1JOSA

Ribosome binding factor a(rbfa)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
RSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLSYAKIFVTFLFDHDEMAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVEGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RIBOSOME-BINDING FACTOR A
publication title The 1.7-A Crystal Structure of HI1288 - Ribosome Binding Factor A (rbfA), a Cold Response Protein
rcsb
source organism Haemophilus influenzae
total genus 27
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1josA00
2ASBA 4DV1C 1QWIA 4JI7C 5LMUC 4YY3C 2CXCA 4DUYC 4LFBC 5LMNC 2DYJA 1ZB9A 3JAMD 4DR4C 2YCBA 4AQYC 2HJGA 2E5LC 1N32C 2UUAC 4DR6C 4X64C 2BJOA 4DV4C 1N34C 3IEVA 5BR8C 4JYAC 4NOZA 5FLXD 4DR3C 2UU9C 4XX2A 2XR1A 4DV6C 1L2FA 3T1YC 4B3RC 3AF5A 3EERA 4KHPC 4DV0C 1WF3A 4LF7C 5IWAC 2VQEC 2D7VA 4B3SC 4OX9C 5A2QD 4JI1C 4LFAC 2ZM6C 1N33C 1PA4A 4DR5C 1I94C 4DUZC 4LF6C 3CJEA 4BSZA 4JI6C 4JI2C 4DR2C 2E8FA 1IBLC 4DR7C 2E8CA 1K0RA 2OPLA 4B3MC 4NXMC 1USPB 4MTNA 1N2FA 5IT9D 1XMOC 2ONFA 1FJGC 4DCVA 2CY1A 1JOSA 4K0KC 2PN2A 3R9WA 1ZB8A 4X65C 4LF4C 1KKGA 1HH2P 3GKUA 2VQFC 4B3TC 4DCUA 4LFCC 2PT7G 1VLAA 1IBKC 3AF6A 4DCSA 4JI3C 2KZFA 3I07A 4LF5C 4LF9C 3IEUA 2EGTA 4JI8C 1IBMC 4NXNC 3R9XA 4DV2C 4JI5C 4GKJC 3OTOC 4MH4A 3J80D 3T1HC 1XNQC 4DV5C 2HHHC 1HNWC 2UUCC 2UXCC 4YHHC 1WH9A 1XMQC 3J81D 4LF8C 2QL8A 1XNRC 2UXBC 4DR1C 4JI4C 1HNZC 2UUBC 2F4VC 4JI0C 1MKYA 4JV5C 1USPA 1LQLA 1N36C 1HR0C 2ATWA 2JMPA 4DCTA 1UKKA 1ML8A 2E8EA 2UXDC 1HNXC 2E7GA 2OPLB 1EGAA 1NYEA 4DV3C 4DV7C 4GKKC 1J5EC 4X62C 4X66C 3LUSA
chains in the Genus database with same CATH superfamily
2ASBA 1O93A 2D1RA 1YJ7A 5LMUC 2CXCA 3A26A 1ZB9A 4DR4C 2QW0X 4AQYC 2HJGA 2E5LC 1N32C 2UUAC 4DR6C 4X64C 2MMAB 3UX2A 4NOZA 2YWCA 3A25A 5FLXD 2MM9A 4L2ZA 1MXCA 5H9UA 4LF7C 2VQEC 2VZEA 2E0GA 2ZM6C 4RLQA 1FUGA 5E7QA 2P20A 2CU6A 4JI2C 4G1IA 3L8CA 2E8FA 3ETCA 2E8CA 2OPLA 3CW9A 4MTNA 5IT9D 1XMOC 1M6XA 4K0KC 2M5OA 3R9WA 4ISBA 2ZZMA 1KKGA 2D1SA 3A4IA 1HH2P 4RVNA 3TQIA 4DCUA 1BA3A 5BSRA 1O90A 1VLAA 2ZZNA 3GPCA 2KZFA 5KYTA 2P2FA 5K85A 1ULTA 1T5HX 1IBMC 1P4EC 4FUTA 4DV2C 1XRCA 2VSQA 3UEBA 4WV3A 3O2EA 2HHHC 5T8SA 2UUCC 3N54B 4KTVA 2UXCC 3LGXA 4YHHC 1XMQC 4TPSB 3J81D 2DHMA 2UXBC 4GS5A 2UUBC 4D4GA 1P7LA 3IPLA 2ATWA 2JNVA 4L4QA 2E8EA 2UXDC 3LNVA 1HNXC 2E7GA 4HPVA 1EGAA 4DV7C 5BSUA 5AE3A 1J5EC 3IMLA 1V26A 4DV1C 5GTDA 4JI7C 5BSTA 4LFBC 4RVOA 5LMNC 4GXQA 3I08A 4RM2A 3CW8X 4EATA 1PU1A 4JYAC 2AYAA 3PROC 4DR3C 2D1QA 1M6XC 5DV9A 4DV6C 1GPMA 3AF5A 3FCCA 1MXBA 1WF3A 3VNSA 3LAXA 2M5HA 5A2QD 4JI1C 3C5EA 5JRHA 4PUIA 1N33C 1PA4A 2QVXX 4DR5C 1VEHA 4GXRA 4JI6C 3K6RA 4DR7C 1K0RA 3CQ1A 4B3MC 4RMNA 1USPB 3S82A 2Y4OA 1N2FA 2ONFA 4FUQA 5BSWA 4DCVA 3KXWA 1FJGC 4PUHA 1LCIA 4X65C 1AMUA 2KZ0A 3CQ3A 1O92A 2QVZX 3AF6A 2OO4A 3CQ2A 3I07A 5T8TA 4LF5C 4JI8C 4ODJA 4NXNC 5BUSA 4JI5C 3OTOC 3VNRA 4DG8A 1HNWC 2D28C 1XRBA 2DPLA 4D4IA 2QL8A 1XNRC 5BUQA 4OYCA 3A9VA 4DR1C 5BSMA 1HNZC 2F4VC 3SO4A 3TUFA 2Z51A 1MKYA 4I9FA 3E7XA 1LQLA 1UKKA 2OPLB 4G37A 4DV3C 2WD9A 1MXAA 4X66C 4K0BA 3A9UA 3AY0A 1RG9A 3GR1A 4DUYC 4YY3C 3N2QA 2YCBA 1UWDA 1QM4A 3E7WA 1O9TA 2QVYX 3RG2A 5CZXA 2BJOA 1N34C 3IEVA 5BR8C 4D56A 4XX2A 1RY2A 3TR3A 4B3RC 3T1YC 3RV2A 3EERA 3DHVA 2PROA 4DV0C 3NPDA 1FLOA 5IWAC 2D7VA 3NYQA 4PZPA 2WP0C 3CJEA 4R1MA 1V25A 4PHTA 4NDNA 5AE2A 2CY1A 3B7WA 1JOSA 2NCLA 2P2BA 5A1GA 1ZB8A 4LF4C 4ZLPA 3GKUA 5AE1A 4B3TC 2PT7G 3IEUA 2EGTA 1WCJA 3PESA 5ADZA 3J80D 5BURA 1XRAA 3L95X 4KTTA 4DV5C 4PUGA 4R1LA 4L7IA 1WH9A 4LF8C 4R0MA 3GR0A 4JI0C 3G7SA 4JV5C 4U5YD 2JMPA 4BCAA 1ML8A 2BH1X 1MD9A 4D57A 4RLFA 5BSVA 4GKKC 4IR7A 4IZ6A 1QWIA 5K8FA 1NY8A 4RM3A 2DYJA 3JAMD 4BC9A 5A19A 4I9GA 1XHJA 1PG3A 2P2MA 1MDFA 2Y4NA 4DV4C 3UOWA 2D1TA 3VNQA 2UU9C 2XR1A 1L2FA 1V60A 4KHPC 2OBVA 3ETOA 4B3SC 4OX9C 4LFAC 1I94C 4DUZC 4LF6C 1TH5A 4BSZA 4DR2C 1IBLC 4NXMC 4OXIA 3PBKA 2PN2A 2YWBA 2YX1A 2MCQA 3DAYA 4G36A 1MDBA 3EQ6A 2VQFC 1PG4A 3UX3A 4LFCC 2D27A 1IBKC 4ZJZA 5LCIA 4JI3C 4DCSA 4LF9C 2P2QA 3UZ0A 3NYRA 4LE5A 3R9XA 2P02A 4GKJC 4MH4A 4BC7A 3T1HC 3DLPX 5KYVA 1XNQC 4PROC 1XS3A 2V7BA 4FTFA 4WS9A 5CZVA 5KEIA 5IFIA 3FCEA 1T5DX 3NI2A 4JM1A 4JI4C 2KDNA 3H2TA 3TDEA 1USPA 3LNOA 5A1IA 1N36C 1HR0C 4BBYA 4DCTA 4DG9A 3R44A 1NYEA 1IB8A 2Y27A 1P4EA 4X62C 2P2JA 3LUSA
chains in the Genus database with same CATH topology
2ASBA 1O93A 2D1RA 1YJ7A 5LMUC 2CXCA 1ZB9A 4DR4C 2QW0X 4AQYC 2HJGA 2E5LC 1N32C 2UUAC 4DR6C 4X64C 4NOZA 2YWCA 5FLXD 4L2ZA 1MXCA 5H9UA 4LF7C 2VQEC 2VZEA 2E0GA 2ZM6C 4RLQA 1FUGA 5E7QA 2P20A 4JI2C 4G1IA 3L8CA 2E8FA 3ETCA 2E8CA 2OPLA 3CW9A 4MTNA 5IT9D 1XMOC 4K0KC 3R9WA 4ISBA 1KKGA 2D1SA 3A4IA 1HH2P 4RVNA 3TQIA 4DCUA 1BA3A 5BSRA 1O90A 1VLAA 3GPCA 2KZFA 5KYTA 2P2FA 5K85A 1ULTA 1T5HX 1IBMC 4FUTA 4DV2C 1XRCA 2VSQA 4WV3A 2HHHC 5T8SA 2UUCC 3N54B 4KTVA 2UXCC 3LGXA 4YHHC 1XMQC 4TPSB 3J81D 2UXBC 4GS5A 2UUBC 1P7LA 4D4GA 3IPLA 2ATWA 4L4QA 2E8EA 2UXDC 3LNVA 1HNXC 2E7GA 4HPVA 1EGAA 4DV7C 5BSUA 5AE3A 1J5EC 3IMLA 1V26A 4DV1C 5GTDA 4JI7C 5BSTA 4LFBC 4RVOA 5LMNC 4GXQA 3I08A 4RM2A 3CW8X 4EATA 4JYAC 2AYAA 3PROC 4DR3C 2D1QA 5DV9A 4DV6C 1GPMA 3AF5A 3FCCA 1MXBA 1WF3A 3VNSA 3LAXA 5A2QD 4JI1C 3C5EA 5JRHA 1N33C 1PA4A 2QVXX 4DR5C 4GXRA 4JI6C 4DR7C 1K0RA 4B3MC 4RMNA 1USPB 3S82A 2Y4OA 1N2FA 2ONFA 4FUQA 5BSWA 4DCVA 3KXWA 1FJGC 1LCIA 4X65C 1AMUA 1O92A 2QVZX 3AF6A 2OO4A 3I07A 5T8TA 4LF5C 4JI8C 4ODJA 4NXNC 5BUSA 4JI5C 3OTOC 3VNRA 4DG8A 1HNWC 2D28C 1XRBA 2DPLA 4D4IA 2QL8A 1XNRC 5BUQA 4OYCA 3A9VA 4DR1C 5BSMA 1HNZC 2F4VC 3SO4A 3TUFA 1MKYA 4I9FA 3E7XA 1LQLA 1UKKA 2OPLB 4G37A 4DV3C 2WD9A 1MXAA 4X66C 4K0BA 3A9UA 1RG9A 3GR1A 4DUYC 4YY3C 3N2QA 2YCBA 3E7WA 1QM4A 1O9TA 2QVYX 3RG2A 5CZXA 2BJOA 1N34C 3IEVA 5BR8C 4D56A 4XX2A 1RY2A 4B3RC 3T1YC 3RV2A 3EERA 3DHVA 2PROA 4DV0C 3NPDA 5IWAC 2D7VA 3NYQA 4PZPA 2WP0C 3CJEA 4R1MA 1V25A 4PHTA 4NDNA 5AE2A 2CY1A 3B7WA 1JOSA 2P2BA 5A1GA 1ZB8A 4LF4C 4ZLPA 3GKUA 5AE1A 4B3TC 2PT7G 3IEUA 2EGTA 3PESA 5ADZA 3J80D 5BURA 1XRAA 3L95X 4KTTA 4DV5C 4R1LA 4L7IA 1WH9A 4LF8C 4R0MA 3GR0A 4JI0C 3G7SA 4JV5C 4U5YD 2JMPA 4BCAA 1ML8A 2BH1X 1MD9A 4D57A 4RLFA 5BSVA 4GKKC 4IR7A 4IZ6A 1QWIA 5K8FA 4RM3A 2DYJA 3JAMD 4BC9A 5A19A 4I9GA 1PG3A 2P2MA 1MDFA 2Y4NA 4DV4C 3UOWA 2D1TA 3VNQA 2UU9C 2XR1A 1L2FA 4KHPC 2OBVA 3ETOA 4B3SC 4OX9C 4LFAC 1I94C 4DUZC 4LF6C 4BSZA 4DR2C 1IBLC 4NXMC 4OXIA 3PBKA 2PN2A 2YWBA 3DAYA 4G36A 1MDBA 3EQ6A 2VQFC 1PG4A 4LFCC 2D27A 1IBKC 4ZJZA 4DCSA 4JI3C 4LF9C 2P2QA 3UZ0A 3NYRA 4LE5A 3R9XA 2P02A 4GKJC 4MH4A 4BC7A 3T1HC 3DLPX 5KYVA 1XNQC 4PROC 2V7BA 4FTFA 4WS9A 5CZVA 5KEIA 5IFIA 3FCEA 1T5DX 3NI2A 4JM1A 4JI4C 3H2TA 3TDEA 1USPA 5A1IA 1N36C 1HR0C 4BBYA 4DCTA 4DG9A 3R44A 1NYEA 2Y27A 4X62C 2P2JA 3LUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASB A;  4DV1 C;  1QWI A;  4JI7 C;  5LMU C;  4YY3 C;  2CXC A;  4DUY C;  4LFB C;  5LMN C;  2DYJ A;  1ZB9 A;  3JAM D;  4DR4 C;  2YCB A;  4AQY C;  2HJG A;  2E5L C;  1N32 C;  2UUA C;  4DR6 C;  4X64 C;  2BJO A;  4DV4 C;  1N34 C;  3IEV A;  5BR8 C;  4JYA C;  4NOZ A;  5FLX D;  4DR3 C;  2UU9 C;  4XX2 A;  2XR1 A;  4DV6 C;  1L2F A;  3T1Y C;  4B3R C;  3AF5 A;  3EER A;  4KHP C;  4DV0 C;  1WF3 A;  4LF7 C;  5IWA C;  2VQE C;  2D7V A;  4B3S C;  4OX9 C;  5A2Q D;  4JI1 C;  4LFA C;  2ZM6 C;  1N33 C;  1PA4 A;  4DR5 C;  1I94 C;  4DUZ C;  4LF6 C;  3CJE A;  4BSZ A;  4JI6 C;  4JI2 C;  4DR2 C;  2E8F A;  1IBL C;  4DR7 C;  2E8C A;  1K0R A;  2OPL A;  4B3M C;  4NXM C;  1USP B;  4MTN A;  1N2F A;  5IT9 D;  1XMO C;  2ONF A;  1FJG C;  4DCV A;  2CY1 A;  1JOS A;  4K0K C;  2PN2 A;  3R9W A;  1ZB8 A;  4X65 C;  4LF4 C;  1KKG A;  1HH2 P;  3GKU A;  2VQF C;  4B3T C;  4DCU A;  4LFC C;  2PT7 G;  1VLA A;  1IBK C;  3AF6 A;  4DCS A;  4JI3 C;  2KZF A;  3I07 A;  4LF5 C;  4LF9 C;  3IEU A;  2EGT A;  4JI8 C;  1IBM C;  4NXN C;  3R9X A;  4DV2 C;  4JI5 C;  4GKJ C;  3OTO C;  4MH4 A;  3J80 D;  3T1H C;  1XNQ C;  4DV5 C;  2HHH C;  1HNW C;  2UUC C;  2UXC C;  4YHH C;  1WH9 A;  1XMQ C;  3J81 D;  4LF8 C;  2QL8 A;  1XNR C;  2UXB C;  4DR1 C;  4JI4 C;  1HNZ C;  2UUB C;  2F4V C;  4JI0 C;  1MKY A;  4JV5 C;  1USP A;  1LQL A;  1N36 C;  1HR0 C;  2ATW A;  2JMP A;  4DCT A;  1UKK A;  1ML8 A;  2E8E A;  2UXD C;  1HNX C;  2E7G A;  2OPL B;  1EGA A;  1NYE A;  4DV3 C;  4DV7 C;  4GKK C;  1J5E C;  4X62 C;  4X66 C;  3LUS A; 
#chains in the Genus database with same CATH topology
 2ASB A;  1O93 A;  2D1R A;  1YJ7 A;  5LMU C;  2CXC A;  3A26 A;  1ZB9 A;  4DR4 C;  2QW0 X;  4AQY C;  2HJG A;  2E5L C;  1N32 C;  2UUA C;  4DR6 C;  4X64 C;  2MMA B;  3UX2 A;  4NOZ A;  2YWC A;  3A25 A;  5FLX D;  2MM9 A;  4L2Z A;  1MXC A;  5H9U A;  4LF7 C;  2VQE C;  2VZE A;  2E0G A;  2ZM6 C;  4RLQ A;  1FUG A;  5E7Q A;  2P20 A;  2CU6 A;  4JI2 C;  4G1I A;  3L8C A;  2E8F A;  3ETC A;  2E8C A;  2OPL A;  3CW9 A;  4MTN A;  5IT9 D;  1XMO C;  1M6X A;  4K0K C;  2M5O A;  3R9W A;  4ISB A;  2ZZM A;  1KKG A;  2D1S A;  3A4I A;  1HH2 P;  4RVN A;  3TQI A;  4DCU A;  1BA3 A;  5BSR A;  1O90 A;  1VLA A;  2ZZN A;  3GPC A;  2KZF A;  5KYT A;  2P2F A;  5K85 A;  1ULT A;  1T5H X;  1IBM C;  1P4E C;  4FUT A;  4DV2 C;  1XRC A;  2VSQ A;  3UEB A;  4WV3 A;  3O2E A;  2HHH C;  5T8S A;  2UUC C;  3N54 B;  4KTV A;  2UXC C;  3LGX A;  4YHH C;  1XMQ C;  4TPS B;  3J81 D;  2DHM A;  2UXB C;  4GS5 A;  2UUB C;  4D4G A;  1P7L A;  3IPL A;  2ATW A;  2JNV A;  4L4Q A;  2E8E A;  2UXD C;  3LNV A;  1HNX C;  2E7G A;  4HPV A;  1EGA A;  4DV7 C;  5BSU A;  5AE3 A;  1J5E C;  3IML A;  1V26 A;  4DV1 C;  5GTD A;  4JI7 C;  5BST A;  4LFB C;  4RVO A;  5LMN C;  4GXQ A;  3I08 A;  4RM2 A;  3CW8 X;  4EAT A;  1PU1 A;  4JYA C;  2AYA A;  3PRO C;  4DR3 C;  2D1Q A;  1M6X C;  5DV9 A;  4DV6 C;  1GPM A;  3AF5 A;  3FCC A;  1MXB A;  1WF3 A;  3VNS A;  3LAX A;  2M5H A;  5A2Q D;  4JI1 C;  3C5E A;  5JRH A;  4PUI A;  1N33 C;  1PA4 A;  2QVX X;  4DR5 C;  1VEH A;  4GXR A;  4JI6 C;  3K6R A;  4DR7 C;  1K0R A;  3CQ1 A;  4B3M C;  4RMN A;  1USP B;  3S82 A;  2Y4O A;  1N2F A;  2ONF A;  4FUQ A;  5BSW A;  4DCV A;  3KXW A;  1FJG C;  4PUH A;  1LCI A;  4X65 C;  1AMU A;  2KZ0 A;  3CQ3 A;  1O92 A;  2QVZ X;  3AF6 A;  2OO4 A;  3CQ2 A;  3I07 A;  5T8T A;  4LF5 C;  4JI8 C;  4ODJ A;  4NXN C;  5BUS A;  4JI5 C;  3OTO C;  3VNR A;  4DG8 A;  1HNW C;  2D28 C;  1XRB A;  2DPL A;  4D4I A;  2QL8 A;  1XNR C;  5BUQ A;  4OYC A;  3A9V A;  4DR1 C;  5BSM A;  1HNZ C;  2F4V C;  3SO4 A;  3TUF A;  2Z51 A;  1MKY A;  4I9F A;  3E7X A;  1LQL A;  1UKK A;  2OPL B;  4G37 A;  4DV3 C;  2WD9 A;  1MXA A;  4X66 C;  4K0B A;  3A9U A;  3AY0 A;  1RG9 A;  3GR1 A;  4DUY C;  4YY3 C;  3N2Q A;  2YCB A;  1UWD A;  1QM4 A;  3E7W A;  1O9T A;  2QVY X;  3RG2 A;  5CZX A;  2BJO A;  1N34 C;  3IEV A;  5BR8 C;  4D56 A;  4XX2 A;  1RY2 A;  3TR3 A;  4B3R C;  3T1Y C;  3RV2 A;  3EER A;  3DHV A;  2PRO A;  4DV0 C;  3NPD A;  1FLO A;  5IWA C;  2D7V A;  3NYQ A;  4PZP A;  2WP0 C;  3CJE A;  4R1M A;  1V25 A;  4PHT A;  4NDN A;  5AE2 A;  2CY1 A;  3B7W A;  1JOS A;  2NCL A;  2P2B A;  5A1G A;  1ZB8 A;  4LF4 C;  4ZLP A;  3GKU A;  5AE1 A;  4B3T C;  2PT7 G;  3IEU A;  2EGT A;  1WCJ A;  3PES A;  5ADZ A;  3J80 D;  5BUR A;  1XRA A;  3L95 X;  4KTT A;  4DV5 C;  4PUG A;  4R1L A;  4L7I A;  1WH9 A;  4LF8 C;  4R0M A;  3GR0 A;  4JI0 C;  3G7S A;  4JV5 C;  4U5Y D;  2JMP A;  4BCA A;  1ML8 A;  2BH1 X;  1MD9 A;  4D57 A;  4RLF A;  5BSV A;  4GKK C;  4IR7 A;  4IZ6 A;  1QWI A;  5K8F A;  1NY8 A;  4RM3 A;  2DYJ A;  3JAM D;  4BC9 A;  5A19 A;  4I9G A;  1XHJ A;  1PG3 A;  2P2M A;  1MDF A;  2Y4N A;  4DV4 C;  3UOW A;  2D1T A;  3VNQ A;  2UU9 C;  2XR1 A;  1L2F A;  1V60 A;  4KHP C;  2OBV A;  3ETO A;  4B3S C;  4OX9 C;  4LFA C;  1I94 C;  4DUZ C;  4LF6 C;  1TH5 A;  4BSZ A;  4DR2 C;  1IBL C;  4NXM C;  4OXI A;  3PBK A;  2PN2 A;  2YWB A;  2YX1 A;  2MCQ A;  3DAY A;  4G36 A;  1MDB A;  3EQ6 A;  2VQF C;  1PG4 A;  3UX3 A;  4LFC C;  2D27 A;  1IBK C;  4ZJZ A;  5LCI A;  4JI3 C;  4DCS A;  4LF9 C;  2P2Q A;  3UZ0 A;  3NYR A;  4LE5 A;  3R9X A;  2P02 A;  4GKJ C;  4MH4 A;  4BC7 A;  3T1H C;  3DLP X;  5KYV A;  1XNQ C;  4PRO C;  1XS3 A;  2V7B A;  4FTF A;  4WS9 A;  5CZV A;  5KEI A;  5IFI A;  3FCE A;  1T5D X;  3NI2 A;  4JM1 A;  4JI4 C;  2KDN A;  3H2T A;  3TDE A;  1USP A;  3LNO A;  5A1I A;  1N36 C;  1HR0 C;  4BBY A;  4DCT A;  4DG9 A;  3R44 A;  1NYE A;  1IB8 A;  2Y27 A;  1P4E A;  4X62 C;  2P2J A;  3LUS A; 
#chains in the Genus database with same CATH homology
 2ASB A;  1O93 A;  2D1R A;  1YJ7 A;  5LMU C;  2CXC A;  1ZB9 A;  4DR4 C;  2QW0 X;  4AQY C;  2HJG A;  2E5L C;  1N32 C;  2UUA C;  4DR6 C;  4X64 C;  4NOZ A;  2YWC A;  5FLX D;  4L2Z A;  1MXC A;  5H9U A;  4LF7 C;  2VQE C;  2VZE A;  2E0G A;  2ZM6 C;  4RLQ A;  1FUG A;  5E7Q A;  2P20 A;  4JI2 C;  4G1I A;  3L8C A;  2E8F A;  3ETC A;  2E8C A;  2OPL A;  3CW9 A;  4MTN A;  5IT9 D;  1XMO C;  4K0K C;  3R9W A;  4ISB A;  1KKG A;  2D1S A;  3A4I A;  1HH2 P;  4RVN A;  3TQI A;  4DCU A;  1BA3 A;  5BSR A;  1O90 A;  1VLA A;  3GPC A;  2KZF A;  5KYT A;  2P2F A;  5K85 A;  1ULT A;  1T5H X;  1IBM C;  4FUT A;  4DV2 C;  1XRC A;  2VSQ A;  4WV3 A;  2HHH C;  5T8S A;  2UUC C;  3N54 B;  4KTV A;  2UXC C;  3LGX A;  4YHH C;  1XMQ C;  4TPS B;  3J81 D;  2UXB C;  4GS5 A;  2UUB C;  1P7L A;  4D4G A;  3IPL A;  2ATW A;  4L4Q A;  2E8E A;  2UXD C;  3LNV A;  1HNX C;  2E7G A;  4HPV A;  1EGA A;  4DV7 C;  5BSU A;  5AE3 A;  1J5E C;  3IML A;  1V26 A;  4DV1 C;  5GTD A;  4JI7 C;  5BST A;  4LFB C;  4RVO A;  5LMN C;  4GXQ A;  3I08 A;  4RM2 A;  3CW8 X;  4EAT A;  4JYA C;  2AYA A;  3PRO C;  4DR3 C;  2D1Q A;  5DV9 A;  4DV6 C;  1GPM A;  3AF5 A;  3FCC A;  1MXB A;  1WF3 A;  3VNS A;  3LAX A;  5A2Q D;  4JI1 C;  3C5E A;  5JRH A;  1N33 C;  1PA4 A;  2QVX X;  4DR5 C;  4GXR A;  4JI6 C;  4DR7 C;  1K0R A;  4B3M C;  4RMN A;  1USP B;  3S82 A;  2Y4O A;  1N2F A;  2ONF A;  4FUQ A;  5BSW A;  4DCV A;  3KXW A;  1FJG C;  1LCI A;  4X65 C;  1AMU A;  1O92 A;  2QVZ X;  3AF6 A;  2OO4 A;  3I07 A;  5T8T A;  4LF5 C;  4JI8 C;  4ODJ A;  4NXN C;  5BUS A;  4JI5 C;  3OTO C;  3VNR A;  4DG8 A;  1HNW C;  2D28 C;  1XRB A;  2DPL A;  4D4I A;  2QL8 A;  1XNR C;  5BUQ A;  4OYC A;  3A9V A;  4DR1 C;  5BSM A;  1HNZ C;  2F4V C;  3SO4 A;  3TUF A;  1MKY A;  4I9F A;  3E7X A;  1LQL A;  1UKK A;  2OPL B;  4G37 A;  4DV3 C;  2WD9 A;  1MXA A;  4X66 C;  4K0B A;  3A9U A;  1RG9 A;  3GR1 A;  4DUY C;  4YY3 C;  3N2Q A;  2YCB A;  3E7W A;  1QM4 A;  1O9T A;  2QVY X;  3RG2 A;  5CZX A;  2BJO A;  1N34 C;  3IEV A;  5BR8 C;  4D56 A;  4XX2 A;  1RY2 A;  4B3R C;  3T1Y C;  3RV2 A;  3EER A;  3DHV A;  2PRO A;  4DV0 C;  3NPD A;  5IWA C;  2D7V A;  3NYQ A;  4PZP A;  2WP0 C;  3CJE A;  4R1M A;  1V25 A;  4PHT A;  4NDN A;  5AE2 A;  2CY1 A;  3B7W A;  1JOS A;  2P2B A;  5A1G A;  1ZB8 A;  4LF4 C;  4ZLP A;  3GKU A;  5AE1 A;  4B3T C;  2PT7 G;  3IEU A;  2EGT A;  3PES A;  5ADZ A;  3J80 D;  5BUR A;  1XRA A;  3L95 X;  4KTT A;  4DV5 C;  4R1L A;  4L7I A;  1WH9 A;  4LF8 C;  4R0M A;  3GR0 A;  4JI0 C;  3G7S A;  4JV5 C;  4U5Y D;  2JMP A;  4BCA A;  1ML8 A;  2BH1 X;  1MD9 A;  4D57 A;  4RLF A;  5BSV A;  4GKK C;  4IR7 A;  4IZ6 A;  1QWI A;  5K8F A;  4RM3 A;  2DYJ A;  3JAM D;  4BC9 A;  5A19 A;  4I9G A;  1PG3 A;  2P2M A;  1MDF A;  2Y4N A;  4DV4 C;  3UOW A;  2D1T A;  3VNQ A;  2UU9 C;  2XR1 A;  1L2F A;  4KHP C;  2OBV A;  3ETO A;  4B3S C;  4OX9 C;  4LFA C;  1I94 C;  4DUZ C;  4LF6 C;  4BSZ A;  4DR2 C;  1IBL C;  4NXM C;  4OXI A;  3PBK A;  2PN2 A;  2YWB A;  3DAY A;  4G36 A;  1MDB A;  3EQ6 A;  2VQF C;  1PG4 A;  4LFC C;  2D27 A;  1IBK C;  4ZJZ A;  4DCS A;  4JI3 C;  4LF9 C;  2P2Q A;  3UZ0 A;  3NYR A;  4LE5 A;  3R9X A;  2P02 A;  4GKJ C;  4MH4 A;  4BC7 A;  3T1H C;  3DLP X;  5KYV A;  1XNQ C;  4PRO C;  2V7B A;  4FTF A;  4WS9 A;  5CZV A;  5KEI A;  5IFI A;  3FCE A;  1T5D X;  3NI2 A;  4JM1 A;  4JI4 C;  3H2T A;  3TDE A;  1USP A;  5A1I A;  1N36 C;  1HR0 C;  4BBY A;  4DCT A;  4DG9 A;  3R44 A;  1NYE A;  2Y27 A;  4X62 C;  2P2J A;  3LUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...