3CQ2A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein TTHB138
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 22
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq2A00
1XHJA 2M5OA 3CQ3A 3LNOA 3UX2A 1UWDA 2JNVA 2Z51A 1TH5A 3CQ1A 2M5HA 3UX3A 3CQ2A 1VEHA 2CU6A 1WCJA
chains in the Genus database with same CATH superfamily
1HR0C 3O2EA 2KDNA 1MXBA 3R9WA 4OYCA 3J81D 1IBLC 4NXNC 1IB8A 4I9GA 1P4EA 4JI5C 2D1TA 4DR6C 2KZFA 1WCJA 3A4IA 2P2FA 1USPB 3GR0A 4DV6C 4RLFA 3DHVA 4KTTA 4RVOA 4DR1C 1LCIA 4L2ZA 4DG9A 1WF3A 4BCAA 2YWCA 3OTOC 5T8SA 5BUSA 5LCIA 2YWBA 2Z51A 3T1YC 4OXIA 3UEBA 4B3TC 1MKYA 1IBMC 1O90A 1XRBA 2BH1X 1N33C 2E5LC 4JI2C 4D4GA 2KZ0A 4AQYC 3CW9A 5CZVA 4GS5A 2ZZNA 4L7IA 2D28C 3LNVA 4DUZC 2P2MA 2ONFA 1PG4A 3AY0A 3ETOA 4JYAC 4X65C 1XMOC 3RV2A 1XS3A 1YJ7A 2NCLA 4XX2A 1V60A 4U5YD 3PBKA 2UU9C 4LFBC 3R9XA 1RG9A 3RG2A 4RM2A 2D1RA 1N36C 1N32C 5AE1A 5BSVA 2ZM6C 5BSMA 4DR5C 2Y4OA 4IR7A 1XMQC 2VQEC 4DCTA 5A2QD 1AMUA 4R1LA 1IBKC 3CQ1A 2V7BA 4JI1C 1BA3A 5BR8C 1XRAA 2QL8A 2QVXX 3A9UA 5BSWA 4MH4A 1MDFA 1MDBA 1P7LA 1PG3A 4G37A 4PROC 4LFCC 1KKGA 1HNZC 3I07A 1L2FA 1M6XC 4DV3C 4B3SC 1UWDA 4DR7C 4B3MC 3E7XA 4DCSA 3LAXA 5BSTA 2P2BA 5FLXD 1O92A 4EATA 3CQ3A 1NY8A 1GPMA 5AE2A 3TQIA 4GXQA 3N2QA 4BBYA 2XR1A 4GKKC 2ASBA 4D56A 2MM9A 1O93A 2YCBA 4PUHA 1ZB9A 1UKKA 2OPLB 3PESA 4X66C 5IWAC 3UOWA 3SO4A 2CU6A 3LNOA 3CW8X 2DPLA 4DCVA 3NYRA 3L8CA 4ZLPA 3IEVA 2UXCC 5A1IA 4JI6C 3VNSA 4LF7C 3GPCA 5BSRA 5A1GA 5A19A 4TPSB 3IEUA 4PUIA 2P02A 4GXRA 5GTDA 2WP0C 4RLQA 4FTFA 4LF9C 5K85A 3B7WA 4PUGA 4JI8C 5BURA 4G36A 4PHTA 2P2QA 3VNQA 4OX9C 1FLOA 5LMNC 3TDEA 2EGTA 3EERA 4JV5C 1NYEA 2E7GA 4DV0C 4LFAC 2DYJA 2D1QA 4DV2C 2OO4A 3IMLA 2YX1A 4DV5C 4JI0C 3UX3A 5LMUC 1VLAA 2Y4NA 3TUFA 2ZZMA 3EQ6A 4R1MA 1P4EC 1XHJA 4MTNA 5IT9D 4G1IA 4DCUA 3ETCA 3K6RA 4R0MA 1ML8A 4LF8C 3GR1A 3H2TA 4GKJC 1PU1A 1RY2A 1XNRC 4JM1A 1QM4A 1VEHA 4JI4C 1HNWC 1N2FA 3PROC 4DUYC 5JRHA 4ZJZA 3GKUA 4WS9A 2UUBC 3I08A 4JI3C 4K0BA 2WD9A 4HPVA 2D7VA 1TH5A 3CQ2A 4RMNA 4ODJA 1QWIA 2UUAC 3TR3A 3LGXA 3N54B 5CZXA 1V25A 4WV3A 1HNXC 5ADZA 3NYQA 1USPA 4FUQA 4LF5C 2MMAB 4DV4C 2P2JA 4D4IA 4NXMC 3VNRA 4DG8A 4RVNA 2QW0X 2VSQA 1WH9A 5T8TA 5IFIA 2E8CA 2M5HA 2E8FA 5BUQA 2VZEA 5KYVA 4BSZA 2CXCA 2M5OA 5KEIA 2D27A 3CJEA 5K8FA 1XNQC 1EGAA 1K0RA 2MCQA 2UXBC 3G7SA 2ATWA 3E7WA 4X62C 3L95X 1T5HX 5H9UA 3A25A 4I9FA 4LF4C 1M6XA 4YY3C 3FCCA 1LQLA 2F4VC 2QVYX 4D57A 2HHHC 4DR4C 1PA4A 1ULTA 2BJOA 4BC9A 2E0GA 4KHPC 3KXWA 2OBVA 3NPDA 3AF6A 2PROA 2JMPA 1O9TA 3FCEA 5BSUA 3R44A 4DV7C 4L4QA 1J5EC 4JI7C 2VQFC 2E8EA 1MD9A 1T5DX 2DHMA 3LUSA 4YHHC 3A9VA 3DLPX 3JAMD 1MXAA 1XRCA 4LF6C 2UUCC 3AF5A 1ZB8A 3A26A 4ISBA 3T1HC 2PN2A 3UZ0A 2Y27A 4DR2C 4K0KC 2CY1A 3C5EA 3DAYA 1FUGA 5AE3A 1FJGC 2P20A 2UXDC 5KYTA 4KTVA 2HJGA 4NOZA 4PZPA 4DV1C 2JNVA 1I94C 3J80D 3S82A 2PT7G 1N34C 1V26A 4NDNA 2OPLA 2QVZX 5DV9A 4BC7A 4DR3C 3IPLA 1MXCA 4LE5A 2AYAA 4IZ6A 3UX2A 4X64C 4B3RC 2D1SA 1HH2P 4RM3A 3NI2A 5E7QA 4FUTA 1JOSA
chains in the Genus database with same CATH topology
1XHJA 2M5OA 3CQ3A 3LNOA 3UX2A 1UWDA 2JNVA 2Z51A 1TH5A 3CQ1A 2M5HA 3UX3A 3CQ2A 1VEHA 2CU6A 1WCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHJ A;  2M5O A;  3CQ3 A;  3LNO A;  3UX2 A;  1UWD A;  2JNV A;  2Z51 A;  1TH5 A;  3CQ1 A;  2M5H A;  3UX3 A;  3CQ2 A;  1VEH A;  2CU6 A;  1WCJ A; 
#chains in the Genus database with same CATH topology
 1HR0 C;  3O2E A;  2KDN A;  1MXB A;  3R9W A;  4OYC A;  3J81 D;  1IBL C;  4NXN C;  1IB8 A;  4I9G A;  1P4E A;  4JI5 C;  2D1T A;  4DR6 C;  2KZF A;  1WCJ A;  3A4I A;  2P2F A;  1USP B;  3GR0 A;  4DV6 C;  4RLF A;  3DHV A;  4KTT A;  4RVO A;  4DR1 C;  1LCI A;  4L2Z A;  4DG9 A;  1WF3 A;  4BCA A;  2YWC A;  3OTO C;  5T8S A;  5BUS A;  5LCI A;  2YWB A;  2Z51 A;  3T1Y C;  4OXI A;  3UEB A;  4B3T C;  1MKY A;  1IBM C;  1O90 A;  1XRB A;  2BH1 X;  1N33 C;  2E5L C;  4JI2 C;  4D4G A;  2KZ0 A;  4AQY C;  3CW9 A;  5CZV A;  4GS5 A;  2ZZN A;  4L7I A;  2D28 C;  3LNV A;  4DUZ C;  2P2M A;  2ONF A;  1PG4 A;  3AY0 A;  3ETO A;  4JYA C;  4X65 C;  1XMO C;  3RV2 A;  1XS3 A;  1YJ7 A;  2NCL A;  4XX2 A;  1V60 A;  4U5Y D;  3PBK A;  2UU9 C;  4LFB C;  3R9X A;  1RG9 A;  3RG2 A;  4RM2 A;  2D1R A;  1N36 C;  1N32 C;  5AE1 A;  5BSV A;  2ZM6 C;  5BSM A;  4DR5 C;  2Y4O A;  4IR7 A;  1XMQ C;  2VQE C;  4DCT A;  5A2Q D;  1AMU A;  4R1L A;  1IBK C;  3CQ1 A;  2V7B A;  4JI1 C;  1BA3 A;  5BR8 C;  1XRA A;  2QL8 A;  2QVX X;  3A9U A;  5BSW A;  4MH4 A;  1MDF A;  1MDB A;  1P7L A;  1PG3 A;  4G37 A;  4PRO C;  4LFC C;  1KKG A;  1HNZ C;  3I07 A;  1L2F A;  1M6X C;  4DV3 C;  4B3S C;  1UWD A;  4DR7 C;  4B3M C;  3E7X A;  4DCS A;  3LAX A;  5BST A;  2P2B A;  5FLX D;  1O92 A;  4EAT A;  3CQ3 A;  1NY8 A;  1GPM A;  5AE2 A;  3TQI A;  4GXQ A;  3N2Q A;  4BBY A;  2XR1 A;  4GKK C;  2ASB A;  4D56 A;  2MM9 A;  1O93 A;  2YCB A;  4PUH A;  1ZB9 A;  1UKK A;  2OPL B;  3PES A;  4X66 C;  5IWA C;  3UOW A;  3SO4 A;  2CU6 A;  3LNO A;  3CW8 X;  2DPL A;  4DCV A;  3NYR A;  3L8C A;  4ZLP A;  3IEV A;  2UXC C;  5A1I A;  4JI6 C;  3VNS A;  4LF7 C;  3GPC A;  5BSR A;  5A1G A;  5A19 A;  4TPS B;  3IEU A;  4PUI A;  2P02 A;  4GXR A;  5GTD A;  2WP0 C;  4RLQ A;  4FTF A;  4LF9 C;  5K85 A;  3B7W A;  4PUG A;  4JI8 C;  5BUR A;  4G36 A;  4PHT A;  2P2Q A;  3VNQ A;  4OX9 C;  1FLO A;  5LMN C;  3TDE A;  2EGT A;  3EER A;  4JV5 C;  1NYE A;  2E7G A;  4DV0 C;  4LFA C;  2DYJ A;  2D1Q A;  4DV2 C;  2OO4 A;  3IML A;  2YX1 A;  4DV5 C;  4JI0 C;  3UX3 A;  5LMU C;  1VLA A;  2Y4N A;  3TUF A;  2ZZM A;  3EQ6 A;  4R1M A;  1P4E C;  1XHJ A;  4MTN A;  5IT9 D;  4G1I A;  4DCU A;  3ETC A;  3K6R A;  4R0M A;  1ML8 A;  4LF8 C;  3GR1 A;  3H2T A;  4GKJ C;  1PU1 A;  1RY2 A;  1XNR C;  4JM1 A;  1QM4 A;  1VEH A;  4JI4 C;  1HNW C;  1N2F A;  3PRO C;  4DUY C;  5JRH A;  4ZJZ A;  3GKU A;  4WS9 A;  2UUB C;  3I08 A;  4JI3 C;  4K0B A;  2WD9 A;  4HPV A;  2D7V A;  1TH5 A;  3CQ2 A;  4RMN A;  4ODJ A;  1QWI A;  2UUA C;  3TR3 A;  3LGX A;  3N54 B;  5CZX A;  1V25 A;  4WV3 A;  1HNX C;  5ADZ A;  3NYQ A;  1USP A;  4FUQ A;  4LF5 C;  2MMA B;  4DV4 C;  2P2J A;  4D4I A;  4NXM C;  3VNR A;  4DG8 A;  4RVN A;  2QW0 X;  2VSQ A;  1WH9 A;  5T8T A;  5IFI A;  2E8C A;  2M5H A;  2E8F A;  5BUQ A;  2VZE A;  5KYV A;  4BSZ A;  2CXC A;  2M5O A;  5KEI A;  2D27 A;  3CJE A;  5K8F A;  1XNQ C;  1EGA A;  1K0R A;  2MCQ A;  2UXB C;  3G7S A;  2ATW A;  3E7W A;  4X62 C;  3L95 X;  1T5H X;  5H9U A;  3A25 A;  4I9F A;  4LF4 C;  1M6X A;  4YY3 C;  3FCC A;  1LQL A;  2F4V C;  2QVY X;  4D57 A;  2HHH C;  4DR4 C;  1PA4 A;  1ULT A;  2BJO A;  4BC9 A;  2E0G A;  4KHP C;  3KXW A;  2OBV A;  3NPD A;  3AF6 A;  2PRO A;  2JMP A;  1O9T A;  3FCE A;  5BSU A;  3R44 A;  4DV7 C;  4L4Q A;  1J5E C;  4JI7 C;  2VQF C;  2E8E A;  1MD9 A;  1T5D X;  2DHM A;  3LUS A;  4YHH C;  3A9V A;  3DLP X;  3JAM D;  1MXA A;  1XRC A;  4LF6 C;  2UUC C;  3AF5 A;  1ZB8 A;  3A26 A;  4ISB A;  3T1H C;  2PN2 A;  3UZ0 A;  2Y27 A;  4DR2 C;  4K0K C;  2CY1 A;  3C5E A;  3DAY A;  1FUG A;  5AE3 A;  1FJG C;  2P20 A;  2UXD C;  5KYT A;  4KTV A;  2HJG A;  4NOZ A;  4PZP A;  4DV1 C;  2JNV A;  1I94 C;  3J80 D;  3S82 A;  2PT7 G;  1N34 C;  1V26 A;  4NDN A;  2OPL A;  2QVZ X;  5DV9 A;  4BC7 A;  4DR3 C;  3IPL A;  1MXC A;  4LE5 A;  2AYA A;  4IZ6 A;  3UX2 A;  4X64 C;  4B3R C;  2D1S A;  1HH2 P;  4RM3 A;  3NI2 A;  5E7Q A;  4FUT A;  1JOS A; 
#chains in the Genus database with same CATH homology
 1XHJ A;  2M5O A;  3CQ3 A;  3LNO A;  3UX2 A;  1UWD A;  2JNV A;  2Z51 A;  1TH5 A;  3CQ1 A;  2M5H A;  3UX3 A;  3CQ2 A;  1VEH A;  2CU6 A;  1WCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...