1JOSA

Ribosome binding factor a(rbfa)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
RSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHDEMAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME-BINDING FACTOR A
publication title The 1.7-A Crystal Structure of HI1288 - Ribosome Binding Factor A (rbfA), a Cold Response Protein
rcsb
source organism Haemophilus influenzae
molecule tags Rna binding protein
total genus 27
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1josA00
2HJGA 4DR1C 3EERA 3IEVA 4DR4C 4DV7C 4JI7C 4LF7C 1ML8A 2DYJA 2QL8A 4JYAC 5IT9D 2VQEC 5BR8C 1J5EC 1I94C 2UU9C 2BJOA 3IEUA 1EGAA 5IWAC 1N34C 1FJGC 3LUSA 4JI3C 1WF3A 4DCUA 1USPA 4JI1C 1ZB8A 4DUZC 3R9WA 2CY1A 4X64C 5LMNC 4JI4C 3J80D 1HNZC 4GKJC 3OTOC 1N32C 4MH4A 2KZFA 4LF4C 2D7VA 4AQYC 4LFCC 3AF5A 4K0KC 1KKGA 2E8EA 4LF6C 1VLAA 1IBMC 4JI2C 4JI5C 4JI6C 2XR1A 4DV6C 1HNWC 4XX2A 2E7GA 2JMPA 1IBLC 4DR2C 2UUCC 1K0RA 1XNRC 3AF6A 4NXNC 4OX9C 4BSZA 4DCSA 4MTNA 4JI0C 3JAMD 1UKKA 4DV4C 4DR7C 1NYEA 2VQFC 1MKYA 1PA4A 2UXBC 1N2FA 2OPLB 3I07A 1L2FA 2YCBA 4B3SC 4GKKC 2UXDC 4LFBC 2UXCC 1HH2P 4X62C 2ZM6C 1JOSA 2ONFA 2PN2A 2ASBA 4YY3C 1HR0C 4B3MC 4X66C 4LF5C 4DV0C 4X65C 2EGTA 4DV3C 4LF9C 1WH9A 2ATWA 3J81D 4KHPC 4DV1C 4JI8C 4DCVA 5FLXD 4DR5C 2E5LC 4LF8C 2E8CA 4LFAC 4DV2C 1ZB9A 4YHHC 4DR6C 1IBKC 2CXCA 3GKUA 1N33C 4B3RC 2OPLA 3T1YC 1LQLA 1XMQC 2HHHC 2UUBC 2F4VC 4NOZA 4DV5C 1USPB 3R9XA 2PT7G 4DUYC 1XMOC 1HNXC 2UUAC 5A2QD 1XNQC 3T1HC 4JV5C 4DCTA 4DR3C 1N36C 2E8FA 5LMUC 4B3TC 1QWIA 3CJEA 4NXMC
chains in the Genus database with same CATH superfamily
2HJGA 4DR1C 3EERA 3NYQA 4DR4C 3TUFA 1NY8A 4JYAC 2OO4A 2VQEC 1J5EC 5T8TA 4JI3C 2V7BA 5KYVA 2CY1A 1M6XC 5A1IA 2NCLA 3PROC 3OTOC 4DG8A 3GR1A 4PZPA 4RMNA 1MDFA 4DG9A 3AF5A 5A1GA 4LF6C 3CQ1A 5A19A 5K85A 1HNWC 3C5EA 3R44A 3UX2A 5E7QA 5ADZA 4DR2C 3UEBA 3AF6A 1ULTA 4BC7A 4RM2A 5BSUA 2QVYX 2JNVA 5BSRA 1MKYA 4WV3A 1XRCA 5JRHA 2UXBC 2P20A 2D1RA 4B3SC 1L2FA 2YCBA 3NYRA 4GKKC 4LE5A 2ASBA 1HR0C 4B3MC 4PUHA 4DV3C 5CZXA 5H9UA 2P2FA 2KDNA 3GKUA 2PROA 4PUGA 1N33C 4TPSB 3PBKA 4DV5C 5K8FA 3AY0A 2P02A 2MCQA 1XMOC 4JV5C 1MD9A 2MM9A 3RV2A 4JM1A 5BSVA 2YWBA 3DLPX 3N54B 4DV7C 2AYAA 1XHJA 4LF7C 1I94C 3FCCA 5IWAC 3I08A 1MXBA 1WF3A 1V25A 4DCUA 3E7WA 2ZZNA 4X64C 5LMNC 1O9TA 3L8CA 5AE3A 4WS9A 4JI4C 1RY2A 4D4GA 1N32C 3A9UA 4PUIA 2KZFA 4AQYC 1LCIA 4LFCC 4ISBA 3K6RA 1VLAA 1IBMC 2WP0C 3E7XA 3TDEA 4KTTA 2E7GA 1IBLC 1IB8A 4RLQA 1XNRC 2D27A 2Y27A 2P2QA 4OX9C 1MXCA 4DCSA 4MTNA 3H2TA 4L4QA 4D57A 3JAMD 4EATA 2VQFC 1PA4A 4G1IA 1XRBA 2BH1X 4LFBC 4OYCA 2ZM6C 1WCJA 1MXAA 2EGTA 3RG2A 1M6XA 2D28C 1WH9A 2WD9A 2ATWA 4KHPC 3B7WA 2Z51A 4HPVA 4DCVA 4DR5C 2E8CA 4BCAA 4LFAC 3UOWA 3DAYA 2YWCA 2M5HA 1ZB9A 3NI2A 3A25A 4BBYA 1IBKC 2DHMA 2YX1A 4NDNA 2OPLA 3T1YC 3FCEA 2HHHC 3VNSA 1UWDA 4IR7A 2KZ0A 3R9XA 2UUAC 4DCTA 1FLOA 1N36C 2E8FA 2MMAB 5BUSA 1QWIA 3CJEA 4NXMC 3CW8X 5BUQA 4K0BA 3IEVA 4JI7C 3LNVA 2DYJA 2QL8A 2UU9C 2BJOA 4I9FA 3IEUA 1EGAA 3LUSA 4RVNA 4BC9A 1USPA 1ZB8A 4DUZC 3PESA 3R9WA 3LAXA 4ZLPA 4MH4A 5LCIA 3DHVA 4LF4C 2D7VA 3EQ6A 4I9GA 2D1TA 4JI2C 4JI6C 2XR1A 4DV6C 1P4EA 4XX2A 5BSMA 4L2ZA 2QVZX 4BSZA 4JI0C 1UKKA 4PHTA 3UZ0A 5GTDA 3SO4A 4RM3A 2DPLA 3LNOA 4RLFA 4G37A 5AE1A 2OPLB 3I07A 3NPDA 2UXCC 1HH2P 4X62C 3IPLA 4LF5C 1BA3A 4X65C 4G36A 4DV0C 4ODJA 4LF9C 4PROC 2Y4NA 2OBVA 1V60A 4IZ6A 4U5YD 1T5HX 4DR6C 2CXCA 1MDBA 3CQ3A 1FUGA 4R1MA 2UUBC 2M5OA 4NOZA 3G7SA 1USPB 1XS3A 3ETCA 3KXWA 4DUYC 4ZJZA 1HNXC 5A2QD 1PG4A 3S82A 1XNQC 3T1HC 2VZEA 5LMUC 3GPCA 3A4IA 5AE2A 4FTFA 3A26A 1ML8A 5T8SA 5IT9D 3UX3A 5BR8C 2E0GA 3N2QA 5BSWA 1N34C 1FJGC 4GS5A 3CQ2A 4JI1C 2D1QA 2P2BA 2QW0X 2P2JA 3ETOA 3J80D 1HNZC 4GKJC 5KYTA 1QM4A 5BURA 3A9VA 5CZVA 1VEHA 2Y4OA 4GXQA 4K0KC 1KKGA 3L95X 2E8EA 3IMLA 4D4IA 3O2EA 1T5DX 4JI5C 4FUTA 2ZZMA 1O90A 5IFIA 2JMPA 3CW9A 2UUCC 1K0RA 4RVOA 1O93A 1XRAA 1AMUA 4NXNC 1PU1A 1PG3A 3VNRA 4DV4C 3VNQA 4DR7C 1NYEA 4L7IA 3LGXA 3GR0A 1N2FA 1TH5A 5DV9A 2UXDC 1P4EC 2QVXX 1JOSA 2P2MA 2ONFA 2PN2A 4YY3C 1V26A 3TR3A 4X66C 1GPMA 1P7LA 3J81D 4DV1C 4JI8C 5FLXD 2E5LC 4LF8C 2D1SA 5KEIA 4DV2C 4GXRA 4YHHC 4FUQA 4B3RC 4R0MA 3TQIA 1LQLA 1XMQC 2F4VC 1YJ7A 4D56A 2VSQA 2PT7G 5BSTA 4KTVA 1RG9A 4OXIA 4DR3C 2CU6A 4B3TC 1O92A 4R1LA
chains in the Genus database with same CATH topology
2HJGA 4DR1C 3EERA 3NYQA 4DR4C 3TUFA 4JYAC 2OO4A 2VQEC 1J5EC 5T8TA 4JI3C 2V7BA 5KYVA 2CY1A 5A1IA 3PROC 3OTOC 4DG8A 3GR1A 4PZPA 4RMNA 1MDFA 4DG9A 3AF5A 5A1GA 4LF6C 5A19A 5K85A 1HNWC 3C5EA 3R44A 5E7QA 5ADZA 4DR2C 3AF6A 1ULTA 4BC7A 4RM2A 5BSUA 2QVYX 5BSRA 1MKYA 4WV3A 1XRCA 5JRHA 2UXBC 2P20A 2D1RA 4B3SC 1L2FA 2YCBA 3NYRA 4GKKC 4LE5A 2ASBA 1HR0C 4B3MC 4DV3C 5CZXA 5H9UA 2P2FA 3GKUA 2PROA 1N33C 4TPSB 3PBKA 4DV5C 5K8FA 2P02A 1XMOC 4JV5C 1MD9A 3RV2A 4JM1A 5BSVA 2YWBA 3DLPX 3N54B 4DV7C 2AYAA 4LF7C 1I94C 3FCCA 5IWAC 3I08A 1MXBA 1WF3A 1V25A 4DCUA 3E7WA 4X64C 5LMNC 1O9TA 3L8CA 5AE3A 4WS9A 4JI4C 1RY2A 4D4GA 1N32C 3A9UA 2KZFA 4AQYC 1LCIA 4LFCC 4ISBA 1VLAA 1IBMC 2WP0C 3E7XA 3TDEA 4KTTA 2E7GA 1IBLC 4RLQA 1XNRC 2D27A 2Y27A 2P2QA 4OX9C 1MXCA 4DCSA 4MTNA 3H2TA 4L4QA 4D57A 3JAMD 4EATA 2VQFC 1PA4A 4G1IA 1XRBA 2BH1X 4LFBC 4OYCA 2ZM6C 1MXAA 2EGTA 3RG2A 2D28C 1WH9A 2WD9A 2ATWA 4KHPC 3B7WA 4HPVA 4DCVA 4DR5C 2E8CA 4BCAA 4LFAC 3UOWA 3DAYA 2YWCA 1ZB9A 3NI2A 4BBYA 1IBKC 4NDNA 2OPLA 3T1YC 3FCEA 2HHHC 3VNSA 4IR7A 3R9XA 2UUAC 4DCTA 1N36C 2E8FA 5BUSA 1QWIA 3CJEA 4NXMC 3CW8X 5BUQA 4K0BA 3IEVA 4JI7C 3LNVA 2DYJA 2QL8A 2UU9C 2BJOA 4I9FA 3IEUA 1EGAA 3LUSA 4RVNA 4BC9A 1USPA 1ZB8A 4DUZC 3PESA 3R9WA 3LAXA 4ZLPA 4MH4A 3DHVA 4LF4C 2D7VA 3EQ6A 4I9GA 2D1TA 4JI2C 4JI6C 2XR1A 4DV6C 4XX2A 5BSMA 4L2ZA 2QVZX 4BSZA 4JI0C 1UKKA 4PHTA 3UZ0A 5GTDA 3SO4A 4RM3A 2DPLA 4RLFA 4G37A 5AE1A 2OPLB 3I07A 3NPDA 2UXCC 1HH2P 4X62C 3IPLA 4LF5C 1BA3A 4X65C 4G36A 4DV0C 4ODJA 4LF9C 4PROC 2Y4NA 2OBVA 4IZ6A 4U5YD 1T5HX 4DR6C 2CXCA 1MDBA 1FUGA 4R1MA 2UUBC 4NOZA 3G7SA 1USPB 3ETCA 3KXWA 4DUYC 4ZJZA 1HNXC 5A2QD 1PG4A 3S82A 1XNQC 3T1HC 2VZEA 5LMUC 3GPCA 3A4IA 5AE2A 4FTFA 1ML8A 5T8SA 5IT9D 5BR8C 2E0GA 3N2QA 5BSWA 1N34C 1FJGC 4GS5A 4JI1C 2D1QA 2P2BA 2QW0X 2P2JA 3ETOA 3J80D 1HNZC 4GKJC 5KYTA 1QM4A 5BURA 3A9VA 5CZVA 2Y4OA 4GXQA 4K0KC 1KKGA 3L95X 2E8EA 3IMLA 4D4IA 1T5DX 4JI5C 4FUTA 1O90A 5IFIA 2JMPA 3CW9A 2UUCC 1K0RA 4RVOA 1O93A 1XRAA 1AMUA 4NXNC 1PG3A 3VNRA 4DV4C 3VNQA 4DR7C 1NYEA 4L7IA 3LGXA 3GR0A 1N2FA 5DV9A 2UXDC 2QVXX 1JOSA 2P2MA 2ONFA 2PN2A 4YY3C 1V26A 4X66C 1GPMA 1P7LA 3J81D 4DV1C 4JI8C 5FLXD 2E5LC 4LF8C 2D1SA 5KEIA 4DV2C 4GXRA 4YHHC 4FUQA 4B3RC 4R0MA 3TQIA 1LQLA 1XMQC 2F4VC 1YJ7A 4D56A 2VSQA 2PT7G 5BSTA 4KTVA 1RG9A 4OXIA 4DR3C 4B3TC 1O92A 4R1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJG A;  4DR1 C;  3EER A;  3IEV A;  4DR4 C;  4DV7 C;  4JI7 C;  4LF7 C;  1ML8 A;  2DYJ A;  2QL8 A;  4JYA C;  5IT9 D;  2VQE C;  5BR8 C;  1J5E C;  1I94 C;  2UU9 C;  2BJO A;  3IEU A;  1EGA A;  5IWA C;  1N34 C;  1FJG C;  3LUS A;  4JI3 C;  1WF3 A;  4DCU A;  1USP A;  4JI1 C;  1ZB8 A;  4DUZ C;  3R9W A;  2CY1 A;  4X64 C;  5LMN C;  4JI4 C;  3J80 D;  1HNZ C;  4GKJ C;  3OTO C;  1N32 C;  4MH4 A;  2KZF A;  4LF4 C;  2D7V A;  4AQY C;  4LFC C;  3AF5 A;  4K0K C;  1KKG A;  2E8E A;  4LF6 C;  1VLA A;  1IBM C;  4JI2 C;  4JI5 C;  4JI6 C;  2XR1 A;  4DV6 C;  1HNW C;  4XX2 A;  2E7G A;  2JMP A;  1IBL C;  4DR2 C;  2UUC C;  1K0R A;  1XNR C;  3AF6 A;  4NXN C;  4OX9 C;  4BSZ A;  4DCS A;  4MTN A;  4JI0 C;  3JAM D;  1UKK A;  4DV4 C;  4DR7 C;  1NYE A;  2VQF C;  1MKY A;  1PA4 A;  2UXB C;  1N2F A;  2OPL B;  3I07 A;  1L2F A;  2YCB A;  4B3S C;  4GKK C;  2UXD C;  4LFB C;  2UXC C;  1HH2 P;  4X62 C;  2ZM6 C;  1JOS A;  2ONF A;  2PN2 A;  2ASB A;  4YY3 C;  1HR0 C;  4B3M C;  4X66 C;  4LF5 C;  4DV0 C;  4X65 C;  2EGT A;  4DV3 C;  4LF9 C;  1WH9 A;  2ATW A;  3J81 D;  4KHP C;  4DV1 C;  4JI8 C;  4DCV A;  5FLX D;  4DR5 C;  2E5L C;  4LF8 C;  2E8C A;  4LFA C;  4DV2 C;  1ZB9 A;  4YHH C;  4DR6 C;  1IBK C;  2CXC A;  3GKU A;  1N33 C;  4B3R C;  2OPL A;  3T1Y C;  1LQL A;  1XMQ C;  2HHH C;  2UUB C;  2F4V C;  4NOZ A;  4DV5 C;  1USP B;  3R9X A;  2PT7 G;  4DUY C;  1XMO C;  1HNX C;  2UUA C;  5A2Q D;  1XNQ C;  3T1H C;  4JV5 C;  4DCT A;  4DR3 C;  1N36 C;  2E8F A;  5LMU C;  4B3T C;  1QWI A;  3CJE A;  4NXM C; 
#chains in the Genus database with same CATH topology
 2HJG A;  4DR1 C;  3EER A;  3NYQ A;  4DR4 C;  3TUF A;  1NY8 A;  4JYA C;  2OO4 A;  2VQE C;  1J5E C;  5T8T A;  4JI3 C;  2V7B A;  5KYV A;  2CY1 A;  1M6X C;  5A1I A;  2NCL A;  3PRO C;  3OTO C;  4DG8 A;  3GR1 A;  4PZP A;  4RMN A;  1MDF A;  4DG9 A;  3AF5 A;  5A1G A;  4LF6 C;  3CQ1 A;  5A19 A;  5K85 A;  1HNW C;  3C5E A;  3R44 A;  3UX2 A;  5E7Q A;  5ADZ A;  4DR2 C;  3UEB A;  3AF6 A;  1ULT A;  4BC7 A;  4RM2 A;  5BSU A;  2QVY X;  2JNV A;  5BSR A;  1MKY A;  4WV3 A;  1XRC A;  5JRH A;  2UXB C;  2P20 A;  2D1R A;  4B3S C;  1L2F A;  2YCB A;  3NYR A;  4GKK C;  4LE5 A;  2ASB A;  1HR0 C;  4B3M C;  4PUH A;  4DV3 C;  5CZX A;  5H9U A;  2P2F A;  2KDN A;  3GKU A;  2PRO A;  4PUG A;  1N33 C;  4TPS B;  3PBK A;  4DV5 C;  5K8F A;  3AY0 A;  2P02 A;  2MCQ A;  1XMO C;  4JV5 C;  1MD9 A;  2MM9 A;  3RV2 A;  4JM1 A;  5BSV A;  2YWB A;  3DLP X;  3N54 B;  4DV7 C;  2AYA A;  1XHJ A;  4LF7 C;  1I94 C;  3FCC A;  5IWA C;  3I08 A;  1MXB A;  1WF3 A;  1V25 A;  4DCU A;  3E7W A;  2ZZN A;  4X64 C;  5LMN C;  1O9T A;  3L8C A;  5AE3 A;  4WS9 A;  4JI4 C;  1RY2 A;  4D4G A;  1N32 C;  3A9U A;  4PUI A;  2KZF A;  4AQY C;  1LCI A;  4LFC C;  4ISB A;  3K6R A;  1VLA A;  1IBM C;  2WP0 C;  3E7X A;  3TDE A;  4KTT A;  2E7G A;  1IBL C;  1IB8 A;  4RLQ A;  1XNR C;  2D27 A;  2Y27 A;  2P2Q A;  4OX9 C;  1MXC A;  4DCS A;  4MTN A;  3H2T A;  4L4Q A;  4D57 A;  3JAM D;  4EAT A;  2VQF C;  1PA4 A;  4G1I A;  1XRB A;  2BH1 X;  4LFB C;  4OYC A;  2ZM6 C;  1WCJ A;  1MXA A;  2EGT A;  3RG2 A;  1M6X A;  2D28 C;  1WH9 A;  2WD9 A;  2ATW A;  4KHP C;  3B7W A;  2Z51 A;  4HPV A;  4DCV A;  4DR5 C;  2E8C A;  4BCA A;  4LFA C;  3UOW A;  3DAY A;  2YWC A;  2M5H A;  1ZB9 A;  3NI2 A;  3A25 A;  4BBY A;  1IBK C;  2DHM A;  2YX1 A;  4NDN A;  2OPL A;  3T1Y C;  3FCE A;  2HHH C;  3VNS A;  1UWD A;  4IR7 A;  2KZ0 A;  3R9X A;  2UUA C;  4DCT A;  1FLO A;  1N36 C;  2E8F A;  2MMA B;  5BUS A;  1QWI A;  3CJE A;  4NXM C;  3CW8 X;  5BUQ A;  4K0B A;  3IEV A;  4JI7 C;  3LNV A;  2DYJ A;  2QL8 A;  2UU9 C;  2BJO A;  4I9F A;  3IEU A;  1EGA A;  3LUS A;  4RVN A;  4BC9 A;  1USP A;  1ZB8 A;  4DUZ C;  3PES A;  3R9W A;  3LAX A;  4ZLP A;  4MH4 A;  5LCI A;  3DHV A;  4LF4 C;  2D7V A;  3EQ6 A;  4I9G A;  2D1T A;  4JI2 C;  4JI6 C;  2XR1 A;  4DV6 C;  1P4E A;  4XX2 A;  5BSM A;  4L2Z A;  2QVZ X;  4BSZ A;  4JI0 C;  1UKK A;  4PHT A;  3UZ0 A;  5GTD A;  3SO4 A;  4RM3 A;  2DPL A;  3LNO A;  4RLF A;  4G37 A;  5AE1 A;  2OPL B;  3I07 A;  3NPD A;  2UXC C;  1HH2 P;  4X62 C;  3IPL A;  4LF5 C;  1BA3 A;  4X65 C;  4G36 A;  4DV0 C;  4ODJ A;  4LF9 C;  4PRO C;  2Y4N A;  2OBV A;  1V60 A;  4IZ6 A;  4U5Y D;  1T5H X;  4DR6 C;  2CXC A;  1MDB A;  3CQ3 A;  1FUG A;  4R1M A;  2UUB C;  2M5O A;  4NOZ A;  3G7S A;  1USP B;  1XS3 A;  3ETC A;  3KXW A;  4DUY C;  4ZJZ A;  1HNX C;  5A2Q D;  1PG4 A;  3S82 A;  1XNQ C;  3T1H C;  2VZE A;  5LMU C;  3GPC A;  3A4I A;  5AE2 A;  4FTF A;  3A26 A;  1ML8 A;  5T8S A;  5IT9 D;  3UX3 A;  5BR8 C;  2E0G A;  3N2Q A;  5BSW A;  1N34 C;  1FJG C;  4GS5 A;  3CQ2 A;  4JI1 C;  2D1Q A;  2P2B A;  2QW0 X;  2P2J A;  3ETO A;  3J80 D;  1HNZ C;  4GKJ C;  5KYT A;  1QM4 A;  5BUR A;  3A9V A;  5CZV A;  1VEH A;  2Y4O A;  4GXQ A;  4K0K C;  1KKG A;  3L95 X;  2E8E A;  3IML A;  4D4I A;  3O2E A;  1T5D X;  4JI5 C;  4FUT A;  2ZZM A;  1O90 A;  5IFI A;  2JMP A;  3CW9 A;  2UUC C;  1K0R A;  4RVO A;  1O93 A;  1XRA A;  1AMU A;  4NXN C;  1PU1 A;  1PG3 A;  3VNR A;  4DV4 C;  3VNQ A;  4DR7 C;  1NYE A;  4L7I A;  3LGX A;  3GR0 A;  1N2F A;  1TH5 A;  5DV9 A;  2UXD C;  1P4E C;  2QVX X;  1JOS A;  2P2M A;  2ONF A;  2PN2 A;  4YY3 C;  1V26 A;  3TR3 A;  4X66 C;  1GPM A;  1P7L A;  3J81 D;  4DV1 C;  4JI8 C;  5FLX D;  2E5L C;  4LF8 C;  2D1S A;  5KEI A;  4DV2 C;  4GXR A;  4YHH C;  4FUQ A;  4B3R C;  4R0M A;  3TQI A;  1LQL A;  1XMQ C;  2F4V C;  1YJ7 A;  4D56 A;  2VSQ A;  2PT7 G;  5BST A;  4KTV A;  1RG9 A;  4OXI A;  4DR3 C;  2CU6 A;  4B3T C;  1O92 A;  4R1L A; 
#chains in the Genus database with same CATH homology
 2HJG A;  4DR1 C;  3EER A;  3NYQ A;  4DR4 C;  3TUF A;  4JYA C;  2OO4 A;  2VQE C;  1J5E C;  5T8T A;  4JI3 C;  2V7B A;  5KYV A;  2CY1 A;  5A1I A;  3PRO C;  3OTO C;  4DG8 A;  3GR1 A;  4PZP A;  4RMN A;  1MDF A;  4DG9 A;  3AF5 A;  5A1G A;  4LF6 C;  5A19 A;  5K85 A;  1HNW C;  3C5E A;  3R44 A;  5E7Q A;  5ADZ A;  4DR2 C;  3AF6 A;  1ULT A;  4BC7 A;  4RM2 A;  5BSU A;  2QVY X;  5BSR A;  1MKY A;  4WV3 A;  1XRC A;  5JRH A;  2UXB C;  2P20 A;  2D1R A;  4B3S C;  1L2F A;  2YCB A;  3NYR A;  4GKK C;  4LE5 A;  2ASB A;  1HR0 C;  4B3M C;  4DV3 C;  5CZX A;  5H9U A;  2P2F A;  3GKU A;  2PRO A;  1N33 C;  4TPS B;  3PBK A;  4DV5 C;  5K8F A;  2P02 A;  1XMO C;  4JV5 C;  1MD9 A;  3RV2 A;  4JM1 A;  5BSV A;  2YWB A;  3DLP X;  3N54 B;  4DV7 C;  2AYA A;  4LF7 C;  1I94 C;  3FCC A;  5IWA C;  3I08 A;  1MXB A;  1WF3 A;  1V25 A;  4DCU A;  3E7W A;  4X64 C;  5LMN C;  1O9T A;  3L8C A;  5AE3 A;  4WS9 A;  4JI4 C;  1RY2 A;  4D4G A;  1N32 C;  3A9U A;  2KZF A;  4AQY C;  1LCI A;  4LFC C;  4ISB A;  1VLA A;  1IBM C;  2WP0 C;  3E7X A;  3TDE A;  4KTT A;  2E7G A;  1IBL C;  4RLQ A;  1XNR C;  2D27 A;  2Y27 A;  2P2Q A;  4OX9 C;  1MXC A;  4DCS A;  4MTN A;  3H2T A;  4L4Q A;  4D57 A;  3JAM D;  4EAT A;  2VQF C;  1PA4 A;  4G1I A;  1XRB A;  2BH1 X;  4LFB C;  4OYC A;  2ZM6 C;  1MXA A;  2EGT A;  3RG2 A;  2D28 C;  1WH9 A;  2WD9 A;  2ATW A;  4KHP C;  3B7W A;  4HPV A;  4DCV A;  4DR5 C;  2E8C A;  4BCA A;  4LFA C;  3UOW A;  3DAY A;  2YWC A;  1ZB9 A;  3NI2 A;  4BBY A;  1IBK C;  4NDN A;  2OPL A;  3T1Y C;  3FCE A;  2HHH C;  3VNS A;  4IR7 A;  3R9X A;  2UUA C;  4DCT A;  1N36 C;  2E8F A;  5BUS A;  1QWI A;  3CJE A;  4NXM C;  3CW8 X;  5BUQ A;  4K0B A;  3IEV A;  4JI7 C;  3LNV A;  2DYJ A;  2QL8 A;  2UU9 C;  2BJO A;  4I9F A;  3IEU A;  1EGA A;  3LUS A;  4RVN A;  4BC9 A;  1USP A;  1ZB8 A;  4DUZ C;  3PES A;  3R9W A;  3LAX A;  4ZLP A;  4MH4 A;  3DHV A;  4LF4 C;  2D7V A;  3EQ6 A;  4I9G A;  2D1T A;  4JI2 C;  4JI6 C;  2XR1 A;  4DV6 C;  4XX2 A;  5BSM A;  4L2Z A;  2QVZ X;  4BSZ A;  4JI0 C;  1UKK A;  4PHT A;  3UZ0 A;  5GTD A;  3SO4 A;  4RM3 A;  2DPL A;  4RLF A;  4G37 A;  5AE1 A;  2OPL B;  3I07 A;  3NPD A;  2UXC C;  1HH2 P;  4X62 C;  3IPL A;  4LF5 C;  1BA3 A;  4X65 C;  4G36 A;  4DV0 C;  4ODJ A;  4LF9 C;  4PRO C;  2Y4N A;  2OBV A;  4IZ6 A;  4U5Y D;  1T5H X;  4DR6 C;  2CXC A;  1MDB A;  1FUG A;  4R1M A;  2UUB C;  4NOZ A;  3G7S A;  1USP B;  3ETC A;  3KXW A;  4DUY C;  4ZJZ A;  1HNX C;  5A2Q D;  1PG4 A;  3S82 A;  1XNQ C;  3T1H C;  2VZE A;  5LMU C;  3GPC A;  3A4I A;  5AE2 A;  4FTF A;  1ML8 A;  5T8S A;  5IT9 D;  5BR8 C;  2E0G A;  3N2Q A;  5BSW A;  1N34 C;  1FJG C;  4GS5 A;  4JI1 C;  2D1Q A;  2P2B A;  2QW0 X;  2P2J A;  3ETO A;  3J80 D;  1HNZ C;  4GKJ C;  5KYT A;  1QM4 A;  5BUR A;  3A9V A;  5CZV A;  2Y4O A;  4GXQ A;  4K0K C;  1KKG A;  3L95 X;  2E8E A;  3IML A;  4D4I A;  1T5D X;  4JI5 C;  4FUT A;  1O90 A;  5IFI A;  2JMP A;  3CW9 A;  2UUC C;  1K0R A;  4RVO A;  1O93 A;  1XRA A;  1AMU A;  4NXN C;  1PG3 A;  3VNR A;  4DV4 C;  3VNQ A;  4DR7 C;  1NYE A;  4L7I A;  3LGX A;  3GR0 A;  1N2F A;  5DV9 A;  2UXD C;  2QVX X;  1JOS A;  2P2M A;  2ONF A;  2PN2 A;  4YY3 C;  1V26 A;  4X66 C;  1GPM A;  1P7L A;  3J81 D;  4DV1 C;  4JI8 C;  5FLX D;  2E5L C;  4LF8 C;  2D1S A;  5KEI A;  4DV2 C;  4GXR A;  4YHH C;  4FUQ A;  4B3R C;  4R0M A;  3TQI A;  1LQL A;  1XMQ C;  2F4V C;  1YJ7 A;  4D56 A;  2VSQ A;  2PT7 G;  5BST A;  4KTV A;  1RG9 A;  4OXI A;  4DR3 C;  4B3T C;  1O92 A;  4R1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...