3DHVA

Crystal structure of dlta protein in complex with d-alanine adenylate
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
503
structure length
498
Chain Sequence
KLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTSPKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-alanine-poly(phosphoribitol) ligase
publication title Crystal structure and enantiomer selection by D-alanyl carrier protein ligase DltA from Bacillus cereus.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Ligase
total genus 156
structure length 498
sequence length 503
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3dhvA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dhvA01
4R1MA 3B7WA 3LNVA 4EATA 1LCIA 5BURA 5BUSA 5KYVA 1AMUA 4E5DA 1MDBA 2D1QA 4D4IA 3O82A 3GPCA 2P20A 5BSTA 2VZEA 5BSMA 3T5AA 4OXIA 4PZPA 4RM3A 3WVNA 3DHVA 3RG2A 4RM2A 4U5YD 1ULTA 4LGCA 1PG3A 3IVRA 3ETCA 3WV4A 3VNRA 3L8CA 5BUQA 4G36A 3NYQA 3ITEA 4FUTA 5IFIA 4D57A 2P2BA 3IERA 2QVZX 4IR7A 3RIXA 3LGXA 5DWVA 3LAXA 4GR5A 3PBKA 5D6NA 1YJ7A 4RVNA 4W8OA 5BSVA 3CW8X 4ZJZA 1V25A 4D4HA 2Y4OA 4FUQA 3E7WA 3VNQA 3O84A 2Y4NA 3FCEA 4GS5A 3WV5A 5BSUA 1MD9A 2P2FA 4GXRA 2D1SA 4GXQA 2D1RA 1BA3A 3IEPA 2WD9A 3G7SA 3R44A 3O83A 2QVYX 3A9VA 3A9UA 4M46A 2P2QA 5K85A 4D56A 3IPLA 3EQ6A 3T5BA 2P2JA 5DV9A 4G37A 1MDFA 3E7XA 5E7QA 5GTDA 2P2MA 3U16A 4DG8A 4RLQA 2D1TA 4RMNA 4GR4A 1RY2A 4DG9A 4RLFA 2V7BA 3IESA 3KXWA 1PG4A 3QYAA 2QW0X 3DAYA 3C5EA 4RVOA 3DLPX 4IZ6A 3NI2A 5JRHA 3VNSA 4WV3A 4ISBA 3NYRA 3CW9A 4R1LA 4R0MA 1T5DX 5KYTA 5BSRA 2VSQA 1V26A 3U17A 3TSYA 2Y27A 3FCCA 5BSWA 4OYCA 5K8FA 2QVXX 4D4GA 3E53A 1T5HX 5KEIA 3T5CA
chains in the Genus database with same CATH superfamily
4HQ0A 3FGNA 4QXMA 4FKZA 1D6NA 3SNHA 5CDTA 5BUSA 1R00A 4UDNA 1HV8A 1A50B 2FN3A 1IWBB 3KTAA 4Y9TA 5HFAA 4FEGA 4DNOA 2QTGA 4HSGA 4E32A 3TLMA 1XMSA 2ZIFA 2KM1A 2CHVA 2FMFA 4AJJA 2QTWB 3LKZA 4B31A 4K8OA 1I4DD 4JD5A 1T2EA 3UJ8A 2O6HA 1CFZA 4BGDA 2DFKB 2WWWA 3IAEA 4BVLA 2HJWA 3IQHX 1XOIA 1X8JA 2HPVA 3UHOA 4ERXA 5KU7A 3TS1A 1YQTA 5A06A 1GUAA 1HQCA 1AQUA 3U48A 5B3JC 3IVRA 4WNAB 5H80A 1NVTA 1Y4ZA 2HA5A 3L0PA 3H4IA 1IDOA 3TTVA 3IP1A 2O52A 1JZQA 1M8KA 2JCXA 2WWFA 1W0KA 3OJLA 3SLRA 3VHQA 2WG1A 2QEQA 3COZA 3DNMA 4WUTA 1ATIA 4OH1A 2X7JA 2IXTA 4AECA 2BI4A 4WBNA 2UAGA 4HS9A 1AK2A 1P17A 2ZR9A 3KPUA 1ESDA 4S35A 1NLYA 3N58A 4DWOA 1IJEA 5KYYA 1L4NA 1NY8A 2FTKE 5LOVF 4YDSA 1P1RA 1QQ5A 4RJKA 4DKXA 2PZEA 3CUYA 3MCTA 3PT5A 4XAQA 4ZHSA 1UAAA 3B51X 3MS2A 2VK8A 4IIDA 3QFSA 3SO4A 3CW2A 1ML3A 5KWIA 3F73A 3MXOA 5FR2A 1U8YA 3SBXA 3WA6A 3KKMA 1ES9A 1U65A 4KV9A 1U2GA 1Y3FE 2FLKA 2BJWA 3CLUD 1ZAKA 1X6VA 1WD5A 4Q5IA 1QDUA 4QDUA 4UTZA 1GYQA 3SWWA 3V1LA 4Z49A 2CBXA 2RH8A 1EX9A 3KFLA 3Q7IA 4ZO9A 4ACAA 4E2ZA 3DTTA 4MQFA 1Y7LA 4L9SA 4P9NA 2I9KA 2WJGA 1QIKA 2ZS9A 2X19A 1XD2B 1M75A 2WF5A 1OT5A 1KAMA 3SMVA 4JV5B 3NHBA 3R9IA 3GLHB 3D1JA 3IEIA 2BEJA 3EF1A 1IL0A 1W48A 1WPQA 3K96A 1YOBA 3QLUA 4JQCA 5BW6B 1NNI1 1FSPA 2A9JA 4XUDA 4R8MA 3ZY5A 4Q1AA 4XVHA 3WGZA 5IEJA 1NE2A 3LAWA 2MCFA 4JEIA 5F2NA 4QGGA 2G88A 3KZOA 1U4OA 3TKAA 3ORQA 1WW2A 1T3ZA 3LYUA 2AEFA 5F3WB 3UFXA 3DGEC 1HX7A 5LQJA 4CUZA 3K9CA 4HPXB 1EWQA 4JU9A 1MRNA 2QE6A 1BWPA 3I3SR 4KPGA 4MW7A 5DBHX 1XG5A 1PZNA 2C9ZA 4F06A 4YHHB 1W4CA 2ZITA 2WDPA 3Q2KA 1NJSA 4A10A 1PNRA 8MHTA 2O0KA 4URFA 4F46A 4JVOA 2AG6A 1C2YA 3EBLA 1PR1A 5AK3A 1UEIA 4ZT6A 1M6YA 5AVQA 1UBCA 4RIFA 5AH0A 2NV6A 1XLUA 5LLTA 2FEWB 4RORA 3U7GA 1P9LA 3TB4A 4EGFA 1JEQA 1FU4A 5FO1A 3KYCA 2GN9A 1B0ZA 1ZN2A 3OUUA 3PD7A 2C3UA 2WZCA 1JYSA 4UJ3A 3TR5A 1R0YA 4MDEA 2PIDA 1QUFA 1IN5A 2C0PA 4DQDA 1C8LA 1SWWA 1GPKA 1V3TA 1JQBA 2BFCB 4HN2A 4NJMB 3PRJA 3KEQA 4XLZA 1S0UA 3PR3A 3S8YA 1IBRA 3E53A 5B1HA 5KSPA 1K7SN 4GHWA 1K08A 2FU5C 5IMBA 3L1HA 1G8MA 1RYYA 3GMDA 3Q0IA 3ELYA 1UM9A 4U9UA 5FV7A 4ENVA 2XGSA 1S3SA 3EG9A 4GI2A 2IUSA 3GBPA 1XQ6A 4QLOA 4FT2A 4BE7B 4DMUB 1L8XA 2JGJA 4HZUB 3WDLA 2ZR8A 3UWOA 1MC8A 2CMHA 2OBLA 3BXOA 3PHIA 3VAZA 4CEHB 1SZJG 1Y9ZA 4RV4A 1WP4A 3HYNA 4OK6A 5CYGA 2WAXA 5JSZB 5E9QA 5H0IA 1X3SA 1T4BA 3R0VA 5IHXA 2APJA 4HEQA 4XKJA 2ADFA 4IWYA 2HA6A 1IZ9A 1U4NA 2PRZA 1R66A 1HYEA 3LECA 3NNNA 4L1KA 4QYSA 1NMZA 1RRKA 1LF5A 3MW8A 4W5WA 2A1TR 1U2PA 4MTCA 1ZH8A 1X1RA 5T7BA 3RAEC 3DL4A 4DNPA 3FYCA 1T29A 2O1SA 3NHYA 3CISA 2R1TB 1P8AA 1PLLA 2RCYA 4XR9A 4QLBA 3COPA 2OCPA 1JSZA 4HFRA 2WA2A 5D5HA 4UFPA 1JEAA 3EIXA 1ZHHA 1TM4E 3GFGA 2O3RA 4QPNA 1BVYF 2CDNA 4P4LA 2PZGA 3AKDA 3LKDA 3QNWA 1SKBA 3G8AA 4OQYA 4MKZA 2KSQA 1N75A 3ES9A 4MZDA 5AJHA 5E6SB 1PQYA 4C2TA 4ZZ1A 2GN4A 2CJXA 4JJEA 4ZEOA 5K0FA 1VHJA 1W59A 1M8GA 5ITVA 1TYEB 1WRBA 1PTKA 5C8DA 1NKSA 1V7QA 4DNFA 1I5EA 1ACJA 3R9WA 3TK1A 2VQEC 1ZQ1A 4UZEA 1OBOA 4I1UA 2PK3A 3V9PA 4KR9A 4CFZA 3Q8MA 2OV4A 4YCDA 2YY5A 1L5LA 3L18A 3I62A 1CRLA 1CP3A 2EKZA 4MW0A 1TAHA 1CR0A 1OQAA 2Z6VA 2FV8A 5KNDH 3SC3A 4YH1A 2GKGA 2QL6A 5LBUA 4A8JC 4M9SA 1WDLA 2P8SA 1G5IA 2R7KA 2WKPA 1C3OA 1K1EA 4HEA1 1BRMA 1P74A 1PJQA 3LGAA 4I14A 5CW1A 3U49A 4LOJA 1PUXA 4G65A 3SZLA 1CSEE 2AJCA 3L7KA 4Y0NA 2XXAB 3ESQA 3EJWA 1R0WA 1N6LA 2FRDC 2ZRKA 3OFJA 1ZJYA 3RS0A 3MTQA 3FM9A 3N2IA 1AG9A 1OMOA 2YASA 4YRLA 4DXAA 2JIQA 5AFSA 3ZXYA 3KLPX 4U7GA 3QNMA 3R09A 3E03A 2B2CA 3DV0B 3FCYA 2OK8A 2IH5A 1T8TA 4ZOCA 3WYNA 1PCXA 1QCDA 1U1CA 2JFBA 1IM2A 3SE7A 1EUZA 2VUIB 1FLOA 1EFRD 1MLDA 2DY0A 2ZRCA 3ESYA 3QBDA 5CK4A 4B4WA 3T7SA 4DR4B 4I36A 1WU7A 1U7TA 2WFLA 3HXMA 3HRIA 3JASB 1LDNA 2ZBFA 5HK8A 1U2EA 4A26A 3MCZA 1NASA 1CUSA 1JJAA 1U3FA 3HO8A 2QMEA 3TJRA 1UC9A 4YYZA 2C2HA 3QE4A 4YGXB 5TDHA 1V26A 2FEXA 1Z16A 3BXFA 3HZHA 5DNWA 5EXTA 4ZYXA 5A4FS 2FX5A 2FZKA 1G2OA 2FWNA 2ZQYA 1T6BY 2VZ0A 4JI3B 2N46A 2WZBA 4TLMB 5DW3A 3K0EA 2ERYA 3IPAA 3ZBPA 4OKNA 1C0KA 1U94A 3WFZA 4TV8B 2AD5A 1CKEA 1T1EA 2M2IA 1C9DB 3U3OA 4YMIA 2JFWA 3OLYA 3O7MA 2XXBA 3AI7A 1EDBA 4KFUA 1AS3A 5IJ9B 4RMHA 5DSZA 4B3RC 1LX7A 1N3BA 3BMNB 3LL4A 2IH4A 1NAIA 1FUUA 1VP9A 1JHZA 1F2TA 1SIWA 1Z5NA 3NWBA 1O97D 3NIWA 1IY9A 4GIBA 3V42A 3VSBA 1VA5A 5JBNA 1EEXB 1QM5A 2WYHA 3A4MA 4ZWNA 4CCSA 3GJ0A 2OVBA 1D7OA 1CBUA 3W5JA 5I01A 1DZ3A 4AKSA 2Y0CA 4ZU1X 2NUTB 3EFEA 2ABWA 1DINA 2QSUA 4P86A 4WVFA 1N78A 3ORHA 2V1XA 5K4GA 4TXNA 2WM8A 5AW5A 1BQ4A 1J00A 3T9CA 3IOEA 1QFZA 2JIZD 2JBWA 3RVMA 1M6XA 1TK9A 1UMBB 5FPSA 3K70C 1O87A 4D9CA 3I1JA 3K0FB 1ZI8A 4XLLA 4BC1A 1J8FA 1VA4A 2FPGA 4UUNA 2I8AA 3VZRA 5JLAA 5BV2P 2DSTA 1CDZA 3IMEA 4G01B 4PINA 3LIIA 2FZLA 4N47A 2JCYA 1CU1A 4Z7OB 5FH9A 5K0LA 4NIMA 3T15A 3O94A 721PA 1Q7GA 4ALJA 4AMZA 3WAGA 2C7BA 2P6OA 1M33A 4FDLA 4MULA 1X1EA 1YTUA 3FMVA 1HDGO 4GG1A 4PFKA 3GVHA 1F51E 1VI6A 2XKBA 2ZIXA 2V9PA 3CCBA 1BU8A 3KKKA 5AXCA 1A04A 3FTEA 1V4VA 4ARIA 1DG9A 4XJVA 2WINI 2O50A 3AVTA 4PLCA 1POXA 1SG0A 3H0KA 2ORWA 4PYNA 1U7PA 1UP7A 2VNSA 4YRTA 3BDAA 3TAHA 3RC2A 1XNGA 5BOSB 2MJLA 4BYGA 2O7VA 2PKXA 4OLJA 4YRMA 3VKHA 2IIBA 2BONA 3KR2A 3O2SB 3WNZA 1I30A 2FNAA 4I2VA 1Y48E 3JRXA 4PG6A 5CBPA 4YJHB 2JKYA 2XDQB 2DTDA 4ZKEA 5JVDA 4JI5C 1IUNA 2VEOA 1N0UA 4UD6A 4EO4A 1RZRD 5JASA 3M4YA 5DVZA 3EIOA 5ICEA 5LZ9A 2PVPA 4KTVA 2WZQA 1EDZA 1Y7IA 2G40A 3AU9A 3H11B 4EQZA 3UT5A 4DIBA 1N3IA 3CG0A 1EI9A 3GZ4A 4TTQA 4WK6A 2I7DA 3B7GA 3DDZX 5FR1A 5B58T 5HR5A 2FSPA 4MCJA 1BH6A 1W8DA 1Y9EA 1OLSA 4JI4B 1PP4A 2GDJA 4K6GA 2VTKA 3W0LB 4OI4A 4UHEA 2QTMA 4BO6A 4BX9A 1G1AA 2OYCA 4I8IA 3CXRA 5E7MA 1JKFA 1PFVA 1QH1B 1AVTA 2QTTA 2LV8A 2XHEA 3L7AA 4BGUA 1W8IA 2O0HA 1CUYA 2VAMA 5D7BA 3TAXA 5FEUA 3M4JA 5TSDA 5JPDA 3U0VA 2NVUB 1LK7A 3II6X 2ZRJA 5E1MA 4AROA 5BN3B 3GR1A 1KDPA 1L4YA 2DRIA 2VR1A 4WEOA 1X1SA 4AY2A 1IONA 1C7ZA 4XIYA 1DE0A 2GRAA 1E1RD 3L9XA 5B37A 3Q6NA 2PPLA 1TQ8A 5C3UA 2QP3A 1BWRA 1OAKA 4OL9A 3W8EA 2OCLA 5I3ZA 2J87A 3E9RA 3TNLA 5JRDS 5JXIA 2G1UA 3HU2A 1YJ5A 3NEJA 1M3SA 4BBYA 3HJUA 4RIEA 2J59A 3KUDA 4XA8A 4YJDA 4UMVA 4ZYUA 4NPHA 1YH3A 1CUJA 2BDTA 3CJTA 3QVXA 4I4LA 5A71A 1MVOA 4D3SA 1FNMA 2AJLI 5JROA 3RNOA 3W6ZA 3UPTA 1ABEA 3I6BA 4TZ0A 3B8HA 1YVUA 2QRKA 3WTCA 1UKBA 4OFXA 1HNZB 1QH0A 3CBGA 3S2SA 1IIRA 3J7TA 4CIXA 4X71A 1BIFA 3NETA 4D25A 3SICE 2X1VA 3D3WA 1N25A 2X5XA 3KQOA 4MVJM 3TLKA 3HDYA 3FDXA 4ESOA 4QNRA 2NV0A 3OICA 2UXDB 4R3NA 2HTFA 3NALA 4YMGA 1CWUA 4LHWA 2VFAA 5JDIA 3U09A 3H2GA 4P35A 4DV1B 1O57A 1YJAA 1J9GA 5AMXA 3UMMA 5HEKA 1JMYA 4HF7A 3HYSA 3AB8A 1R5OA 2EX0A 3EEYA 3SQNA 4EQ6B 4ZCRA 5HRAA 4G5HA 6GPBA 1L8QA 3HR4A 3ISJA 3EA5A 3PHBE 4WACA 5TPWA 5A4DA 1JR4A 5B4TA 4RSHA 2O59A 5FF9A 3INGA 2F7SA 1BEEA 4Q1DA 3BAZA 4G8JA 4BAUA 1CHNA 1J70A 2R44A 3LF2A 4O5AA 2BI8A 2Y3IA 2Z09A 2D6FA 4URZR 2HU5A 3GT7A 4N5HX 4OGKA 4D45A 1O95A 3KM0A 3ON5A 4M0LA 4YONB 2WZDA 5BORA 2HK8A 2B5OA 2P0YA 1U2QA 1YC2A 3HUDA 4E70A 4ZGGA 4GNRA 2CNWA 1EJBA 1B4DA 5AJWA 3JD0A 4J6EA 2A0KA 1KEZA 3K0BA 4BO0A 3KOYA 1MC5A 2AN5A 5K0TA 3C48A 3UB4A 3ZCPA 1RTTA 3OVMA 5K2OA 3MWDB 3A9SA 3JU3A 5I5GA 1F6DA 3P2KA 3VFDA 1J42A 2CHQA 3HC7A 1J0AA 1FEZA 4C4PA 2JZCA 4J90A 4MS3A 3GFSA 4OKIA 5ALHA 2HBYA 5EUMA 4B6SA 5THXA 3FDFA 4M46A 4JXJA 5LMNC 1MAVA 5FD8A 3ZLUA 1AQJA 1U81A 2QLFA 4BGIA 1RI4A 3WGQA 1USVA 1HQKA 5EIEA 2AW3A 2Y92A 1K6IA 1KYTA 1X14A 5LP6C 5B3KA 2X76A 3OX4A 4EELA 3G1WA 2JA1A 4MGHA 5BV1A 1PBNA 1CNFA 2EDAA 1YR1A 3DAFA 1T5IA 3K4QA 2ZANA 4KVAA 1KJZA 5FTJA 3K20A 5DM60 4OLBA 1OUMA 3HBAA 4MCIA 1HR0B 2QSJA 3H1BA 1DRJA 2XBUA 3NDIA 4P3XA 4TYPA 3C7CB 3GJ7A 3F9CA 3WZLA 4AJHA 4J16C 3WWCA 4ZRDA 3ZWQA 1R4NB 2C78A 2PSHA 1R1DA 2R5NA 3IRUA 4DV6B 3NH9A 1Z83A 4TVKA 4BXOB 1XEWY 3EOAI 4HJRA 4PUHA 1ENYA 3E58A 3DDHA 1JR3E 1USUA 2WHPA 4S24A 2QRGA 5FUVA 3D9QX 1BFDA 7GPBA 3QEMA 4A0SA 4E2WA 4B3SB 4KOAA 4RKQA 3ONVA 3V6LA 3LWBA 2ZUSA 3BD9A 4XI9A 1YA6A 1WXIA 1KZGB 1OLXA 1Q3HA 2XA9A 4D81A 1T0PA 4IP0A 2JJ1A 5E95A 1PX0A 2WJIA 1UKVY 4IVNA 2HLHA 1WBBA 2A0YA 4IKOA 2CWDA 2FW9A 1NVMB 1PD0A 2IXEA 3M70A 1SB8A 1I4EB 1OFHA 1XRSB 4WASA 2FFQA 4DZZA 4I0WB 1XNRB 3PEYA 1LH0A 3AF0A 2QG9A 1MA0A 5T64A 3JQAA 2NU7A 3Q12A 5ELLA 1PEKE 4Q21A 4DMMA 1O03A 2EJTA 2PEYA 3FWYA 4WRRA 1Y6JA 1OC2A 5I4BA 3I9MA 1X70A 3OJWA 1FPMA 1XNQC 4MR8A 1RRVA 3DE1X 2PQ0A 2E18A 1JNXX 2IE8A 1FMJA 1RYZA 2H16A 4BFXA 1DFHA 5AW8A 4KWIA 4K6CA 3V8EA 1S8AA 5BSEA 1PR2A 5IK2D 3L5KA 1AXRA 1Z88A 4DLSA 5TC4A 2JD1A 2OILA 2OXIA 1MJHA 2A1UA 4L4SA 3ZBUA 1EVZA 2JJ2D 4YQZA 5J2TB 4PHHA 4R2IA 1XHJA 3GGOA 4KXMA 4BE4A 4K9LA 1YK0A 1CUZA 5JV5A 4NCHA 1H23A 4U4AA 2HBZA 1PS9A 5EHZA 3ACCA 1L6IA 1W2GA 1YMVA 2EKDA 2H3HA 3K9NA 1GJRA 4CKWB 2OZLB 5GONA 3IMCA 5BMVA 4F2GA 1M54A 2XADA 5F4BA 4Z86A 4RZHA 1Q0SA 3K94A 3ABZA 4CKBA 3L5OA 4K0KC 1IXSB 1JXOA 1U6JA 3QPDA 2XNHA 2DKOA 2Z4RA 1NVXQ 2ZROA 3ENQA 3H0CA 5EIFA 4GBGA 5FKJA 3WZMA 4QUAA 2VA8A 5NLLA 4L3VA 4EFNA 4LGMA 3E7WA 3ADCA 2DB3A 3ZHZA 2IY8A 1U11A 3GLUA 3MWEA 3T61A 1HOXA 4UUQA 3VR6H 2O54A 2JAQA 4I9NA 1RJGA 1AXGA 2PD6A 3QEJA 2KZ0A 2WOJA 3TM4A 4I81A 5LA6A 2I8LA 3X3HA 5JDCA 3COJA 4LXGA 1NU8A 4HG2A 1DC5A 1DFIA 1DCTA 2FMTA 5CXQA 1JR3A 4OEHA 2W2NA 3BB3A 3G0OA 1ZUWA 1RXVA 1CIJA 4IH4A 4FC7A 2RGGA 5CG1A 4DMKA 2ZBEA 1JJIA 2QZ9A 3P20A 4FP9A 2Q0XA 4MA5A 4XCVA 5J1SB 4MWSA 2XEDA 4QFCA 4BRSA 3LX5A 1ZR4A 4OQEA 2RDMA 1RWVA 1X7HA 2W6MA 3WKCA 3T3HA 3JALA 4AZTA 2YVAA 5FUBA 1XZFA 1LW6E 3BAFA 1BHQ1 2X2FA 3LRXA 2I66A 3CXUA 3GFTA 2J6HA 4DLUA 2FP4B 4CEIB 3UGTA 1JBKA 1I3NA 3F5SA 1GUYA 1GCGA 2WHXA 1NN1A 2PBFA 1DUSA 2IYTA 4ZAYA 3AJ9A 4YJ2A 3HY3A 3AOEC 4V24A 1NSFA 2W98A 2O7RA 1VLAA 5DNUA 4XTCS 5JATA 1T5LA 2PXXA 2QIOA 3CTPA 1K0RA 1W73A 3OPYI 5ECDA 2GVZC 3MA0A 3I07A 1BEZA 3G3EA 2WSBA 4NJEA 1PGOA 3TDKA 3QITA 1WCIA 4LY3A 4JB2A 3BMQA 4RIGA 3T0IA 4BOYA 4YAKA 2DY1A 3ESDA 3HCFA 4A16A 5ADVA 5TGDA 3RWBA 3RJ5A 1JFFB 4DPLA 4UM9B 4S1WA 4KYUA 4H3HB 4DYDA 3K1AA 3EZNA 3L04A 1EK0A 4WL0A 2HCRA 4CF6A 4O4JB 3GL9A 3SQLA 1A7AA 1IFXA 3LO5A 3LY8A 3OZDA 4IIVA 4QU5A 1IY8A 4RVHA 5DLDA 2D1QA 4B6OA 4BZQA 4DSTA 4F84A 4Z3OA 3O1JC 4FOSA 3BILA 1O0CA 1YJ8A 2ZQ5A 4EG5A 2C59A 1N2FA 4UE3S 3EUAA 2F1KA 3PXCX 2D5AA 1WKCA 3L7JA 3NM6B 1QHXA 2CVHA 1IMOA 2K7ZA 4LDPA 1BG6A 3K70D 1RXEA 2GCOA 3R2JA 3NTVA 4TGLA 1CUGA 3GOHA 3HI6A 4LWPA 3U3XA 1ZUHA 4INPA 4C22A 4HADA 1E1NA 1YBVA 3PQCA 2AV6A 4NDZA 4A9AA 3ISTA 1Z5WA 2DM6A 3IKTA 3ROKA 4UM9D 2H3EA 3RS2A 4BFVA 4HMOA 1GQQA 1U8CB 3B1ZA 4RQAA 3SEFA 2IDJA 3ONFA 5CNIA 1MV5A 2AOWA 4KWEA 3QHPA 5AI5A 2AIRA 3ETGA 1JAZA 1V11B 3HJTA 4QPDA 4C76A 1EWKA 4B47A 4D5GA 2FPKA 3OF5A 2C7VA 5KOJA 1LPBB 1HC7A 3NHWA 1T9AA 1LJ8A 3VRHA 4DJDC 4WAUA 4EGCB 2X5OA 3QH4A 1OY1A 1Z12A 4XX2A 1QXSA 2FE1A 1W9HA 2BEKA 3NHZA 1EWYA 4BQOA 1AH2A 2ZJOA 2EV9A 5EJIA 4C01A 3NMUF 1OVMA 3AF4A 5F76A 5EZ6B 3MG9A 2GJ4A 3FNQA 3N3BC 3C5WP 5AVYA 2P67A 4YPVA 4JOQA 5TEWA 2E85A 4AMGA 4EKYA 3PE3A 3PQFA 2C7PA 3O84A 3CNBA 3MFYA 3CN7A 4W9MC 2YMQA 1H8ED 1V16B 4KMOA 4D4KA 1KVSA 1RPJA 1ZHFA 1XDZA 3V80A 1WMBA 1UXJA 5A7HA 2Z5LA 3LHIA 3BJZA 3GMTA 2FOXA 3WLTA 1NIJA 4KVZA 2V97A 1F5SA 1YI1A 2AZDA 4TYMA 4G09A 4NZ9A 3B52X 4M1YA 4RDCA 2J5RA 4ZHQF 1USPB 4QYWA 1X7ZA 4ZN6A 3H1AA 3QENA 1FY2A 2ZJ1A 2Z8YA 3OZGA 3C2QA 4BEWA 2ONFA 4KYTA 1IVYA 3ZJYA 3FPHA 1P1IA 1MTZA 4P4NA 1E7QA 1EP3B 1UJ5A 2GTIA 2IPXA 2JRLA 2PD3A 3CJQA 1HBJA 1QYIA 4GQBA 4MROA 4KTTA 4OMCA 4LSZA 3KSMA 4BNDA 4P81A 3H5LA 5KC9A 2IRWA 2YYSA 2WSSD 3AF2A 4V0NA 1HTWA 5BQ3A 1MIOB 1OU0A 4RVOA 2H92A 1OKKA 3NM4A 3VYWA 4RMGA 2Y1FA 1Q16A 3QSYA 3MT9A 3OTWA 1N9GB 4GX0A 4YECA 4FMBB 1CF9A 2B4YA 2GN6A 1GNPA 5A3SA 1KZYC 1OWPA 4L57A 2Z98A 5KYUA 4EJ6A 5BUZA 2O8EA 1N1DA 3QVSA 5IXJA 2C5GA 3ANXA 1FFBA 3DUFA 2PUFA 1GGHA 3H2SA 4ZEMA 1L4EA 3GO4A 2RJOA 1FCJA 4RETA 1E4EA 1RBMA 2QRLA 2WJWA 3FIUA 4FYIA 1OYVA 2QGNA 3KAKA 3T5CA 5H59A 1G5HA 1L7RA 4E13A 3MGKA 5EZQA 3BHJA 3TOXA 1SKMA 3ED1A 4QRIA 2OQVA 4N0MA 4TV9B 1U0FA 2BFAA 4CKXA 5BQPA 4WKGA 2PFKA 4AN1A 4UTXA 1XKLA 2WJ4A 4B3TC 1EGMB 1KVUA 2WMNB 1EXVA 3AHFA 4NBNA 2DF8A 1IM5A 1P7YA 5AVUA 2UZ1B 1OIVA 2ZU0C 2AKYA 5A62A 1J6UA 2GN1A 3S1AA 5LQMA 3MAGA 2UZ4A 3RS5A 3W34A 3TRJA 1KDTA 2GAOA 4A82A 1DCKA 3VUFA 1T9DA 4LJ5A 4X54A 1DEOA 5CIQA 3AW9A 1BXRA 1P6XA 2YWGA 3JV7A 5IWAC 2OPHA 2JIRA 3GDFA 3I9OA 1OJ7A 4MUHA 2FSSA 4QDOA 4EG1A 3OZSA 4HYEA 1MZVA 1D1TA 4I7EA 1AB5A 4CDRA 3F71A 4D42A 2G8LA 2J9FA 2WF6A 4R31A 1E1CB 1NP3A 1AOXA 5F7OA 1EXMA 1QFMA 3T1NA 4R2JA 1GU0A 2MHCA 4DR6C 1PSWA 4A5OA 2C3YA 4ASUD 1R2QA 3RGWS 3C3DA 1R15A 2QD2A 2O4CA 2ZJZA 1RC0A 3LQYA 4JHXA 1GPNA 1TD1A 2ODEA 3EW7A 2EFGA 1P1FA 2NCLA 1P2BA 4IHJF 4PPFA 3ZCUA 4CN8A 4YAGA 3U4QA 4R54A 5AJVB 3Q7SA 4EZBA 4O8ZA 1KQ3A 4G9EA 4D82A 4IIJB 5IT9D 4MYCA 3CVOA 3C8ZA 2VHVA 3OT1B 3OFVA 1WR8A 4BCAA 3PTZA 1DSSG 3RTDA 4C0QC 1QHIA 3AVXA 2PXHA 2DR2A 2NZVG 1QS0A 3IAAA 5A4IS 2NUPA 2O2XA 3C0KA 3N28A 1YACA 1ADFA 1GA6A 4G67A 4CIBA 1HYBA 1Q3TA 4MICA 2QPTA 2BKUA 5EHIA 4L6IA 3SZMA 4B7AA 5BPHA 3OBBA 2IPAB 2J9ZB 4PW0A 2KBEA 4PXYA 3G9XA 3MRVA 4I9UA 4TL6A 1PSZA 3SX2A 4C4YA 1BRTA 1IAQA 5E8JA 1L4GA 3T4UA 3DE4X 5C35A 1NMEA 4D9BA 2X4IA 4Z2YA 4G0PA 5E4YA 4ZOLB 3G2KA 4V0SA 4BFYA 2PLNA 1U3UA 3PEFA 4Y2GA 4KO8A 3C1TA 4P84A 4BE9A 3UOWA 1JVBA 3DDSA 4NH4A 2GUGA 4ZI7F 2WEKA 3D2BA 3KIPA 5EJAA 2YV4A 4QOGA 4RYLA 3BT7A 2GJKA 3G2HA 3OCXA 4N7BA 1EK6A 2QUJA 1NA5A 1X0VA 2WU1A 3KPJA 4FW9A 1XNQB 3KR9A 4BNGA 3I1IA 4KW7A 3G17A 3VNSA 4BPRA 4DIOA 4OQDA 1ETHA 5ULLA 6CHYA 3HU1A 4P2BA 1ZIXA 1YGPA 3NHFA 2ZUDA 2FSVC 3K9LA 3ND6A 1A1SA 2ECOA 3UMGA 4B6GA 4JMLA 4HNUA 4UEQA 3W7VA 1FXWF 4Z7NB 1T36B 1BSVA 3L49A 4DT1A 2C4MA 5DT2A 3VTAA 5FNVF 3FUCA 1IHOA 2ZE6A 1NKVA 2RKWA 3UQZA 4W5NA 2A88A 2I55A 4PLFA 3AI1A 3I2HA 3M6XA 4ODJA 1TF7A 3LNVA 4EATA 4YY3C 1WF6A 3EPPA 4B3GA 2VF4X 4C2AA 2XZLA 2AOXA 4IJMA 4UPDA 4AUNA 1B8NA 4D4IA 2QJFA 5IAGA 1PZFA 1N36B 3S1LA 2P20A 2GD2A 2WMOB 3FD8A 2AJ8A 4RF2A 4E22A 3EWSA 4AKTA 4C6TA 4DSZA 1DRKA 2QL7A 2NYRA 1RXYA 2ACKA 1ZNQO 3P45A 4QNNA 2B94A 2YHIA 3LPCA 1MU0A 3TUJC 1KJ8A 2AFHB 2DUWA 4AKEA 2IXDA 1NQAO 3COWA 2R62A 1D2EA 2EOAA 1TM1E 2PH5A 3O0DA 3ROPA 3H87A 4BMZA 5DNYB 2VHJA 3DWIA 4INZA 4KIUA 4NNPA 1G2PA 1GTJ1 4DCUA 5HJ2A 2B25A 2Q62A 1ZRMA 1K6JA 3EQ2A 1QRDA 3KYDB 3GRYA 3THYB 1DBIA 4Z1OA 3QYFA 4YLEA 4OQMA 1ABFA 1G7TA 4CEJA 2JJYA 2XODA 1E2EA 2W8ZA 4YMUA 1UEXC 2ZUTA 1MENA 4K26A 3GLFE 1ECPA 5B1YA 5U9CA 1RQLA 4GGPA 2AKAB 1KKGA 2G04A 4J3NA 5K0GA 1XK6A 1XIVA 4RIIA 3RTAA 2X0EA 1M2VB 3QVKA 2C5HA 2RHRA 2J5KA 1UDAA 2ZUVA 2AFIB 2WFAA 3PUWA 1AQYA 2G7MC 4BO5A 4O3FA 3JQ8B 2WIAA 3AP3A 4YNBA 3A2LA 3EFBA 2QD1A 3EARA 4OA8A 2OHXA 4RNCA 1YQXA 5EMNA 3R7FA 4W5QA 1O5TA 2YBEA 4PNHA 1HNWC 5EIWA 2IPOA 2IYEA 4BFTA 2QE7D 3B5IA 5LWQA 5DLPA 1CUWA 1TJNA 2AD1A 2NU6A 2H57A 3GFVA 2BM0A 4EHLA 3FLBA 3N8GA 3UFBA 3WYCA 3GEGA 3O26A 2CLIB 4MMXB 3WGUA 1KK1A 4ND2A 1SVKA 4H7HA 3JQRA 3C3BA 2PRKA 2F8TA 1SHTX 4M8SA 2WWYA 1WZEA 3VHXB 3DHNA 1B43A 4ROTA 1R10A 2WJHA 1SXQA 4EA9A 4CKZA 5HUQA 1JOSA 3FLMA 3CG4A 1AD2A 4V3BA 3T5BA 3FWHA 4URYR 1ISIA 3LLMA 3V34A 3EGXA 4OG2A 4PZLA 1ZMXA 3PIIA 3KUKA 3QQ5A 2B1RA 3E9ZA 1G3QA 2PA3A 3JTEA 3L7YA 3SVTA 3THXB 1SPBS 1JF8A 5A3JA 2X0RA 3MK31 1HQDA 3C5EA 4FOLA 2ZRFA 3PICA 4NRDA 4PYLA 5B64A 3K9WA 4AYWA 1M7HA 4FJ2A 3F1LA 2DT5A 1MB2A 2P3LA 5EHGA 4ME6A 3V4OA 2QAGB 1ZA2A 3EVTA 4U2CA 1WG8A 1U28A 2FPIA 2QRQA 4KQ6A 1GY8A 1UWLA 5DGDA 2C2XA 3SHFA 3UMJA 4WJKB 4GZMA 3P26A 4R1SA 4TS3A 4CU2A 1B41A 1NYTA 5L8VA 2DBQA 4DA4A 4UMDA 3ND9A 4XARA 1RABA 3KQWA 3GLGE 3KB1A 5L3SB 5DI9A 4GECA 1E5DA 2QS9A 2W6JD 3QE9Y 3O90A 4UW9A 4D3YA 1MOQA 1ZW1A 4R69A 3QTBA 5LYYA 4Z5XA 5I9IA 3PFIA 3HA7A 3QKTA 4K9NA 4Y2QA 4Z9YA 5ABPA 1XKXA 1LBHA 4UCQA 2J0QA 2PTGA 4A0RA 1DIHA 4G0NA 5ICFA 3BFJA 5TPZD 3ABOB 2FG7C 1B3BA 3OE4A 2WVGA 3Q5DA 2I6GA 2BFMA 3WWPA 4IFEA 4IX9A 3VPSA 5IAOA 4H08A 2ZI4A 1MXCA 3SKVA 2GESA 4B35A 1UOQA 2HJRA 1XALA 2H07A 1BJRE 1DQRA 3SXUB 1QTRA 4RGYA 1D6SA 2Z3WA 2P5TB 1TF2A 4PONA 1NBEA 1N2EA 1QDLB 2W2TA 2WFZA 4G5OA 3T9DA 5ALQA 2MSKA 5LQUA 2JLVA 3AF6A 1G3UA 1GDTA 2G72A 1DAEA 2X8JA 2YY7A 2Y1WA 2LNDA 4DDTA 3KZKA 1PK7A 4UXHA 2WM3A 3DDUA 3MLAA 2WTMA 1G8AA 1UZMA 1XQ9A 3D4NA 1QKKA 2EJUA 3N59A 4UEWA 4ZOBA 2BOVA 3FPBA 3CX6A 4OI2A 1KYWA 4IOLA 8AT1A 1AURA 4F71A 1YZFA 3QYJA 3TQSA 5IFLA 1E3IA 1LSUA 1HGXA 2WD8A 3QVLA 3NDPA 4LBYA 3IKVA 3K1JA 2RAFA 4I6GA 4QDTA 4KDFA 1RJ9A 2X0NA 5DM1A 4AMBA 2UYHA 3FSGA 4LF5B 5FRDA 3C14C 4KPYA 5TQ0A 4JXZA 3GRZA 2F2TA 3O3CA 3I9LA 3VU3A 3QPWA 3AR7A 3EDQA 1Y1RA 3NYWA 3ZHTA 2VDUE 5JOQA 1AJEA 4J0EA 2B37A 3VZDA 4GOOD 4HNAA 3IMGA 4D5EA 2P2FA 3QU5A 1EGVB 2MSCB 4M8NE 3NLLA 4JT4A 3KJHA 3JTMA 4UHHA 4UXIA 2XBMA 2D1RA 3EPRA 3E27A 1VI5A 1P4SA 2IA5A 3OD5A 1FFAA 2DWQA 1P18A 5AO9A 3ZDBA 1HURA 1PWEA 3LOUA 1ZJ5A 2ZR7A 4B3TB 1J8YF 2EBFX 2A94A 3F9RA 4GLFA 4LY9A 5CLGA 4KXQA 5AW9A 2OPLB 3LT0A 4XDYA 3L95X 1HL7A 2QUBA 4DRXB 2Q28A 4B0PA 4ZARA 3AUFA 4XQEA 3FI9A 1BS2A 3L6EA 4XIFA 1Z13A 4EB6B 3V2IA 3DVLA 1LDGA 3HMKA 4RADA 1WZ2A 3B3GA 3Q72A 1VCHA 4K2HA 8ATCA 1XWFA 1W75A 3U6KA 1B2RA 4FI3F 1JHUA 3I05A 3RRFA 5I7HA 4GE0A 2ESRA 1H6BA 3D6TB 1OREA 3WGIA 3WG9A 4M88A 5JJLA 2ZRDA 4TSFD 3A6HA 3IX7A 3TZCA 5AVZA 4A36A 3BE6A 4ZVNA 1YV9A 1L8AA 2XCIA 3JWJA 1KI7A 1P1HA 2GERA 3SYKA 3L4JA 3DPIA 3AHCA 4IVQA 2NXJA 3RH0A 2V0CA 5A1TA 1YK1A 4CM1A 4EAQA 4RTNA 2GUWA 2OG2A 2CFOA 2P3SA 2HF2A 4MEBA 3CO0S 4OX9B 3H1GA 3P7MA 2AG8A 1KQGA 1EFAA 1FL9A 3GMIA 2E6UX 1EVLA 3TLAA 4LYHA 1QGUA 1SC9A 3WB0A 3WQSB 1UBKS 2IYOA 4AQYC 2BMJA 1KZ4A 2OO3A 3ETNA 5E6UB 3A4NA 4WBNF 1SBYA 2W4QA 2X5JO 3QF7A 1QP8A 1U8FO 2P2DA 3ZCVA 1LPOA 3BTOA 4M54A 3SR0A 3Q2OA 4QEKA 1RTKA 2GCIA 1H6CA 4P7JA 1H1LB 1SVNA 3M4XA 3QVWA 2WIBA 1BWSA 3RFVA 4DWJA 1ACMA 2PYZA 1SA0B 5I8ZA 2IWRA 1N2CA 2Q1TA 1UOOA 5IRCD 1NV9A 3UMSA 1IATA 3DT6A 3LDHA 1I2AA 13PKA 4BX0A 2E5LB 5TT0A 5HS6A 1KRWA 3CKLA 3BUSA 4E2YA 2P9GA 3T1OA 4EJSC 1O6FA 4RW0A 4FFRA 4B7ZA 3S44A 1IQPA 1SXJB 2BJHA 4XQ0A 3AESB 3RYFB 4M0FA 3N8NA 4GKAA 4YUZA 3K8QA 2OP0A 1Z39A 1FVFA 1X7YB 1XVLA 2AZMA 2OO5A 4G8DA 3VC7A 3W2HA 5IPFA 3ZIAD 1TAUA 4BTVA 1L5SA 3IBGA 2PSJA 3LY9A 4KKVA 1IN1A 1ZC3A 2Q1XA 1E69A 2VO1A 4O4IA 5JY6A 2PBRA 2XB9A 2C5AA 1EHCA 2XPCA 4FFBA 3IKLA 5J9FA 1Y8CA 2I9PA 2WT4A 1DAPA 2C4TA 2J4FA 4HLQB 4CLOB 4AMYA 1O94C 1B6GA 4FINA 4ND8A 1KGSA 3VPGA 5A9SB 1LU9A 2B36A 1DKOA 1Y1PA 4ZMSA 2LVBA 4K6OA 3IBFA 3C6KA 4PAWA 4QTTB 3F8WA 2VK1A 1KP2A 4C0JA 3AT1A 5K3AA 3DB2A 3WS7A 1QWIA 1NG1A 1MQ8B 2YHUA 4Q47A 2AXPA 1SOVA 1UPFA 3T5DA 4CMCA 4HX5A 4B74A 4CT5A 4V1CB 4M83A 3C39A 3OLCX 4YY3B 3JQ7B 5F77A 3AVQA 3R44A 4YP1A 2JLXA 1QPZA 2RGRA 4ABYA 3WK8A 4NE7A 5K05A 2CXXA 1VP3A 4E31A 2A9OA 2P5YA 1YAHA 5DT9A 4EA6A 2CDRA 4LFAB 2PLFA 4HMQA 2JIBA 2P2GA 3H17A 3FFAA 3COYA 2ID9A 5B7QA 1PR9A 2XYVA 3B70A 3PSAA 3LQ1A 3RS4A 4WFQA 3WK5A 1TB4A 4MJ3A 5TJHA 1BDHA 4M6WB 3W6PA 2OB1A 5I45A 3HUUA 1SBTA 2YWFA 5BN5A 5CJ2A 2BCEA 1A98A 3T3MB 3KXWA 4DCNA 4DGQA 2EJBA 3NZEA 1ZRNA 3IKJA 1Z38A 1P5JA 4Q12A 4L8WB 4LNAA 2JJ8A 4HAYA 3GVXA 3QA9A 1DOZA 3S2GA 4RHFA 3UHFA 1XTQA 3I61A 1JALA 3EEBA 3IT1A 1ZGJA 4Q7QA 5AD1A 1VKJA 4XQCA 2CYAA 4FTWA 3P2YA 2XQKA 1JYFA 1C80A 1NM5A 1JDBB 1YR2A 1GXSA 2RIPA 3AEZA 2QKYA 2WSMA 3U60B 5J4HA 1GDHA 1GEGA 4ZT5A 3RV3A 4Z9XA 3OJFA 2FX3A 2B30A 1Y3CE 2VRBA 3A9CA 1W88A 1OPXA 3T99A 1MXHA 4BMCA 5A9RA 5C1IA 4OFWA 3ED5A 3BJMA 2L19A 1ILWA 4UAGA 4H9GA 1MJGA 1EJ6A 2ROQA 2VQ3A 1DMRA 3W77A 1KTIA 5DN6A 2CT8A 1I94B 1JQLB 3P9XA 1O7JA 1AKUA 4JDUA 4MV8A 5EI5A 4CV0A 1RU3A 2A78A 4HGPA 4P0TA 3HBJA 3A1DA 3E23A 5L3RA 2WF7A 4GT1A 1CIVA 4AJNA 2CDCA 3GUYA 3TNJA 2JLBA 4BVJA 4DS3A 3HM9A 5E9AA 1C8KA 3R0ZA 4D79A 1NXXA 4GDMA 3AG5A 4G1VA 1FOEB 4CLEA 4TZ6A 2QYOA 1VEHA 3NWOA 4JP5A 4HAZA 1HDXA 1T43A 1NBOA 3N2EA 4P0QB 4OHYA 2Q6LA 1RD4A 3QXCA 2GO7A 5J43A 3LVFO 1E9EA 1A9XA 1KYVA 3PENA 4Q4CA 1ORHA 4KSCA 2ZBDA 2C1XA 3HUFA 3FYSA 1SURA 4N5MA 1DMSA 4O8CA 2WU8A 5FQOA 2DG2A 1G5QA 1NRWA 2GM4A 5BXYA 4E88A 5FBZA 4RVUA 3SIWA 3W5DA 3HS3A 3CRW1 4NC9A 3PEUA 4KO4S 1C3LA 3EOZA 2C7QA 3BDVA 4JK3A 4RSMA 4MRVA 5JHHB 3REFA 3LA8A 2O8DB 1W19A 5DTRA 3NNDA 2JATA 1JEDA 2IUYA 2I2WA 1Z82A 4GPBA 1QK4A 1BC5A 2GWRA 4EEKA 1U9CA 4Z9AA 1QGZA 4MHTA 4EY6A 4YO8A 4FYHA 1QCCA 2BCJQ 2AJDA 2R5WA 4J2TA 1XMPA 4RU1A 4DQKA 5LMUB 4JODA 1JPVA 3LX6A 1FX0B 1P33A 3LYLA 2B5WA 4K9OA 2Q7OE 2PH1A 4H1HA 4E4TA 4LF9B 3HWWA 1SCBA 2C57A 2HMUA 5EZYF 5D3MA 2LIVA 3CFYA 2R2GA 4BNFA 2OR3A 5KQLA 4BLTA 3HO1A 2NZXA 2OO4A 4QU0A 5F4ZA 1AQLA 4OH7A 3K6JA 1Y8AA 2Q3LA 5GZ6A 3UAZA 3QU9A 3OPQA 2NO0A 5J59A 2OL4A 1L8OA 3FI0A 2X86A 5JFTA 4OJQA 5D3KA 4ZPJA 4CTOA 1I2BA 3UAYA 4JCCA 3PNVA 5JI3E 5CDFE 4RY8A 4Q4AB 1L7VC 2P2CA 4BNMA 4RA9A 3PEEA 2HB6A 4EKDA 4DV2B 4WCDA 2DJIA 4DG8A 2GHQA 4RD2A 4UVEA 1L4LA 1M66A 3HH8A 4PR0A 1KIMA 4IDQA 3CNNA 3R7NA 3SQMA 5C7OO 4GZLA 1AUQA 5LZ5A 2JEOA 1VSQA 3GPLA 4H1TA 1PW7A 1LZLA 1PJSA 1VFPA 1UBMS 1P5HA 4PUGA 1HE2A 4WZ6A 1H05A 2VTVA 4NU0A 1J5EB 2DGDA 4MMYB 3ADPA 4IDDA 4Q3CA 1CY4A 2P30A 5COQA 5IN5A 3QK7A 3ZHVA 3PHCA 4ZT4A 3TGPA 4HNQA 1CYDA 3C7TA 5JCZA 2O7NA 4LKRA 1DCMA 1IG0A 2GYYA 2PV0A 2ZZKA 4XPZA 5B3AA 4G1MB 4CM6A 4WOJA 3H42B 5HF6A 1IBSA 3GGJA 3LY5A 4N6NA 3CUWA 3GJTA 3HV2A 5ECYA 4C29A 1JJFA 2ZYWX 3D7NA 3OZXA 3FLEA 2B78A 3N2GB 4N5NA 3MTAA 2ZM6B 7YASA 3WLPA 3MMXA 3QU7A 4WH0A 3RHSA 4OMUA 1N5RA 2JS7A 3HYLA 1GLGA 4R3WA 4C6RA 1H6AA 1SXHA 1N0WA 1BHO1 3AQ4A 4XD7D 2H52A 4CKEA 1ZVQA 3Q9NA 1Y5MA 5SZIA 4A3SA 5CBKA 2OCDA 4FNOA 4GRIA 4IX1A 2Y0DA 3KX2A 2VS1A 1U2ZA 5EJ4A 2H4HA 1YZLA 2E4WA 2ZCUA 4ZVRA 4LFCB 2B4TO 3MTEA 3H2KA 4ENPA 5FYDA 2QLNA 2ET6A 4MW5A 1SR8A 3SOZA 1ST3A 1EG2A 3ZK9A 2Z9CA 5CPFA 1E94E 1LS6A 1P29A 1QNFA 3K8ZA 5EWLA 3BM5A 3GPBA 5EC8A 4BJHB 1NMXA 2JDID 3OTIA 5MN5A 3WHKA 2R7MA 2PLRA 2Q50A 4XWAA 3X1JA 1R8SA 4E5PA 1MO2A 2GI4A 1RZUA 4B2PA 5KREA 1SUWA 3LT2A 4MIKA 3AGQA 1RQXA 4IMRA 1KMIY 4OY3A 5I51A 4JYAB 4PG8A 3QF4B 3N07A 2REOA 1BS1A 3E8SA 4J91A 1VECA 3I8OA 2BFFB 4PCVA 1UMCB 2ZSAA 2A30A 3DOIA 2HWYA 5CDFA 3DE6X 3EMKA 4E6PA 5KOHB 1CPYA 1QHHB 1T9GS 3X1WA 1CJBA 4WA7A 5JS1A 2J1LA 4CRWB 5ESRA 1X74A 4B6FA 2BN4A 3KQHA 4AZ0A 3G6WA 2XEXA 1PFUA 3UANA 1FXUA 3K5WA 2UUBC 1XAGA 1GN8A 5AVSA 4ESHA 5K01A 2JLSA 3OJCA 4UOEA 3QMWA 2Z57A 2K7FA 2G07A 1Z0IA 3LCMA 4B7CA 1FFWA 4HUQA 3ZHOA 4NQRA 3ZNPA 5LQKA 1AUOA 1Z4OA 4HY3A 5D8DA 4YV1A 4GPEA 3STYA 3CM0A 5CIYA 4Q4DA 4CVNA 4PWZA 1ZBQA 3LOPA 3KFXA 4QWMA 2YWXA 4RFLA 5THKA 1PE0A 2IHYA 4RTQA 6YASA 2XMPA 3ENNA 2X77A 1OD6A 1S9DA 2XB4A 2D1FA 2P5SA 5ADWA 2G8NA 4JBIA 4YRZA 1NGSA 1JUDA 1RKVA 1UBTS 3TRDA 3UC9A 1GYRA 3L4EA 3C6MA 4PS1A 1Y1KE 1U0GA 1M7GA 1DUVG 1V8FA 1XRJA 2GZSA 1OT3A 2PO7A 1TKRA 4KIJA 3HLYA 4Z9FA 3RQIA 1EFKA 4IO1A 1QGDA 3ZXSA 1W49A 2WMYA 4X63A 3UCFA 3H2IA 1Q84A 4UUBA 3W6OA 4B9EA 3AEKA 1PG4A 3FYUC 3N0TA 4LHZA 2Y0EA 1T8WA 2ZRHA 3G59A 4Q7MB 4ZVMA 2EZ9A 3UJAA 5LIRA 3I09A 4D9NA 4F4IA 1ISSA 2OQRA 1N2JA 3KZMA 3KAQA 2GYUA 1Y6FA 1RRFA 2Q5FA 5DNDA 3VR3A 2H7VA 4EJSB 1LPSA 2E49A 4BO8A 4BO2A 3LVQE 1H94A 2F3SA 3W90A 4QOFA 3L9WA 1XZGA 3DD5A 5IUKC 3UMYA 4QEDA 4G25A 3CEAA 3H3FA 5LNK6 1DWUA 4H7EA 1PYDA 4KGZA 2VJOA 1HSZA 2ZUUA 5F1YA 4MGYR 2CJYA 1Z75A 1AQ6A 2WM9B 1UP6A 2Q9AA 4H7KA 4BBPA 4BQNA 2UZIR 4J0FA 2PX0A 2EGUA 3E0QA 3AHDA 2YWEA 3HYTA 3OZEA 4FKBA 4I1SA 4OU5A 1FQKA 1PQWA 4Q7JB 5JY1A 1GAXA 3D8TA 4LV6A 2ZETA 4ZAGA 3TTWA 3WKAA 3K32A 1CG6A 3ZDEA 4JL5A 5BSFA 5I6DA 3OUZA 4Z4HA 1O6GA 4PC1A 5AVOA 4DTIA 2A5GA 2W8BA 3EZ2A 1KBOA 1J39A 2SHKA 1L7XA 4GI7A 5IF3A 1QO9A 1FUIA 3K0AB 3TSOA 4DEVA 2Z83A 4HD8A 4DV5B 4RX1A 3SN6A 4NOMA 3TX6A 4LGCA 1JT9A 3LQFA 1W0JD 3T12A 1DFGA 4TWBA 3M6MD 3SCZA 4QE3A 3ZWBA 4DLYA 5JSHA 4MV3A 5F73A 2O0MA 4BB0A 4DDKA 5KTYA 4B3FX 2Y66A 1W9MA 1XTUA 2I1VB 2O8NA 2JIOA 4JFRA 4M99A 4OHRA 5EJ5A 3GLFA 2H1VA 4R5HA 4F5EA 3FMOB 2G67A 2QUHA 3GU3A 4I50A 1I51A 2PMCA 1U2DA 1Q2UA 3QLTA 5JYBA 1NVVR 1SC3A 1ECGA 1VBNA 3Q5GA 5AE3A 4N9QA 2XUJA 3WYDA 3BGSA 4MRNA 2P2BA 2P4QA 2FETA 1XRPA 2V7XA 3ZZ1A 1G5PA 1YB4A 2VPZA 2GK6A 5CA1B 1SO8A 8LDHA 2Y1LA 4YRFA 4LZOA 4CIYA 2PUWA 2E2WA 3RYHB 5IHPA 3W5CA 2ZB8A 1P39A 4R83A 1O94D 4OSOA 4N03A 1KMHB 4MMZB 1W2WB 3FDIA 1WPRA 1LW7A 5C5EA 3ILHA 3VYUB 5KZMB 1XZJA 4YTEA 1JEYA 3KDAA 1H22A 1KAGA 1I5OA 2OENG 4UREA 2DFPA 1DOAA 3HSSA 3OU6A 3KQUA 1YCDA 1K6MA 4UKDA 1G4UR 4ZTBA 3ZDXB 4R1QA 3WGNA 3ZDCA 4CQJA 2E4VA 1ZD3A 1YDFA 4HAWA 5HP4A 1QFXA 2A9QA 1J21A 1RKXA 3I2FA 3QKRA 1S8FA 4D0RA 1I01A 1I7DA 3HP1A 3JWGA 3GNSA 4IUCS 2EZUA 4EHDA 1W1WA 2J0SA 2Q5EA 3KOMA 5BN4A 1XQVA 5ER9A 2ZREA 4UEOA 5CD9A 2PSEA 3I04A 2O8CA 3IP3A 4MI3A 5KNDD 3RIMA 3KXIA 4C0AC 2H1LA 1HT1E 3G49A 1TL7C 2A33A 4FYXA 4ADSG 4QGBA 3PX2A 1XCJA 4TKUB 5B57C 4ID9A 2CMKA 2W6CX 3LQKA 3ABQB 1KI3A 1VSBA 3JVVA 3TMAA 1IEQA 1CZNA 4ZDJA 2V5UA 3P8ZA 1ND5A 3GA0A 4GOMD 2XDWA 4ENQA 2G9UA 4RV9A 4QBFA 1DQZA 4D2IA 4BLOA 2FUNB 4U00A 5EMJA 3GCDA 4N7JA 4QXPA 2VTBA 4PVCA 5B3JA 2BIFA 2B9EA 2QD3A 1MOPA 1G42A 2XTAA 1T0IA 2GXAA 3H2TA 1NDHA 1R74A 1QU2A 5G4KB 1YTLA 1IBCA 3LCJA 5G02A 1NBIA 3HJBA 5AW7A 3DZBA 3SQXA 2E89A 4F8EA 1LVUA 2V6MA 4WZAB 4BNXA 3ONNA 3G5AA 5DRTA 3UJNA 3MC1A 1Z6GA 2YIJA 4KFRA 3ZGXA 5HIIA 3GPIA 1RVDA 2QV7A 1JWLA 4RTOA 4O1MA 4PLWA 4IINA 1F8UA 5K8FA 4PGAA 3T41A 2LXNA 4RK0A 3V55A 3ABIA 4UAJA 5P21A 2R11A 2DMRA 1E32A 3ETHA 1HLGA 3PB3A 3PVSA 2BFDB 2XQGA 3OM9A 3QTLA 4MITA 5J2UA 5HW0A 4X60A 5K3FA 3X2SA 2G0AA 4FX5A 5JWHA 4FNMA 1SHLA 2F67A 4EF6A 5CT4A 4BDSA 2XCRB 5MFPA 4PX9A 3MQFA 3ZXUB 1T8RA 4UUOA 3GDWA 5AKEA 5EWMA 4BQRA 2VXBA 1DOHA 1WOMA 4URVR 1WXWA 1NI4A 1KZ1A 2EQAA 2P6PA 3O9MA 4OOFA 4BO1A 3CB4A 1NTRA 3PA6A 4NZNA 1BNCA 1Z8NA 4OKSA 2HREA 4PZDA 2BGGA 2CXCA 2KX7A 2CLDX 2QU7A 4LWZA 1NXOA 3T4PA 2KDNA 3FNBA 1FDSA 1K92A 1V1RB 2RI1A 4E15A 4COOA 1HOTA 2J9XB 1W4LA 3UXEA 3S4YA 5FTWA 5EFZA 3I9V6 2REQB 4DN6A 5KWJA 5SICE 3WBKA 4COKA 2IWHA 1GNRA 2G28A 4N9WA 3KT0A 4W9RA 5BMVF 2QRNA 1GAQA 1D5CA 2XTNA 2R8EA 4I9FA 1WX1A 2PAAA 2PT7A 1MP0A 2W2MA 3KOUA 1Y80A 1U1GA 2VPTA 2ZP1A 4PX2A 1XDUA 2IT1A 4JGIA 3TUFA 5KQRA 3X1DA 1DT5A 4FB5A 1GPUA 4LOAA 1IVNA 3PZBA 2ACVA 3WYEA 5HM6A 4ETWA 2YQ4A 2VHYA 4KSYA 1AUVA 4Y6SA 3I1YA 3MEQA 1OR8A 3U19A 4GKKB 4EK9A 3AKZA 1DAIA 4KXYA 3JQ6A 2DKFA 5LA6F 1F3OA 3K9BA 5EGSA 1U0SY 2C7OA 1FB5A 5EVCA 1BGWA 3EX7C 4EI7A 1K4KA 4PRKA 4S1OA 4PCAA 4Z2AA 1A7UA 3SZOA 4EG6A 1MH9A 1NVEA 1KYYA 1VJCA 2Q5HA 4Q37A 1V4NA 5LIPA 3KQYA 1SCAA 2FF7A 3BMCB 3AOGA 4NU6A 2EKPA 4UU8A 3RKSA 5FLXA 4ZXFA 1CUBA 2IYUA 2UXCC 1P9NA 3MCAA 3BSWA 1X1QA 2AI1A 3O9ZA 4RNDB 3TUIC 1ZVVA 1YQGA 3L4SO 1XA0A 3D5QA 2W2KB 4ZHQB 1CE8A 1XKTA 3H5IA 3DB1A 4UUPA 3N9IA 3ZCRA 4EVRA 2UYCA 2O1WA 3SHQA 5ITWA 2ZJ8A 5JFOA 3T3NA 1LBSA 4WY8A 3ZQ6A 1HLFA 3C74A 5FL7A 3JVUA 2YVLA 1Q19A 3VR4A 3JR3A 2QUKA 3SXPA 2OGUA 4GYJA 4HBGA 4IEEA 1G8JA 3GZNA 3UWDA 3PC3A 5COAA 4YJ2F 3FOFC 1TIKA 3LUBA 4ZREA 2DUJA 2QT9A 2EFDB 4KBGA 3D3NA 3KUUA 4ES6A 3DQQA 5JAMA 1M76A 3CR7A 1P0QA 4BKRA 3E81A 4OJMX 3D1LA 3CWZA 3OQIA 1D4ZA 2YN4A 4PLTA 1DV2A 1KEEB 3BWVA 4KFSA 2HT6A 5EG5A 3AIOA 1EM8B 2WNIA 2OQ2A 3QA3E 1IDN1 4ANFA 5HOQA 4LMBA 2ZWVA 5HGJA 4PZ0A 3SBDA 1A5TA 1CUFA 3LE8A 4N12A 4E21A 2BMEA 5ALKA 4ER0A 1JSRA 2V8OA 4DRYA 4S04A 1YRAA 2C5SA 1V6CA 5TS2A 3ZU6A 1H3EA 2ORIA 1I7PA 1X9IA 2VJQA 3PV0A 3OHPA 4PSVA 4KO3S 3QQPA 3KZCA 1GZ7A 1NFFA 3RM3A 4EBBA 1DDGA 1I7LA 4DMFA 5IDYA 1LLFA 4IZIA 1JHMA 3E61A 1HWYA 5IK2A 1CFJA 5DLYA 4BMVA 3E0XA 4YAFA 4KYVA 1RLOA 2D2EA 1SEVA 2UVPB 4FU0A 5KVAA 2J0UB 1K7CA 4D80A 2GPWA 1T34A 3CA8A 3UW1A 3BTVA 5GM1A 2HO5A 4M9ZA 3MZ0A 3LNOA 3GBSA 1K5HA 3NB0A 4Q3OA 3E22B 1L7DA 3Q3HA 2YC4C 3GJRA 3R40A 3MRSA 4IWXA 4ZT7A 1I80A 3RVSA 4JR2A 1DQPA 2IVFA 3E48A 4MJXA 3JRWA 3EFHA 3CONA 3OO0A 2ZI5A 2C99A 2QP9X 3R3JA 4P5PA 4IQFA 1L5NA 3HLTA 4DCOA 3P94A 5A3RA 1SCQA 3NOVA 2WSIA 3I2GA 5FPTA 3G2NA 5ARBA 4FX2A 1G7SA 2NO4A 3DLCA 2DH5A 3FHCB 3B6ZA 4LDAA 2OD7A 3F97A 1B0UA 5IM4A 2FRDA 4WXMA 3RVRA 2FX2A 2QAIA 1JAXA 3G6KA 3WB1A 3NHRA 3GDGA 3ZGNA 4MB2A 3CURA 2VDRB 5JMOA 3J81A 3WRVA 1NRXA 4RPGA 3PC6A 2WC1A 2QN8A 4TN1A 4OQFA 4HWKA 5CEFA 5AVTA 5CFPA 2OXRA 1Q7RA 5CLFA 1L9XA 4PGGA 1X80A 3BRWA 1UJ4A 1W85B 1UPTA 1EA7A 2OFWA 3KEOA 3TL6A 1QHSA 1VCIA 5ALJA 3VV3A 4OOEA 4B3JA 4ER7A 2PE5A 2P2LA 3IOBA 4OB8A 3GAFA 4OHBA 3G0GA 4PV7A 1BQEA 1B73A 1GPBA 2IOHA 2PGJA 3V00A 2P6RA 1XZNA 4LQCA 3MINA 2GFIA 4RVNA 1VBMA 3JQDA 2VDJA 3TW8A 3DDCA 4BVFA 2YWJA 4EF4A 5I7UA 2GCNA 2OUKA 1FJXA 3KT6A 4IY1A 2YQZA 3B20A 5A2GA 4LPKA 2FCRA 2B1JA 3IULA 4FFNA 4M9UA 4BRWA 4D4HA 3U3JA 3QVGB 4X1YA 3VQTA 1XV5A 2BTQB 2PR2A 3VHRA 5IYZF 1W5EA 4GKJC 1CETA 1L5VA 3ROQA 5JJIA 2EIXA 2ARKA 1U2GC 3A6GA 4LYAA 2BZSA 1SHUX 2QNRA 3BS4A 4MWGA 4I99A 3CCCA 5FWAA 3T3OA 2O2YA 1XGKA 1WCJA 3PZRA 1CZKA 2FVXA 3N2KA 1MORA 3R3SA 3M9XA 1RAGA 1XX6A 3OKAA 4I5IA 4YI3A 3S8MA 2AYAA 4KQXA 4A2WA 4AVYA 2O8FB 1CRPA 4ZI7B 1M2OB 2GCPA 1HE5A 3L41A 4NZMA 4CLRA 2VDVE 4YI5A 1SY7A 3SM9A 4YV7A 1G3MA 5WRFA 3UT6A 1RLMA 4KQWA 4YC7A 5JE8A 2PT6A 3RK1A 1I36A 1ZS9A 1ZOPA 4AX4A 3RYCA 1ORIA 1UJBA 2WAMA 3FYDA 2XY4A 4K88A 2UDPA 3IVMA 4MPPA 1PEDA 2NX2A 3K0KA 1A9PA 1ZRSA 1QIDA 3U7JA 3VU0A 1JNYA 3OOEA 2W9XA 4L02A 3EDCA 2XOKA 4Y18A 3QG1A 4IDHA 4UVHA 4U9IS 1MABB 4BTEA 2IEYA 2WHRA 4XR4A 1LDEA 1G0NA 4AUEA 5AQ1A 5AIBA 1SKQA 3TEMA 5JQGA 4MNTA 2W6PA 5A6SA 1CR1A 3PNYA 3CRVA 4NV0A 3BGDA 3R3HA 2V5VA 3JYQA 4MLCA 4QPJC 4NHOA 3URMA 4DR5C 3K9GA 4FDVA 4M1TA 3W2IA 1TC1A 2D2XA 4MDHA 1VMDA 2PX5A 4HDOB 2J4DA 1T5OA 1KE1A 3LCUA 1BD3A 2JF0A 4ZTZB 3F6SA 3IPRA 4FFDA 1YQEA 3RBVA 3A04A 1QCZA 2WHEA 5AP9A 2ZRGA 4II2A 4ZC8A 3PFWO 4F12A 3P71T 2FFRA 3V2GA 1Z08A 5C4MA 4OQLA 3QKSA 4HATA 2EG9A 3WYBA 5K8UA 3O82A 1UDRA 2PYDA 5LVAA 1GPH1 1ZX1A 1XJQA 4O29A 2YRWA 5EPOA 4JASB 4YAOA 4E51A 2QYHA 1WHSB 3ZDAA 2A86A 3EEFA 2HWUA 2WU3A 3PXDA 3T1YC 4X6YA 1NUAA 3A6LA 2R3SA 4WNIA 2XUGA 4B81A 1Y4UA 4NZPA 4LA4A 1A3CA 1H0KA 4MS1B 3V4VB 2KS6A 1M0TA 4KACA 4EHKA 3ZE6A 1XYVA 4BLPA 2FQYA 4PYOA 1TXGA 1Z7EA 1B8UA 2X3FA 2O5CA 4L8GA 1PKXA 5JNLA 3FKJA 1VZ3A 4QHTA 3U7EB 1Y9AA 1H8EA 3OIDA 5LBIA 1UZAA 3NTOA 1DRWA 2RHDA 3H2HA 4Y1FA 3LCRA 4J76A 4CM5A 3D3KA 3CLRC 4YR9A 1KMCA 2B99A 2OGTA 4B3XA 2PL9A 4CQLA 1LTKA 5SY4A 4W5RA 3MILA 5AXDA 2ZVQX 3EMVA 1O5IA 4JI6C 1T1JA 3KPVA 4YBZA 2IHJA 4G1EB 1P72A 4DNXA 4X94A 1S1MA 3WDSA 4PN7A 2WYIA 5B6JA 2C98A 5B1DA 3A37A 2Y76A 4X7RA 3E9QA 3WGHA 2YHSA 3AEUB 4BP9A 2WT9A 1IK6A 1WNFA 1OX5A 5AT1A 4QXRA 1JPNA 3W9UA 5LZ8A 3P9SA 3UKJA 2JLCA 1ZGAA 1EEHA 2PZAA 4UVIA 2EC5A 2CXOA 4AF7A 2WSSA 3QEAZ 4RJLA 1VQ1A 4MR7B 1Q83A 3NIBA 4S12A 2QQEA 5KINB 1C3XA 3RTGA 1XTIA 1GPAA 1TJPB 2GD1O 2AC4A 3DKPA 5EKDA 2QQGA 3Q7TA 3W8RA 3GG2A 4OHPA 2XKKA 5F1KA 5K3DA 1C81A 2WUGA 3A9UA 1GD1O 4CCWA 3FMIA 3VR6D 1E2IA 4GYWA 4NBVA 5EYPB 2IYWA 4BFWA 2ODQA 4OBWA 4ZVPA 1H9CA 3N8IA 3GP5A 5CZXA 3R7WA 3QVMA 1EXNA 3RARA 1NW4A 2PX3A 4FVTA 5GTDA 1O8BA 1YKFA 1G8PA 4ZYWA 1ZJJA 3RQSA 1KXJA 2FPLA 4JJZA 4KMSA 4FDTA 1YZ3A 4JLNA 1O54A 2X3UA 3TNDA 3ICEA 4NV1A 1MEEA 3M5CA 3UGKA 1NZDA 2E7GA 1Y98A 1OLUB 3CEPB 4Y2YA 3GARA 1H5NA 3B38A 1CR2A 4L28A 5DH9A 2MYNA 4FQ7A 1DEAA 3KWFA 3EWIA 1BW9B 3VH4A 5JCOC 4JELA 1QH8A 2JEYA 4QULA 1Y9DA 1GTVA 3AILA 1QV6A 2RC5A 2VUHB 4GAEA 3AHHA 4H1VA 1SZCA 1P1BA 5FP0A 3SZRA 1S02A 4XW2A 3B2EA 2H1WA 3K1YA 5H82A 4NOJA 1E61A 4Z7QB 1LV7A 3NFRA 1QFJA 1KWGA 2AEMA 3DKRA 1XZ8A 3ZDYB 4JX8A 5A3VA 2OSBA 1BOOA 4M0MA 2FN8A 3BSSA 3P9KA 4B4UA 1NQXA 2OFPA 3PDIB 5FAXA 3F4KA 4ZOQI 1NPDA 3WISA 4DDWA 1SAYA 3KKNA 5FORA 2WWVD 4DV4C 1U2SA 1FSZA 4P98A 4HQKA 3RRMA 2RHWA 2Q2VA 1T6XA 1A5ZA 2IPLA 3PQ3A 1DIOB 5L4LA 1KE2A 3NAZA 5AJZA 4GI5A 1ZSYA 2VP0A 2M1ZA 2I3AA 3TQQA 3G8YA 1M2HA 3B9PA 4NBUA 3Q7EA 3I6IA 1V60A 2OHVA 2WOOA 2PX6A 1ODJA 4LC0A 1GGMA 1XTBA 3WGYA 4C0BA 1PUIA 4QO8A 1Z9BA 3I6ZA 1VG1A 3R7BA 4WMLA 4H6WA 5I4IA 1J7KA 5LP6A 1KZHA 1O58A 3C15C 4BQEA 1EX7A 4NCIA 4XB2A 2NVBA 3IUEA 4HDMA 1VJTA 4OHXA 4P08A 2GPSA 3D81A 5EIHA 4H3KB 4OD0A 2ZI7A 3ZNNA 2IS4A 1OTHA 3JZDA 2QU8A 3HADA 4R2KA 1M6XC 3RK0A 1LQLA 1N0HA 1RXCA 2VDKB 1IB0A 4NOZA 4J16A 1D1QA 5L3VA 2P2YA 4I55A 3IUSA 5FLXD 2NOAA 4O1IA 2ZRAA 4Y2UA 5D6NA 3G88A 4M22A 3X2EA 2R1VA 1JHQA 4MRPA 4QATA 1F1BA 1NRJB 1SKUA 4H2DA 1R5BA 4LF8B 4KIGA 4F92B 4C3OB 2R6AA 5JTUA 5KTTA 2HFKA 4MX8A 1YE3A 3P19A 3I12A 1M6VA 4X24A 4XPIA 5FHRA 2R6FA 2E55A 3BIFA 2EFCB 2VNKA 3K1TA 1U7WA 3U4CA 1MUUA 4I4TA 2HNKA 4U0JA 4TTIA 4V0OA 1O9HA 4AG5A 2X8BA 1KJIA 4BVBA 4CTMA 5C9ZA 3DVAB 5LQCA 1K9VF 3QELB 3VU9A 2E4AA 1U5BB 2H59A 1QP7A 2HPZA 1QKJA 1ZSVA 3NYIA 1QV9A 2QVYX 1TZ2A 1JIUA 1WUJS 2PU5A 3E1SA 3AKYA 2PBZA 4RE6A 4PU0A 1WIWA 4KAFA 5LM3A 1H0SA 1AKVA 3LS2A 4S0XA 1JWAB 1NUTA 1U3DA 3CH7A 4UFNA 2D3WA 4Y1RB 1EGHA 1E0DA 1D0VA 4XWGA 4M9RA 5CR9A 4YUVA 2PUGA 4XM0A 2ZAIA 2XWQA 1P44A 4OCZA 4Y2XA 4YAJA 3T6KA 2GN2A 1TA4A 1UK7A 3NV7A 4FYVA 1Z5PA 2ATWA 4TX1A 5DYYA 3REOA 1Y1TA 1SCUA 2GAJA 1RM0A 2ODPA 3AB3A 3B1FA 3GEMA 3K15A 1KAHA 1DDIA 2MYTA 2QRZA 3IESA 1UT5A 3KTAB 1SIOA 1JTVA 2IYSA 3O3MB 3DKVA 4BB9A 2Q5JA 3GLIE 2VZ8A 1BXKA 4MW4A 4B82A 1A5SB 1CY7A 1PZXA 5IBRA 3NUZA 2IZOA 4OUKX 4OMFG 4JLKA 4X1IB 821PA 5HZHA 1OFUA 4H3VA 5CIWA 3ESBA 4UOZA 3LUKA 3WGOA 5ISMA 5IVKA 1T0JB 3AUTA 2F4NA 2UU9C 1YFJA 2VLBA 5BRAA 3FCCA 3HA5A 3MCVA 1XDSA 2ZZNA 3S5JA 3ANNA 4EP1A 1Y82A 2I1LA 1H2RS 5H3LA 4YUAA 5EKSA 3MJCA 3S6JA 4FR2A 5B2ZA 3VZCA 2GFHA 2HDHA 2ZPTX 4I46A 4YJ3F 4QUKA 2C29D 5AIAA 2UVDA 2PMEA 1EBUA 1ZISA 4YA6A 1D2AA 3L0DA 1CR6A 1ZM4A 3C8MA 3F7OA 4KDEA 4KFTA 4X8MA 3NCHA 3C4VA 2RHLA 1T9KA 4YMVA 2WWHA 3BQNB 4BASA 4EYKA 2DWPA 5KYYB 1ONOA 2ZSJA 3KJZA 1FUEA 4HEA6 1B74A 1DEKA 2WJPA 3KFVA 4LZNA 2WAYA 3RAGA 2DPXA 4F9TA 5D85A 1RCTE 5CAEA 4EEZA 2JLZA 3HN6A 6NULA 1BTOA 3RGGA 2GLTA 3DO6A 1Y3HA 3MN1A 4HGNA 2CLMB 3PCTA 2FOLA 1EWTA 4JEMA 5HZGA 2HHHB 1VTKA 1Y1LA 3GFRA 2V7VA 4PSCA 2H06A 4CU5A 4II3A 3ZHYA 4B84A 3RPEA 3A9TA 4LRQA 3K72B 1DO8A 3W2FA 1IOWA 3GGPA 3L02A 4HH1A 4Q19A 1Q20A 1I0ZA 1RADA 1W0KD 4OSEA 4D57A 4HPJB 1Z26A 1E2GA 1JKIA 3DFMA 2Z2YA 1GPMA 4FN4A 3Q41A 1SD2A 2R87A 5KNCA 2JEZA 2QP4A 5HA5A 2YRXA 2WAOA 1QJCA 3CNOA 4FBGA 4LVNA 2BP7A 5KHOC 5TVKA 2DFDA 1OYYA 2HL6A 3L6BA 3PF8A 2QG4A 1Z6PA 1TX4B 4RACA 5G53C 3R9KA 4CG3A 5JDIC 1TKAA 1FMTA 1UKAA 5F3RA 1EQ2A 1XZDA 2GASA 1LDYA 3UFXB 4KR2A 2HU2A 5FWNA 3TIGA 1ENZA 4DCMA 2IBTA 2C97A 3AONB 1WDMA 3HP7A 3JQFC 2HO4A 3B6IA 1LRLA 5CYPA 1J1ZA 1XVAA 2X9QA 1DQNA 3ANLA 3MJHA 3OKPA 1S1CA 2EX4A 3INNA 4WE3A 2OA0A 6REQB 3S99A 3GLIA 1Q1AA 3O8RA 3SHWA 3O3OB 2A1IA 5DHTA 3SC4A 3AUSA 5ARDA 3MWFA 1O95C 1JEQB 5IVPA 4LXIA 3RHTA 3KYCB 3T95A 5HNKA 4GFDA 5JNVA 1TMKA 3ODGA 1MB4A 4HGQA 4KUHA 5JH7A 4WD3A 2CV2A 2PLWA 1ZK3A 5BWCA 1CULC 2HD4A 2PUVA 3ONWA 1OX6A 4QQNA 4F11A 4EY3A 4CE6A 1UBGA 2QRPA 2VCHA 1A4RA 1VPWA 2FEKA 3P2OA 3DNFA 5JAZA 1MDFA 1UDBA 3LIPA 2AZ4A 4KI0A 4AXBA 1VRCA 1HLDA 3BIWA 1BYIA 5IN4A 5IXYA 5ALIA 4BX3A 5MN4A 1PU2A 4C9BA 1M1ZA 1TYBE 1UM9B 4B8ZA 1CY8A 4JC4A 3EG9B 4DSOA 4EZEA 2Y99A 3PUXA 3H99A 4LGYA 1AV7A 1LSOA 1U31A 3I2KA 4UAUA 1WV0A 4OQQA 5ENZA 1OXVA 1TW3A 1W5AA 1J99A 3BIJA 2R4UA 4ZVQA 5H16A 4FWTA 2FMUA 3HWSA 4LX8A 5TPZA 2Q21A 3GA7A 1O96A 1GU1A 5F35A 1M8JA 1PZHA 1VKRA 3I6MA 4I3HA 2QX7A 2VI5A 4QJ4A 2FCAA 5LD2B 4QQFA 4X62C 1H3NA 1IMJA 3Q7QA 4HEJA 2D13A 1VPTA 3HU3A 1K27A 4NJOA 1FSGA 1UWVA 2HOQA 4YRGA 2O1EA 1A27A 3KEFA 3KJFA 2FZCA 3OE5A 3UOGA 1WEHA 4YCJA 2GKSA 1A95A 3TLZA 4F4UA 4MUXA 2EL7A 3DTVA 2I7TA 4U2FA 5JCXA 5IKEA 1I2ZA 4HQLA 3D4IA 3PUHA 3A1EA 3DMYA 3OEWA 2BF7A 4G4IA 2D5BA 4DBVO 1EJ0A 4H7IA 3OFNA 4YJFB 2OWDA 2WIFA 3DP7A 4NFSA 4OQNA 5DBFA 1FJGC 5CHYA 1SVSA 3CX4A 2ZSIA 3WNBA 4R1PA 1L5HA 3UWSA 2J6IA 3OP4A 5KNBA 2VCYA 2X1MA 2P77A 3CLRD 1E8MA 2BMAA 3EYAA 1KHTA 5EE0A 4HHEA 5K0NA 3KL2A 2MYPA 4E46A 4Z4EA 4AAYA 5LOVA 2ZTLA 4O4IF 1JAIA 4O2AA 4PG4A 3EZ6A 4FDUA 1U7UA 4YDQA 1PZEA 3S0JA 4Y2TA 1YZGA 2VDPB 2WSYB 4YO7A 1DELA 2D8AA 4YMTA 2W90A 1QGYA 4R6WA 1H42A 1YASA 4EX7A 2PNFA 1A2OA 1T2AA 1MXBA 4FTFA 1XBTA 1J1UA 2A7QA 3AB7A 1E18A 1NY6A 3W7AA 2OCIA 1ZD4A 2FWRA 2JBAA 2YUTA 4JN6B 4RY2A 1CYEA 1E4OA 4DR1B 4BGEA 2GM9A 5FBVB 2L42A 1Z56C 3FYHA 4TYNA 1M5UA 1T8YA 2WTXA 2J07A 2ZJ5A 2CYCA 2FPPA 2P9ZA 4EFDA 1OXUA 1RHKA 2GEVA 3TXXA 4X85A 4RDXA 3U9SA 5I4KA 2YN0A 3OOWA 1QIIA 3YASA 3HWX1 1O2DA 1YDWA 3TPZA 4JT8A 3A70A 3IIIA 4WWHA 4CG1A 3CW8X 1SVWA 3GNTA 1ODTC 3AW8A 5DPMA 3H1TA 4AM8A 4FGLA 4G85A 3MJVA 4URXR 4LK2A 4UM8B 2Y4NA 3O95A 1SQ6A 1QYRA 3KDPA 2DQZA 2IS2A 1HT2E 3QE2A 2WFLB 5SZJA 3KPYA 1QCYA 2YV2A 5JAIA 2QTFA 3M3HA 4GZ3A 1OV4A 2LR0A 2EW8A 3O2JA 1W35A 2VJCA 1QONA 1TYCA 1BA3A 3HCBA 3PRHA 1FMFA 1GCIA 1II8A 4REQA 4CT0A 5K8VA 4QDXA 4KXNA 5J5CA 1UOPA 1G5RA 3M1AA 1FFEA 3OSZA 3PPVA 4O2RA 1YI8A 3D6MA 4NG4A 1A4IA 1JIXA 2HRDA 1N6NA 2F3PA 3H2JA 3NT5A 4NP6A 5AVJA 1E99A 4D97A 1JHXA 1VL0A 3HKCA 3IV7A 2DUUA 4KN8A 4NBKA 4GM0A 3U0BA 3KQNA 5L6MB 3QVVA 2P9EA 2IYXA 4D4LA 4J0GA 3EN0A 1KWKA 2EAUA 3ASYA 1H85A 3C4JA 2JA2A 1YS1X 3PLRA 4IGAA 4DBZA 4R01A 3GQBA 5ALXA 3EVGA 2W43A 3HGMA 2RE8A 1B0PA 3QFTA 4OLFA 9LDBA 4G63A 1X7XA 1LVGA 1EUCB 1QBGA 1YDHA 1ZNYA 2R5FA 3ILVA 3PNLA 5I7OA 1C1HA 4RTSA 2IXAA 2YXEA 5HKOA 2N47A 3WBFA 2DSNA 2WUEA 3F1KA 2C2GA 1JN0A 1KORA 1QC5A 2FQ1A 3DEFA 3DT9A 4XVRA 1XB2A 1MJNA 3DL7A 3GRKA 1UDCA 2ECPA 2IKQA 4U6NA 1KYZA 4ZP1A 4BCDA 4C0LA 2YDYA 3EGOA 2E0GA 3RUFA 4KITB 1Q5PA 3LT5A 3KBBA 2WK1A 5BT9A 3ZYCA 5JH7B 4MS4A 3T7JA 3AY7A 3JCZA 4M9XA 1KYIA 2FPGB 2H5JA 3R5HA 5CNKA 3HKDB 2ISQA 3EAFA 1ESNA 3QX3A 3FNHA 1EFUA 3EZ7A 1ZYUA 4G0MA 5EFOA 3C16C 2ZSBA 3GVCA 3NAGA 2ZYSA 3JXEA 3IKMB 4ZI5A 3DT8A 3L7NA 2X9NA 1Q0UA 1TPYA 3HNRA 4GL2A 9ABPA 3D7MA 2WI8A 2OB2A 1QJ4A 4P3OA 4CN9A 1SBNE 2ZLBA 1F2DA 3WV4A 2PAFA 2ZIXB 2E9SA 3E2MA 1VYUA 2XCTB 3FA2A 3EA0A 4LKOA 2NTNA 3KCQA 4L9RA 4QUEA 4GL4A 1R6AA 1I24A 3BSFA 5IUNC 2D7DA 4A2QA 1BFKA 2JI6A 2UZ3A 4OU4A 121PA 3M4ZA 3R1IA 1SIBE 2ADMA 3FSRA 3AEQA 4X92A 5CBPB 4F3TA 1KQOA 5IDXA 1Z6QA 2BSXA 1Z4QA 3NPAA 1H9AA 2HQSA 1JIVA 4P4GA 4Q15A 4QHSA 2IYRA 5JVDB 1I13A 1UMDA 3A1CA 3C3MA 2DTEA 3BCHA 3ZVNA 3U56A 2J3QA 4V0LA 3NASA 4PANA 2J5XA 4OI1A 5K0BA 5CH5A 3SDSA 3IC5A 1KO1A 3LZDA 4L2IA 3SY8A 3UT5B 1EK1A 1L3CA 2I6SA 3VTKA 1Z6ZA 3MIZA 5DX1A 2JFXA 5I8WA 2GEUA 1O1YA 2ZT6A 5C32A 3C3KA 1OLSB 3MWYW 2RGCA 1QHNA 5DEIA 3WQRA 4B33A 1FW8A 2FOIA 4Y0VA 3TR6A 2VTDA 4B3BA 4ED9A 1PBTA 2UU9B 4WINA 4LF7B 3IILA 3W2TA 5T4EA 1Y8QA 5D3QA 2QK4A 2QUZA 5ESDA 5CDGA 4UTOA 1KQPA 4M0PA 4MP8A 4Q9NA 1KAOA 3DLAA 1RQPA 5F21A 3RCBA 3VR4H 2XVAA 2F64A 3AHGA 3U5ZB 2D3TA 3DQZA 2D1SA 2NZJA 1YS4A 2ZRQA 2E37A 1K2VN 4IDFA 4L8FA 5FXMA 4Q93A 3JQBC 4A4DA 1ZM2A 3DEZA 3OY2A 4IDCA 2G5GX 2PYIA 5ESWA 3PTAA 3A26A 4DOMA 4MKHA 1G9XA 4R5MA 4M2LA 2QROA 4W8HA 2F4VB 5LLSA 4FWBA 3H97A 2R8YA 3B7PA 4EUNA 1CLEA 5HWSA 4JGBA 1U0JA 2GCGA 1ICIA 3V48A 3P2JA 3EXG2 5LKRA 2AMJA 2ZDHA 3IA2A 4X9XA 4OL0A 4HTAA 5D87A 4BBZA 4C7BA 3F5QA 5LPNA 3NOOA 2BFPA 2VPYA 3LVRE 4ZVOA 1XVVA 5A04A 3HVIA 5L7WA 2NPOA 5K3EA 1NFRA 2X4LA 4QD3A 3RFFA 4TUYF 1Y42X 2NO1A 3F7NA 3VHLB 2Z08A 3T0GA 3UQYS 3HDHA 1AF4A 1E8DA 2X7HA 2GPBA 2VNJA 2Z8YM 4K7JA 5BQOA 6LDHA 1NJ5A 5LB4A 3ZNQA 1N34C 3O21A 1BWQA 5AUQA 1D0SA 3RD5A 1Z5VA 4DUYB 3O1LA 5K8IA 2D0IA 1OWOA 3T4XA 3D3WB 2Q5OA 3K5HA 3OSUA 3FAKA 3GEEA 1XPRA 4Q34A 4B76A 3N6VA 4YFYA 1JIIA 4HQFA 1WQ3A 4FMDF 3UGQA 3PNSA 3HEBA 1QWSA 2CLOB 1MEOA 4UNNA 4B0OA 1EM6A 4NEGA 1E79D 5DNEA 3WL4A 5AW4A 5C7YA 2O7SA 1M9NA 1HKHA 1U0EA 2YCLA 1EIWA 1EJ2A 4NQZA 4YAIA 5D84A 5TPWB 1PS0A 3DEKA 2WICA 2IE0A 4PZPA 2YYYA 4XXHA 5DYGA 5LQRA 2X40A 2HXSA 1FMCA 1YIDA 3BQ9A 4E4YA 4WBXC 2QLTA 5FOXA 2CFIA 3HG7A 3PUYA 3K09A 3SC2A 4J29A 1VL1A 3AFHA 4K8RB 2BLLA 4G4JA 1YMUA 3LP8A 2I1QA 3ILXA 2JGMA 4UEKA 5JNWA 3DWGA 2OUIA 4GVXA 4NL4H 2EP5A 1BZYA 4HDKA 4BP3A 3GJYA 1X1BA 4O08A 3KG2A 1FDIA 4NMHA 1K6EA 1UXOA 2I03A 4X65C 1VB5A 4EWLA 1NONA 4H1WA 4YGYA 4JI8C 2GGSA 1GTZA 4IVRA 2CL5A 3FCAA 4ZLPA 1VCNA 1T0BA 5E7JA 3FBTA 4MS3B 1Z28A 1WCXA 1FQWA 1SU7A 3U7IA 2D27A 4CV2A 1KIFA 3I5YA 5UKDA 4WXYB 3KWMA 2YTZA 1AGRA 4KAAA 1D1SA 4HTFA 4D26A 5EQFA 4RK6A 4QUBA 1O95D 1BX0A 1A8PA 3NTRA 1TF5A 4NMLA 2ONJA 3H7AA 4Q4HA 4DA8A