3DHVA

Crystal structure of dlta protein in complex with d-alanine adenylate
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
503
structure length
498
Chain Sequence
KLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTSPKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-alanine-poly(phosphoribitol) ligase
publication title Crystal structure and enantiomer selection by D-alanyl carrier protein ligase DltA from Bacillus cereus.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Ligase
total genus 156
structure length 498
sequence length 503
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3dhvA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dhvA01
3PBKA 5E7QA 4M46A 4EATA 4RVNA 3O82A 4D4IA 4ISBA 5KYVA 4DG9A 3IPLA 4U5YD 3U16A 3VNRA 3NYRA 2D1TA 3C5EA 3IEPA 4ZJZA 3ETCA 4G37A 3GPCA 4R1MA 5K8FA 5DWVA 3NYQA 3O84A 3U17A 3L8CA 2D1SA 3RG2A 2D1QA 3T5CA 5BSTA 4DG8A 3E53A 3LGXA 3B7WA 3ITEA 5BSRA 4RVOA 4W8OA 3E7XA 5K85A 1RY2A 2P20A 4LGCA 5BSMA 5GTDA 4D56A 5KEIA 3R44A 5BSUA 2VZEA 4IZ6A 5JRHA 3T5AA 4RMNA 3A9UA 3DLPX 3LAXA 3T5BA 3DAYA 1ULTA 1LCIA 2QVZX 3A9VA 3FCCA 5BUQA 3QYAA 5IFIA 1PG4A 5BURA 4GXRA 2P2FA 1T5HX 3RIXA 1MD9A 4GS5A 5KYTA 3WVNA 4RM2A 2V7BA 4RLFA 4GR4A 2P2MA 4R1LA 2P2JA 1T5DX 2WD9A 4E5DA 3FCEA 4GXQA 3EQ6A 4WV3A 2P2BA 3G7SA 4R0MA 2Y27A 5DV9A 2QW0X 2QVXX 1YJ7A 5BUSA 4D4GA 4FUQA 3IESA 2Y4NA 2P2QA 3NI2A 5BSVA 3TSYA 1MDBA 3CW8X 3IVRA 4OYCA 3WV4A 1V26A 1MDFA 3CW9A 3LNVA 1V25A 4RLQA 1PG3A 5D6NA 4D4HA 2QVYX 4GR5A 3DHVA 4D57A 4OXIA 4IR7A 1AMUA 2D1RA 4RM3A 3O83A 4G36A 3VNSA 3VNQA 3WV5A 5BSWA 4FUTA 3IERA 3KXWA 4PZPA 2VSQA 2Y4OA 1BA3A 3E7WA
chains in the Genus database with same CATH superfamily
2F4VB 5E7QA 5DX0A 4XX0B 1ODIA 3VYUB 3L79A 2Z2YA 4MI6A 4MHSA 3DR5A 4X66C 1IDN1 4TVKA 2X5KO 1HYEA 1ZNZA 3DZBA 3EY9A 5KJEA 4AVYA 3DONA 1X7DA 5BRNA 2I03A 1WMEA 1B76A 2B2CA 3M3PA 4N49A 2B1JA 4I2VA 4RK1A 1DAIA 1T8TA 2YBEA 4ZV9A 5GPBA 3FOEC 1TW3A 1KVUA 3H17A 2JIZD 4FNMA 4ZOLA 2HKIA 1GJRA 1LVHA 1ZLYA 1VTKA 2VTDA 4U7JA 1FUKA 5HILA 2FPPB 2VNIA 4YQFA 3I6QA 3MRVA 5IJ9A 2QLMA 2OBXA 5AM0A 5TT0A 2P5SA 4I4TA 4KREA 2XUJA 2Q6LA 5KVAA 5AXAA 1O95C 1R8YA 3I23A 3I9JA 1W88B 4DEXA 4GNRA 2H4YA 4HQLA 2W4IA 1UPFA 2LD4A 5LLSA 3AOEA 4QSHA 4BMYA 2OORA 4CU5A 1NNEA 5M5BA 3DKKA 2CUNA 1AA6A 3AEKB 3AI2A 5KQSA 1PLKA 3KLMX 3PF9A 2XDAA 1JHXA 1V9SA 4P83A 3WJ2A 4MVJG 3HYNA 1EFVA 3IDOA 2NACA 1BWQA 1BNCA 5FNVF 3C5WP 2CFTA 2ZAIA 4N5MA 1XEFA 1VLVA 5CX4A 4JK3A 1R2QA 4RHUA 3CUSA 3EIXA 3P9ZA 2V74B 3RV3A 1RPAA 3IE2A 3QI7A 2FRXA 1NR5A 4ZVKA 4C2AA 5CFRA 3KSRA 1CS0A 1ZI8A 4UUBA 2UZIR 5DXJA 4IIBA 3L8DA 5ESWA 5SY4A 4CG1A 3ZDYB 4NI5A 1THZA 3OZBA 4W1SA 4EWLA 3ZJTA 4ZAWA 3KAJA 4EG5A 1WXXA 2ZDGA 4P7FA 5KREA 1M66A 1USVA 1SUIA 3A9SA 3O26A 3WYAA 4HNVA 4NDAA 3OZDA 3W5VA 3P9PA 2JCYA 1U7WA 4XGIA 3DE5X 4DNPA 4DB4A 1ZGCA 2R8PA 3T7SA 2IHKA 4NH0A 2ZPTX 1ZRSA 2XA9A 3RC1A 5LXTB 1KMNA 5LYJA 3KYDB 2RHWA 4IKOA 4EELA 2BEVA 5D84A 4DCOA 4N1AA 2CHGA 1WUYA 4CCYA 4OKNA 4ZYTA 1Z63A 3A0RB 1AKVA 2A3RA 1QQBA 5HCNA 1XSEA 2Q5IA 2NVWA 3MRSA 2GAAA 4BCAA 2X0RA 3GPIA 1LPNA 3LLVA 2OO5A 2P41A 4KI7A 2WU3A 2Q27A 1ACJA 2VN8A 5IJ0A 4IPTA 5I4CA 1GPLA 4XVCA 3HBMA 3DCIA 5K7SA 3WB0A 1TCUA 1XTZA 1XMJA 1ISSA 3CT6A 1I7DA 3EA0A 4MMYB 5DTRA 2VNKA 4ZVLA 1UC5B 1JFTA 2YVUA 3CSSA 5LB4A 1CNFA 1SD2A 1Y4ZA 3U9TA 4MB6A 2P69A 2AXPA 3MUEA 1AB6A 3ENWA 3K0EA 1X70A 3LUAA 4DR4C 2VP5A 4Y30A 1P17A 3OF5A 4BEWA 3MA0A 5BNFA 1XCMA 1DINA 4DLPA 5JR3A 3C7AA 4Y9DA 4YHHB 3M33A 3KBBA 1BVRA 5LMNB 5H59A 1J9EA 4OMFG 1CWUA 4X6XA 4X64B 3ZW8A 1KAHA 1KEEB 2PLFA 1TO2E 2H1SA 1PR6A 2FX2A 5DLPA 5K9ZA 4JR1A 4WMLA 3WKBA 2O0JA 1M34B 2FW7A 3ICEA 3QEMA 2DCUA 1H1LB 2VZLA 3A3PA 2ASEA 3DBHA 4XPIB 5IS2A 3GFPA 3QYPA 2LKDA 3VZCA 3ZXIA 4MI1A 3GLQA 1GKLA 2PLNA 4FQ8A 1DEHA 4KFTA 5DIZA 5FA6A 2BHLA 3PNOA 4DQKA 4UNRA 5CLFA 1BQ3A 4M21A 4Q9NA 5K0BA 3VDRA 1X1CA 1M2OB 1QH0A 2GETA 2CNLA 2IUSA 1QNFA 2I54A 3S55A 2MINB 3MT8A 4L4RA 4QU0A 1YKSA 3JWHA 2PBFA 3I39X 4WCFB 3HV2A 3W3AH 1BHO1 1KDTA 3COPA 4IXWA 3OHSX 3ITEA 1CNEA 1NQUA 4BZQA 4RIEA 5C1DA 4L27A 3E7XA 4FTFA 2A14A 4IDBA 2HQBA 3S5UA 4KITB 3SYLA 1M2JA 5GINE 4AICA 1K8YB 5CFLA 4NHEA 3F46A 1B2RA 1SVNA 2PZFA 4ZVQA 3C3YA 3TZHA 4B1FA 5JO0A 4U0KA 1U2EA 2DY1A 2V6BA 4K2HA 2WAYA 1ZR2A 3N07A 1KJ8A 3REGA 2IQIA 4RGQA 3LSYA 5CYFA 5ALUA 1DNPA 3B1KA 1SHZA 3EGVA 2C4TA 2H5JA 2VHXA 3TSYA 1CUAA 3EA5A 1ORTA 4ID3A 2OHHA 3G13A 3RSFA 2ILTA 2PMBA 1M6VA 1EE2A 3PCXA 5EXXA 4ZVNA 4G0QA 3CYFA 3ZYCA 2B7LA 3J81k 2IA5A 2YOGA 3DV9A 3QUQA 1WZIA 1OASA 3O2SB 5FOXA 2WJYA 4HXFB 4QGAA 2AH5A 2X4IA 4ZVOA 4AJOA 1BJKA 2XWPA 4IMIB 5D5HA 5EUQB 3L6RA 5BORA 1HNWB 2WMOB 2FUNB 4EO7A 4JCCA 4RVHA 3JATB 5IF9A 1Z0JA 1XNQC 2DHCA 2NO5A 3D2BA 1U2DA 3IQWA 1ZH4A 1W75A 3GJ8A 3PHBE 4N8DA 4R41A 4TRNA 2D1YA 2OA0A 5K0SA 1OTXA 2YCLA 1WCIA 3AILA 1OBHA 1AGXA 1UIMA 1XTKA 1GUBA 2OMEA 4BNTA 2AQIA 3KQWA 1OYWA 4Z0HO 4QDTA 3HTXA 3EX7C 2HN9A 4TUYB 5DV9A 4PRZA 4PRYA 3VI3B 4MDEA 2ZB3A 4PSAA 1OAAA 4OAPA 2K4MA 1IDOA 1O6BA 3E22A 3CF0A 3KKNA 1Y5IA 3SOPA 1NP3A 1TK9A 1UC4B 1F60A 1LVUA 1ZITA 2PWAA 3N6XA 4GNKA 4YJGA 3ZN2A 2Q4EA 3CZ9A 3RSGA 2NU8B 4XWOA 2AG8A 1OWPA 4GVLA 1Z83A 3WWDA 2BAGA 5IKMA 2EEPA 1TEZA 2XSZD 2QX7A 3U4HA 1H6AA 2GHTA 1Z6AA 2REOA 5LBIA 2FEOA 4N8SA 1RRFA 3R7DA 1R6TA 1JHUA 3CVWA 2LV8A 1VCMA 2M98A 5FBQB 3KOUA 3E9EA 2X15A 4K03A 4HCJA 2REQB 2WF7A 4LNHA 1DCTA 4FGKA 4P2BA 2B98A 4TWIA 5DBFA 3PFGA 1CKEA 3PQCA 5ALFA 1PRYA 5ADUS 4RCVA 4H3KB 3TTSA 5IDVA 1HPLA 2VJLA 3HZHA 2WUEA 2HCRA 3HVJA 5CAEA 3LT1A 2WWRA 3T7DA 4TMVA 4KXYA 4INZA 2IK8A 3HBFA 2YV3A 3HB7A 5FBWB 3RU3A 4UW9A 2FPIA 3FLBA 1DZIA 4CR6A 2GD0A 1N0VC 4MEBA 5DCLA 2JLCA 4FFPA 4B3MB 3JARB 1I4LD 3GIDA 1E2QA 3A3YA 3G68A 2YHSA 4YTEA 4NJOA 1M8JA 3F98A 3G2JA 1KDPA 3PFFA 3L4BA 1NVVQ 4MW5A 3V5NA 1HH4A 4D3FA 2VOEA 1C3JA 3QSGA 4C01A 5HRUA 3W6OA 4CR7A 4REQB 3S28A 4D02A 4JJAA 2ZJ2A 4HH0A 5IAAA 1JJFA 3IAXA 5T6MA 2FW0A 1P1IA 2HRCA 4LJ9A 4YFYA 1KEUA 2GN2A 3W7BA 5AVUA 1IUKA 4R8LA 2XE4A 2UZ1B 3QUTA 1DU4A 1PNOA 1V5IA 3P96A 4ZMSA 3JQQA 4RXTA 3ANMA 3LF1A 5F1YA 4GYKA 4GYYA 1U0NA 4LBYA 1XDZA 2JCSA 3PC7A 4BMOB 1BO6A 1MH9A 2OYSA 1YTLA 2QV7A 2GEDA 2RGWA 2VQDA 4H1HA 4D97A 1UBSB 2FH5B 2ONZA 3TZEA 1ECCA 2Z6UA 2BHRA 2C8VA 2HK8A 3CNBA 1T2VA 3W7AA 3NCHA 1NKSA 3GGDA 3O03A 3R8FA 1IZ7A 1WHSB 3E9YA 3T7KA 2HY7A 4L07A 4WGFA 5ALXA 3TR0A 2ZCJA 2A1IA 4EI9A 2O2GA 4NNOA 4CR8A 4BQNA 5I7HA 4IMPA 1AQ6A 5EQDA 4XM2A 5DCUA 3R7BA 3UZUA 1EM8B 1W8DA 2DTEA 1C7IA 4G67A 3CIFA 4RPLA 4TXHA 1CY0A 1NXOA 2XD9A 2P9EA 4IICA 2M6LA 3BB4A 1I13A 3IDZA 3F97A 4ZQIA 3TLEA 3GRPA 2I4TA 1NNUA 3QKRB 1M6XA 4JI8C 1NI4A 1ZD9A 3QU9A 3A11A 5L4LA 1AO0A 4R54A 2ATIA 1LEHA 2TMDA 3N2GA 4J7AA 3OE4A 5CVUA 3BXEA 5TSDA 3I9LA 3NDRA 2CNBA 4L74A 3DXZA 2IZ5A 1X7WB 2NSHA 4IOKA 4RAOA 3MK31 2PSJA 1BDHA 4UHCA 4DM7A 3GJ4A 2AGVA 4EG3A 1XE3A 1YB4A 5I47A 3FM9A 1GN9A 3C6QA 3TYXA 3EBPA 4ROTA 1T26A 4BLOA 4D4GA 1GZ4A 1TTQB 1PW7A 2W0MA 4MPDA 1KKUA 2PIAA 3K20A 3T15A 4C4XA 1TJ5A 5A5GA 3ABIA 4G0OA 3CCFA 3QENA 2GRJA 4C2UA 4X63A 4HVAA 4HVTA 2O7NA 1MZPA 3IR7A 3DTNA 1F4VA 3I28A 2XB6A 2KZFA 3M81A 3PL5A 4FE4A 4LY0A 4N65A 5F4BA 4YV2A 5LNK6 1AGYA 2LDBA 5E2IA 3K5WA 4S1VA 3TRJA 4OB7A 1YOBA 4PQGA 3T3NA 1EK5A 1RAEA 3AMVA 3K0AB 2E0IA 4ZHQB 4FDVA 1FJXA 1NBHA 1F9EA 1XFAA 1T4BA 4DSUA 2RGEA 1DBRA 2ATCA 4I55B 5CRIA 4EUHA 4M9SA 1QUEA 1RYDA 2BKVA 4YCNA 2WOJA 4CM4B 1BGXT 2WHPB 3OE7A 4L72A 4M0EA 5C35A 4X60A 1P5ZB 3T7IA 3G6WA 1LC3A 2CNWA 2WWTA 3FYUB 4IUYA 4TMWA 4Y6RA 1U0EA 4YUVA 4MRMB 3TI7A 1CDDA 4FPXA 5F5XA 2CWDA 3KAPA 2RGUA 4Z9XA 1YAHA 1SIBE 3ORYA 1XELA 2JGRA 4PNZA 2DQ4A 3MWDA 2YXNA 5EYPA 1VCHA 4EUEA 1KS9A 2Q8PA 4HWGA 5FHQA 1GLGA 4C0HA 1OXMA 4KQHA 2H57A 2WU8A 3RRJA 1XI2A 5EJ7A 3PVSA 1IXYA 1AKEA 2Q3LA 4CFSA 1ESEA 4MWZA 2I6XA 1RT9A 3G5UA 2R751 1M1NB 2I6GA 4V0LA 3TQFA 2R7NA 4AF8A 1KO7A 3N0VA 3O0TA 1SUCA 5AJZA 1DJPA 4BE7B 1WNFA 5HPYB 1KOGA 4YP9A 2DFNA 4MR7A 1C3XA 5EWLA 5H81A 3UJCA 2VXYA 3O8QB 3PB3A 5F2OA 2ZRPA 2GK3A 3G2PA 3VKWA 1V6SA 1DFHA 2W48A 3ZIAD 3Q6MA 4WKBA 1TVKB 1Z4MA 1KTIA 1NV8A 4UBIA 3DAGA 3CZAA 4UBMA 4QOFA 1YNOA 3ZWPA 3R44A 3T1QA 3A7DA 4LMRA 4NZZA 4IZ6A 1GAWA 2AIRA 4JLVA 4HDCA 3DBVO 2B5WA 4BX0A 5JU6A 4N82A 4PLVA 5FWXB 1C7EA 3H5NA 5FPPA 3A26A 1I4WA 3SJZA 3JVEA 3ZJ5A 4DHEA 4E2XA 5ARDA 2OG2A 4CEHB 4R1TA 2CD7A 1QIHA 2GTIA 1C8KA 1Y5LA 3AI1A 5D87A 3ZLTA 3DH0A 4XYEA 4RPHA 5GZ6A 5LMCA 3UTCA 5JD3A 4UM7A 1EFAA 1F4LA 2LXNA 3EZ6A 3C3AA 3UB4A 2W6MA 1BVYF 4Y7DA 4RE5A 1DIGA 2CNKA 4O02B 3C6XA 4EUSA 1XL1A 2C92A 4D9EA 4ODJA 5LQCA 2FVYA 1G3QA 2JAWA 2W2TA 3MLAA 1T2EA 4TLLB 4D5GA 3INRA 2QUZA 2YIJA 3IKMB 1K0RA 2NCLA 3DE0X 3IBCA 2D2FA 4QGGA 5DM1A 1NWHA 3DEHA 3D02A 1CPYA 4Y2QA 1YR2A 5TRTA 4GMKA 1OAOA 3STVA 3LP6A 4Q4AB 3U3XA 3G7SA 4II2A 1N92A 2A9OA 3E7PA 5DYTA 4CGYA 4HTAA 2QYSA 1M2WA 3SLRA 3SMVA 5BR8B 1D2EA 1LKZA 1P1KA 1GU1A 1TRHA 3I9V6 3KXLA 3M5WA 3TIXB 3WK5A 4AW9A 2UUCC 4NQZA 3KTDA 4A6XA 4C0WA 2QE7A 3L6EA 4OB8A 1TYBE 4MDHA 3GLFA 3UWMA 3MWGA 3DDUA 1U0BB 4O4JB 3HRHA 3S2EA 1V37A 1FVOA 3HWWA 4BFXA 2AG6A 2ZTVA 1E9CA 3OJLA 3R09A 3I8XA 3DMHA 4FKZA 5JCPA 4CMKA 1G19A 2FRDA 3PUWA 4CFZA 4W9NC 1DAHA 2IYQA 2Q2OA 3H5LA 1U3WA 2WSMA 2YJ5A 2HB6A 3QQ5A 4Z4HA 1F0PA 2PMCA 1UJ4A 4XDHA 5EQTA 3THWB 1QGUB 1E2DA 1GCOA 2BFNA 1S2GA 3EK2A 3KLOA 4MKRA 4PZZA 2VSYA 4URYR 1U8TA 1DRKA 1J25A 3EOBI 4FWTA 5DNWA 3GKUA 3ZDDA 1Q5PA 3B3FA 2GKGA 3WV5A 5KNCD 2GN1A 3FTDA 3BA1A 4UNPA 1XVVA 2YNMC 5LPNA 4G65A 5EPUA 1VIAA 2X3UA 1Z5PA 2VKQA 1UM9A 1JIIA 3JQDA 5EMMA 5H7XA 5LLDA 1QB7A 1YWGO 3WGOA 3GBSA 2GKOA 1VJ5A 3N7AA 1JF8A 4IDOA 3AETA 3ODPA 4DR5B 1DARA 5AW2A 1MHTA 1Z2DA 3O94A 3PRJA 1XMOC 2IZZA 4U5YD 3DE7X 2O07A 2X3YA 3LUPA 1OX4A 5DT9A 4E7PA 1K6IA 1SBZA 5FNVA 2PPLA 2O05A 2PT6A 3VU9B 1B1CA 1F2UB 1H0SA 1KDVA 1JFLA 1Z4LA 1ZRHA 3QNUA 5E0OA 4CMHA 3MMSA 1FMTA 5AJYA 1YFZA 3FLAA 2VDNB 3KB8A 5G02A 2AD5A 1AF7A 3LLMA 4CM6A 4LF7B 1JS1X 1J97A 3IA2A 1AXGA 3H8SA 4YA6A 1UPCA 2ZG6A 1NJ2A 4DQVA 6REQA 1Q17A 3SQDA 5D8DA 3E15A 1CZRA 1Z75A 2MSLA 3LPNA 3Q5EA 1Q1AA 3P0FA 3EJ6A 5GTDA 1KNQA 4HWSA 5TS3A 4BVEA 4YPFA 2AC2A 4JL5A 4L0MA 3TX6A 4BVJA 4JVOA 4K26A 4HNGA 3DEJA 4FJ1A 4W9MC 1DXOA 1EE9A 4IQ0A 3IEMA 5LM3A 2V7GA 5EKTA 3BWBA 3LK7A 1LX6A 1Y1TA 3U3JA 2NUAA 3CQ1A 1ES9A 1L7PA 4BVKA 3DAYA 3STUA 3U13A 2JAOA 3T1HC 3GO4A 1H2YA 3HL0A 3UW1A 4DJJA 1V9LA 3AK4A 4PLHA 2BFMA 2J08A 1GP2A 5K3OA 2INGX 3G0OA 4N6OA 1WXHA 1YBMA 1X1EA 1EHYA 3IC5A 1E59A 2Q5HA 2O8NA 3BWVA 3WNDA 2JBWA 2GLUA 1SA0A 2O3QA 4J2HA 2JZCA 1PG5A 3H4MA 4NLLA 4P38A 3WOHA 3F5FA 2UDPA 2X58A 1CVLA 3DOEA 1SRRA 4GU5A 5F23A 4OLBA 5F9MA 1QYXA 1IG0A 4OM8A 3W7VA 4F97A 4NOLA 2E8FA 3DM5A 1FUEA 4P1ZA 2PUFA 5JPDA 1UZUA 2CZQA 1EX7A 1I4TD 1QS0A 5EAIA 3NYIA 5KBYA 1SOWA 5EZSA 2AVNA 4TVSA 4AJPA 5AOVA 3OEED 5DTMA 1OXTA 4DKXA 1NPDA 3O1IC 2HT6A 3MTIA 4BWFB 1IBLB 1X74A 2BLLA 1DDOA 1MJGA 1SUSA 3CW8X 1T1RA 1TYZA 1TYEB 1RJWA 2IYXA 1KR2A 3U6KA 3H65A 3AVYA 2VLIA 4BMXA 1KKGA 2GZ1A 2VH5R 1MRSA 3PPIA 4YLYA 2XXJA 5BSFA 1ZPDA 3FKSD 2O1SA 2X5JO 1XKLA 2G5GX 2PAAA 4G89A 3U09A 3LQ2A 1F1BA 1UJCA 2OPLB 3SKVA 2HMSA 1F2DA 5IJAA 3HKDA 5I51A 2PGAA 4MARA 3EVNA 4Q3OA 1E2GA 1OPXA 1UKEA 2W37A 5TE9A 4BLWA 3H7IA 1OLOA 2B2XA 2GZHA 3DO5A 4O6VA 3NDJA 3TKYA 4PICA 2AQKA 4D3SA 2Z3ZA 1IATA 4F86A 1FVFA 3EUWA 4II3A 3DAFA 1HR0C 3VXKA 2B4TO 4L5JA 4ZDIA 2WFAA 5T67A 3RT9A 1Z6PA 4UTRA 4IJ5A 3AVTA 5JNLA 3FROA 1HQKA 4KRGA 4R2IA 5G0VA 1O58A 1A2OA 2C88A 5EEHA 4PN3A 2FV8A 3HVRA 1CQWA 3IMGA 4XGRA 4QJ5A 3EAFA 4TN1A 4X92A 2M6KA 1W5FA 3FI9A 2Z83A 2C8JA 3HFRA 3IAS6 1KVQA 4TRRA 1WMAA 2Y67A 2YFQA 4YRJA 1AKQA 3WBJA 4J90A 1MXHA 1TUIA 1EA5A 2Z8XA 3IV7A 3GFQA 4K9DA 2HHAA 5LJLA 1FXWF 4MKHA 4QYXA 5HJ2A 4GKKB 1CX9B 1HBJA 1E4OA 2H5IA 1NJSA 2CB9A 4O4IF 2WI8A 4CKEB 4JH0A 2NNWB 1U7OA 2JIRA 2WOOA 4BE9A 4FCTA 2YICA 4AC9A 3GQBB 1W2WB 2C42A 2JI9A 2BFFA 3VYSB 1EUCB 2HLDD 4M7WA 2UVPA 2J0VA 4FSXA 2QAIA 1ELOA 1D2AA 4AQ7A 2AV6A 3JRXA 1WOMA 2WWWA 4LGCA 2H2AA 5AE3A 4DLAA 5IMBA 5I9NA 1AM4D 4JELA 1Y8AA 1HTBA 2JGDA 2XOKD 2ZU6A 3LYUA 4CQMA 4P82A 1NQ5A 4EHIA 5BMVB 3PUKA 3KOOA 1T9CA 3MN1A 1ZMTA 2C03A 5IT0A 1CUDA 3VSEA 1UWCA 3AB8A 1G6OA 3UHPA 1E3MA 3DKPA 2I0FA 1KP9A 2Q07A 1EJ0A 2Y66A 2HLNA 1QFSA 4MUNA 5IUNC 2J1LA 2QVZX 1YRWA 5CJPA 2I6SA 3SIWA 3UTDA 3PNVA 5FBVB 3KJHA 1HE4A 1T3TA 2XGMA 2YZ7A 5KYUA 3UUEA 3WGMA 1O8CA 1N78A 3PEFA 4H6VA 2QRGA 2ZIXA 1SHTX 3UA3A 5GIPE 4B3RB 3NDBB 5FIUA 4KE8A 1IXSB 1MF7A 1YR8A 1EMDA 2P4UA 3D6UA 2V7QD 3RCBA 3RVBA 3V8VA 1XMQB 1RJ9B 1T5LA 1T2CA 2V58A 2ZIGA 4Y1RA 1QV6A 3DMTA 5DSXA 1WWKA 4IGIA 4E4TA 4XOUA 2VP6A 2XTAA 4B3TB 4TSRA 1S96A 4AZ3A 4H17A 1KEKA 1HY3A 1S2DA 1E2MA 5K8IA 3ERCA 1G2PA 1FDVA 3NGMA 2E87A 1PNQA 2PGJA 4KHZA 5IDXA 3I1FA 5EPEA 4JMPA 2FXIA 3SVTA 1CLUA 4K7JA 2O8CB 2RKWA 3BD8A 3HB9A 4B0OA 1ZOLA 2ZBVA 3PK0A 1IWBB 1A9XA 4HS4A 4AB1A 4UNIA 4KLAA 1OU0A 4M0LA 1Z5VA 5EWJA 2VL7A 3A6JA 4LHYA 3JR3A 2TMGA 3CWZA 1XDSA 5ADVA 1V26A 1SC3A 5DYNA 2VHEA 1NULA 3ZXYA 1E4EB 1V1JA 4DUPA 3BK2A 2J3DA 4IJVA 5K0ZA 3NFRA 2PH1A 3IV6A 5I4IA 1ULSA 2VBGA 4KUHA 1P80A 4MUKA 1N33B 2VG8A 2XZDA 1V4VA 1KTVA 3FIUA 2ZAYA 1CF2O 8GPBA 4UNQA 3ZE2B 1QVAA 5AE2A 4HNAB 3DBRB 4TT3D 3U4QA 4P7JA 2G80A 1F1JA 3TEJA 2FPLA 4FNOA 5TQ0B 2VK4A 1CY2A 2CD9A 3DDSA 4J0JA 2B4AA 4XW2A 5HIMA 3SSAA 4BFTA 1B14A 4ZI7A 4KVAA 1LLUA 3DAPA 2QU8A 1DJMA 3R7FA 2BI8A 1Y4AE 4E09A 4RX1A 4BTEA 4KBYA 2HLPA 4UCFA 3H8VA 2JLZA 3C3CA 3O7WA 3FWNA 3TMAA 3I1YA 4U1RA 3ZW9A 1QH8A 4CIBA 2E5LC 1JA1A 4BNDB 1P4AA 4PCLA 5BW6B 2BYTA 4NMHA 5FNZA 1MOQA 1YQ9A 3DSRA 4WNAB 1ZNQO 5EUBA 2AFIB 3FFWA 4CKWB 4OJNA 5IASA 1GN8A 2MYNA 3S8YA 3E7DA 1GGEA 4UBJA 3AJ8A 1NDUA 5F12A 4MI3A 4GDFA 1NWCA 4C89A 2R8EA 1BX3A 2OT3B 3C8UA 4JL8A 3UG7A 2RD2A 5ALEA 1J8QA 2BIFA 2KM1A 3AB3A 1V39A 3GB9A 4KV9A 4TLBA 3MMZA 4MVJD 3RC8A 1NVMB 2CLKB 3AY3A 4RGYA 1SVKA 2AX3A 4OHZA 4B31A 3TQTA 1VSVA 4PCUA 4P4LA 1QR2A 2XW6A 3GAZA 5FUYA 4A6DA 4M0CA 2UUPA 4G1MB 4XYMA 2XNKA 2WW8A 5CUQA 4DDMA 4TZ0A 2QMEA 4A8JB 4EKNB 1FMJA 1NJGA 3B12A 2MSNA 4MYHA 2J5XA 3T0IA 2VTVA 4U4AA 2COEA 1OGIA 4RTKA 3IPYA 4FW9A 4HGYA 5FYQA 5K2MA 4EO4A 4ZYWA 3ESYA 3BFKA 4C08A 1BYUA 3M2TA 5JS1A 1QIJA 3LVBA 3P2IA 4BQEA 4MUXA 1A82A 1H2WA 2WD8A 2BTQB 3ELDA 1MXBA 1OOEA 1U3VA 1US8A 3L4EA 1YI1A 3I9KA 3QF4A 3E58A 5DTIA 3ZZNA 3IT1A 2RJ3A 2V6IA 3HN7A 3KHTA 2W6ZA 3OX4A 4QWWA 2GBFA 2WIGA 1X1QA 4YCDA 3JD4A 1O90A 3L40A 5AP9A 1D0IA 3E9ZA 3B53X 3TZBA 4EKGA 5C1IA 2AJBA 2WE7A 4JD5A 1MBZA 1V2GA 1XYVA 2VDPB 5J9FA 3GZNB 2QMZA 3ZWWA 2HRZA 5AVYA 2V7EA 3NHFA 5DE3A 2DG2A 1FFXA 3SIXA 1QRAA 2M32A 4GGOA 1TKRA 5H68A 3OLCX 4JOQA 1U3CA 1FYFA 2RI6A 2W93A 1E9DA 3A27A 3CRZA 5CZXA 1NW8A 3CLUD 3HB0A 3LBHA 2O7SA 3OX3A 2ACKA 4S3MA 4WWHA 4ZD6A 3WYGA 3FUXA 3PEUA 3O4FA 3VOSA 4YX9A 2IHUA 3ELWA 2JHFA 1A69A 1OGJA 4DXDA 5H9WA 3NAGA 3VJLA 3OFND 1TU4A 4RFLA 1XUOA 1IHOA 2SECE 3GQVA 4DR2B 4GBGA 3A0UA 3VVCA 4IIVA 3WQHA 1GV1A 3KU1A 1JKFA 2HR1A 1V16B 2YZKA 1M1YA 3AR4A 3FCOA 3JD1A 1HT2E 1YCHA 3KZNA 2EOAA 3R77A 4J0KA 4NWIA 1C2TA 2YH2A 3MBIA 4FHDA 4CN9A 1JV2B 4JYMA 4YUWA 5JDIC 5KX5B 1Y5RA 2H1FA 3FPCA 2JK1A 4H3VA 3TKLA 1E6MA 1SC1A 2AZDA 3ZV5A 3QFRA 5BWOA 1T3GA 2JIQA 2QPTA 2Y1OA 3LIIA 3B1VA 2H4HA 3AGQA 3LS2A 1XL0A 1OI7A 2QGNA 5AK0A 2ISCA 4RM3A 3RVSA 3UMFA 3ZQ4A 1PJCA 2PFSA 2HYIC 4C5BA 4OMDA 4A0GA 3SM3A 2CK3D 3LOPA 3KQUA 2B21A 2JGEA 5EGNA 3QWFA 2Q1TA 2WP0C 1Y6RA 3ORFA 4Z0TA 1T1JA 3ENKA 3GLHB 1OZFA 2YXEA 2IYUA 1CR4A 3F0TA 3ROFA 1N34C 1ZI9A 4MTLA 1CIVA 3K31A 3MRXA 1M7BA 2QN2A 2C4NA 1DQPA 1TM1E 7AT1A 2QQGA 4F9EA 4U0JA 5GP1A 3NHLA 3HCOA 4CYMA 5JI3E 1U0GA 1MJHA 2HK7A 1E1CB 2RI1A 4PFKA 3ESAA 4YGYA 5BV8A 3EXHC 4YP1A 1QTIA 4J6EA 2QTNA 4WHMA 4JUCA 2P6RA 1JEEA 3BF7A 3ASUA 4HF7A 4P33A 5CT9A 2OCGA 3CZMA 4EW6A 5LNK1 4WX2B 4RZUA 4UHFA 4OX9Y 2D2IA 3AVWA 3PJRA 1VIMA 1OXKB 3K4QA 1KO8A 4LJSA 3LA6A 4QTTB 1PG2A 1CY4A 4QUBA 5DH9A 5EY5B 1Z7EA 3CEPB 3D7SA 3I9OA 2G63A 4LJ7A 4Z4QA 1WXWA 3DDOA 1VL8A 5AOAA 4QOIA 4BFZA 4LBWA 4EGSA 5K0JA 2UYCA 2I76A 1LLCA 4JM1A 1I32A 4PHTA 4FE7A 1UJMA 5JNUA 2IHNA 2C7OA 4IUCS 3PXDA 2O52A 2W6IA 3LBNA 3WIVA 3GCZA 1GG5A 4DSZA 4G9EA 3F7OA 1SGWA 4CUKA 4BX2A 2OOSA 1SUPA 1DCMA 4E4YA 4QOSA 3PEYA 1QHHB 3CNLA 2D5LA 2PAFA 1Y3HA 1IUNA 4NU0A 1QGDA 4Q1AA 1TQHA 2Q21A 3M6WA 1WULS 4FEGA 1RVDA 3UAYA 2P2GA 1QFMA 3GJYA 4YS6A 3LL4A 3O74A 4C0XA 1P8AA 2NXNA 3I42A 1Y89A 5CDTA 5IEJA 2HO4A 2FU5C 1Y9JA 1I1QB 4EB3A 5TARA 3BRWA 3W2GA 4HBGA 3AFOA 2GN9A 3T7TA 4KWTA 3BAZA 1LD3A 4PXAA 1BE1A 4P0TA 3WQRA 4HAUA 4O25A 1I24A 3IQFA 4WA8A 1N1EA 4HAYA 1GA4A 1K6EA 1P7VA 3B9PA 5DHPA 4DA6A 4Q9DA 4TKVA 1B16A 1IM2A 2R6AA 2FEMA 2X1MA 3E8SA 3JZIA 3K9CA 1NW4A 3HDQA 3Q87B 4HH1A 4P4UA 4N5DA 4FYMA 3ZJ4A 2KHZA 2AMJA 2AHRA 4K6HA 5K4AA 4QBKA 3JSAA 4B3SC 3WO0A 1GVHA 4OYCA 1UK9A 4JGIA 3OIYA 1G21A 3PX7A 5AI9A 1QFJA 1X87A 3UT5B 5D6NA 2FFAA 4AAYA 4TKUB 1IHUA 2VHYA 4NU6A 5A7HA 1FX0A 1ZU4A 5BNZA 4HRAA 4V1CB 1F20A 2ZRIA 4AI6A 3IP1A 1B0UA 2ZJ1A 4OHRA 3UH1A 3VFDA 1V60A 4PSDA 4BLPA 5M29A 3WXMA 1H1TA 4TXJA 3T35A 1Z07A 1RMTA 2CUKA 3ANSA 4TTVA 1KBOA 1W1WA 3NOOA 2X7JA 2ZM6B 3GRCA 1SXJB 3OX2A 1XLWA 2OCDA 4FZRA 3HR8A 4MR8A 3SE7A 4CQLB 4W5RA 1T2DA 2EWMA 3MCUA 5LSAA 1V9CA 4K0RA 4EB6B 1TFRA 4R2WA 1FU4A 2CUZA 4B3CA 2ZPAA 1SJ9A 3L93A 4GG1A 4DT1B 2HU8A 4DCTA 3I9V1 1C3OB 4EZBA 3EDYA 1FP4B 2QTFA 1GNLA 3R76A 3VYVA 2VYVA 4S2UA 1RC8A 1W581 1VKJA 1BOFA 5JSKA 3W9SA 3E9NA 1EA7A 1KI9A 1VSQA 3WAGA 2QYTA 4JS0A 5CG1A 1WIWA 4IZHA 3H97A 4LMBA 4QNRA 3L8CA 1NIJA 1U8EA 4KHPB 3L05A 1CU1A 4C0SA 3WBBA 1PEDA 2OENG 3K09C 2O8DA 1FRFS 2QX6A 5FBLB 2GPSA 4AJ4A 3SO4A 1PWXA 4JWKA 4TKZA 4EF5A 5EIEA 2CBGA 1EGQA 3H86A 3VPDA 3MGGA 3I3OA 4DARA 4R7GA 3FW1A 5LZ2A 1Z5NA 4KWHA 2PT5A 3R8XA 3HGMA 3T95A 4ZALA 3VTZA 4JT4A 4BB6A 4FNAA 1BXKA 5DBEX 3FMIA 1IY0A 4CTKA 3E6AA 5T4FA 5BRAA 3HVIA 3IAUA 3NIFB 4Z5XA 4I6JA 2DM6A 3R40A 2BRUC 5AXBA 1GZHB 1RXWA 4HDNB 2RGGA 4KRYA 2O2YA 3N58A 4EB8A 3DT8A 4NXMC 1L1RA 2PVCA 1JGTA 1M8FA 3MWJA 5A2GA 5LMZA 1TB4A 2C83A 4Q4HA 2PZGA 4ZA2A 1T1IA 3GELA 4BVBA 2OKCA 4D98A 1NFRA 4PGGA 4UHHA 1Z0IA 3F9CA 4RLFA 1NW5A 1U3DA 1OLUA 4GMXA 4LYYA 5FI1B 4UEJA 5LVAA 3GLIB 3WMRA 3ND5A 1R3UA 1WXFA 1YRLA 2H17A 3X44A 4OYRA 3LRTA 5DYWA 1Y5NA 4EI2A 3MCTA 2WKWA 4RL6A 3DOCA 3KUXA 5AW8A 3KZOA 3KVYA 1WSWA 1A7AA 1M7HA 4WJKB 3SNHA 5TPZA 3SQOA 3BBLA 3CZPA 2WAXA 4JLBA 4ZO6A 3FMGA 4FGWA 2Q2VA 5T4HA 3FHJA 1IEQA 1NXWA 3IP8A 2VFAA 2MJLA 2BL4A 2JHPA 2BCGY 5J1TB 1I2MA 3N2ZB 3PC6A 3ZJUA 4PBTA 1JWAB 1C9YA 4ZEXA 1HE1C 2HIMA 3V97A 1H4SA 2Z04A 2BWJA 3HKBA 4Q4JB 5AW9A 4FGZA 1TYAE 3N2EA 3O7MA 4ZCQA 3FYHA 3V7YA 5T4BA 4DV5B 4YASA 1TA4A 2CVOA 4YT4A 3LF2A 3RS9A 3KNZA 1QFYA 3ZI7A 4I50B 3EPKA 4NMLA 3REQA 1T0HB 3WLHA 3IKLA 1FXWA 4B9EA 1D2MA 2CLEB 5IEBA 3TLMA 2H4JA 4LRQA 4O4IA 3C1TA 1D3AA 3WNBA 3ACDA 4ERNA 5JFGA 1CC1S 3LO5A 4V0OA 5H83A 1MN6A 3PGJA 3GROA 4QBHA 3IERA 1E0AA 2OXEA 4FJ2A 4DDWA 5CBPB 2JJ1D 1JALA 1KDRA 3P5BA 4XRGA 4KR6A 1CHNA 1P6XA 1RYNA 2RE8A 4L4ZA 1T9GS 2E5WA 4WLNA 1YASA 3MOGA 4FWBA 1X0VA 1LZKA 1W4RA 1EINA 1HUQA 2G17A 2GFIA 2WYHA 3D3KA 3PBKA 4PLYA 4KAAA 1RBQA 2JAXA 3EH1A 3KT8A 4JV5C 2V59A 1D0VA 2DUJA 1BRMA 2OBLA 5HGJA 1LPSA 2PZAA 3O3OB 1O6GA 4RY9A 1X7GA 2I3DA 3GLUA 4EABA 2QAGC 4E03A 4F12A 2A33A 4QUJA 4X1YA 1DEKA 2HLHA 1QO9A 4YJ2A 2E6KA 2Y0BA 5KJFA 2W2LD 1MRNA 4DFDA 4EI7A 4DSAA 1UMBB 2N0SA 1QMPA 4I99A 2E85A 4CKBA 1BJRE 4B74A 3QZUA 5B4VA 1F17A 4TTJA 5E9JA 2QMOA 4PG6A 4Z2YA 2C4WA 5H82A 1WW2A 4I9NA 3SEQA 4DMGA 3W3AA 3Q41A 5AHRA 3SDSA 2B0JA 3KS9A 4D56A 2R62A 3ZGLA 1P2GA 1T8YA 4EY8A 1GZ3A 1HZZC 1KRXA 3AT1A 1I6MA 3RTEA 3RS8A 3I5XA 2ZJFA 5K8JB 5DEIA 2RH9B 3ORQA 5DGCA 1YVDA 5C4GB 5B7GA 1E4VA 1GITA 1O96A 3HA7A 4GKJC 3PS9A 5IVPA 1E6UA 1N2JA 4NFHA 5ED0A 4UUMA 2YV5A 2Z95A 3C6YA 1JDNA 1RWQA 3C41J 2DHQA 4NBUA 1D6NA 5DXFA 2G9UA 3FJOA 3R3JA 2Z2IA 1QE3A 3H42B 1V8PA 2AR9A 4RC9A 2BMWA 1X1SA 2NYVA 2PRJA 3LHIA 3TGPA 4KQ9A 3RHSA 3TDNA 1NIPA 2LZ0A 4OHBA 3RYTC 1OH6A 3CU5A 1OE0A 4EHJA 1NX6A 1T13A 3MILA 5ENDA 2JJ8A 3MJTA 3HYCA 3HJTA 3B78A 1WDWB 2VF7A 1E3TA 3QUAA 1RHKA 4YRDA 3ROPA 2Q5LA 3A8TA 2HUNA 2FYTA 3LNTA 1HT1E 1I2CA 1XU9A 3OJXA 1NRIA 3QK7A 4LHXA 4DCJA 2IDMA 4MPJA 2FSIA 5D86A 1ISFA 1WV0A 1T3SA 1LQUA 2C00A 4AKSA 1YDEA 5ETJA 3OF3A 1X0XA 3BPSA 4ARZB 1XZDA 1B2LA 4V24A 4LZNA 2YQZA 3CZQA 4R2JA 1CUXA 3PNLA 4KO3S 5C3UA 2J7PD 1TM3E 5JC8A 4WERA 4GVXA 2YFKA 1GPYA 1YRHA 4FHZA 4CCWA 3ZNQA 3H5WA 5ELXA 2ATEA 2NGRA 3VPCA 4XR9A 2NUPA 4W99A 5JWHA 1LJLA 1VI6A 2OB1A 1ENOA 4LTMA 1L7BA 2KPOA 3TFWA 2AUTA 2ZJ3A 4IXDA 3BSSA 1ZGGA 4L0CA 3Q3VA 4NMMA 2X1HA 3QXHA 1ZK4A 3BJMA 1V8ZA 1BWRA 1QHNA 1QHGA 4L5BA 4Q3DA 1NVKA 2WV7A 4GWLA 2LCFA 4P6VF 4RAQA 1UP4A 3JALB 3WL6A 2PGNA 1XN4A 2AN4A 4NK4A 2AT1A 1OILA 2II6A 3FAKA 4BWGA 5L3QB 2N46A 1N7HA 1T1EA 1DIAA 4D0GA 3EQ8A 4ZVPA 1FP1D 1K89A 1ZN7A 3HI6A 1JQEA 4MYRA 1N57A 4MV1A 4GIBA 1ZUHA 2JDIA 4MS4A 4Q1CA 3QNWA 4FMBB 2EJWA 3OI7A 4PX9A 4QJBA 4FYWA 4KXUA 1ZGJA 3RSLA 4KH1A 1ZWKA 2Q49A 3N0TA 3VTFA 1Z5OA 1E0JA 3D6VA 3I0ZA 1X3LA 1YDWA 1W46A 1K3FA 3J81A 2PX0A 3HXTA 2I34A 1OIXA 4RJIA 4MVJM 2YRWA 4A26A 2VHCA 1I2AA 1KOJA 3THXA 3HSSA 2UYQA 5DBOA 1X94A 3FOBA 4BNIA 5L3SA 2ZM5A 1V5FA 2QRUA 3K9BA 3MPUA 3U4CA 4J0GA 1WHTB 2KX7A 4R3WA 4UEWA 4PLZA 1FK8A 3AUYA 3BMNA 3I45A 4WXYB 5T8KC 1K8XB 3VZQA 4ENSA 2VDJA 3AHCA 2A88A 3Q8MA 1NG1A 3PZRA 1YTUA 1ZXLA 4LHZA 1KMIY 3HCFA 2PGXA 4BEBA 2LW7A 4ZANA 3X3HA 3DC7A 3VPBA 1UF9A 3G9QA 4EX6A 2I3ZA 4DV3C 4GLFA 4IWYA 3SU8A 4B5LA 1MEEA 4BFWA 4C7KA 1QM4A 2YHIB 4PHCA 1J2RA 2JLQA 2R79A 3FOWA 1RRKA 1OT5A 2RKBA 1N2OA 3BHMA 4L4XA 1SZJG 2EW8A 4ZZ2A 2R6FA 4UE3S 1KKLA 2P3OA 1H2AS 3Q8WA 3ABRB 4F3NA 3LC1O 6LDHA 1ZIPA 4DM3A 4F1KA 3P0IA 2XUAA 4UTXA 2P27A 3GVPA 3W2TA 5C5DA 1DKOA 2FR8C 3BILA 4LVNA 4MJ7A 4PLWA 4JT9A 4UREA 4BNVA 2C04A 1M33A 3CUWA 3V2HA 3R3ZA 4E08A 3A6DA 3C85A 3EZGA 3O9MA 4PSVA 3U2QA 4JLWA 2PV0A 3R9IA 3VDNB 3O9ZA 1IOVA 3G9XA 4YEDA 1W85A 5EL0A 3IR6A 4H27A 3F71A 5HNKA 1BE0A 3M4YA 3ASYA 4OQQA 3TPZA 1JR3A 1L5QA 1DEAA 1NT2A 1ST3A 4B76A 4F4JA 1KFKB 1X1RA 3RO7A 4UBOA 3CCBA 3H13A 2V9CA 3N2KA 1DOAA 1T5DX 2BSXA 4KQ6A 2GEBA 4PFSA 1Y4DE 2FR0A 1JTEA 2QRJA 3G0DA 2Y92A 5CP8A 2JNVA 4WZBA 1QTRA 2IEAA 1EQAA 2FNAA 2RBEA 1KK0A 1RJDA 2J7KA 3GZTB 1H6BA 1H8HD 1VMIA 4HLUA 4YYZA 1AT1A 4M0PA 5IU6A 4V1CI 1NBIA 1UJ6A 4K40A 2AFHE 3R41A 2IE0A 3AVOA 3IIEA 2P9JA 3HJRA 3SVLA 4IOLA 4ZLPA 4L1KA 4UHKA 3S2YA 4MIOA 3IHKA 1QGED 4KB5A 2WZBA 3OZAA 2Z51A 2TMYA 1JIQA 2FW6A 1U65A 1LSJA 1P77A 2WUGA 3R3SA 1FUYB 3QBEA 4G5HA 4PC6A 2V65A 1OHHA 4L76A 2QTAA 1OH5A 3PROC 2FSVA 2NG1A 2YHBA 4HB2A 1E3IA 1YK0A 4HY3A 3WLFA 3D8UA 3H9CA 4IY1A 1EFHA 3WLTA 5T8SA 3RIHA 1KZHA 4CU2A 1A9RA 1MV5A 5IBCA 1YL6A 3E4DA 3VNBA 4G0WA 2VJNA 4C29A 4KO1S 3PRHA 3H4IA 4OBWA 4J1NA 4P3KA 3GRVA 1WS6A 1M9NA 4DRXA 2IU6A 1VA4A 4H7PA 1K7YA 2FMTA 2BFOA 4K6CA 1T5BA 4DWWA 4I1RA 5HKKA 1NOIA 4JI6B 3RWOA 5BQ3A 4HATA 4N03A 4ZT7A 1AZWA 4PO9A 1QANA 3K8OE 4P5DA 5JZSA 3QMPA 2HSZA 4BX3A 3OBIA 3BMOB 3FLEA 1T9KA 2G9ZA 3R9XA 4AU1A 4BO0A 4M87A 1H3EA 2WWFA 2X8JA 3BDVA 2JATA 1EFTA 2ZYDA 2XCOA 4CT0A 1NY8A 1Z7GA 4LF5C 4FSDA 1WTAA 3DMYA 3FXAA 3RYCB 2B1GA 5BN3B 4BO7A 1JVBA 2VJPA 3BTVA 1AUXA 3LC0A 3W5SA 4C2BA 2BFWA 4ZZIA 3ESXA 3AF4A 3K0FB 4CF3A 4MIEA 1L1FA 3KYCA 1G1AA 2EEZA 3K0CA 5KJ1A 2C95A 3H2ZA 2D1SA 2VWPA 3GGSA 4GI1A 4I9HA 4MA4A 1XQYA 3ZI0A 4BCCA 1I2DA 1PLLA 3GP3A 5HUQA 1FDWA 1NC1A 2AI1A 4JU8A 1QQ5A 3BDIA 1TMGE 5KNCH 1TQDA 1TVEA 3EWIA 3INYA 3RHTA 2WG1A 4FCVA 1DQRA 5SZJA 5GZ1A 1MQ9A 1U1CA 1MTZA 2YWDA 4MA5A 1CUBA 1Z36A 2ILVA 4RMIA 5EIBD 2FKAA 1B26A 3LUBA 2BBTA 1U2GC 3QWHA 4IS3A 4K46A 4X1IA 5HFAA 5CCBA 1QDLB 1WSDA 3BIFA 1MQ8B 4AQYC 4IWNA 3WYDA 3O4RA 2DWQA 1HQCA 1UBKS 3DOFA 3DT6A 3KHUA 3LT2A 4RETA 5J2UB 3RDPA 2OK7A 5BQOA 3I6ZA 3F90A 4JLUA 1SOAA 4NAVA 1F14A 4EFLA 2Q2NA 1TPYA 1WY5A 3TR3A 1M0WA 2FCRA 3ILVA 3ZBUA 5EQFA 2XUKA 3EXEB 4IMJB 5TIIA 1DBPA 3AI7A 2A92A 3QOYA 4E5NA 4N5LA 1J0EA 4ZT4A 4RVDA 5L3VA 1L2TA 2RK6A 2XF2A 4EJFA 1SQGA 1XXHB 3P9QA 4M76B 3OPNA 3QQPA 3PGMA 3LNOA 3I9NA 3LUJA 4BO1A 4DQUA 4EMTA 5JZBA 4RULA 1B8PA 4NE2A 4KXMA 4OYYA 4KQXA 4IFTA 4MUEA 2IF2A 3E9QA 2IGTA 2FOLA 3LUKA 4GGMX 4GVPA 4D4MA 2CE2X 1E0DA 4EG4A 4Q4DA 3H3FA 3C4JA 5EWMA 4I7EA 2RCNA 4KQJA 4UHDA 3OOYA 4QGFA 1E7RA 4E5UA 2C7BA 4KYTA 2V55B 4WI1A 1YAJA 4L57A 3OG9A 2M1ZA 4JJ6A 1NBMA 1CUYA 4BUZA 3BXGA 1QCDA 5KDLA 3DOOA 3ABOB 1J1UA 5KIAA 1UP7A 5JHGB 4L51A 1GTRA 1KJ9A 1D4FA 1DIBA 1WQ3A 2XXBA 3AB7A 2O8FB 4CM8B 1A8PA 4Y9UA 3RTAA 3N28A 1J23A 3AJDA 3CF4G 4INPA 4K81B 3HABA 2BEUB 2ZSKA 1I14A 3OOHA 4YDQA 4JLJA 4ZT3A 5GY7A 2O4UX 1V25A 3D6HA 4AJIA 5HE9A 4YCLA 2NV2B 2EZ9A 2ZI7A 4C4OA 5IPFA 4F7DA 3ELYA 1TUGA 2QTBA 4UFNA 5DW0A 3LDHA 4BNYA 4ACAA 4WINA 1U31A 1GU7A 1P9OA 4O2LA 2AOWA 3KV1A 3G2NA 2H9IA 3KHSA 3II6X 5E9WA 4P4GA 1V1RA 2C9MA 1U80A 3CE9A 4M37A 3RUAA 4BIIA 3OTHA 1PWYE 4DGSA 3RKRA 3VKVA 4HPJB 4WY8A 1KVTA 1VMEA 4YK7A 3VU8A 1B23P 2XF8A 2NTYC 3FPAA 3H9UA 3N8KA 2YNMA 2OCXA 3BGSA 2WHYA 5CG2A 4TTPA 1XDUA 4JY7A 3VH2A 5C9ZA 5ADZA 1T36B 3PDHA 4O2AF 2IKSA 2B7BA 3OUTA 4PFJA 4R81A 2GNAA 2XBMA 2IIVA 2HJWA 4FFSA 5JQGB 4C87A 1N2HA 1RLIA 1KGSA 2GT1A 4J7UA 3D1JA 1LDEA 3OUUA 4NCNA 2YMPA 2J9ZB 1RLUA 4IIXA 3AIIA 4BXOA 2CXHA 1BD3A 1TC1A 2PMWB 1XDGA 4YT5A 3RWMB 4GSLA 1YACA 1ZS9A 1ISPA 1G1MA 4IG9A 1XAJA 1YE8A 2D1QA 1WF6A 3GEBA 3NP9A 1I7NA 5GJWC 3ZJVA 4MV4A 3HFSA 3TBKA 4HNUA 5HJ5A 4LJRA 3HU5A 1CE8A 2OQIA 4GUAA 5EESA 3JWGA 4GOJA 3U7QA 1PLJA 1ZVMA 3WP1B 3P5SA 1QWOA 1JR6A 2A0KA 3F8WA 4QVGA 1IN7A 1GO2A 1PK7A 2GBPA 2RGBA 4JHLA 4RZSA 3L01A 3KJNA 3KXIA 1KQFA 5I3CA 4NDNA 1WB6A 1D9XA 3UJ3X 2P2CA 3J7TA 1GAJA 3N0WA 5KDDA 4M4SA 4D9GA 2WWHA 1WABA 3SJUA 1QIMA 1W19A 1V7ZA 3KLBA 3ZCRA 3G8BA 3RSCA 4C4PA 1H42A 4ZVTA 4OQLA 1RHMA 4KH0A 3E05A 4DMMA 1VKZA 2NV6A 3KQVA 4BNFA 3IOYA 1QLHA 4XVHA 3WHIA 2R6DA 1BMQA 1ONSA 4FS8A 4K8OA 3W3ZB 3DYVA 1Y5MA 3GAFA 1FRNA 4YAUA 3F5QA 3EGDB 4GS5A 5JAHA 1MEOA 2FW1A 1DAFA 1GQ2A 4DV6C 1W0JA 2DR0A 6PFKA 1OZAA 5SV2A 2A9VA 2I67A 1L0BA 4BC9A 3BBPA 2A1TR 4RMJA 2F8LA 3ROKA 4CMEA 1HL3A 2CVHA 2PIDA 3PEEA 1U0OC 4WIAA 3S70A 1RQ7A 3VDXA 5DNUA 1DFGA 3OQVA 2IBTA 1KH3A 4XUCA 4E30A 2RB5A 1Z25A 1XVAA 4JWTA 4DC0A 1KHTA 4EG1A 5HZGA 4V0SA 3DFUA 5A1IA 2B30A 2NX2A 3A6EA 3ZWKA 2ZBDA 5CB6A 3NJ8A 5EP4A 2X7HA 1PGQA 3ICWA 4RHXA 4ZHQF 1UFRA 2VF8A 3QFTA 2VA9A 2X76A 4N39A 3HK2A 4JZKA 4KKXB 1CXZA 3NOXA 1AQNA 2ZIEA 1UUFA 3W1VA 3H9GA 3MBKA 3TAUA 2WY2D 4I6GA 3TIFA 4DAEA 3GBVA 1BCRA 1C1HA 5CD1A 1BMDA 2PUCA 2ZIAA 2AMYA 1CJUC 3AYZB 1E5VA 1YE3A 2V6MA 5ER9A 4B83A 4LRXA 4F46A 4RK7A 5ICMA 4EP1A 3BORA 5IUJC 4I81A 3E48A 3L7LA 2XR1A 5A5EA 4QOGA 2RK4A 1A5ZA 3KWLA 5FLYA 3SF8A 1KY3A 4U00A 4ZQFA 4AMBA 2VHJA 1FSFA 5B37A 4M22A 4DUGA 4X7MA 4UBLA 3LTNC 1KY4A 1RWMA 3K1JA 5CCEA 3GGCA 3NWEA 3OJWA 3T3HA 4FC7A 4TWAA 2FEPA 2GKSA 1YHYA 3KKQA 3NVDA 1XK7A 2A2ZA 2DMRA 4G41A 2W6QA 1P75A 3L0IB 4PZYA 5LZ5A 1MFZA 5BVHB 5BR1A 3ZE6A 5J2TF 4MQLA 1F6WA 1NMZA 4Q3CA 2DTXA 3JX9A 4EG6A 1DWUA 2P1ZA 3IV9A 1XAIA 4IV0A 4IHQA 3DOUA 5EA2A 2AUNA 4QYMA 4MUYA 2FFJA 5ENVA 1SN7A 2ISQA 4DG9A 5D7BA 3ESDA 3P71T 3V1MA 1G64A 2BP7B 4DTIA 1VB5A 2H2FA 4U2DA 4Z4GA 1Z2OX 1ZBQA 3UOAB 1ZIDA 1YCDA 1DAPA 3FUUA 1NMYA 4LZZA 4AXXA 4KDEA 5DWVA 1LI5A 1VB3A 2EKLA 2VJBA 4TM7A 5EJFA 5JCZA 4TZ6A 4FJ0A 1ORRA 3RJ5A 5G3YA 1K7XB 1YJAA 4DZTA 4JNKA 1NG9A 1JLLA 1YJ8A 1WQ1R 1T6YA 2PX5A 1E96A 2GA9A 5E4YA 3TTVA 3OQ1A 5AKIA 5AUNB 3MCAA 3QVMA 4JLKA 3VGPA 3QEAZ 1HQDA 1Y4SA 4PNHA 5IAOA 1KYVA 4BZZA 2NYRA 2XY4A 4WOJA 1XJ5A 4NFSA 3UK0A 1AGNA 4BASA 2IOFA 4RGBA 3ZVRA 3QHAA 1V8OA 3HNRA 3MUOA 1IN1A 2YINC 3QU4A 4ZOLB 3NEYA 1ML3A 1MH1A 3FPLA 3NT4A 4REOA 4OQPA 3LZCA 4XCQA 5H3LA 1E2KA 4F5ZA 1IY2A 2SCUA 4KRFA 1LTHR 5JJLA 1N2GA 5M3BA 5DNAA 3WKCA 4C7JA 4I4TB 1H3NA 4X5OA 5IJ9B 4JGBA 1QOQB 4RZQA 1USKA 3ZHVA 3KEFA 4KR9A 3VQTA 1K5DA 4BMSA 1EFPB 4YALA 1LZLA 1CR0A 4MVJH 4Q93A 1ZD8A 4ZEWA 2V9ZA 4RPKA 8ABPA 4Y2YA 1TTHA 2ZS7A 4M1OA 4ZVRA 4A8HA 1KO5A 2P2MA 1HRKA 1NLZA 4IJMA 4EHNA 3HO1A 4U63A 4XX0A 2HHHC 1XTBA 4GPEA 1IH8A 3VR0A 1EFVB 3D7KA 2NSJA 2BJVA 6AT1A 3EASA 1IULA 1TK2A 2FGJA 1MENA 3MSCA 4BKOA 3O2EA 3PRKE 1Z17A 2YL2A 4BV3A 4R84A 3CPEA 3ZDBA 5K5EA 1EU1A 3MAGA 4OHVA 1X86B 3KSUA 1RFGE 2EJTA 3F78A 3FA2A 1PF7E 3DE1X 3KFLA 5F5LA 1SD5A 5FLEX 1X9GA 3NGXA 2BBWA 1NUUA 5I01A 5JT1A 1LI7A 4XQCA 4ZU6X 3IURA 5DTEA 3CLKA 1KSGA 3UCEA 4TRMA 4IL5A 1GSAA 1YQEA 3WSTA 3K2EA 4UAVA 5C5IA 3USES 3GEPA 2HF9A 4U7DA 4ZV7A 2Q99A 3HCRA 3WMFA 2IS6A 1EK2A 1P74A 5C7OO 1VLAA 2WJPA 1W48A 4AJ1A 1L4FA 1SMKA 2PD6A 3TXYA 4A8PA 2B99A 3KKOA 1PKEA 3AEKA 3HZRA 1E2HA 1R6DA 2BJWA 2DWCA 2RC5A 3E2MA 4CCYB 2QZSA 3BT7A 3D4IA 4IDEA 3QPWA 5CDFA 5DXAA 4FYXA 1UK7A 2IBMA 4MIKA 4RCYA 4DMLA 1R15A 4Y2XA 2HD4A 1CUIA 3W5BA 2KI5A 3DZFA 2E4XA 4HXGA 1J5EC 3TQIA 4I4LA 5DBHX 2AMFA 2Z2XA 3TQSA 5IVDA 3TVDA 1QRTA 3EPLA 5JO9A 1XQVA 3LVRE 2PDAA 4CMIA 1M6NA 1BFKA 1DO2A 2W83A 2C2XA 3G9TA 1BTOA 2EJVA 3CFYA 3EGIA 4J0HA 4MWOA 3GA7A 5EZYB 1FLAA 5FBRB 2B3DA 3CLSD 1E79A 4J6FA 1Z6ZA 4CMJA 4WESB 3DE4X 3KDSE 4JQOA 5L4SA 1L4UA 2JF0A 2FUKA 1OTHA 3CSUA 1FTSA 1NMXA 1QE5A 1XCGB 3AR3A 5FOVA 4CEIA 1GILA 1CB7A 1I3CA 4LXQA 1X7ZA 3ASZA 5JNVA 1JXMA 3ZCQA 4BVAA 3QEMB 3T3DA 4X65B 1ZJWA 5AHXA 1C7ZA 2H3EA 2UZ0A 3NO4A 1JEDA 3M6MD 2PE5A 3KPYA 1HKUA 2I2FA 3EVZA 3LKZA 1E3EA 3NBKA 3OE7D 3Q7QA 3U7JA 1AUVA 3OMXA 3SG0A 3UUFA 1CFZA 2IGBA 1IBMB 1LWOA 3ZC3A 2CNWD 2H0QA 4AT1A 5AT1A 4FVTA 1CJCA 4X7BA 3F96A 1EGVB 4F6LA 2HJSA 4LFAC 2WZDA 2G7MC 3IAM6 3L1UA 1KQNA 4BB9A 1QM5A 1GTMA 3ON5A 4KTTE 1A7UA 2BD0A 4NBNA 1EP2B 4PZEA 5K6AA 1GAXA 1P4JA 5JARA 1K97A 3S1SA 3I6IA 1Y1SA 3TDMA 3EPPA 3IJEB 1IBKC 1V8FA 2DBQA 1QAMA 4JROA 5B58T 3UFXA 4H4DA 4TS1A 1JN0A 3GCGA 4YUXA 4LJ4A 3GVHA 4FFBA 4TTAA 4XGQA 1FTQA 4XUGB 2PUGA 2PXAA 2P7HA 4IYRA 1VBFA 2FPGA 1FE8A 1M34A 3PDUA 3OSUA 1RQRA 5DHRA 3WIBA 2CXSA 5JANA 1ACLA 1N1GA 3ZX5A 4US2R 3EZXA 1DAGA 1QCYA 1C3EA 1WNTA 5H1YA 2FTKE 2JGNA 3Q9UA 3PEWA 1LVGA 5DOZA 421PA 4LGVA 3N0RA 3N74A 4D4LA 1DPGA 1JJAA 3HVHA 5NLLA 3CJRA 2IYWA 2YXBA 1M2OA 4ZFNA 3BXZA 5AQEA 5KTYA 4LAFA 1U7HA 4H31A 4DMRA 1YZHA 4AUEA 3QMWA 2QPLA 5TS2A 5HXAA 5I9IA 3HJFA 2JAUA 4UEQA 2PR7A 5EVCA 3KAQA 1U8XX 4A0QA 2CDRA 2P3QA 2Q5QA 1ULBA 3IDFA 3S2SA 4BJHB 3B9BA 5KVSA 2QMYA 4IDFA 5KTKA 3ZR4B 1NRJB 1WCIB 3A1UA 4RVUA 2A0FA 1R8QA 2VDVE 2P65A 4M60A 1N6NA 1RWXA 2A0WA 2AEMA 5EXEA 2HCFA 4B79A 1W36C 5IJWA 5KOHA 4F9TA 3H1GA 4PW0A 4RUKA 3DP7A 2W5UA 3NALA 1XP8A 3M89A 4F4HA 3G17A 1YOVB 1NOKA 3E22B 5CM2Z 4EKYA 4RORA 3ZS8A 4EG0A 3NHAA 1G8PA 4YJGB 3KB2A 4HWKA 3RIEA 3OFSA 5M2QA 3OY2A 4EGCB 1KO1A 1OWNA 1A8SA 4YT2A 1TC2A 3RS0A 3UQZA 2H1OA 4J3JA 4WLEA 3CEHA 3ID6C 2ZDQA 1E6CA 3TUFA 4DR6C 1T9HA 5F77A 5ILOA 1A1VA 1ULZA 4XQ9A 3TW6A 2UXCB 2R00C 4DIFA 4ZC8A 2VRCA 3OY7A 3VISA 1TM4E 2FOIA 2QE7D 3OT1A 1CDEA 4JP2A 4QOHA 4TLMB 2AWNA 1C1DB 1XD9A 2RAFA 3L41A 4RFVA 3L1HA 3MTDA 2P6UA 4H7IA 4I8XA 1RWVA 2QE6A 1T25A 2AA3A 5CAEB 1RYZA 3GAMA 1GTG1 2V0NA 3WKEA 1HK7A 2A59A 2P0AA 5C0OE 3IO3A 4GYWA 5B4UA 3IUEA 1KR5A 2R5NA 5KSOA 2FPIB 3N9IA 2AKEA 2ZKIA 5CR9A 5DCWA 4O8CA 1II9A 1PQUA 3F4LA 3N53A 2NU8A 3UV6A 5AH0A 2JAPA 4HXYA 1IXRC 1LC0A 2XNSA 4HFRA 2ZUFA 1NI3A 2Q3BA 2HSJA 2W6NA 1TU0A 4DV0B 3FPBA 3RRFA 3KJEA 3ROTA 3RRXA 3E9CA 3LMKA 1OH8A 3X1JA 4J03A 1NLUA 2PL5A 4JUIA 4YROA 1O08A 1NYLA 1WW3A 1YZ3A 2I6FA 4G5GA 4RIGA 5G1PA 4HDQB 2DFDA 4JI7B 1RYEA 5LR6A 1VHLA 2QJWA 1PNVA 2WNHA 5AVWA 3GEDA 4AWAA 5BVGB 4DR7B 4MHTA 2NO1A 2MIIA 1UMDB 3C3KA 2JAHA 1A97A 3KKLA 2HA3A 1DO0A 3STHA 2FZGA 1I6LA 2X4GA 3OH8A 3KU4A 1NMSA 4O1IA 2KDNA 1VG0B 2CXNA 2WSYB 1VJCA 1EK1A 4P0PB 3RFFA 1QLWA 1FRZA 4BO6A 1U28A 1H2XA 4MUJA 3T5GA 4EARA 3K9LA 1E5LA 1N3IA 4AJ9A 3ODGA 4LI0A 2HPAA 4P22A 2ZWMA 4ZYUA 1NNLA 2CXTA 2G3YA 1YU6A 4OP2A 3ROMA 4D5EA 1PA4A 4OFZA 1GZDA 1NY5A 3THSA 1LFDB 4CCAA 4FLEA 2GBLC 2HDWA 3AL2A 2WKPA 3DL4A 5LA6F 2W4MA 4AMZA 6NULA 7ADHA 3VPSA 4REQA 5CVCA 1KYTA 4F6RA 4LHSA 1SOUA 2HXGA 1DC3A 2PV7A 2IYSA 2SHKA 2UVQA 3L02A 3H5RA 1ADGA 1CUJA 2OTCA 3HJCA 3PNBA 3PXAA 1J33A 1FTWA 4MPTA 4YJHA 1NN3A 3HL4A 4OK5A 4GZ5A 2PQ6A 3HBNA 1S1CA 4O2AA 3KPWA 1YCFA 2ZCUA 1JDVA 2P90A 3N2GB 4R8KA 3WGJA 1TAQA 1JT2A 3GUZA 3M82A 4XLTA 5HZHA 3Q12A 4QJ4A 4M1KA 3MZ0A 1LLDA 1N9GA 3KEQA 3LKDA 3NTUA 3IT3A 2PUTA 4H7JA 5D3MA 1E7WA 5FOQA 5BP7A 2GARA 3QWAA 3AJEA 3CQ3A 4BCDA 5C8YB 2XZPA 1WHSA 3T5PA 1D4AA 1J8MF 2I1QA 4MUIA 5EE1A 1KC1A 5K0CA 5K51A 3RB8A 4UFPA 1NF3A 2YV1A 1S7GA 4WKCA 2HMAA 3JVDA 3Q9NA 5CT5A 4WCDA 5TEWA 3S6JA 3VX4A 4GPBA 1V1MA 3FFTA 1QONA 4Q15A 1ONNA 3LDGA 3HDTA 1E9EA 4PFQA 4AURA 4QLOA 4EPYA 1E2PA 4PZPA 5F3WB 4KXVA 1WKCA 3D4LA 3NNNA 1SXHA 2C20A 2VTEA 3AM4A 5BRJA 3ZTWA 2OVFA 1BVHA 2XTNA 1TCBA 3A1FA 1UAAA 3TSWA 4X8HA 1WX1A 1GKUB 1FX1A 4QHTA 1P1HA 2APJA 5DLYA 4G86A 3T3OA 5A05A 5K3BA 1P6QA 4C3VA 5ECYA 1BA2A 4H35A 4RY8A 2DUNA 3DWGA 2WYVA 1ULHA 3VHLB 3V1LA 4I1PA 2C98A 4LJKA 1W5SA 4BDTA 3D59A 3MEQA 4KEAA 3U9SA 5EHQA 3F4BA 3W9UA 2IUEA 5IX8A 2XGSA 2UAGA 3AVPA 2IEDA 4EUKA 5LDGA 4YUAA 2Q3DA 4ZMRA 2WSSA 3EB9A 4YRQA 2GZ3A 1XNJA 1X3SA 3H18A 4WFQA 1Z0AA 5CLQA 5IW8A 3PCRB 4C0LA 4YMWA 1GR1A 3L0YA 3GDOA 5EYPB 1S8AA 1K4MA 1P3JA 1T91A 2GM9A 4NPAA 1H4VB 4HLCA 3CVJA 5FOTA 3KAKA 2GERA 1C9EA 2OC4A 1KI8A 1S02A 2D54A 3L49A 2FQ1A 3E4CA 1OD6A 3OQPA 3QJ5A 2ZJOA 5AOCA 4JXJA 4NU8X 4NOJA 3WK6A 1RPJA 3AF1A 3KG2A 4RF2A 1IFXA 4OGFA 3AG5A 1CUSA 3RYFB 3VV3A 3GHYA 1PGJA 3VTAA 3OO1A 2DEUA 4ZHQA 5HUJA 5JH7B 3ZW7A 3TDEA 2ALJA 3BFVA 1ML4A 1V7CA 3FRJA 3HFJA 1K9SA 4MR7B 5DNCA 1BQ4A 4Z9YA 1UDAA 3U7GA 1IM8A 1JHAA 4FIDA 4EYEA 1CZUA 1YZFA 1EUYA 5IFIA 1VMAA 3L1VA 4CM4A 1MUUA 1CRLA 4N5HX 4BP9A 2EERA 3GUCA 3P0HA 4J4BA 3WLNA 1SXIA 1PEKE 3BMQB 4IG4A 4LVOA 1G20A 1S2OA 3EVBA 4LMAA 1NF8A 1C4XA 4K0KB 3K72B 5KKNB 2G77B 3JAWA 3KCNA 4LYHA 1TJYA 2BMAA 4ETNA 2H9YA 2IP1A 5JMWA 4P7BA 4YDRA 1YI0A 3TEFA 1DEXA 2QXTA 5KC9A 3K8ZA 3RF6A 1BGWA 3JZAA 2NPIA 3EIQA 5KX5F 1TZCA 1V3VA 1RC1A 3DLCA 4FMPA 4G1FA 4WADA 4GLLA 3L1JA 3ROZA 3KO8A 2VZ9A 4L9WA 1GA6A 1VE9A 4ZQGA 2OUKA 5COQA 4CQMD 2CHQA 2V1UA 4X95A 4ZAVA 4H3SA 5ILQA 1M1NA 4A0HA 4FGLA 2G5PA 5J2TA 4DA7A 5FWNA 1X8KA 2CMFA 4NIMA 2SICE 5EHZA 2NVUA 3V7NA 5JEDA 5GQSA 5KC8A 3AUJB 2G36A 4R1NA 5JC1A 2ZE8A 4C4RA 1KIFA 3CBQA 2AEEA 3K7EA 4CLEA 4Y2HA 2GSDA 1WKBA 4C3UA 1QQ7A 3NUZA 4QXQA 4NEGA 2PNFA 2YV2A 3ZGYA 1R0BA 2N9UA 4YQYA 3T9FA 3O2JA 1YFKA 2QN9A 3KM0A 2BJOA 3UC5A 1F7VA 5SYAA 3WSWA 3CLRD 4G85A 4R71A 1S3IA 2BOVA 4J0DA 2YY6A 2Q28A 3QSYA 1TAUA 2I4IA 2CYAA 3CRQA 3PQ7A 1U94A 1LV7A 4XD2A 1OY1A 2UZ4A 3T52A 3I5AA 1KFBB 3TCXB 3DVQX 4CLRB 1BEZA 4YHHC 1IE3A 2BONA 2YBDA 3EEIA 2VA8A 4FFOA 4MUAA 4BUCA 5LMNC 4JSRA 2UV8A 5SYMA 3GLFB 5ALOA 4B3DA 4D3DA 1VFPA 5EP3A 4X64C 3BULA 2ZSJA 4N41A 1F8UA 4RZ2A 4BBZA 2E4UA 5LWHA 2VTBA 3ESQA 1CG6A 3C2QA 5JAPA 1J49A 1V11A 2Y1FA 3WQQA 5HQTA 1MVLA 2IS1A 1TJ4A 2R44A 3LVFO 3FBTA 5DMXA 1PFVA 4JJZA 2FMHA 4RIFA 4UPVA 3HLTA 1JZQA 4KN5A 3B3AA 3FFAA 3TB6A 1L7QA 1YRQA 3TSCA 1GKIA 4BVGA 1NKVA 4AULA 2Y05A 3I76A 2WHQA 2PS1A 4B82A 1CK4A 3WFIA 4BC1A 3OQIA 1PR4A 4W63A 1KERA 1RQGA 3HSKA 3PFCA 1USPA 2JCGA 4BFYA 4WCFC 1D7OA 3H4TA 3KJFA 2CV1A 2B37A 3VJKA 3WWYA 1VI2A 3KIPA 4OTZA 4JI5B 5JYDA 1RXYA 3AETB 5D1NA 4BOYA 5JXGA 1KGDA 2O5VA 4YXWA 4CM9D 5JE8A 3T9AA 4DLNA 8AT1A 1TT7A 1E3LA 2FN7A 4Q66C 3SQWA 5FO0A 3WI7A 1T9AA 4AY2A 4C1NA 1II0A 3UV7A 1OX4B 1ZUIA 2EYUA 2F64A 4OHYA 5FNVB 4NU5A 1Z39A 2SKDA 3GOQA 4QTXA 4QM6A 2ORED 2PCLA 5REQB 4GBMA 1Y34E 4DLLA 1HYBA 5ITVA 3UMGA 2XNJA 1JAXA 5T5QA 1R6AA 1Z74A 3QF7A 4S12A 2JARA 2VYNA 4N0EA 2MR5A 3RIXA 2OFFA 6REQB 5IRCD 5JZOA 4B7AA 1P19A 3PQEA 1KA9H 2YWXA 3JVUA 3KTAB 3AUKA 2R65A 4W6ZA 3PL1A 4AG5A 1YQQA 3TSAA 1HNWC 2Q6VA 2QL7A 4PAWA 1ZJYA 4R1LA 1HFWA 4JI3B 4DLTA 2POCA 2QM3A 2YV4A 4JASB 5EE3A 4FQ5A 2ICAA 2JLAA 2NUAB 1NUAA 2EJBA 3DBOB 1FFGA 3H8JA 3RH0A 2VUSA 2BEWA 4WT7A 3RJZA 3T3MB 3U26A 5GADl 4FN5A 4PWZA 3ZNOA 1JFFA 4LISA 1ML8A 1JUDA 2CLHB 2X1VA 1T3HA 1DBQA 4YJFB 3HDYA 5FBZA 2JGKA 3DZJA 5BR7A 2YVQA 3DWIA 5KYGA 4G0NA 5BOSA 1I2BA 5EHXA 2FWPA 5G0UA 2O2JA 3JQ7B 2HV9A 4BEVA 1FTNA 5IZCA 1DGQA 1LWNA 1SA0B 5HM6A 1S7CA 5DSZA 3EYWA 3LLUA 4J16A 2OGTA 5KWSA 2IEZA 1Z6QA 2YVKA 2SNIE 3IHLA 5E4TA 1NXTA 2VATA 1N4AA 4BLTA 4TTSA 1Q92A 2I6TA 4L8WB 5B5SA 1J6UA 4YR9A 4KLNA 5AM4A 3PHJA 1GU0A 4EZEA 4X90A 3OPXA 1QS0B 4MVJF 4I1YA 3N0XA 2EX0A 5A3VA 3S68A 1F6DA 4LGMA 3STTA 1QRDA 4JYAB 5E6UA 5AE1A 1Q6ZA 1CV2A 1QV7A 1X1DA 5EQJB 5MDHA 1XQ9A 4DC9A 5KTNA 5AJVB 1RHJA 1FNSA 4A1FA 2R11A 2OFOA 1K63A 1SEPA 3N59A 2F3QA 4AYWA 2ORVA 4Y2TA 3UJ7A 1YHZA 1V3TA 1D03A 2OCAA 1CEEA 3CPHA 4DV1B 1CJKC 1ZC3A 1Z5GA 3JQBA 3RC2A 2ZWOA 2VSXA 3I5UA 4GP9A 1F12A 3W4JA 4CZ2A 4D4IA 2YFYA 4RS3A 5BO5A 4NE9A 3U7IA 1AG9A 5U4XA 1RZUA 2PQ2A 3HKDB 1GA1A 1K4YA 4B3MC 2G5TA 2QB5A 3A3KA 4HB0A 4OB6A 4D6XA 3FTPA 3AOGA 3FHTA 1F8XA 3NANA 4ODIA 4W7SA 2R6GA 2ZCVA 1C8LA 1UDXA 2QTZA 1I7SB 2FDCA 3PQ5A 3EZLA 1G8JA 1C29B 2H7VA 3MTEA 4WD3A 3ICOA 2QDXA 1T0BA 4OQXA 1SQ0A 3VOTA 2LGJA 3JAKA 3FMVA 1DTWB 4K05A 4DXHA 1C7FA 4R01A 4TQAA 1W1UA 4F8EA 2C7PA 4OHKA 4EVRA 5EP2A 4Y6PA 4CWAA 3MAAC 4JEIA 4J4TA 4BB0A 4CCSA 2VHVA 4QO7A 1D0SA 5ES3A 2H00A 2NQTA 4ECAA 2Q4RA 4QDJA 1DCFA 2O2IA 5KEIA 3AYXB 3EEYA 3QX3A 5BSUA 1P1RA 2GF0A 1R16A 3MIZA 3THRA 1DKNA 5B6IA 1G18A 2CFIA 2JZOA 2WHEA 3U40A 5I9TA 3WJAA 5JCXA 1O9GA 1PCXA 2I99A 1R9MA 2GWRA 2OPLA 5HP4A 2QLLA 5CMLA 2G1KA 4CW7A 3M4JA 5FI0B 2ZUWA 2QRVB 1NJ6A 3FDIA 2XT6A 4GL4A 1NASA 4DA9A 3HJHA 3DB1A 5EJ6A 3A37A 4M1WA 2BFFB 2YWEA 1MRZA 2ZYSA 2UVPB 1CUGA 3M3HA 1I1OA 2AJTA 2H1RA 4HPXB 4KSYA 2XDWA 2GYWA 3FKQA 4OF4A 1YJBA 2JGDB 2DF8A 2F3PA 3AVQA 3OHPA 4MCIA 4CQMB 2BFPA 5BY2A 4FEEA 3P9CA 4LA4A 1IEXA 4GXTA 1ZHHA 3OJEA 3G89A 1TTPB 3L8YA 1USGA 1DKPA 1JHVA 3NNDA 4JQZA 3KE9A 5E3HA 3CKMA 3ZZTA 4E5PA 5CITA 3FY4A 2VK2A 2B5VA 5AM2A 1ZA2A 1WZCA 221PA 2H2GA 3M1AA 4YT8A 1LS6A 3EWAA 3EERA 3WAJA 2QLFA 4F6CA 1RKBA 4L3WA 2A7QA 2NN3C 4Y2SA 5IJZA 5KYUB 1LPBB 1XIVA 4DMKA 2PJZA 1ZCFA 3AO0B 5KYWB 1KZ7B 2Z9BA 2R7KA 5A9SB 2GBCA 2W6ID 2JC3A 4DLSA 3ANLA 3CKLA 3COWA 1W9MA 1DLJA 3ADKA 3UC9A 3UMSA 4XFJA 4X20B 2A0UA 2QZ4A 1MW9X 2EVWX 5FJJA 2YVAA 3BB3A 1XD2B 2Y8EA 4MQEA 5F78A 2IYEA 2O4CA 1U8CB 3GG2A 1G8YA 2VAMA 4KO4S 1JT9A 1NVGA 4N0QA 4AZ3B 4CV1A 4L5CA 4CM3A 4Y98A 1MAVA 1TAHA 1VPLA 3O2QB 4BB5A 1JG6A 2C5HA 3OFJA 2XQKA 1E2IA 5ALDA 4K8RB 5EHNA 4Z2AA 5CT4A 3O83A 4GZLA 5A3RA 1CZKA 4MAAA 4D45A 5C8DA 3ANNA 3ZI4A 1TOAA 1CJTC 1W59A 1A9XB 4L9RA 1QC5A 1ADBA 3BRWD 4HDAA 5EWJB 5C7LO 4Q7KA 1T15A 2UVDA 4HD8A 2XUOA 4J0EA 5IC4A 1ECFA 3DXFA 4POAA 4UARA 1ZA1A 2VSNA 2DSNA 2EHJA 3FYUC 2E6UX 3V1TC 1ZD1A 2ZIZA 3VUEA 3VR6D 3QVVA 2R8YA 2VQ3A 1JSRA 5JSHA 1SCNE 2QUJA 2WV9A 2FMXA 3H2GA 1XKTA 4QEDA 4DILA 2HSEA 1E1YA 4GW3A 4KG7A 2G1UA 3LW7A 4RVGA 4AN4A 1LRLA 5EZ5A 3GUHA 1SXQA 4E15A 1XCPA 2NSDA 3A10A 2G1JA 3COVA 4XARA 4IV5A 4ZI7B 5FT9A 2GNOA 3G0GA 4EMSA 5F7JA 3LFUA 1Z47A 4Q3NA 5K85A 4N54A 1H9CA 3DQQA 1QH8B 2P75A 1PT9A 3OLWA 3OZRA 3CX8A 4C30A 4AYTA 4BYMA 4MIYA 4CT5A 1XEWX 4Q7QA 5KNCA 3KQYA 4AXBA 1SVUA 3VVMA 4TMFA 1JHDA 2FF5A 1ESCA 2PQ0A 1DTSA 2ZKLA 3B3GA 3JWIA 5JDCC 2CMDA 2WM9B 1QORA 3P27A 5B4TA 2HT1A 3LWZA 2DHRA 3QHQA 5LA6A 1J2UA 1EWRA 2QQ5A 4I3HA 5CDGA 4ZCTA 4QXMA 4U7HA 5L3RA 1WH9A 3AONB 1LLFA 2J3MA 4K9OA 3TQHA 3TW0A 3WYEA 3UMYA 4H2DA 1JHOA 3U4GA 2CLOB 2VYVD 3QBDA 3DBRA 4R7ZA 4BPRA 5KYTA 1EGAA 4ZCRA 3T54A 1Z0FA 1N0WA 3L3BA 4IQ4A 4R3UC 3RAGA 2CV2A 2OKGA 3TGWA 3RU7A 4C2TA 1JECA 5CJ2A 3RVNA 1W94A 1CS4C 3SSNA 3K30A 3HY6A 2JHAA 2OFWA 3RPEA 1KXJA 5JAQA 3HO8A 2X5OA 2OLKA 3DF7A 2QD1A 5AI8A 3E2PA 1RHUA 1LBQA 3NHZA 4L0DA 5IABA 3QMVA 2C5AA 2Z3WA 1C9MA 1US8B 3S2UA 4BNDA 1YS4A 2D0OB 1XTUA 4HWPA 4ZKDA 3W04A 1REQA 2W7TA 2Q3JA 2RIPA 3IPAA 4JYBA 3T3PB 3UV3A 1EFRA 4FTWA 4B0PA 5KSYA 3D31A 4HB4A 3ZDZB 5A4JA 4B6JA 3EXG1 4TTIA 5I8WA 4U7TB 5L45A 2HPZA 2GPJA 1J8YF 3IBFA 4IFEA 1L5HA 4AJHA 1PJQA 5AUPB 2ESRA 3ZTTA 3ZCTA 2J4DA 2W00A 2C9YA 2IBSA 1NQXA 3AF0A 1GL6A 5U4QA 3SIRA 3ZGOA 1VGQA 4LWPA 4OXQA 1OQAA 2X19A 3B1ZA 4AZ0B 1CYDA 2F67A 2YXLA 4W5JA 2G8NA 1TT5A 1I4OA 5AW3A 4F5DA 3OQOA 3AP3A 4MYDA 1Q14A 4BIMA 4CVNA 1GNVA 3KR2A 1KZ1A 5JRJA 2OSBA 1QYVA 1ZISA 2QJTA 1QGOA 2WZCA 4KQEA 3NHMA 5IK2A 3PDCA 2VOJA 4RF3A 1HDRA 1CUVA 4YAFA 3RSZA 5IHXA 4Y6GB 3ETGA 5DM0A 4EW1A 1XZMA 2I1WA 4REMA 2IE8A 3BD6A 3S5JA 3SXUA 2OQRA 1B43A 2YX1A 1PJRA 3KDAA 1PT7A 4L75A 1Z13A 2PX6A 4Z3DA 1Z8HA 1LV8A 3TOZA 5HDQA 1M1YB 2BKUA 2J6BA 2KSQA 2OAGA 2Z1MA 3KR9A 2D2EA 2LRHA 2XAAA 2JD0A 4M1QA 3RVMA 3S27A 3VR5A 1E3JA 5TPZD 3O4HA 1IM5A 2J9GA 3PYMA 4XLZA 2LIPA 2Q2WA 4TLDA 1H5UA 5H4HA 3QTBA 4LOAA 2ZTSA 4E07A 4GPAA 5AESA 4ZO9A 3TRDA 3EWNA 4QD3A 1ECPA 3FNGA 5E6RA 3TL3A 5JFTA 4DR5C 3K6SB 1ARZA 2H16A 1USWA 4E32A 4GX1A 4TYNA 4MQ6A 3FF4A 1M5TA 5L8VA 3D4PA 4FZ5A 2QM8A 3QW4B 1SQSA 3BE8A 3ZD8A 1PJSA 1W6UA 2HU2A 1IN6A 1X13A 1TM5E 4G07A 4WK4B 1YA4A 5KWJA 4K3VA 2P30A 4NATA 2FZEA 1JQBA 3RU2A 4TYPA 1N75A 2OAQ1 4LF7C 1E6KA 2XQJA 3ENVA 1KBQA 5F21A 3DB2A 3ZXXA 1M72A 3L18A 3L77A 4YRMA 1GUYA 3PWZA 5C46F 1SBQA 4JLPA 1YMUA 4ED9A 1XEAA 1RZRA 3NWOA 4ABTA 2IP2A 4BQOA 4CXMA 1N5MA 4ARVA 2V0CA 3FTNA 4DBLC 4F56A 4CLOA 3L1IA 5L4NA 2QTRA 3JD2A 3HCEA 1OFVA 2HU7A 3T5BA 3EPJA 4WBXC 5C8VA 2VJKA 2XZOA 1DBIA 3EXG2 3QXSA 4QFDA 1GAEO 2QLNA 4LJ8A 1N2ZA 2DPMA 2Z09A 3OAAA 4V02A 3L0OA 3IQEA 4ZIRB 1ESNA 4INOA 4NCXA 3JYHA 1KPIA 2AR7A 2IOQA 2AOVA 2QQ0A 2H8GA 3QTLA 4G5SA 5F2KA 1KI1A 4PE5B 3WGLA 3ZXUB 4CM1A 2VF5X 4JDPA 3OQNA 2WVHA 4KODA 5B7PA 1ZFNA 3PENA 1U3TA 5IWCA 1BC5A 5B1SA 2AN9A 4HNHA 3GHHA 3EIWA 4R1UA 3WB2A 3O8DA 4QGHA 4GXQA 1IQ0A 4Z3OA 2IY7A 2VKTA 4LJAA 1NF2A 2C5GA 4GICA 2A5GA 4RTOA 3NASA