4FUTA

Crystal structure of atp bound matb from rhodopseudomonas palustris
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
502
structure length
475
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDGATIDEAQVLHGLDGQLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malonyl CoA synthetase
publication title Structure-Guided Expansion of the Substrate Range of Methylmalonyl Coenzyme A Synthetase (MatB) of Rhodopseudomonas palustris.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
total genus 145
structure length 475
sequence length 502
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4futA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4futA01
5BUQA 3DAYA 2V7BA 3U17A 4R1LA 4IZ6A 4D4GA 4DG8A 2P2QA 4ISBA 5BSTA 5KEIA 2D1QA 3O84A 4RLFA 5KYTA 4D4HA 3VNSA 2QW0X 3QYAA 4RM2A 1LCIA 4LGCA 3NI2A 4E5DA 3E53A 3KXWA 1MDFA 3U16A 3VNRA 5JRHA 2D1TA 3A9VA 3E7XA 2D1RA 3T5BA 3NYQA 3T5CA 5K8FA 2QVZX 4RM3A 4GXRA 2P2JA 3O83A 4RLQA 2QVYX 1RY2A 4GXQA 4GR4A 3LGXA 2VSQA 3CW9A 4IR7A 5KYVA 5E7QA 4ZJZA 2Y4NA 3IPLA 1AMUA 3B7WA 5BSRA 4U5YD 4GR5A 5BSUA 4RVNA 1YJ7A 4OXIA 3ETCA 4FUTA 3EQ6A 4D57A 5BUSA 3WV5A 3WV4A 5IFIA 3ITEA 5D6NA 5BSVA 4FUQA 4OYCA 2WD9A 3E7WA 3DHVA 2Y27A 4M46A 1ULTA 4GS5A 3O82A 4EATA 3GPCA 3T5AA 3FCCA 3IVRA 3TSYA 3A9UA 2P2MA 3IERA 4R0MA 4RMNA 3PBKA 1MDBA 3LNVA 3VNQA 2P20A 4D4IA 2D1SA 1PG4A 2QVXX 4DG9A 1MD9A 2Y4OA 4G37A 5GTDA 2VZEA 5DV9A 5K85A 2P2FA 1T5DX 2P2BA 4RVOA 3WVNA 3C5EA 3L8CA 5BSWA 1BA3A 1T5HX 4W8OA 3G7SA 3CW8X 4R1MA 5DWVA 3RG2A 4D56A 1V26A 4G36A 3NYRA 3DLPX 3LAXA 4PZPA 4WV3A 5BURA 3IEPA 3RIXA 3R44A 1V25A 1PG3A 3FCEA 3IESA 5BSMA
chains in the Genus database with same CATH superfamily
4YV0A 2D0PB 3DBLA 1SHZA 3A4YA 3MWGA 3KAPA 1G0NA 2B9VA 4QARA 3SYLA 4GGPA 2ZB2A 2L19A 3WHLA 5F4ZA 3U3XA 4DV4C 1K97A 4HR7A 4KQHA 1JEYB 3STHA 4IGEA 2VG8A 2H6EA 2OZEA 2FRDC 2ZR8A 4FIDA 2R8BA 5FOTA 4QGGA 2R6CA 2XTNA 3JQEA 3EW9A 2QRKA 1ZNZA 2NZ2A 2R6AA 1UBJS 1YIAA 4WGGA 2Z83A 3S27A 1N8NA 1PVDA 1JR2A 3UAOA 3UAZA 3IMCA 4KE9A 3NIGB 4QXMA 5JR3A 2BJWA 3GGJA 1ID1A 2Y1KA 2NQTA 5I7FA 4CEHA 1TCCA 4F3CA 3RVOA 5PNTA 2C20A 2ASBA 3VZDA 1SCQA 2BM0A 2IYEA 1R0RE 1Z4NA 1DAPA 1KJJA 4B75A 1S1CA 4LMAA 4DR4C 4E1VA 4P6VF 1SBYA 2JLUA 4G4SO 5FAXA 4ZVQA 3IIIA 5ARBA 4OK5A 2CMGA 5KYXA 3T5CA 5K8FA 3SM9A 3UNXA 3LX4A 1KORA 2TMDA 2XUIA 2GEKA 1H22A 2H07A 2J6IA 4FKMA 2DRIA 1GWNA 1Z0JA 3IRUA 4WNYA 5TJ9A 3RTEA 1T9ZA 3CURA 4O4JB 3T3PB 3KELA 3K6SA 1L5MA 3IH5A 4PYNA 3RC3A 5KREA 1LPOA 1YJXA 3VTAA 2YVLA 3NWOA 1GNRA 3FPEA 1U2GA 3H8WA 1KSHA 2FPUA 1NM5C 5BSUA 1Y0BA 1E2UA 1JFFA 1GL3A 3BM5A 3OSUA 3OU2A 4OB7A 4RZXA 1N1EA 1ZITA 4TRMA 1XTPA 3HO6A 3MSCA 4U7GA 1ZD4A 5P8WA 4FZVA 3ADBA 1XMOC 3ACBA 4B8ZA 3SQLA 1L8LA 4J8PA 2BUCA 2QE6A 3FPKA 1NN3A 2FSPA 2O14A 4RDHA 5KHAA 1NSYA 1T6NA 2JAUA 4JBXA 2J7KA 4M0EA 4MR9B 5IX8A 5KNBA 1GEEA 4F1JA 1J21A 3VYVA 3N3AC 3P0FA 4PG6A 4U02A 1GTZA 3RI3A 2VNIA 3LUGA 2X8JB 1VBFA 1WDMA 3V2GA 2IBSA 1CG6A 1NMQA 3A14A 2WDPA 4LQCA 4M99A 1PS0A 1ZKDA 4LNUB 3IDFA 4NK5A 3N0VA 2CE2X 4PC2A 4FQ8A 1BRTA 2BH1X 4H4CA 4I3GA 5JSFA 5K1ZA 1GT6A 2DWCA 4BVJA 4U39A 2E5WA 1FMJA 3OLXA 1L7XA 3H8SA 4RE6A 2H17A 5KVQA 1GCIA 1BS2A 1R0LA 4GBGA 1ZM3A 1XWFA 2LDBA 4KV9A 4XDYA 2ZI5A 5CT5A 3VU0A 2W90A 1UEXC 2YV1A 1SHKA 1NC3A 2FLKA 4WCFC 1ZX1A 3IOYA 2PEZA 4UARA 2R6JA 3CVOA 4MV6A 4CR8A 1VBKA 1GSIA 3CM0A 4BAGA 3NZEA 2L18A 2FLVA 2NSDA 3OZVA 5LQUA 1JIUA 1JG3A 2NZVG 1RWMA 3IO3A 3R0IA 3GVPA 3UZUA 4ALNA 4DJ5X 4WBNF 1DRUA 1YB1A 2Z58A 1OTYA 3BXOA 5ADHA 5JYEA 2RAUA 4GVPA 4C4XA 1G59A 4XIYA 1RHJA 4QGFA 5DJ5A 1SHUX 1IJFA 2Q46A 4LQ4A 4QLOA 1I9CA 3PC3A 3ER8A 2FJUA 1W2WB 2WWIA 1CF9A 1S9HA 3I9LA 4UPEA 4RKYA 1EG2A 1W73A 1U2QA 4M1TA 3T6KA 1LF5A 1JKMA 1UADA 2SKDA 1DSSG 3K0FA 4UM9D 3T94A 2IEAA 4PWYA 3OTOB 1WDKA 2XOXA 3WB1A 2GBCA 4IYJA 3H3JA 4FVTA 2YVUA 4A6DA 5IN4A 2BBSA 2P0YA 1ZW6A 3PDJA 4BMOB 2Y92A 2WAOA 3P94A 3ZJTA 3JASA 3LC7O 4BJHB 4X85A 1ECJA 1E5VA 2E18A 2E55A 3FVQA 3U26A 4EKDA 1I4DD 1ZGAA 4Q66C 2X0IA 5G0TA 2DFDA 3GFTA 3IULA 4H6XA 1E2DA 3E53A 3GFBA 4BLSA 5MFZA 1CEEA 4XVHA 4LG1A 1IEVA 1AB6A 1LDBA 3Q7EA 2EFEB 3WK8A 2QN2A 2DFLA 2AN4A 2PNFA 3ONVA 1TO2E 3CJTA 3A9VA 4PCUA 5FD8A 3L6EA 3HDTA 1L6IA 4N5NA 4KDFA 4O4IF 3LPCA 2EDCA 2FK7A 3DMGA 3UANA 3BF7A 1I7SB 1QDEA 3KKPA 4R2WA 2QMZA 2C1EA 4I5EA 3SS7X 1WUHS 1E58A 2B37A 2Y1GA 2YW9A 3H04A 3C7KA 2PFGA 3L8EA 4M9SA 3HDGA 3RSOA 3RUEA 3HXOA 3PROC 4QNMA 3OEED 4JEIA 1GCGA 1XQ9A 1ZHOA 5FNVA 2VDMB 5AHXA 3VR5D 3NCTA 5CW1A 1SU6A 1LW6E 4L8WB 2EJUA 1SC3A 1Z18A 1V8FA 3QJGA 4GOKA 4M49A 3OHPA 4WAUA 1ZP6A 3LPNA 5FBZA 1H8ED 1FQJA 2X23A 3ENVA 4RCYA 1A2OA 4BEJA 4FS3A 4DARA 3CNOA 4OM8A 3FDFA 4KITB 1XHEA 1KJ9A 1KYTA 1UBFA 3C5HA 1ZU5A 4LRYA 2FUEA 3II6X 2MJLA 3HKCA 1QTRA 1W0JD 2R2GA 3IAAA 3OY2A 4WESA 4Y0VA 3REGA 5C8ZA 4DV5B 5DI9A 5FBVB 3NBMA 5K3OA 4BFSA 1GAEO 5FI3A 1X7YA 4J1SA 4PSCA 1EGQA 2O3RA 3PX7A 4BNXA 1XKXA 3RW9A 4YRQA 1UKEA 3ZXSA 3I9KA 5ESWA 4ZFNA 4J1TA 5DW0A 2WF9A 5A4FS 1LPAB 1J0CA 1T1IA 3FDZA 2YRXA 4QX6A 5LBIA 2WTAA 4D9JA 1X7ZA 2FW7A 3LT2A 1YVPA 2Q6LA 3P0EA 4FJ1A 4NBVA 2V6JA 1DO8A 3FYTA 3MLAA 3VZQA 2AN9A 2GEUA 4BJ1A 3HVUA 1VLMA 2GAFA 3EEBA 1OILA 2PROA 2ZITA 4N5LA 5HJEA 3H4IA 4YACA 5EHQA 4LF7B 4HB0A 3CBGA 3FGNA 4Q4HB 1S8NA 3DEKA 4NEHB 4X63A 5AM5A 4F84A 5CB4A 5KQRA 2DLCX 1XZEA 3AGQA 5BWBA 4J75A 1SK8A 3DDHA 3DMHA 4W5HA 1VJRA 2Y99A 1UC9A 2CNOA 3QW2A 3OJWA 2QUHA 1E2PA 2N42A 2BONA 4UVHA 3RVPA 2ATXA 3FOWA 3RO7A 2BWJA 5BN5B 4A8TA 1VOTA 1YB4A 1P1JA 1RWOA 4J16C 3ZIAD 4ARVA 3PA6A 2ZKLA 4LXQA 3WLEA 1IUNA 1N0IA 3GXOA 3IDZA 4XYGA 1RAIA 1JJIA 1T2FA 5L6LB 2FN4A 2K4MA 4B76A 2NVOA 1ZLXA 4REQB 3OLVA 5CDUA 4QXOA 2B6NA 2CC2A 4MCAA 3JSAA 5CIWA 2OAEA 3TD9A 1TTTA 2FQXA 4K9QA 2Z43A 3DAYA 3QVGA 2HTFA 1YVRA 1B0ZA 3F78A 4XVRA 5D84A 1LPPA 1PYDA 3J7TA 2QLLA 3M4NA 3ORYA 3R5KA 1JKIA 4GPEA 2IV3A 4CV3A 1I24A 3CMMA 4M9QA 3PC2A 4AJ4A 5JT1A 1V6SA 5BOSB 1GR0A 3I9OA 2NVBA 1PR9A 3MCUA 3TQRA 4DDMA 3T5MA 1P9RA 1Q15A 3NO4A 2V55B 3ODGA 1PGJA 1QO0D 4EY3A 1F14A 2O3SA 2PMFA 4LKOA 3WBBA 2VWPA 3ZNPA 1XDZA 3ZVMA 1P5HA 4M0DA 4N9WA 3KE8A 3CLKA 3DR5A 3SDZA 1KF0A 4B3SB 2DTDA 3EEQA 3O3CA 1KJNA 3S2EA 1OF1A 2WWGA 1MPXA 4Q34A 3I6ZA 3C3YA 2EU8A 1WY7A 3L0CA 2C03A 1KYQA 1IOLA 2FR8C 4EPVA 3WLRA 4RZ2A 4JR1A 4F4UA 2IH4A 1FFSA 3BK2A 4OQ4A 3QNMA 1X94A 2QJWA 4LOHA 5J1TB 1PG0A 4OP2A 3WX0A 5DTMA 2Y0CA 1N2FA 2WIAA 5INTA 2E3JA 4Q4AB 1Z2CA 1B14A 4L74A 4LJ4A 3PUHA 5AIAA 2JKYA 1Q7RA 2ZJ3A 1DDGA 3FLBA 5A6SA 3RADC 3V7YA 3MJCA 3ZD7A 1SUWA 3DMRA 3WQHA 4MGYR 3LYLA 1FLVA 1TH5A 1P4GA 3B7WA 5DTEA 2O8BA 3RS3A 5J23A 1MXFA 1KYIA 5TGTA 3UCFA 3GJ3A 2XUQA 1W44A 1TRKA 4N6GA 1Q19A 4PO3X 2Q7DA 2H1IA 1FZQA 1G1MA 5KS2A 1UAYA 2A0YA 3MW8A 3EDRA 1Y34E 1X8XA 2WAYA 3ESQA 3LWNA 4X20A 5EPOA 1TJ3A 3RGWS 3S1AA 4BMDA 3W6OA 4NQRA 4KN6A 1GGNA 4OHYA 5KC8A 1YR2A 4MYHA 2R751 2BT4A 3I0ZA 2WP0C 2FQ1A 4M76B 4S1OA 4XCVA 5H1YA 4AS3A 1NR5A 4HJXA 4QREA 3SSOA 3ZZ0A 2WJGA 2Q9AA 4AJ9A 3K5IA 3VU9B 1EFKA 2P2LA 4AB1A 1CHDA 3USCS 3WGMA 3W8RA 2F7SA 5C46F 2IYQA 4KFUA 4TMKA 1SCUA 2OD2A 5J5CA 1EUDB 5JC1A 1KEVA 5IARA 3GUZA 4B5KA 3AM5A 5DLDA 1OYVA 3X1WA 1MOPA 3PE3A 2AFIA 2RG7A 2OHXA 1PF7E 3FPJA 1SHTX 5IG2A 3HCWA 4PGAA 1ZCZA 1KBZA 3BD7A 3GROA 4V03A 4C4ZA 3N58A 4JXJA 3FR8A 4OJMX 4R1TA 2CLDX 2PT5A 2YQ5A 4LNAA 1DQYA 3UJNA 2Q28A 4UHHA 1O0CA 4R1MA 2F3QA 3EUWA 4IX1A 4X1YA 1R4ZA 3VNUA 1SEPA 1R8JA 2PTHA 5J2TF 1IONA 1JA0A 3HDVA 3WWCA 5KBYA 1CZRA 4U7WA 3NTQA 1WPXA 4FFDA 2O8CA 3AUKA 4P5DA 1EJ2A 3TRHA 5BWNA 4POAA 1VKRA 3A2NA 3H5OA 1N2BA 3L6DA 4GPZA 1REQB 1XLVA 4NS4A 2IQIA 3IEPA 4PHGA 4RSRA 1ULAA 3RIMA 1ECLA 3EPRA 4L72A 4N39A 4GP7A 4FILA 3GLGB 4C6TB 2LGJA 3E3MA 3ZWXA 1U1FA 1YI1A 2J1LA 3KBOA 4B79A 2O5CA 3SR4A 4A3SA 2Q50A 3BE8A 3Q15C 4BNHA 3K9FC 2WJ6A 2CZQA 3DHWC 3RBAA 5E6UA 3N07A 5LNK6 3PNYA 2H57A 3EF1A 4FMBB 4HYYA 1XRCA 3CT6A 3ID6C 1CP3A 5L3RA 3ZI4A 2WHPB 2JIOA 2IZ0A 6Q21A 3A6HA 3DNMA 1P80A 1WHSA 1Y7LA 4OBXA 1BE8A 4ND4A 4RADA 4LHYA 1E2NA 3ZV7A 1YVEI 3JR7A 3CRNA 5I7SA 4LQDA 5HUHA 4Q16A 3OUTA 2OB1A 3VJKA 2VJOA 4BKRA 1XKLA 1HNNA 3K53A 1RWXA 4NNPA 1E9AA 3WRYA 3AQ4A 3TZ6A 2CNWA 4MINA 5KJ1A 2Q5OA 2WQZA 1F9EA 3P4XA 4IDHA 3PICA 2Q6TA 4OATA 3S0JA 1YZNA 1YQDA 4Q7QA 4PZLA 2A9JA 2W8BB 1W6UA 2PSJA 2YIDA 3E5RA 4WFJA 4PYJA 3U7EB 3G2LA 2I8CA 5DP1A 2JBHA 4CV1A 1ESMA 1KPHA 1XWWA 3GQVA 2RB4A 2WAAA 3AJEA 2GN6A 1US8A 3K9GA 3PXUA 4HRVA 2V3CC 4QGBA 1XRRA 2F9FA 3GGCA 2HU2A 3GCXA 2MINA 4YCSA 3GL9A 3LCCA 3G0HA 3H1TA 4QPNA 1KNQA 4B3GA 3I4CA 1TQHA 2HDWA 1IWPB 1CNMA 5LQRA 1RXUA 3QPAA 4M9RA 5EUQB 5JH7B 5CA0F 3L7MA 4EZBA 2A9VA 2Z6AA 2MOKA 2B8EA 1G20A 4B46A 1FUGA 3JAMD 3KZVA 4QRHA 4KNVA 1DEHA 4HGNA 2AYXA 4JYPA 3U1TA 1QVRA 2WKQA 2J3MA 2WT8A 4G1MB 1OR8A 5EE1A 2HZBA 1XTZA 4NBWA 3JWGA 4U2FA 3RYFA 4EHBA 3UFBA 1EWYA 3SZGA 2G9ZA 1KQGA 1JHMA 1ATIA 3O8CA 4MUKA 4C4YA 3AR7A 4NXMB 1G9XA 1WDTA 2ODPA 3O38A 4LYDA 5A4KA 1B73A 3STVA 4O2RA 2O06A 1PWZA 2A84A 1C7ZA 1HH2P 5JSUA 5LSAA 5T4BA 1PU2A 1GKIA 1IATA 4WNAA 1RPZA 1I4OA 2CXRA 2OCIA 3N8HA 3OD5A 4I2VA 5IVDA 1HH4A 2CW5A 3ND6A 4DG9A 3O9MA 4DWJA 3ZZMA 3HBMA 5IUJC 2ZTVA 1EWKA 1JDJA 2V59A 2Q6VA 1NVXQ 1C8VB 1Y3HA 2MMAB 3OZSA 2NP6A 3O8BA 5K0LA 3X0DA 1F8GA 4HVCA 5AI0A 3IAM1 3UHAA 4B3FX 2FSVA 4C22A 4MV4A 4QBHA 3BGIA 3F7TA 4TLBA 3OO0A 3N2NA 4BFVA 4XGKA 4RLSA 1X1CA 4EYGA 3BD6A 2IVFA 3IAUA 3EOZA 2A94A 1MW8X 3L6RA 1F2DA 1DEOA 3F8TA 3QPWA 2HM7A 3F97A 1ZHFA 3N8GA 1SCIA 2J59A 1TU4A 3EZ7A 5FDFA 1L4HA 3Q8MA 4HPXB 1MQ8B 1DUSA 1YR9A 4C4SA 2X2FA 3ED1A 3OA2A 2WSIA 5D87A 1M7BA 2F9MA 3GZJA 4UTZA 4BN4A 5KYWA 1CJUC 3I92A 3PNBA 1KHTA 4LW8A 5JZMA 2OKGA 1JDSA 5EAIA 3IP1A 2VHCA 1R3DA 3OTOC 2M6SA 5A02A 1NYLA 5MN4A 1GKLA 2DY0A 4QOJA 1KQFA 2YJZA 4WKOA 3HE3A 3ZDYB 3A2LA 4C14A 221PA 5EWLB 3R76A 3DXXA 3V2HA 3EEOA 2GTHA 1G9TA 2X1LA 3O1LA 4PQFA 2W6CX 4QPZA 4G0PA 3VR0A 2HN9A 2YMQA 3HU3A 4EB0A 3AOGA 4UUNA 3DZDA 2CB9A 1UQRA 4IOLA 3UJ6A 2LE0A 3TTYA 3U44A 3GCZA 3IEUA 2A5JA 1SOWA 4KQGA 4QVGA 1Z26A 4Z0HO 2WMNB 3ZNQA 5KYNA 1HYGA 3QYAA 1HO3A 5K3CA 4P35A 3K9BA 5IYZA 4XW2A 3AF4A 4O4IB 4HWTA 5FXMA 4FZ3A 3EGDB 5U4XA 3DBVO 1HG1A 1HT2E 3FETA 2ZP1A 3LNCA 3QE3A 4IIJA 4OD0A 3DE0X 3JQAA 5JDCA 3N75A 1G7CA 3AI2A 4H4EA 1XDWA 3GPBA 4HPJB 1RC8A 1IUKA 3F3MA 4FYIA 2C3PA 4XRRA 2W2QA 3IV6A 1JJAA 1Z74A 3WGJA 4A8PA 5JS7A 1C4XA 1II8A 5B55A 1QRUA 1R8QA 2QR2A 3TFWA 1E18A 1AIPA 4MWSA 3RAPR 1L4LA 5AKIA 4M98A 3L8MA 1K9VF 4ARZA 2NVUB 1RD4A 3U4AA 4WZBB 3UYKA 5KSZA 1SVUA 1KDZA 2R47A 2GTPA 3N0XA 1H2WA 3CEPB 3BUSA 1W35A 3K2EA 4QJIA 1JB1A 3UPTA 2UDPA 3VR2D 2FR1A 3AH8A 3Q8XB 1I7QB 1DPGA 2EF0A 3ENZA 3ZV4A 4DV5C 3SQNA 3TNLA 2WE7A 1Z6ZA 2DFKB 4ZD6A 2GJ4A 2X0RA 4BSZA 4ETIA 1O4VA 3NT2A 2QYOA 4G3XA 3M7IA 4CUKA 4KNYA 2ZJAA 4ZCQA 5C3MA 2GFQA 4KPEC 4AU1A 3AFMA 4ZVUA 2E8EA 4I66A 3D7KA 4FXPA 2J3LA 3PXAA 3C7DB 4ZQEA 1ZQ9A 1IXZA 1TB4A 1RADA 4CL8A 1Z63A 4MS3A 5LQMA 3QVOA 4OHXA 4LNHA 2NV6A 3LLVA 1YCFA 4U5QA 1R5BA 4QJ4A 2CUNA 2ZIVB 1XYVA 5KDDA 4S2EA 2CDNA 1ZJ5A 1E6MA 2GO7A 3H05A 3QXSA 3VRHA 3VOBA 3KSZO 4HXFB 1LTHR 2BSAA 2IPOA 3VNAA 3TAXA 2B7LA 2ZS9A 4WKPA 4BB5A 3H5VA 3WL3A 4ONEA 1C81A 2JRLA 1M9NA 3KQUA 3NBUA 1O6ZA 4J2HA 1E20A 2F1JA 1Z6TA 1YU6A 2PKWA 1RBYA 3M6WA 4HYEA 1H8HD 2WWHA 3F5DA 4A10A 1LSOA 5DTJA 4NDZA 4AECA 2OLJA 1NQOA 4PLGA 3KT6A 2Q1YA 1GXSB 4WXPA 4ES6A 2CYBA 3EASA 5KNCA 3K2BA 4TV8B 2XQFA 3VDQA 1JSRA 3QBJA 4I6GA 1OB2A 3KKKA 3DOIA 3G7SA 4S2UA 1BJTA 1RYYA 5AK3A 2PLAA 4F04A 5FI5A 5HIKA 5LD2B 1KYZA 4LA4A 1KQ3A 3RFXA 5C5DA 1UBRS 5IM4F 2XEXA 4UHEA 5ARCA 1ORHA 3KAKA 4OHCA 5TF4A 3EAGA 4NPHA 2IUYA 4TL9A 1A9PA 1KK0A 3ISTA 3TXXA 2QXYA 1OD6A 4FYXA 3GLGE 3QUSA 4P3OA 3K8QA 4CVNA 4NBRA 2HYDA 3FPSA 5DLPA 1FUKA 2L0XA 2QAGB 3W5IA 4EELA 3NAGA 1WG8A 1YZQA 1ZY2A 1E6CA 1ECPA 1F4VA 2FOIA 2GVNA 3IESA 3OF2A 4DZRA 4Q0MA 1SBCA 1DBIA 2V03A 3QE2A 4IMJB 1NVVR 1YC5A 1XR3A 4L2ZA 4HDSA 2HIMA 4NEGA 4NR0A 5DE3A 5FUBA 5HCUA 3VR3D 4BO7A 4R3UC 5CLQA 1WOYA 3DV0A 3B2NA 4DA4A 2ZAGA 1TCVA 5I7EA 2YJ4A 4BTLA 3EC2A 4X7BA 1Q92A 2BC9A 4B3SC 2NU7A 2D1QA 2ZSFA 3MC1A 1XNRB 4HTFB 2OG2A 1X6VA 1CD5A 4DPKA 2DHQA 4M0PA 4XM2A 3C2QA 1ACLA 2M6LA 2DU8A 1WPRA 5T6BA 1J07A 5FBLB 2PX5A 4RTLA 1MB9A 2A7QA 1ZCBA 3KFVA 3IUJA 4RIHA 5FFFA 4TPSB 4G5YA 3UO8B 5ICEA 1OZFA 2AMLA 3I9FA 3G8BA 1CY6A 2IGBA 4MDFA 3AXSA 1QAMA 1DX9A 2FW1A 1Z5VA 2ISSD 3O26A 3PC7A 2ZYHA 4BUZA 4FB5A 3NTOA 1EQ2A 3TCKA 1XD2A 2VI5A 4QQFA 2I67A 2JIQA 3HJUA 3IPYA 4I1SA 4LMBA 5FV4A 1K2WA 3ZI0A 1U7HA 2I22A 1Y6FA 3T5GA 3R20A 1KFEB 3B3AA 1EZZA 1F0PA 3C0KA 3KTAA 1A7KA 4ID3A 2R8RA 3DS8A 4JI1B 4RY8A 3W5JA 3YASA 2ONZA 4DCGA 1WXEA 2DAPA 4HQFA 4DUYC 1LH0A 1OA1A 5HOQA 5KVCA 1FSFA 3NKFA 2NXWA 3I2JA 5DX8A 1T8PA 3ET5A 4BB9A 2IHZA 4TWZA 5A9SB 2FW0A 3K9CA 1UODA 4G5HA 1D4OA 1EE2A 2VBIA 5BR4A 2R6GA 1DXYA 1ADJA 1UDRA 2IWHA 1QHHA 4OHZA 3I2YX 5LQKA 4B47A 2Y1OA 4I8XA 4S0ZA 4F9EA 4B2LA 3UA4A 4LZOA 2QLJA 3QBTA 4NVRA 1JIVA 2CXOA 2PH5A 4HQ0A 4OCZA 3TW4A 1UBUS 3K0SA 3H42B 2AZMA 1WEKA 2BDTA 621PA 3PGVA 3KKLA 3TKAA 4R0MA 1U80A 2G7ZA 2JHFA 3DBOB 3BMQA 1AZWA 3QUAA 2C7QA 2R1TB 1UK8A 3SLKA 3T4EA 1VHJA 1K3FA 3K6KA 2ZGVA 1NBIA 1FOEB 3RS8A 3F6EX 4O4LF 2OHVA 3VSEA 4EJSB 5JJIA 2IYYA 2PTGA 1ZDMA 3OC6A 4F56A 4ZGBA 2AFHA 1Z2DA 2QV0A 1ZN2A 4EG7A 1JDTA 3CSDA 3OOHA 5ITZB 1H1DA 1NX6A 3DEFA 1X7XB 1KMNA 1ONPA 1XTKA 1ZB9A 1XSEA 4MKHA 3QKWA 4I1YA 4NPCA 5EJFA 4F5YA 5CD1A 1Y6GA 3LQ4A 3OIFA 2RC5A 5KO2A 4JIGA 2YZMA 4XIFA 2V7GA 3V1KA 3B2QA 2B7BA 3BJEA 4P4SB 4KUHA 3HL0A 4NEQA 1U99A 3LNTA 1CFJA 3FYHA 1JHYA 1U1EA 1I3OA 1ZAYA 3UK7A 3NNSA 4FPXA 1KI7A 4WDRA 3QW4B 4YRBA 1EVIA 1G21B 4JOSA 1Z4MA 4ZAZA 1RJEA 1LI5A 2A35A 2B4AA 2DCMA 4X54A 3QXHA 3EDQA 3DFKA 3SPXA 4P4TA 2ZVQX 4B4KA 4I4IA 4DQKA 3AL0C 4I1IA 3AP1A 2B6HA 1YDHA 2ZYUX 3H2YA 4M0FA 1LQTA 2V7BA 1V4VA 3F7NA 4ZARA 1FVOA 2G6TA 1V3UA 3CUUA 3HU2A 4RDCA 1M0TA 3G0CA 4WOJA 5ILQA 4P7KA 2O2SA 5KDLA 3URKA 5BRJA 1EE1A 2ENWA 4TN1A 5D51S 3B6KA 1Y8QA 1KI6A 2H9IA 2PR7A 3Q3VA 2OBBA 4L8VA 1XMIA 2Q5IA 4JVLA 3WK4A 3RRMA 3PVSA 3O8NA 2X6QA 3BEOA 1PDVA 3ZWYA 2YW2A 3H5AA 1V1MB 4R2KA 3I8XA 4PX9A 4PG8A 1PR3A 3I30X 5AVVA 2HSGA 4O29A 1YZ3A 3EGXA 4M1YA 1K5HA 1AUVA 1WABA 1T9GR 2XYVA 3JX9A 2H54A 3LHSA 3T7CA 2X7JA 5IXSA 3U0BA 2ZK7A 4D9BA 1D6MA 3IAFA 3FN4A 2CMDA 4K87A 1N7IA 2CYCA 2X7XA 1M7GA 3ENWA 4MDEA 4JLJA 3OZRA 3C8HA 2PK3A 1PQUA 5DBEX 4ZXFA 4UTVA 4M3NA 2R86A 2WJHA 4TL8A 4WZBE 2FA9A 4B8YA 1Q1AA 4EBBA 4UVGA 2AK3A 4M8LA 4B6JA 2X0JA 1Z0AA 1K7EB 4FFBA 3JATA 4N0QA 3ZUGA 2XVZA 3ZXYA 5KOJA 3L8DA 4U7HA 3PV0A 1ZNQO 1JOSA 1IZZA 4JASB 2PCLA 3DXFA 2E87A 3EOAI 1RRFA 3F6CA 1Q0PA 2PLWA 4PZYA 1KY5A 4ZU6X 1AX9A 2E85A 3OI7A 1EESA 1BOOA 1Y5MA 2NU9A 3N8DA 2P3QA 5IFKA 4LC9A 1P9OA 1C0IA 2XSZA 3TW8B 3FUVA 3I1IA 2ZSIA 2B1JA 1H6AA 1XUOA 4KRGA 3CYFA 1CEXA 4MK4A 3DT8A 1F0YA 4P93A 4X71A 4RFSB 3PXGA 2LRHA 4NXMC 1OIWA 1VDZA 2ZYWX 3IEMA 1LJ8A 5LZ9A 2JLXA 3FLAA 1M0WA 3IQDB 4HHEA 4BRUA 3QKIA 3JVVA 1JVSA 2R97A 4ZRMA 3KQVA 2C04A 1Z35A 4MI1A 3PTLA 4ZHQA 3H97A 1L9XA 3PT5A 4L7VA 1GZ4A 3I28A 1OTHA 2I9PA 1O77A 1P4HA 4HUTA 3HCAA 5B36A 2AR0A 1E69A 4YP5A 2XB2A 3CZ4A 2WM2A 1I7NA 1H2RS 2J3DA 1DRVA 4H1VA 3KOXA 4YJ2F 1UJ2A 3BXFA 5GQSA 4KBYA 1C0LA 4B31A 3GDOA 4G4JA 4KXUA 3IQHX 1GRRA 1UK6A 4LJ5A 3S7TA 5D00A 3UT5A 3LYHA 2ZBEA 4KJZA 2GZMA 1BNCA 1V7QA 3T4PA 1QM5A 1CZHA 2FSFA 1XTBA 1LI7A 3HCEA 1D2GA 3L3BA 3PQ3A 2AUMA 3SQWA 4FDAA 2GJ8A 1D6SA 3ZK7A 3AW9A 3AUJB 3IE2A 3GHYA 4ZVPA 4OI4A 1PJCA 4MJ3A 3TWOA 5IXYA 3K6JA 4JODA 3UHJA 4TM8A 1DJNA 4DCTA 5DM4A 1P7WA 5FWXA 1MO3A 1L5WA 1CE8A 4QBTA 2QN1A 1PE0A 2EL9A 3SC2B 1L7OA 3CT4A 2FPKA 3FOAA 1FNBA 3D4LA 3B6JA 2HF7A 4RIEA 1GPUA 2GNAA 3AL2A 1NN1A 3B1FA 5EP1A 3MJRA 2Q4DA 3FGOA 4K46A 1KSJA 3GC6A 3SQOA 5L4LA 5CDSA 1N5RA 5FLXD 3EARA 1OAOA 1P1KA 1QU2A 1MQSA 1N32B 3UMYA 4H0NA 1TM3E 3M5WA 3WA6A 4LV5B 3COYA 2Q9BA 3MJEA 4D9EA 4S04A 3DTVA 1QOQB 2BEWB 3D6JA 3E84A 4IICA 4NP6A 3WJ1A 5J2TB 1JX6A 2PQ6A 2VK1A 2B30A 3TVYA 3JAWA 2ADFA 4LK2A 1HYHA 3DYIA 5FULA 4BJ5A 3FSEA 5TQ0B 5H5JA 4ZYWA 4N76A 1AS2A 3QHQA 4ISBA 1QANA 2AW5A 3FYUA 4ZJYA 2EW1A 3B70A 3SNKA 3EFEA 4I9FA 3R9XB 1IFXA 2WZDA 4KMOA 3DF7A 2ZSJA 1HE1C 3CO5A 3H5TA 1FLDA 3AUFA 3GK3A 3K7EA 5EIEA 3FNQA 3GBVA 3LMKA 1YVUA 3AEQB 4PRYA 4MS1A 3RK4A 4CTOA 1RMYA 4ZI7F 5BMVA 3U4QA 3NASA 3DW1X 3UAXA 1G8HA 3BXHA 2G77B 5G1PA 1EH5A 2VJLA 2ZFUA 3UW3A 2FVYA 1T8SA 2N3ZA 3ZLUA 1PJTA 4Y2YA 4JEUA 4O8ZA 1BX1A 5IKMA 1O94A 1EMDA 2XR1A 3B89A 4R2LA 4Z51A 4HZUA 1YRLA 5JNSA 3E0XA 2PWZA 4KGDA 2ZBQA 1OC4A 4A0QA 3QVWA 1G63A 2WD7A 1AZLA 2Y1EA 1SG9A 3EGOA 1MA3A 1AHHA 4MGZR 3RJZA 5ARDA 4EHFA 4HK4A 4UPDA 3O9VA 1AGNA 1ADBA 3S8MA 1GAJA 3BREA 4TPKA 1Z2NX 3X2EA 2L2QA 2JNWA 1ESDA 3ETGA 3T9BA 4CKBB 3MXOA 4PLTA 3RS2A 1E89A 1YJ5A 3M5PA 4HUQB 1WUYA 4HYTA 4D9KA 5LOVF 2SKCA 1Q17A 1C41A 2FPSA 4O1HA 3WYAA 1W5FA 3V1YA 1IIRA 1Q1ZA 5REQB 4ZVNA 3D0RA 1U3VA 3FPCA 1D7AA 1ZISA 2GXQA 5DSZA 1RHQA 4WLUA 1ZOIA 2POQX 1C9DB 3R3JA 1GQOA 2VLIA 4PYLA 1CUIA 1QHSA 3PR2B 1E79D 2RBKA 5GV8A 5LA6A 4DV3B 1KP9A 3WL7A 2W42A 5TMBA 3IURA 2ZSDA 4EG6A 2XDQA 4P3PA 4ZMBA 1W8IA 3DMNA 2J85A 4UDYX 1P5ZB 2Y8EA 2QX6A 3L0YA 1MC1A 1WF6A 1J22A 3EIOA 2XCTB 2EG9A 4YQZA 1HQDA 1JNYA 1MD9A 2ZU0C 1J9GA 1QQ7A 1X2EA 2JJ8A 4K6MA 3G2OA 4MVXA 1P1BA 1K98A 2RBGA 3UTDA 1S0UA 5BR8B 4BC9A 3IAEA 2UU9C 5LD2C 2ZBDA 2Z2ZA 1IZ8A 4G8JA 4DC0A 2G5GX 1JWLA 3H3FA 3PU6A 2D5LA 2EARA 3CJRA 4C7JA 1T91A 1P0QA 3CW8X 3TI7A 5A0TA 1U2PA 1PYGA 2VJAA 3H2TA 2OAGA 4M8SA 4RHUA 1UDWA 1PL0A 3MXTA 2NW6A 1RQNA 2FPIB 2ZUSA 3COPA 3L8YA 4BE4A 1G21E 3MWLA 4CMEC 1P6QA 1DAGA 2GBIA 5KKAA 1HY3A 2QAGC 2R5WA 3V5NA 1EVYA 3HEMA 1ISSA 3D6HA 3U7QB 1VGVA 4CDMA 1QIKA 2QX4A 4N0PA 1TF2A 3N74A 3ZCSA 2C5HA 1WKVA 5J1SB 1W6RA 4CM9D 3KHSA 3H11A 2XOEA 3KDAA 4JBLA 5GIOE 1LDMA 3RFFA 2OFFA 2VTBB 3HJBA 3KJFA 2ZBRA 1A72A 1R6AA 1Z22A 3I2GA 1G3IA 3NRBA 3QA9A 5LZ7A 4X9XA 1PLKA 1GYPA 2O50A 1SOUA 4P38A 5T8KA 2WC1A 4D42A 1VI2A 4O08A 3TQHA 1WLYA 2ICAA 1FX1A 2X5XA 2ONKA 2CBGA 4FINA 1FDSA 3SZOA 4UEWA 2JAPA 4EPWA 1JLHA 3L9XA 1OKKA 4MR8A 2HF2A 4YMGA 5E3IA 5H0IA 2NTNA 5AW0A 4ARCA 1S3FA 1E6EA 1YASA 2AX4A 3T0FA 3I6QA 3WNDA 5HR5A 1NF3A 5BN4B 3TR6A 5HRCA 1XCOA 1V8PA 1JLKA 1O89A 1V7CA 1OFGA 1YOVA 1CY8A 2C4MA 3CKYA 3TXAA 3W2FA 2VWQA 3QVTA 5FWNA 2XGGA 1AQJA 3VNRA 1C29B 1ODFA 3KVOA 1CUGA 4UU0A 4W6QA 5EUMA 3LCUA 4DG5A 1BROA 3V4FA 1XHLA 3OC0A 3NWJA 2IUSA 3DM9B 3RUIA 4TRRA 2I6SA 3R1IA 3PUYA 3H1AA 4GI5A 5F7JA 1CUSA 1M6EX 1NBMD 3L5OA 2WZQA 4JI1C 2FFBA 5CVCA 1M83A 3D8UA 4FJ0A 3ZHYA 3CW9A 4FEAA 4X8HA 5TMDA 1DQZA 1ABFA 1W19A 3EWNA 2RAFA 3K8YA 3KD3A 2ZAIA 1WCXA 3KZCA 4NYIR 5AI5A 3G9QA 5JASA 4R2JA 1BDBA 2AD1A 2JA2A 1XEXA 2TMGA 2ZRHA 1DBQA 1ZD9A 3DMPA 3HYCA 3KU1A 3OQVA 4GDMA 3ZR4B 2PUEA 1G5RA 3CUYA 4FYKA 3OCCA 5AMXA 5BQ5A 2O1SA 2PYIA 5BV8A 4YV2A 2ID4A 1MORA 5EIBC 2BF7A 4W8GA 3WV4A 3ITEA 5JUWA 3L7NA 3DHVA 1QRDA 1UQUA 4WLVA 1M3SA 2DEUA 1Z06A 1XTTA 1OFVA 1U9ZA 3DD1A 1RYDA 2BEVA 3AEYA 2Z9DA 1I1OA 3C24A 3JZFA 1LPMA 2WIGA 1JMYA 4L4ZA 2IU0A 3L7BA 4A5SA 5C4MA 4O4LB 1LLCA 1ZK4A 4O02B 3B48A 5E9JA 4XVCA 2UYHA 3DJYA 4US0R 4XCXA 4ZVVA 1MC4A 2ZJZA 3WXBA 1Q57A 1T25A 1RLUA 1RTTA 1XO1A 1GL7A 4DIOA 3GA0A 3T99A 1MXHA 4ND2A 4DR5C 4EAAA 3LY7A 4JLSA 4XUGB 3D1LA 1TUEA 5KWJA 1M6VA 1A82A 1TEXA 1ZEJA 2W6ZA 5LXTA 1DEXA 3L7KA 3WVNA 3VJRA 3H65A 3NVAA 3KZMA 4LBZA 5F77A 1XU9A 5D86A 1ACJA 3RSSA 1ZQ1A 3H1PA 4BFCA 4BCDA 1B8VA 5AHWA 2VNAA 5I7UA 3SBXA 4P33A 3UK2A 1PDWA 5HK9A 3M2TA 4LK3A 1NBOA 4NBTA 1XA0A 1P0IA 5LYJB 4ALJA 4Z7OB 2W6JD 4Y2TA 1EK5A 2RGUA 4DJTA 4M0LA 2X0FA 5AIBA 3RG2A 1OZ0A 4RPCA 3E61A 4CN8A 4N8EA 1VLHA 1KKMA 1MAAA 1ZNYA 4M37A 4WZ6A 3Q98A 2E0IA 4M86A 2G80A 3VGJA 5JQGB 2GXAA 4G0UA 4BO2A 3O94A 4TLDA 5CZXA 3DF9A 5BSMA 2OHGA 4X95A 4JB8A 2HZ7A 1QFSA 2YVAA 1D0SA 4X1OA 2GDZA 4AJLA 3MT9A 3ZG6A 3ZWOA 2CCJA 2J9ZB 2ZWAA 3MNFA 4ZCMA 3FNBA 1FXWF 1VHQA 4FMCF 5M2QA 3UXEA 1UPFA 2ZR9A 4JJAA 1TT5B 5IMSA 4LECA 2ZB3A 4U3JA 4CL0A 3F98A 1AKMA 4BMSA 2ZZNA 3AI7A 4NC9A 4C7OA 3IE1A 1JAHA 3OOJA 3JRWA 3SOPA 5G2OA 5A5VA 4DUGD 2AJTA 1HPLA 2GHIA 3ADPA 4EL5A 1DO2A 1KJQA 2DHDA 4CU5A 2A0XA 2YASA 5DXFA 2CLHB 1EM8B 3C1UA 4HFRA 2QRNA 4DLWA 3B7PA 3DEHA 3HUDA 3AHJA 2PKQO 3OFVA 3HXTA 2FPXA 3AR4A 4V0KA 1F1BA 3CTPA 1JPUA 2A2ZA 1I2BA 1OXSC 4DQXA 2KZ0A 1IDN1 1FMLA 1ZM4A 3A4VA 3DQPA 3LZ6A 1GOTA 1NQWA 1R4NB 3MIIA 4AYTA 4PZ0A 3VI3B 3IQGX 2YWGA 1SKYB 3WP0A 3CLRC 5EZYB 3AL3A 3ZGVA 1DCFA 1FDUA 3A1SA 2ZRBA 4AP5A 5H16A 1NR7A 1EX9A 2L82A 1SKUA 3TR0A 4AFNA 4C2BA 2BM8A 1MN6A 1MW9X 1WHTB 1O5OA 3N1UA 1RR6A 2YWEA 1Z38A 1J2RA 1G8GA 2FW6A 1A8UA 1GG9A 2PUWA 2JCYA 4GLOA 4RU1A 4FN5A 4ZEMA 4FC6A 1D7OA 1ZINA 1G19A 5IJZA 5KPJA 5CVVA 2Q3CA 1N2EA 3SX4A 2HU8A 3K73O 3NHMA 3O5AA 2IOFA 1YA8A 5LKAA 4KO3S 2AG8A 2HDNB 1TK9A 3PUIA 1PZHA 3D59A 4YJ2B 1XF9A 3CWCA 4IDCA 1Z6QA 4DLVA 1KK2A 3S8EA 5IS2A 3EPHA 4E4YA 3VAAA 3A8TA 1I4EB 2PD3A 1NW6A 4NCHA 5AK6A 3TMAA 2I78A 1EA5A 5JY6A 2GBFA 4QYSA 2WAXA 4DQLA 1WD7A 2QROA 1IUOA 3A11A 5BVHA 1AA9A 3FLMA 3PNPA 5AW5A 4M22A 2HUNA 3KQLA 4PYMA 1AZSC 5IHPA 1C8KA 3UHOA 3LDUA 4ECAA 4A8JA 1FA9A 2AOTB 1IZ9A 3QYJA 1VI6A 4DIEA 5IPFA 2K5UA 2YV2A 4DEXA 4XX0A 4JROA 2RD2A 3LU1A 3EN0A 2O20A 1M2OA 2C0QA 3EUAA 4HMPA 4KE7A 4TYQA 4BWFB 4NONA 4NZPA 1WB5A 1YBMA 1LSJA 4JGGA 4ROTA 3VAZA 4OJTA 3U31A 4LE2A 1KYYA 2Q3DA 4I46A 4ODIA 1RKXA 1DMRA 2RBEA 4JBIA 2PZJA 2BFOA 1YZVA 2VOJA 2VH1A 3PNSA 4YRDA 2YYYA 1YAHA 3KUDA 3D7MA 2QRMA 2E0GA 4R68A 4I5GA 4EW2A 1N32C 1E5XA 1FEZA 1ZXBA 2UVPA 1XNRC 1QIMA 4F45A 1MX5A 2NTVA 3H4VA 4DCMA 2WOJA 2SKEA 2ZBPA 1OWNA 3ZK8A 4X8MA 3RIXA 3BK7A 5FWAA 3R7WA 3IXMA 4G8CA 2G0TA 3L77A 5FFMA 4F97A 2P3OA 5HTKA 3QZUA 4Y6OA 3HO8A 4Z5XA 1AD2A 4DJJA 3T41A 3KEFA 3K6SB 3SXUB 4WERA 3GEEA 4FGWA 1MG5A 3DE5X 1UK9A 1LBSA 1MVLA 3HP1A 2P67A 2YDYA 1M33A 2A0FA 1WMDA 4LHSA 1OV4A 4ZI7B 2JVIA 2D0OB 3HPRA 3OCYA 1JUDA 1CR6A 3E18A 2VJBA 3MT8A 1E1YA 1FVXA 2NO7A 4FSXA 4TSKA 1JE0A 2PUBA 3RM3A 4MRPA 5CDGA 2XZTA 3D64A 3ZY3A 3ZGOA 4NYJQ 1V4NA 2XEDA 3EVFA 1TYBE 2R1VA 4I1OA 3T38A 2HHHB 1OXTA 1YV9A 2VZ0A 1RZRD 3WBKA 4D8TA 2KYRA 3RJ9A 1KE1A 5L7TA 4QUHA 3OZUA 3B9BA 1ND5A 1O6GA 2QTAA 2WTXA 4C0HA 4NCAA 1PQPA 4MCIA 2RJNA 2BMDA 5F5XA 1DAEA 1SEVA 2JEYA 3ZHVA 4Z7NB 4KN8A 1KO7A 4MZDA 3FMPB 4C29A 5AICA 1LVGA 2ZTHA 2NU8A 1OLXB 1A9SA 2X5OA 2NTEA 4ZDIA 1VPLA 2HCFA 3MWJA 1RCUA 2QXTA 3DYBA 7GPBA 4G1EB 1YMVA 3N7AA 1QH8B 2NXJA 4H7HA 3PUJA 2VHZA 2J9GA 3DGFC 1WDWB 1V9LA 3DMFA 3EQ2A 4FHCA 5LOVB 2GBLC 3BILA 3MUEA 3GJRA 3LIIA 3QBVA 1YO6A 4B32A 2EBHX 5EE3A 1E92A 1JQKA 1OVGA 2JGDA 1DS6A 3TMKA 2IYRA 4P0TA 3EX7C 2Q4OA 4ZTUB 4I81A 2OCBA 3CH6A 1S3GA 3P4UA 4IS3A 1LNZA 5I4BA 2XMPA 1E3JA 3A3YA 4OJNA 3ML1A 4NJMA 1ZK2A 5IN5A 1YJ7A 1U3FA 1Z7GA 3BB4A 2G1UA 4TXHA 3REQA 4Q4DA 1AVTA 1M8PA 2O2JA 3TTUA 4BO9A 4UDXX 2Z04A 5A4MS 4IL5A 5FAKA 5I7VA 5DB4A 1PWYE 4PHFA 4DV3C 1ODCA 5COAA 1CS4C 1ULTA 3MWDA 4DSAA 1C9EA 5F51A 3ROEA 4EATA 2RGWA 1DG1G 4NENB 2DBRA 5MGBA 3TFQA 2KE5A 2P2GA 2A5GA 4EW1A 4LRTB 3NHRA 3S68A 2CY0A 16PKA 3E9EA 3GA5A 5H9VA 3ZH2A 2WG0A 4HGYA 4ED9A 4XWOA 5IJ9B 3WB0A 5KB3A 3JY6A 1JMKC 3KPUA 2PZBA 4QASA 5JHHB 2GA8A 5BR8C 1LJLA 1RIFA 3PDCA 1K68A 3ZH9B 4ZYVA 1WSAA 1Y4UA 3LQYA 4GZ6A 3HWRA 2DHMA 3OMLA 3I6IA 1CV2A 1ZN9A 2VAWA 3QVSA 4KV7A 4N82A 4ZVSA 3GAZA 1PJLA 2I6XA 1QKIA 2YWXA 1AY0A 3FWNA 4LV6A 5MN5A 4Z4QA 1ML4A 4ZYTA 1PL8A 2K87A 2X14A 3GRKA 1XF1A 5JDIA 4ZPJA 1V1JA 3EPKA 4GGMX 2PR2A 3B5EA 3O91A 5LNK1 4ZZ2A 1VE6A 5ERGB 3VVMA 4YASA 4WE3A 1UPUA 4ZAFA 4N49A 3UQZA 3OX1A 2ZBVA 5H4HA 1CDEA 5CIQA 4TLLB 5CEEA 4PZDA 1U1IA 4IIFA 4KE6A 2ZTUA 5AW6A 2EBWA 2XXAB 3KEMA 1QHIA 3QLEA 2WF6A 3BOSA 2QZZA 4CCWA 5FTLA 3RLFA 2P9QA 3A9SA 1WXWA 1LRKA 2MDTA 5EP3A 1UINA 1ZI9A 4IKOA 4JP3A 5LLDA 1L4KA 3DHEA 3PQFA 5HKOA 5LMUB 1K8QA 1DAIA 2HXYA 3ZPXA 4RULA 3MS7A 1XCGB 1TZ2A 5TGDA 4QELA 5F3DA 2IIPA 3JQQA 5EMNA 2FCAA 3NHYA 4FOPA 5FL3A 1XRAA 3ABZA 1JQJC 3G79A 1U8FO 3NIDB 1KI4A 3WAKA 2EERA 1UH5A 4DILA 2IYWA 2AN1A 2NO9A 4HNTA 1BCSB 1AV6A 5CVDA 1K6EA 1MNAA 1R10A 1Z6GA 2ZWVA 4TS4A 3P20A 5I5GA 2HRCA 3W0LB 3IP5A 4JI5C 1LF0A 3KYDA 3SF8A 4YIKA 1OU4A 1E4YA 1I51A 1OLSB 2VXOA 2QD4A 3ZHZA 5F33A 3BL6A 1PS9A 2HMUA 1EJ0A 4LRSB 3WK6A 1P5JA 3PR1A 1ZA1A 3B52X 4XJTA 2ZM5A 3PEYA 2H59A 2VC2B 3D3QA 5AVXA 3PYLA 5FOVA 1NI3A 1U4NA 2FN9A 3OOEA 1VKNA 1BEUB 1EZ4A 1TJ4A 1A9XB 1NQTA 1RTKA 3RKRA 4EY8A 1H3EA 1Q0QA 3B9RA 3HVJA 1A1SA 4UATA 2HK9A 1UEJA 1LBIA 1WCYA 2EYQA 3L7OA 2N46A 3L0BA 2P2ZA 2OYSA 3NETA 1D6JA 3PQ4A 1OB5A 1EFUA 2RHCA 5FTJA 4KQ9A 4A1FA 2I76A 1Z82A 2WYUA 1RQ2A 1SU4A 1YCHA 3DFMA 2BJOA 4PZAA 3UJ9A 3OIUA 4A92A 3G49A 2GB4A 4B83A 1RP1A 2GPTA 5YASA 4C7VA 3FHLA 3ZU4A 4C78A 2H4WA 1JAZA 4L4RA 2ONJA 2C7RA 1XVUA 2AMJA 1BW9A 4BBZA 2W11A 3UJBA 2JCBA 4UBMA 3H87A 5IZCC 5AJHA 2VIIA 4W7IA 3SYRA 4HI0E 3WYDA 4ZI5A 5I51A 5G4KB 4P2BA 5I9IA 1VXRA 4QYXA 3CZRA 4J4TA 2FEOA 4BKQA 2C54A 1BHSA 2HHAA 3H9CA 3ADCA 1QH0A 2BTQB 2AQIA 2F67A 5LVAA 1JH9A 4G09A 3I2FA 3SHFA 1PNTA 2MYNA 4E14A 5KUTA 3F6YA 1CUAA 1MQ9A 5FIUA 3EPPA 2MMCA 3AM1A 1NOKA 1B3BA 4YJGA 1J5PA 3RRBA 1O96A 3KVRA 1R4MB 3GPCA 1LZKA 1CS0A 1Y7TA 2WVAA 4QOEA 4OHBA 1NKVA 5BVGB 2PD4A 3LOQA 3PQEA 3ELWA 5C53B 4GQBA 4OAQA 4JITA 1H6CA 1QO7A 3OKPA 4ACAA 3N6RA 4QG7A 4RVSA 3HB5X 4XUCA 4KXWA 4B33A 2IRWA 4C6RA 3BWYA 5HIMA 2ZAYA 4HWPA 2D1SA 1Z0KA 2VF7A 3NHJA 3UMGA 4Y1GA 1MHPA 1JIKA 3G2KA 5AXBA 4G1IA 1EUCB 4LVUA 3G68A 1TADA 2I87A 1SCAA 1X7WA 4IV5A 3ZHRA 2R25B 1AKYA 1TYDE 4L5JA 3PIRA 4W63A 1LBTA 4U9IS 2X1HA 3DVAB 4M8KA 2XCSB 5LIRA 2XNJA 2HO4A 1ZD3A 4YBRA 3CO0S 5EHXA 3HV0A 2II6A 2X4GA 1PVVA 3NM5A 4Z3OA 4FSHA 1TGYA 2VNKA 3RIGA 3UVEA 3HCCA 2J0EA 2QW8A 1ORIA 3EZGA 4RQTA 1DP4A 5CFOA 4IMPA 1Q0RA 3FI0A 3ETDA 3HB9A 3MEQA 3FFWA 8ADHA 1BX3A 1CRZA 2V98A 1DC5A 2NGRA 5IKEA 3RJ5A 2A9OA 3NPMA 2CFRA 4TSRA 5EZ6B 3UIEA 4YA6A 3WWEA 4OX9Y 6REQB 5F23A 1GARA 3A3NA 4FMCB 2IF2A 2M5HA 2ZB4A 1DADA 1GQRA 1ZOPA 2EKPA 2ZYRA 3CUTA 1GFIA 4L73A 4WGFA 1GHTA 3IIJA 3SZMA 1ZZGA 4QKQA 4LI3X 4PIVA 2C2YA 2ISCA 1Q2XA 1A4XA 2P6NA 2TYSB 3KSMA 3QBEA 3PGLA 4WVLA 2PFSA 4E3WA 4CLOB 4YXWD 4CV0A 1HT0A 2HKIA 1JIQA 4L6IA 1KHHA 4NCIA 3BWVA 1JI0A 1QJ4A 3GARA 3T3NA 4FT4A 1R9JA 1UOQA 2JVJA 2GEFA 1K6MA 3AFOA 3KQPA 4L1KA 4XQGA 4YCAA 4NAUA 2IY9A 4CCYB 3HH8A 3SDBA 5LDHA 2QL9A 5L3SA 1EWVA 4C2TA 2B36A 1NDUA 2PJDA 4MEAA 1H4QA 4JEMA 4B34A 1T4MA 3PC8A 4DY6A 3W5DA 4GWGA 2VJMB 2JCSA 3ETNA 4CNQA 3O92A 3EWSA 3LI2A 3CLUC 4GKVA 2GSDA 2QPAA 2R2AA 3OFND 3WL4A 3A2MA 4V2IA 5EY5B 5GOZA 3W34A 1KDPA 4QZVA 1X87A 1X8KA 2HFKA 4DIFA 4FR2A 3VHXA 4MYUA 4Q9LA 1T9KA 2QT9A 1SVKA 3CXRA 3DUFA 2C7BA 1X3SA 3I12A 2OGUA 4G9GA 5I5EA 3T5TA 3D4IA 1NT4A 4RM3A 1UMBB 5HMMA 2WTMA 5TB5A 3WIUA 1QO9A 3CC8A 4CEIB 1RY2A 2X2OA 4B81A 4FTFA 4BGVA 1RJWA 1Z39A 1ZUWA 3SO4A 2HK7A 1PWHA 5JSYA 4N9QA 1UWDA 1GSHA 3FYCA 3OHSX 2CXCA 4I1PA 3DE3X 1R2QA 1V95A 2XT9A 1XC7A 3BZUA 4U0KA 5T5QA 1TZMA 3EDCA 3X1XA 3WGIA 4CQJA 1H1TA 4EWLA 1HEYA 1QAOA 1QOZA 2EFHB 5H4GA 1DMSA 1LFDB 2AXPA 1CDDA 3EJWA 3LQ2A 3JVDA 2AEMA 1V2GA 4JC4A 3KC2A 5AK5A 3IVXA 2XT0A 1WXXA 1YJQA 4M1ZA 4D80A 4UNIA 3DAPA 1TIBA 4JCOA 4RVFA 4DR2B 2ZRQA 3IUMA 4PFJA 4NCKA 4RPHA 1JB9A 2C84A 4GS5A 2C29D 1F20A 1GPBA 4K9DA 5EZ5A 4AY2A 3BH7A 4YCJA 5K3AA 4G63A 3TX2A 3ZZNA 3UBMA 3BMNB 3M4XA 1PG5A 3D9QX 5JE8A 3H75A 4R8LA 1P0MA 1SBNE 3IJPA 4X1IB 4LRUA 2PZEA 1QRAA 2D2VA 2Y4OA 3N54B 3P9RA 2PKYX 4YMIA 3ND5A 3WSTA 1LA2A 2DP4E 4CMEA 1O8CA 5A5GA 2KLHA 3LUBA 1YCDA 1B76A 2F2TA 4WNCA 5ALHA 4BNIA 3DPSA 1PZNA 4J1NA 4BV3A 5AVSA 3UKJA 1U6JA 3GUHA 3R4CA 5DCUA 1BWSA 1GADO 5K6TA 3HVIA 4I3FA 4BRWA 1O5IA 2R65A 3WLLA 2X19A 4HQRA 4YPFA 3OFSA 1RYFA 4FDTA 3HJRA 1NVDA 4WLEA 3K0BA 4XCQA 2BYTA 1NQ5A 2ZT7A 1EM6A 1TQ4A 1H94A 3QK7A 4V0LA 3L07A 5C80A 1KO4A 1N25A 2WA2A 3D7NA 5CFNA 1OX4B 2C97A 4P1ZA 1IBKB 4FNGA 1SO8A 2BSXA 3N8IA 3PD0A 3R5HA 4Q7MB 1WW3A 5TV2A 4MPJA 3WZ2A 2V0CA 4GU5A 2NQ8A 1TAUA 2PNJA 3HXLA 2JFYA 2VQDA 1P44A 4P4GA 1FLNA 4NZ9A 2HRDA 3FTQA 3BGWA 3FCOA 4GI3A 3W9SA 1N75A 2AW3A 1N5MA 1YI0A 3D5QA 4K86A 3GP8A 2TMKA 4FYYA 4G97A 5BNFA 3I58A 3DZHA 3F7OA 3MPUA 4Z2YA 1RHKA 5KKCA 1V2HE 3K05A 2EJCA 3D02A 4OG2A 1SR8A 2A1UB 1FLOA 2HHHC 2YV5A 3QF7A 2QY9A 4AYXA 1A4RA 4XGNA 2C42A 2D1YA 3NCHA 2NTJA 1EVJA 4YMVA 5IAAA 5EJ8A 3MHTA 3RFCA 1Y6ZA 3C3DA 4MAFA 4JT8A 3LXMA 1E32A 3C14C 4HGQA 2QAIA 2P77A 5EIBD 4ZIRA 2Q7XA 2GM9A 4X7RA 2D1TA 4A0HA 1ILEA 4G0ZA 4N0EA 1JQBA 1MZVA 1ZJ4A 3UF0A 3T5BA 3CB2A 3SC6A 1U0GA 2IV7A 2FMKA 5CW2A 4LGVA 2C9BA 2R44A 1GFZA 3HWX1 4ZOLF 3OZEA 3P9ZA 3JYLA 5K05A 4QRDA 3R3VA 1DBRA 1M8JA 2O8EA 1E1CA 2EJWA 2E82A 4K9SA 2QR3A 2O2YA 2VYNA 4OQEA 3C3BA 1P8JA 4OUDB 3BWXA 2P2SA 3CLHA 3T0GA 1NUAA 1WP4A 4MI3A 5BN3B 5CX1A 4BVFA 1T5TA 3QXXA 1JL3A 1IEQA 1YL6A 2TMYA 1XZFA 2HRBA 4ENPA 1SVWA 5BSKA 4ZVTA 5AW8A 4DCPA 1Z0IA 3I32A 4EUEA 2PH1A 1EXVA 5C52B 3OA0A 1JQ3A 4PBRA 2GF2A 2FPGA 1OXKB 5KNDH 1XCBA 1D09A 1XVVA 4MCJA 2V7PA 2ZRNA 4RXMA 1ZESA 2H1FA 2Q8PA 3E6AA 3ENKA 3H0EA 3OCWA 3QKTA 2R60A 4EKYA 3BH0A 3IUQA 3TOZA 2PRZA 2QN6A 1E1KA 2UUOA 4X64B 1Z88A 4CM3A 3HYRA 1W52X 2ZKIA 4LI0A 4QNNA 4Y7DA 4NDNA 3JRXA 2XD9A 1QFXA 1NXVA 4KPFC 4EZIA 1UBEA 4GKJB 2YJ3A 1V6AA 5CG2A 2CHGA 1T5IA 3E3AA 1VL2A 2FZLA 1PG4A 4U2KA 4FSDA 4EHLA 3CUKA 3CSSA 4EQZA 4DV6B 2SCUB 1H2YA 2QQ5A 1KJYA 4FEEA 1WXHA 4K2HA 2FYTA 4P7JA 5E4TA 2RC6A 3V4OA 4ZN6A 3HJTA 3EISA 4XSHA 4EJ2A 5JNVA 3LCJA 2CDRA 3AF6A 4IYRA 3SNHA 2B99A 5DKFA 4EEKA 1WCIB 3L92A 4NF2A 4C0SA 2DBZA 4CTJA 2QVCA 2SHKA 3DVRX 4BNTA 4FLFA 4PC6A 3KJNA 4Q3BA 4BZPA 2QBYB 4QO8A 4PU0A 2H7CA 3QWFA 2VRNA 2D2IA 3EZNA 4ASUD 3LUJA 3P97A 5IDQA 2Z3VA 1YR6A 1RBQA 1A9RA 1NBHA 5FLYA 1HK7A 3TPFA 5LMUC 4N8DA 5T4HA 2JHPA 3EXIA 2BMEA 3P4YA 1FUUA 2ZU6A 3LX8A 3Q85A 2VT6A 5BWLA 2GN8A 1YRQA 2AZ4A 1RW4A 3QA3E 3HLYA 2Z08A 5ERYA 4E07A 2WUVA 4DM3A 2WFZA 5DNUA 3ADDA 1T34A 2CBZA 2CF5A 2D8AA 1T0BA 4GMXA 5C31A 2I33A 3KVVA 1XLUA 2VP9A 3NT5A 1VRCA 1OGIA 1D1QA 1JECA 5AVWA 1S96A 1MXBA 2D7JA 2HSEA 3E3NA 5E1MA 1N5IA 3SEZA 1QPBA 3SI7A 3CLRD 5FLEX 3MCVA 3V9PA 3GO4A 3W8DA 1P19A 3W2IA 1VSUA 3KLOA 1B16A 2B8NA 4QULA 4B8WA 4QQRA 4BKMA 3QEMA 5CLGA 5EZQA 3RAEC 3S2IA 4RJIA 2IS2A 1Z5PA 3ZX5A 1NU6A 1YIDA 4BGUA 2EHJA 5FX2A 5SYNA 3O73A 3DMTA 1DJQA 3T9FA 2XQVA 1XPRA 2I6GA 3WA7A 3SHQA 1DQNA 1NNI1 4F4DA 3V2IA 1N33C 3OEHD 3RBXA 1AHNA 2X76A 1J6UA 2Y93A 4Q7LA 5MDHA 2YNMC 4CJXA 2JCVA 2JLYA 1WCJA 3P45A 3THYA 1ZI6A 3MINB 1HQCA 4J7AA 3D81A 3F3SA 4Q05A 4UNPA 3QI7A 1YDGA 4G67A 2ZXUA 2I65A 4ZDKA 3BEDA 3O74A 3TUFA 2DGDA 4DBVO 2O8FB 3INYA 4ZI2A 2BMJA 3ROQA 1AQLA 3TLEA 4CETA 5AVJA 1XLTC 3ZYZA 4JI8B 4G8DA 3L0IB 2FPPB 7AT1A 3RNLA 4TKVB 5HF5A 1EWRA 2A0KA 4J0KA 2Y4NA 1TLFA 1UDCA 2ZR7A 3L7CA 4K5QA 4F46A 5TF0A 2GYYA 2ODBA 4HLUC 3AGPA 2BFPA 2W6PA 4BNFA 1ARZA 1W25A 2QWXA 1O9TA 2XF2A 3D6NB 3DLAA 3FJ1A 1CETA 4JUFA 4NICA 5C51B 4RPKA 4O1MA 1XXHB 4D57A 2BE9A 3FA2A 1Z25A 1PBTA 4CCSA 3T7DA 2XCRB 4C9BA 1OBCA 1U2DA 2C8KA 4FUQA 2C5GA 2P9ZA 4JBNA 3RJTA 3D6AA 1FP4A 1V16B 4MV5A 3GY0A 4KTTE 2I7TA 4LXTA 1K2VN 5E9QA 2FNAA 4DSOA 2P02A 2A9KA 4TT3A 3HVHA 3QVLA 2XHZA 1G42A 4YP7A 1Z6YA 2CHVA 1FCJA 1W29A 3V32A 2IOYA 3I8OA 3MJVA 2XRZA 5ES4B 1KZ6A 3JARB 2HF9A 3KAJA 2MCQA 3V3TA 4FONA 4ETWA 4O4HF 5H80A 3D0OA 4M1WA 2I3BA 3QOXA 3TCXB 3ZWAA 3TG8A 2RGXA 4UFPA 2EP7A 3FWHA 1W85B 3G0BA 3SM3A 1VMAA 1XCMA 5LCXA 1SWWA 4J2OA 1UFKA 4X84A 4HNVA 3NTLA 2O0JA 4JYCA 5CAEA 1N6NA 1DHRA 3QOWA 4OFWA 1TPYA 1PNOA 3WQBA 1YF3A 4R71A 1SY7A 1UBCA 3EIQA 1Y8RA 2JGJA 4BQOA 3U3JA 1DDOA 4AMVA 2AKYA 2WK1A 1H2XA 1YTLA 4NU6A 2ZPUA 1BKSB 3K9WA 2A88A 1OOEA 2WPNA 3IT0A 4G1CA 4CT4B 2EIXA 1R0CA 2G1JA 3URMA 1KAOA 1KVTA 3RAGA 3FFXA 4HH1A 2OXEA 4KO4S 2VJYA 2XJ4A 3LWZA 1SCJA 3PITA 4Z3DA 3ND8A 2JFVA 4CG0A 1GPMA 1ZGGA 4X3PA 3R9KA 3M6VA 3FX2A 5LJIA 5BR1A 1W5EA 2NUAA 3GCWA 5DNDA 3QPVA 5BUQA 4G2NA 1S8FA 1RPAA 3G2HA 1W8DA 5EWMA 1JQEA 3IVMA 3TTXA 5AESA 2FFQA 1XTVA 3ASYA 1WVGA 1IWOA 1Y48E 1GGFA 2X8AA 2E89A 3M6FA 4E1AA 2CHQA 5ALJA 3H9UA 5DNWA 2DPHA 4CQLB 1SBQA 2PRJA 3HN2A 3M1IA 4WHMA 5KOHB 2A67A 3E2PA 2BH2A 4M87A 3UHFA 2A92A 2EVWX 1D8TA 2W4IA 3OICA 4M8IA 1SZDA 5CHYA 5EOVA 2IELA 1KY2A 4FOLA 5EMMA 3STWA 4PY2A 2AC2A 2I91A 1FE8A 1NVFA 2GCOB 2OOSA 4M7PA 4RJJA 2AT1A 2G9UA 1FVFA 2VNHA 3OEYA 1GRQA 3PJDA 4PPNA 2DQSA 4X0EA 4X00A 3D3JA 2IA5A 2AKEA 1GU1A 1J8MF 2HAEA 3OY7A 1MRSA 1TVKA 1YDFA 1KH3A 4C04A 4KN5A 1KK1A 1AV7A 2XODA 1U2SA 3UC5A 2DT5A 1P1RA 5JSQA 4E08A 2FPMA 2FWAA 2DJIA 2ZRPA 3CE6A 3IP6A 3OIDA 4CM8A 5BWCA 3LY5A 1W88A 4I36A 5EXDA 2W5UA 3NJ8A 1U98A 2AJDA 1UAGA 1O95A 3WIVA 4FMDF 2XUKA 3NUZA 4L9WA 3THWA 3IPAA 1DL5A 1W1WA 1ZH8A 4NMMA 1T4CA 4RY9A 1ZUIA 3PGXA 1Z0DA 2YVQA 4C0LA 2IQ5A 2PKRA 2Q5HA 3ME5A 4OQMA 5JRJA 4DLNA 1W36B 2IPXA 3FIJA 2CL5A 3LVQE 4DR2C 5TPWA 1R5NA 2GN2A 3S5JA 5BNWA 3IE0A 2JJ1D 3F4KA 2DWOA 4RCVA 1B41A 3PDUA 5CDHA 2GCIA 4LDPA 4WUVA 5E6SA 4KREA 2VHQA 5IWCA 2HMTA 3M6UA 2EKZA 5K20A 4LHZA 1K27A 2BM1A 3FM9A 3PSHA 4HQNA 4JT2A 1NNEA 1JHOA 2P9GA 2O2HA 3K5PA 4HDOB 1QRSA 1M1YB 3OJCA 3RVSA 3COJA 2KX7A 4DPLA 1Q20A 4YP1A 1NJSA 1KGSA 2XCLA 3HP4A 3OOWA 4R2MA 3UQYS 1XNJA 1KWGA 1XCPA 1F3LA 3FMVA 3QLVA 1KP2A 4IW3B 3M4JA 3RGGA 4KKVA 2GM4A 2J9XB 3IYLW 2FP4B 4RHTA 4F92B 5BSEA 4DV1B 1MT3A 2CXPA 3OZDA 1GA6A 4BIIA 4HNAB 2ZJ2A 4I55A 1TK2A 1JG4A 4J76A 3MMZA 5SY4A 5CEFA 2OTCA 1U0BB 1OA0A 4D43A 3WS7A 4BX2A 3HBLA 4KKXB 4IIHA 2V6IA 1EQAA 2O3TA 3NNDA 5JD4A 5LJLA 2NIPA 3GPLA 1X80B 3X2FA 2I3DA 3F6BX 3H2BA 1IBKC 3D2AA 1ZSVA 3FSGD 5H3CA 1JHRA 2Q3HA 4F9GA 3T1HC 5JRZA 1G9SA 2CK3A 1ZVJA 3HO1A 2C1XA 2XITA 1E4OA 1AKQA 3IAS6 5D7NA 5K51A 4FT2A 4AQYB 1I3CA 2W98A 1IN5A 3TL6A 1OU0A 3C4VA 5PGMA 2OL4A 3ZZTA 2WICA 4V0OA 3GLFB 2FP3A 4WNIA 1L1QA 4ROSA 4UNQA 5M34A 1T8UA 4HEJA 1NW4A 1UPXA 4A2CA 3E3OA 4NFSA 4IY1A 1VHTA 3RVDA 2B1GA 3M82A 3RCBA 3ETOA 3PTZA 5E2AA 4NOJA 4TYMA 2P6MA 2Q7OE 1AUQA 1RQGA 4YJHB 3UWOA 5JXJA 4DV0B 2VPXA 3KG2A 1P1IA 3M9WA 3F46A 4N3AA 1DQSA 2ZIXA 3NDRA 5LBTA 2BGJA 2I7XA 4PRLA 3K0AB 2P40A 1Q12A 2P1ZA 5FBKA 2VJDA 2AJCA 4II3A 1W47A 3QRWA 1GGHA 3W78A 2C7OA 2JBWA 2WFLB 3F67A 3VC3A 2GK7A 1ORDA 3ZWMA 5GONB 3TRKA 4DR6B 1JR3E 1WOMA 3EQ8A 4B80A 3V4LA 4D96A 2I03A 3QHPA 2OZLA 2RI1A 3VR5H 4D6XA 1XZMA 1KAHA 3ESRA 4E22A 2IYZA 2X3FA 3D31A 2NU6B 3NXSA 4K6KA 4MP8A 4RD2A 1SN7A 1QTIA 5DH9A 3O21A 4G9BA 3VKFA 4MVCA 2M6KA 3VX3A 2A0UA 2JIPA 1Z37A 2GPJA 2QRGA 3MWEA 4LSWA 8OHMA 5C0OE 1NG9A 2B25A 1NXXA 1C3OA 3CZCA 5BN1A 4DCNA 1GL9B 1PZEA 3JZMA 4JJIA 5B3LA 1FX0A 2VPYA 4MQLA 5T41A 3MCZA 5CBKA 2Q5FA 4I5IA 3VVBA 3BDVA 4KIFA 4Y2UA 2ZSBA 2IX3A 2KJQA 4V0MA 4JYZA 3CPSA 4NE9A 1QZZA 4PROC 2JJMA 2HV9A 2RDMA 3C98A 1L5HA 5FPPA 4LJKA 2DBYA 4P34A 1P2FA 1GLNA 1F8FA 5DEOA 1D1SA 3LVBA 4QXAA 4Y3UA 2VDNB 4WADA 1XDGA 3R5SA 3HZRA 2CKMA 2WD9A 3ED5A 5HJ5A 1MABA 4BNYA 2VDPB 3MWYW 2E1PA 1XIVA 3INNA 5EXXA 5HZHA 4LVOA 3SEQA 3IIEA 1SELA 2ZJ1A 1YS9A 1WX1A 1A0OA 4FGUA 1TIKA 5JNUA 5LP6A 1B0AA 1KDTA 2YZKA 3WMRA 4B3CA 4NBLA 2A4MA 4JA0A 1QV9A 4BZWA 3KOUA 1GPLA 5ED4A 4IUCS 1IHXA 1YRWA 2PYZA 1KKLA 2PV7A 1FU7A 2E6KA 3CQ1A 2GCPA 3DD5A 3MSXA 4OBEA 3N76A 4KCGA 4JJFA 1Y4DE 2H1VA 1H0KA 1E1QA 2B1QA 3KJGA 4QJBA 5IXJA 4M1EA 5ILGA 1NQXA 1KYVA 2VUIB 1NW8A 2AL7A 3E22B 4QPDA 5DI3A 5L95A 4K0BA 1FYEA 4G01B 4UXIA 1ESCA 3QEJA 4GRIA 2I80A 4U1RA 3RC2A 5K5EA 3RC8A 4MQEB 5HYVA 4K3VA 3O4FA 3I4FA 3OM0A 2Y9MB 1E4EB 1YB5A 2QUZA 2XQGA 5CR9A 2QKYA 1RQLA 3AZQA 2FXVA 3ESZA 1LBHA 2W48A 3LOUA 1NJ8A 3ILSA 5ALPA 2QRPA 1A88A 1RPJA 4UJ3A 5DWVA 3V00A 4FYHA 3CLUD 2CEKA 1J0DA 2ZUWA 1XVTA 3OPYB 2PYDA 1XYYA 3N53A 3A9TA 3CX4A 4DWWA 1MB2A 3LPAA 5JCOC 4RPIA 3ZZUA 4U6QA 3LYAA 3V7NA 4H15A 1KVSA 1XI2A 5EJ5A 5BW4A 3NBYC 3MMNA 3WHPA 2EGHA 3GAAA 1I0IA 3MQ4A 4M36A 1ST2A 5A5EA 3T1YB 1XZCA 4X90A 2WJJA 4FLMA 1LWNA 5AJTA 3X44A 4A26A 3ER6A 2F64A 3F9RA 1OFIA 3DOHA 4OVKA 4JUCA 5CM9C 1KRHA 4F7WA 1RP7A 1T24A 4R1OA 1UR5A 2IYLD 3IQZA 1HSZA 2HC9A 3FE2A 4KK3A 4NIMA 1D2MA 3OQIB 1J1IA 4XGQA 5IULC 5IDXA 4BO3A 2XUZA 1ZOOA 3PGJA 1KU0A 2FUG6 4KYUA 4CFSA 1S2LA 5AHRA 2MU1A 3U5ZB 1ZC4A 4B3RB 1SBHA 3TDMA 4LYFA 4Y9RA 1AN9A 5JXHA 1OBHA 5KTOA 1WU8A 4L4YA 2F48A 3EZ2A 4AXXA 3BPSA 2I1WA 3LK6A 1BFKA 3W9UA 3CU5A 4HV4A 2BUBA 4TN5A 5FO0A 1OZGA 2CDBA 4GLLA 2QD5A 4XI9A 4J0JA 1HEIA 3QEAZ 3UX2A 3ORRA 1G5IA 4KX5A 2DLDA 3H9JA 4DA7A 4QTTB 4XX1A 4QT4A 1IXRC 1P7VA 4MEBA 3BF8A 4LYGA 1IQ0A 1QFYA 4BPBA 4YNBA 1F2TA 1U0FA 1JP7A 4G0MA 1P17A 1VLVA 2DPLA 3H5RA 3ONFA 4ZJZA 5EQDA 1UC4B 3TR3A 1TT7A 1JU9A 1OT3A 2WP0A 3PHBE 3HSSA 1BSVA 4YGXB 3I5UA 3WRWA 3VQTA 4EFMA 2IHJA 1JBEA 3I0MA 4LHEA 4K81B 3ZOZA 1S01A 1ZUNA 2H4XA 3DTNA 5A4AA 1V35A 5AJWA 3RRYA 4EECA 1C7QA 4DLYA 1V7ZA 4XASA 1VMDA 2RAPA 3ANYB 1FMTA 2HMVA 4B6PA 4EJFA 1V43A 3N2GB 3O8OB 4D6PA 4DDVA 2F3UA 4HMQA 1F5NA 4E4RA 3KQOA 1M1YE 3P9NA 4R4JA 1ZH4A 3JWIA 4O4HB 5A06A 1TUBB 1AOXA 1TA4A 4ARIA 5JTUA 2XCOA 5J2UA 2C3YA 4JFAA 3F5SA 1F60A 3LM8A 4KFSA 3G1WA 4KSYA 4XYMA 1GUDA 1N7GA 3ADOA 2HBZA 1NW5A 2ON6A 4UOQA 4FC7A 1TA0A 1FNNA 3GZ4A 4IVQA 3VBCA 4ZHSA 1X7HA 1R1DA 1Z8NA 5MGNA 2AXQA 4HAXA 2QTBA 4UMDA 1RI4A 4WINA 2C2GA 2PA3A 1UFRA 1QP4A 5KIAA 4BBAA 3SJAA 2WKPA 4F2WA 6NULA 5EEGA 4RTJA 1IB8A 1QG4A 3A9RA 3OQ1A 4BDSA 4DSNA 3U4IA 3O93A 5IMBA 1EZ1A 2AMYA 2RHGB 5HS4A 1KS2A 4RY0A 2UXBC 5EC8A 2W22A 3GLUA 1ENPA 4BCCA 5B7QA 4YJ3B 2QE7A 4RA6B 4HDKB 3X1ZA 2WF7A 5FHRA 1T8YA 1MXAA 1CK4A 2J7PD 5BPHA 5KJFA 2RKBA 4IV0A 2CJWA 2ONCA 2YL2A 2NZ8A 4V39A 4X5OA 3GLFE 1XVIA 1GNPA 3MB5A 3TL2A 2XXJA 2JI4A 1DV2A 3IQXA 5TS3A 3AERB 5BURA 4WKCA 1MEEA 2GK4A 2XI4A 5J58A 3PI6A 3T3DA 5FNVF 5FF9A 3DEAA 4BVEA 2YXDA 3EMVA 4XH9B 1UWCA 3OPVA 2B3DA 1TD1A 3F96A 3DHNA 3FOBA 3RRZA 2QMQA 4ENTA 1E8NA 1VRWA 2QUIA 2QTNA 1L7VC 3BHIA 3OJLA 4MV3A 4ZTBA 3STTA 4AICA 5CCBA 1XZ8A 2VQ6A 1NYQA 3OWHA 1GZHB 1JXQA 4NESA 5HKLA 4F72A 1QH1B 4AIIA 3ZWWA 5HTOA 1ZCFA 4M54A 1Q1EA 3VR6D 1VP9A 4XR9A 3HXQA 3QVJA 3UK0A 3GCDA 4DEVA 1PQWA 3GPIA 4K03A 1J0BA 4Y2VA 3THOA 5EKUA 3AQIA 2HRZA 4QSMA 1P2BA 2BFDB 1RJ9B 2ETXA 2RH5A 3KB6A 4RAOA 1TM7E 3GF4A 1G4AE 2HPVA 4D9CA 1EX7A 1FDTA 3IPCA 3KLPX 1GRCA 4Z0TA 1RWNA 2C2MA 1C4WA 2AC7A 2ORVA 3DZKA 4BASA 5JRHA 2GXSA 1BMFA 5KYUB 2BFCB 3AFHA 1ES9A 4PHCA 3A32A 5JG7A 5BSGA 5IAOA 3HB0A 4RE5A 4FMDB 2VEDA 3DWEX 4TWBA 5DHTA 4CMGA 1I3KA 1K4YA 1XV5A 4BXOA 5AI9A 2LKCA 2GD0A 2O1WA 4KFTA 2DKNA 1XQ1A 3CKKA 3EQ9A 2UZ4A 2H3EA 2INGX 3BFXA 4GR4A 3F4LA 1QS0A 3LUFA 1TECE 1CNFA 2VSQA 5DVZA 2DC1A 1PA4A 3V33A 4B6SA 5CB4F 5IF9A 1SH7A 1W36C 1Y1QA 4BJ3A 1WB4A 2N9UA 4JL8A 4EW3A 1UXJA 2CLKB 3NHPA 1KYXA 4Z1MD 1XTUA 4L7IA 1RRPA 2E49A 3GNQA 4DMFA 4LNUA 3QX9A 1NJ1A 4ZOBA 3MTEA 3CUSA 1RAAA 3RVLA 3FZNA 4LF4B 3I9V6 3GFQA 3S55A 3RU7A 3QMVA 1DAOA 2CF6A 1AB5A 5EJAA 4CM6A 3VO1A 3ET4A 4US1R 5AVYA 1JHDA 3MJSA 2ATCA 4LDQA 3QKUA 3ZWCA 4AMZA 1N2IA 4XD7D 3EQZA 5A0FA 3ZCRA 2BM9A 4BVLA 3IP8A 5FO1A 3EA0A 3L79A 3UTCA 3TM5A 3U39A 1OBVA 4RJKA 5E6RA 4O2BA 3F5FA 5AKZA 3VGPA 2BOVA 1J99A 2JF0A 4A2QA 4LJSA 4C06A 5AQEA 5UKDA 4RVHA 1HR0B 2G40A 4NHOA 1JA1A 4OYRA 3GJ0A 4DV1C 1GZ5A 5AVUA 5DRYA 1DTSA 1MV5A 2WU0A 3NAMA 1P9WA 3WTCA 4N3NA 4DRZA 1UZUA 1RZVA 1UIRA 2X1MA 1YS6A 3EVNA 3PCTA 4IG9A 1IN1A 1HX7A 5K0GA 3HKDA 1PFYA 2H48A 4PLYA 1DEKA 4AQDA 2UYCA 4YV1A 1OWMA 4HXEB 4ENSA 3AW8A 5TMPA 3ILYA 2BF4A 1RE0A 4HBZA 4BP9A 3ZHSA 2Q4TA 3FHJA 3QU4A 4IIDA 3VKUA 4D0NA 1U3WA 3I62A 4OGKA 3SDSA 3INTA 2ZS7A 4AQYC 1CJMA 3LBFA 1L8QA 5KTKA 4MWEA 5DGXA 1TFUA 2GAJA 4TVBA 2B92A 4KPUB 2CV1A 4Q03A 4KLZA 2R1ZA 4EUHA 1M1NB 2Q3MA 1QBGA 1EK6A 4XX2A 1SG0A 3PRYA 1A9OA 1SUDA 3WADA 4MVJA 4BLQA 2Z2KA 3RFUA 3U80A 1ONSA 2AEJA 1ZC3A 2YNMD 4ZRDA 3UKOA 4C88A 1EVLA 5ENZA 5JEEA 3W06A 1PL7A 2DTEA 1R15A 4P54A 5ALDA 5C8YB 3FCEA 1PFQA 5B37A 1C9JA 2ZLBA 5E9AA 4EHAA 4Z4IA 1QYCA 5BSHA 1PAUA 2G1PA 4ZV7A 1R0YA 4CMAA 1GAQA 2WKSA 2I3AA 1DX4A 3FTNA 4ZVOA 4DB2A 2D7DA 1U3GA 5CEJA 3ENQA 1XEFA 3H13A 1NW3A 2E2WA 3DKRA 5CCDA 3TUJC 1VL1A 4DEYA 3K1AA 4YYZA 4N7RA 1ZJYA 1Y8AA 4GHWA 4EF6A 2CLCX 3O84A 1Y3IA 4JBHA 4KUEA 3ESCA 3RSQA 4EK9A 2RI0A 3NW9A 1RABA 4TLCA 2I3GA 4MO2A 3SZ3A 5KZMB 2OD7A 2PXAA 3KCNA 3I05A 4AUEA 3NI2A 1OZAA 3MWFA 5DBOA 3IKVA 3IQEA 4L85A 5EI5A 1RE1A 1K8XB 3KOWA 2AFRA 2PPVA 2QP4A 4MTNA 1T8WA 2I7CA 3C3MA 3OIGA 4Q47A 3V1NA 4AF6A 1NUHA 4Q93A 1P2TA 5T8TA 1S2MA 4JOBA 2ZDGA 3C1AA 4KZPA 4U2CA 1H9BA 3OFJA 2EOAA 4IINA 3V8NA 3DB1A 4F91B 1GSAA 2QM8A 1YSCA 3G23A 3L4BA 1PJ8A 1U0SY 4QPPA 3ZKWB 4R9VA 4W5NA 3JAKB 2XQIA 4FD2A 2G08A 3ZHTA 1WE2A 1JHQA 3CF4A 1OI2A 4TVOA 3DL4A 3AOEA 4HH4A 5FPTA 3OZAA 1S02A 2ODNA 4WVFA 4YAFA 4FK8A 2A9QA 3GJ4A 3WK5A 3WAGA 1FSPA 3SBDA 3UAYA 2A1TS 1FDOA 2Y6VA 1STOA 3Q7TA 1QIHA 2B21A 3TLXA 2H7YA 2OFXA 4PLPA 3KUXA 3FOFC 2J46A 4QAJA 2FLWA 3DBLB 4JIMA 4Q4HA 3RRNA 1ZRHA 3C87A 1VMIA 3K92A 4X8OA 2XUOA 4OYCA 1CXZA 1EI9A 1Z75A 5DIFA 13PKA 3S1LA 2DSNA 2OESA 4RVDA 1VSQA 2Y1DA 2OBFA 1KMHA 1AT1A 3AR5A 1VGRA 3W7VA 1RXVA 2GZ3A 2GRUA 3QNWA 2CNKA 2V97A 3CR3C 4MPDA 4DIUA 3LOPA 4NBNA 3ZBPA 5IEJA 2ZRCA 4PLWA 3QPBA 2VP6A 5JWRA 4N41A 4HRXA 5I9LA 2WWVD 5ITVA 1G6KA 1XZIA 2VF8A 3X1DA 1XTQA 2PMEA 4X94A 1KZ7B 3C3CA 4R40A 3IT2A 4RTPA 2AXEA 5BT9A 5K2OA 1XZBA 2VCHA 3L1HA 3FJOA 3QJ5A 1Q91A 4IJUA 4Q3NA 3TLGB 3TRJA 4IJ5A 2FEAA 2Q0HA 2QQ0A 3PKIA 3F6PA 4L4QA 1C50A 3F9CA 1NX9A 3MUFA 3EOBI 4AYWA 4BVAA 3PLNA 3CQ9A 3RT9A 1GPDG 1IE3A 3HCOA 4CTMA 5KYXB 1ZGBA 4EI8A 5K0CA 4QOSA 1F06A 2X5KO 3OT1A 5SYMA 4DXHA 5JLAA 2FI1A 3K8ZA 5HILA 4MUIA 1WXQA 1OHHD 4XQ9A 2DWPA 3UH1A 3CWZA 4C21A 1R66A 3VPFA 1UKYA 3OTIA 4ON9A 4PONA 3JALA 1GFSA 1B6SA 1NY5A 5HQ3A 4EVQA 4L8GA 1V26A 1RYHA 1MQAA 4CM4A 1RCTE 1O3YA 2BCGY 1KFKB 4N3CA 4DFDA 3TNFA 1IPEA 1E2HA 1DPFA 3BCSA 1JFFB 2QGFA 4CM5A 1YJAA 4XVUA 3T1YC 4Q1CA 4UKDA 4XWAA 4Y9UA 4BHTA 4P31A 2GPAA 5K3SA 1SZJG 1Q44A 2PSFA