4FUTA

Crystal structure of atp bound matb from rhodopseudomonas palustris
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
502
structure length
475
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDGATIDEAQVLHGLDGQLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Malonyl CoA synthetase
publication title Structure-Guided Expansion of the Substrate Range of Methylmalonyl Coenzyme A Synthetase (MatB) of Rhodopseudomonas palustris.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 145
structure length 475
sequence length 502
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4futA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4futA01
4GXRA 3A9VA 2P2QA 2P2JA 3U16A 2QW0X 4IZ6A 5KYVA 1MDBA 4RLQA 1LCIA 3ETCA 3L8CA 3EQ6A 4OYCA 1MD9A 4GS5A 4GR5A 4RLFA 4W8OA 4RMNA 3RIXA 3TSYA 4ISBA 4GR4A 3WV5A 3G7SA 1T5DX 3T5AA 3LGXA 3RG2A 3CW9A 5BSUA 3VNRA 2P2BA 2D1SA 3C5EA 5BUQA 2Y27A 3VNQA 1T5HX 3NI2A 3B7WA 4RVOA 4U5YD 5DV9A 3IESA 3IPLA 4RM3A 4RM2A 3O83A 4WV3A 1ULTA 3FCEA 3PBKA 1PG3A 3IERA 4ZJZA 5D6NA 4G36A 1AMUA 3A9UA 4G37A 4R1MA 4RVNA 3IVRA 3WV4A 1V26A 3ITEA 2P2FA 4D4HA 2D1TA 1YJ7A 4IR7A 4R1LA 3LAXA 3VNSA 2D1QA 3E7WA 4D4IA 1MDFA 5BSTA 5E7QA 5KEIA 3KXWA 3LNVA 3T5BA 5BSVA 3T5CA 3NYRA 3E7XA 4D4GA 2VZEA 2VSQA 3U17A 2QVYX 4FUTA 1BA3A 2WD9A 5GTDA 2V7BA 2Y4OA 2Y4NA 1PG4A 3NYQA 4EATA 2D1RA 5DWVA 3O84A 3O82A 3DHVA 3CW8X 2P20A 4M46A 5BURA 5K85A 2P2MA 2QVZX 5BSMA 5JRHA 5BUSA 1RY2A 4D57A 3FCCA 4FUQA 4D56A 5K8FA 4GXQA 3E53A 5BSRA 3GPCA 5KYTA 4DG8A 3IEPA 3DAYA 4R0MA 4LGCA 2QVXX 1V25A 3DLPX 3R44A 4OXIA 4DG9A 4E5DA 3QYAA 3WVNA 5BSWA 4PZPA 5IFIA
chains in the Genus database with same CATH superfamily
3VO2A 4G65A 4R9UC 3A9VA 5K8CA 4KN8A 1I4LD 2H1VA 3FJ1A 1MF7A 2I2WA 2WHPA 1A82A 4LX8A 3L04A 3R7LA 5KKNB 3UJ9A 1ZKMA 2X6TA 2V4UA 3JQ9A 5B58T 5JALA 1VSBA 1WBJB 3QY9A 1D8TA 4FP9A 3CLRC 4NJMB 2NU6A 1Z4JA 1W1WA 2JIMA 1AVTA 1S01A 2FW9A 2Q6KA 2ZJ0A 3DXXA 3I76A 4H3SA 2XB2A 3OCVA 1QG2A 1GG2A 3QEJA 4NFHA 2WOJA 3H6GA 3UHJA 4V03A 1EFDN 3E2IA 2NZWA 3DFZA 3I6YA 5IH3A 3T9AA 1TQDA 3KAQA 1XF1A 1JLHA 1Q20A 4IFEA 4QFMA 3C3PA 4KGZA 2D1YA 4LRUA 1X8JA 5JC8A 3CX3A 3WZMA 3F8SA 4N7MA 4TRNA 3HCRA 3AB7A 4RIFA 4BKPA 4GOND 1OVMA 1UPXA 4MHSA 5DGXA 5EL0A 2OAQ1 1O8CA 3O8BA 3CXUA 1HYGA 1G19A 4FFSA 3K9WA 2DH6A 3V1YA 3BMOB 1PFQA 2UXDB 4ID9A 2QTAA 1XCGB 2CVFA 1U7DA 4R1TA 4WERA 2FTKE 1XLVA 4II2A 5FKJA 2GB4A 2ZK7A 3TMKA 4TMVA 1POXA 2ANBA 1LS1A 2H2GA 1PGPA 4DMUB 4HGOA 2O8FB 2HW8A 1MORA 3GRKA 4NG4A 3IB6A 1E7QA 4L5AA 2J4CA 1E9SA 1NTRA 4INZA 3OCJA 1WD5A 1P8AA 1I36A 4F46A 3PXXA 4JCCA 4QNNA 1X7DA 3T7SA 2O7NA 1T2UA 3FPBA 1ZJ6A 2XGMA 2ZPUA 2QVLA 1BMQA 2Q9BA 1JLSA 3S2ZA 3UZ0A 3LWZA 2I87A 2JGIA 5L7TA 1T8RA 1TM4E 3D6UA 3ZGOA 2H4ZA 4B9EA 3BRWA 3L49A 3PFHA 1NMYA 5CLIA 3JD2A 1P18A 3TZKA 4FFBA 3R7BA 5DTRA 1JU4A 1KVQA 1CUCA 1JBEA 3H3XA 3NHBA 4IGIA 1LTKA 4KDFA 5EMHA 1YBVA 1TA0A 3TSZA 4D4MA 2QX4A 3I52A 3EW7A 3MK31 2OGWA 2R6GA 1HI9A 3DBRB 1DG1G 2I4MA 1P7ZA 5LA6A 5IAOA 3KQTA 3RVLA 5K3EA 3BWBA 3DZFA 3OECA 3FCSB 5TQVA 3WTCA 3UEBA 1NXOA 4B81A 2TRSB 1Y89A 4X20A 2ZSUA 2CXPA 3WWOA 4A10A 4CMAA 1KWKA 4J6EA 4D56A 4V3CA 3B51X 2VF7A 1W5TA 3ROXA 1I13A 2ZYDA 1SZCA 3KQOA 3OX1A 3TIFA 4DJFC 1SPBS 1FSFA 3E4CA 3ESAA 1N1GA 1XZMA 3IFSA 3KKLA 3L79A 5LZ8A 2Q6TA 4MUFA 3H83A 3HU1A 1CUZA 1HT0A 2C8LA 4JZYA 4ZI5A 2O8BB 4PIVA 3T34A 9LDTA 2CN1A 1IZYA 3EAGA 4ENSA 1SUFA 3O3NB 4PCVA 3WDLA 3SIXA 4DM4A 4YP0A 4H2DA 4TL7A 3CLSC 5DGHA 1E62A 3IDFA 2INGX 3SZGA 1WQ1R 1YL5A 4B3CA 5KQPA 1Y8AA 4EF5A 1RBZA 2VSNA 2OZLA 5TEWA 1F2DA 4HNHA 1NBMA 4YDSA 3OFSA 3IIEA 1GUZA 5ALRA 5BN5B 4KAFA 3AMVA 4ZGBA 3QU4A 3R3YA 3TLJA 1H1LB 5TF0A 3ZXUB 1JL3A 3TVYA 4FDAA 1U11A 3WL7A 2R1VA 3JQEA 4Y6GB 1A72A 1EQ2A 1J0XO 4YJ2F 1EK1A 4Q6BA 4UQLA 1UFOA 3MQFA 1UMDB 1XXHE 5JECA 2YUTA 3LBIA 1E0JA 1IN6A 2YNMC 4G26A 4BU0A 1OYVA 1QHIA 2PMWB 1FQWA 4B40A 5I7EA 3GQBB 3KETA 4FB5A 1TTPB 1BDJA 5DBIA 1ECCA 4UMVA 5LYJB 5JQGA 4CG2A 3CX8A 1XA3A 3DZDA 4ENUA 4L6IA 1XKXA 4LA4A 2Q46A 1PZGA 5EE9A 1GNLA 2GZ1A 4EGAA 4G07A 1V6AA 3RU2A 1PHPA 3SMVA 3KZKA 3H4IA 1SIUA 1O90A 4AO7A 5E95A 3LW7A 5FV7A 1RRGA 2JH8A 5BQPA 3BZUA 4HEQA 1MPTA 2WILA 3EZ2A 4EJ2A 5AFSA 4R7ZA 1USKA 2JAOA 4J0FA 4QFDA 2VK1A 4N8DA 1E2IA 3QA9A 2XKJE 1BTOA 4G84A 4D45A 2O8EA 5CNJA 2XHEA 3DHEA 2D1QA 2M2IA 1DJPA 2IZ7A 3CIOA 5IVDA 4XGIA 1O95A 1KO4A 1DJQA 3O1JC 3EXEA 2HK6A 1QYCA 3STYA 4Y2VA 1TYDE 3L05A 4QPNA 4E7OA 3UT5B 2P7IA 3DP7A 5ILGA 1CUSA 1WCWA 3OZRA 2BCGY 2PQMA 4M9QA 3P4UA 3I8XA 2IYNA 3MB8A 1HE5A 3OFJA 4QYSA 4MUKA 3FPKA 4O5OA 2QT9A 3QVTA 4INPA 5ESRA 3VH3A 2BUAA 2QN8A 2RMKA 3R0QA 3LCRA 3WB2A 3GFRA 3WYAA 3MJFA 2BFDA 4CL8A 4AI6A 5KVVA 1FFHA 1CEQA 5JMPA 3OFVA 1LTQA 3M9XA 2ZKLA 4PLPA 3V1LA 5GGXA 2P20A 1KC1A 1TM1E 1TM5E 3VVMA 3H5IA 1KZ4A 2WRZA 4MW1A 3SKYA 1MQAA 2XR1A 1XZHA 2KLHA 3L40A 4AXXA 3M6WA 3NT5A 4B7XA 2ACEA 4ZOLF 4ES6A 4M1KA 2NZ8A 3UATA 2OE2A 1XRJA 1YOVB 1JHRA 5B7NA 4QTUB 5EPUA 3ICOA 1FDSA 3TZLA 3CTPA 1O3YA 2WNSA 3A6HA 3OQJA 4NONA 5DI3A 1CUAA 2ZTLA 2YHIA 3JYNA 5L9AA 5M04A 4DCTA 4KN6A 5F3DA 5KUTA 2VUSA 1VJGA 1ZCZA 3U7HB 2H7VA 1L8LA 1I7QB 2KM1A 3G8DA 1A5SB 3H0CA 4UVDA 5DNUA 3DFKA 4OLHA 1I3MA 3HUFA 4Q4JA 3NDRA 5LQJA 4KTVE 3T7JA 3EQZA 1X42A 3SS7X 4WOBA 3K8ZA 3M4ZA 1AD2A 1SZJG 1X7WA 2I29A 2QXTA 3UB3A 4YDQA 3J81A 2FPWA 2PZFA 3JATA 5EUCA 2BFEA 3HA2A 3P5SA 1QSGA 2H2DA 4QQNA 4EHHA 1HGXA 3MCWA 2BBTA 1LK5A 4Q3KA 4Q9NA 2DPHA 5LQAA 2R60A 3V7YA 3E3MA 1VE3A 2F6RA 3WKAA 1WB6A 1UPBA 3AUFA 3F90A 4PG5A 5FBVB 5CB4F 1QNLA 4HNVA 1I4EB 3FSRA 1E79D 3TINA 3DEIA 3O8CA 4BMDA 3LGXA 1XYYA 3FNHA 1RLMA 4W6QA 3DE3X 4D4LA 4Z51A 1NAHA 1Z26A 4I8IA 1UWVA 1WHTA 3CTMA 3FZNA 4OQ4A 4Q4AB 2BGUA 4TMTA 5FUQA 2FZKA 4YMTA 5G2OA 1W85A 1YRQA 2PWPA 1DINA 3H2KA 3IDSA 4IFTA 1EWVA 1V9SA 4ND4A 1YGYA 5BVGA 1Y3HA 2OPLB 5F7OA 1QAOA 1UAYA 1Y3CE 2VI5A 3O4RA 2VLIA 2PIDA 4X00A 3RSQA 4LXGA 1EJ0A 2QLNA 4HH4A 1JT9A 4BKUA 4D9KA 1W88B 1TCBA 1F5SA 1GG8A 4RVDA 3AX6A 5JXHA 3U4QB 2I1VB 3DTTA 3NTUA 4N5MA 5DSTA 4RTPA 1BQ3A 4R1MA 1I4OA 1SD2A 1VI5A 3N6XA 3WP0A 1CK4A 3CO5A 4J0QA 4L0DA 1L8QA 4W6ZA 1SUWA 4E6PA 3IE0A 4N8EA 4X1OA 4WBNF 2IIQA 3ROPA 3BMNA 3TFOA 4QASA 4RFVA 1MFPA 2B78A 1SXJB 2E55A 2IZ0A 2RI0A 1T3GA 4R2MA 2M6LA 1OMOA 2FPPA 1GP2A 3H0KA 4YLGA 3TJRA 5EIAA 3TSOA 3B3GA 3D3WA 5DKFA 4FHZA 1SCDA 5EJFA 4BZWA 5C5DA 1JI0A 3ANLA 4ARAA 5C32A 5HUHA 5C52B 2R1TB 3PGMA 4BP3A 3BE5A 4YJ3F 1P31A 3ZWAA 2QHXA 4I50A 2NX2A 1KPGA 5DGDA 3KYIB 5JCJA 1O0BA 1EFVB 4N0PA 4WLFA 2R5NA 1MG5A 4PINA 1V8OA 1AUQA 3OOYA 3PHCA 4LJ5A 4RCZA 1ZL2A 4ZQHA 3M3DA 3TDMA 3KQHA 4CEJA 4ZV9A 3AUTA 5ALQA 4XTCS 5FBZA 3FKSD 5FL3A 16PKA 1D0SA 4MQEA 3ROKA 4MJ3A 5FQOA 1ZW1A 4NOKA 1DKLA 4LV5B 5ICCA 2D7CA 1YBMA 1C8BA 3NT2A 4ALMA 2IIBA 2AOVA 2HQRA 2GF2A 5HILA 3Q7IA 1LPSA 4JR2A 2QQ5A 4LJLA 1D6SA 3TZHA 3V3TA 5IF3A 2CXUA 5BSEA 1QX3A 3BWEA 2P5YA 3HP1A 3EDRA 2C7RA 1OILA 4JL5A 3TYXA 1WA5A 3U4AA 3MBIA 4LYAA 1BE8A 2MDTA 1N6OA 1WB9A 3MCAA 2H0AA 1LBSA 2IWHA 2DU8A 3A6EA 3E27A 3RFXA 3AY6A 4DR2C 1A8HA 3RKUA 3AHDA 1R2QA 5ECWA 3WMWA 2PKEA 2JZCA 4GHWA 3PVCA 5I8PA 3C0KA 2J9ZB 3LDAA 2Z09A 4DR3C 3P9IA 5LCIA 3EVBA 5I7SA 1M5RA 1SU4A 3KTAB 1ZESA 2DAPA 3WYNA 1NXPA 1OIWA 1CNEA 3RV2A 4F96A 2DT5A 4OUDA 3NIDB 3B8HA 1JEAA 1SB9A 1IZ8A 3MCTA 4HUJA 5FR2A 4ENWA 1AQIA 4LRWA 5ALDA 5DDIP 1DAHA 2ZSJA 5CPBA 4ZYUA 4PAOA 3F4LA 1O2DA 1EVJA 1PI3A 2O2SA 4G9BA 4WVFA 5HJ7A 3MS4A 4LDPA 3ZHRA 3NBQA 4QDUA 4EQZA 3RT9A 3BILA 1NX6A 3E03A 5FI3A 2OQ2A 1GKYA 2HPVA 4KQFA 1JG3A 4TL8A 4XI9A 3V7WA 4COKA 3HPQA 4Q9KA 1DRJA 3Q3GE 4RHYA 3STVA 2JLYA 3LX8A 1O6GA 3U19A 1Q1ZA 1JFVA 3U7IA 3AR5A 3OEEA 1OZFA 3DHNA 3OT4A 3NAQA 1N5MA 3UFXB 3IXQA 2JFYA 2CNOA 4D80A 2QU8A 4D8UA 2B20A 3GDOA 4ZI7A 3KLMX 3QXCA 4ZMSA 1HE2A 1HOTA 4Y1GA 5CPFA 3JPWA 1H9AA 1T0PA 5DV9A 2TMGA 3NLLA 1OYOA 2E85A 3VR4H 3NJRA 5DYGA 2BFBB 1QO7A 4RM2A 2HV8A 2VJOA 4IF6A 1RVV1 4N18A 3O91A 1PTJA 4J6FA 2R87A 1YUMA 2G8LA 3JQBA 4OJQA 4XWKA 5C8YB 4FYIA 5DM0A 4XSGA 2HI0A 1JDNA 4WCFB 1Z8HA 3WIEA 3OM9A 3T1QA 2WT9A 3ETHA 1V71A 1RG9A 1WS6A 3OZXA 4TM7A 3LA8A 4FEEA 1C1XA 1IHUA 3AL0C 3ELDA 4UDOA 5LQDA 3FG9A 1MHPA 3OPYI 4MW5A 2QLFA 4YREA 5DNYB 2IE0A 2C77A 3QI2A 1DWQA 1EE1A 3O2NA 1GTJ1 2EQ5A 1CEYA 3SU8A 1JYSA 2JRLA 3QUQA 2PWBA 2EG9A 4HDCA 4XVHA 5BN4B 4CLOB 4W1RA 4YRAA 1QH1B 2HA3A 4AN1A 4URXR 1ACLA 2B82A 5BSVA 1AUXA 1TVKA 2OMKA 2XDQA 1OD6A 4JASB 4OTZA 4X6UA 4ZO8A 5DX1A 1AG9A 1D5CA 1QHFA 3MTJA 4I4NA 3JAWA 4LDRA 1KDPA 1FMLA 2BH1X 2H1SA 5D2CA 4YUVA 2WVJA 4LXHA 1NVFA 4IDGA 1FTQA 3LVRE 5GV8A 4EB8A 4JLDA 1SUSA 3C41J 2Y1CA 5TS3A 4J1TA 1P44A 5JZ9A 3G0GA 4IEIA 1E66A 3ZH9B 1NYTA 4CF5A 2Q9UA 3D9QX 4H0CA 5KPDA 3JQ6A 1UBEA 1M8PA 2VK8A 3CLTD 4ZOQI 1JQAA 5MFZA 1DUVG 3SZRA 4FMBB 3FOFC 2FEXA 3SR4A 3TTUA 3GGJA 3V6LA 5EJ4A 1DRKA 5BR4A 2YWJA 2MINB 4QUHA 4ZVSA 4GVXA 4MVJA 2NGRA 1FPMA 2VRCA 4CL3A 3MPOA 3O75A 4R4JA 4CKWB 4KE9A 5IC4A 1DG3A 1E4VA 3LPNA 3HCCA 1XMXA 4PYNA 4OHPA 4RH3A 2LCQA 3C3XA 3ADPA 4IMPA 1Y6ZA 2OD7A 2NU8B 4LZAA 4NYJQ 1DXOA 1PT6A 4L4ZA 3LCJA 1DWPA 4O4JA 1WXDA 1A4RA 2VA8A 5GAJA 4Z4QA 2HHHB 1L7VC 4Q9AA 2OKGA 4TZTA 2VJPA 4GFDA 2QTBA 5TV2A 5KNLA 2D5IA 1CJMA 1IHXA 1RJEA 2CMHA 2VC2B 3OWXA 5FOUA 3RTCA 1SXJE 4PZLA 3W05A 3L7OA 4EUEA 1IH8A 3R0XA 2CEKA 2ZRIA 3OUTA 2MMGA 2NAFA 3FF4A 4P3KA 4BCCA 4NC9A 8ADHA 1E1DA 2VSOA 2P2GA 3WNZA 1KETA 3LZCA 4ND7A 2HLDD 1EPUA 2HSDA 4EA6A 3VKGA 2DFKB 2WE7A 3HR4A 1EWKA 1VSVA 3BREA 1HZZA 1NX9A 5A6VA 1T5DX 1YOBA 2W42A 1EHYA 5CEJA 1C1DB 2WU8A 4B3JA 3PTZA 1YS7A 3Q3JB 3ZWPA 3COVA 4EO9A 2A7QA 3LKBA 4ESEA 2ZRBA 3KFVA 2X15A 1WP9A 3EVEA 4QHSA 4CBVA 1PG0A 3ZHSA 4ZHQA 3OFND 4CM8B 4EGFA 1JE0A 1YB7A 3A6LA 4JROA 2EERA 3SYNA 1I5RA 3PICA 2WSIA 3ZU3A 2Q0XA 3DFIA 3I2FA 3O2QB 4HWRA 3RVPA 1QC5B 1JAYA 1V45E 3L18A 2Z2KA 3OY7A 1PFVA 1Y81A 3BFJA 4TKVB 3FBTA 5KHOC 4QBHA 4OJYA 3I09A 4AWBA 1A4UA 3E3AA 3HY3A 5EJ7A 4FZJA 2HLPA 2ZVJA 3HB5X 3EA0A 3UM9A 3IKVA 3RSHA 1YZTA 4H9GA 2JANA 4NZZA 4YP5A 5KNCA 1CUHA 5EQJB 3G2MA 3E3OA 1OBHA 4JB3A 4LE2A 1JHOA 3JWGA 3NU1A 4RMHA 3VV3A 2PRIA 4BMYA 1IN7A 1N3YA 3KPWA 1DKRA 1HG1A 2GHIA 2AR9A 4NENB 3RM3A 1ZVVA 4QFCA 4KBFA 5GQSA 5MGNA 4DGSA 4L85A 2J5BA 3M33A 1D4FA 2WZQA 1U6IA 1Z2DA 1L6IA 2QL8A 2J3HA 3AFHA 3M6LA 4AKSA 5AW3A 4D26A 2CYCA 3KKMA 2HN9A 1CFZA 3C8MA 4P83A 2R86A 5CM8B 3QOYA 4E3ZA 4F85A 2IP4A 1AGXA 1G20A 1Z7GA 5A62A 2JARA 3UUFA 2PSHA 4IRMA 1TMKA 2A3NA 1CRZA 1T2EA 2WIFA 3NNSA 1XQ9A 4WW0A 2W6CX 1IQPA 1JHPA 1QG4A 3LUGA 3HFRA 1G6KA 4AZVA 3JQFA 5EIOA 1P1KA 2VCYA 3QJYA 3ABQB 5LVAA 1SQGA 1O94A 1XHEA 2VHJA 2M6SA 3JYOA 1VJ5A 3H8WA 4V2UA 2ZPAA 1E5DA 2Z1NA 1V7PC 1C0EA 2CHQA 1NMEA 2HSJA 4W7IA 1PO7A 1Q92A 4F1KA 1UK8A 2DCUA 3IEMA 3BK7A 1G2IA 1ISRA 1CRPA 4CQMA 4G0MA 5H9UA 1QPZA 1U90A 2CLCX 2EGTA 2BOVA 3TX6A 4CQLB 5LNK1 4M83A 4YCBA 4G97A 4DLTA 1E1RD 2YWRA 1LDNA 3G2HA 2ZM6B 1NBHA 4L8VA 3JQCA 4L78A 5ALHA 3TB6A 3X1MA 4EYKA 1TKAA 4Z2AA 3B52X 4BZQA 2RHDA 5JJBA 4IFBA 4Y9RA 4KUEA 4E5DA 1Z2NX 2GVZC 2JZOA 2R6DA 3ECAA 1XC7A 4TN5A 5MN6A 4HVCA 3UMBA 1H0KA 3HEAA 3KOOA 1YB4A 1DAOA 1QCYA 3MTDA 4FFBB 4M54A 1GOTA 3NHLA 2DSNA 2GFHA 3FY4A 4P2BA 5JZMA 1RMYA 1Y9DA 2ZSAA 3FCXA 3ORRA 1Z5NA 4RQTA 1I2ZA 5I4KA 5IZCA 3URKA 2MJLA 1XMQC 4JMLA 3HVHA 1KGDA 4B0PA 1SXJC 2QUKA 1N2JA 2POCA 1FSGA 2Y1GA 5A1TA 3ESYA 4UM8B 1REQA 4DLBA 1LQ2A 2DFDA 2Q41A 1O96B 1P1CA 2VJLA 4RZQA 1UOQA 5K0LA 2WQ6A 1MVOA 4DWOA 5ER9A 1UC9A 4MCJA 4X20B 3IUNA 2ZR7A 1MQ8B 2A59A 4PYJA 1L7PA 2GESA 3FOAA 4BTVA 3RRNA 1QWOA 2C4UA 5HVNA 2PSJA 1E3LA 3KOZA 1Z4LA 2QN9A 4QD3A 4GBGA 4HXFB 4KW7A 1M8FA 3KDPA 1U0EA 3EAQA 1QU2A 1NVXQ 1D07A 5CZVA 3N8DA 1K27A 3F1LA 3FTPA 1QLJA 1L7OA 3HK2A 4MS4B 3ESCA 4KWHA 4C43A 1U3VA 4WDQA 4BRSA 3L07A 2R7AA 4DA9A 4MAAA 3RVDA 3L8ZA 2REBA 2OHGA 2H06A 3PEUA 3TW8B 4BZPA 4JI7C 2NYUA 1DUIA 3A9UA 1CUYA 3BGIA 3C6XA 5JT1A 3CE9A 5BPHA 4IDAA 1MGOA 4RTOA 4AQYC 1INLA 5K3CA 3HC7A 1PR3A 3URMA 4A23A 3A2KA 2OZLB 1IWOA 4G9GA 1UXIA 4RC9A 3VJRA 5CBKA 4EPYA 1UZLA 1CUGA 3LM8A 1YFLA 2CB9A 3HNRA 2J6CA 3NPMA 5I48A 3ZHVA 5L4SA 1O0CA 3QPUA 2NP7A 1RFLA 3AP1A 1FQJA 2I7XA 3AJEA 4HLNA 4X62C 5EQFA 1GGHA 1L7AA 3K9LA 2ASBA 4YWJA 1XKLA 5DX0A 1H0SA 2VZ9A 3BZBA 4OIMA 4LGYA 3VSAA 5EIXA 4BGEA 1XVIA 4O2BA 1TAUA 1E6LA 2P6OA 2J3LA 1PUIA 2KLBA 1JHQA 2R6ZA 1CF9A 1IBSA 1WMSA 1NJFA 2HIGA 2QXYA 3GNLA 4HCJA 1UBLS 1X14A 4C0QC 4KWTA 3W6UA 3F6BX 3ETDA 4ZQCB 1MT0A 1MAUA 3FLMA 1Y8RA 4L15A 4V2IA 4R71A 3RYCA 1PS8A 2R00A 1Q6YA 2XSZA 3IQEA 4WLUA 4Y30A 3B53X 4Q34A 4Y2JA 1IEWA 2VWQA 3A3PA 2G83A 3ETLA 4DYVA 5KSOA 1GU0A 1WG8A 1RYMA 3WAJA 1ZUWA 2YZNA 1D6JA 5HW0A 5LQUA 5LZ7A 3A2MA 1UEJA 4WKGA 4Y6PA 3AEXA 3CO0S 3BSWA 3NTQA 3NBXX 4O02B 3ANMA 5EKTA 2XYPA 1D4AA 3P97A 1U02A 2IRWA 4NZNA 1L4FA 2O8EB 4WAUA 4LJ8A 2HU2A 3OMXA 5E3IA 5B3AA 3UMFA 2QMQA 1K9VF 1J5PA 3EXEB 2NSLA 4NH0A 5C7IO 1MABA 2ST1A 4ACBA 2YXBA 3THXA 2BM8A 3SYKA 4QBGB 3D4LA 1RQGA 4OGFA 3QWAA 4C0AC 1I3NA 4MUBA 1QH8A 3V97A 4G56A 2HNBA 4AKGA 1O08A 1R0XA 2CLIB 3ZZTA 1QZUA 1V5WA 3OT1A 4P98A 5FWDA 3ZVMA 4IHKA 4D8TA 3ZJVA 5HUJA 4WCFC 1BKSB 1U7UA 2H7XA 3FDZA 2DLNA 1TJPB 2WP0C 2JCYA 2O48X 3HYNA 1EUDA 3UKDA 4ZZIA 5AVUA 1UBRS 3VISA 1ABFA 2BFDB 2UAGA 5JR3A 3N2LA 4KO8A 4QXRA 4QGSA 5TMPA 2BMEA 2H1WA 2OBNA 2WJ4A 3IULA 1T6YA 3OOJA 4TRRA 4JP2A 4U2GA 2TECE 1EVZA 4UFNA 3SQLA 2RD2A 2AW3A 4LMRA 1II8A 4Y67A 1ZW6A 1M34A 4GP9A 5I9TA 3UJ7A 4A8JA 1D04A 1UUFA 5KIAA 3UJCA 1F2TA 2UXBC 1KY5A 4PRKA 3HVIA 1DXQA 1YBFA 2P9BA 2B8EA 2H92A 3ZN2A 3RW9A 3KR9A 4HFRA 1KSHA 3CVVA 3LXMA 2P5SA 2Y66A 2IXBA 3OE7D 3BL5A 3BXGA 3CVOA 2LKDA 1GPLA 4NAUA 4YRTA 5EE1A 3HMQA 1K6XA 4RX1A 1KJQA 2DHEA 5LUBA 3CLUC 1CD5A 5DYNA 2GBPA 1MJFA 3NI2A 3W8RA 4CXMA 1QNFA 2JFPA 2EJCA 2ZRMA 2YHIB 5DI3B 5E0KB 4LWPA 4BOYA 4EFMA 3R76A 1R0YA 1I7NA 3R3UA 5CJ2A 3ZCUA 4YXWD 1PW7A 4GX1A 4D81A 4MULA 1Z12A 4N5NA 3BSYA 1DDIA 3AZOA 5LKAA 2OCLA 2REOA 2ORYA 2YZMA 3GBSA 2WA2A 4KAXA 2C4TA 1UPFA 5CB8A 3H5NA 2GBGA 4M88A 2XYQA 4EDHA 5BSFA 4QZVA 1ZQ9A 1R8JA 4CU5A 2EEZA 5DFAA 3PK0A 1BH6A 3AIMA 3IXLA 4Z3DA 2BFEB 3EJWA 1EDZA 1V60A 2PUVA 3CUVA 1KZ9A 1DIOB 2Z5FA 3ENNA 4UHBA 1YA8A 4TUYF 4E7PA 4H7PA 3CEMA 4MP6A 1D1TA 3ZY2A 2PKYX 1W0CA 2EZ9A 3DLTA 4M8KA 4BP9A 3KXWA 1XKQA 3TLMA 1C50A 5D1HA 2ZBFA 1TKRA 2V7PA 3T95A 1OYWA 2XLCA 1WHTB 4EUHA 3LVFO 1OWMA 2AG6A 1KJIA 3O4HA 1G98A 3RFCA 1W85B 4QWMA 1TYZA 4GMGA 4OAPA 1H3NA 1LQUA 2H31A 2O4UX 2PT7G 1KIAA 4MITA 3H2GA 1PQUA 1HDEA 1JXMA 2ATEA 2JLAA 3MMXA 1X6VA 4TMYA 2JW5A 1YDEA 4EAAA 1NATA 4Z7JA 3MWDA 3SC3A 4CCSA 2XMZA 1CC1S 3TE7A 3V4ZA 2WP8J 4YASA 3FTFA 2R7LA 1H94A 3F3YA 4WOCA 4YJGA 5DEOA 5FNVB 3D2AA 2VG8A 3QZUA 1QV9A 4RELA 4WZAA 5IYZF 3T3DA 4CNBA 5BURA 4RACA 5CT8A 1LW6E 1GFZA 1RYZA 2I7CA 1N2SA 4FGSA 2HTFA 2PZBA 4BNUA 1NYQA 1MVLA 5FOVA 2C5BA 3ADOA 3KB8A 2FPPB 1F2UA 4IJ5A 4RD3A 3SYLA 1XRPA 4MRNA 2D13A 1CJSA 1WF6A 3D3WB 4C2TA 2WE8A 3C3KA 4AMUA 2WM8A 4BZXA 2CDCA 3H13A 9GPBA 1NSTA 4DTCA 3PP8A 3ZE6A 3JARA 1T4CA 2QT0A 1VDMA 3O1LA 3G0HA 4PSDA 4ARIA 3HKDA 5IBQA 1KDTA 2HNKA 3LUSA 3HZZA 4I50B 3ZE0B 3PDHA 4PE5B 1J23A 2QTNA 4RPCA 1KH3A 3P0JA 4TYNA 2Q3CA 2ZG6A 3QQPA 1P4RA 1ZI8A 5ITSA 2C7PA 1MAVA 2GZSA 2W71A 5IT5A 1JQBA 4S1VA 3D2CA 3TIGA 4ASUA 1V96A 2PKQP 2WMDA 1ODSA 4MQEB 4EKNB 3TFQA 4Y98A 2R84A 2YWDA 4L0CA 4NFLA 5AI6A 1J4AA 2DY0A 4ZYXA 5DSXA 1COWD 3OTOC 4MV9A 1NBAA 5HSGA 5AVYA 3IP1A 2AR0A 4V02A 1DMSA 3PXUA 4O6VA 4C6RA 2BJHA 3OJOA 3P2YA 2P3SA 2CT8A 4FS8A 4CMHA 2CZGA 1Z8FA 5AJWA 3CUKA 2HA2A 2EHDA 2GD1O 3QF4A 2AL7A 4PYLA 4WE3A 4KLAA 3SE0A 2HU5A 2WYVA 3MT9A 4U3JA 4FXPA 2FJ0A 4MRRA 1UWDA 1JLLA 1FK8A 2DPGA 3E8XA 3N8NA 3PKIA 3K0HA 2ZT8A 4HWGA 4QQKA 1KDVA 2CNNA 3IQIX 4D9EA 3GHHA 1FFXA 1NOIA 2FW6A 4CV1A 4BC7A 5JH7A 3TTWA 2O7VA 1U0FA 2EQBA 2JC3A 3BFXA 1V3QE 4PUIA 2ZR8A 2X3FA 3EFOA 3LP5A 3UCEA 3QF7A 1HURA 3GYBA 3UCFA 3QLEA 5TT1A 4DLVA 5FLKA 1UAAA 1NI4A 5DRTA 5C46F 4DR1C 1BOOA 4PTZA 1CZOA 1P2BA 3T5GA 5JD5A 1SO8A 1TCUA 1Z16A 3GVHA 3RRZA 3IVRA 1RTKA 1MX9A 3IUYA 1GZHB 3MOSA 4WOKA 3PUWA 4XWYA 4MQ6A 3VJLA 4TVBA 3LUFA 4YAWA 3ZK9A 5AI0A 3LOPA 1KU6A 4LXUA 4MICA 5CFZA 5A02A 2HGZA 1TECE 3GLKA 2VH2A 4G1MB 3OIWA 4F84A 1E3WA 4KV7A 1SCNE 4GDFA 2ZYRA 2FLVA 2Q7OE 4P38A 2OHHA 3ENWA 1UM8A 5F1OA 1SHUX 3HLTA 4IDBA 3E1KA 3L7JA 5LBUA 3IEXA 1SUBA 3HVKA 3TZQA 4AY4A 3NP9A 4ZU3A 1B73A 2GD6A 1FLOA 4HN2A 3UW1A 4ZLPA 3BULA 2PYZA 1TLFA 2Y1OA 5H3CA 3WQRA 2WFMA 4E12A 2AI2A 5LZ2A 2ZQZA 3WLMA 2BJVA 3VU1A 4Q3EA 3DONA 1NW5A 2QZSA 1FB5A 1IY1A 3EHEA 2AEJA 1OJLA 4KNVA 5D3KA 1IM8A 5CX1A 2AN1A 1USUA 2VDUE 3N2EA 5COAA 2QVBA 5JRJA 3PL1A 4L4XA 1N7IA 5AWFC 3G68A 3IURA 3H04A 2W6IA 3FNQA 4NI5A 1SIBE 4HN9A 3ZW7A 1KI8A 1EHIA 4BE7B 2DTXA 4JLNA 4Q1BA 2B8JA 1II0A 1U2QA 3N7TA 4TL6A 1Q91A 4U1RA 1C1XB 2XGJA 1FMJA 1ZDMA 2V58A 1D2MA 2DP4E 4DIKA 4KWEA 4FNOA 1A5AB 2Q6LA 5HFNA 4B87A 1N1DA 2BV3A 4CFSA 4TTTS 2AW5A 4HMPA 4M0DA 5F5NA 2MMAB 4R9VA 2AYXA 4OM8A 2L42A 3K94A 2V98A 2XDQB 1XZEA 2VK4A 4PYIA 1T8WA 2JCVA 1E7WA 4XQ9A 2DSTA 2XF2A 3K5PA 2B4RO 4YMLA 5CH5A 5LU8A 3JAWB 3ZDYB 2J85A 1W581 4N41A 4Z7OB 4PZDA 1CR2A 3PJGA 4X66C 2HBZA 1IM2A 4C0XA 1RW4A 4S1PA 2R8ZA 3F7OA 1HDCA 4XJSA 3EZLA 1PNQA 4R7GA 3UENA 3U26A 1EX9A 3DOJA 3C7TA 4QIHA 1LEHA 4O33A 5HKKA 4P4UA 4CMIB 4GLJA 1U6JA 3K0CC 1KQFA 3BL6A 1QV7A 1V4BA 2IYUA 4QDJA 3EF0A 4QECA 4DHWA 2AMLA 3FZQA 4H3VA 1QIGA 4TXJA 1C2TA 1QONA 3JALA 3ND8A 4KYIB 4C29A 1XEAA 4D2IA 1GUBA 4UEQA 2HHCA 4D44A 1AV6A 2RGDA 3JU3A 1I3KA 5LQCA 1MXBA 5KI6A 2IZ5A 4DBVO 2DC1A 1G8YA 5DGTA 4Z99A 4KR0A 4MWDA 4F04A 3MZ0A 3N9IA 4NYMR 3R7WA 4GVLA 5DH9A 3SQXA 3UGJA 3IA7A 1M2WA 4YP7A 3S0JA 4U2BA 2W2NA 4ANFA 4DDMA 1H4TA 4HB2A 5JASA 4O4JB 5J2UF 4L0MA 4RZ3A 1DCKA 1ULAA 2CC2A 3GELA 4MCIA 1ZB8A 2MCFA 3VZBA 1KZ1A 3X3HA 3M6XA 4U2DA 2IVFA 3OU7A 5E1DA 3TLCA 1L4YA 3EGVA 2PT7A 3KKPA 3PPWA 3O1IC 1TT7A 1P77A 4BNFA 1Q7TA 5DIZA 4M1ZA 5IC5A 3OZIA 4FSDA 4HH0A 2C2BA 3NATA 4EAQA 1EQUA 1DKNA 1EVQA 1DARA 4WXMA 4J3NA 1WMDA 3M6AA 4BWYA 3K71B 5LMUC 4P31A 2GM5A 3QOFA 1ICIA 5EWLB 3ZI4A 3LCCA 1V9CA 3L8HA 3ZU4A 3VOAA 1KYVA 1B43A 3LNOA 4BNJA 5TARA 3OPVA 2QY9A 1YJCA 2NU9A 4Y18A 3N0VA 3WJ1A 3BRWD 3CR3C 3MTQA 1OLXB 1IBKC 2BELA 2J41A 2VDVE 1R1DA 1F8UA 2ZAIA 4IRUB 2VYCA 2PR7A 3FYUC 3Q2IA 1KSGA 3S4YA 3K6KA 1LH0A 5EJ6A 4ZHQB 3PIIA 4L5JA 5EHIA 4DANA 4EJFA 5I45A 3LYUA 3W4IA 3N59A 1AS2A 1E1QA 4M3NA 3CBGA 4KMOA 5M3BA 4C78A 1VZ2A 3O92A 4URWR 2IJGX 4AKTA 3RNOA 1TLLA 4XWWA 2EOAA 3ETGA 3LUHA 4EW1A 2A9VA 4P8RA 4L3VA 2DB3A 1JSXA 1ISMA 2EFJA 3BDIA 2JL1A 3KVNA 1SOVA 4DWJA 2Q5IA 4KLRA 1T6ZA 2VT2A 4NEHB 5LP6A 3EUAA 3JCZA 4D57A 2Y0EA 1W52X 3T1YB 5JW6A 3H6HA 3IBGA 3REGA 1QYRA 2AS0A 1LLQA 2F1HA 2IKQA 4WASA 2IV3A 2BBWA 2XNSA 3F9RA 1EG7A 4F5YA 2I3GA 3BFPA 1E9EA 1OT3A 3E3LA 3MGCA 4PVDA 4ZRDA 3ZOZA 4NXMB 1P0FA 3M6MD 1H9BA 3DKRA 1Q0QA 3LECA 4QT4A 3O8OA 2CGEA 4IDEA 3EXG1 2HUPA 1FS4A 2GXSA 4Y1RB 1E63A 2WWGA 5FBRB 4YWHA 2IVZA 3LT1A 1KHTA 3FE2A 4JV5B 4LOLA 4FYHA 2NYVA 3ABZA 5CZXA 3IV6A 4R8LA 5F5XA 4DCPA 2BMJA 5LIPA 4M9RA 3C85A 4OUKX 1VSUA 3IJRA 4IIJA 1SVKA 4DIMA 3RAFC 1GEEA 1NBMD 4MWBA 3OAAA 3RB8A 3H18A 1EGMB 4BFUA 1M83A 2P62A 5K1ZA 1RAIA 4KB5A 4LYDA 1EFRA 4NECA 1F0NA 3PKZA 4ATNA 2UYHA 2I8LA 1G0OA 5K8JB 2BFFB 4ISBA 3EVTA 2XZTA 1UC4B 4MGEA 3HJCA 1Q0TA 3RHFA 3NBAA 4RCYA 4S1NA 4YUYA 2A0YA 1YBAA 4RA6A 4CQMB 5FEUA 5I9IA 1UC5B 1C80A 3TRFA 3ZWVA 2QRNA 1FU4A 4PX3A 1KY2A 4O4IF 3MTGA 1G8PA 3JYHA 3WB1A 4ZYYA 4Z4CA 2YV4A 3WDKA 1PNRA 2B9EA 2V7EA 2WWRA 3RSCA 1WTAA 2VHWA 3VR5A 1JILA 5DN6D 3H1AA 4IOKA 1JG7A 3P52A 1QWIA 5JY1A 1S7GA 2NTEA 1RKUA 3GPBA 5HRUA 4H6PA 2ON6A 5ED0A 2NZUG 1OU4A 1QHGA 4X60A 3ZV3A 3M2PA 4GRDA 4TV8F 2PBZA 4LZNA 1Z29A 1KMMA 4ZJZA 4AO8A 3F47A 3MF4A 4J91A 4KVZA 4OV6B 4IUCS 1MFZA 2AD1A 4BMOB 1JIUA 1NW6A 3GRYA 3Q11A 3D5TA 1E6KA 2G04A 3QX9A 3ZLUA 5JJLA 2VKQA 3ZX4A 1N32B 3L95X 1TMOA 5DYIA 4N01A 1LQLA 1M7HA 1I7DA 1O95D 5G0UA 2F9MA 4RTQA 1REQB 2D06A 1XWIA 2OGSA 1HE8B 1TTHA 3WJ7A 1EUYA 3BMXA 4KIUA 3BD9A 2Q3LA 2X8LA 5ARDA 4A2QA 4LF4B 1PUXA 2QQFA 3SXPA 3OBBA 4RULA 1GNTA 1K9SA 4D4GA 1YZNA 2WP0A 4K6CA 1TU0A 4V0MA 1EXMA 2VOEA 3SQOA 3KJZA 5CXQA 3ZGLA 4CW7A 3ZD8A 4EDFA 1XMSA 4C7VA 3LSYA 3HCWA 2ZRDA 4AJKA 5CDHA 4ZK6A 1HLGA 3ODGA 3UMSA 3FWYA 3IOEA 3FROA 4DT1A 1NL3A 1PAUA 4EFLA 3DMNA 4K6FA 1LNSA 3VDNB 3DWEX 2DUWA 5B3LA 5DBGA 2WSSA 5T4EA 1CUVA 4FI3F 4V1CA 3U6KA 2X4DA 1V3VA 4GC9A 1T43A 1XVAA 2QZPA 1UFKA 3PYXA 1V3TA 4MOWA 4D6XA 1TX4B 4XB1A 4MVJE 2VT3A 4GI5A 1JRLA 1XALA 3L7MA 4L8LA 2C88A 3LQ2A 2GMWA 2ZIGA 3G3EA 3NEJA 1GZ4A 2XWQA 1NNI1 2RBGA 2E37A 4KDEA 1QR6A 2YMPA 2OB1A 4I19A 1LPMA 1RWMA 2HZBA 2I76A 2P0AA 2W93A 5L3QB 5JZBA 1CR4A 4ZOAA 3ELYA 2QD2A 4OLJA 4XVUA 1WSBA 1CTQA 5F7XA 2PH5A 5JEEA 4MV5A 2WT8A 2WOOA 1NE2A 2BGTA 3G2PA 3AI2A 3FH0A 3G7UA 4LIPD 1VGRA 1Q0HA 3LQ1A 4MNTA 1K6IA 3FA2A 2A67A 1NNLA 2FWBA 3LSTA 4JJ4A 5B2FA 1GZDA 2AWOA 2FSSA 1F6WA 4O2BB 1QCDA 3I1FA 3JASA 3QFHA 5EJ5A 3KV3O 1FNSA 3IIKA 1DAPA 1XRLA 2VK2A 1HG0A 2ZJ3A 3ZCTA 2PX8A 1C4KA 4D3DA 3J81D 3RYCB 1Y8RB 2AEMA 3BCUA 3O9ZA 3ZW9A 5BQFA 4LTDA 4PLGA 4DCUA 5JAOA 3IR5A 1GSHA 5CFMA 1UWKA 1OH8A 2D8AA 3V4VB 4ZCIA 2R7KA 1L9KA 3DGEC 3C8UA 4HTFB 3TXAA 1CB0A 1RZRD 2H0RA 1NZJA 1DEAA 5J5CA 3HSSA 3C15C 4PX9A 621PA 4CF7A 2GRAA 4XTRA 2YV2A 2B4TO 1OVGA 3LA6A 2XTNA 2XUHA 2IEIA 1ACMA 2GPYA 4CLHA 2MT9A 2V7XA 3MA0A 1C8VB 2Z9CA 2C3PA 2Y1LA 3V4SA 3ENVA 1P5HA 2C2XA 2CBGA 2W48A 4I9HA 4RMJA 5BSUA 4Z8XA 4KNYA 3KCQA 4TSRA 3TRJA 1Z5UA 3CZCA 3QPVA 4N39A 1QWSA 1GCOA 1DAFA 2FN7A 2UZ1B 3A1DA 3G8BA 4G5GA 4B4DA 1AJEA 1MABB 2ZE6A 3TRKA 7MDHA 3BH0A 1GT91 4HTAA 3ZS9A 2Q3FA 1ECJA 1GNVA 3N5KA 3THXB 4KI7A 5LBTA 1IBLC 2QN2A 4JGIA 1BEUB 3OLQA 4IDNA 5FH9A 5A0TA 3DOIA 3RBVA 1N57A 3MCUA 1LKZA 2ECQA 2OC4A 4DYDA 2VRNA 1FEZA 1KJ8A 2DZDA 3OE5A 2FZCA 4FGKA 2P75A 4MVYA 1EYZA 1FRQA 1U0LA 3FDZB 4C5AA 5KQSA 2JASA 1EUDB 4D4HA 4G67A 2MCQA 2JLXA 2YRWA 3DZGA 3ONDA 4XCQA 1ZG3A 4B71A 5IT4A 1Q22A 1HK7A 3WO0A 2VF4X 1M33A 1T5SA 3AUAA 3LAXA 2C3UA 1NW3A 3KPJA 3LO5A 1ODFA 1MW9X 3H75A 1M34B 2VRWA 1T8PA 4YUZA 2E5LB 3Q0EA 4K03A 4UKDA 1KR5A 4A8JB 1PQYA 3T1NA 3WSTA 1KORA 3IDOA 4R9NA 4YMHA 5LZ4A 4HPWA 5IS2A 1KBZA 4V0NA 4Q48A 1U8CB 2G5GX 3N53A 2B4AA 1ZM9A 4CKZA 4MVJH 4R05A 3ICPA 2F64A 5IAEA 4QJ3A 2H85A 4MKGA 1HOXA 1ZN2A 1N2OA 4IF4A 4A0RA 1EJ2A 1N2CA 2GEKA 1BHJA 2NVWA 1FYEA 5DLEA 2C0PA 5P21A 1JEYA 3LDFA 1OIXA 1C3JA 3VKWA 3JY6A 2QSUA 1U3UA 3G0IA 5FORA 1EX6A 2HRDA 4E15A 2PIAA 3OTHA 4ZEVA 1A9TA 2RHMA 1E5TA 3GZ4A 3H97A 3BA1A 3LRPA 4FZ5A 1CWUA 4Q7LA 4YS6A 1P73A 5FTLA 4CTOA 6CHYA 2LVBA 1EBFA 4AJ4A 3EGWA 5BMVA 3V2GA 3GARA 1N34C 3HVJA 3EGDB 3OHSX 4EMBA 5LQSA 1Z17A 1RI4A 3D8RA 5K5EA 1X7XA 4AF6A 1XTZA 1KU0A 2I2CA 4OQNA 4L16A 2AOUA 2PJDA 4DDTA 5ADWA 2H59A 4DCVA 4WKCA 3V5NA 1W34A 2ZRLA 3VOSA 4EPVA 1SHZA 2ZUCA 3H7AA 1L5HA 4RAOA 3GRPA 2PMCA 2NN3C 4RPHA 5IDWA 3C3JA 1JTVA 4BWGA 3Q8MA 5D5HA 4AT1A 3L7IA 2ZRJA 5I9BA 4LGMA 2FQ1A 4C7MA 1NQ5A 1X7YB 2FQYA 5DYYA 3ZGNA 1KYTA 1QH9A 4QRIA 2OFOA 3OPMA 3RV4A 4YIKA 3PSAA 1OE0A 2OBLA 2OQVA 1ES9A 4FFMA 1XA4A 3MWDB 1S89A 4LY0A 1BHQ1 5FL7D 2XUPA 4EPWA 4YJGB 2XOEA 4GBJA 3P27A 3I08A 2RGXA 1IAQA 3PL5A 2JRCA 4LE0A 2A0XA 4O2AF 1FW8A 1BXKA 1DBIA 4IBOA 4IVNA 4UJ3A 4MWSA 5DK6A 5AW5A 5T8KC 1DSSG 4RPJA 1JTEA 5F1YA 3SKVA 3T3MB 5K20A 1XTBA 4Q82A 5LZ5A 3A6DA 3WLTA 3VUEA 2IHJA 4CPDA 1B2RA 2VP4A 2RJ3A 1F2UB 3IMLA 2ONKA 3QHPA 4DQXA 5HIKA 3J81k 1XDGA 1M76A 2LIVA 2P2YA 3DV0A 1NP3A 5KSZA 3I64A 4FFLA 2H1IA 4HQ6A 3SIWA 3PRJA 2OGTA 1CS4C 1ZH6A 1SZPA 1NV8A 2DX7A 4QBFA 2GN0A 3ZI0A 3LQKA 1Z6GA 3JARB 1F8XA 1T4CB 2MYPA 2XRFA 3QTLA 3HJNA 4FIDA 4HGPA 3I6IA 5GM2A 2WWVD 2YDYA 5DM60 3R0IA 4Z9YA 5A4IS 1T1RA 1VECA 4URZR 3RUCA 1LDEA 1LI7A 4PY2A 4F11A 5K4GA 3R75A 1UEXC 4HAUA 1HTTA 3VC1A 4WN9A 3FNGA 3CPEA 2Y2UA 3R74A 2QJFA 2QW8A 4M0LA 3OEWA 1SVSA 4EG4A 4B83A 1D09A 4JI1C 1PIWA 1SUAA 2C5FA 3Q3CA 2BI8A 3RVMA 4UTVA 1AUPA 1B74A 2BCJQ 2ADMA 3E5HA 1XP5A 1CQPA 3UTCA 1K4YA 3DDOA 1NPYA 4NXMC 4LRQA 4RDIA 3GLGB 1EFLA 1EHCA 3G49A 3I0MA 3MB5A 2IYTA 5KEIA 3P19A 5KNDA 1TI7A 2FPIA 3C4QA 1NUHA 4ITUA 1YKGA 3QF4B 3EA4A 3H2HA 1SBZA 1Y1SA 2K6GA 1W75A 3ABIA 4JOQA 5I8ZA 1XK6A 4TWAA 3SX2A 4A1FA 1KMHA 4EZBA 1T1EA 1JLLB 2WD7A 4LJKA 5LCXA 2AEEA 4W9NA 1VM6A 3CLRD 3WIVA 1N25A 2GPNA 4TQAA 4AUNA 2QLTA 4BE9A 1IXYA 1PNOA 5JH7B 4ZEXA 2Y0BA 1J33A 3OHMA 1H4QA 1BVRA 1XTTA 3ITKA 1DB3A 1YQDA 4K6OA 4ZT6A 3EFOB 1YRBA 3FOBA 3CWQA 5T4HA 1VKNA 3PDIA 3N6RA 2YFHA 5EZQA 1NI4B 2QF7A 4E4RA 1UZAA 1U3GA 3CC8A 1WBBA 3F6YA 4HNGA 3S6JA 4HBZA 3L0DA 1U0OC 5CA1F 4Q4HA 4P92A 5A06A 1MXHA 2QA5A 1GU7A 4LHEA 2R7NA 3AW8A 2QRHA 4D74A 2OCYC 5IULC 3JXEA 1HC7A 2V8OA 4IW3B 1DC8A 3DULA 2D59A 1H6AA 4OA5A 2VRCD 1PFGA 1JKMA 5H3HA 1E3WB 1SXGA 4ND2A 1EXVA 2R1UA 4K81B 4C3OB 3U9SA 4NCIA 1E0SA 4I6JA 4QEZA 5IRCD 2XE6A 1DFIA 1GXSA 2H16A 4NFYA 4ESOA 4OXYA 4PPNA 4X63A 2IH2A 3BXFA 3H65A 3I2IA 1X9HA 4P86A 2CYBA 1FXWF 4RKYA 2XB8A 2Y3IA 2OL4A 1XIVA 3I42A 4KX5A 1KTVA 4BAGA 3KHTA 4UAVA 3AHJA 1B0AA 3H17A 3IMEA 5HE8A 3ENZA 2PL5A 3NPAA 5G3YA 2DWQA 4JKIA 1RM5A 4ZCSA 4K46A 3PXEA 4J29A 4EKYA 4I4TB 5CX1B 1XTPA 1P4EC 1KI4A 4XD7A 4C3VA 5E2BA 2JIZA 3HP4A 2XYVA 2QN3A 421PA 4MRPA 1GJRA 4B4UA 1LDMA 4BLSA 1Z4QA 1L8AA 3Q9NA 5IDVA 1Q57A 2FZWA 3FYUA 4KI0A 3SQDA 1ZGAA 5DBOA 6REQB 4QDZA 4P4GA 1FLVA 1YRYE 1VC2A 4FC6A 4UCXA 3IUJA 5FP0A 3VR1A 4Y9TA 3ZWWA 4DLAA 3QSYA 5DJ5A 4PYKA 3PHLA 2C4HA 1KAHA 1U9IC 2WTAA 2ZYTX 3O0TA 4PLFA 4RY0A 4DUGD 1WMEA 2GHRA 5JMOA 2SNIE 4U7JA 3ZLJA 2HCBA 1KFKB 2WWIA 2CE2X 2P2SA 3BWYA 4PQYA 2A9PA 4QL3A 5J9FA 3KE9A 3VDXA 3RHTA 3BBLA 3S2GA 1YJBA 3R3WA 1JDBC 2YIDA 3B1ZA 2DERA 4URYR 1U8ZA 4QELA 3QQ5A 1ZU5A 2WZCA 5E6SA 1XJCA 4N5DA 2ZE7A 2QR5A 1F60A 1NUTA 3AWIA 2P41A 1M1NB 2B0CA 3FKJA 2ZB4A 3RE1A 3DDSA 2W6MA 4JJAA 3R9XA 4N7BA 1KK1A 1CEXA 4OXNA 5KNCD 2ENWA 4QO8A 2UUPA 1ABEA 5B3JC 3WGVA 1O1YA 3A7EA 3DE2X 3JWHA 3OTIA 4PU0A 3N2QA 3T7EA 5I7OA 3AOEC 2O7RA 4XWAA 2J07A 3L4JA 4RY2A 1NNSA 1QP4A 3NKFA 1ISJA 2XMQA 2F8LA 2P6PA 2UVQA 3LL4A 4AAYA 3N76A 5EGSA 3HM9A 3KTFA 4V0KA 4Y2QA 1SXIA 5B1DA 2I6TA 4FNAA 3RTBA 5TX7A 3LNVA 3JALB 3AC0A 4R40A 5H7XA 4DA6A 2JIQA 4PR3A 3MIZA 1YCHA 3FBGA 3NH9A 3G17A 4X24A 1L5VA 4BVKA 4OX9Y 5J2TA 1Y42X 2BFWA 5EQTA 4EH1A 2CK3A 4FYWA 4G89A 5JYBA 3HV0A 2Q5LA 3ESXA 4MGKR 3RRBA 3PPVA 4RORA 3I72A 5TRTA 2ILVA 4Z8YA 3E5MA 5DHRA 1RLUA 1FFGA 1H2HA 3WSWA 1KYZA 3USES 4MXDA 2NVUA 2XE7A 2ZUSA 3TGWA 1BMTA 1U7PA 1I0IA 3N2NA 4RIGA 1F7UA 1MLDA 2D0DA 2AG5A 1CZLA 4G1IA 2ADOA 4HQ0A 5A6SB 4CQMD 5CBPA 1I2DA 3CT4A 1GRNA 5HRCA 2VDNB 3DOOA 5IJWA 3TGPA 4K88A 1LVUA 2F43B 4J94A 3JAKA 2E4ZA 4UBIA 4Z1OA 4ZYZA 4RETA 3RVQA 4R68A 2FFQA 3HZRA 4Z3KA 1G5QA 2GRUA 3DFMA 2YJNA 3Q3HA 4TSKA 4C1NA 4DQLA 4HGYA 5EVCA 1PEKE 4MV7A 5KOHA 3FFXA 2IF0A 4QYMA 2CJWA 2NU9B 4B47A 1P81A 3B2QA 2LCIA 3F6SA 4U7TB 3HA3A 1IULA 5EKUA 2D7DA 2ZBVA 4KZPA 2J0EA 1R27A 2PR2A 4MYSA 3VSEA 5I9NA 3I83A 3PQ2A 2WFLA 3VVCA 5CJPA 1MJNA 4KPYA 3DEYX 1NVVR 1L4HA 1P9OA 4C76A 1X9GA 1VHLA 1ZMBA 4RJTA 3WGYA 1ONBA 1A9OA 1N6PA 3TAHA 4DLSA 1M5TA 3NUGA 1FUEA 1IIBA 3WGZA 5KYKA 4NTZA 3PUYA 4PX5A 1IN4A 1DLIA 2JGAA 5CAEA 5LLTA 1WDLA 4D25A 1BDMA 3C1TA 3W8EA 1JIJA 2IUSA 4FS3A 3C8DA 2CDRA 5LP6B 1XE3A 2W6JA 4KXVA 1EP3B 2D3WA 5EI5A 1MG0A 3PIRA 2W11A 1QPBA 3SN6A 5CDUA 1TOAA 5D5QA 1UXJA 3RS8A 3IAUA 2FPKA 2Q4TA 2RHCA 3LQFA 4C21A 4GPEA 4JLBA 3P2OA 2AZXA 3KUDA 4Y2RA 1W4ZA 2O07A 4CT4B 5GGYA 4CKEA 1A9ZA 1U2DA 2Q49A 5EKSA 1F38A 4XXHA 4BJ3A 4XWTA 3O8OB 4RFLA 2A5FA 2LGJA 2IEBA 4P3OA 1I94B 5SYNA 4NZOA 3R8XA 4DLPA 3QLUA 1E1KA 1ZUNA 1FYDA 5EEHA 2C7GA 4N3BA 5DGCA 1SCIA 2FGJA 4AC9A 3ZGZA 3WQBA 2XUZA 1EG2A 4FILA 2Q9AA 4YIHA 1JS1X 2XQGA 2PH7A 3NW9A 4IIJB 3GRZA 1YZVA 4LI0A 4LX0A 4RUKA 3KUXA 2Z4RA 1KMCA 1K66A 4LOAA 3BD8A 1M66A 1ZGGA 4Y0AA 5L53A 4GC5A 4MPJA 2BTQA 2RGEA 1DDOA 3KK0A 3KRTA 4QQRA 2OUKA 1KAEA 3BGSA 5HFAA 2J3IA 3QPDA 2JLQA 2OSBA 2KPOA 4U7HA 5HOQA 4RA6B 3GNQA 1PLKA 5AOBA 4YMGA 2XNKA 2QTWB 3R7AA 3RC3A 5K8LA 4HNTA 4B3RB 4OHFA 5BWMA 2IKSA 3FR7A 3CEPB 1CETA 3QLVA 5JNLA 2UZ3A 2XSZD 3P96A 4GI3A 2IPLA 3N5CA 4JT4A 1EIWA 1Y3BE 1LC3A 5NLLA 1DBPA 1BE6A 1RABA 1UKEA 4IM7A 3L8FA 5AVZA 3UBTA 3U44A 4XB6B 1OROA 2XCRB 1E3TA 2NO9A 1VE9A 4PC3A 5E7JA 3W7BA 1UODA 5FOQA 1Z6XA 3KSBC 4MI9A 1OX5A 3RWOA 1J2TA 3QUCA 3PWZA 3PA6A 2JMPA 2PVCA 3GJ7A 4GLFA 5HK8A 3SSMA 4BO9A 1T9GS 5CFLA 2J32A 3L7YA 3VTAA 1KTIA 2PT9A 2GPAA 3TTXA 1I0ZA 3OZWA 4ZOCA 4ZARA 1S8AA 1O0SA 1PSDA 3AG6A 1YR3A 1J2YA 2AJLI 3E61A 5CHEA 5EZYF 3S27A 2HYIC 2HDHA 2AE2A 4OJNA 4AMGA 4DDHA 1N2EA 4LVOA 2A5DA 3V9PA 1IZZA 3I73A 4ZI7F 3A4TA 1IOLA 1T8YA 2GM9A 2PPLA 1Z4KA 3M82A 4ECAA 1WQ4A 4AZ3A 3KPYA 4X61A 3MWLA 2ZDGA 3VMMA 4P0QB 3RH0A 2CXCA 5IFIA 2LWIA 3DWGA 5AM1A 2V1XA 1PJAA 3BXOA 2DFPA 3KJFA 1DOZA 3WFZA 3HEBA 1HE1C 1I32A 1MENA 1WTCA 3B2NA 2HHAA 1QJ4A 3PUZA 3QBTA 4DT1B 4MRSA 5K9ZA 5L7WA 4F2DA 3QE0A 1V47A 1NKSA 3DDHA 5ALSA 3ETCA 1VL8A 4JUAA 4DC0A 4D9MA 1FY2A 2ZI3A 4FWTA 4YMVA 5F98A 5G4LA 2BSQA 4EW6A 5HIMA 1G7TA 3IXMA 3FMPB 4O1IA 1O4WA 1P9LA 5EE0A 3K53A 4MVJI 1ZISA 4AJJA 3BFVA 1GGVA 3IUPA 1J70A 2VNSA 2DCMA 3AFOA 4PLCA 1F06A 1YKFA 1C5KA 3H1TA 1FUKA 3V7NA 5U9CA 3M6IA 2OFWA 3CH7A 4FYJA 3ZJTA 3OO0A 4JIGA 4B43A 3ZS8A 2ARKA 4ZKEA 2A0UA 1XZNA 4I46A 1FDTA 1JV2B 4OREX 3UWPA 4A82A 5U4XA 4YNBA 1SY7A 4JENA 3UVEA 4CEHA 1JDPA 4LFBC 1PWEA 1UPCA 5IDQA 2J0SA 4BNYA 4BQEA 3KYJB 4N65A 3IPLA 1YDGA 1YFKA 4N5HX 1SKBA 3THRA 2DFTA 2PX4A 3E7PA 4JVSB 4TLAA 2O5CA 2VAVA 1KH2A 4FHFA 4KWCA 1FVFA 5CTJA 2GBLC 4AS2A 5L40A 1KMQA 4WECA 3FVWA 1RC0A 2CMGA 2FEMA 3KZCA 1UQRA 4BEVA 4QEKA 1Z6AA 3HDVA 3TQTA 4AWXA 3IPXA 2GN2A 3KQSA 5FPSA 4K9QA 4BC9A 2UU9C 4M1EA 4RV4A 1Z36A 3W9SA 4YP1A 2V55B 1E89A 3O7MA 2C7VA 3VNSA 1ZM7A 3QVJA 5FPTA 1D2HA 1Z88A 3WL4A 4IIHA 4Z54A 1KEKA 2F8TA 2LNDA 3G8YA 4ND5A 1GRQA 1Z8NA 2UYYA 2WJVA 5MN5A 2AUNA 2Q5EA 3MT8A 5HJ5A 1NQOA 1QVVA 2I4LA 1KYIA 1OF1A 4HPJB 3ZTYA 5CH8A 3KXKA 1X0VA 3AKDA 3M49A 1WABA 1W4BA 4I3HA 1VZ3A 3KUUA 4CV3A 1VLVA 2E1PA 3GMIA 4LY6A 1TA4A 4ZAWA 4D0RA 4ZTZB 1OFVA 2H51A 1H6CA 4L0QA 1SULA 4D9IA 2P2NA 2LBPA 2PSDA 3CUEF 4FZVA 4H1HA 4TTSA 1CQIA 4ZQBA 4IDQA 1TYAE 4DLXA 2OGUA 5A3RA 2Q5OA 4MQMA 1ZMTA 2ZUBA 5D7BA 1K7XB 2YQ4A 3H5LA 4RD1A 1JTFA 5DNCA 2QTMA 2Y05A 1T3HA 2WVAA 5FUWA 4AICA 2GETA 5JDIA 1ACJA 3JYLA 3LFUA 1SA0A 2BMDA 4JVOA 3VSCA 5LMZA 1XTKA 4AUMA 1YD7A 1T5OA 1LU9A 2BI4A 4GNRA 1UOOA 1Z82A 2D2FA 3PT5A 1D2RA 1TM7E 3KT3A 1OUMA 1XNJA 5HKLA 4HS4A 4BNNA 1Z07A 3U48A 4XX1A 3F4BA 3LVBA 5IXJA 4IWYA 5TGZA 1TZMA 1OI7A 1T9GR 2F3QA 1GQYA 4DEXA 3ZVRA 1M9NA 1QUEA 3FOZA 4FDLA 1RYNA 4KQJA 2CFCA 2H52A 4KBGA 3S2FA 5GZ1A 2BKUA 1DRVA 3DUWA 2OCKA 3KZ1E 3IBTA 1VCMA 2XE8A 3IJ5A 4K9MA 3UHAA 3V8NA 3VHLB 4DNXA 1EXNA 1LRLA 1YHYA 4ZRNA 5LXTA 3C70A 4ZQIA 2HF7A 3JAMA 1ENPA 1I4WA 2P67A 4DF3A 2W6OA 1JECA 4OMCA 3JVDA 3SEZA 3B6KA 1N2CB 1KZHA 1KOLA 4BO3A 4BEBA 1JEYB 3TTYA 2YOFA 3A7DA 3AFGA 2WSLA 1S6YA 3EQ6A 1EZZA 1II9A 2BL4A 2ILTA 1VB3A 3HL0A 2NZXA 2JCBA 2F4VB 3UC5A 4ZJUA 3SK0A 2O14A 4LOJA 2IXFA 4HEJA 3KX2A 1LPAB 1XEFA 2RIPA 1P7WA 4JLVA 4M7PA 1IB0A 3GGPA 3L7LA 5BMVB 2BAGA 1XHJA 2GJ4A 5A19A 1NRIA 2PA0A 2GPTA 2GEFA 3E0QA 3O94A 3PGKA 2WG1A 3LX5A 1JEDA 1YS6A 1NBIA 3QA3E 1GR0A 2RBKA 4P4SA 4IIGA 1GZ7A 2H1HA 2OLJA 3WDMA 4RIEA 1YO6A 3NOXA 2P9FA 1H23A 1GLNA 3DE6X 3R3XA 3OKPA 4RPLA 2ZCJA 2D5AA 4KYVA 5AI4A 3TI9A 4JYAC 2CVZA 3G1WA 1MJHA 2BWJA 3OO1A 4CKYA 3RSFA 2H1LA 4TZ6A 2G1UA 3RHSA 1RQRA 3V8RA 1JG4A 3EZ7A 3H8JA 2G08A 3PFFA 4LZLA 4TTRA 4C89A 4F5ZA 3AVUA 1A98A 2NXNA 1T6BY 2NYAA 4XEHA 1JG6A 1GGFA 3C3CA 4NYMQ 1YVDA 3QXHA 5BNFA 4ZYVA 3W3AA 4M7OA 1XZ8A 1E8DA 2RI1A 2GKOA 2ZU6A 3A1NA 3GYGA 4W5JA 3STUA 1DIGA 4D4JA 3RTGA 5CIYA 3LCVB 1C8LA 3G6KA 4EL5A 4LF7B 1N78A 1W0JA 1R8XA 5A3SA 3JQ8A 2M6RA 4RJ2A 5EE3A 2EHJA 3EXG2 1PJLA 3D3JA 1XCOA 2G1AA 4IAOA 4RHFA 2FA9A 4AL4A 2ZSIA 1FS6A 1WLYA 3I9V6 1RE0A 1M0EA 4JWTA 4EUNA 2DUJA 2E7GA 4YRBA 1M8JA 3E7XA 3IAAA 4J8PA 4K2HA 3LHKA 5CRIA 4XLLA 4UHCA 1UOEA 1DMRA 1O4VA 2MSWA 2ZATA 1T8SA 3C1OA 3DV0B 3TL3A 2CY0A 1A4XA 2G6BA 3C3MA 4I14A 1GUDA 4ZVUA 3ZWCA 2QD4A 4E09A 4DDWA 1W7AA 4KREA 1Z0KA 1J49A 4DR5C 3W34A 1XQ6A 2G67A 2UUOA 2R6R1 3LKVA 1XWWA 5IUKC 3C1AA 4CG0A 2BT4A 3ITDA 3DF9A 1VQ1A 4D41A 1VKOA 2JFQA 2W6ID 4RQAA 1YHZA 1N7HA 2VIIA 1ZM3A 1RJ9A 4CVNA 2ODQA 4B09A 3GX1A 4WN9B 4YBRA 3GR6A 1LJLA 4MLDA 4DJAA 3E81A 2XVXA 3CNLA 5D51S 5B57C 2C00A 2ZBDA 1T2FA 2H8GA 4TYYA 1H93A 2RK4A 4GT1A 1J0CA 2XTJA 1U28C 2E82A 1FVHA 4ED9A 3KC2A 4Q7EA 4OI2A 2E49A 3ESRA 3L6CA 3ZY3A 1AKNA 2MIIA 3EG9A 2HT6A 4TTPA 2EL9A 2LDXA 2WZBA 1ZS9A 2GF9A 2FPIB 5E3JA 3IRUA 3WICA 3ZU6A 2JJQA 4EO4A 4M8IA 1I94C 2GYUA 3TD6A 5JFOA 1P3JA 1Z2AA 4G0YA 5DB4A 5AXCA 1UL1X 1Y8CA 2E4XA 2PHZA 2R62A 1ECPA 4QT0A 4LYHA 4RV9A 2WD7B 1XPUA 2BP7A 3TZ6A 6NULA 1RAEA 5C3MA 4DXDA 1YE3A 1TA9A 1HFEL 1UBTS 4HDRA 2JNWA 4WBXC 4DV6C 1QOZA 3LCUA 4FCVA 5G0SA 3RJMA 3TUFA 2YS7A 2NCLA 4RF2A 5HKKD 1AURA 1DKMA 2AYYA 4KMMA 4K8RB 4ZXPA 3PDIB 5LDHA 1HNZB 2RGGA 4YAUA 4D8VA 2ZOSA 4UNIA 1BXRA 1AHIA 5F64A 3DZBA 1SC3A 1V16A 2IHBA 3LY5A 4JLKA 4Q4HB 2NV0A 2OXTA 2ONFA 3SGLA 1ZD3A 2F9FA 3EULA 4IINA 3CJRA 3RAEC 4UUQA 4D46A 2HA4A 1ULHA 3PQ5A 3B89A 3FUCA 3BQNB 5DULA 3ZV7A 4C3ZA 1ATZA 1QQ7A 2HSEA 3RRJA 3HBFA 2G72A 5E6RA 4FKZA 4YK7A 3TRHA 3W8NA 1M8GA 3TQFA 5J47A 1Z0SA 4LBVA 1PNVA 1R7RA 3DCIA 1PJSA 4G25A 1GXSB 4HVAA 1FFWA 1B41A 1RFGE 2BEWB 2OAGA 4P7JA 3KHSA 1AE1A 1IU9A 3Q12A 4IX9A 4PSVA 4XIGS 1JWLA 3BTOA 3NC0C 3FDJA 4C30A 4JNCA 5AJZA 1DQYA 3UV3A 1WXEA 3KYCA 3NVDA 4HQRA 5F4BA 4DREA 1CVLA 3K0BA 1YKSA 1WJGA 2Q1YA 4EECA 2JLBA 1NPDA 3LC1O 4V0QA 5E8RA 2P2FA 1C7JA 1TJYA 5K2MA 1X9IA 2AHRA 1U9ZA 1DTEA 2DKNA 2MYNA 3M4JA 1YJAA 4QU8A 3TIIA 4DJDC 1U8EA 2DLCX 1QUFA 4FSHA 3NVMB 1GPMA 2DBZA 4TKZA 1W4AA 3AIKA 3FFWA 4OY3A 1SKUA 3ZE2B 1MC8A 1G9TA 2FEWB 3D0RA 3IPCA 4X1IA 3WRXC 2C2GA 2WYWA 1E4OA 1UKBA 5CVCA 1ZK0A 3E23A 4X90A 4N48A 2ZI9A 4XA8A 3QEBZ 4R1NA 3RLFA 3KXPA 1PQ4A 3IT3A 5DYTA 3M5PA 4N9QA 1EMDA 4WJKB 3JD4A 3ZKWA 4F6RA 2OZPA 2OFFA 1VCIA 3GPLA 1SU6A 1OSNA 2V6MA 4ZCRA 3RC2A 3DPIA 3EPHA 1ZA1A 4N49A 1ST2A 3QJ5A 1DOAA 1IDN1 3S2EA 2RGUA 3H5AA 2W2KB 1FC0A 4JJEA 5E6SB 1NN1A 5F35A 1NPTO 1AV7A 3GC6A 4MS1A 1L5NA 4HAXA 5EKXA 2WJJA 3KL4A 5ARBA 1I2AA 4P7FA 4DSNA 1BEEA 3E7FA 1PU1A 1FUGA 4EZEA 4YUAA 2PUBA 2AEFA 4M22A 4OXXA 2CLHB 5JIBA 1EX1A 4XDHA 2LV8A 3DD1A 4NCBA 1BVYF 4G5XA 3PNVA 4HYTA 3UN1A 3HN6A 1MIHA 9MHTA 1WEHA 1N6LA 3B7GA 2W4QA 1E3DA 3P4YA 3E22B 5BSRA 1YZYA 4EB6A 3AR9A 2PLRA 4MI6A 3INTA 4DADA 1HNWB 4BECA 4NBLA 1C9YA 4HGRA 2NSJA 1M6VB 3F7MA 2J3MA 1EDEA 4PFSA 4MUJA 3FVTA 2SCUA 4J0IA 2HLNA 4URUR 4XR9A 4EW3A 1A5ZA 4WFKA 3QIAA 4EFDA 5DBHX 4ZZ0A 3ZIAD 4J16A 1JLRA 4FD2A 5J2TB 3NEYA 5A4MS 1FLNA 1L4EA 2JKZA 2R4TA 4RPKA 2OESA 2PUDA 1W5EA 1L4KA 2FAXA 2X1MA 3OAAD 1H22A 4QTTB 5DLQC 3ZNOA 5JWRA 1Z63A 4IZ6A 1G7RA 2CJYA 2NO7A 4OSOA 4K0KB 4LE5A 3A6JA 1AZLA 3QW4B 4MVXA 5FBHA 5LPNA 1PL0A 1KIMA 3ASYA 2Q2OA 4GR5A 2NVUB 4UOQA 2WYOA 4Y1FA 1CSEE 1SN7A 3HJUA 1ISIA 2H48A 3B20A 4RWEA 3SR0A 3NDBB 2O8CA 1C3LA 3UXMA 1MT3A 2FZGA 3QLJA 5CBPB 2PBRA 5T6BA 1FFAA 1P5FA 1DT5A 5CTAA 3H1BA 1VMKA 1HA3A 3ONFA 2OGZA 2RH4A 3I9NA 3IUSA 1IK6A 2QS9A 2FPUA 4J0EA 4W1QA 4YCJA 1IPHA 3VR5D 4JUDX 4EY4A 2V3VA 2COKA 1BWSA 3AH8A 5KZMB 3DBIA 5TC4A 4WNYA 3SNKA 5E9QA 3ANTA 2X9LA 3D0QA 5E4JA 1QM4A 3SSOA 4IJVA 2H4XA 4GI1A 2V6JA 2ZSFA 2XUIA 4ITVA 2IBSA 2G6TA 3CCCA 4FR0A 3ZDQA 4ALKA 3DMYA 5IVHA 5JNUA 1KY3A 4C1BA 3DO6A 2WFLB 5AKJA 1IEXA 2DUMA 3HFGA 2NZVG 5BW4A 4FDVA 4S0ZA 1DEXA 4KIJA 4RCVA 1QF6A 1RZUA 4O4LF 2E5WA 1LBIA 3G82C 3K2QA 4AY5A 1I30A 2VP2A 1VMIA 3GJYA 3UXYA 3E4DA 4GL2A 4D6YA 5JS1A 1R16A 2O52A 1GUAA 4DC9A 1O6BA 5CAEB 1JWBB 3R6TA 5FWYB 4ZTUB 1QF9A 1RWNA 5FTMA 1UXGA 2YJ5A 2A5LA 4M4SA 1YS4A 1THGA 4RY9A 3R20A 3R41A 4MJLA 2Q6OA 3M4NA 4ZEMA 3OT5A 1T0HB 2EGHA 5AW6A 2Q1TA 3R4VA 1MB4A 4Q1AA 3E0XA 2PL3A 4Q6WA 1F8GA 1PFWA 4UHDA 1ZH2A 1CDEA 1CP2A 1NM5A 2P9EA 3BK2A 4NULA 3WNBA 4PN3A 4CKEB 3VSDA 2RAVA 3LWNA 4BNVA 5A5DA 2XT9A 1A9XA 4ETIA 4CN8A 1GYQA 4HBGA 5HJ2A 3ZY5A 3BBPA 4BV9A 4HFMA 4BO7A 2WSSD 4UM9B 2X0RA 5C7YA 2BTEA 3KPVA 1NHWA 2F4VC 3B5EA 1ZUNB 3JSAA 4FX2A 1IXSB 2B2CA 2MSLA 3KD3A 4U7PB 3CLUD 3F78A 4WD3A 1H8EA 4HD8A 3WK4A 1ZX1A 3QHAA 2XT0A 1RQPA 1Q17A 2Z4SA 3D8UA 3FPGA 3IAFA 2AH5A 1A95A 1IUOA 4E4TA 3OJLA 4CL2A 3ID6C 2CXTA 3TLKA 4OFWA 3PRHA 1PR4A 4Z9BA 1DWUA 3WP1B 1TGVA 2BTQB 1SUPA 2IYRA 1A96A 2WA1A 2XAUA 3LCMA 4GPAA 3GGCA 4ZOLA 3V8EA 5EJ9A 3L4SO 2CLOB 4RXUA 3JZAA 4G0ZA 1FNCA 4CLRA 2QAGB 1LDBA 3EFBA 3FUTA 3R3SA 3UOGA 4NATA 1FW6A 3A9RA 3C98A 3GH3A 3UMGA 2PN2A 1GM5A 5KWIA 3WLHA 3MINA 2P68A 1YI8A 3I04A 3NFRA 4LVUA 3S2IA 4Q7QA 4OYYA 2D7JA 2CXOA 2P5TB 3RRFA 4AG5A 6AT1A 2W43A 4WNIA 3GVCA 4Z3OA 2XD9A 4CM9A 3ADKA 3BRCA 3Q3IA 2AVDA 1JHVA 3DSRA 4L7QA 1H3EA 1H2RS 3RAGA 3D7RA 4UTZA 4YFVA 2JLWA 4I6GA 4D9GA 2FEOA 2XCIA 2J9FA 1Y5MA 4KR6A 5D00A 1F14A 2P8SA 3O74A 5CCEA 1PVOA 3I8OA 2C99A 1JHAA 5GMOA 5EWMA 1EDBA 3W4JA 1F2VA 2VF2A 3IQZA 5AM3A 5C18A 1V11A 1THZA 3L0YA 3NHKA 4ZQGA 3IJEB 5L3VA 4Q01A 1OWLA 4GICA 1QE0A 1GR1A 1LSUA 3SJUA 2BRUA 1X2BA 3QWFA 5F3RA 4QLAA 4ZZ2A 4FKBA 5CB4A 5A0VA 2PD3A 1WBDA 1P5JA 1RCTE 3FI9A 2I8AA 3FM9A 1BX0A 3IYLW 2HWYA 2VYQA 4M0FA 1GPH1 1Q15A 4HQNA 5DX8A 4C0BA 4UC0A 3MJDA 3EX7C 1FUUA 1NJ6A 3HI4A 4QKQA 2A1UB 2O3QA 2BH9A 1E8NA 1Q7EA 3L4EA 4JT2A 4XM1A 2RDMA 5HGXA 5JPDA 5KX5B 4C7OA 5K8IA 1RQ2A 2HCTA 2PGDA 2DUUA 4S1TA 1FU7A 4DSOA 1PYDA 2EKBA 3K1ZA 3JVEA 4CM4B 3QXSA 4G36A 2AF4C 1ZP6A 2PZAA 4MMZB 5LJLA 1ND6A 4MO2A 1C4XA 4MB2A 1FMFA 3GG2A 2GFQA 2J3EA 2ZSDA 2AK2A 5JYDA 1TK3A 3AHIA 3L92A 5L3SA 3A6ZA 1O92A 1OPXA 1XZJA 2W2LD 1YB5A 2QRVA 4J7AA 4NEQA 4P1ZA 4UXJA 5I9SA 3RSSA 4LZOA 2DLDA 1M6YA 1K8YB 1BGWA 2JA2A 1J06A 3E9CA 1E2PA 3AWDA 4B74A 4WBNA 5JNSA 4L51A 4OOFA 3JVUA 2QD3A 1TFRA 3CB2A 4NU8X 3UO8B 5CVTA 1GITA 2WPNA 1BSVA 3LC7O 1AQYA 3KYBA 4DE5A 2WF8A 4MWOA 4QOHA 4G8CA 4B44A 4BO6A 1R5OA 4DJ5X 3L1KA 2VQFC 1O89A 3FKQA 4AS3A 1KVSA 4HAOA 4A91A 4B8YA 4YJ3A 1J2UA 4K9LA 4R8SA 2HK9A 2IW3A 2X8JA 1U7ZA 2X1HA 3NT4A 2QDKA 3OZDA 4G4GA 1R5BA 2WD8A 4L9AA 5TDHA 1GSAA 4K3VA 1JP7A 4RHEA 2IP1A 2Y0DA 2FMFA 4AMBA 1BC5A 3NYQA 1QZTA 4BEJA 2JGRA 3FAZA 2WYHA 5KKCA 2J9RA 2O1XA 3SAJA 2RGNC 2B2NA 4BNWA 2X5JO 1TEXA 4UAUA 1Z4PX 3TECE 2AK3A 2C3YA 4JHLA 4RZXA 4OLFA 3M2TA 3UV6A 3MJSA 2I4OA 3H5RA 1Y9ZA 3I45A 4HGZA 1WCIA 4D3YA 3C43A 3HO8A 3RBZA 1MO3A 4G5HA 5DNWA 3F49S 3G2QA 4BQQA 5AK6A 4DG8A 1CJBA 2WJHA 2C57A 2FMKA 4XYEA 5EXPA 3JQQA 4LBZA 5DTMA 2X0IA 3SSAA 5BSKA 1IONA 2Z56A 1EB9A 5M34A 2WWYA 3G1UA 4IRXA 4JBYA 3UC9A 3HI6A 2X58A 4ICIA 3TM4A 4WL0A 2JPDA 5A7HA 3H4TA 1CRWG 2GO1A 2HCJB 2X0EA 3SIRA 1M2OA 3L0IB 3L6RA 2HXSA 3GVXA 4HGNA 3DTVA 2OQIA 5KNBA 3AVTA 5FADA 2XMRA 1R4NA 2IHTA 3EASA 4YJHB 2R8YA 3FTQA 1JQDA 3LUJA 1GDDA 1T9DA 3ER9A 5C8XA 5DZSA 3RU3A 1VJ1A 4QOEA 1R0WA 2W2OA 5KOYA 4JY7A 1Z68A 4KR9A 1O87A 1ST3A 4JJ8A 5J5VA 4B6RA 4C6HA 1HDZA 1D03A 3BGVA 4I55A 4F12A 4INOA 5ALOA 1SRRA 3I2GA 1SQSA 5A9TA 1L1QA 2I66A 3IR6A 5EUBA 3ZCXA 2YC4C 2G70A 4Z9FA 1B6RA 2ETVA 4ZVVA 1IWBB 3P0FA 1BFUA 2NT4A 2P3OA 3JQAB 1TQHA 1NLUA 1P1HA 3HB4X 3KLBA 4MIKA 3GLHA 4XGQA 4J9UE 3SP1A 4EI7A 1H2EA 5TY0A 4DHEA 3DR3A 5EP4A 4B2YA 4WZBA 4I5GA 2ZGVA 2I7DA 1FTSA 4QNRA 5A71A 3VAZA 4WMLA 2MU1A 2FWPA 1WHSB 4J0HA 3HYTA 3GT4A 2DPLA 1JAHA 1W25A 5LXTB 3AL2A 3N1UA 4YDHB 3U7RA 3UH0A 1N5LA 3D4PA 4REMA 3UANA 2AB0A 5KHLB 4N8SA 4EX6A 3PXDA 3H1EA 1XCBA 1M67A 2WV7A 4PZEA 1FCJA 4U2FA 4W5RA 2REQB 2O2DA 5EJ8A 4REQA 2PSSA 4S2UA 2OFPA 3SHVA 4AX8A 4KHPB 3DDZX 3PJFA 1DELA 1XZBA 3I1JA 4OFXA 5EY5B 1X86B 3GOQA 5I9MA 2OVFA 4ZZ3A 4DV5B 1WPQA 4JXKA 5KNDD 4RD6A 1J25A 5ERGB 3MPUA 1GTZA 1OFGA 2VP0A 3ZQ4A 4RYLA 5FTKA 1QTNA 3R6GA 4HZIA 3EZYA 5CDFA 2IU0A 4P4SB 3SOZA 1E92A 1R9GA 2WKQA 1MXCA 3F6EX 1QH0A 2CNKA 1VA4A 4LV8B 1JB1A 1M2JA 1QQBA 1JQKA 5HKAA 3EEOA 3R0VA 2QP3A 5CH3A 1S8FA 2BGJA 2HD4A 1RRFA 3GFTA 3WQHA 5BP7A 2OBBA 3MT0A 1Q84A 5JSKA 1RHMA 3CRVA 1QRRA 3HABA 3FMGA 2ZUUA 5KWJA 1QOPB 2XQKA 3C3EA 5JVDB 4GLBA 2BKVA 5EJIA 5EZ6B 4GX5A 1ZH8A 4DUZB 2Q1XA 4NICA 5DN6A 4G2NA 2VJQA 2IBMA 5EFOA 2IIPA 2WAAA 3UPDA 4AX4A 1ISFA 2FXIA 1SUIA 2AZTA 3S1SA 3HEMA 1L4GA 1L7DA 3PV0A 3REQB 1HNXB 3IO3A 3L43A 3CSSA 4X6LA 3M1IA 4NZMA 4Y0VA 4AZ0A 5IAJA 1QGYA 1E6MA 4NP6A 3BB1A 3ZE8A 2JI4A 3WL6A 3PC6A 1TZKA 4Q66C 2IU4A 5AXDA 3CUTA 4LF5C 5CXUA 1L5YA 2WICA 1I5OA 4H4DA 5ANRB 3GIWA 5EXXA 2Y0CA 1E9DA 3JQRA 1CUFA 4DMHA 4ESHA 1I4TD 1NVEA 2Y67A 4TXHA 1F6DA 4UUMA 4QAQA 3V48A 2CF5A 5K8UA 4DB4A 1GZ5A 3V1MA 4YBZA 5CCXA 1S1MA 1KQNA 2NUAA 2J3JA 3UB4A 4OX9B 5D85A 3PC8A 2WUDA 2HCRA 2YJZA 3GEMA 2CY1A 2VXCA 3ABSB 4K87A 5H1YA 3QXXA 2A9RA 1Y6QA 4UU7A 1GCIA 1FRFS 4LZWA 3SLKA 3QFSA 1TTQB 3RSOA 1GGNA 1YZGA 2EV9A 2O2IA 5HMLA 1UBOS 3K96A 5KJ1A 2XY4A 3EB9A 1IB6A 2ZP1A 3IAXA 5BWCA 4B3BA 3V1KA 2JIZD 2O1SA 1IOZA 4QTXA 3A04A 3LOUA 3TNDA 4HKTA 1TF2A 3WWYA 4ZHSA 3FLBA 3QYFA 1X15A 1RJ9B 1ISSA 1NVVQ 4DZTA 2I2FA 3WRYA 4OQDA 1XZLA 1YJ8A 1GRCA 2E4VA 4I2VA 1PJ8A 2Q1WA 3OTQA 4LAFA 1TTTA 1SNYA 1KI1A 1NC1A 1I6WA 2R5FA 3A4MA 4BWFB 1Q77A 4QARA 1RPAA 3PQDA 3V8MA 2ERXA 5ALWA 4KFTA 4NCHA 1L7MA 4H7FA 2WWXA 4AY3A 2X8WA 3EG9B 5KTTA 5L3RA 1SD1A 1HL7A 4IXDA 4MQUA 1MPXA 2O0KA 3DMRA 3GMTA 1VMDA 3IE2A 5HZKA 1AKUA 1SMKA 3WLOA 4UE6A 2OXIA 1BXZA 2P6MA 4HRAA 5EJ2A 3PFKA 5IARA 4OHBA 1RXCA 2TYSB 4RAQA 1JH9A 2BP7B 1C7FA 1IHDA 3AF4A 5HM8A 2FSHA 2JVKA 5I7FA 1J2RA 3F3MA 4EUSA 2VDLB 3UAXA 1WOMA 5TQJA 3SJBA 1XPOA 3GF4A 2X9GA 4I2NA 1M0TA 4UUOA 4JS0A 5E6UB 5JDCC 4D9FA 2LR0A 4YV0A 5AIBA 1ZEMA 1JPUA 2FZ4A 2QG6A 4GQIA 3ZJUA 3E9NA 1S4QA 1R6VA 1BXRB 3EXHA 3M6VA 3BJMA 2CFSA 1W8DA 3M1YA 1A8IA 4BJ5A 2A8YA 4YV2A 2QAGC 1W96A