3CQ2A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB138
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 22
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq2A00
3LNOA 3CQ3A 3UX2A 3CQ2A 3UX3A 1XHJA 2CU6A 1WCJA 2M5OA 1UWDA 1VEHA 2M5HA 1TH5A 3CQ1A 2Z51A 2JNVA
chains in the Genus database with same CATH superfamily
4I9GA 1O90A 3IEUA 4RLQA 4L7IA 1LQLA 2AYAA 2WP0C 3LAXA 5AE2A 1N2FA 4RLFA 3R9WA 2D28C 2DHMA 1QWIA 4DR1C 1HNXC 2CY1A 2Z51A 2QVXX 4RVNA 4JI2C 5BR8C 2OBVA 4ISBA 3T1YC 4KTVA 4KHPC 1GPMA 4PUHA 1NYEA 3NI2A 3B7WA 2D27A 5A1GA 5AE3A 1O92A 4NOZA 1N36C 4DR4C 4K0BA 2P20A 4MH4A 2MCQA 3N54B 1PG4A 3E7WA 3S82A 3JAMD 4LF7C 4BC7A 1PG3A 1N34C 4G1IA 4G36A 5GTDA 1WCJA 2UXDC 4JI4C 3L95X 4DR3C 4JI6C 2E8FA 3A26A 4IR7A 2NCLA 1TH5A 4IZ6A 4R1MA 3K6RA 3EERA 3CW8X 4PZPA 1T5DX 4LF9C 2HHHC 1XRAA 3IEVA 2UUAC 1ML8A 4DCVA 1V26A 2Y27A 5BSWA 5BSUA 4U5YD 1XHJA 1ZB8A 3TUFA 1FJGC 1XMOC 2ONFA 2Y4NA 4JV5C 5LMUC 4DUYC 4R1LA 4BBYA 2E8EA 5E7QA 4LF5C 2ZM6C 3NYRA 2PROA 3G7SA 3A4IA 4PROC 3DAYA 4AQYC 4DCUA 5T8TA 1PU1A 4MTNA 4JI5C 3ETCA 1IB8A 1LCIA 3NYQA 2OPLA 4HPVA 1USPB 4LF4C 3AY0A 1T5HX 2VQEC 3R9XA 4YHHC 1FUGA 4DUZC 1XRBA 2D7VA 1EGAA 4JYAC 2QVYX 1AMUA 4DV4C 5DV9A 4GXQA 5KYVA 4B3TC 2P02A 5FLXD 5LCIA 1HR0C 5K85A 4B3RC 4EATA 3TQIA 3OTOC 2E8CA 2WD9A 2UUBC 5A1IA 4X62C 3VNRA 1KKGA 2PN2A 5BSMA 1VEHA 4DV0C 4DR6C 3J81D 3PESA 1MXBA 4RVOA 1XNQC 4JI3C 4YY3C 2VSQA 1FLOA 4XX2A 2P2MA 2P2BA 1XMQC 2VQFC 2QW0X 5CZXA 3CW9A 4PUGA 1IBKC 4NXNC 2ASBA 2D1SA 2XR1A 1MXAA 4ZLPA 2P2JA 4D4GA 1V25A 2YWCA 1O9TA 2VZEA 2ZZNA 1N32C 1XS3A 1QM4A 3RV2A 5BSVA 2UXBC 1V60A 4G37A 4BC9A 3I08A 5BSTA 2D1TA 4LE5A 3A9VA 4RM2A 1XRCA 1YJ7A 4NDNA 2HJGA 3N2QA 4NXMC 4LF8C 3EQ6A 3C5EA 3TR3A 1ULTA 2E7GA 3DHVA 1IBLC 4X65C 5BURA 3FCEA 2QL8A 3SO4A 1HH2P 3R44A 2D1RA 4LF6C 4DV2C 4BCAA 4BSZA 1P4EC 2ZZMA 2BJOA 5A19A 5LMNC 4DR2C 1P4EA 3IPLA 4DCSA 4B3MC 1USPA 3I07A 1I94C 4X66C 4LFBC 1PA4A 3PBKA 1RY2A 3CQ2A 4ODJA 5BUSA 2M5OA 4FTFA 1L2FA 3PROC 2P2FA 2E5LC 4X64C 1WH9A 2UUCC 3LGXA 3CQ1A 2UXCC 3KXWA 4DG8A 1JOSA 4FUTA 1MDBA 4PUIA 3O2EA 3L8CA 1M6XC 4I9FA 5CZVA 4KTTA 4DV5C 4WV3A 1M6XA 3FCCA 4L2ZA 4DG9A 4JI0C 1ZB9A 2DYJA 1P7LA 3GPCA 4RM3A 2V7BA 1HNZC 2ATWA 4L4QA 5T8SA 5KYTA 1VLAA 4DR5C 1UWDA 5A2QD 2MM9A 4WS9A 3GR0A 2UU9C 5K8FA 3IMLA 4JI8C 3H2TA 2YX1A 4D4IA 4DV3C 2OO4A 2M5HA 3E7XA 2F4VC 5BUQA 2KZFA 3ETOA 3VNSA 2KZ0A 2JMPA 2MMAB 4JI1C 1BA3A 2E0GA 3NPDA 5BSRA 1MXCA 2QVZX 2YCBA 2CU6A 3A9UA 3TDEA 5JRHA 4DV6C 4D57A 3AF6A 3LNVA 4DV1C 1J5EC 2DPLA 2P2QA 2YWBA 3UX2A 5IT9D 4JI7C 4D56A 1MKYA 4OXIA 1MD9A 4GKJC 2D1QA 3LNOA 4FUQA 4GS5A 1NY8A 4OX9C 2BH1X 3UOWA 3A25A 2Y4OA 4ZJZA 5ADZA 3CJEA 4LFCC 1RG9A 1N33C 5KEIA 2PT7G 2JNVA 3UZ0A 5IFIA 3DLPX 3T1HC 4RMNA 3RG2A 2CXCA 3GR1A 3AF5A 4PHTA 4TPSB 5AE1A 5H9UA 4OYCA 3UEBA 1K0RA 3GKUA 3UX3A 4R0MA 2OPLB 1O93A 4DCTA 1HNWC 3J80D 2KDNA 4GXRA 1WF3A 1UKKA 1IBMC 3CQ3A 4B3SC 3VNQA 5IWAC 1MDFA 4DV7C 4DR7C 4LFAC 3LUSA 2EGTA 4JM1A 4K0KC 1XNRC 4GKKC
chains in the Genus database with same CATH topology
3LNOA 3CQ3A 3UX2A 3CQ2A 3UX3A 1XHJA 2CU6A 1WCJA 2M5OA 1UWDA 1VEHA 2M5HA 1TH5A 3CQ1A 2Z51A 2JNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNO A;  3CQ3 A;  3UX2 A;  3CQ2 A;  3UX3 A;  1XHJ A;  2CU6 A;  1WCJ A;  2M5O A;  1UWD A;  1VEH A;  2M5H A;  1TH5 A;  3CQ1 A;  2Z51 A;  2JNV A; 
#chains in the Genus database with same CATH topology
 4I9G A;  1O90 A;  3IEU A;  4RLQ A;  4L7I A;  1LQL A;  2AYA A;  2WP0 C;  3LAX A;  5AE2 A;  1N2F A;  4RLF A;  3R9W A;  2D28 C;  2DHM A;  1QWI A;  4DR1 C;  1HNX C;  2CY1 A;  2Z51 A;  2QVX X;  4RVN A;  4JI2 C;  5BR8 C;  2OBV A;  4ISB A;  3T1Y C;  4KTV A;  4KHP C;  1GPM A;  4PUH A;  1NYE A;  3NI2 A;  3B7W A;  2D27 A;  5A1G A;  5AE3 A;  1O92 A;  4NOZ A;  1N36 C;  4DR4 C;  4K0B A;  2P20 A;  4MH4 A;  2MCQ A;  3N54 B;  1PG4 A;  3E7W A;  3S82 A;  3JAM D;  4LF7 C;  4BC7 A;  1PG3 A;  1N34 C;  4G1I A;  4G36 A;  5GTD A;  1WCJ A;  2UXD C;  4JI4 C;  3L95 X;  4DR3 C;  4JI6 C;  2E8F A;  3A26 A;  4IR7 A;  2NCL A;  1TH5 A;  4IZ6 A;  4R1M A;  3K6R A;  3EER A;  3CW8 X;  4PZP A;  1T5D X;  4LF9 C;  2HHH C;  1XRA A;  3IEV A;  2UUA C;  1ML8 A;  4DCV A;  1V26 A;  2Y27 A;  5BSW A;  5BSU A;  4U5Y D;  1XHJ A;  1ZB8 A;  3TUF A;  1FJG C;  1XMO C;  2ONF A;  2Y4N A;  4JV5 C;  5LMU C;  4DUY C;  4R1L A;  4BBY A;  2E8E A;  5E7Q A;  4LF5 C;  2ZM6 C;  3NYR A;  2PRO A;  3G7S A;  3A4I A;  4PRO C;  3DAY A;  4AQY C;  4DCU A;  5T8T A;  1PU1 A;  4MTN A;  4JI5 C;  3ETC A;  1IB8 A;  1LCI A;  3NYQ A;  2OPL A;  4HPV A;  1USP B;  4LF4 C;  3AY0 A;  1T5H X;  2VQE C;  3R9X A;  4YHH C;  1FUG A;  4DUZ C;  1XRB A;  2D7V A;  1EGA A;  4JYA C;  2QVY X;  1AMU A;  4DV4 C;  5DV9 A;  4GXQ A;  5KYV A;  4B3T C;  2P02 A;  5FLX D;  5LCI A;  1HR0 C;  5K85 A;  4B3R C;  4EAT A;  3TQI A;  3OTO C;  2E8C A;  2WD9 A;  2UUB C;  5A1I A;  4X62 C;  3VNR A;  1KKG A;  2PN2 A;  5BSM A;  1VEH A;  4DV0 C;  4DR6 C;  3J81 D;  3PES A;  1MXB A;  4RVO A;  1XNQ C;  4JI3 C;  4YY3 C;  2VSQ A;  1FLO A;  4XX2 A;  2P2M A;  2P2B A;  1XMQ C;  2VQF C;  2QW0 X;  5CZX A;  3CW9 A;  4PUG A;  1IBK C;  4NXN C;  2ASB A;  2D1S A;  2XR1 A;  1MXA A;  4ZLP A;  2P2J A;  4D4G A;  1V25 A;  2YWC A;  1O9T A;  2VZE A;  2ZZN A;  1N32 C;  1XS3 A;  1QM4 A;  3RV2 A;  5BSV A;  2UXB C;  1V60 A;  4G37 A;  4BC9 A;  3I08 A;  5BST A;  2D1T A;  4LE5 A;  3A9V A;  4RM2 A;  1XRC A;  1YJ7 A;  4NDN A;  2HJG A;  3N2Q A;  4NXM C;  4LF8 C;  3EQ6 A;  3C5E A;  3TR3 A;  1ULT A;  2E7G A;  3DHV A;  1IBL C;  4X65 C;  5BUR A;  3FCE A;  2QL8 A;  3SO4 A;  1HH2 P;  3R44 A;  2D1R A;  4LF6 C;  4DV2 C;  4BCA A;  4BSZ A;  1P4E C;  2ZZM A;  2BJO A;  5A19 A;  5LMN C;  4DR2 C;  1P4E A;  3IPL A;  4DCS A;  4B3M C;  1USP A;  3I07 A;  1I94 C;  4X66 C;  4LFB C;  1PA4 A;  3PBK A;  1RY2 A;  3CQ2 A;  4ODJ A;  5BUS A;  2M5O A;  4FTF A;  1L2F A;  3PRO C;  2P2F A;  2E5L C;  4X64 C;  1WH9 A;  2UUC C;  3LGX A;  3CQ1 A;  2UXC C;  3KXW A;  4DG8 A;  1JOS A;  4FUT A;  1MDB A;  4PUI A;  3O2E A;  3L8C A;  1M6X C;  4I9F A;  5CZV A;  4KTT A;  4DV5 C;  4WV3 A;  1M6X A;  3FCC A;  4L2Z A;  4DG9 A;  4JI0 C;  1ZB9 A;  2DYJ A;  1P7L A;  3GPC A;  4RM3 A;  2V7B A;  1HNZ C;  2ATW A;  4L4Q A;  5T8S A;  5KYT A;  1VLA A;  4DR5 C;  1UWD A;  5A2Q D;  2MM9 A;  4WS9 A;  3GR0 A;  2UU9 C;  5K8F A;  3IML A;  4JI8 C;  3H2T A;  2YX1 A;  4D4I A;  4DV3 C;  2OO4 A;  2M5H A;  3E7X A;  2F4V C;  5BUQ A;  2KZF A;  3ETO A;  3VNS A;  2KZ0 A;  2JMP A;  2MMA B;  4JI1 C;  1BA3 A;  2E0G A;  3NPD A;  5BSR A;  1MXC A;  2QVZ X;  2YCB A;  2CU6 A;  3A9U A;  3TDE A;  5JRH A;  4DV6 C;  4D57 A;  3AF6 A;  3LNV A;  4DV1 C;  1J5E C;  2DPL A;  2P2Q A;  2YWB A;  3UX2 A;  5IT9 D;  4JI7 C;  4D56 A;  1MKY A;  4OXI A;  1MD9 A;  4GKJ C;  2D1Q A;  3LNO A;  4FUQ A;  4GS5 A;  1NY8 A;  4OX9 C;  2BH1 X;  3UOW A;  3A25 A;  2Y4O A;  4ZJZ A;  5ADZ A;  3CJE A;  4LFC C;  1RG9 A;  1N33 C;  5KEI A;  2PT7 G;  2JNV A;  3UZ0 A;  5IFI A;  3DLP X;  3T1H C;  4RMN A;  3RG2 A;  2CXC A;  3GR1 A;  3AF5 A;  4PHT A;  4TPS B;  5AE1 A;  5H9U A;  4OYC A;  3UEB A;  1K0R A;  3GKU A;  3UX3 A;  4R0M A;  2OPL B;  1O93 A;  4DCT A;  1HNW C;  3J80 D;  2KDN A;  4GXR A;  1WF3 A;  1UKK A;  1IBM C;  3CQ3 A;  4B3S C;  3VNQ A;  5IWA C;  1MDF A;  4DV7 C;  4DR7 C;  4LFA C;  3LUS A;  2EGT A;  4JM1 A;  4K0K C;  1XNR C;  4GKK C; 
#chains in the Genus database with same CATH homology
 3LNO A;  3CQ3 A;  3UX2 A;  3CQ2 A;  3UX3 A;  1XHJ A;  2CU6 A;  1WCJ A;  2M5O A;  1UWD A;  1VEH A;  2M5H A;  1TH5 A;  3CQ1 A;  2Z51 A;  2JNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...