3CQ2A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein TTHB138
total genus 22
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq2A00
1VEHA 3LNOA 1XHJA 2M5HA 2CU6A 2M5OA 3CQ2A 1WCJA 3UX3A 3CQ3A 1TH5A 2JNVA 3UX2A 2Z51A 3CQ1A 1UWDA
chains in the Genus database with same CATH superfamily
5BSTA 3LNVA 5BR8C 4RVOA 4LFBC 4R0MA 3G7SA 3CQ3A 2V7BA 5K85A 2HJGA 3E7XA 3VNSA 4PUGA 4DV6C 4GS5A 3EQ6A 1UWDA 3IMLA 2D1QA 1YJ7A 3UX3A 4DG9A 3FCCA 2KZ0A 4WS9A 2PROA 3GR0A 4DCVA 1WF3A 4RLQA 4X66C 3RV2A 2E7GA 5BURA 3TUFA 2MCQA 4I9FA 3SO4A 2JMPA 4DR3C 3GR1A 5H9UA 2OPLA 1P7LA 3AY0A 3TDEA 5T8SA 5DV9A 4DR4C 1L2FA 1O9TA 3N54B 1ZB9A 3C5EA 4R1MA 5A1GA 5IFIA 1UKKA 1TH5A 3AF6A 2EGTA 4DV0C 4PROC 4G1IA 2Y27A 4NDNA 4JI8C 4DV3C 4RMNA 1N34C 3IEUA 2UUCC 4G36A 3TQIA 5AE1A 1P4EC 2E5LC 5LCIA 1XRCA 3PESA 2P2MA 2MMAB 2OPLB 1LCIA 5GTDA 5FLXD 4DCTA 1JOSA 3CQ2A 3DHVA 1XNRC 2E0GA 4BSZA 4LF8C 3CJEA 2UXBC 4X65C 4LF6C 4BC7A 4DR1C 2YWBA 4JI2C 2UXDC 4JI3C 5BSVA 4JI5C 3K6RA 3A4IA 4LF4C 5LMNC 4OX9C 4LF9C 1FJGC 4BBYA 4NXMC 1GPMA 4DR6C 2F4VC 4JI7C 5BUSA 4OXIA 5CZVA 2D1RA 4AQYC 2QVYX 2UUBC 1I94C 5BSUA 2Z51A 4PUHA 1XRAA 1IBLC 2E8FA 4OYCA 2M5HA 4JI4C 3I07A 1AMUA 4U5YD 5A1IA 1NYEA 1EGAA 1XNQC 3JAMD 1IBKC 2ATWA 1K0RA 1XHJA 2WP0C 4JM1A 2P20A 1V60A 1PG4A 1HNWC 1ULTA 4D4IA 4LE5A 3UOWA 4RM3A 3O2EA 4MTNA 3OTOC 3B7WA 4DUZC 2BH1X 1N2FA 2ONFA 3LNOA 1ML8A 4ISBA 4GKKC 4B3RC 1N33C 1MD9A 4DV1C 4LFAC 4L4QA 5BSRA 2YX1A 2UU9C 2E8EA 1M6XC 1XS3A 3PBKA 2ZM6C 5KEIA 2QVXX 4D56A 4RM2A 2PT7G 4DCSA 3ETCA 3T1YC 3EERA 1XMQC 2D1TA 3S82A 3TR3A 1V25A 3I08A 4MH4A 4D57A 4DR5C 5A19A 4PHTA 4FTFA 1P4EA 2JNVA 4B3MC 1IB8A 2VSQA 1KKGA 3GKUA 1T5HX 1T5DX 4RLFA 2DPLA 4LF5C 2VZEA 3A25A 2DHMA 4GXRA 2D1SA 4X62C 4R1LA 4JI0C 4JI6C 1FUGA 2P2FA 2D28C 4KTTA 1IBMC 4KTVA 2CY1A 5IT9D 3UEBA 5K8FA 1FLOA 1MXAA 3L8CA 2ZZNA 3R9XA 4XX2A 4K0BA 3KXWA 2CU6A 2D27A 4G37A 2QL8A 2P02A 2Y4NA 2HHHC 4BC9A 3IEVA 1MXCA 1HNZC 2YWCA 4DCUA 1HR0C 4GKJC 4ZJZA 2OBVA 3CW8X 1J5EC 4ODJA 4RVNA 1M6XA 4NOZA 4BCAA 2UUAC 2MM9A 2ASBA 5BSMA 5LMUC 3UZ0A 3A26A 4JV5C 3DLPX 4LFCC 5IWAC 2UXCC 2QW0X 4L7IA 4KHPC 1WCJA 4DV4C 1O92A 3DAYA 4DV2C 3E7WA 2P2JA 3NI2A 2P2QA 2QVZX 5T8TA 3FCEA 2CXCA 4LF7C 1O90A 1RG9A 1PU1A 3NYQA 2XR1A 3R44A 3H2TA 3L95X 1BA3A 3IPLA 4PUIA 4ZLPA 1O93A 2VQFC 4JI1C 2DYJA 4B3SC 1ZB8A 5KYTA 2KZFA 3LAXA 3A9UA 5JRHA 1N36C 5AE2A 2YCBA 3LGXA 2E8CA 1USPB 3NPDA 4IR7A 1MKYA 5CZXA 5AE3A 4DR2C 4GXQA 3T1HC 1MDFA 4K0KC 4FUQA 2NCLA 4TPSB 3RG2A 1XRBA 4D4GA 2AYAA 4DG8A 1MDBA 3PROC 3AF5A 1VLAA 4DV7C 3N2QA 2KDNA 1USPA 3UX2A 5BSWA 1N32C 3CQ1A 3J81D 4B3TC 2VQEC 3R9WA 5BUQA 4FUTA 5A2QD 2ZZMA 4DR7C 1PA4A 5KYVA 4EATA 2BJOA 2P2BA 3CW9A 4HPVA 1V26A 1QM4A 3VNRA 1HNXC 4WV3A 4X64C 2WD9A 4DV5C 2OO4A 3VNQA 1HH2P 4NXNC 5E7QA 4YY3C 3A9VA 2M5OA 4JYAC 3ETOA 4IZ6A 3NYRA 1LQLA 3J80D 4L2ZA 4YHHC 3LUSA 4I9GA 4PZPA 3GPCA 1VEHA 1MXBA 2Y4OA 1PG3A 5ADZA 1QWIA 2D7VA 1WH9A 4DUYC 2PN2A 1NY8A 1RY2A 1XMOC
chains in the Genus database with same CATH topology
1VEHA 3LNOA 1XHJA 2M5HA 2CU6A 2M5OA 3CQ2A 1WCJA 3UX3A 3CQ3A 1TH5A 2JNVA 3UX2A 2Z51A 3CQ1A 1UWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEH A;  3LNO A;  1XHJ A;  2M5H A;  2CU6 A;  2M5O A;  3CQ2 A;  1WCJ A;  3UX3 A;  3CQ3 A;  1TH5 A;  2JNV A;  3UX2 A;  2Z51 A;  3CQ1 A;  1UWD A; 
#chains in the Genus database with same CATH topology
 5BST A;  3LNV A;  5BR8 C;  4RVO A;  4LFB C;  4R0M A;  3G7S A;  3CQ3 A;  2V7B A;  5K85 A;  2HJG A;  3E7X A;  3VNS A;  4PUG A;  4DV6 C;  4GS5 A;  3EQ6 A;  1UWD A;  3IML A;  2D1Q A;  1YJ7 A;  3UX3 A;  4DG9 A;  3FCC A;  2KZ0 A;  4WS9 A;  2PRO A;  3GR0 A;  4DCV A;  1WF3 A;  4RLQ A;  4X66 C;  3RV2 A;  2E7G A;  5BUR A;  3TUF A;  2MCQ A;  4I9F A;  3SO4 A;  2JMP A;  4DR3 C;  3GR1 A;  5H9U A;  2OPL A;  1P7L A;  3AY0 A;  3TDE A;  5T8S A;  5DV9 A;  4DR4 C;  1L2F A;  1O9T A;  3N54 B;  1ZB9 A;  3C5E A;  4R1M A;  5A1G A;  5IFI A;  1UKK A;  1TH5 A;  3AF6 A;  2EGT A;  4DV0 C;  4PRO C;  4G1I A;  2Y27 A;  4NDN A;  4JI8 C;  4DV3 C;  4RMN A;  1N34 C;  3IEU A;  2UUC C;  4G36 A;  3TQI A;  5AE1 A;  1P4E C;  2E5L C;  5LCI A;  1XRC A;  3PES A;  2P2M A;  2MMA B;  2OPL B;  1LCI A;  5GTD A;  5FLX D;  4DCT A;  1JOS A;  3CQ2 A;  3DHV A;  1XNR C;  2E0G A;  4BSZ A;  4LF8 C;  3CJE A;  2UXB C;  4X65 C;  4LF6 C;  4BC7 A;  4DR1 C;  2YWB A;  4JI2 C;  2UXD C;  4JI3 C;  5BSV A;  4JI5 C;  3K6R A;  3A4I A;  4LF4 C;  5LMN C;  4OX9 C;  4LF9 C;  1FJG C;  4BBY A;  4NXM C;  1GPM A;  4DR6 C;  2F4V C;  4JI7 C;  5BUS A;  4OXI A;  5CZV A;  2D1R A;  4AQY C;  2QVY X;  2UUB C;  1I94 C;  5BSU A;  2Z51 A;  4PUH A;  1XRA A;  1IBL C;  2E8F A;  4OYC A;  2M5H A;  4JI4 C;  3I07 A;  1AMU A;  4U5Y D;  5A1I A;  1NYE A;  1EGA A;  1XNQ C;  3JAM D;  1IBK C;  2ATW A;  1K0R A;  1XHJ A;  2WP0 C;  4JM1 A;  2P20 A;  1V60 A;  1PG4 A;  1HNW C;  1ULT A;  4D4I A;  4LE5 A;  3UOW A;  4RM3 A;  3O2E A;  4MTN A;  3OTO C;  3B7W A;  4DUZ C;  2BH1 X;  1N2F A;  2ONF A;  3LNO A;  1ML8 A;  4ISB A;  4GKK C;  4B3R C;  1N33 C;  1MD9 A;  4DV1 C;  4LFA C;  4L4Q A;  5BSR A;  2YX1 A;  2UU9 C;  2E8E A;  1M6X C;  1XS3 A;  3PBK A;  2ZM6 C;  5KEI A;  2QVX X;  4D56 A;  4RM2 A;  2PT7 G;  4DCS A;  3ETC A;  3T1Y C;  3EER A;  1XMQ C;  2D1T A;  3S82 A;  3TR3 A;  1V25 A;  3I08 A;  4MH4 A;  4D57 A;  4DR5 C;  5A19 A;  4PHT A;  4FTF A;  1P4E A;  2JNV A;  4B3M C;  1IB8 A;  2VSQ A;  1KKG A;  3GKU A;  1T5H X;  1T5D X;  4RLF A;  2DPL A;  4LF5 C;  2VZE A;  3A25 A;  2DHM A;  4GXR A;  2D1S A;  4X62 C;  4R1L A;  4JI0 C;  4JI6 C;  1FUG A;  2P2F A;  2D28 C;  4KTT A;  1IBM C;  4KTV A;  2CY1 A;  5IT9 D;  3UEB A;  5K8F A;  1FLO A;  1MXA A;  3L8C A;  2ZZN A;  3R9X A;  4XX2 A;  4K0B A;  3KXW A;  2CU6 A;  2D27 A;  4G37 A;  2QL8 A;  2P02 A;  2Y4N A;  2HHH C;  4BC9 A;  3IEV A;  1MXC A;  1HNZ C;  2YWC A;  4DCU A;  1HR0 C;  4GKJ C;  4ZJZ A;  2OBV A;  3CW8 X;  1J5E C;  4ODJ A;  4RVN A;  1M6X A;  4NOZ A;  4BCA A;  2UUA C;  2MM9 A;  2ASB A;  5BSM A;  5LMU C;  3UZ0 A;  3A26 A;  4JV5 C;  3DLP X;  4LFC C;  5IWA C;  2UXC C;  2QW0 X;  4L7I A;  4KHP C;  1WCJ A;  4DV4 C;  1O92 A;  3DAY A;  4DV2 C;  3E7W A;  2P2J A;  3NI2 A;  2P2Q A;  2QVZ X;  5T8T A;  3FCE A;  2CXC A;  4LF7 C;  1O90 A;  1RG9 A;  1PU1 A;  3NYQ A;  2XR1 A;  3R44 A;  3H2T A;  3L95 X;  1BA3 A;  3IPL A;  4PUI A;  4ZLP A;  1O93 A;  2VQF C;  4JI1 C;  2DYJ A;  4B3S C;  1ZB8 A;  5KYT A;  2KZF A;  3LAX A;  3A9U A;  5JRH A;  1N36 C;  5AE2 A;  2YCB A;  3LGX A;  2E8C A;  1USP B;  3NPD A;  4IR7 A;  1MKY A;  5CZX A;  5AE3 A;  4DR2 C;  4GXQ A;  3T1H C;  1MDF A;  4K0K C;  4FUQ A;  2NCL A;  4TPS B;  3RG2 A;  1XRB A;  4D4G A;  2AYA A;  4DG8 A;  1MDB A;  3PRO C;  3AF5 A;  1VLA A;  4DV7 C;  3N2Q A;  2KDN A;  1USP A;  3UX2 A;  5BSW A;  1N32 C;  3CQ1 A;  3J81 D;  4B3T C;  2VQE C;  3R9W A;  5BUQ A;  4FUT A;  5A2Q D;  2ZZM A;  4DR7 C;  1PA4 A;  5KYV A;  4EAT A;  2BJO A;  2P2B A;  3CW9 A;  4HPV A;  1V26 A;  1QM4 A;  3VNR A;  1HNX C;  4WV3 A;  4X64 C;  2WD9 A;  4DV5 C;  2OO4 A;  3VNQ A;  1HH2 P;  4NXN C;  5E7Q A;  4YY3 C;  3A9V A;  2M5O A;  4JYA C;  3ETO A;  4IZ6 A;  3NYR A;  1LQL A;  3J80 D;  4L2Z A;  4YHH C;  3LUS A;  4I9G A;  4PZP A;  3GPC A;  1VEH A;  1MXB A;  2Y4O A;  1PG3 A;  5ADZ A;  1QWI A;  2D7V A;  1WH9 A;  4DUY C;  2PN2 A;  1NY8 A;  1RY2 A;  1XMO C; 
#chains in the Genus database with same CATH homology
 1VEH A;  3LNO A;  1XHJ A;  2M5H A;  2CU6 A;  2M5O A;  3CQ2 A;  1WCJ A;  3UX3 A;  3CQ3 A;  1TH5 A;  2JNV A;  3UX2 A;  2Z51 A;  3CQ1 A;  1UWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...