3CQ2A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB138
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 22
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq2A00
1XHJA 3UX3A 2CU6A 3CQ2A 1TH5A 3UX2A 2M5HA 2M5OA 2JNVA 1VEHA 3CQ1A 2Z51A 3LNOA 1WCJA 1UWDA 3CQ3A
chains in the Genus database with same CATH superfamily
5KYVA 3A9UA 1MDBA 3RG2A 3FCEA 4FTFA 2ASBA 2E7GA 5IWAC 1WF3A 3UOWA 4X62C 4G36A 1IBKC 3E7WA 3JAMD 1AMUA 1XRCA 4NOZA 5BSMA 3NYRA 4MH4A 3VNSA 1O90A 1QWIA 4DR1C 1ML8A 2CU6A 2BH1X 4PZPA 4IZ6A 3A26A 4B3MC 4PROC 4L4QA 2KDNA 2VZEA 1USPB 3FCCA 4B3TC 5JRHA 3UX2A 2UUCC 1O9TA 1IB8A 3VNQA 4LF8C 4DCTA 5BUSA 2D7VA 4YY3C 3R44A 3EERA 4BC9A 4BBYA 1O92A 5LMUC 4BCAA 2F4VC 3L8CA 5AE1A 4JI7C 1XRBA 1WH9A 2OPLB 4LF5C 2OBVA 4DR5C 1HH2P 3IEVA 3NPDA 3LAXA 4LF4C 2MM9A 2P2BA 2YX1A 2UUAC 4G37A 1P4EA 5K85A 3NI2A 1MXAA 3N2QA 2YWBA 2KZ0A 4TPSB 4OXIA 4KTTA 1MXCA 1NYEA 2DYJA 4DV1C 3EQ6A 3GKUA 2VQFC 3GR1A 1XNQC 4R0MA 4DR2C 1XS3A 4LF9C 3TR3A 2HHHC 3PROC 2PN2A 2P2MA 4YHHC 1N33C 2CY1A 4DCSA 1O93A 5IFIA 2JMPA 2E8FA 1RG9A 4OX9C 5CZVA 2AYAA 1VEHA 5K8FA 4DV4C 1UWDA 4JI2C 1XHJA 1FLOA 4NXMC 5GTDA 1PG3A 3CQ3A 4JM1A 2NCLA 2D1TA 4RLFA 3CQ1A 5LMNC 5DV9A 4RM3A 1T5DX 4PUGA 1M6XC 2BJOA 3CW8X 4I9FA 4DG8A 1N32C 4MTNA 5LCIA 3UX3A 4D57A 2UU9C 1KKGA 5KYTA 4JI8C 2QW0X 3TUFA 2M5HA 1PU1A 2OPLA 1T5HX 3A9VA 3A25A 4ZJZA 1TH5A 4I9GA 4PUIA 3KXWA 1J5EC 4NDNA 2Y4NA 4L2ZA 1GPMA 3VNRA 4RVNA 1L2FA 2P02A 5AE3A 3R9XA 3DHVA 5A1IA 1UKKA 1ZB9A 3CJEA 1MXBA 1EGAA 4G1IA 5FLXD 2UXBC 3B7WA 1I94C 1LCIA 2M5OA 1NY8A 2CXCA 4GXRA 2ZZMA 1V25A 3UZ0A 4U5YD 5CZXA 3IPLA 4RMNA 4KTVA 4LF7C 2MMAB 3PESA 4FUTA 2D1SA 2VQEC 2D28C 5BSVA 3LGXA 1K0RA 3DLPX 2WD9A 2ATWA 2KZFA 2PT7G 4RM2A 4JYAC 5A1GA 4JI3C 1IBLC 4DR6C 3K6RA 1XMOC 4DR4C 4X65C 4GS5A 4BC7A 4BSZA 5BUQA 3A4IA 3I07A 3IMLA 1XRAA 4R1LA 3E7XA 5AE2A 1QM4A 3GPCA 2ZZNA 4DCVA 4DR3C 1PG4A 2Z51A 1M6XA 4JI1C 3AF6A 2ONFA 2UUBC 1MKYA 3IEUA 4DV7C 2E8EA 4DV3C 2QVXX 4X66C 4B3SC 5BR8C 1YJ7A 3PBKA 1FUGA 3T1HC 4AQYC 5BSTA 3AY0A 5A2QD 4D56A 4DUZC 4EATA 5ADZA 1HNXC 3S82A 5BURA 4JV5C 3LNVA 1FJGC 1P4EC 2XR1A 4DV2C 3RV2A 2P20A 3ETCA 5KEIA 1HNWC 1LQLA 4LFCC 2YWCA 4RVOA 1WCJA 2QVYX 4LE5A 3CQ2A 1N36C 4K0KC 1N34C 2D1QA 4WV3A 2HJGA 2MCQA 4LFAC 4ODJA 4JI0C 2E5LC 3UEBA 3R9WA 1ZB8A 2E8CA 1HNZC 4IR7A 3J81D 4LF6C 1HR0C 4DR7C 3AF5A 3LNOA 4JI5C 1V60A 5BSRA 3J80D 4LFBC 1RY2A 1XMQC 2QVZX 2EGTA 5E7QA 3ETOA 5T8TA 2VSQA 4GKJC 1N2FA 5T8SA 4RLQA 3TQIA 4GKKC 3I08A 4B3RC 1V26A 2OO4A 2P2JA 2Y27A 4NXNC 3CW9A 4PUHA 4L7IA 4ZLPA 5H9UA 4JI6C 5IT9D 1MD9A 1JOSA 2Y4OA 4DG9A 2D27A 2DHMA 4KHPC 4K0BA 2UXDC 5BSWA 3SO4A 2ZM6C 4GXQA 2YCBA 2V7BA 2QL8A 4JI4C 4WS9A 1MDFA 3O2EA 4D4GA 3OTOC 1ULTA 4ISBA 1BA3A 2P2FA 2PROA 4X64C 2WP0C 1PA4A 3TDEA 4DV6C 3C5EA 3H2TA 3DAYA 1VLAA 3L95X 3N54B 2P2QA 4XX2A 4DCUA 4D4IA 4HPVA 3LUSA 1IBMC 4DUYC 4FUQA 1XNRC 3NYQA 2JNVA 3G7SA 5A19A 1P7LA 4DV5C 4DV0C 4R1MA 2DPLA 3T1YC 4OYCA 3GR0A 1USPA 4PHTA 5BSUA 2D1RA 2E0GA 2UXCC
chains in the Genus database with same CATH topology
1XHJA 3UX3A 2CU6A 3CQ2A 1TH5A 3UX2A 2M5HA 2M5OA 2JNVA 1VEHA 3CQ1A 2Z51A 3LNOA 1WCJA 1UWDA 3CQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHJ A;  3UX3 A;  2CU6 A;  3CQ2 A;  1TH5 A;  3UX2 A;  2M5H A;  2M5O A;  2JNV A;  1VEH A;  3CQ1 A;  2Z51 A;  3LNO A;  1WCJ A;  1UWD A;  3CQ3 A; 
#chains in the Genus database with same CATH topology
 5KYV A;  3A9U A;  1MDB A;  3RG2 A;  3FCE A;  4FTF A;  2ASB A;  2E7G A;  5IWA C;  1WF3 A;  3UOW A;  4X62 C;  4G36 A;  1IBK C;  3E7W A;  3JAM D;  1AMU A;  1XRC A;  4NOZ A;  5BSM A;  3NYR A;  4MH4 A;  3VNS A;  1O90 A;  1QWI A;  4DR1 C;  1ML8 A;  2CU6 A;  2BH1 X;  4PZP A;  4IZ6 A;  3A26 A;  4B3M C;  4PRO C;  4L4Q A;  2KDN A;  2VZE A;  1USP B;  3FCC A;  4B3T C;  5JRH A;  3UX2 A;  2UUC C;  1O9T A;  1IB8 A;  3VNQ A;  4LF8 C;  4DCT A;  5BUS A;  2D7V A;  4YY3 C;  3R44 A;  3EER A;  4BC9 A;  4BBY A;  1O92 A;  5LMU C;  4BCA A;  2F4V C;  3L8C A;  5AE1 A;  4JI7 C;  1XRB A;  1WH9 A;  2OPL B;  4LF5 C;  2OBV A;  4DR5 C;  1HH2 P;  3IEV A;  3NPD A;  3LAX A;  4LF4 C;  2MM9 A;  2P2B A;  2YX1 A;  2UUA C;  4G37 A;  1P4E A;  5K85 A;  3NI2 A;  1MXA A;  3N2Q A;  2YWB A;  2KZ0 A;  4TPS B;  4OXI A;  4KTT A;  1MXC A;  1NYE A;  2DYJ A;  4DV1 C;  3EQ6 A;  3GKU A;  2VQF C;  3GR1 A;  1XNQ C;  4R0M A;  4DR2 C;  1XS3 A;  4LF9 C;  3TR3 A;  2HHH C;  3PRO C;  2PN2 A;  2P2M A;  4YHH C;  1N33 C;  2CY1 A;  4DCS A;  1O93 A;  5IFI A;  2JMP A;  2E8F A;  1RG9 A;  4OX9 C;  5CZV A;  2AYA A;  1VEH A;  5K8F A;  4DV4 C;  1UWD A;  4JI2 C;  1XHJ A;  1FLO A;  4NXM C;  5GTD A;  1PG3 A;  3CQ3 A;  4JM1 A;  2NCL A;  2D1T A;  4RLF A;  3CQ1 A;  5LMN C;  5DV9 A;  4RM3 A;  1T5D X;  4PUG A;  1M6X C;  2BJO A;  3CW8 X;  4I9F A;  4DG8 A;  1N32 C;  4MTN A;  5LCI A;  3UX3 A;  4D57 A;  2UU9 C;  1KKG A;  5KYT A;  4JI8 C;  2QW0 X;  3TUF A;  2M5H A;  1PU1 A;  2OPL A;  1T5H X;  3A9V A;  3A25 A;  4ZJZ A;  1TH5 A;  4I9G A;  4PUI A;  3KXW A;  1J5E C;  4NDN A;  2Y4N A;  4L2Z A;  1GPM A;  3VNR A;  4RVN A;  1L2F A;  2P02 A;  5AE3 A;  3R9X A;  3DHV A;  5A1I A;  1UKK A;  1ZB9 A;  3CJE A;  1MXB A;  1EGA A;  4G1I A;  5FLX D;  2UXB C;  3B7W A;  1I94 C;  1LCI A;  2M5O A;  1NY8 A;  2CXC A;  4GXR A;  2ZZM A;  1V25 A;  3UZ0 A;  4U5Y D;  5CZX A;  3IPL A;  4RMN A;  4KTV A;  4LF7 C;  2MMA B;  3PES A;  4FUT A;  2D1S A;  2VQE C;  2D28 C;  5BSV A;  3LGX A;  1K0R A;  3DLP X;  2WD9 A;  2ATW A;  2KZF A;  2PT7 G;  4RM2 A;  4JYA C;  5A1G A;  4JI3 C;  1IBL C;  4DR6 C;  3K6R A;  1XMO C;  4DR4 C;  4X65 C;  4GS5 A;  4BC7 A;  4BSZ A;  5BUQ A;  3A4I A;  3I07 A;  3IML A;  1XRA A;  4R1L A;  3E7X A;  5AE2 A;  1QM4 A;  3GPC A;  2ZZN A;  4DCV A;  4DR3 C;  1PG4 A;  2Z51 A;  1M6X A;  4JI1 C;  3AF6 A;  2ONF A;  2UUB C;  1MKY A;  3IEU A;  4DV7 C;  2E8E A;  4DV3 C;  2QVX X;  4X66 C;  4B3S C;  5BR8 C;  1YJ7 A;  3PBK A;  1FUG A;  3T1H C;  4AQY C;  5BST A;  3AY0 A;  5A2Q D;  4D56 A;  4DUZ C;  4EAT A;  5ADZ A;  1HNX C;  3S82 A;  5BUR A;  4JV5 C;  3LNV A;  1FJG C;  1P4E C;  2XR1 A;  4DV2 C;  3RV2 A;  2P20 A;  3ETC A;  5KEI A;  1HNW C;  1LQL A;  4LFC C;  2YWC A;  4RVO A;  1WCJ A;  2QVY X;  4LE5 A;  3CQ2 A;  1N36 C;  4K0K C;  1N34 C;  2D1Q A;  4WV3 A;  2HJG A;  2MCQ A;  4LFA C;  4ODJ A;  4JI0 C;  2E5L C;  3UEB A;  3R9W A;  1ZB8 A;  2E8C A;  1HNZ C;  4IR7 A;  3J81 D;  4LF6 C;  1HR0 C;  4DR7 C;  3AF5 A;  3LNO A;  4JI5 C;  1V60 A;  5BSR A;  3J80 D;  4LFB C;  1RY2 A;  1XMQ C;  2QVZ X;  2EGT A;  5E7Q A;  3ETO A;  5T8T A;  2VSQ A;  4GKJ C;  1N2F A;  5T8S A;  4RLQ A;  3TQI A;  4GKK C;  3I08 A;  4B3R C;  1V26 A;  2OO4 A;  2P2J A;  2Y27 A;  4NXN C;  3CW9 A;  4PUH A;  4L7I A;  4ZLP A;  5H9U A;  4JI6 C;  5IT9 D;  1MD9 A;  1JOS A;  2Y4O A;  4DG9 A;  2D27 A;  2DHM A;  4KHP C;  4K0B A;  2UXD C;  5BSW A;  3SO4 A;  2ZM6 C;  4GXQ A;  2YCB A;  2V7B A;  2QL8 A;  4JI4 C;  4WS9 A;  1MDF A;  3O2E A;  4D4G A;  3OTO C;  1ULT A;  4ISB A;  1BA3 A;  2P2F A;  2PRO A;  4X64 C;  2WP0 C;  1PA4 A;  3TDE A;  4DV6 C;  3C5E A;  3H2T A;  3DAY A;  1VLA A;  3L95 X;  3N54 B;  2P2Q A;  4XX2 A;  4DCU A;  4D4I A;  4HPV A;  3LUS A;  1IBM C;  4DUY C;  4FUQ A;  1XNR C;  3NYQ A;  2JNV A;  3G7S A;  5A19 A;  1P7L A;  4DV5 C;  4DV0 C;  4R1M A;  2DPL A;  3T1Y C;  4OYC A;  3GR0 A;  1USP A;  4PHT A;  5BSU A;  2D1R A;  2E0G A;  2UXC C; 
#chains in the Genus database with same CATH homology
 1XHJ A;  3UX3 A;  2CU6 A;  3CQ2 A;  1TH5 A;  3UX2 A;  2M5H A;  2M5O A;  2JNV A;  1VEH A;  3CQ1 A;  2Z51 A;  3LNO A;  1WCJ A;  1UWD A;  3CQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...