4FUTA

Crystal structure of atp bound matb from rhodopseudomonas palustris
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
502
structure length
475
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDGATIDEAQVLHGLDGQLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malonyl CoA synthetase
publication title Structure-Guided Expansion of the Substrate Range of Methylmalonyl Coenzyme A Synthetase (MatB) of Rhodopseudomonas palustris.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
total genus 145
structure length 475
sequence length 502
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4futA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4futA01
3IVRA 5BSRA 4RVNA 2D1SA 5K8FA 2P2BA 5KYTA 2QVZX 1PG4A 4FUQA 1AMUA 4DG9A 4WV3A 3DLPX 1YJ7A 4R1LA 3IESA 3R44A 5JRHA 1RY2A 2P2JA 4RLFA 1T5DX 3FCEA 3NYQA 5BSUA 4LGCA 3IEPA 5BSMA 3G7SA 3RG2A 2VZEA 5D6NA 3O84A 5BURA 4R1MA 3LNVA 4G36A 2VSQA 2P2MA 4E5DA 4GXQA 2WD9A 5IFIA 4ISBA 1V25A 3VNSA 2D1QA 4OYCA 1PG3A 2QVYX 5K85A 4GR4A 3WVNA 3VNRA 3GPCA 3O83A 3LGXA 3E7WA 3VNQA 2Y27A 5BUSA 2D1RA 2V7BA 3O82A 3TSYA 4IZ6A 3FCCA 5KEIA 3A9UA 4OXIA 3ETCA 3B7WA 5DWVA 2P2FA 3ITEA 2QW0X 4RM2A 4D4GA 5DV9A 3NYRA 4M46A 3QYAA 4GS5A 3CW9A 1MDBA 5BSWA 3U16A 3EQ6A 4D4IA 3DAYA 3L8CA 3U17A 1LCIA 1T5HX 3CW8X 5GTDA 3T5AA 1ULTA 3E7XA 5E7QA 2P2QA 5BUQA 1MDFA 4FUTA 4PZPA 4IR7A 1MD9A 3IPLA 5KYVA 4D4HA 4GR5A 1V26A 3C5EA 4W8OA 4G37A 3WV4A 4RVOA 2P20A 3A9VA 3DHVA 3T5BA 4R0MA 4RLQA 2D1TA 2QVXX 4RM3A 3PBKA 5BSVA 3KXWA 3IERA 5BSTA 4D57A 4ZJZA 4U5YD 3RIXA 2Y4OA 3LAXA 3T5CA 4EATA 4DG8A 2Y4NA 3WV5A 3E53A 1BA3A 4RMNA 4D56A 4GXRA 3NI2A
chains in the Genus database with same CATH superfamily
1KWKA 2C54A 3IBYA 3B13B 5LQDA 3SX2A 1F8FA 2QQ0A 2XB9A 2CNWD 3ST7A 4ODJA 1E2PA 1XEFA 2PMBA 4L7VA 2NU8B 1VYVA 3T9BA 2WJGA 1FSZA 5U1PA 4EY6A 4OJMX 4TM7A 2I3AA 5IDYA 2JIQA 3NAGA 4RVCA 3CCBA 3WFZA 1U5BB 4RLFA 3TAXA 1AH2A 2PS0A 2JJ8A 2CHFA 2X7HA 2BBTA 2VTVA 2BDEA 3G2KA 3OQIA 4JASB 1VA5A 4LJ4A 4BCDA 3WZ2A 4RTJA 1XZPA 1AMOA 3NT5A 3Q4GA 5FR1A 5I4BA 4ZOQI 4DM3A 1YE3A 4MI9A 1UM9A 4Z86A 1QRRA 2WW8A 3G89A 4AUKA 5EEGA 1Y9AA 1PSZA 2A1UB 1F9EA 2XXBA 4MPJA 2F9LA 3R7DA 3IEVA 4BVBA 4TYPA 2XBUA 7REQA 3K6SA 3Q9LA 2CLMB 3H84A 1DC8A 1PTJA 1G64A 1DIHA 2QE7D 3VDMA 4YRKA 3LT0A 5LYJF 2XW6A 1SVOA 1NXOA 2Z51A 1B4DA 3U4HA 3MSXA 1VKOA 3OZXA 3DCIA 4LRUA 2VVTA 3Q72A 3UAXA 1ADGA 1BXRB 3AX6A 1EFAA 1P4GA 1TRHA 1WKCA 3D0OA 4EF4A 3WGGA 4DILA 4F72A 3KFVA 2J08A 5DULA 3JQ6A 3DCNA 3O5AA 5J59A 3A37A 1H0HA 1YR1A 4TS9A 3RBAA 4P6VF 1DQRA 4XD7A 5G4LA 3N0XA 2JAPA 1RW4A 4EZIA 4M53A 4A10A 5A19A 3T3MB 5IG2A 1H42A 2BH2A 3RYIB 1SC4A 1TF7A 1MZVA 4YAEA 4BCBA 5J4YA 2O8NA 4C2UA 1HMYA 1BKYA 4ON9A 1XA4A 3ZX4A 3ZY2A 5TQ2B 3UMBA 4ZDJA 1SELA 2G82A 3H9EO 4ZHQA 3QUCA 1P5RA 5G4KA 1EWYA 2IDMA 3WA6A 1LTQA 1XDSA 2ZIZA 5KU1A 1JG7A 3GZ4A 1RPNA 4UDXX 2HAEA 3MS4A 1E9RA 3NG1A 4LZPA 2EX4A 3AETB 1AV6A 2LBPA 2QUJA 2XUQA 4O6VA 1TYDE 3OCYA 4ZQFA 4AJJA 2XKKA 4YCNA 2ZQYA 4HDRB 3V4RA 4X1OA 2K6GA 1EINA 4G9BA 1SUPA 3UJ8A 1NXXA 8AT1A 5KVSA 4K9MA 1J1ZA 3RS3A 3BMXA 5IARA 1JG4A 3EUFA 5DSTA 4QXOA 1OZAA 1I7LA 2IUUA 4K9SA 3X1YA 3DB2A 5FORA 1BD4A 1Z4JA 3N2IA 1SG6A 4HH3C 4KJXA 4OG2A 4OP2A 3HDHA 4FIDA 2HADA 1YBHA 4HQ6A 4ZXPA 2QJOA 4H15A 4KOEC 4TROA 1UF9A 3LWBA 1FP1D 2GVNA 2HCJB 2V7PA 4R0MA 2VYQA 4G1UC 2XNDD 5FUBA 3V1MA 4B3RB 1QIIA 3OQ6A 2WTXA 4KNVA 2NM0A 1TO2E 4Y9RA 1SCUB 1PDWA 5KDOA 3ROEA 3OIFA 3E6AA 4B35A 5DYGA 4B82A 2J41A 1A2KC 2PKXA 2VKTA 1RYDA 1ULAA 3LFHA 2IUSA 5FWYB 1U8XX 3QWAA 1L5HA 4MRAA 2IUYA 3VOTA 2O1EA 1FMTA 2A1IA 3D8TA 1NW3A 2GEFA 4CM8B 3ZYCA 2UUCC 4MUKA 3VVBA 4GD3Q 2H63A 4P32A 4TRNA 3RC1A 1Y8ZA 3W5HA 4GX0A 2I76A 4MWBA 5IYZA 1FDSA 1IK4A 1ZOOA 3ICCA 2PGDA 4CR8A 4MR9A 3VR6D 2YMQA 2EW2A 5IJAA 2O52A 2R2AA 4BFVA 2NTYC 1NGSA 2W0SA 3EZYA 1DC6A 5CR9A 5E3HA 5B1YA 5EJ4A 1P1KA 4YO7A 4MVJA 4MP8A 2PH1A 2HIMA 2XUKA 3NWPA 3T0FA 2XOEA 1OXBB 4L3WA 3N1UA 1AV7A 1FRVA 4JV5C 3CR8A 3WGOA 1VL8A 3RG2A 3RUPA 3ZWYA 3SDBA 1FRQA 4MV8A 4C2BA 2QSJA 2ZUDA 4YRLA 1RWNA 5KJ6A 3P9PA 4PGAA 5COBA 1HV8A 4KMSA 3STYA 5JIBA 3NTUA 3WAJA 2B5OA 3NBQA 2HBZA 1KHTA 4EQZA 1F5NA 3LPLA 5HRCA 1V6CA 5K0GA 5HPYB 2GN4A 2PX4A 4DMKA 3G1WA 2OLKA 3LY8A 1KQOA 1SHKA 1Y1SA 3O1LA 2CJXA 4Q18A 1EK1A 3SS9X 4C7VA 2H4WA 3P4YA 3DKRA 2OOSA 3FUWA 3MFYA 3U9LA 5K2MA 2CMKA 1U0OC 5HE8A 2VHCA 3U19A 1Q12A 2VAXA 5BW8A 1E2FA 3K2IA 4GPTA 4R0VA 3TB4A 2W00A 2R11A 4QPCA 1RFLA 4EAAA 3ESRA 3LD9A 1RBMA 1AQNA 2ZAMA 3O7WA 4JJIA 4MV6A 3OJ0A 5FL7A 3WLLA 4AM8A 1O9BA 1PUJA 2ZYRA 3FB4A 3NXKA 1L4FA 1YZLA 4KQXA 2JKYA 1Y48E 1WXGA 2EX1A 4KUEA 2JG3A 2F1JA 1YQ9A 1GTG1 1T5BA 1C9KA 1W0KD 4RKFA 4G84A 5EP4A 1BH6A 2H9YA 4I1OA 4G0UA 2D0IA 1N36C 4BC9A 2GD6A 3L4BC 2VUTA 2C92A 1DSSG 2IS4A 1CRPA 1SRRA 2WWWA 5ALLA 4F86A 1P81A 4KQJA 1JFTA 3QF4A 4FINA 5ER9A 1SULA 1AM4D 1R4MA 2FMFA 3HY3A 4H9GA 1FFGA 3S70A 1ISGA 3MAGA 1SQ6A 4UMVA 1YDGA 1KK0A 4E13A 4YP9A 1T2UA 3K8OE 4Y2SA 4XQCA 2C5EA 3MAJA 2I9PA 2YHBA 4WFIA 1CLUA 5DGCA 1CWUA 1X1BA 1OLSA 2W4QA 4CQJA 5EUCA 3ZY5A 1VYUA 2VIIA 3LPMA 2B9EA 4I46A 2IOFA 4MRMB 1TQHA 2D8AA 5IX8A 3Q1KA 1P3DA 4MGIR 4EQ6B 2SNIE 2BGRA 3OX2A 5JD3A 4FU0A 5HMMA 3SBOA 2ZR8A 4QVKA 3ZDXB 4AB1A 4MMXB 1JR3E 4J94A 2F62A 2GN2A 5G2OA 2YW2A 4BSZA 1XK6A 1ZVQA 3KZOA 3RC3A 1PG2A 3K9NA 1FC0A 1KKMA 2DCUA 3AG5A 1P5ZB 3MLAA 5H4HA 2Q0SA 4C7XA 1J8DA 1XOIA 1PDOA 4D9HA 1IBKB 1JSRA 5HOQA 3USCS 1UKCA 1ZH4A 2IHJA 3QVVA 4UUOA 4EBBA 4ZALA 1NVTA 1NDUA 1JV2B 4IXWA 1WL8A 4PG8A 2FUG1 1B2RA 1C9NA 1HT0A 4OKSA 3V7YA 3P9XA 1E0KA 1YZVA 4N3AA 2CJWB 1E3IA 4RK0A 3T3PB 3ESZA 5ALPA 2YOFA 1JTVA 4JLDA 2E89A 2CFIA 4MLZA 1MRZA 1QFXA 2AMVA 3QKRA 4OYYA 1YRQA 3D7LA 2VNJA 3L0YA 2X7XA 3OJOA 4HPJB 2FG6C 4WKOA 4MKFA 4CPDA 2AV6A 5C8DA 1NUQA 4U2GA 4O3FA 5E38A 3W5CA 4XVQA 5BWOA 1E20A 5FRDA 2C5GA 3A6HA 1ZKDA 2IITA 3L7CA 4HGPA 3ZK9A 2Q8QA 1PP4A 1A9SA 3BRWA 2QX9A 3OZ7A 2H2GA 2QTWB 3QOYA 5FWXB 1ISSA 4AF6A 2BFNA 4X85A 5LFAA 1K8ZB 2B7LA 1PJTA 3TUFA 1X80A 4N3BA 1XJ5A 4ZV7A 5KSOA 4HL6A 3JQAB 1XMQB 2JGIA 1IY1A 1MB2A 3CO5A 4C6RA 4O2BB 3PA8A 2WKRA 3WO1A 1KGDA 3FTPA 2GBLA 3UMCA 1G17A 4W6QA 5HDBB 4XLLA 2H1OA 1GO2A 2VWHA 1KFJB 1QV9A 5JEDA 1EFHA 3A70A 4GR4A 4W5HA 3AF3A 4DRZA 1XXHB 3RAPR 4Q9IA 3EDRA 3LUFA 5SY9A 1IUPA 1UM8A 5DVZA 1H1LA 1GNTA 4LCEA 1LDGA 2VP2A 2WT4A 4NV3A 1R16A 1E64A 1W85B 1Z6QA 2DTEA 4FXOA 4R41A 3RAJA 3TMYA 3RRJA 1R6AA 3DNPA 1E79D 2H5IA 3O1IC 3FFTA 4MSUA 4ZRMA 3B6JA 4X9XA 3GRRA 5KHOC 5C53B 4EPVA 4E5KA 1QFYA 4YI3A 5DBEX 9ATCA 4DR7C 3A9RA 4DDWA 5KYXB 3OI7A 1SOAA 2X76A 4JEIA 3ABRB 5DNYB 1XZGA 4ZAGA 3EQ7A 2PH7A 4Q24A 1NMYA 2FCAA 1X9GA 1I1QB 4B47A 1MR3F 1SXHA 4ZHQF 1RC0A 3N8KA 5KYGA 3PIIA 4EAQA 2ZJOA 5AHRA 1SFRA 1H5QA 3F9RA 4J0HA 5C8YB 3H18A 3L18A 1SNYA 3GVCA 1T25A 3HKEB 4XEHA 5EGSA 2XGSA 3SY8A 3DPSA 5JZMA 4R98A 4X71A 1B76A 4QYSA 1OWLA 4RY0A 1FTGA 3NRBA 1P2BA 2UUOA 4C03A 5HF5A 5LMZA 1PJ2A 2M1XA 2Q0QA 1JT9A 1O6CA 4YXFA 1HH4A 4P38A 2POCA 2GZRA 4OLHA 4E08A 3AB7A 2CD7A 3K2QA 1SC1A 2WF8A 3FZYA 4Q15A 4F1JA 1JA1A 1RRGA 3WIVA 4DSAA 2AXQA 3FVVA 4RNDB 1Z7EA 3ZHYA 4KQCA 2HNAA 3DTVA 2ET6A 1Y6FA 2BGWA 2VH5R 3UUGA 4Q03A 3VKHA 3K7EA 2P41A 4WMLA 5IAKA 5LMUB 4MJ3A 1V5GA 2Y1XA 4WFJA 1GUDA 2Z30A 2ZANA 3HEAA 3PNYA 3K09A 3B1VA 3JATB 1RJ9A 1ZN7A 4CDRA 1YB5A 4KP7A 3VAZA 1DAMA 1NSTA 4IHJA 1FUKA 1HK7A 5JFTA 2H2HA 4KO2S 1YKFA 5I7AA 4AKEA 2NP6A 1OJ7A 2DJ5A 1VHLA 1P4AA 1QRUA 3ZGLA 5FH9A 1QH1B 2KQUA 1T3TA 1ZWLA 4FKZA 1CQIB 2G0AA 2GXUA 2CLFB 2WLSA 1YJQA 2OGSA 3IAM1 1XHLA 4LXXA 4W9RA 3ROFA 2D3TA 1L7MA 1OTYA 1XD9A 1MO2A 3TBHA 4B43A 1RLIA 3E2PA 2MTBA 3V8RA 1B0UA 1E0DA 1FY2A 3AFNA 4X5OA 2A7QA 4YMSA 4BLOA 2D13A 3ADBA 2ZUBA 4Q47A 2E5LB 3KQVA 4OX9B 3GOQA 3PNPA 3A14A 4FDUA 4RFLA 3T0IA 1I2CA 5BSRA 1U0JA 1R0WA 1IXZA 3EEFA 4FW9A 4M9RA 4G1FA 1W9MA 2W48A 4MVJF 5BYBA 2WOOA 3JQFC 3MCZA 2HMWA 1TTQB 2ZKLA 3PDIB 4QUIA 5FTJA 3A36A 3D2LA 1ZNXA 4U7HA 1BRMA 4U2EA 5EJ2A 5IBRA 3TUZC 3EPLA 4Z4GA 4ARSA 4JSTA 4JIMA 4DLPA 4F45A 3DFIA 2PT6A 1YJ5A 5TMBA 3D59A 4G23A 2WUEA 3GAMA 2G07A 2WM2A 2M2IA 2AF4C 4J2HA 4AIRA 3C5HA 4KQ9A 4YX9A 6REQB 3F46A 5HIMA 3JWIA 1JF8A 1O9HA 4JBWA 5EESA 4JYMA 5KJEA 4BVLA 3KPJA 1TM1E 1I2DA 1J2JA 4YY3B 4GQAA 3KQPA 1E4EB 5A2QD 3GJ3A 3MJVA 4LYHA 4P34A 4BAUA 1D5CA 4WQMA 3W5JA 5JSZB 1ULHA 2WWFA 1U0RA 3OFND 4KHPC 1XQYA 3F6RA 5FA6A 2JAHA 1L7OA 1THTA 3T5GA 3LX5A 2XZTA 1UIRA 1EVZA 2JEYA 3G88A 2R3SA 3B3AA 2PZGA 5DBIA 1M6NA 5TX7A 1PCXA 2H8GA 3FOBA 4QPPA 5HXAA 2V9PA 4D9EA 2NUPB 2V7TA 4FZ3A 4A8HA 1VPTA 1GVNB 5K8VA 1RYHA 1QIGA 1UMKA 3CNLA 3G68A 3SG0A 3L0SA 2V9CA 2O2YA 5I01A 3AJRA 3MC1A 3L4EA 2ICAA 2JCVA 1PR1A 3RQSA 2QZ4A 4AS1A 2DSNA 1Z5UA 1R6VA 3EVZA 2D2VA 3CYFA 4C87A 4EIWA 1NI4B 1NUTA 1TOAA 1XNGA 4FE7A 4EJSC 2WQ6A 1G1AA 4HB4A 2LP4Y 2I6TA 3OLXA 5K0CA 2JLWA 4J0QA 1XK7A 5AKHA 1QHSA 4R9UC 2PWBA 1U7XA 3ENQA 2R8XA 3JALA 3V1KA 4J1TA 4PQRA 1CRLA 3IPXA 3GYBA 4G5QA 1ZBDA 1G7SA 1Y1KE 1OWPA 1ZHHA 2R8BA 5KNDD 4FYKA 2VLBA 4P2GA 3RABA 4C4XA 1EXDA 2A0FA 1E8DA 1COWD 5M7EA 1L9XA 1U7DA 4JLWA 3WAGA 1GTJ1 1R9GA 3KPVA 3SYRA 1IN4A 2FPPA 4KRYA 1AA9A 2VYCA 3V97A 4LF8B 3FTNA 3ORHA 4LN1A 3G8BA 5CB4A 1Q0PA 3WTCA 3VA7A 1Q15A 1RR6A 3C98A 4KE9A 2O0JA 2VO1A 4RDHA 3LFTA 5TE9A 2QVLA 2COUA 1X2BA 5FQNA 2PUBA 1MXAA 1ZAYA 1L7NA 1U7ZA 4IEIA 2B0JA 5FPTA 2H07A 2CDAA 1QYWA 3E3OA 4PTYA 4RPJA 1M2WA 2I4TA 2WJ4A 5ALRA 3TWOA 3HRIA 3LYAA 4QASA 1EX9A 2C1XA 1ZINA 2W9XA 3EARA 1P1RA 5EPOA 2BGIA 5D8DA 5I9IA 1FX1A 1L4GA 2Z2ZA 3OU7A 5L8VA 3UJPA 2EKDA 1NOKA 1B42A 3B9QA 4JBIA 1E1LA 1NC3A 4WZ6A 4YDSA 3OPQA 4OYRA 3DVLA 2IIPA 3QH4A 1R9JA 3O8OB 3THRA 2X3UA 3PUJA 4LXYA 3S2SA 1EU1A 2EAUA 3T9AA 4F71A 1L5RA 3DM9B 3IUJA 2QVZX 2P3SA 4LZWA 2AW3A 4UHEA 1U28C 5BW6B 3IIIA 4UHKA 1E18A 2NVUA 2QM0A 1G9SA 1DAIA 2YR0A 3G2OA 5JPCA 1WU7A 3TECE 2GCOA 3N2ZB 3H11B 3HA3A 1SB8A 3GT7A 3WMWA 2H0RA 4BNKA 4LDRA 2YHSA 3AOGA 4EVRA 4C07A 2ZCUA 2ZR0A 2SBTA 3KSZO 2JNWA 3FWZA 1Q95A 1ZM4A 3NAQA 3RSFA 2CJFA 4R7TA 3RW9A 2P2DA 4ZCIA 4RJKA 3BERA 3HQ4O 1TIBA 1TJ4A 4WE3A 2ATCA 3V9AA 4D8TA 1XBTA 2OHHA 2LVBA 3AWIA 2YYSA 4JLKA 4FCCA 4M88A 3KJHA 3WR5A 3LDUA 2R8RA 1M6XC 2ZJ7A 3L84A 4WZBE 5J2UF 2KM1A 3E3LA 3FWYA 1M8FA 2X40A 4FYJA 2QG6A 1N2IA 3Q41A 3SKXA 3WYNA 4XDYA 3UWSA 3L95X 1TFRA 2WWYA 2JIOA 1IOZA 1VA4A 1W6UA 3VNQA 5HQ3B 5D1HA 4CIXA 5IJZA 5JAPA 4JYAC 1IZ9A 1JHPA 2YIJA 2NXJA 1FVFA 4V39A 2AEFA 1HYGA 2C84A 3AT1A 3GZTB 4GEKA 4QWWA 5DHSA 2VTKA 4ZMRA 5J58A 4UAJA 3PL1A 5I51A 2XUZA 3QA3E 3VHLB 3I9MA 4I1VA 2PMEA 2QM3A 3NV7A 5CA1B 3B20A 5CA0A 1HX7A 1FS4A 4GKAA 5EE3A 3WO0A 3D3QA 4AICA 5A9SB 2CHVA 2QQEA 1IVSA 4C7OB 4DJAA 5GJWC 4P5EA 3A6LA 4YLGA 1EK5A 3TB6A 4DY6A 2YRXA 3IXLA 4OVKA 4M8IA 1R10A 4CG0A 3AR8A 1HNXC 3GLTA 2QMOA 5FBKA 3I9OA 1ZVKA 1NZJA 4KWEA 3LDAA 1N6NA 3F2VA 2AOTA 4XSGA 3IODA 5ALQA 3IAAA 5E9WA 2HF8A 2PX2A 3STHA 3O93A 2OBVA 3EULA 5TGZA 2P0AA 2Z3ZA 3L6RA 3N58A 1ZYUA 4B8YA 1KL7A 2VNKA 5H3CA 3I2FA 4I2NA 3TZCA 2BHRA 3ZHQA 5IULC 5JCZA 3WB2A 2BTEA 3BXPA 4R1PA 4DLZA 2FSFA 1T2NA 3VR4H 2GZAA 2Z9CA 3FPGA 3N2KB 4ZKEA 4ANFA 1Q0TA 3TLBA 3DGFC 3EA0A 5K6AA 1YULA 3PQ4A 2O8CB 1BWRA 3GY0A 1F6BA 5EP2A 1D1QA 1TTHA 3HWWA 4GIBA 3FJ1A 3V2GA 2MR6A 5DDIP 1YUNA 2NYVA 2A7XA 4KGVA 4LJ6A 1FMCA 4EHDA 3C39A 1N0IA 5TVGA 3HLKA 4QYIA 4ZVNA 3GFVA 2FZKA 1ZDMA 4TMXA 3TVYA 4GI3A 4DDHA 2J3JA 3VSDA 3GLGB 3OQNA 5EWLB 3LXUX 1A9OA 2J31A 3JWJA 3RE1A 4GX5A 3PDJA 1RAAA 3D3KA 1UT8A 1RYNA 4M7OA 3WQRA 5KWSA 1E66A 1LSJA 1V3TA 3KT8A 3PC6A 1U2SA 4KOAA 5DNCA 2Z4TA 1L8XA 2LE0A 3C1TA 2DUUA 2FTKE 3LUSA 3IVRA 5GMOA 3UGTA 3UPTA 1BFUA 4B7CA 1UK9A 2EGHA 5ITVA 1CUUA 2EBWA 1P6XA 3IULA 1FTNA 3OY2A 4RF3A 3FHCB 1YZKA 4GLOA 4DLRA 5BNTA 1DLJA 1IPEA 1Q20A 2CJPA 2OCKA 5GGYA 4A2WA 1JT2A 4NYIR 3MGGA 2BUCA 2GCIA 1XU9A 4BLWA 4KQIA 4F9FA 3KKPA 3ZI4A 2AUMA 1F2UB 4UM8B 4E32A 1RIFA 2IH4A 2RIRA 5AXAA 1STOA 3EWSA 4KPYA 1Z68A 1CR4A 3VZBA 2BRUA 3RFCA 4JYZA 2Y67A 5A2QA 1P1HA 1VXRA 2VCYA 3MJRA 3LHIA 4JL8A 4NU6A 2XMRA 3RYCA 3FOWA 5CURA 2YS7A 1DKNA 3GGCA 4I99A 5FADA 3RROA 4ZK6A 4UFOA 1G38A 2A9VA 2OXTA 3VC2A 3JYPA 1XCGB 2EP5A 2JLAA 3BMOA 3C41J 4K26A 1O6GA 2OB2A 3W9BA 3QTTA 5IJ9B 4ME6A 1X6VA 3Q7IA 3NJ4A 1AO3A 4Y8VA 2A57A 4XTRA 2FWPA 3H2TA 1J2EA 1T9GS 4I1PA 1HORA 4PYMA 1V7QA 4EI2A 4YMGA 3FZGA 5KO2A 3RKSA 4B6PA 3DVAA 2FEWB 2MSLA 1R5BA 4YUVA 3O2EA 2F4NA 5AK4A 3SXUA 2ZSUA 4NZ9A 1JHXA 5BQ3A 2ASEA 2ZT5A 1ODIA 1FNCA 1TYAE 1Z4NA 3A6KA 1LLCA 5CIWA 1B23P 4OY3A 1JHYA 1M2KA 1M83A 4JBXA 2DUWA 2B3DA 3WP1B 3I5UA 1JR3D 3HBAA 4ECEA 3W8DA 4MRSA 3Q8MA 1QG0A 3JR7A 1G20B 3CO0S 4E51A 1C7IA 1ZN8A 2XADA 2Q4EA 3A1WA 3AU8A 3Q5DA 1H23A 1M2VB 5MFPA 2D3WA 4BU0A 3OX3A 4NKRA 4FJ0A 2OK8A 2JMPA 2WYHA 4UATA 2FZLA 3D1LA 2NVWA 3F7MA 3V5NA 4DABA 3UPDA 4RU1A 2EW1A 4RH3A 4ZO6A 1LF0A 4ARCA 3UTCA 4DR7B 1Y8RA 1LPSA 1O77A 5DJ5A 3ZJ5A 3F6PA 1S2LA 2OO3A 2P6NA 3IBSA 4PFKA 1QYDA 2OKGA 5SZJA 2FA9A 4HNGA 3FKSD 4WDQA 2VP6A 5IM4F 3II6X 5EUQB 4IX1A 4FFSA 4MS3A 4YRCA 1Y1TA 2AI3A 1YBAA 1XL0A 4MUFA 3D8SA 5HMLA 4LOJA 4WPGA 1UBOS 1JAIA 2YJNA 4G5RA 2F55A 4RHYA 3W3AA 4FR2A 5A3SA 4LCBA 1H2EA 1AZSC 4DZRA 1UBLS 5AVJA 1OI3A 3BQNB 1K0UA 3WX0A 1H2YA 4DADA 1OSNA 1HNWC 4DQUA 1JEOA 3ESYA 3FSGD 3IE2A 3MPOA 3QV1A 4IQ8A 4U2FA 3NHAA 5AI0A 5CFPA 1JIVA 2XKBA 2BSAA 4FN4A 1FRNA 2V6MA 2FGKA 5DN6A 4UUAA 5JD5A 3CSUA 2VHUA 2WFLA 3LAXA 3X2FA 2PLAA 1PJCA 2Y4NA 1NLUA 1QYVA 3DDZX 4KYTA 2H8KA 2PYIA 3V8BA 1EI9A 2QUZA 4BMOB 3EXFA 2HO4A 1JSXA 4BBZA 4LJLA 2XMSA 5JROA 1PGOA 2HV9A 3R6TA 3I58A 1PU1A 4PZYA 4QTUB 1TADA 3DMGA 3LCRA 1PFGA 4ZQBA 4BNGA 1TZJA 4BZWA 3LDHA 1FFYA 4DG9A 2KBEA 2Z95A 3PFBA 2YOHA 1RE1A 2ZSEA 3B6IA 3N6RA 1UFVA 1X86B 2ZVDA 4IWYA 2IA5A 1CG6A 2FE4A 4XAQA 1UDWA 4P3OA 5CMLA 1TKRA 3U1BA 2J6HA 4PG5A 4ALIA 3M4YA 4OHKA 1GZUA 1LLQA 4F2HA 1XCLA 2QN8A 3W1EA 5D3MA 5FPSA 4RPHA 2BEWA 3VQTA 5INTA 2O2EA 3KSBC 4QU8A 5AUNB 3V1NA 1EK6A 1NF8A 1PFWA 4JY7A 4QIHA 1RQ2A 2R60A 4X91A 5D5HA 2DWUA 5EJIA 2FPRA 4HD8A 4LSMA 3WQQA 5AW6A 2BHTA 1E7MA 1M2OB 5DHTA 3ZWDA 1WB6A 5MGNA 2JARA 1OX4A 2VNSA 1CYEA 2GRAA 2YOGA 2XA2A 4ENQA 2A5GA 5KDDA 3EDCA 2HXSA 3TL3A 4OU4A 2J6CA 2GH1A 4CGYA 3DFUA 3PRHA 5JRJA 2WPDA 4ZYTA 1R8XA 5B57C 2A92A 4H7KA 3UHOA 2XTZA 3VNAA 1O87A 3G9QA 2ONFA 1OF1A 2PEYA 4DV6B 2C1ZA 1Y3BE 2TMDA 4HNVA 2V59A 3H5VA 4P8RA 4URHA 3DOEA 3KC2A 4DMRA 1H2HA 3NNNA 1RJDA 3OE5A 3W6ZA 5IH7A 2WTUA 4I14A 4M86A 2AGVA 4X8OA 2P9QA 4KXUA 3EXHA 2B82A 2ZBDA 4QBFA 5IYZB 1B0ZA 4DM4A 1GU0A 2PIAA 5GV8A 1SUEA 4BYGA 1TEZA 1ODTC 5LUBA 1ZN9A 3MCTA 3OQPA 1HDIA 1W49A 3S8YA 1SXQA 1SH7A 2GVDC 4EECA 1QTQA 1CUGA 5DGTA 1J21A 4OMUA 4ZO8A 4BLQA 5LOVB 2HIHA 3ILVA 4YRTA 1YBMA 4C6HA 3KZMA 4UNQA 1U4OA 3DE3X 5EZ6B 3QSYA 3H0EA 4XUGB 3GFPA 1SU8A 1Y4ZA 3G5TA 3VR3D 4LBVA 1N1MA 5CVEA 3OE7D 4OQXA 4A0SA 2CMFA 4V0MA 4EY4A 4EW6A 1NNSA 1KEZA 5CXXA 2VNHA 4UCFA 4XYMA 3VO9A 4HB3A 4KRXA 3R75A 3H1TA 4JJZA 2V4ZA 4A2PA 4C7KA 1UPBA 4F84A 3MFQA 1VBNA 1V60A 4RGQA 1SUDA 4JJ4A 4LVUA 3HUFA 4MLDA 5KYWA 1FP4A 1W2HA 3PNSA 5TJHA 1YZHA 4EG5A 3EYWA 2CZGA 4P86A 3QELA 2EQ5A 4Y2GA 3A6DA 4QSHA 4Y9TA 2PNJA 2AOVA 1OREA 3SBXA 5DI3B 4Y9SA 2BV3A 3OEYA 4XZ3A 2GDJA 3BN3A 3OIGA 2IZ7A 3TGWA 3GFRA 2V55B 1GTVA 3MF4A 4JI0B 3TUJC 3QITA 1TK2A 3IERA 4OIMA 2Z04A 2P9TA 1BXKA 4P1ZA 2HPAA 4BV2A 5KC9A 2JFFA 1MV5A 1KTIA 4PGFA 2R6AA 1XTQA 1RM4A 1XRPA 4X94A 3RUDA 1X74A 3FM9A 5E0OA 4JLMA 3TEMA 3ZUPA 3IT3A 5KTNA 3P9KA 1I6LA 3ZWQA 3PJDA 1FNNA 4OV6B 1W4ZA 1YHYA 2P3QA 4M1QA 3ZJVA 1B3BA 4ZWNA 3T15A 1KO8A 4DNFA 1ZO8A 1I0LA 3F97A 1I0ZA 1NP3A 1Y7PA 3GCGA 3VDQA 4CMHA 5EHZA 4YBZA 3TW6A 4O4HF 1QV7A 1YQUA 2HL6A 3H1PA 4AJOA 1GWNA 1DADA 1IDN1 1U7PA 2FE1A 2JRCA 1DJPA 4J43A 5HGJA 2GEJA 2HIGA 3DT8A 3MGCA 3R5HA 4C4OA 2OV8A 4CTJA 1NR1A 1HE4A 1Z33A 1CJCA 4N39A 2ODNA 3FVTA 4GKVA 3SZMA 1NKTA 1J8VA 3ED5A 1T1JA 4JP8A 4CCYA 2Y6UA 1QANA 5JSFA 4ZCMA 3BMQB 4YJ2A 3M6FA 1ZUHA 4F3RA 3UK1A 2I1QA 4EHBA 1U8TA 2JHGA 1F51E 3KQMA 4WKBA 4Y9DA 3GLIE 3WNZA 3SQNA 5C1BA 2VHQA 5L4SA 3IA2A 3ML1A 1J8YF 4TL6A 4BAZA 2EQAA 1C3VA 2XV1A 3CEAA 4WK4B 3RSHA 2QD2A 1VQ1A 1QO0D 3KSDO 4QJ4A 2PEZA 1V3VA 4I1RA 2OESA 5AWFC 2J9XB 4PC6A 4UBJA 3DW3X 2J32A 1DWQA 3IDFA 4NBRA 4XGIA 4E6EA 5DE3A 3RSLA 1XLTC 3GRVA 1JN0A 2CHQA 4QA9A 4MPDA 1U2QA 3D2AA 3IP9A 2VDKB 1NR5A 3FMGA 4UQOA 1HWYA 2DQYA 1WVGA 4M54A 4PX5A 3N7AA 3ANXA 4Z0NA 2FHSA 5KTMA 1OB2A 1U6IA 3EXG1 3SK0A 3SIWA 5A3QA 1RTTA 1OFGA 2IIBA 2CL5A 2W2NA 2WG1A 2C99A 3KHKA 4ND6A 3AB8A 2BBOA 4H2DA 1USPA 2CYCA 3FBGA 2G9RA 5F1PA 3NZEA 2E4WA 4GEGA 5J4KA 4EITA 4B3SC 3BORA 3QWHA 1VMKA 4Q6WA 2JBAB 3ETEA 1N4DA 1OV4A 4TV8A 2PGJA 3EEQA 4LRTB 1LLFA 3TG8A 2IY7A 2FEOA 3FDZB 1PYOA 2OGTA 4BNUA 2C5FA 4CQMD 5JAUA 4MUEA 2NPIA 4IEFB 1PZNA 1ISHA 2D2EA 1JDNA 3LWZA 5HUQA 1AUVA 2IXGA 5A04A 2ODTX 1NVBA 1R15A 2GJ8A 1FU7A 2V7EA 4KHZA 1ZD2P 4WNIA 2NYAA 3DXXA 4GMFA 2YIMA 2EXXA 4JJAA 1ZOIA 3KBBA 3INGA 2WIGA 2QROA 4XUCA 4E5UA 4RXTA 4F5WA 4H1UA 4OHWA 1UDCA 3SXPA 5A5FA 4EEXA 1M5TA 1W4LA 3EZNA 3D0QA 3N8IA 1Z6XA 4LAFA 4MCAA 5ESDA 5AXCA 4CTKA 5A9SA 1OXTA 2X0JA 4WOCA 1TIPA 4P0PB 4Q39A 1GQOA 1E96A 2HBYA 3AKZA 1ZI9A 5I8ZA 2B6NA 2HWKA 4MWSA 1OZGA 1SD1A 2G71A 1LQUA 3O8QB 2Y4OA 1C80A 4UE3S 3U44B 4CNQA 2ZEJA 4OXQA 4EATA 3ZVKA 4NXMC 2DWPA 4QXRA 5KOYA 3R5KA 3U62A 4RKQA 5LP6A 5AR1A 2XCTB 1R00A 4L22A 1AF7A 1RQPA 4C3VA 2OPHA 3U61B 3MUEA 1YS7A 2Z5GA 3D9QX 4FBLA 1QV6A 5ALSA 1Y80A 1U2EA 1YONA 2WB2A 4Q3BA 5JJBA 3K8ZA 4QRHA 1KAHA 2ASVA 2GESA 1VHDA 4N7RA 5JCOC 3BAFA 1V7ZA 3D8RA 3RSQA 1PUXA 3OTIA 3TIIA 1AUXA 4R16A 4G0YA 4QOSA 4GDMA 4F8EA 1ZR4A 1FTYA 5K0JA 4LVOA 4E5VA 2PXXA 4AJPA 1WCIB 3DVSX 1GITA 3NDRA 3LZDA 1ADYA 1ZB9A 2J5QA 5BWNA 2VZEA 3WBFA 4AY5A 3MERA 1T4CA 1EXNA 5HKKD 5CDHA 4IIFA 4JKIA 3OLYA 1VXOA 4EARA 1MAAA 2W5UA 3CBGA 1XROA 3AQ4A 3GGGA 4MS1A 4GE3A 1H9BA 2CLKB 4GBJA 4IPTA 2A78A 3EOZA 3RHSA 2FW0A 4D8YA 3AEZA 3DFKA 3HNRA 3KAJA 4RPCA 1EZ1A 1BDMA 2C5SA 2X5OA 2XXJA 5CJJA 4MB2A 4BECA 1SCKA 1DCMA 1U6JA 5I4CA 3E5MA 4LFBC 1NMQA 5CZVA 1AHIA 1M72A 2I6FA 3OQOA 1QGED 2EKLA 1KFEB 4II3A 1JEYB 1AJEA 5T41A 5BNWA 3FZNA 1H8HD 4K81B 2JGFA 1DJOA 5CFRA 4FFWA 3M70A 1DKQA 1DMSA 2FZWA 3IFSA 4FPXA 5DWQA 1D09A 4G5HA 1OPXA 4RESA 1X1DA 2CFSA 4HWOA 3WMGA 2IP4A 5C5IA 1SU6A 1SVUA 1DHTA 2AJ8A 4UC0A 2HREA 2X9QA 3JRWA 2I6QA 3FDJA 4IRMA 2BEUB 3ZDRA 1TVKA 3COYA 4PLHA 4CLEA 2JF0A 4PYRA 1VEHA 2F3SA 2SCUB 4YQZA 3ZW8A 4B6JA 4M2LA 4RWZA 4AMUA 4HXYA 1GQ2A 4K6FA 2QL5A 4IXNA 1IJFA 2VXOA 4A03A 2V97A 1E98A 3I9JA 2GARA 4D92A 4LNUB 5AUQA 4CLDA 4LF9B 3OE7A 3GRZA 3UX2A 1E99A 3L6EA 4MWGA 3MTEA 3RFXA 4MTNA 3MTQA 1ZH8A 2ZSDA 1URPA 4HS9A 4TKUA 4RSGA 2EDAA 4JI5B 5KNBH 4N48A 2Q9CA 4OB7A 4LKRA 5ALUA 1F0PA 2FZEA 3ZU6A 3ENNA 2YJ3A 4TWAA 4D4HA 4DCPA 5T4HA 3PHBE 3TPZA 2OZLA 3UV3A 2F1IA 1TVCA 2P30A 2HMTA 1TK3A 2AHOA 2VQDA 1KE1A 1CUVA 5IXYA 3NWBA 1R3DA 3JQBC 3CF2A 1OH8A 2P2SA 2OCDA 3PKIA 1BEZA 1K08A 3N2QA 3E27A 2QX4A 5ARDA 5GWXA 2ZROA 4Q82A 4DRXA 5JFOA 5LVAA 4XYBA 1TF5A 1HT3A 3L7YA 1C30B 4FNAA 3O94A 4X63A 1YS9A 4X7PA 4F1KA 1U7HA 1V48A 2GAAA 4DV1C 1FFSA 2O2CA 3IEIA 2C57A 4XLTA 2XB2A 1QQ5A 3KU4A 3ND5A 2Q62A 5IPFA 1WBJB 2OBMA 3R77A 1RRFA 3OPYB 4OFXA 2BKXA 3TSCA 3FGNA 1VOTA 2ESRA 2IU6A 2XDQB 2HDHA 3KYIB 3MOSA 3FXAA 4UUMA 4D26A 2ATWA 1N2BA 1WXHA 3EEYA 3FDFA 2GD2A 3H5WA 3H8VA 3QEMB 4FKBA 4KK4A 4ZAVA 1Q77A 4MW4A 5AVKA 3NYIA 4QGSA 1NVMB 1GNVA 1ZVJA 2VPIA 3N2YA 4H7PA 2C3MA 4I5GA 3X1JA 1UOPA 4YREA 3VM6A 1OH6A 1LPBB 1II8A 1HZZA 3R7BA 1Z0FA 1IHDA 3G0GA 2Q7OE 1HNWB 5CPFA 4BWGA 2WP8J 1VFNA 1L5MA 3FWHA 4BZPA 4C7JA 5BVHB 1PEKE 1V9LA 2D62A 1XQ9A 4LDZA 2G6TA 2FKNA 1J9GA 4KTTE 1QNLA 3H9CA 3DZGA 3DBOB 3UWOA 3QVGA 4TMVA 3OQHA 3N5CA 1UMCB 5ALVA 3KS9A 1Q7EA 2V03A 4PO3X 4YJ2F 2QIOA 2GLUA 2EERA 3OT1A 1GSIA 3IP7A 4G67A 1N2CE 4GQBA 4UVEA 3FETA 3UXEA 3I92A 2X13A 1WMSA 1QYCA 1E6MA 3GJ8A 4N0QA 4B87A 1J99A 3FUUA 3OPNA 2WJJA 2HTEA 3IVAA 3BDVA 4DDKA 1RKVA 3F2IA 4GMXA 4TVKA 2Q1YA 1Q11A 5K3BA 1YUMA 1IEXA 3EPHA 1Z4MA 4NV0A 1J2UA 3RK1A 2DWOA 2GYUA 2OD7A 3CH7A 1E6UA 1S2DA 4LRWA 4YBRA 1UDAA 3ISVA 1KEEB 3L79A 2OPLB 3BGDA 2VDQB 3OKFA 4K0BA 1G4UR 2DQ4A 2RJOA 4MS4A 4PS1A 5KOIA 3ZD6A 5LZ5A 3ITEA 2IYZA 1WZNA 2FJ0A 4D4GA 3E84A 3N8DA 4LDPA 1PEAA 2Z8ZA 2QN7A 3OSZA 3ADCA 2QNRA 4E3WA 1Y7LA 2QLNA 3F78A 5K8JB 4ZAFA 2VDPB 1KRHA 2XMBA 3MIZA 1QZTA 3CLKA 4DYDA 3R5XA 4ZPJA 4OQLA 5G0TA 5IS2A 2EQBA 3R24A 4H0NA 1FYDA 3LY9A 2NVUB 4CF7A 1G9TA 2QRJA 3DAYA 4JI4C 3EISA 4RVFA 3EXEA 3TCXB 1Q2UA 5EXDA 1YK0A 4QICA 4HFNA 1DCTA 2XXAB 2RBEA 1Q14A 1DBWA 1SVMA 2QE6A 2REOA 1C3OA 3VXKA 4WHMA 1KR2A 1JNXX 3DD1A 4Z7NB 5E6SA 2PGLA 4G8JA 4TKLA 5B4UA 2ZRHA 2HJVA 4NL4H 4YRBA 1ABBA 1SVIA 1GD1O 1Z56C 2C82A 2W6CX 4J9UE 4QDUA 3DZHA 3LGSA 2V8OA 4FCWA 1IAVA 4ZT4A 2OFFA 4WXPA 3O26A 4QBIA 4BRSA 3AKDA 2YC2C 1CS4C 3GOHA 3TLZA 3VI3B 4QARA 1DOAA 1IY8A 1IHPA 3PCXA 4ZMSA 1W88B 1A71A 1JDPA 1JQ5A 2PA3A 3U81A 1O94C 2QI9C 2FETA 2BEVB 3NUQA 1TYEB 5DX0A 4I4TB 3D3JA 1RZVA 4QBTA 3T6KA 3R4CA 4MICA 4UOQA 1YOVB 4WY5A 5EP3A 1MC5A 1GGNA 4LXQA 4X7RA 3FA2A 3NVAA 4FQ5A 3SOPA 3LO8A 4CT5A 4LSGA 3DONA 1L6IA 2IIQA 2BFPA 2ZWIA 1A2OA 3MRVA 4LRYA 3FJYA 2NSDA 5G1NA 621PA 4N41A 3B8HA 3UKDA 3CLRD 3NIBA 1CUSA 2HPHA 4XCQA 3WKDA 4AMBA 2PANA 3PUYA 1JPVA 2WZBA 3WK6A 3JWEA 5TS2A 5LP6F 1EWKA 1TB4A 3O2JA 4WESA 1K7YA 2I5PO 3SQOA 4AUMA 4P4SB 3O8RA 1TUBA 5HTKA 4BMPB 3CT4A 2OAGA 3U4QA 4BFSA 2C97A 4PZ0A 3T4PA 2JJMA 3RSCA 4NOKA 3RVSA 4EUHA 2B20A 2ZJAA 4JT8A 3TXAA 5DNDA 4D46A 5GJCA 4LWPA 4M1YA 3H0CA 4WY2A 1PRYA 3K0BA 5J1SB 4L4SA 5M04A 2OAQ1 4EI7A 3ND8A 3K8YA 2GKSA 5CW2A 2ONJA 3AEQA 4AURA 1DUSA 3IUSA 2BD0A 4D79A 5HKKA 4JI3C 4LGCA 2O59A 1BTOA 2JH8A 4HX5A 4R2IA 2KW5A 1DTWA 3RRNA 1PKEA 3ZXIA 5AO9A 4TN5A 1HNNA 3GU3A 4M8KA 3WGIA 4Q9AA 1SZCA 2RH9B 3HKDA 3AESA 3EWNA 2I6SA 3GA5A 4ISBA 5TARA 2MYPA 4ZREA 4C6TA 4EY7A 2O0MA 3H9GA 4P3PA 1C29B 2BEKA 1P8JA 5LZ7A 3DWIA 2J3KA 4P81A 3R3VA 1X0VA 2OP0A 4Q1FA 4O4JB 2XDWA 3LXMA 3W5VA 4RHTA 16PKA 4ZT7A 1K88A 2PG3A 3FSEA 2OBBA 3BE8A 2GQ0A 3B85A 3GVPA 2IUTA 4N0EA 3FOAA 3DE5X 2DPLA 3HTXA 1UEXC 5K3OA 3D5TA 2HCRA 3ZCUA 2PS9A 3M8KA 1SCDA 2HFKA 2GPTA 2JHCA 2P4SA 4B76A 1B93A 4MI1A 4DGSA 3AH8A 1TEXA 5JFGA 2Y1LA 1CFZA 2NT3A 4DJJA 1Z63A 4EB8A 4DQDA 3U40A 4KXMA 5EUMA 4AI6A 3TLJA 5KNCH 1PU2A 4H0CA 1NV9A 2YV5A 4JSRA 4IILA 3ZNQA 5JJIA 3NOXA 1JSLA 3HP1A 4CTOA 5JCXA 3OAAD 1SCQA 2RI0A 3DKVA 3EZLA 3KDPA 3E7PA 4OK3A 5A9RA 1QFSA 5L95A 1MA0A 1AMNA 1XZ8A 4OUKX 4UJ3A 4ZYVA 4LFBB 2PL9A 4ZYUA 5DM4A 4CM5A 2NADA 1GPYA 3H1AA 3WGZA 1II0A 4BQIA 2H9IA 1B0PA 1K89A 4D97A 4LK3A 3PC7A 4DB4A 3LHKA 4COKA 1GL6A 1CEYA 1WSWA 3CR3C 3UX3A 3L4SO 2IYWA 5E7MA 3G8AA 4U0KA 4H1HA 4DUGD 3ZDCA 4FMCF 4KN5A 4JA2A 1X7WA 2LGJA 3E7DA 4HB2A 1AY0A 1H05A 4N8EA 4ZAZA 4LHZA 1YI0A 5DHRA 3WGUA 2P6PA 2R4UA 1KO5A 1PEDA 4K9LA 1PT7A 5FLYA 4CR7A 4MW5A 3QE2A 4L9SA 4DJ5X 3OURA 4UMDA 1E1NA 1QVAA 2Q5EA 1Y6RA 5EXSA 3LP5A 1XEWX 1HPLA 3PC4A 1T4MA 3N2GB 2JIRA 5EJ8A 4NU8X 3AVOA 1BXZA 3W4IA 4BQNA 3SM3A 4EDHA 2DSTA 3P0EA 2NZ2A 1QU3A 1CEEA 2EP7A 4X66C 3I6ZA 2MM9A 1CR0A 1KYVA 3PC8C 3T7RA 4IXDA 2G7ZA 3RVPA 2OMKA 4ILEA 2BF7A 1WBBA 4K1LA 2RARA 2A35A 2Y93A 4MA4A 3GLRA 5GONB 3DDUA 4Y1EA 4YMHA 1XV5A 1VHWA 3SF0A 1I51A 2HH9A 2CVQA 2P27A 4ZDKA 4CXMA 2FR8C 3UXHA 2XEXA 3CJTA 5CVJA 3FHLA 2QM8A 3GC6A 3ANYB 5A7HA 3LMKA 3QU9A 1PWHA 1TQ6A 4UPVA 4MTCA 2CVOA 4F3TA 2WKWA 3BIOA 3PPVA 2V1UA 1CCWA 2Y6VA 3ZHUA 3L5KA 2OC4A 1ZK2A 3AUAA 1L8QA 4V0RA 2X1HA 3NWOA 3MLBA 3NLLA 4CUKA 1Z2CA 4CT0A 3QYJA 2FMXA 2OOKA 3I01M 5JZOA 3LWNA 3BL6A 4MLCA 4BKUA 2CNNA 5LIPA 3WI7A 3D1JA 5T5QA 3NHMA 2QTZA 4NDAA 2FPGA 1US8B 4ETNA 4LJ5A 1JVSA 1PFYA 1RAIA 2VXBA 5CX4A 3BZUA 4OHYA 1KVRA 2V5UA 2FU5C 1YR8A 4B85A 3QG1A 3NORA 4BIIA 1FRZA 1VRVA 5BR8B 2C9ZA 3ZBPA 2R1UA 1C0KA 1W2GA 1X9IA 3KT6A 3ZD7A 1XPUA 5EHQA 1FDOA 2Y0BA 5FBLB 4FMDB 4BP3A 1TEHA 4E2XA 4BEJA 2OYCA 4N7JA 1G2QA 1KC3A 1Z0UA 1XVUA 4DXHA 2VYVD 4II2A 4YQYA 1E2IA 3CKKA 1G6Q1 3UWPA 4IMPA 2RG7A 5ESWA 4OXNA 5BV1A 2FWBA 2JIBA 2OV2A 3ORRA 2OD2A 5BQ5A 5AW8A 2EC5A 1NRXA 4DSTA 3GJTA 4RF4A 1FMFA 1KQPA 1HDXA 2QTVB 1JGTA 5BN5B 2N1BA 5DXAA 5JXJA 4MQ6A 1XTKA 2GETA 1RFGE 5LB2A 4CU2A 3JZMA 5FP0A 1DP4A 3ESAA 4LBWA 3ZNNA 4AG3A 4DLLA 1U8YA 3HSYA 1IU9A 3L6DA 3UJ6A 4E3ZA 5BT8A 5LDHA 2YHAA 3LBIA 2JANA 3ZTWA 1SPBS 1ZJYA 1Y6ZA 2VATA 1CJSA 4IX9A 3MMXA 3D02A 1FL9A 1EFDN 4ZO4A 1FDWA 3CVXA 3OEEA 4Q4LA 3OQVA 4EJMA 5J2TA 2ZGVA 2OWEA 3IR7A 4UM5A 5HG0A 2Q07A 4KE8A 1T9DA 3IELA 4K9KA 1T6BY 4TZ6A 3ND6A 4DLUA 2CNBA 2I8LA 2OL4A 2H11A 1ZL0A 2ZM5A 2O5EA 5BUQA 1HFWA 5JOQA 3RHFA 4FUTA 4C06A 3WSTA 1QE0A 2FW9A 2BDTA 4BLTA 5I3ZA 3QVOA 3H4MA 1EJBA 2FK8A 2K7ZA 3MWDB 4G5GA 4MYCA 4AKHA 1V5WA 4PAMA 4US2R 5B3AA 1R8SA 1W1IA 1QTNA 4PRZA 3ROMA 2V74B 4YONB 5JARA 4N1AA 2XYQA 1GTL1 3GGDA 1I13A 2NPOA 3KLPX 3HO1A 2XE8A 3GJSA 3H3XA 3QTBA 4DL9A 1EX7A 2G1KA 2BI4A 1TMGE 4GT1A 4JAVC 1P1CA 2R9VA 3IUEA 3VR4D 2FCRA 4DJTA 3OCXA 1SCAA 3B1ZA 1OFHA 4ESHA 3TSZA 1EHCA 3HBMA 3UFXB 3BFKA 4B3GA 5JAHA 2PT5A 4RIHA 4YT5A 4YT2A 3MB8A 2YWBA 4IGKA 1OTHA 2PX3A 3IJEB 2QVBA 3R7WA 4I1SA 3LY7A 4OKIA 1G5TA 2HMYB 2B4RO 4RKYA 3BCUA 4WINA 5EXTA 4JXZA 1GLGA 2QUBA 4NABA 5FOTA 3KQKA 4G63A 4CQNA 4PIPA 2HUPA 1BWPA 2ODPA 1PK8A 2WQ7A 2JEZA 4PW0A 4YRPA 1MABB 3KDAA 1BDJA 2Z2JA 4HAUA 5REQB 3ZHZA 4ZI7B 2WWHA 4OI2A 3TEFA 1NM5A 4MK4A 4AZWA 3WAKA 4LX8A 1E5TA 1IOLA 2P79A 4DV7C 1D7AA 4DV1B 2CHEA 2WWGA 2IX3A 1KS2A 1AUOA 3IR5A 1UC5B 1WUKS 1CDDA 3AIIA 2IHKA 3DFZA 4Z5XA 4HDSB 1P0CA 5D51S 3RUIA 2C2WA 3WSWA 3KALA 3ZWKA 2WMYA 5CG1A 5E2IA 4A5OA 2UXBB 1DT3A 3HB1A 2CDNA 1OC4A 2QGNA 5AYVA 2QL6A 2WI8A 1KRWA 3GRYA 1FFCA 5DX8A 2VSQA 1XHEA 2ZYUX 1KU0A 1MH1A 3CKYA 4PYOA 1GNPA 1EZZA 3K35A 3C6YA 3LQ4A 2J1LA 4XPIA 3VYVA 5KOJB 1A88A 1VPWA 2I9KA 2B6HA 1ZI6A 1WEKA 1EGQA 1OH7A 1PNTA 3AF2A 3FNQA 3RRXA 1ZG3A 3P26A 3CG0A 4WUTA 3SN6A 3KYDA 4A73A 1A4IA 5IU6A 1MKYA 1U0SY 4JP5A 3GK3A 3TJMA 2KJQA 3QKUA 1QYRA 1Y6GA 3SP1A 3PDCA 1MC8A 1ZJZA 2GAOA 3QU7A 4JL5A 3GQBB 2AG1A 3DMYA 3FTQA 6Q21A 1I4TD 5JS1A 1VKZA 1XTPA 1YZTA 3BWCA 3RSGA 5I5GA 3TIFA 1Q1EA 2PBLA 1JJIA 2O2XA 4PBSA 1GPBA 3I8SA 2WSSD 1CY8A 2ZW9A 5JO0A 1NE2A 4BQRA 4EY5A 1RXWA 2ZJFA 4ZZ0A 4OGFA 3WKAA 4MPRA 1MOSA 4MQLA 4KREA 2JLRA 3BB3A 4GXTA 1NDHA 2UZ4A 4XSHA 4OLFA 3K16A 1P9WA 2QA5A 3SIRA 2NUAA 3TLKA 4GP7A 5BWLA 4NZZA 2L2QA 3D3EA 1EUCA 1X19A 4H7EA 2AVNA 2PXCA 3D4BA 5FV7A 3VYTB 2A58A 4CCAA 1PZEA 1Z7WA 2G06A 3BYZA 4J7XA 5LQSA 2GS9A 2R85A 1ID1A 1XO1A 3Q10A 3WRYA 1VDMA 2QT1A 4MQUA 2AFIA 3O7MA 3QVMA 3BQ9A 5BVGA 3A1NA 4PAGA 3IIMA 3U4CA 4MV4A 1VP9A 4KQEA 3D6JA 3JS5A 4CCYB 2Z1DA 1W1WA 3I2JA 2BTQB 4H6PA 4BO2A 2HRZA 3FTDA 2TS1A 1Z0AA 4DUYC 3BL5A 2OYRA 2LZ0A 1QF9A 3UOAB 5NULA 5AW7A 3G2JA 3KHUA 1NE7A 4P4GA 4Q7JB 2YTZA 1HFKA 4GLLA 5FFNA 1FYVA 2W2TA 4JJKA 4AFNA 1M5RA 4YJKA 4L3OA 4S2UA 5AQEA 3IDOA 1ITZA 4OAQA 3SEZA 1FUIA 4DUZB 1E7RA 4LX0A 4Y6OA 4V0OA 1WUTA 3P45A 2IXEA 2J0SA 4QJ3A 1EJ2A 2YJ4A 3C1UA 2VHZA 1PQUA 1NLFA 2HHHC 5ADZA 1X9HA 2BGLA 3HH8A 4J9VA 2H52A 5IAJA 3SAJA 3WQSB 4DPMA 3HLYA 3A1VA 2DH6A 3W2HA 2HFJA 5HKAA 1XELA 2ZRDA 2NU6A 1V41E 5TPWB 1BX3A 3TRFA 2J07A 3DOHA 4EENA 2WG0A 4M55A 4NS1A 3V2UA 1C1DB 2O2DA 4HH1A 3VPGA 4Z54A 1XPOA 3H2IA 3EBLA 2WYVA 4N01A 1PJSA 4E12A 4EB6A 4QD3A 5F4BA 2QBYA 3D6TB 4TXNA 1VHJA 1Q16A 1OU4A 5DHQA 2V1XA 1Z22A 2ZAYA 1V11B 1PG0A 5FLXA 4L5BA 4TV8B 1IWBB 1ID8A 3L9XA 1XNRC 1RY2A 1ZLYA 2JJ1A 3GAFA 2FMHA 3KXKA 2CE2X 1EWQA 2LKDA 1PT5A 1XRRA 4X6UA 3RS8A 3H6GA 5JO9A 2CLOB 1DRVA 3A6JA 2ZBVA 1JXAA 4HY3A 4GXQA 3GKUA 1BDBA 1E9FA 3PR2B 4MW2A 1EP9A 1OBVA 1SPXA 4WK0B 3CWZA 3U9TA 5A2GA 3AP1A 6GPBA 2C2ZA 3SZRA 5GJBA 1I2BA 3QHQA 3B52X 1Z0KA 2C98A 3OPVA 2O7QA 2H0AA 3B38A 2NZUG 2YRFA 3RWMB 2PYDA 5ICCA 2D2XA 2DTDA 2QR3A 3QY0A 2EARA 2B8TA 3O83A 3SEFA 1WZ2A 1U3WA 1BKDR 2YWEA 3UATA 1YHNA 2Q4OA 2EKZA 1D1SA 1I5OA 2ZT6A 3B5EA 3EYAA 3L93A 2ILVA 2Z56A 1Y1RA 2FEMA 1Y5IA 3QE3A 2JA1A 2P7IA 3C8ZA 3E3NA 3QP9A 1CDOA 1Q0ZA 1JKJA 1JBQA 4LF5C 1EDDA 4O2RA 3G1UA 4FFNA 5EQDA 5ADWA 2CU6A 4BV9A 5K4GA 3U6BA 1KBOA 5ILQA 1TTTA 1DXYA 4Z6KA 3STXA 1WM1A 5B1EA 1YR2A 1WU8A 1K98A 3JZFA 3WADA 5AVYA 4BUZA 3QX8A 1N6KA 2Z9DA 2WWIA 4QOGA 2QTMA 1OXMA 2IC5A 2Y1WA 3QYAA 4J91A 1R0RE 5SICE 4J0KA 5J2TF 4X1IB 4PXYA 1UWVA 2XNCA 1IE3A 1ZSYA 4X45A 3SGLA 4NK4A 1LK7A 4KR9A 4DMUB 3BX1A 2VQFB 3DDSA 1VJGA 3AYZB 3DBRA 5ALKA 4TMZA 2HA3A 4K5QA 4HATA 4OF4A 1Z88A 1RD4A 1Y8QA 4URWR 4MIOA 2BBSA 2ZJ0A 4E5YA 1AO0A 2PRSA 1XZEA 4UTOA 4ZOLB 3H5OA 2IZZA 3D8HA 4TYWA 4LE5A 2I4LA 3SHQA 3F8TA 5TJ9A 3UPUA 5E8RA 5HIAA 1H69A 2UDPA 4TTAA 2DHRA 5EA2A 4BV3A 2O54A 1G8KA 3PXXA 2GWRA 3LHFA 2YY5A 1B2LA 2E8EA 4MA5A 3DOIA 5CCXA 3LUGA 3NTVA 1OBHA 4A6EA 2F8SA 1T36B 3TFQA 1CF2O 3RIGA 3OJEA 1YHZA 1G8JA 3EEIA 1KI3A 4I08A 4J0IA 1GEEA 2DFNA 3VO8A 3O4VA 3HG7A 4N47A 4TMWA 3TQHA 3WVNA 4AWBA 5EJ7A 3SQLA 3UJDA 1C4OA 4GPAA 1VBFA 1ISFA 4FGSA 5CXSA 5EQFA 5KYUB 2I1VB 2HR1A 1A2BA 4GKKB 3SLRA 3LVQE 4QYMA 1LVHA 2XYRA 4Q9KA 3GD7A 3ETNA 1NY8A 5K8IA 2UU9B 4P83A 2FRDC 3PGJA 5ERYA 5CX1B 1CQPA 2Y3IA 2IF0A 5CYGA 1YE5A 3QFTA 4IO0A 3ZX5A 3J81k 2G5GX 2GM9A 3KZ1E 2YXPX 4V0SA 2QUHA 4EPTA 2JIDA 1JP7A 1DAKA 3KVNA 3WJ1A 4EH1A 1W7AA 1ARZA 5AVWA 1MJGM 2WYIA 3OU2A 5IZCC 1K3TA 3N7TA 4MVXA 5FJJA 3CFYA 1LQLA 2OCLA 4MQFA 1TVEA 3S1AA 4X66B 5B55A 1YA8A 2CXXA 3AY3A 5DM1A 2X23A 5E4JA 3LOQA 5LDGA 4KO1S 3U9SA 4DEVA 4BUCA 4TLDA 3H5NA 3V6LA 1NYQA 5B7QA 3FOEC 1PLKA 4UASA 2Y05A 1T1SA 1NXPA 2G3YA 2FSGA 1KYQA 3GLSA 1AOXA 2J8ZA 4KBGA 4Z99A 2QYOA 5I5EA 2YN4A 2EHDA 2BGUA 2H5EA 1J07A 4YO8A 2ZRLA 2W6NA 3AF4A 1ZM2A 3PDUA 4CTNA 3N28A 2WVHA 3R7LA 3C6MA 2IVZA 1XTBA 1BCSB 1X77A 4FFBA 4PNZA 2ZIXB 3IT2A 4J8PA 4TLBA 4IIUA 2VP0A 3DLBA 4ZVTA 3DZFA 2E49A 1HSZA 1Y3HA 4A4DA 3NGLA 5LQNA 2F43B 3I9FA 5FUQA 5HS4A 1Z12A 2QXYA 1QWIA 1SC9A 2E37A 5FA5A 3EGXA 3BIXA 4HZGA 4DQLA 1RWOA 4PQEA 2GXSA 3NT4A 1K8YB 3CTPA 1KIMA 2GAFA 1U8CB 3E5NA 3KDSE 4URUR 4Z7JA 2FN9A 2FPIB 4RFSA 3L2OB 2WSSA 2AUNA 5EGNA 1IONA 5SY4A 2R68A 4R1TA 4KB5A 2QP3A 2WJZB 2XRFA 4B0PA 2G67A 2NTVA 2OUKA 2HJRA 5JAMA 2ACWA 3EWAA 3H2KA 4FDTA 1CY0A 1Z35A 4M1EA 4NECA 1VE5A 2GO7A 2XYVA 1KYXA 4ND5A 5JU6A 2A5FA 2Q2OA 2O5CA 2DPYA 5F9HA 4GS5A 1YC5A 1Y63A 2J0UA 2ZS9A 2HQBA 4XCXA 3ZBTA 1AQJA 1EQUA 3RS4A 2FX3A 1EFVA 1UXIA 2Q5LA 4G1CA 2DUMA 2VPYA 1E0SA 2BLLA 2HMUA 3O95A 2EZ8A 1UFKA 3LKVA 4JLOA 4UHFA 4V3CA 5LQMA 1Z5VA 2Q9UA 1EDEA 3QEAZ 1CUAA 3STTA 4ZD6A 1CDZA 1YV9A 3ZHOA 3OG9A 1YIAA 5KYYB 3ZGZA 1UBTS 3PNMA 3JYLA 4BEVA 4DEXA 1U1FA 4LRQA 5CT6A 4ZN6A 4C5CA 3AI7A 1QZXA 3SQWA 2XAUA 5JS8A 2R62A 3IUNA 3L6BA 4JX9A 4QDJA 2AYXA 3QLVA 1D6NA 1SU4A 5C46F 1NMXA 1W93A 2RI6A 4K6KA 3TO5A 3UMRA 3VUFA 1T0BA 3DO8A 4EKNB 3T5BA 2ZS8A 1BRTA 4NNPA 3KB1A 3FVQA 5JSYA 1IIBA 4DRYA 1N77A 3LGAA 2HPVA 4W5WA 3DLAA 3WYBA 1TL7C 1DL5A 2OQ2A 4FNMA 4MAAA 4OXYA 1NT4A 2X8BA 4MV9A 4EO7A 3F4BA 2ZJYA 1RYYA 2PVSA 3JAKA 4JGBA 4IYRA 4EM6A 5C4GB 2IV3A 1LPAB 1WJGA 1E3MA 3SKYA 3E53A 4BMYA 3ZDZB 3E4CA 1KY3A 3EZFA 5LU9A 1A9XA 1SVNA 3WKBA 3ZDYB 5LLSA 1NVVQ 4HJXA 4DCMA 4S2EA 1EP2B 4WGGA 2GBLC 1PVOA 1QUEA 4FDLA 4L6IA 5HE9A 3W7VA 4EMUA 1P3JA 5D85A 3AJ9A 1IZYA 2Q3JA 1U4NA 1E7WA 1WXDA 3EG9A 3OPXA 2HHLA 4GM0A 1DBIA 3CE6A 1CP2A 5E4YA 1JDUA 3H5LA 1SXJA 5LXTF 2W8BA 4CQMB 3J81A 5EC8A 1R64A 2F6RA 1R7RA 5HYVA 1Y1PA 1YBFA 4P3NA 1BMFD 3RSZA 1OJLA 4QG7A 2NYUA 3SS7X 4CETA 2Q6LA 1WSBA 1ZHFA 3BWEA 5LC1A 2L17A 3JD3A 1LXCA 2WM9B 1EIZA 1OYYA 2MSCB 1PJAA 5J47A 1ZITA 3FVRA 4L4YA 1MJGA 2QVGA 2RHLA 1O8BA 4JBNA 3E5HA 5KNLA 1O93A 1CLEA 3P9IA 4C0XA 1EXWA 5FNVA 3C8UA 1SB9A 2PLWA 5E1MA 4EI9A 2DH5A 3AXSA 5JSKA 3F74A 2BISA 1GT6A 4YMTA 1TUEA 1XVVA 4RZUA 1KEUA 2YNMA 3BJIC 3IBFA 3E03A 3GJXC 2ZSBA 3ODPA 3ZCVA 4B6FA 4WZBB 3U09A 1HYQA 1U7WA 3DC2A 2O2SA 3OTQA 4DSZA 3LHSA 4RTLA 1GUBA 4ER7A 3CX7A 4XFKA 3WLAA 4B46A 2O2GA 1KH2A 1UBCA 2O3JA 2ZSKA 3LCUA 1T6ZA 3V32A 4ALLA 5AM3A 3FY4A 3VR1A 3EZ6A 2QD4A 5DH9A 5L3QB 4W5JA 3H9BA 3TIVA 3ZV4A 2BMWA 3NHLA 2JD2A 4X92A 4RPLA 1FPMA 2CSUA 2AE2A 5FBWB 3EW7A 4V38A 1GR1A 3ZTTA 3NTXA 4AJ2A 2AYYA 4MOWA 3UV6A 1I9CA 3K09C 4PG6A 1Z4IA 4Q05A 1VE6A 3TTSA 3NW9A 2FPSA 1XDGA 2JASA 3BJZA 5FBZA 2O8BA 5CDFA 4ZQIA 5DISB 2ZQZA 4G8CA 2DZDA 2VBFA 2K5UA 5EYPA 1PK9A 1E5DA 5HJ5A 5ITSA 1FP7A 1VBKA 3SQMA 1J33A 3T54A 5A3RA 3V42A 1LNSA 4MQ5A 2DX7A 1K6MA 2P4EA 1HE8B 1N6RA 5ALZA 4KQWA 4WNYA 2PZMA 4L8YA 3N8GA 2H4JA 2PBRA 2WPNA 5L3VA 1HYHA 4UTXA 4PONA 1XEXA 1KKLA 1RXYA 3DOJA 1EFPA 3JQ8A 3JW8A 3M6VA 3OM1A 2XQKA 5KNBD 2NP7A 5DYYA 3GJYA 2QW1A 3VOSA 1CQJB 1CSEE 3PQDA 4BB6A 2B8NA 1FFXA 1GIAA 5DLQC 4K7JA 3UHAA 3HS3A 1CZOA 1VJ1A 1SXGA 4ABTA 3C3YA 5GM2A 3OE1A 4PLZA 3G2HA 1G63A 2QTGA 1HOTA 4X93A 5CGQB 1CNMA 1JJ7A 3KR2A 4WJKB 3E9CA 4ZOBA 5EJGA 2IEDA 3AUSA 3OIWA 4YP5A 4C1BA 5KVVA 1FBNA 3GJ7A 3E70C 3WJ7A 5CB8A 3ZOKA 2C2HA 4NYMR 1IBLC 3L7LA 3LOPA 4RMNA 5CHEA 5K9ZA 3T5MA 2RKWA 4WEQA 3ZU2A 3C6XA 3R3SA 1YMQA 4LS3A 2BN4A 3VC7A 2B36A 5BYJA 3UC9A 1JLSA 1PSWA 2WBLC 3MW8A 3FMFA 3ZTYA 3AZPA 5C3UA 4ND7A 1T0PA 5CNKA 3H1FA 3ZV7A 1C7FA 1H2BA 2GFHA 1Y7IA 2ANCA 3AEUB 1F0YA 5IHPA 2Q9BA 4RBNA 1PNRA 4F2PA 1S8NA 2R7NA 1AC5A 2QL8A 1HNZC 4JROA 4BKQA 4FYWA 3O47A 2C4WA 3Q7SA 4WK2B 1X7WB 1QC5A 5F51A 1A7KA 4P0QB 1E1RA 1KMHA 4O1IA 1JFFB 4OA5A 2FPUA 5ADVA 4X8LA 1E59A 2BMEA 1MNQA 5IFIA 3WLIA 1Y9ZA 2IXFA 2OENG 2JIZD 4R1QA 4IHAA 1T3HA 2VKQA 5TC4A 2H1HA 3WA7A 2IYFA 3WHLA 2OVBA 3KVRA 4CMJA 1QO7A 2JFQA 1E3JA 2AXNA 2L19A 1FNDA 1GTZA 5EUBA 2A9JA 4DC0A 4E30A 3H65A 3REFA 3VNRA 3CRW1 1N78A 1XNRB 5JMTA 5CW1A 2NACA 3MUNA 3WNDA 1QBGA 3B78A 5DK4A 1WSDA 1V4BA 1GCAA 2PWAA 2YJZA 1E1CB 3IBTA 2J3MA 2B7CA 3H8JA 5F5NA 1WXQA 2OD9A 2YX1A 2H4ZA 1RPZA 2WJVA 2GYYA 1N1EA 3LAWA 1BGWA 1GRNA 4J1TC 3ZXYA 1OGJA 1VLVA 3UUEA 5LA6A 3DYBA 1UQRA 3DA8A 4ROSA 5ELLA 2H3EA 3DHNA 4F06A 4MWOA 1PLLA 4QM6A 3STWA 1P4HA 4WI1A 3IUQA 3QEKA 5EOVA 1SKMA 4NHOA 2H5JA 3WJAA 4JP3A 5DB4A 3EQ6A 1CBUA 2MWMA 2XR1A 4G1BA 2R2GA 4HN4B 2GTIA 2V4UA 4Y2TA 5F23A 5ES4B 1TX4B 3KYBA 4ILKA 5LD2C 3TZHA 1DELA 3KKLA 1F48A 4RA6B 1GA6A 3QJYA 4ZO9A 3DFMA 1CIPA 3RF7A 2OHFA 3OOHA 1KAQA 3RHTA 1PHPA 3PXAA 2RGRA 4LF5B 2H6EA 2XD9A 4WASA 1P31A 3LX8A 4L4UA 2AA3A 2IPXA 2G83A 3K5HA 2Y68A 1PZMA 5TY0A 3RJ5A 2FPGB 1H93A 3RYHA 5KMGB 4NF2A 1RI5A 2UYOA 3ZDEA 3TNDA 5D5QA 3UH0A 2DXIA 3M1LA 1P18A 5FL3A 1OW3B 3ELWA 2X58A 1UK6A 1QIHA 1X15A 4EL0A 5K20A 4HGNA 5EQTA 4WWHA 2I4RA 4N3GA 3PT5A 4NCJA 1HDEA 1D2MA 4WLNA 1GU7A 4R2KA 2GEKA 3DKIA 3L4JA 1R0XA 4FD3A 1ENZA 2ERXA 4HKTA 2J9FB 1RP1A 4IWXA 3LBNA 3GUCA 3A4IA 1PQYA 1BVYF 1UPUA 2WOJA 3C3CA 2WA2A 2O8FB 3P7MA 1E9SA 1Z2OX 1ML3A 2IY9A 1PR0A 1UC9A 4MI3A 4YJGB 1GG5A 1E92A 1U1GA 4GVLA 5EE1A 4D3DA 3NOOA 5EKDA 4A36A 4GNRA 4RXUA 1XWFA 3CUEF 3FPHA 4JUBA 5FI5A 1U94A 3L8DA 3N87A 3VPDA 3ZQJA 5EMNA 1L7AA 2PUDA 2XWPA 3I1IA 1H0RA 2HU7A 5FULA 1ZK1A 2I2CA 2X1MA 2YJ6A 3IVMA 1QKIA 3HKBA 4NOMA 5F2EA 3OD5A 3VHXA 5KWIA 5BUCA 4DYVA 4C2AA 4EHFA 1PR2A 1JMYA 1VB3A 3DMFA 4LISA 4WRRA 4XUDA 3TLGA 2ATVA 1JKXA 2EVWX 3HJTA 5AE3A 3DF9A 1A8SA 1OUMA 4OQPA 5KJ1A 2IYUA 2Y92A 1VZ3A 5I7WA 1BMFA 2B30A 5WRFA 3VAYA 1QQBA 1ZXLA 2UZ1A 4GI2A 1MN6A 4P0TA 2CXUA 1W52X 5JSZA 3IJPA 4S1WA 4V1CA 1JEQA 3D6AA 2HYIC 1B8PA 4PCLA 1PJ3A 1E2GA 1J8QA 1UIMA 3VMMA 3ZZUA 3GLFE 4ZODA 2Q49A 2RHOA 2QY9A 4QQKA 4R40A 5CZXA 5FV4A 2XQIA 1NF2A 2H00A 5FNVF 4G86A 1RAEA 4IIJF 4QUJA 1YS4A 4RA9A 2PUWA 2WKQA 1EFLA 1Y33E 3CEMA 4LHYA 1TK9A 4FB4A 4G9EA 2PX6A 3P0IA 3JQ7A 2J3IA 3TX6A 4YRAA 1CIVA 1DJQA 2D7JA 1COZA 4I4NA 3EJ6A 3B5IA 4Y0VA 4WADA 3R5SA 1EAYA 1Y89A 3BWDD 3HU5A 1XALA 2DHCA 1DEHA 1PW5A 2ZRMA 3IAUA 3M5CA 5IFKA 1QLHA 4RACA 3E7WA 2RD2A 1U3FA 2IOQA 1Q3HA 3EIEA 4OK5A 2I3GA 4KQFA 1VHTA 3K4QA 2Y77A 4A91A 2B5VA 2IYAA 4MV5A 1QJ4A 4QSMA 3HR8A 2JFGA 2BZSA 1Z29A 3DTYA 4FFOA 4NFSA 3THXB 2ZRAA 4N4AA 1NATA 2GBPA 1U98A 4OL0A 4W5TA 3CJRA 3L7KA 2NZYA 3RBVA 1LX7A 3HDJA 1FSGA 1L3BA 4JQCA 4LI0A 4D42A 2O7NA 4WXYB 4UNRA 1Q57A 4Z3KA 1ES9A 3PNOA 4Z4CA 3U4AA 1WS6A 4GRAA 2PFKA 4ARIA 2VHJA 2DT8A 2IEIA 1L9KA 3A8TA 3F3MA 4HWPA 5KNCD 1KQGA 1Q1BA 4KO3S 3RAFC 1J5EB 2ZRGA 4KO8A 3D6HA 1PF7E 1MJFA 4N8DA 1A82A 4JT4A 2VZ8A 2PLNA 2W7TA 2EHJA 3NB0A 4Y67A 5BRNA 1H4VB 4CMEA 4ARZA 2O2IA 4CKCB 4RZXA 2QAJA 2CXPA 3SI7A 3TVTA 3T52A 4EGCB 1LSSA 4WNAB 1XDDA 4EKDA 2O05A 4F5DA 1X7ZA 4IKEA 4DLVA 2XYPA 5AVRA 2XWJI 2W2VA 1BVUA 3S81A 1WH9A 3H5IA 1NVUQ 1NYTA 4ZA2A 5IW8A 1CPYA 1XRLA 4OGLA 3N0TA 4Q9DA 4W5NA 3C8HA 3B9PA 4CL2A 4PZCA 3KQNA 3KNZA 2WK1A 3LSYA 3VBCA 4EX6A 1MTOA 3DKPA 3ITNA 4H3VA 2CNKA 1MC4A 1F4PA 4AJNA 3UA3A 1CXZA 2ZE6A 3CXRA 3NEAA 4HWTA 3CLSD 3QPWA 4TPKA 4YEDA 5AI8A 4LZAA 4F6RB 3ANLA 3Q3HA 1A5ZA 1FEZA 4XR9A 1RWWA 3ANTA 4ZI5A 4ENUA 2CY0A 1T9ZA 2WIAA 1QX3A 5T3YA 1ZGJA 2SHKA 2VPZA 3A1TA 1NJ1A 4X62C 1OA0A 1TNDA 2BKEA 1A5TA 3A31A 4MVJI 3K5WA 1EUYA 4DIFA 4G07A 2UUBC 4G8DA 1UINA 5MN5A 2RHRA 5F3DA 3TR3A 2IXBA 3V00A 1ZBQA 1J5XA 4ZVLA 3RFVA 2VG8A 3K96A 4GYKA 1ZOSA 3L05A 5AJWA 2G70A 5IC6A 3TR6A 4KWTA 3PJFA 4PUHA 5GVRA 4PU0A 1V7CA 2CDRA 3H2GA 3M5PA 2ETXA 4JEHA 4L57A 1D4OA 2DPMA 3G1TA 1PEYA 5THQA 3WYAA 2AK3A 3VTAA 4KR7A 1V45E 2JIZA 2AG6A 1W73A 1A96A 2ZRNA 4DC1A 4FWTA 1PNVA 4CF5A 3SLKA 1U81A 1ODSA 3Q6IA 5BOSA 4ZAYA 1O58A 3WNCA 1IHUA 3LW8A 3GJZA 4CQLB 3VU3A 4Z0HO 4B17A 4OQ4A 4X90A 2XSZD 1GN8A 5I7RA 4LF6C 4C88A 2PMFA 1ISJA 2WILA 3KEMA 1L4NA 4PINA 3ZHVA 3T1YC 1EG2A 3P19A 3GLIB 2RCYA 4BWFB 3NPDA 1SHZA 3HKCB 1GQSA 1DV2A 4OSEA 3BILA 2P0YA 3QPBA 5C2JB 1Z6TA 1E3WA 2P62A 3BIFA 4GLJA 2G28A 4RMJA 1OIVA 4UCQA 5FWAA 2VT7A 1H2WA 1ISRA 1XA3A 2QAGA 2DR0A 3MA0A 3NO4A 3PHHA 4MR8A 1MIOB 4Z0TA 4O4IB 3ZY4A 4BFUA 4GOKA 1L5YA 2KDNA 1RWKA 1DKLA 1EFRD 5CVDA 4GH5A 5FOSA 1QAOA 2PUHA 1C1HA 4R6WA 3GJ5A 4UBIA 3ZWAA 1N2JA 4R1NA 4QQFA 5G0WA 4EB6B 5IZ4A 2QBYB 1F38A 1MOZA 1PT8A 2R4QA 3HC7A 4NZYA 3M4ZA 4EJSB 3A4NA 4TX1A 2Q41A 2LW7A 4KNWA 4PBRA 1L7PA 3L8CA 3HYRA 4EPRA 1JOSA 2I66A 1KZ9A 2C0QA 2HDWA 3QX9A 1NW6A 1RYBA 2PRYA 1M67A 2BDUA 4YDHB 3IDQA 3RT9A 2V3VA 4YLYA 3CVWA 1U9YA 1RMYA 3UW1A 2PFGA 2H4YA 3V4LA 1SKQA 3ZGVA 2V7QA 4Q9HA 1N3YA 1U7TA 4H60A 4QATA 1NXTA 4W1PA 1IBMC 1DZIA 1T5TA 4HDKB 4WSOA 3F1KA 5BN1A 4J7AA 5JYEA 5EFZA 1DIRA 4AL4A 2JJYA 2GM3A 4BWYA 5D84A 5A6SA 3PYXA 3NAZA 2CMGA 1QE5A 1NUPA 4KC0A 1M6YA 1WX1A 1FSSA 2HSZA 4JR1A 3RVJA 2BFEA 1PD1A 2HA4A 1Q44A 3MWYW 2IFTA 4UCWA 1BO6A 1DXOA 1L5SA 2OKCA 5AOAA 3A25A 3RRFA 3TQSA 1CEXA 3VNVA 2QU8A 1C41A 1LA2A 2JFYA 4DLBA 3FR8A 4CEIB 3BSFA 3TS1A 5DNAA 5ITZA 2RH5A 2X0EA 1V37A 1YZ3A 4ZCTA 1T35A 2E85A 3KXWA 1F6DA 2C2YA 5CEJA 4OA8A 5IJWA 1IEQA 4QHYA 3R9KA 2C7PA 2G40A 1BMTA 4IZHA 2PUEA 4YRRA 5EMMA 1B0AA 3RC8A 3WK7A 3KKZA 3MTJA 1HR0C 5J5VA 2WM3A 1AT1A 5BN4B 2PZAA 1Z83A 2YXBA 4AT1A 1XCMA 2EV9A 3RODA 2MHCA 3FYUA 1L5KA 3QXCA 2AFRA 1WLSA 3DT6A 3HBFA 3KZNA 3H2BA 3O4JA 4INJA 3RU9A 5JD4A 4R1OA 3M6LA 5AJYA 1JKIA 1E2BA 1JDBC 4UBLA 1GAEO 1ORRA 3GLHA 2WF6A 2HMSA 2ZP1A 2ORIA 1HLGA 3QLJA 1F9AA 4L8VA 4BO4A 5KCMA 2HK8A 2BKLA 2DY0A 2R44A 5AKGA 3BTSA 2VEDA 3M6WA 1O57A 5L4NA 1A72A 3R3XA 1WABA 2QLFA 4D9KA 2AH5A 1IZ0A 3GPDG 3IR6A 4XFDA 2ZJ8A 1H3NA 2CXTA 3EVTA 4L7QA 4NQRA 4BP1A 5JC8A 2JLQA 3OHMA 4MVJP 1MO6A 1GKKA 2NN3C 5HBRA 2FP4B 3ZC3A 1XQ1A 2HSGA 4MDHA 4RJJA 5CDSA 4Z49A 2PO5A 5F73A 3MILA 3RDPA 1IEVA 1K27A 1U7UA 1GM5A 3HBLA 2Q1UA 2W2OA 5BR7A 4EJ2A 5CCBA 4JQSA 3EXHC 3VSCA 1SCBA 4ZFNA 3F67A 1U9CA 4FFRA 2QQGA 1BNCA 4HCJA 1OCEA 1VL5A 3ABSB 4I6EA 3V4ZA 4WXEA 3LYLA 3VPBA 4MZDA 3AF0A 3KRTA 1DZ3A 1OU0A 3LVFO 4PZAA 1T43A 2WIFA 1EEHA 3I2YX 3FCSB 3LBFA 5JT1A 1E2QA 3ZZTA 2ODQA 2R7LA 4JUDX 4OXIA 4MQEB 2LR0A 1DIAA 3PC2A 3QYPA 2PL5A 5CJ2A 3UZUA 1YBVA 2N9UA 1PDVA 3I3OA 2GNOA 3CWCA 4HPWA 2JI7A 1ST3A 4FNOA 2VJBA 1WTCA 2I0FA 4B1FA 5KREA 1KU6A 2H2IA 4NY1A 3OFJA 3KUUA 1RLJA 4MUXA 3EF3A 3MQ2A 3ACCA 1GJRA 1GVHA 1GUAA 4UUPA 5H0IA 3BFXA 4JD5A 1ORDA 5CM2Z 5ANRB 4JI7B 1O90A 4CIWA 3BXXA 4MKZA 4XDGA 1DV1A 1FFBA 2XNJA 4BBYA 3OZWA 4ALNA 4ALJA 1HDGO 1E77A 1NOIA 2PWZA 3RVOA 3FPKA 3OJFA 4NDNE 4F4JA 3CVYA 2HCTA 5JRZA 2DFLA 2PGAA 1AKVA 2FWAA 3Q6MA 2I55A 4TS3A 4U2KA 4ASUA 3EQZA 4KVFA 4AYTA 4C43A 2QPLA 4K1XA 2IXAA 1H5NA 4NVRA 3SJ7A 2ZWMA 3LLSA 3R9WA 3S40A 3PG5A 3FLAA 4HG2A 5FF9A 3T5PA 5E8JA 3N6VA 5K6RA 4YPFA 1KMMA 3VR2D 3AHHA 2G1UA 1ZMRA 2F7SA 2GLTA 2XODA 3DBHB 4OB8A 2C3PA 3GP8A 5A4KA 3H4TA 2R1TB 3JARA 3L8HA 1N32C 1M6VB 1F8GA 3R3YA 4B09A 2BLNA 2BHNA 1FFWA 3L8GA 4R1SA 1MVOA 1YS6A 2X14A 4DCVA 4RD4A 1YNSA 1HL7A 2WYWA 3A3OA 3HM2A 3ZWNA 2FDCA 3AVWA 4RJLA 5CDYA 4U5YD 1QK5A 3EMVA 1FIUA 2ID7A 3CNHA 3UK2A 1ECCA 1ABFA 3OLCX 1X7YB 3ONVA 4AAYA 2CWWA 3EXG2 4NARA 5B3KA 3PUKA 2P67A 5DSXA 4IJ6A 3WXBA 5KI6A 4FHGA 1RABA 1GG8A 4BO7A 1E2KA 4ALKA 1JB9A 3HJUA 3DE2X 3LL4A 4LPKA 4N6NA 1XKTA 5FI3A 1DKPA 2C95A 4KE6A 2KE5A 3CN7A 4MIYA 3PA6A 4O25A 4Y1RA 3WGKA 4H3HB 2VTBA 2I99A 4DR5B 2JFWA 2PMDA 4FLMA 1EM8A 4JHLA 3OZIA 5BQPA 3BH6A 2VRCD 4WKNA 5F9MA 4E11A 1KH3A 1XMPA 3EGIA 4D6YA 5KWVA 1JLLB 3U7QA 4W6ZA 2COKA 4A0FA 1NU6A 1EA7A 2C96A 4WLVA 2PZKA 4DIMA 4XWOA 5ADHA 3S2YA 3ETOA 5DHUA 4OCZA 3ZDDA 5DWDA 4TSFA 3CF6R 2C9OA 2IKQA 1MB4A 1RVDA 4IDDA 3VV3A 2CHUA 4HP8A 4G0PA 1N9GA 1VE9A 3LE8A 5AXDA 1UP7A 3BUSA 3BKWA 4QYTA 4DV0C 1UFOA 3AC0A 3O1HB 5JNRA 1IDOA 3LUCA 3KVYA 5AI9A 1GPH1 3B6KA 1N2CB 2XYGA 2IVFA 2WD8A 3QSGA 4H1VA 1XZKA 4XIGS 1G5FA 3W3ZB 1L8OA 5IH3A 4CG3A 4C1NA 4CUJA 4OI4A 5AVZA 4BVAA 1HC7A 3LECA 3DPIA 4A8TA 2IPNA 4ABYA 3HVRA 2JDID 3PCRB 3WISA 1NP7A 1A8PA 1W35A 4CVNA 5JSHA 4A6PA 2FRXA 4BNZA 3FF1A 1JUDA 3FVWA 1EFRA 4CEJA 5ESRA 1X7XB 1OHHD 3CUSA 4DAEA 1NMEA 1USWA 1ODCA 2R66A 3O8NA 3PRJA 5E9AA 4LW8A 2WZCA 3DF7A 1Y5NA 5JS2A 2X2PA 2UZIR 4JLBA 4ONEA 1NXSA 3WK4A 3P1JA 5TQ0A 4BMCA 3OH8A 3WLMA 5GTDA 4Y6SA 3T7KA 3D4NA 1NKVA 2Z2XA 4GECA 3L0CA 4TUYB 1WF3A 1J0DA 4QAJA