3A 3FCCA 4BCAA 1M6XC 2P2MA 4RVOA 4AQYC 1FUGA 3LAXA 4GKKC 4KTVA 1QM4A 2D28C 4DR3C 4ISBA 4NXNC 3NPDA 4R1LA 4X62C 4DV4C 1PU1A 4BSZA 1XS3A 4JI2C 3L95X 1XNQC 1V25A 2AYAA 3LUSA 2MMAB 5A19A 4L2ZA 3OTOC 1O93A 2VQEC 5FLXD 3ETCA 3C5EA 3CW8X 2WP0C 4DCSA 1MDBA 4B3TC 1FJGC 4PROC 3UX3A 5CZVA 1ML8A 2XR1A 1MDFA 3NYRA 3K6RA 5T8SA 1V26A 3T1YC 1UKKA 4RMNA 4WS9A 3N2QA 3FCEA 5BUSA 5DV9A 1BA3A 2P2BA 4DR5C 3IEVA 1P4EC 4LF4C 1V60A 3I07A 2KZ0A 4YHHC 2OPLB 1ZB9A 4FUTA 4JV5C 3DAYA 5AE2A 4D4IA 4YY3C 4JI0C 3E7XA 2QW0X 3O2EA 3TQIA 1KKGA 3ETOA 1PG4A 5A2QD 2ATWA 2UXBC 1WCJA 4GXQA 2DHMA 2QL8A 1XMQC 2M5HA 2NCLA 1VEHA 3PESA 4OYCA 4GS5A 4DV5C 3AF5A 1JOSA 3EERA 4XX2A 1K0RA 3RG2A 4GKJC 2KZFA 3IPLA 4EATA 1T5HX 4LF5C 2UUCC 3AY0A 4PHTA 5JRHA 2CU6A 3GPCA 1M6XA 4BBYA 2ASBA 4IR7A 4JI1C 5BSRA 3UZ0A 4G36A 2HJGA 4L4QA 4PUHA 4X64C 1NYEA 3VNRA 1GPMA 1P7LA 1RG9A 1N36C 4JM1A 1IB8A 1HR0C 3A4IA 3S82A 1LCIA 3RV2A 4LFCC 2YWCA 4DV6C 3SO4A 4R1MA 1ZB8A 2P02A 4DV3C 2CY1A 4X66C 2E7GA 1USPB 4DCUA 2Z51A 3UEBA 4LF8C 4B3SC 2E5LC 2OBVA 2E8CA 3LGXA 1MD9A 2HHHC 3TR3A 4MH4A 2P2FA 4DCTA 4OX9C 4D56A 5H9UA 1HNWC 2D27A 2ZM6C 3NI2A 3CQ3A 4B3RC 4FTFA 2Y27A 3CJEA 2UU9C 2EGTA 5BUQA 3CQ1A 3JAMD 4K0BA 3R9XA 4DR4C 1LQLA 1O90A 3CQ2A 2F4VC 2UXCC 3AF6A 1XHJA 3R9WA 1HNZC 4KHPC 4LE5A 4ODJA 5T8TA 5BSUA 4JI7C 4IZ6A 2M5OA 4JI5C 4B3MC 1IBLC 4DUZC 1PA4A 4JI4C 3A25A 2YX1A 1WH9A 1N32C 4JI8C 4BC7A 2P2JA 2PROA 2JMPA 1YJ7A 4DR7C 2VQFC 4PUGA 5IFIA 1J5EC 1IBKC 5K85A 2VZEA 3A9VA 2MCQA 5BSTA 3T1HC 1XRAA 3L8CA 2P2QA 4RM2A 2P20A 3R44A 4BC9A 1XNRC 5CZXA 4GXRA 4U5YD 5AE1A 2WD9A 2YWBA 1NY8A 3B7WA 5LMNC 5K8FA 1MXCA 3GR0A 2Y4OA 2Y4NA 4I9FA 2D1RA 2OPLA 1TH5A 5KEIA 5LCIA 5BSVA 3IMLA 4NDNA 3DLPX 4RLFA 2JNVA 2D1TA 5BURA 4X65C 2KDNA 3KXWA 4JI6C 3NYQA 4DCVA 1VLAA 3TUFA 4K0KC 4DG8A 3G7SA 2E8FA 4DR2C 4LF6C 1RY2A 4LFBC 1HH2P 3GR1A 4JI3C 3IEUA 2PN2A 4DV2C 2ONFA 5BSWA 1XMOC 4I9GA 1N33C 5E7QA 5ADZA 2V7BA 3GKUA 5LMUC 3TDEA 4ZLPA 5AE3A 1N34C 1P4EA 1I94C 2PT7G 3A26A 5GTDA 1N2FA 2OO4A 3UOWA 3H2TA 3EQ6A 1MKYA 3PBKA 2QVXX 4WV3A 1UWDA 5BSMA 1MXBA 1FLOA 1MXAA 2YCBA 3I08A 4DV0C 4MTNA 4DR1C 4JYAC 2MM9A 4LF9C 2CXCA 4L7IA 4TPSB 3UX2A 3J80D 3J81D 1XRBA 2D1SA 2D7VA 4G37A 4ZJZA 4G1IA 2ZZNA 2UXDC 1AMUA 3LNVA 1EGAA 2E0GA 2BH1X 1USPA 1ULTA 2D1QA 1IBMC 5A1IA 3LNOA 4FUQA 4DV1C 4PZPA 3E7WA 4KTTA 1PG3A 2DYJA 3N54B 2E8EA 5A1GA 4DV7C 4D57A 2VSQA 4DR6C 2UUBC 4PUIA 5KYTA 1XRCA 4DUYC 3A9UA 1L2FA 1HNXC 5KYVA 4LF7C 2QVYX 4DG9A 4R0MA 4RVNA 3DHVA 2ZZMA 1O9TA 2QVZX 4OXIA 4RM3A 5BR8C 3VNSA 1T5DX 2DPLA 3PROC 4LFAC 4D4GA 3CW9A 4RLQA 1O92A 2BJOA 4HPVA 4NXMC 4NOZA 1QWIA 5IT9D 5IWAC 3VNQA
chains in the Genus database with same CATH topology
2UUAC 1WF3A 3FCCA 4BCAA 2P2MA 4RVOA 4AQYC 1FUGA 3LAXA 4GKKC 4KTVA 1QM4A 2D28C 4DR3C 4ISBA 4NXNC 3NPDA 4R1LA 4X62C 4DV4C 4BSZA 4JI2C 3L95X 1XNQC 1V25A 2AYAA 3LUSA 5A19A 4L2ZA 3OTOC 1O93A 2VQEC 5FLXD 3ETCA 3C5EA 3CW8X 2WP0C 4DCSA 1MDBA 4B3TC 1FJGC 4PROC 5CZVA 1ML8A 2XR1A 1MDFA 3NYRA 5T8SA 1V26A 3T1YC 1UKKA 4RMNA 4WS9A 3N2QA 3FCEA 5BUSA 5DV9A 1BA3A 2P2BA 4DR5C 3IEVA 4LF4C 3I07A 4YHHC 2OPLB 1ZB9A 4FUTA 4JV5C 3DAYA 5AE2A 4D4IA 4YY3C 4JI0C 3E7XA 2QW0X 3TQIA 1KKGA 3ETOA 1PG4A 5A2QD 2ATWA 2UXBC 4GXQA 2QL8A 1XMQC 3PESA 4OYCA 4GS5A 4DV5C 3AF5A 1JOSA 3EERA 4XX2A 1K0RA 3RG2A 4GKJC 2KZFA 3IPLA 4EATA 1T5HX 4LF5C 2UUCC 4PHTA 5JRHA 3GPCA 4BBYA 2ASBA 4IR7A 4JI1C 5BSRA 3UZ0A 4G36A 2HJGA 4L4QA 4X64C 1NYEA 3VNRA 1GPMA 1P7LA 1RG9A 1N36C 4JM1A 1HR0C 3A4IA 3S82A 1LCIA 3RV2A 4LFCC 2YWCA 4DV6C 3SO4A 4R1MA 1ZB8A 2P02A 4DV3C 2CY1A 4X66C 2E7GA 1USPB 4DCUA 4LF8C 4B3SC 2E5LC 2OBVA 2E8CA 3LGXA 1MD9A 2HHHC 4MH4A 2P2FA 4DCTA 4OX9C 4D56A 5H9UA 1HNWC 2D27A 2ZM6C 3NI2A 4B3RC 4FTFA 2Y27A 3CJEA 2UU9C 2EGTA 5BUQA 3JAMD 4K0BA 3R9XA 4DR4C 1LQLA 1O90A 2F4VC 2UXCC 3AF6A 3R9WA 1HNZC 4KHPC 4LE5A 4ODJA 5T8TA 5BSUA 4JI7C 4IZ6A 4JI5C 4B3MC 1IBLC 4DUZC 1PA4A 4JI4C 1WH9A 1N32C 4JI8C 4BC7A 2P2JA 2PROA 2JMPA 1YJ7A 4DR7C 2VQFC 5IFIA 1J5EC 1IBKC 5K85A 2VZEA 3A9VA 5BSTA 3T1HC 1XRAA 3L8CA 2P2QA 4RM2A 2P20A 3R44A 4BC9A 1XNRC 5CZXA 4GXRA 4U5YD 5AE1A 2WD9A 2YWBA 3B7WA 5LMNC 5K8FA 1MXCA 3GR0A 2Y4OA 2Y4NA 4I9FA 2D1RA 2OPLA 5KEIA 5BSVA 3IMLA 4NDNA 3DLPX 4RLFA 2D1TA 5BURA 4X65C 3KXWA 4JI6C 3NYQA 4DCVA 1VLAA 3TUFA 4K0KC 4DG8A 3G7SA 2E8FA 4DR2C 4LF6C 1RY2A 4LFBC 1HH2P 3GR1A 4JI3C 3IEUA 2PN2A 4DV2C 2ONFA 5BSWA 1XMOC 4I9GA 1N33C 5E7QA 5ADZA 2V7BA 3GKUA 5LMUC 3TDEA 4ZLPA 5AE3A 1N34C 1I94C 2PT7G 5GTDA 1N2FA 2OO4A 3UOWA 3H2TA 3EQ6A 1MKYA 3PBKA 2QVXX 4WV3A 5BSMA 1MXBA 1MXAA 2YCBA 3I08A 4DV0C 4MTNA 4DR1C 4JYAC 4LF9C 2CXCA 4L7IA 4TPSB 3J80D 3J81D 1XRBA 2D1SA 2D7VA 4G37A 4ZJZA 4G1IA 2UXDC 1AMUA 3LNVA 1EGAA 2E0GA 2BH1X 1USPA 1ULTA 2D1QA 1IBMC 5A1IA 4FUQA 4DV1C 4PZPA 3E7WA 4KTTA 1PG3A 2DYJA 3N54B 2E8EA 5A1GA 4DV7C 4D57A 2VSQA 4DR6C 2UUBC 5KYTA 1XRCA 4DUYC 3A9UA 1L2FA 1HNXC 5KYVA 4LF7C 2QVYX 4DG9A 4R0MA 4RVNA 3DHVA 1O9TA 2QVZX 4OXIA 4RM3A 5BR8C 3VNSA 1T5DX 2DPLA 3PROC 4LFAC 4D4GA 3CW9A 4RLQA 1O92A 2BJOA 4HPVA 4NXMC 4NOZA 1QWIA 5IT9D 5IWAC 3VNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA C;  1N33 C;  1WF3 A;  1JOS A;  4JI5 C;  3EER A;  4XX2 A;  1K0R A;  4GKJ C;  4AQY C;  4B3M C;  2KZF A;  3GKU A;  5LMU C;  1IBL C;  4DUZ C;  4GKK C;  1PA4 A;  1N34 C;  1I94 C;  4LF5 C;  4DR3 C;  4JI4 C;  2PT7 G;  2UUC C;  4NXN C;  1N2F A;  1WH9 A;  1N32 C;  4X62 C;  4DV4 C;  4JI8 C;  1MKY A;  2ASB A;  4BSZ A;  4JI1 C;  2JMP A;  4JI2 C;  4DR7 C;  1XNQ C;  2VQF C;  2HJG A;  3LUS A;  2YCB A;  1J5E C;  4X64 C;  1NYE A;  4DV0 C;  1IBK C;  4MTN A;  4DR1 C;  4JYA C;  3T1H C;  3OTO C;  4LF9 C;  1N36 C;  2VQE C;  2CXC A;  5FLX D;  3J80 D;  3J81 D;  1XNR C;  2D7V A;  1HR0 C;  4DCS A;  4B3T C;  1FJG C;  4LFC C;  2UXD C;  1ML8 A;  1EGA A;  4DV6 C;  2XR1 A;  1USP A;  1ZB8 A;  4DV3 C;  4X66 C;  2CY1 A;  2E7G A;  1USP B;  4DCU A;  5LMN C;  3T1Y C;  1UKK A;  1IBM C;  4LF8 C;  4B3S C;  2E5L C;  4DV1 C;  2E8C A;  2DYJ A;  2E8E A;  4DV7 C;  4DR6 C;  2UUB C;  2HHH C;  4DR5 C;  4MH4 A;  4DCT A;  4OX9 C;  2OPL A;  3IEV A;  4LF4 C;  1HNW C;  3I07 A;  4DUY C;  4YHH C;  2OPL B;  1L2F A;  1HNX C;  4LF7 C;  2ZM6 C;  1ZB9 A;  4B3R C;  4JV5 C;  4X65 C;  4JI6 C;  3CJE A;  2UU9 C;  4YY3 C;  2EGT A;  4DCV A;  3JAM D;  4JI0 C;  1VLA A;  3R9X A;  5BR8 C;  4DR4 C;  4K0K C;  1LQL A;  1KKG A;  2E8F A;  4LFA C;  2F4V C;  4DR2 C;  4LF6 C;  4LFB C;  2UXC C;  3AF6 A;  1HH2 P;  5A2Q D;  2ATW A;  2BJO A;  3R9W A;  1HNZ C;  4KHP C;  2UXB C;  2QL8 A;  4JI3 C;  4NXM C;  4NOZ A;  3IEU A;  2PN2 A;  1XMQ C;  4DV2 C;  4JI7 C;  2ONF A;  1QWI A;  5IT9 D;  5IWA C;  1XMO C;  4DV5 C;  3AF5 A; 
#chains in the Genus database with same CATH topology
 2UUA C;  1WF3 A;  3FCC A;  4BCA A;  1M6X C;  2P2M A;  4RVO A;  4AQY C;  1FUG A;  3LAX A;  4GKK C;  4KTV A;  1QM4 A;  2D28 C;  4DR3 C;  4ISB A;  4NXN C;  3NPD A;  4R1L A;  4X62 C;  4DV4 C;  1PU1 A;  4BSZ A;  1XS3 A;  4JI2 C;  3L95 X;  1XNQ C;  1V25 A;  2AYA A;  3LUS A;  2MMA B;  5A19 A;  4L2Z A;  3OTO C;  1O93 A;  2VQE C;  5FLX D;  3ETC A;  3C5E A;  3CW8 X;  2WP0 C;  4DCS A;  1MDB A;  4B3T C;  1FJG C;  4PRO C;  3UX3 A;  5CZV A;  1ML8 A;  2XR1 A;  1MDF A;  3NYR A;  3K6R A;  5T8S A;  1V26 A;  3T1Y C;  1UKK A;  4RMN A;  4WS9 A;  3N2Q A;  3FCE A;  5BUS A;  5DV9 A;  1BA3 A;  2P2B A;  4DR5 C;  3IEV A;  1P4E C;  4LF4 C;  1V60 A;  3I07 A;  2KZ0 A;  4YHH C;  2OPL B;  1ZB9 A;  4FUT A;  4JV5 C;  3DAY A;  5AE2 A;  4D4I A;  4YY3 C;  4JI0 C;  3E7X A;  2QW0 X;  3O2E A;  3TQI A;  1KKG A;  3ETO A;  1PG4 A;  5A2Q D;  2ATW A;  2UXB C;  1WCJ A;  4GXQ A;  2DHM A;  2QL8 A;  1XMQ C;  2M5H A;  2NCL A;  1VEH A;  3PES A;  4OYC A;  4GS5 A;  4DV5 C;  3AF5 A;  1JOS A;  3EER A;  4XX2 A;  1K0R A;  3RG2 A;  4GKJ C;  2KZF A;  3IPL A;  4EAT A;  1T5H X;  4LF5 C;  2UUC C;  3AY0 A;  4PHT A;  5JRH A;  2CU6 A;  3GPC A;  1M6X A;  4BBY A;  2ASB A;  4IR7 A;  4JI1 C;  5BSR A;  3UZ0 A;  4G36 A;  2HJG A;  4L4Q A;  4PUH A;  4X64 C;  1NYE A;  3VNR A;  1GPM A;  1P7L A;  1RG9 A;  1N36 C;  4JM1 A;  1IB8 A;  1HR0 C;  3A4I A;  3S82 A;  1LCI A;  3RV2 A;  4LFC C;  2YWC A;  4DV6 C;  3SO4 A;  4R1M A;  1ZB8 A;  2P02 A;  4DV3 C;  2CY1 A;  4X66 C;  2E7G A;  1USP B;  4DCU A;  2Z51 A;  3UEB A;  4LF8 C;  4B3S C;  2E5L C;  2OBV A;  2E8C A;  3LGX A;  1MD9 A;  2HHH C;  3TR3 A;  4MH4 A;  2P2F A;  4DCT A;  4OX9 C;  4D56 A;  5H9U A;  1HNW C;  2D27 A;  2ZM6 C;  3NI2 A;  3CQ3 A;  4B3R C;  4FTF A;  2Y27 A;  3CJE A;  2UU9 C;  2EGT A;  5BUQ A;  3CQ1 A;  3JAM D;  4K0B A;  3R9X A;  4DR4 C;  1LQL A;  1O90 A;  3CQ2 A;  2F4V C;  2UXC C;  3AF6 A;  1XHJ A;  3R9W A;  1HNZ C;  4KHP C;  4LE5 A;  4ODJ A;  5T8T A;  5BSU A;  4JI7 C;  4IZ6 A;  2M5O A;  4JI5 C;  4B3M C;  1IBL C;  4DUZ C;  1PA4 A;  4JI4 C;  3A25 A;  2YX1 A;  1WH9 A;  1N32 C;  4JI8 C;  4BC7 A;  2P2J A;  2PRO A;  2JMP A;  1YJ7 A;  4DR7 C;  2VQF C;  4PUG A;  5IFI A;  1J5E C;  1IBK C;  5K85 A;  2VZE A;  3A9V A;  2MCQ A;  5BST A;  3T1H C;  1XRA A;  3L8C A;  2P2Q A;  4RM2 A;  2P20 A;  3R44 A;  4BC9 A;  1XNR C;  5CZX A;  4GXR A;  4U5Y D;  5AE1 A;  2WD9 A;  2YWB A;  1NY8 A;  3B7W A;  5LMN C;  5K8F A;  1MXC A;  3GR0 A;  2Y4O A;  2Y4N A;  4I9F A;  2D1R A;  2OPL A;  1TH5 A;  5KEI A;  5LCI A;  5BSV A;  3IML A;  4NDN A;  3DLP X;  4RLF A;  2JNV A;  2D1T A;  5BUR A;  4X65 C;  2KDN A;  3KXW A;  4JI6 C;  3NYQ A;  4DCV A;  1VLA A;  3TUF A;  4K0K C;  4DG8 A;  3G7S A;  2E8F A;  4DR2 C;  4LF6 C;  1RY2 A;  4LFB C;  1HH2 P;  3GR1 A;  4JI3 C;  3IEU A;  2PN2 A;  4DV2 C;  2ONF A;  5BSW A;  1XMO C;  4I9G A;  1N33 C;  5E7Q A;  5ADZ A;  2V7B A;  3GKU A;  5LMU C;  3TDE A;  4ZLP A;  5AE3 A;  1N34 C;  1P4E A;  1I94 C;  2PT7 G;  3A26 A;  5GTD A;  1N2F A;  2OO4 A;  3UOW A;  3H2T A;  3EQ6 A;  1MKY A;  3PBK A;  2QVX X;  4WV3 A;  1UWD A;  5BSM A;  1MXB A;  1FLO A;  1MXA A;  2YCB A;  3I08 A;  4DV0 C;  4MTN A;  4DR1 C;  4JYA C;  2MM9 A;  4LF9 C;  2CXC A;  4L7I A;  4TPS B;  3UX2 A;  3J80 D;  3J81 D;  1XRB A;  2D1S A;  2D7V A;  4G37 A;  4ZJZ A;  4G1I A;  2ZZN A;  2UXD C;  1AMU A;  3LNV A;  1EGA A;  2E0G A;  2BH1 X;  1USP A;  1ULT A;  2D1Q A;  1IBM C;  5A1I A;  3LNO A;  4FUQ A;  4DV1 C;  4PZP A;  3E7W A;  4KTT A;  1PG3 A;  2DYJ A;  3N54 B;  2E8E A;  5A1G A;  4DV7 C;  4D57 A;  2VSQ A;  4DR6 C;  2UUB C;  4PUI A;  5KYT A;  1XRC A;  4DUY C;  3A9U A;  1L2F A;  1HNX C;  5KYV A;  4LF7 C;  2QVY X;  4DG9 A;  4R0M A;  4RVN A;  3DHV A;  2ZZM A;  1O9T A;  2QVZ X;  4OXI A;  4RM3 A;  5BR8 C;  3VNS A;  1T5D X;  2DPL A;  3PRO C;  4LFA C;  4D4G A;  3CW9 A;  4RLQ A;  1O92 A;  2BJO A;  4HPV A;  4NXM C;  4NOZ A;  1QWI A;  5IT9 D;  5IWA C;  3VNQ A; 
#chains in the Genus database with same CATH homology
 2UUA C;  1WF3 A;  3FCC A;  4BCA A;  2P2M A;  4RVO A;  4AQY C;  1FUG A;  3LAX A;  4GKK C;  4KTV A;  1QM4 A;  2D28 C;  4DR3 C;  4ISB A;  4NXN C;  3NPD A;  4R1L A;  4X62 C;  4DV4 C;  4BSZ A;  4JI2 C;  3L95 X;  1XNQ C;  1V25 A;  2AYA A;  3LUS A;  5A19 A;  4L2Z A;  3OTO C;  1O93 A;  2VQE C;  5FLX D;  3ETC A;  3C5E A;  3CW8 X;  2WP0 C;  4DCS A;  1MDB A;  4B3T C;  1FJG C;  4PRO C;  5CZV A;  1ML8 A;  2XR1 A;  1MDF A;  3NYR A;  5T8S A;  1V26 A;  3T1Y C;  1UKK A;  4RMN A;  4WS9 A;  3N2Q A;  3FCE A;  5BUS A;  5DV9 A;  1BA3 A;  2P2B A;  4DR5 C;  3IEV A;  4LF4 C;  3I07 A;  4YHH C;  2OPL B;  1ZB9 A;  4FUT A;  4JV5 C;  3DAY A;  5AE2 A;  4D4I A;  4YY3 C;  4JI0 C;  3E7X A;  2QW0 X;  3TQI A;  1KKG A;  3ETO A;  1PG4 A;  5A2Q D;  2ATW A;  2UXB C;  4GXQ A;  2QL8 A;  1XMQ C;  3PES A;  4OYC A;  4GS5 A;  4DV5 C;  3AF5 A;  1JOS A;  3EER A;  4XX2 A;  1K0R A;  3RG2 A;  4GKJ C;  2KZF A;  3IPL A;  4EAT A;  1T5H X;  4LF5 C;  2UUC C;  4PHT A;  5JRH A;  3GPC A;  4BBY A;  2ASB A;  4IR7 A;  4JI1 C;  5BSR A;  3UZ0 A;  4G36 A;  2HJG A;  4L4Q A;  4X64 C;  1NYE A;  3VNR A;  1GPM A;  1P7L A;  1RG9 A;  1N36 C;  4JM1 A;  1HR0 C;  3A4I A;  3S82 A;  1LCI A;  3RV2 A;  4LFC C;  2YWC A;  4DV6 C;  3SO4 A;  4R1M A;  1ZB8 A;  2P02 A;  4DV3 C;  2CY1 A;  4X66 C;  2E7G A;  1USP B;  4DCU A;  4LF8 C;  4B3S C;  2E5L C;  2OBV A;  2E8C A;  3LGX A;  1MD9 A;  2HHH C;  4MH4 A;  2P2F A;  4DCT A;  4OX9 C;  4D56 A;  5H9U A;  1HNW C;  2D27 A;  2ZM6 C;  3NI2 A;  4B3R C;  4FTF A;  2Y27 A;  3CJE A;  2UU9 C;  2EGT A;  5BUQ A;  3JAM D;  4K0B A;  3R9X A;  4DR4 C;  1LQL A;  1O90 A;  2F4V C;  2UXC C;  3AF6 A;  3R9W A;  1HNZ C;  4KHP C;  4LE5 A;  4ODJ A;  5T8T A;  5BSU A;  4JI7 C;  4IZ6 A;  4JI5 C;  4B3M C;  1IBL C;  4DUZ C;  1PA4 A;  4JI4 C;  1WH9 A;  1N32 C;  4JI8 C;  4BC7 A;  2P2J A;  2PRO A;  2JMP A;  1YJ7 A;  4DR7 C;  2VQF C;  5IFI A;  1J5E C;  1IBK C;  5K85 A;  2VZE A;  3A9V A;  5BST A;  3T1H C;  1XRA A;  3L8C A;  2P2Q A;  4RM2 A;  2P20 A;  3R44 A;  4BC9 A;  1XNR C;  5CZX A;  4GXR A;  4U5Y D;  5AE1 A;  2WD9 A;  2YWB A;  3B7W A;  5LMN C;  5K8F A;  1MXC A;  3GR0 A;  2Y4O A;  2Y4N A;  4I9F A;  2D1R A;  2OPL A;  5KEI A;  5BSV A;  3IML A;  4NDN A;  3DLP X;  4RLF A;  2D1T A;  5BUR A;  4X65 C;  3KXW A;  4JI6 C;  3NYQ A;  4DCV A;  1VLA A;  3TUF A;  4K0K C;  4DG8 A;  3G7S A;  2E8F A;  4DR2 C;  4LF6 C;  1RY2 A;  4LFB C;  1HH2 P;  3GR1 A;  4JI3 C;  3IEU A;  2PN2 A;  4DV2 C;  2ONF A;  5BSW A;  1XMO C;  4I9G A;  1N33 C;  5E7Q A;  5ADZ A;  2V7B A;  3GKU A;  5LMU C;  3TDE A;  4ZLP A;  5AE3 A;  1N34 C;  1I94 C;  2PT7 G;  5GTD A;  1N2F A;  2OO4 A;  3UOW A;  3H2T A;  3EQ6 A;  1MKY A;  3PBK A;  2QVX X;  4WV3 A;  5BSM A;  1MXB A;  1MXA A;  2YCB A;  3I08 A;  4DV0 C;  4MTN A;  4DR1 C;  4JYA C;  4LF9 C;  2CXC A;  4L7I A;  4TPS B;  3J80 D;  3J81 D;  1XRB A;  2D1S A;  2D7V A;  4G37 A;  4ZJZ A;  4G1I A;  2UXD C;  1AMU A;  3LNV A;  1EGA A;  2E0G A;  2BH1 X;  1USP A;  1ULT A;  2D1Q A;  1IBM C;  5A1I A;  4FUQ A;  4DV1 C;  4PZP A;  3E7W A;  4KTT A;  1PG3 A;  2DYJ A;  3N54 B;  2E8E A;  5A1G A;  4DV7 C;  4D57 A;  2VSQ A;  4DR6 C;  2UUB C;  5KYT A;  1XRC A;  4DUY C;  3A9U A;  1L2F A;  1HNX C;  5KYV A;  4LF7 C;  2QVY X;  4DG9 A;  4R0M A;  4RVN A;  3DHV A;  1O9T A;  2QVZ X;  4OXI A;  4RM3 A;  5BR8 C;  3VNS A;  1T5D X;  2DPL A;  3PRO C;  4LFA C;  4D4G A;  3CW9 A;  4RLQ A;  1O92 A;  2BJO A;  4HPV A;  4NXM C;  4NOZ A;  1QWI A;  5IT9 D;  5IWA C;  3VNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...