3DHVA

Crystal structure of dlta protein in complex with d-alanine adenylate
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
503
structure length
498
Chain Sequence
KLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTSPKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords D-alanine-poly(phosphoribitol) ligase
publication title Crystal structure and enantiomer selection by D-alanyl carrier protein ligase DltA from Bacillus cereus.
pubmed doi rcsb
source organism Bacillus cereus
total genus 156
structure length 498
sequence length 503
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3dhvA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dhvA01
4D4GA 2QVZX 5DWVA 2VZEA 4RM2A 5BSVA 5BURA 1MDFA 5K85A 3O83A 1T5DX 3A9UA 3B7WA 3U17A 2QW0X 4G36A 4FUQA 3QYAA 3WVNA 2D1RA 4R1MA 4E5DA 1PG3A 3E7WA 1LCIA 3G7SA 2QVXX 3E53A 4LGCA 2Y27A 2P20A 3FCCA 3T5AA 3IERA 3PBKA 4RVNA 2P2QA 2D1TA 4R0MA 4DG8A 4ISBA 3CW8X 3T5BA 3EQ6A 3CW9A 4D4IA 3TSYA 3NYRA 2D1QA 3E7XA 5KEIA 1MD9A 4RLQA 1ULTA 3ITEA 3IVRA 5KYVA 3VNRA 3A9VA 3ETCA 5KYTA 3NI2A 3R44A 5JRHA 1BA3A 3L8CA 3LAXA 5BSTA 4OYCA 4OXIA 4ZJZA 3LGXA 5DV9A 3NYQA 3LNVA 5BUSA 2V7BA 3FCEA 3WV5A 4IZ6A 4RLFA 2D1SA 1MDBA 4PZPA 1V26A 3IEPA 4RMNA 3KXWA 5BSWA 4D4HA 3DLPX 2WD9A 4GS5A 3IESA 4GR4A 3RIXA 3O84A 1PG4A 5BSUA 3O82A 4G37A 4DG9A 5BSMA 2P2JA 5BUQA 5GTDA 3WV4A 2VSQA 2P2FA 5IFIA 2QVYX 4U5YD 3U16A 3C5EA 4GXRA 2P2MA 3DAYA 2P2BA 2Y4OA 1YJ7A 4RVOA 4D57A 3VNSA 2Y4NA 1RY2A 4RM3A 3VNQA 1V25A 4IR7A 5BSRA 3DHVA 3RG2A 4R1LA 4WV3A 1AMUA 3GPCA 4W8OA 4EATA 4D56A 3IPLA 4GXQA 4GR5A 4M46A 3T5CA 1T5HX 5E7QA 5D6NA 5K8FA 4FUTA
chains in the Genus database with same CATH superfamily
2NYAA 1CZKA 1PSWA 1QK4A 2VQSA 5KREA 3WS7A 3M6MD 3V2GA 1BXKA 2EKDA 1O89A 3PFHA 4XWOA 4RK5A 2VO1A 2JLYA 3THSA 1RLMA 1I14A 1M34E 4EG5A 1ZM9A 4JUFA 5DBHX 2AXEA 2PZKA 4UTPA 2BV3A 1XZLA 1Z83A 4I50A 2BC9A 4I3GA 5BV8A 1LCIA 4F3TA 3P27A 4PO9A 4D5EA 4FGJA 4WKBA 1KI3A 2ECOA 1NG9A 3WDLA 4QA9A 5CP8A 4K9OA 1XAIA 1WQ3A 2SNIE 5K20A 2P3OA 4PZ0A 4QXMA 3JQPA 1VLZA 1NI3A 1HDXA 1JJ7A 4B6PA 4BO3A 3GELA 5IF9A 2HCRA 5IN4A 6PFKA 1CIVA 4GC9A 4I4IA 4YP5A 1W36B 5FL7A 3GLIA 2FEXA 4WEOA 1W46A 4MEJA 3K09C 3CLUD 4MS4A 3PNQA 4YUAA 1J90A 3VKUA 5C81A 3L8DA 4DLYA 3ZHOA 4OPMA 4YT2A 1QFJA 1EUQA 4Q4AA 4RAQA 3SJZA 1WNFA 4B5LA 4DDHA 2IP4A 3T4XA 1UEIA 4DMGA 4WXMA 4OYLA 4ZK2A 2PX3A 1XLUA 3DBVO 4HDOB 3UPDA 4EFLA 3PROC 4LX0A 4LRTB 4URHA 1J25A 3FUVA 1J0XO 1PHPA 2QLBA 4JU8A 4X91A 2ZBRA 1QDLB 1ECGA 3STUA 1R6VA 3DNMA 1KYYA 4UM9D 4BFTA 3DOHA 3IPRA 1Q0HA 4P98A 5EE9A 4LFAC 1SNYA 3FVQA 4PUHA 5H16A 2PVSA 3TDMA 3WK7A 4BAZA 4C01A 5JWRA 2O54A 1GL7A 3RDPA 1WBBA 1U7HA 2Y3IA 3I23A 3JZMA 3NT2A 4OX9Y 4JWKA 1B8VA 1OX6A 1UF9A 1DQPA 5CFLA 4ALLA 3OZRA 4FNMA 3RHFA 2O8BA 4IHJF 3PGXA 2EU8A 2VHUA 5ICMA 3EF0A 1D8TA 1XJWA 2V7GA 4YWJA 3T41A 1KKMA 3TEJA 4Q1DA 2OHOA 3VHQA 4P3XA 1G291 1T6BY 1ZK0A 5SYNA 3W9BA 3WYGA 3C87A 4NCJA 1URPA 2A35A 3T1YB 2HYIC 1SXHA 4IMPA 3CZ5A 4RORA 4B7AA 5CXQA 1G4HA 1HLPA 2D8MA 4UBKA 3WYDA 4LF5B 4DA8A 4B3RB 3ELDA 4D9FA 2XWQA 3K0FA 4RD4A 5EJGA 5KWJA 3V8VA 3HDJA 2B4TO 1R9NA 3MNFA 5EIWA 2QAGC 3HNOA 3P2JA 2ZVJA 1DC4A 1ENZA 4ZI7B 4KIJA 1JIIA 3PRHA 4KHPC 5B4VA 4I99A 2E7ZA 1EVIA 3DBLB 3VJKA 3KVOA 4JN6B 1U0EA 3H04A 1SBYA 3CLKA 4FMDF 2COKA 2W93A 4OHWA 3UW1A 4BBJA 4D43A 5M5BA 1TADA 2IU0A 1GAJA 2QTNA 3A6JA 2X7HA 1JHQA 4X20B 5EIXA 3BMNA 1C7ZA 4RF3A 5LQJA 4X7BA 2UUBB 1EQ2A 1WF6A 3V4VB 3PHHA 1ADJA 1GVNB 2CHEA 3VOSA 5KNCH 3RH0A 5JJ5A 3TKLA 5KTRA 3BZWA 3NEAA 3WRWA 2PJRA 4G2TA 3L8YA 3OAAD 3WC4A 3BB1A 4D4GA 1VHDA 1ZGZA 4XPZA 4AS2A 4DA6A 4OUDB 4RMIA 4EVIA 4E7PA 3D2CA 3UX2A 3NBFA 4ZZIA 3J81k 4QEZA 2J30A 1USKA 4FHFA 1DEXA 3A2LA 3MB5A 3KT3A 5F1KA 1JLRA 2EFYA 3KWMA 2VF2A 1FU4A 2WY2D 1MHPA 4O0MA 1CJSA 3G8CA 4Y0AA 1AUQA 4URZR 3FMOB 4FDUA 4HDKB 3IP9A 3A06A 3RARA 5LQAA 2IW1A 4BLPA 1Y6JA 4E46A 3FWHA 3OHSX 1L5SA 1NVVQ 2O57A 5FWYB 5BN5B 4QUGA 4G8JA 4IILA 2Z43A 4U2FA 4CV3A 3QU9A 1X1RA 3R3HA 4NENB 4BP8A 5CB8A 4CLRA 4HAVA 2W2PA 1N6OA 2ZR0A 2ZUBA 1YDEA 2RHMA 1E1YA 4HVAA 1PYGA 1RRCA 3PLAE 1F5SA 3JRWA 5AXCA 5K51A 1KO1A 5T4FA 4CCYA 2Q0HA 1U1IA 4HF7A 2HK8A 4OQQA 1U2SA 2O8CB 3AIMA 1T8UA 2B98A 3VPGA 4CF6A 5M34A 3M5WA 4J0DA 2BN4A 1JEDA 3RJ9A 4EKYA 3RADC 2N46A 4CL3A 1IFXA 4GM0A 4I3HA 5LR6A 1SC3A 2QX8A 1G66A 2FRVA 2UZAA 3SC6A 5C1IA 2JCVA 1P1KA 3IEPA 3VU8A 4BKQA 2GPNA 1RAIA 2QROA 2R8PA 3BDIA 5CR9A 5DOZA 1VDZA 2ZJAA 4DC0A 3R4VA 5C53B 1J4AA 4L3WA 5HE9A 4K7JA 2WSLA 3LP6A 5AK6A 1A76A 2CFOA 4NE9A 2QMYA 2IYNA 1YDMA 3RHTA 3ONNA 4TN5A 4R3UC 4FPXA 2GPWA 4CHTA 2VQ6A 3HLKA 5FTNA 1TK3A 1NSYA 2G70A 4UHBA 1VRCA 1I8TA 3KVNA 4GMKA 1CE8A 4REMA 2ZBPA 4CM4B 4P7GA 1OBFO 1CJTC 1QH8A 5FBQB 3T5DA 1PNRA 3K32A 4WN9B 4L2IA 1M8JA 2PV0A 3OLYA 3T52A 5EHQA 1QV7A 3BRQA 3I3SR 3OJCA 4HGQA 1IHXA 3ANSA 3K2BA 3KUCA 1WXDA 2CXSA 1YASA 3QXSA 3ZNPA 2ZSIA 1XPOA 2P1RA 3DEZA 1MOSA 2WU8A 3CA8A 5E7IA 1EHCA 2Z57A 1N34B 4DB2A 3LT0A 1OSNA 1LK5A 2JIBA 1W1UA 3D0RA 4AM8A 1ZZGA 5ALKA 3EVGA 1TD1A 2AI1A 2ZUUA 3C8ZA 3AQIA 3NANA 3OZXA 4Q02A 4B7CA 4RDXA 1HF3A 2PWBA 4DV7B 2BMVA 3RVLA 4ZA2A 5A0FA 4CLOB 1YNSA 3K72B 3H2JA 2HY7A 5FA5A 4IOLA 2MCFA 1DOAA 4F6RB 1T0HB 1R4NA 3OMXA 2X23A 4L8YA 4TPKA 3VGJA 2GZAA 2AV6A 3ESAA 1X8JA 5EZSA 5C0OE 2ZTMA 1O2DA 4QJ5A 2YMLA 4KE6A 6AT1A 1A72A 2O3RA 1BS2A 2VJYA 5IJZA 1O57A 2X2PA 4I08A 1E4EA 3HWSA 4Y3UA 1DZ3A 1S3IA 1JZSA 5GOTA 3GG9A 1NIPA 1YJBA 3HJHA 3OURA 4Q24A 2X5NA 2WWGA 1Y3BE 4O4JA 3GGSA 2B4AA 5DGXA 3O74A 3EEYA 2ATEA 3NETA 4J49A 2AXNA 5D3MA 2VRCD 1TTPB 4F8YA 1XRCA 2AN4A 1GZ3A 1ZD4A 2AUTA 3EAFA 2EARA 4RTMA 2REQA 3G2IA 4JOQA 2OSVA 3GRKA 3R5TA 4MVWA 4E6EA 5DVZA 1AE1A 4DR6B 3BB3A 1H4TA 2BH1X 2OV4A 1QWOA 1ZICA 3C6XA 4C5BA 4EUEA 3IVAA 4GHWA 1RXCA 2PS0A 1KEUA 3BSSA 4HT3B 2F8TA 1SXJA 2Q21A 2KDNA 3EK2A 2DWPA 3IUEA 1TKBA 4MKZA 4RH1A 2A14A 2F3SA 4G56A 4GAEA 3KX2A 4QGBA 4XGKA 3WHPA 2QP9X 5A7FA 1B0AA 1CLUA 2CMHA 4DV2B 1X38A 1M5UA 2QEQA 2ZSBA 3G5TA 5ECDA 2XUOA 2N9UA 2YDYA 1WXEA 2RKOA 4BBAA 3CW9A 4K9QA 2OR3A 5FFFA 2H4XA 3PR3A 5B1DA 3WNCA 3V8PA 4E5YA 1IOLA 1RMYA 1LBEA 2GEVA 2WTUA 3EAGA 2QJOA 4NXNB 1ZVJA 2JJQA 2UUOA 1JKJB 3GJ5A 4TMFA 1ZA1A 1CY4A 1I3OA 2C83A 1KZ4A 1FNDA 4J29A 1MP0A 1PWXA 2NIPA 3O4VA 4MW1A 3WICA 3LBYA 2Z5FA 2FW9A 5C2JB 4PC3A 1ISIA 4NNOA 3L5KA 5KMGB 3BQNB 4CM8B 2GN1A 2A1UA 2RGYA 4FFNA 1A96A 2NZWA 3VYRB 1ZVMA 2VT3A 3DQQA 4O2AF 2JLUA 5LCIA 1YZQA 1VGRA 3HJUA 3FNFA 1MDBA 4UHHA 4RMNA 5J47A 4EUSA 3ADPA 1XDBA 2QUKA 4L3VA 4N3NA 4J2HA 4RFVA 3OCVA 3UW3A 3ZHBA 2C4VA 3PNSA 5HWSA 1EVZA 3SEQA 3ZXYA 4N6OA 3G85A 1KDZA 5BNZA 2OOKA 1JG6A 4OGLA 4FYPA 1ZKMA 2Z09A 4EUFA 2QT9A 2QLMA 3DNFA 5B1IA 1RZUA 4YDRA 2YHIB 5AIAA 1PFKA 7YASA 4TXNA 1NVXQ 2O2IA 4KDRA 2SCUA 5L9AA 3H1AA 2W6JA 1PWYE 3GHHA 5KWSA 2IYWA 1I3LA 2YVUA 1QK5A 1FJ2A 4HWGA 2PUAA 4NE7A 3TTSA 2CK3A 3D3JA 2HIHA 4M36A 3TLZA 2O2JA 2W2KB 3MUFA 4WK4B 4V0ME 1FP4B 2ZTHA 2VJMB 3DAYA 4ND4A 3BZUA 2A5FA 4RC9A 4Z8XA 3TDKA 3I9V1 5HCUA 3QBEA 3K5HA 4FN5A 1S1CA 3EXIB 4YCLA 1E4VA 5SV2A 3O8OA 4O4IB 3TL2A 2XVMA 5FPYA 2UUAB 5A3VA 3NHFA 1ZB8A 4HDSA 1WV1A 1QRAA 3G5MA 4R1LA 2UYHA 2JFZA 4Y0NA 2AF3C 3RJMA 4E2YA 1S4QA 2WD7B 2WP8J 4OXNA 3ZJ5A 1D04A 2DFVA 1G98A 1XTJA 3AR3A 2JGFA 3WZ2A 2PKYX 2X13A 3N6VA 5FOUA 5LQMA 1WW3A 1YFZA 3KLNA 3I2KA 5CURA 3W2IA 5LOVA 2MSDB 4N48A 4F5ZA 4OBXA 1CB7A 3T7JA 2Y9PB 4CU2A 1XEXA 1GYRA 3D9QX 3U3RA 5JNLA 1LI5A 4D42A 1QG6A 5C8XA 1KQOA 2DBVO 3FIUA 3RJTA 4A6PA 2QVZX 3F7OA 5BSHA 2XGMA 2PU5A 5J2TA 3HDHA 5G3YA 4U9IS 3VDNB 4JV5B 1IN7A 5BN3A 3LRPA 2I3AA 1FUKA 3IP7A 5EPEA 3J81D 2WHRA 5B4TA 2ASEA 3I01A 3ODPA 2C2OA 2GUWA 5HF5A 1Z0DA 4K6MA 4BFSA 2D1RA 4K88A 2ZSUA 4A8TA 1KO8A 1YL6A 3F1LA 2JRCA 4D02A 1LDNA 5JALA 4F5WA 4KDFA 2LTAA 3QX8A 3F6YA 4OHZA 1UBLS 2AFIB 4Q7EA 5CVVA 3D3WA 3INRA 5TMDA 2QR5A 1QVVA 4MPTA 3W06A 4C4TA 4EG7A 4B35A 1YTLA 3OP4A 3FNIA 4ZODA 3EUAA 4LKOA 4U9HS 1M2OA 2NP6A 2DP4E 4MVJD 4QDKA 4OMDA 4DR7B 3DD5A 2XRZA 2XOXA 1KVUA 3PXXA 1KE2A 3ORHA 4UAGA 4HVCA 3HGQA 3WLKX 2NYUA 1Z39A 3PNMA 3Q6IA 4MYSA 1VBMA 4JLUA 5LIPA 3MCZA 4PNZA 5JROA 1GZSA 1J2UA 1DAEA 1LZLA 3A04A 3OTWA 1IOWA 2YZ2A 3UH1A 4KR6A 3T3EA 2YQ5A 3U26A 1LC3A 4IIJF 1PK7A 1WUJS 2NUAA 2C9OA 3UTCA 2EAUA 3UJ3X 3WGTA 3HPRA 1DAFA 5L3VA 3W5DA 1YZKA 5HS4A 2YXEA 4FEAA 2WE7A 1HDEA 1QLJA 4NDZA 3LUBA 1AOXA 4FHZA 1P2VA 4ZKDA 4I4LA 4IF4A 5K05A 1BVUA 2OBLA 4YGXB 2CLSA 3LX5A 2WHXA 2AEEA 5COAA 5FLYA 4JXXA 1E6WA 4OF4A 1HSZA 4ZC8A 3E23A 1Z6ZA 1UDXA 4PQEA 1M1ZA 1ZIYA 1PUIA 2DECA 1RYBA 1OBVA 2QA5A 2R96A 1TU3A 2P27A 3P0RA 4ZYXA 1U8EA 4O25A 4ND6A 1F2UA 1UWVA 3B82A 5L53A 4J43A 3VKFA 3WLAA 4C0XA 3DE0X 5I3ZA 4MW0A 3GLGB 1GPDG 2RHGB 3HQ4O 3OPNA 2AG6A 2YJGA 1SUBA 2W6MA 3BGSA 4AMBA 4ZIRB 2WKRA 4BFXA 2Z56A 3ESDA 4KYIB 4FYVA 3OLZA 1OZ0A 4OQPA 1OX4B 3WO0A 1A2QA 1RBQA 2MMCA 2C4NA 2Q3CA 3E84A 3EIWA 2ZM5A 1DO8A 5HFNA 4DLRA 5KC8A 5B6JA 4N54A 2YJTD 4LC0A 4IIVA 2FPKA 3PF8A 5AO9A 1ACJA 2GYUA 2JBAB 3SIRA 5EIBD 4YV2A 4NYMR 5T7BA 2WFZA 1EGVB 5D87A 1CTQA 3QRWA 4Y9UA 2IDJA 2VZ9A 4KV7A 2YNMC 4XX2A 3BHNA 3NX4A 3WNBA 3I2YX 2OFOA 3GJXC 1B0PA 2JL1A 4QOJA 5CPFA 5E6RA 1A71A 1TU0A 2GF2A 4GLOA 3GB9A 3OLQA 4QHTA 3UXHA 2ZUVA 3I92A 4ESHA 4MV9A 5JXGA 1JEEA 3OUZA 3WIUA 4YIKA 2WNHA 2J9FA 4MR7A 3CKYA 3NC1C 1HE5A 4JVSB 1CCWA 4ODIA 1DAGA 4Q15A 2A1IA 4NJOA 3RYTC 3GG2A 4RKYA 4GPD1 4E3WA 4WI1A 2QY6A 3EC1A 2C61A 2YVLA 3NLLA 4QVKA 1YAHA 1DPGA 5JSZA 5JVDA 3AY6A 5LD2C 2B8TA 3IUNA 4DSTA 3SVTA 2ID7A 3LF1A 1O94D 3BJRA 3FFBA 5EG5A 4FYJA 1BQ4A 1PJBA 3W8EA 4LRYA 2Q1YA 4G4JA 1DARA 2QJTA 4LRXA 3S1AB 1RAEA 1ZLXA 3AB3A 3VBCA 2REXB 3VFDA 4ZTZB 3JZDA 3KK0A 1E3LA 4W5JA 2BKEA 2OLKA 5L8VA 3GRRA 5SY4A 4KR3A 3MCUA 3HFGA 2XYHA 1BOOA 1UAYA 1SA0B 2BONA 2WAOA 3IUMA 3R6TA 3GUVA 5EXSA 4DNXA 3SCZA 121PA 4IX1A 1Q7TA 1MN6A 3C5WP 1UXJA 1GKYA 1Y5RA 2VP5A 1NN0A 4QVGA 1EGHA 3MOGA 4LDJA 4TLEA 2F4VB 1L7DA 4L8LA 1IBCA 1PA4A 4L07A 3D2LA 3WRXC 4A2CA 1NN5A 4F97A 4L51A 1ZHHA 3UZ0A 2ATWA 3BSFA 3NPMA 1Z0JA 3A1NA 3G0IA 1KYWA 2ZRLA 4FC7A 2VBIA 3O6VA 5IWCA 4QRIA 4IY1A 1M1NB 2IVZA 4RLHA 3KXIA 2OYRA 1ZHFA 1WOYA 3FPJA 2YWRA 3QX7A 5FJIA 4QTXA 2QG4A 1Y1PA 3OEHA 3WLOA 3FGOA 2ACEA 3QLTA 3RUAA 3VNRA 3M6AA 3LHIA 2XQGA 4R01A 4UTOA 3BHMA 1OTXA 4DMRA 1PS8A 4ZHQF 4TLBA 4B6GA 3VZPA 4G1BA 4AP5A 3CLUC 3H86A 2CNWD 1FFYA 2QRJA 3LNVA 5EXXA 1MJNA 5B7QA 3N0XA 4GNKA 1EZ1A 4CW7A 2ECFA 3GGPA 2IOHA 3I39X 3AEUA 4LS3A 2XDQA 2IPOA 2NSYA 2Q5HA 3AUYA 3ZIDA 4CPDA 1R64A 2C58A 4NXMB 5FOVA 2NAPA 4HQOA 4GGMX 3VTAA 4ZALA 2JVIA 4CNBA 2OT3B 4JL6A 5EY5B 3Q5EA 2YWCA 3VZSA 4K26A 1B4DA 1JFFB 1Q91A 3A2MA 4TLAA 1YB7A 2ODAA 3ANYB 5FI1B 2BSQA 1JT9A 3KUUA 4EYKA 1J2JA 1KIMA 4GOJA 1Z3IX 1QGZA 2NN3C 4PHHA 2JW5A 3VR3D 3VU1A 4B44A 4TYYA 3RC2A 1OI7A 1TB4A 4LKRA 4DRYA 1E1QA 1ONOA 2NOAA 1WW8A 2ZRCA 1T13A 3DAHA 2NZVG 3E8MA 3I2HA 1FS5A 3GGCA 2FZKA 1PQWA 4G8DA 2ATCA 2F3PA 1KVRA 1Y9AA 5JZVA 2H85A 2RB4A 1E7QA 4WXHA 4H18A 2OXTA 2PPVA 5JH7A 2GEBA 4YY3B 3IGFA 3EBLA 3VSEA 5IDVA 3KBOA 2GZMA 4R9RA 3DUFA 1A8SA 3C97A 2RCNA 3MMXA 2EHDA 4WT7A 3D8TA 2ZDQA 3G7UA 4PPYA 3TTUA 1PL7A 2B8JA 3QIVA 3RFFA 2PS1A 2VAVA 4GI1A 4S35A 3ZBUA 2H1CA 2PLNA 2O0JA 2PX2A 1EK2A 3KJIA 4I5FA 3A3KA 3WLLA 1ZKDA 1KC3A 1X1QA 2V6GA 3SZUA 4B4DA 5T8TA 2Y1OA 2ZJYA 3HSKA 4L74A 2UXDB 3DTYA 4C14A 4P33A 2C5HA 4L5AA 1F14A 4GP6A 1M6EX 4MROA 5A2QA 3GDFA 3D64A 3N7TA 2JLAA 2O2HA 4JI3C 3BRCA 2PG3A 1K5PA 3IIEA 5FIUA 3RUHA 2WUGA 4MUYA 2HFJA 2VJKA 3CTPA 2C4HA 2QT0A 4M1SA 5KYWA 1IZ7A 1JRLA 3AR8A 1NJ2A 3PC6A 3ELUA 3CVUA 5CVTA 1BMDA 4CODB 1GGMA 1F2VA 1RHRA 2GZHA 4MB6A 3M6IA 2PLAA 4M0EA 1VPEA 1Z0FA 2WT8A 3N8KA 1NATA 1XA4A 1YKFA 2AW5A 3NW9A 5EHGA 2IUFA 3HGTA 3ECAA 3PDUA 3R3WA 4N7BA 2NV2B 2VT6A 5A4KA 5JRDS 3NCTA 1YH3A 2O8EA 3HCRA 1P31A 3EVAA 1AN9A 1OI3A 4MPRA 4AT1A 4NU0A 3E3MA 4WINA 3AHGA 4B6JA 2V5AA 4PLCA 4UTRA 7REQB 3TOVA 2WKSA 3WK5A 3OF2A 4ZVTA 2WLSA 3G0DA 3C3BA 4W9RA 4L16A 3FVRA 2UU9B 1YJCA 2ZT5A 1ACMA 1Q3KA 1QO0A 2FPMA 3H5WA 4ZI2A 2V55B 1DKNA 3LT1A 1AO0A 1NMQA 2HMAA 2AQIA 5EQFA 4F7WA 1G21E 4ZVVA 1ODTC 1GYPA 3NYRA 4OAQA 2J5XA 5KS2A 1YS4A 3LMKA 1XCJA 3E81A 1L5ZA 2OOSA 3LO8A 2DSTA 1CNEA 4TKUB 3IHTA 4PHGA 4Z4HA 3FKSD 5BMVA 3NBQA 4AJEA 3W9UA 5TEWA 5J5VA 1NM5C 1J5XA 1QOZA 1B8PA 2YZNA 4G5HA 1SUCA 1RQXA 3MTAA 4UEJA 1YRBA 1CRQA 1HH4A 1YMQA 1B93A 1UUFA 3DL7A 1RM4A 3TW8A 1EK1A 3AM3A 4O3FA 4R84A 3EWNA 5CT8A 3WISA 1MX3A 4BKPA 4P3KA 3MWJA 2Z3VA 1IUOA 3QEMA 4CBVA 2HIGA 4GI3A 3W5JA 1WPRA 3FHLA 3PL1A 4J4TA 4ZQEA 1PJCA 4IG9A 4RPGA 1I24A 4KNVA 5GJCA 3WRVA 5KJ6A 4FR5A 2FE1A 5T8SA 2IGBA 4P35A 4ZWNA 1BMFA 3IDOA 2WTAA 4TV8B 5JADA 2J6CA 1SM4A 1KZGB 4QXPA 4HDRB 4RV4A 5TQVA 4DWWA 2B9VA 2VSNA 1RP7A 3GL9A 3IUPA 1YRQA 3PA6A 5FEUA 2D0DA 3ROXA 4BYGA 4P4SB 5SZHB 4TWIA 2FQYA 2W4MA 3EGWA 4B9AA 4LJLA 4JNKA 3VHLB 4ARSA 2HL6A 2X6TA 4XCVA 2G09A 5J23A 5AMXA 1H9AA 5KWIA 4EYQA 4ER6A 1KU6A 2ONCA 4JBGA 5IDXA 5LDHA 4CF4A 4LYJA 1TM3E 4DV5B 1DG9A 3QIAA 1Z6YA 3M82A 3DZBA 4QTTB 4DMKA 4LPSA 3EOBI 2MSNA 3CQ1A 1ZIXA 2ZTUA 2B35A 2CNKA 4JX9A 3X1ZA 3ZPXA 2MYUA 1Z2DA 5LA6A 1U1EA 1ECCA 1QG2A 3T94A 1ZH6A 4FX2A 3SFZA 4X66B 3VHRA 4EY8A 5KYNA 3LUHA 3TIGA 2RD2A 3KHTA 4NCXA 4HEA6 4MYUA 1QGDA 5A1IA 3O4FA 4WHMA 3HYRA 4INJA 1A9TA 3VR1A 4Q18A 2EGTA 1B15A 4BVEA 3K0KA 1QGAA 1AT1A 4EMUA 2GESA 2OK8A 1AS3A 5KYXB 3MJEA 1CUHA 3CCCA 4B4VA 1I2AA 1ESNA 1RWXA 1FFEA 3FYDA 3UYKA 4KTTA 1TFRA 4OKSA 2WJWA 2RIPA 3AM4A 1O90A 2OBNA 1UOQA 2VJDA 3HDYA 3P4UA 4M1QA 5WRFA 1PUJA 3K9FC 2OFPA 2QAIA 3H9EO 3D8UA 1ZOIA 1BX0A 3B1FA 1Q0PA 2LIVA 1NOIA 3L6EA 4N01A 4URYR 5G02A 5G2OA 3OESA 3NONA 3RRYA 1RKVA 3O1HB 4FZ5A 1P1HA 1PR5A 5A4AA 1NVUQ 3LHSA 4MDFA 3GEMA 2IT1A 1Y8CA 4RIFA 4JYAB 1IBKC 1UZAA 3FGPA 2BE7A 1W85B 3PR1A 5CT9A 5BV1A 3QNUA 1Z6GA 1NW5A 1XE3A 3NOVA 4DCJA 4RKEA 1FX0A 5I4IA 4L7VA 4BFCA 2ZIVB 1X7YA 3K1AB 1IWPB 5D51S 3TZCA 1Z36A 4BNTA 1UOOA 1F5NA 1H22A 4UAVA 3KHKA 4PZZA 4KITB 5FO1A 1RZRD 3ZE7A 3DKPA 3FCAA 4XTCS 3VJRA 4DUZC 3KSZO 4IDOA 4JLKA 3RT7A 3KQOA 3PDCA 3CO5A 2V7EA 4WNAA 3JCZA 3W8NA 3ZDFA 3T1HB 3BIOA 4G2NA 1RPNA 1C4OA 1ZXXA 2JLCA 2QQEA 2NTVA 1BD3A 2VAMA 4P3OA 3HJNA 3OE5A 4MYTA 2M5HA 1QIIA 1JJFA 1JR2A 1DIGA 1FYVA 2HQRA 4YONB 3RRFA 1WVIA 4B3GA 1VLMA 3DL4A 1N6KA 4NH0A 3LUDA 4Y18A 5CRIA 4JI7C 3EGIA 3KQUA 3M8KA 4JFRA 5IKMA 3ZJ4A 4BNHA 3JWPA 5AUPB 5AVXA 4G0VA 2PUJA 3OTQA 4TQUS 4YV0A 1ZHOA 3SF8B 2FLWA 3DA8A 4G5SA 3MPUA 1JJAA 3LGXA 3WL6A 1H2BA 4P84A 5J4VA 3Q3IA 3ZHTA 1UKAA 3K8YA 3NB0A 4FK8A 2GCIA 1DMSA 4RV5A 1IOZA 4DB4A 2V8BA 4YDSA 4GOKA 3IESA 4RIIA 3TQSA 3B3GA 3U4AA 1T9AA 4M0MA 4UFPA 3FTEA 2XZLA 4IO0A 4NEGA 1OXBB 3GROA 5C1PA 1Z5OA 1M75A 1YBFA 3F3SA 4C43A 3I07A 2Z2JA 1JBEA 4B47A 3IAS6 1N9GB 3HWX1 1YRHA 3KZCA 2AH5A 4BNWA 1RU3A 3TOZA 2GVNA 3PE3A 2VHCA 5DH9A 5C4MA 3HTXA 1N75A 2WJYA 4IW3B 4JSYA 3LPCA 1PJ3A 3WQHA 2Q50A 1LKZA 2BELA 4KRXA 2A5DA 2KYRA 4P7FA 4RDHA 3FVVA 2ZRGA 2ONJA 1O95A 2XYGA 1D6JA 5FX2A 1GNPA 3NNDA 1P39A 2CKDA 1FW8A 5LLTA 4M0LA 1KZ7B 5DNCA 3IILA 4KOEC 9LDBA 1SQFA 1MXBA 1VSTA 4LAFA 2RJNA 2VJOA 3L7MA 4OREX 3USCS 4C2TA 2P90A 1DOZA 1A9OA 2KMLA 3HR7A 3VNAA 4CQMB 3LS2A 5HXAA 4WOBA 4N7RA 2ZB2A 5EE1A 2ZR7A 4OXQA 9MHTA 2BEVB 1Q1BA 1N9ZA 2J6IA 5AT1A 3TG8A 1CFZA 1EX1A 2PX4A 2RKWA 2WZQA 3LY8A 3OZDA 4JBHA 1U8XX 1B00A 2LKDA 1U3GA 2SHKA 2VEDA 3OCUA 4JJZA 3O90A 2WM2A 4ZI5A 3JR7A 3DBRA 4BFUA 4Y30A 3AEZA 1H1TA 2VLIA 3NWJA 4EO4A 4MQ5A 4QYMA 1JHZA 2EP7A 1L4EA 2BZGA 1RXSA 2IZ6A 4UMVA 2V6JA 2WSYB 1NJ6A 2NUBA 1D1PA 2YXDA 2FF7A 4D9GA 4I4TF 1GPMA 1KDYA 4CQJA 2VK4A 4ZYVA 1GDDA 1AQ6A 1NQXA 5ELLA 4B0OA 4B3TB 4CDRA 5J2UA 4F4FA 1TM1E 4MVJG 5HKBA 3D1VA 3IKTA 1LTKA 4MJLA 1U9IC 3V1MA 1CQJA 3EY9A 1ZXLA 2GBIA 1CJUC 1EDEA 3GDWA 1QQ7A 4EJSA 1VGQA 1CJMA 1Z0AA 4RSRA 2F3RA 3K9HA 3L0BA 5TQJA 4FW9A 5ICGA 1I94C 1ZI6A 1KBQA 3A28A 1ZW6A 2QTFA 2ZI4A 4EDFA 3R3SA 4ZRDA 3PUIA 4LE0A 4ZVQA 4JQOA 4BFVA 5IASA 2TECE 3DL0A 1FTSA 4HB3A 3LLUA 3E82A 4MVYA 5JFGA 1M8PA 4PAMA 1LPAB 3RK4A 2JDIA 2O06A 4K0RA 4EMTA 2QKYA 1IB8A 3AUFA 3LSTA 1J1ZA 3B1KA 1CULC 4DWVA 1KEPA 2ZXEA 3ZNNA 2HK7A 4GKJC 1OKKD 2IQ5A 4LY6A 2Q2VA 1YZVA 4QODA 2GM9A 3GMSA 1E7WA 4HNVA 2IXGA 2AUMA 4QDJA 1M6XC 2QMOA 4GBJA 3DMTA 1ZD8A 3ETHA 2IQIA 1EDOA 4BN0A 1P17A 1YHYA 3P2MA 4MIKA 3I6BA 3EGDA 1QWIA 5B30A 1J0EA 4M2LA 1HO3A 1I7PA 2XE7A 5FYDA 3WL5A 1YB1A 3KD3A 3ZV4A 1S2NA 2QMHA 3DOOA 3I0ZA 3PF9A 5KOJA 3UJ6A 4U2CA 3O5AA 1DIOB 1Z22A 2YCLA 4DY4A 3U5TA 2HM7A 5AJTA 2V58A 5DW0A 5DBEX 5BVHA 3SY8A 1U0NA 2A59A 3ZKAA 4NULA 4UXJA 4ZAFA 5F77A 4AJOA 2GXSA 2BSXA 3L4BA 1QX4A 2C0PA 2NU7B 2H0QA 4FILA 4MUBA 4U4AA 4RESA 4FZJA 4V0OA 5IT4A 3TQRA 1V1RB 3OA0A 4ZU1X 1CVRA 3QF7A 1O1YA 2UZ3A 1GCIA 4LJ7A 1UK6A 2IEIA 2ACWA 4I3FA 3WLRA 1Y1QA 5TNXA 5AHOA 3FYUB 2H11A 3OQVA 5F52A 1PU1A 3FDZB 4JX8A 1DAIA 2WVJA 2XQVA 3UXYA 5IFKA 1M1UA 2FVXA 5EVJA 3B70A 2H2FA 3TTYA 2F4NA 4OHXA 2QG6A 3L6UA 3NHZA 3H1EA 2A6PA 5ALLA 3ZE2B 1U2GC 3D6AA 1UXKA 1QGOA 1SU6A 1TVKB 3ND5A 4Z1OA 1S7CA 4II7A 1D9ZA 3HKDA 4HMPA 3DAFA 1D2NA 1HE3A 2H4HA 1WU7A 1Z13A 2PGAA 3CZMA 4HTAA 3STHA 1R6UA 5DPMA 4F5EA 1HFKA 3RFUA 1W88B 1NN1A 5FYQA 3JQAB 4WTOA 1NV9A 4EY4A 4WZ6A 5EWJA 1T9GR 4BCDA 4G5RA 5ALDA 1O6FA 1C1XB 4DR2B 1Z4KA 2WTXA 1KEWA 1NW6A 5EIBC 5IARA 5BR7A 1TJ5A 4F4HA 5HZGA 4KQ1A 3T4UA 2JAUA 5K0GA 3V4RA 4YI5A 2JG3A 3ISTA 1OGIA 5HFAA 4XD7D 3GJTA 5HX7A 3SYTA 2PKEA 4NCNA 2AI3A 4K87A 4N12A 4HYEA 2PQMA 4YASA 13PKA 2CL6X 4BUJA 4Q3AA 3PZRA 1K2WA 3D43A 2COUA 3O83A 4MH0R 4UBLA 3SIXA 3ZWNA 2R97A 3TZLA 3IOCA 4E7OA 5PGMA 1GLGA 2VDLB 1LBQA 2MHCA 1M2NA 3OTOC 1RHQA 1SBZA 1O94C 2A0WA 1XZJA 2R6AA 3BWCA 4HEA1 4OATA 2YZGA 3H1BA 1JTVA 1TCVA 5A5GA 2JVKA 4KNYA 1QGUA 3FYHA 4YV1A 2FW7A 3OFJA 3DZ8A 4TRMA 5AVYA 2PA3A 1JFSA 3QU2A 1N36C 2P4QA 2QPOA 1U28C 4E5UA 5FWXB 4L9SA 1IC6A 5CX4A 5KNLA 4Z7OB 1E3MA 2WAYA 3G59A 3ZDDA 1M54A 5F2KA 4Q3OA 3DZDA 2FPUA 4KVAA 5DTMA 3KIPA 3QF4B 2VNAA 5KNCD 1KMNA 3HEMA 4E5SA 2ATXA 1NVDA 3C2QA 2R79A 3HBMA 1OH6A 4GH5A 4XDZA 4EH1A 2O8DB 1P80A 1C1DB 1CUZA 1L5YA 4QUBA 3I5UA 3P4XA 4FFBB 2V7PA 3N9IA 4Y1RA 1BDMA 1T2AA 4G8CA 3WNQA 4EW2A 5L4NA 3M1YA 4X45A 2UKDA 1NY5A 1O6GA 3ETCA 1HE1C 4IDNA 2E48A 1UODA 3QVWA 3T0FA 3ED5A 1ECPA 3HCEA 5KKNB 2HDOA 3PXGA 3CR7A 2G4LA 3FMIA 3KWFA 4RVHA 1K6XA 3C1UA 5JSYA 3SBXA 4KVFA 4DZTA 1N7GA 2ALJA 4MGZR 3K09A 4I50B 4QYIA 3AONB 3MILA 3OZCA 3PUKA 4YLYA 2UUPA 4BSZA 3AJDA 4HRYA 1CYEA 3ZBPA 2W22A 3B7GA 1RYMA 1VG0B 4NATA 4PINA 1WXQA 4X97A 4RADA 4UVDA 1LLQA 3M3PA 5AUOB 4RTLA 4IJMA 2CMFA 2CXRA 1PJ2A 4LF4C 1KSFX 2A9VA 5C3UA 1F51E 3TQCA 4E1VA 1XN4A 4WAUA 1KBOA 3PQ4A 2XZDA 1E2GA 1A8PA 4FJ1A 5EERA 3HR4A 4ZCPA 1ZQ1A 3EDOA 5TT1A 3W04A 1FLNA 1TC2A 4GNRA 4MS4B 4U2KA 2JCYA 2ZG6A 4YRKA 4N49A 4B3CA 3OKPA 4Q4AB 4ZZ0A 4IJKA 3C7CB 4J1TC 4DBLC 1OR8A 2E4UA 4WX2B 4YJ3F 1A5TA 1JHMA 1U2RA 3PPIA 4X7RA 4RPJA 2ZJ6A 4DLLA 2WC1A 4IV0A 3EPJA 3EXHC 4XIFA 3TNDA 2DG2A 1YBMA 3EFBA 8ABPA 1XDWA 2NQ2C 3H5IA 5DISB 1ZI8A 3RROA 3ZD7A 1N25A 3BD6A 1EINA 1G8AA 4WGFA 1PDOA 5F1YA 4AG5A 3C98A 5KQLA 3ZU6A 2QUIA 3ER9A 4M8IA 4OSEA 3PNLA 2X4IA 4NHEA 3ECCA 2ZBUA 1V4NA 3I1JA 1TZ2A 3Q3GE 2PUEA 3BFKA 4NPCA 1TDJA 4INOA 1WG8A 4ZU3A 4XWKA 1E7MA 4Z54A 3VKVA 4EX6A 3CZQA 3S27A 2O8BB 4BFYA 2IFTA 2D7CA 4B3MC 2OO4A 1G8MA 3G2LA 3IAS1 1OYWA 3H1PA 3Q1KA 1LSOA 4ARIA 1Q2XA 3PI7A 1XFDA 2I78A 1QANA 4CTNA 2NXWA 2QAGA 3PUJA 3U4QA 1DVRA 1W1WA 2G80A 3OOSA 4KX5A 1J2RA 1KH2A 4UARA 3QHQA 1MVOA 5DP1A 2ZE5A 4PO8A 2WUWE 1T2VA 1N2CE 4JA0A 2YX1A 1O6ZA 2E6UX 3Q7SA 4I0WB 5CA1A 2DYJA 1AQJA 3NKLA 3LJKA 1KL7A 3K0FB 5JY6A 2EF0A 1SB8A 3KKLA 3MAJA 4RZUA 3TUZC 5ERXA 1UJBA 2WKPA 1L1RA 3AHFA 2PN1A 3EIQA 2BUBA 3GARA 1OFGA 2QVXX 5JBNA 1EVKA 4HGZA 3E53A 1NNLA 3WIOA 3NZEA 3D7RA 1OT5A 1T2UA 1SPBS 3EBOA 2FI1A 1PFVA 2Q4DA 3DXYA 4ZT4A 1AO3A 2G71A 5JNUA 3AINA 4UM8B 1IJFA 5F21A 2EGHA 3I3OA 1XZDA 1EFRD 2YJ4A 3LKBA 2JFOA 1VHTA 1JNXX 2SECE 3BMNB 1D07A 3B9QA 1L4HA 1DC5A 1WPQA 2PT5A 1XA0A 5AQ1A 3V7NA 2FG6C 1G3QA 1CR2A 3FCSB 4BRWA 1U8ZA 1CJBA 5JJCA 4ZVLA 1MBZA 2VDMB 2X9NA 5AKKA 3OZ7A 4BEWA 3ETEA 1UMKA 1SVKA 1ZP6A 4Q7QA 1Z08A 3JAMA 3W7BA 3QEJA 3QVMA 2WYUA 3CSUA 4MQFA 4OK6A 3LZDA 4R54A 5HNKA 3ERCA 1GU7A 1KYQA 1YMUA 5DWDA 2QS9A 4CL8A 4I5EA 5EP4A 4DDMA 2Q4TA 1Z6XA 3FPKA 3O3NB 3CRRA 4JOBA 2R0QC 2DTDA 2BMFA 4RTRA 3VR6A 3AR9A 2VH2A 3NIGB 3DOFA 1PG2A 1A04A 4KACA 1PT6A 3ECSA 2OQVA 1YMVA 1J0AA 2X0EA 1T9ZA 3C7KA 3ETJA 4L9WA 3GR6A 1MJGM 4B1FA 4X6YA 5CHEA 1Y1LA 3B5IA 3C7AA 2BI7A 4INAA 4X1KA 3BE8A 4UPEA 5C4IA 2HKIA 3H7AA 4CLRB 1GSIA 2HK9A 2P9GA 3VZQA 3RKUA 4EGAA 4DKJA 3KALA 5HF8A 4POOA 3O8LA 2AWNA 1E7SA 1PL6A 3BXXA 5C7YA 3DWIA 1WKBA 1QLWA 3RUDA 4DM3A 1RIIA 3JYPA 4ME6A 4TSFD 1YRLA 3RGWS 3VPHA 4E12A 3DAOA 2Q8QA 4UFOA 4Y0VA 2C98A 3FYSA 3FLAA 1Z0IA 3ZIAD 2AYXA 3X1DA 3PD1A 1F60A 2X1MA 4QC2A 5G40A 3VO9A 3GEDA 4ARVA 2HIAA 3ZCTA 2ZWVA 4WBNA 1DSSG 1H8ED 1JU3A 1S3SA 1SG9A 2D5BA 2VJNA 3U0VA 5CIYA 3PX7A 3IO5A 3PRKE 2J08A 3KJFA 3DNPA 3HCOA 3TSWA 1V45E 4BWFB 2PT6A 3BMQA 5AYVA 4CE6A 1O4VA 1OH8A 3LQRA 1PFYA 4XX0A 3OU6A 4DUYC 1FPMA 1WUHS 5IWAC 2LKCA 3OPYI 3V1YA 4BCCA 2NU9A 1GCOA 3AZOA 2R4TA 4X6LA 1BU5A 1Z75A 3SJAA 4KR9A 2BDTA 4NSNA 4EEZA 5BSFA 1IZ0A 1P1BA 2NNWB 1K97A 3F74A 3QJYA 4BO1A 1ZD5A 4EKDA 1CE8B 1XIVA 3L8ZA 2P2GA 1XTPA 1UKBA 3QVKA 1QH8B 4MQUA 4DLSA 4H1HA 1GG9A 1ZSYA 1LGYA 4H0FA 4BWVA 5C7IO 3A6ZA 4B6OA 4LHWA 2E89A 1DCFA 1FSZA 1MOPA 2X86A 4I1RA 4ZI7F 3F9CA 4JDPA 4ZVOA 4R71A 1C2TA 2WUVA 4E51A 2W6NA 1L5OA 5IAEA 4MVXA 1GGFA 1LBSA 1TW2A 3FA2A 3HCBA 3AFHA 2Z9CA 1M6HA 2YHUA 1NBMD 3ICOA 2X0IA 3WLMA 3OM1A 2OFFA 3G2PA 3ZWKA 4B85A 5IC4A 4PYOA 1MRNA 3MT9A 2BH9A 4WDRA 4DTCA 1J2TA 2QQ0A 4LTMA 4W99A 1P7WA 2Q4EA 1A97A 2PIAA 1A9YA 4BV8A 3X2EA 2X76A 1VKNA 5BOSB 4OM7A 1ORVA 2GHQA 1DCTA 2OV8A 1ZJ5A 3ISJA 1IQ0A 1JJIA 3L46A 2P4EA 2D0IA 3R0QA 3X2SA 2IHNA 1NL3A 1R4NB 2D2VA 2JD0A 2QX6A 1X6VA 3A7EA 3NP7A 4JJEA 2OXEA 4MP3A 4UBMA 2BFCA 4G5FA 4LHVA 4DG5A 4EA6A 1KKUA 4Y2SA 1Q5PA 3WIEA 3ABSB 2O2GA 2J07A 1IZ8A 4QX6A 4ZREA 2H00A 2GGSA 4DGSA 1QKJA 1AKVA 1VIYA 3ZWWA 1QVWA 1FFAA 1E4EB 3LDFA 3OD5A 5BYBA 3SKVA 3PHBE 3AR2A 4TV8F 2YYYA 1BE1A 2R6GA 4O4JB 1D0IA 1PJAA 2ZSEA 3P2OA 2FYTA 5LWHA 4UUNA 2RG7A 2W11A 1NULA 1EB9A 3JYNA 2Q5EA 5D3MB 3U5ZB 1JVNA 4M9QA 2JI4A 3DMRA 3TL3A 4B71A 1BD4A 1VHJA 4OH7A 4PG7A 1O5OA 4Y67A 1JHRA 1RYHA 1UJCA 4IKPA 2QN1A 4FP9A 3E9NA 5FORA 1NU8A 1OD6A 1AK9A 1V7PC 2REQB 3JX9A 5G0SA 4C7OA 2EG5A 5KNDD 1K0UA 2HLDA 1CYDA 3QUBA 3UYLA 3MM4A 1TM4E 2BKAA 2IU4A 2KBEA 3WWPA 1SXJB 1GNTA 1WVMA 1XMPA 4F4IA 4YHHB 4ZDJA 1H2WA 2ORVA 2JJMA 3BL8A 2VDNB 3DEAA 4ZCQA 3FMGA 2JARA 5KTSA 2HK6A 1HQYE 1NQWA 2C8JA 2WJGA 4YIHA 2PJUA 5GJBA 3A26A 3T3NA 1U63A 1XU7A 3MQFA 1UXHA 1O9TA 4RFLA 3WV4A 1FRZA 4X71A 2OY0A 2YV4A 5K3BA 2JLVA 3ROFA 4EGJA 5AVJA 1PFQA 4L75A 5H5JA 3LPMA 4A0HA 2Z1NA 3D3QA 1R4MA 3QE3A 3RGGA 1XZ8A 4LXYA 4P81A 3ACCA 5HK9A 4I1OA 4MVJM 4C2UA 4URUR 3O4IA 2R8YA 1UC5B 4TVBA 3TH5A 4K2HA 3RTBA 1HEYA 3F46A 3LUFA 3KXDA 1C9KA 4NBLA 5C8VA 3ANXA 2JLSA 3RVMA 4A2PA 5JMTA 4ZO6A 1QFYA 1Z6TA 1VE7A 2FQQA 2MU1A 4DLUA 1GPUA 5TGZA 4CM9A 1V1MA 4EJ6A 1WX1A 3IE0A 1LJLA 5GZ3A 4HDAA 4DJJA 2Q2QA 5EJ6A 2IV2X 2EW1A 4EYEA 2VTBA 4R8SA 2UZ4A 1XKQA 5ESXA 1E6CA 1M7BA 3V1TC 1FJXA 2X1HA 1KJQA 2QTGA 3HO8A 4ZQFA 4B7UA 4BKOA 2CBXA 4DLAA 2GCEA 3D3NA 3OEWA 5IULC 1NJ1A 2XDAA 3ZJUA 4AYWA 4M7OA 2GKGA 3EEBA 1BDIA 1HGXA 2UVPA 3LGSA 3NWOA 2SCUB 2PXHA 1OWMA 3ROGA 3ZDZB 5JOQA 2W00A 1SKBA 2B30A 1DKRA 2QJRA 2CXCA 5EP2A 5CDYA 5IPFA 1WMAA 3QGMA 3T7IA 3W5AA 3OQIA 1PJSA 4EHNA 4YAUA 2VZ0A 3JQGA 1UPCA 2OPBA 3PVSA 2RBEA 4KIUA 3S2UA 4LFBB 1NDQA 1P7PA 4MV4A 1LU9A 3A9UA 3LBFA 3IMCA 3M83A 1P33A 1BSVA 3LNCA 3QVTA 1UIMA 4HD8A 2BHNA 1GHTA 2ZQ5A 4F06A 5IMSA 1IEVA 2II6A 3O8OB 1HT3A 4ZTUB 3EW7A 3QFRA 1WM1A 3LKZA 1ODIA 4EARA 4EB3A 4LBYA 3RYCB 4HDSB 1F8YA 2CNLA 2IYOA 4TRRA 5C80A 4MWSA 2AJTA 5KDLA 3DFIA 2HRBA 5I5EA 5GMOA 1D5WA 1FZQA 1G2OA 1VSVA 4ITVA 4BQOA 4ZZ3A 3RLFA 2L42A 1BWRA 4MV3A 4RE6A 3GLSA 5LOVB 4XLTA 3WGNA 3E27A 2A5YB 3AUUA 5EFZA 1XEXB 1L8QA 3IAHA 1SCIA 4PC2A 5F4BA 4Z4QA 3UWKA 5I48A 3AHDA 5CIWA 1PEAA 3MMPA 4QE3A 4DJTA 5K1ZA 3QOFA 5J2TB 4ZRMA 1XX6A 1YR3A 5KYYA 4HWSA 4IYJA 4F4CA 5K4HA 5LP6F 4X6UA 3G6KA 1B8UA 4LQCA 5BN3B 2ZE7A 5TS3A 4XRGA 2QRZA 3AKCA 3Q0IA 3ADCA 2HO4A 4NQRA 2GS9A 1U8UA 5BV7A 1M7HA 1TVEA 1VLJA 2XBMA 3EUWA 1OWNA 3S8MA 1QFZA 3BIWA 3V3TA 1N5RA 2IS1A 4QBHA 3U7HB 1ULSA 5AJVB 3PXBA 2E1PA 3D3WB 3DKRA 1LUAA 4UHKA 3MYYA 1KZHA 1KAHA 3PQ3A 2HXSA 3ITDA 1V6CA 3I8XA 5ANRB 3BWYA 1DAHA 3QKUA 2BPOA 3Q41A 3FM9A 1M2OB 1JPNA 3PQFA 3C6MA 1OLOA 2B2CA 1I2ZA 3CG0A 1EK5A 2H7CA 3QG5A 1KS9A 2YQ4A 3C16C 4F0JA 1CUDA 2CXTA 6Q21A 3UBTA 4QD3A 1SBIA 1CC1S 1L5QA 3I73A 1K0RA 2GZDA 2SKEA 4YP0A 4X60A 2ZB3A 1HDOA 3EISA 5CGQB 5T4HA 2C4KA 4E11A 4KK4A 4DAOA 4UTXA 1FYEA 2NUAB 2DHDA 2WWRA 5ECGC 4ZYTA 1XRPA 2X2FA 3E9YA 3IUYA 3NHYA 4IPTA 1DEHA 4AJPA 2XVYA 3VNSA 4PPQA 2CXUA 1MNQA 3M2TA 4I5DA 1WUYA 3H3JA 4PFKA 2I1WA 2J6HA 1ZDMA 821PA 3CTMA 3UJHA 2YKGA 1JG3A 3Q7TA 4LOLA 4Q93A 5C7LO 2P7IA 4RNDB 2I6UA 2XGGA 4A82A 1XBTA 2B6HA 2IEYA 2MSLA 4MNTA 5HYVA 4LBZA 1A5ZA 1KMMA 4QRDA 4KPEC 1H9BA 3OJOA 2Y67A 2J3JA 2B99A 1Q15A 3IMEA 3OZEA 4N6GA 4PC6A 1ORDA 1ZM4A 2DPYA 1Z68A 1F2UB 1A8QA 2X5JO 3DXFA 3CT4A 4GOXA 5G0VA 4C6RA 5DSTA 5HIMA 4BLWA 4XWTA 2IOQA 4Q03A 3U09A 3FBGA 5BUZA 2IOFA 2PM8A 2IODA 4AY2A 4JL5A 1C8BA 3VR5H 2YIJA 2VHWA 3TJRA 4DOMA 3DE4X 3ELBA 2YNMA 4O4IF 4P92A 1JMYA 4YUVA 4JUIA 3FD8A 4PG4A 1YI8A 1E9CA 3IV7A 1YFJA 2BIFA 1D4AA 3M5DA 3GY0A 1MOQA 4AJHA 4H4EA 2ZI9A 3QEAZ 1R88A 5J63A 4EI7A 1FDUA 1XNHA 4M55A 3RANA 4B43A 1HYEA 4CMHA 1WETA 2ES4A 1L7MA 3KRTA 2Q6TA 1R5BA 3R6LA 4CM5A 1QHXA 5TPWA 1HE4A 4A0GA 2ZW9A 4HNUA 1ST2A 2PCJA 3NWPA 2PNFA 3I83A 4Q1CA 1K75A 1SU7A 4XCXA 4BLOA 1Y9DA 5E6RB 4KQCA 2HA7A 4ARZA 1G20E 1TEVA 3OWHA 2HHLA 2PWZA 4PAWA 4PQYA 3UMYA 1XQYA 1EUCA 3OSZA 4FLMA 2ADOA 1WU8A 3A3PA 2IC5A 3ZY2A 5JRZA 4TUYF 1CZRA 2CYCA 1E79D 2J9FB 3F0TA 2CMGA 4LVCA 4MR7B 2G76A 1QE3A 1OZGA 1Y3CE 2ADFA 3AI1A 2IY9A 3IIIA 3QOXA 3W2GA 1GQFA 3OFVA 5JTTA 4QATA 4HGOA 3AZQA 2MSKA 3HZZA 5DBOA 5JSZB 5JVDB 2FJPA 4BQPA 5FRDA 3SNKA 1T1RA 5HIAA 5JJKA 2Q5LA 3HVJA 2A9OA 1GTJ1 2Z5VA 3O2EA 2ZSKA 1XKTA 2FG7C 4GMDA 2H07A 2WWFA 3KKPA 2ETXA 4IMJB 3WB9A 3WNVA 3GH3A 3DDUA 4LJSA 3RJZA 3WRXA 3BB4A 4I1YA 4YRSA 2AOWA 4OXIA 2VJBA 4I14A 1AK2A 3DGFC 4BNIA 3UG7A 1T26A 3JQDA 1LBTA 5EJ5A 2PZ8A 5K3CA 1ZGAA 1GV1A 2O6LA 1YS1X 2RGUA 4GX0A 4V1CA 1JDVA 5CLHA 2BM0A 4IDCA 1IEQA 1DX6A 4P53A 3ZS9A 2OENG 1C30A 1JXOA 2FZLA 2M32A 2X9VA 4EF4A 3BWVA 3ZY5A 4MWBA 2VK2A 4G81A 4DUGA 4Z5XA 3CNBA 3V97A 4UVGA 3H5TA 3V33A 2OEPA 4BX2A 1VJGA 4P0QB 2XXJA 1SKAA 3PC7A 2CLCX 5E4YA 3ESZA 4W5WA 5BW4A 3I58A 5B1HA 3N8GA 3R7DA 4Z7QB 3IIJA 3N3AC 3NAQA 4YT5A 1KEKA 4YMSA 1P91A 1KTVA 3H05A 3UGJA 3JQ8A 4RGQA 4A2WA 2C3OA 1EAMA 4L4YA 4ND7A 3F71A 2Y4NA 1K4MA 1UFVA 2NXNA 4K40A 5CMLA 2AA3A 3BGIA 4IRMA 1EFDN 3KJHA 4X1IA 5DHSA 3BRWD 4GPTA 1TO2E 1MW9X 1GQQA 3AEUB 1Y8RA 1T8RA 3UHJA 1X94A 3ND8A 1MPTA 1UBMS 3HLTA 4JASB 3BULA 2QENA 2XTZA 4DRZA 1QSGA 5HTOA 3OM0A 5EPOA 3ON5A 5HKOA 3RSOA 4TKVA 4EY5A 1Q1QA 3EZLA 2YJNA 5K0LA 4LUCA 3VKHA 4UTVA 4TQGA 2X4GA 3Q7RA 4TRJA 4BC9A 3ZLUA 4DZRA 1Z9BA 4F91B 3GPLA 5LZ5A 1TO6A 1T5LA 2L82A 3EF3A 4R4JA 3DT6A 3TBKA 3U9SA 3HYTA 6ABPA 2ZS8A 3FTCA 3G5AA 1RW4A 2B4YA 4HI0E 4TMKA 1QYIA 1UBHS 4OGGA 3RSGA 4BJHB 4OXYA 1LBHA 3C5HA 3K70D 1N33B 1J97A 2FZ5A 4ND2A 5JH7B 2YR0A 3G9XA 1U0JA 1SHTX 5AW0A 1BIFA 1YFKA 3D8BA 1ZINA 3W77A 1DPFA 1U3WA 3IAXA 3P0IA 3LFHA 1JVBA 3DUFB 5IMBA 2P35A 5IAOA 3G7SA 4YREA 3RS7A 8ADHA 4N7JA 4JITA 3FCCA 1Q7EA 3CUEF 2PSHA 2MSWA 4WLUA 3UCEA 1CD5A 1RADA 2QV0A 3K0AA 3H2KA 3BD8A 4YHBA 3WWEA 1PZFA 3BJZA 5FD8A 2FZ4A 1WCJA 1NBWB 2VCYA 1CIJA 2QPLA 1ISGA 2IBMA 4N8EA 1LDGA 3KVYA 4YLGA 3BTSA 4XPIA 3ZCQA 2P2ZA 1ZNYA 3O4GA 4HPWA 4JC8A 2WPNA 4QQ8A 5A04A 1ISRA 3AVQA 3WA7A 5ENDA 1HR0B 3OAAA 4PCAA 5EQDA 1MMFB 5CEJA 3KAQA 1E5DA 2XMDA 3ETNA 5H3HA 4LBVA 3MCAA 1M2GA 3PT9A 5KYWB 3LDGA 3LQQA 4UBNA 4DSZA 4JP8A 3VVBA 1P9LA 1GO2A 3E7FA 4YUWA 2P3QA 1K8QA 1M1YE 4X8LA 3IEVA 1T0JB 4KO2S 5KU1A 3UMSA 3ZK7A 5L7TA 3D5QA 4EUKA 5DIFA 1ZN2A 1Z2EA 3G2NA 3H9GA 2ZTSA 4F3KA 1F4PA 2A67A 3LK6A 5FHRA 4Z53A 4Z4IA 3DHYA 4R1SA 3HB0A 5G3ZA 1L6RA 5F51A 3MIZA 4UU1A 5AJXA 2X9GA 2HMYB 3MELA 4YALA 3TFQA 5K0FA 2Z6VA 3QLUA 2D8AA 3OZIA 3T38A 2JZCA 1LV8A 1PG4A 3W5CA 1ZH0A 4CCSA 1U6IA 1NM5A 2A7QA 1WHTA 2P6NA 3RVNA 1XDSA 3TMKA 3U7EB 5DM70 3WLNA 5FFMA 4DIMA 1MABA 2I7CA 5AI5A 1ISMA 3IJ5A 1G8SA 3CIOA 1KEZA 4JYBA 3NP9A 5E1DA 2I65A 4HZUA 3NC0C 4F2WA 1KOLA 1Y3DE 1GN9A 1U8CB 4OV6B 4Q4LA 4S0XA 5C8YA 4F4DA 3CNQS 2WJPA 4BNLA 4LMRA 5BMVB 5A2GA 2L2QA 5CH8A 1EGAA 5FXMA 4QL3A 1MENA 3ZWYA 3EXFA 1P44A 2YWFA 1BN6A 2FW6A 4XFKA 3FOBA 3PPVA 3TW8B 2HSGA 3TRDA 3ZBTA 1YT5A 3N59A 3MJHA 5BWCA 4EFNA 3UJAA 1IVSA 3QEMB 3JSXA 4RA6A 2QN3A 2ST1A 3ZD8A 4TQAA 3VR4H 3HSYA 4A0SA 1ZESA 1JP7A 5AKYA 1IEXA 1SMKA 2GZ3A 3QBDA 4QSHA 5EJMA 2X0RA 1GL9B 2V1XA 4G01B 4JWTA 3L07A 3SMQA 3W6PA 1CUAA 4FE3A 4EATA 4ZQHA 4LQ4A 1M2WA 3L49A 4HLUC 2H92A 4G4IA 3M6XA 4EX7A 1P2TA 4KXWA 1I9CA 1PP4A 3BMXA 3TNLA 4BFLA 5T3UA 3SQNA 3AF5A 1J8DA 1RRMA 3CH7A 3HSSA 5B3KA 1Y7IA 2Q3JA 2P0AA 5A06A 2BR3A 1V5FA 1MF7A 3G82C 2ZJ4A 2GNAA 3JPYA 2FMKA 2OLEA 2JIRA 3NIDB 2DULA 3FOZA 3KDSE 2GYVA 2CLOB 1CVLA 2P9ZA 4DR4C 1CZHA 2FQWA 4H1TA 1IRXA 3BMOA 2Q6OA 4GGOA 3LWNA 4LRQA 1ORHA 3ZEAA 3R41A 3LC7O 4AWBA 3DO5A 4HDNA 4Q00A 4AYTA 1UP7A 5EJAA 1HI9A 1ZU4A 2GKOA 3BHIA 1SUDA 3ZHQA 1PL0A 2Q45A 1U7OA 1D4OA 4I7EA 1Q0RA 1OXSC 3ZZ1A 5BN4A 5LA6B 4LI3X 2QSUA 3WE7A 4I6EA 2XOKD 4Q6WA 5LU8A 2OZKA 2VDRB 3MT8A 3IOEA 1NNEA 1V6AA 1FNBA 1J07A 1JWBB 3UGKA 3QUQA 4DQLA 1W44A 3DXXA 2D13A 1P81A 1HK7A 1FFWA 3C0KA 1QIEA 5GP1A 4CV0A 2HC9A 4E1AA 2ZI5A 5BR1A 3ZJVA 2PSDA 4GPEA 5FA8A 1RAHA 3GP3A 1G9TA 1NBOA 2C03A 3AKEA 1S9DA 3AL2A 5A9SA 1DRKA 3KQMA 5LNK1 1XYGA 4WBSA 3N2YA 2JI9A 4I36A 2C9ZA 1D9XA 4TOIA 1ZJJA 2GF0A 1FYXA 3KAPA 1VRWA 2MYTA 4CMGA 5FLXD 1GAEO 1TJ4A 1EMDA 1Y6RA 1IHPA 3I12A 3OVMA 5ARBA 2QG9A 3QXHA 2NX2A 2HBRA 4B33A 1S8OA 1U2TA 5KSYA 5E9AA 3BERA 1MJGA 1HE2A 2VRCA 4UE2A 2QN9A 1ISSA 1NFRA 2RJ3A 4LYDA 2IU3A 4D74A 4DBLE 1VTKA 4FFRA 4RABA 4EPYA 4K6CA 4AAYA 4UZEA 4LHSA 3KCNA 3NM6B 3HPQA 2PT7G 3BDVA 3WB1A 4EM6A 2QUHA 3KLPX 4F38A 5B7GA 1FX0B 4L8VA 2GWRA 2G77B 3U56A 4ENTA 3F7NA 1XZQA 5JZOA 1X7YB 1A7JA 2XXBA 5FLEX 4FIDA 1JIUA 3SAJA 1DV2A 4E32A 3CBGA 2JIOA 4G25A 2I6GA 3KOYA 4ACAA 5K0BA 2PKCA 1CZOA 3CCBA 2Y66A 4NOKA 5KVCA 4IEIA 3N2IA 4KXNA 1NWCA 3WRYC 4WNAB 2IS6A 1AQNA 3FNQA 3A25A 5KWVA 1SIBE 4UEOA 1DTEA 4JAVC 4NK5A 3KL2A 1KDTA 2Q6LA 1KMQA 3CLVA 1IRIA 1USPA 4D26A 1WA5A 3BXFA 3LF2A 3OF5A 4N3BA 3FJYA 3SDBA 3SYKA 4YRBA 1TM2A 1XJ0A 3IP8A 2XZPA 4MSUA 1Z15A 3PHGA 3FX2A 1CQIA 5KZMB 3TXYA 3DCYA 3GOQA 3DBIA 4GYJA 4E5MA 3N07A 5I7OA 3TIFA 3GFRA 4DCVA 1BWPA 4AS3A 1J7JA 1QV6A 2K2QB 2XUGA 3IODA 4N9WA 2QNBA 4HJXA 1WMEA 3HY6A 1SD5A 1GSHA 1LPSA 3B3QA 3INTA 1IPHA 1BKYA 2PWPA 3IULA 3LYHA 3PHLA 4JBXA 3GGGA 4Y1EA 1G6KA 2X6RA 2A30A 3P26A 1D2RA 2NO1A 1PYOA 4M76B 4HLNA 3VZRA 2PY6A 3WBKA 3A6DA 1F7VA 2M6LA 2J9GA 4YS6A 2BLNA 1KJNA 3SBDA 3S70A 3A1SA 2LXNA 2PT9A 1V2HE 4B8YA 3UN1A 5DN6D 5JCXA 4RK6A 2VEOA 2DLCX 3CB4A 3D0OA 5FI5A 3RASA 3U80A 3X1WA 3P7MA 1U2PA 4I6JA 4GWLA 2XUKA 1ZIPA 2BR5A 2PRSA 2GQ0A 1W8DA 2PMFA 4KIFA 3DP9A 4QQKA 1R8YA 1IAQA 1R7RA 1Q44A 2E37A 4BZWA 3ZQKA 3WJ2A 3HZRA 3KB2A 4J16C 4QFCA 3ZWMA 3LXMA 1XPJA 2IPAB 4QFMA 4CKEA 4DV4B 3EZGA 4BEVA 1LPPA 4D0LB 2IDZA 3QQPA 4OFBA 4OX9B 3SFVA 1U0RA 5DKFA 1K6IA 4Q9AA 1HM5A 1NBAA 1PZGA 2IXDA 4PYLA 5IANA 2IYFA 4IOMA 3RS8A 2XMCA 1PLLA 3R2JA 4XOIA 4TLLB 1C80A 2HBYA 2QD5A 5JMPA 4B5KA 5KTYA 1XMIA 5H02A 1XGKA 2YIDA 5DBGA 2JAWA 3WWOA 4CM6A 4KPGA 2KX7A 2I71A 1Z7EA 3TXXA 1N0IA 1O9HA 4H7EA 3UMRA 1HYBA 2Y76A 2I2CA 4B31A 4BL5A 1E6MA 1JDBC 3I42A 4FSXA 4PYRA 1FUGA 4WKOA 4X5OA 2A84A 4KSBA 4HRAA 5KOHA 3DBRB 5AJUA 5T41A 1FX1A 2AMYA 1Y5NA 4DBVO 4GZ6A 4RO0A 3FI0A 1U9IA 4P31A 3ZI4A 1H0SA 2D1YA 2JVJA 2CCKA 3IQWA 4I9HA 4UUBA 3VV3A 4AMYA 2QTTA 1Z18A 2FN9A 3LZ6A 1AUPA 3AIIA 4QUEA 2H5JA 5TMEA 2A88A 1TVMA 4DPLA 5BPHA 1UXIA 1TYZA 3D4IA 4EJ2A 3K0CA 3QYPA 5I7RA 3ZZUA 1L7OA 3DOEA 4B2LA 4Z9YA 4FU0A 3O9ZA 5JO0A 5E8JA 1K7EB 2WYVA 1O6CA 2HB6A 3HJGA 3IAEA 5J2UB 2VWHA 1U7WA 3PDJA 5ALIA 5CLFA 2HSDA 4HEQA 3TLEA 4OFXA 5EP1A 1KAEA 3L7IA 1Z4MA 3B2NA 3OHMA 4EJSB 2BGIA 2AC7A 1KI6A 1BCSA 2F59A 2YV5A 3HM2A 4J9VA 1JXMA 4KFUA 2G9VA 2B36A 4BJ5A 1JU9A 2QRQA 2XZTA 4BE4A 4RD2A 1JHAA 3L3BA 1KDOA 4ZCSA 5JZBA 1L7PA 5F5XA 5A6VA 1M6XA 1S8NA 3CNEA 3UWMA 1YR6A 4F3YA 5BQXA 5ALRA 5E3HA 4TYWA 4DDUA 3BAFA 4UQLA 2RGEA 3NBMA 3KR0A 3EPHA 2QL9A 3ZU5A 1YZUA 2P5TB 4G0WA 3I1FA 3EN0A 5BRAA 1GNVA 1NLFA 2XLBA 2XTMA 3R5KA 4CL0A 1EM6A 2MDTA 2QTVA 4BV9A 1RLIA 2J3KA 1NMEA 4ISCA 2V7VA 5D5QA 4B6RA 4JI0B 3E35A 5LMZA 4L7QA 3GCGA 4FT4A 1PQYA 3OMLA 5JNWA 10MHA 2N1MA 1J0CA 5K01A 1SUFA 3O8CA 3CNHA 3AF2A 3PNVA 4I9UA 4LNAA 1O54A 3EGDB 3KT6A 4RPIA 3WQQA 3FMPB 5FDFA 5DNAA 5IT0A 1VIMA 4MMZB 2VG8A 3ZE9A 5KTNA 1E1DA 3O38A 2VQEC 3C3KA 4JI5B 4JXKA 4BPRA 5KSWB 3KR2A 3CCFA 1C7QA 1TYCA 5KOJB 4AKGA 2HHAA 3M81A 1CDDA 1PU2A 2WI8A 3O9MA 2N75A 2ZRIA 4FXPA 3ZR4B 5MHTA 1IXZA 5HJ5A 3R1IA 4C78A 4MGHA 2Q1UA 4BX8A 1SZCA 5BVHB 2I22A 3AFOA 1L1QA 1KO5A 4M1ZA 1UMBA 4O0LA 1T8YA 1UM9A 1X15A 3S7TA 3E03A 2E5LC 4IIFA 4Q12A 5DT9A 1U2GA 4AKSA 5JXHA 4NEQA 4FZVA 2PMDA 1K1EA 2NXEA 4DT1A 3AUXA 5KKCA 1DJQA 1BNCA 1KZ1A 1SCBA 1T9HA 3ZJYA 3RBZA 3UAGA 4IFIA 1U4OA 2XKBA 4F11A 1UPBA 4PQRA 1DXHA 2R6DA 3S8YA 4XEHA 4PFJA 2UYYA 4AKEA 3KVVA 3GU3A 4K81B 3L7NA 3D0QA 1II8A 1V37A 4QPZA 2AE1A 3QEOA 2IYSA 3OZAA 5U4QA 2YN0A 5B57C 4JBWA 3U13A 4U7DA 1ONPA 3HKDB 5LQSA 1PWHA 4ID9A 1N5OX 3H2TA 2OBXA 3HMKA 4YFYA 5AK4A 3S5JA 1KORA 3WFJA 5KWEA 1FMJA 1AKEA 3RRJA 3O3CA 3FDXA 1GUBA 4NBVA 1NBEA 4HSEA 5EIHA 2GLUA 1A2BA 5EWJB 4PROC 4RVNA 2Q0SA 3M3HA 3LFTA 4KQEA 2H1HA 4ND8A 1RJEA 4R83A 1SVUA 1XTVA 3U3OA 1BVHA 2A94A 4CL2A 4ENSA 4REOA 3OLCX 4KIWA 1TQ2A 4N7MA 4A36A 1OB5A 2BLLA 1O94A 1XZPA 3CM0A 1Q0LA 2HAEA 1WABA 4GXNA 4ASUD 2RIRA 1JI3A 4GZ5A 3P20A 4K6KA 1F6DA 5G0WA 1U28A 5TQ0A 1QZTA 1R12A 1QAMA 3RIHA 3ZWQA 3GUYA 5JZMA 5KHLB 2CJWA 4QSMA 3I5YA 3E48A 1RXYA 2QPAA 1SOWA 2WTEA 1VLQA 3PGVA 1W4RA 4TMZA 2J8ZA 2WOOA 3ONVA 1Y9EA 2P0YA 3RUEA 3K35A 4UNIA 3U3ZA 3GF4A 2ZK7A 1RM5A 1XMVA 1QGUB 3I2IA 1XJQA 3WLJA 3K9NA 1U02A 3MBIA 1X70A 4XX1A 2AD1A 4XARA 1JPVA 3F6PA 1XI2A 2QI9F 3FFTA 3FTDA 4MARA 2BTQA 3BFPA 4GL4A 1JHPA 4B3FX 5A3JA 3OIUA 1EWVA 2P9YA 4A0QA 3S28A 4LCBA 1ZEMA 2O20A 1Z56C 3PZBA 4OJMX 4ZT5A 7GPBA 4QJBA 4MYRA 3BGVA 3QPWA 1XRRA 2HJSA 5TVKA 2O2DA 1IBLC 1AGNA 4N18A 4ZOQI 3ZDCA 1VFNA 3BSWA 3H2IA 2QM7A 3V8NA 4Y1RB 2CWWA 4NDNE 1O8BA 1PGJA 3UHOA 4C7VA 2B3TA 3W5SA 4JLPA 5D7BA 3SD7A 4C4YA 1JEAA 3M1IA 3LDHA 1U2DC 4URXR 1RI3A 2P5UA 4O1MA 2OHFA 4O3MA 1Q16A 1DKQA 1L4KA 1HXHA 1MQ9A 1XA3A 2IHUA 3DLCA 4OGFA 3FNGA 5FT9A 3ZEIA 4QYIB 4Z0NA 1SULA 3IE2A 1TECE 2B21A 1MO3A 3NVMB 2PN2A 1P5RA 4JELA 4UDXX 3BA6A 1W36D 4NBSA 4L9AA 5JDCC 4J1TA 5I7UA 1L4FA 2XNKA 3N5KA 3QUTA 3R20A 4KQFA 4HGNA 4HCJA 1ZR4A 4CFYA 4NU8X 4WCVA 3GH1A 1PJ8A 2O4CA 3EXHA 3IPLA 1MORA 3EPLA 2GAFA 8ATCA 1GTL1 3STTA 3N8IA 4D9HA 2JATA 3HVHA 2H16A 3OD1A 1KI8A 1W25A 3GLIE 3I05A 2O3SA 2PMKA 1NMSA 2HLNA 4HY3A 1VBFA 3G8DA 4NBNA 4ZQIA 3VR3A 4IHQA 3H6HA 2F55A 2IX9A 1L5WA 1XDDA 4LFAB 2XWSA 3EQ7A 3FPBA 2XMPA 3DHEA 1FSFA 2ZSAA 2YXPX 4C5CA 4ZRNA 4CR8A 1T24A 3MJTA 5TDHA 5C37A 1OWPA 2XA2A 1USWA 2IZ1A 1NUTA 4KRYA 5JISA 3AFGA 3Q6MA 1N2FA 5K85A 1ZOLA 4AJ4A 4O8CA 2QW0X 1K8YB 3K8QA 3ND6A 5G41A 1RPZA 4NMLA 2VNKA 3B9PA 2FDCA 1GWNA 1PTJC 4TTIA 2C7PA 3VO8A 1ILWA 3FPCA 2AX3A 2XVZA 2ZSJA 3G5LA 4HBZA 4P2GA 4A8JC 1V6SA 3AJAA 3M5CA 5KTTA 1KAOA 3JWGA 1U6KA 1KKGA 1JALA 1YQDA 2DFNA 2E1RA 4XVCA 6CHYA 2GARA 3LTNC 3MC1A 4RMJA 3O0TA 3ZDYB 4YPFA 3EEQA 1PLKA 1XPUA 1CY0A 4K05A 4R0MA 2QN7A 3RTGA 2FDXA 1NW8A 1CB0A 5T6MA 4WA8A 4U7FA 3G9ZA 2CLKB 1ZAYA 3OLWA 2CV0A 2QAGB 2CBGA 2FP3A 5E9JA 3U4QB 4HTFA 1ZC4A 1XCPA 4BO0A 1MT0A 5EPUA 2Z8YM 5HJ2A 1ZNQO 2GILA 2PBRA 2GERA 3VPXA 1JVSA 4RHFA 5CA1B 1NJ8A 2M6RA 3WKBA 1UL1X 4FIZA 4RJJA 3X3HA 2QL5A 4QGFA 4AF7A 4BVBA 2XUDA 3OCWA 1S3FA 3E1GA 4LF8C 4HOYA 1LTHR 1Z5WA 4NKRA 4DZZA 1RPTA 2UYQA 1G8PA 3NV9A 3SZLA 4N5IX 3KXKA 3I9OA 3KSBC 2AMVA 5IT9D 3IEKA 3QKIA 1E1CA 2OA0A 1N2HA 3HYCA 3F5DA 2C2MA 5HG0A 2W0MA 2X42A 2JASA 1WCIA 1D2HA 5DJ5A 2ZZNA 1ND6A 1WULS 3AERA 1DLIA 3IMLA 2WFAA 3PFCA 2WNIA 4G3XA 3EGCA 2YIVX 3E3AA 1QVZA 3PWTA 2R4QA 4U2DA 1D6SA 2G8LA 4ZU6X 4IIUA 5A5EA 2PX5A 4X3CA 3RQSA 2VDUE 2JFNA 2KM1A 1Y1TA 4HH1A 2C8VA 3ZD6A 2VDJA 2M6SA 3J80A 4PGFA 3O31A 1PZMA 3SN6A 1E5LA 4OHPA 4GMHA 3VKWA 4I50F 2HJGA 1L5MA 2YC2C 2BFWA 5JCPA 2OCKA 2YBEA 1FC0A 1ZWLA 1Y7PA 5IVDA 3SXUA 4KQGA 4QJ3A 3FKSA 3Q40A 1YJXA 5EVCA 2B4RO 1OV4A 2XT9A 4BZPA 1EFHA 4D57A 1R5JA 1GUYA 4DJEC 4FE4A 2HSZA 1THMA 2J9RA 5SZJA 1W0CA 2AGVA 2W43A 3PD7A 3WGMA 3NPAA 3V00A 4IRXA 5A3RA 5GINE 2F00A 3DPUA 3KPYA 3HV0A 3WXBA 2D2EA 2JGAA 3JATA 2WW8A 1WTCA 3KU4A 1DGQA 4H17A 4HNAA 3DOJA 3GCXA 4X1KB 3F2IA 3OPQA 4ZYLA 3ILYA 3H0EA 2OWDA 2A57A 3Q5GA 4HEJA 4K9RA 3BFJA 2DWUA 3B3FA 1X7WA 2FSUA 4UU0A 2WJ6A 2Z2KA 3INNA 1RMQA 5C5CA 1HMPA 1KI4A 4UJ5A 5G4LA 2H4WA 3BJIC 4TTVA 4OJKA 5JBQA 1A7UA 5FBRB 4E5NA 1V41E 2W2LA 2SKDA 3C6BA 2BJOA 1D6MA 2FK8A 2HHJA 1RM3A 5FNVA 3ER8A 1W35A 1YQGA 1PT9A 2R2AA 4OQFA 4LV8B 2GTHA 2EQ5A 4V0RA 3NXSA 3V3KA 2ON6A 4EGFA 3IQHX 3MRTA 2RHCA 3DEYX 4IV8A 3HHPA 3URKA 4WBNB 4XB6B 4AVYA 4R8MA 3OPXA 4JI6C 1Q20A 4LOKA 1JV2B 4EF6A 3F73A 1IAVA 1LF0A 1XTRA 3DTTA 3BMQB 3HO6A 4OKIA 5EJ7A 4H1VA 1N2OA 3AGQA 1AS2A 1Y80A 4LYEA 4XX0B 3EGEA 1O03A 2O5EA 2VDOB 3GV0A 1DT3A 1Z2CA 2NU9B 5FOWA 2I9PA 2KSQA 1VHWA 2KQUA 2H9YA 1KIAA 3Q1LA 2FP4A 4YAEA 1X9HA 1KJZA 3WYBA 2E4YA 2VHQA 4KMMA 1TT7A 4LF9C 3V8QA 4JI2C 3GDGA 1QZXA 1RQLA 2EOAA 4UHFA 4KFTA 1XQ9A 2RMKA 1VXOA 3A9TA 2YUTA 2WQ7A 1DQYA 2CYAA 3EXEA 4H3KB 4FGSA 1GGHA 3W34A 5TEVA 1NC1A 1KSGA 3NI2A 1SIWA 3N2KA 5EUBA 4ER7A 2AQKA 3MN1A 2JZOA 1A8UA 3C43A 3FNHA 1JNYA 2MTBA 3Q3CA 5I8ZA 1BCRB 2NQ8A 2HRDA 3GDHA 3T9CA 4ILKA 1Y6QA 2G1KA 1CP2A 3CSSA 4Q1FA 2P3SA 2ZCJA 2OESA 2AZTA 2OCLA 3V4OA 1RWNA 3N53A 3VISA 3DMHA 5MDHA 4I5IA 5H3LA 1XZIA 2QM8A 1Z7YA 1E5QA 1YS6A 4OKNA 1E3WA 4OIFA 2XMBA 1Z38A 3NBKA 1IN8A 1VKHA 4AY4A 3T4PA 4U6QA 4XXHA 3PENA 3N58A 3FDJA 5D2CA 2VYND 2OP1A 4DCSA 1I0LA 2ZKLA 3EVCA 4ZVKA 2QXTA 2BFCB 3T5PA 2JKZA 1UJ4A 2PAFA 1RC0A 4ZO4A 2GDZA 3H8VA 1NHGA 2HF8A 4HWOA 4KSCA 1E2EA 4BGDA 1YWGO 3DC2A 1WXFA 2RK4A 2ZB7A 1X74A 3CR3C 3PQEA 3NTUA 2Q2OA 4N5HX 3UOGA 3ZYZA 3IC5A 3Q3VA 4MQBA 3PC3A 4JLBA 5AXDA 4QZVA 5CVUA 5JAIA 1HDYA 3HCDA 4BXOA 3AP3A 3JYOA 5LC1A 3H97A 1PR1A 1F6BA 1ZL2A 2X40A 3EXG1 4AX8A 2Q5CA 1W94A 4C2BA 3O4JA 1E89A 4XYEA 3HADA 2XGSA 2BGNA 2YHAA 1WDKA 1BGXT 1NMZA 2A8YA 3GEIA 4OL9A 4E88A 4C7OB 1ZM7A 3I64A 1WP9A 1CQXA 1VLHA 3D6VA 3I2FA 3ZNQA 3MQ2A 2QTBA 3IPAA 4FTWA 2BGWA 1ZGGA 3L6DA 2R6ZA 2FRXA 3LQFA 4J0QA 1H42A 1NNI1 1ABEA 2F1OA 4XOUA 5TJ9A 3R7WA 3ZDXB 2UXCB 1OXKB 4G1VA 3E0QA 4J76A 4QJIA 1OTYA 4HJRA 2EKPA 1SCNE 4LGVA 2JFQA 3Q8XB 4YCBA 7MHTA 2JFUA 5CK5A 3DP7A 2JANA 1G2IA 1Q1GA 2PXXA 4KQ6A 1YGPA 1L4GA 4J0EA 4EUNA 3VRHA 5DRYA 3WQRA 5CDTA 2HWYA 2I4IA 3R23A 2F8MA 4GE3A 5FTJA 2GOYA 1R4MB 3HJBA 5ISMA 2R7AA 1PZNA 1H6AA 4LZLA 4E14A 2ZT7A 5LB4A 1BDBA 2H7YA 1FFHA 4JLJA 3QE9Y 1VZ2A 2Q62A 4HXYA 1II0A 3C3AA 3G2HA 1KAGA 4C7KA 4FYWA 2LV8A 3GX1A 2QVCA 3K2EA 5I4CA 5TIIA 5COQA 4OFZA 5IN5A 4EGSA 2HJWA 3E1KA 4YYZA 2O0MA 3L1KA 1KO4A 2J7PD 1V1MB 2ZB4A 4OMCA 1I10A 1TF5A 1ZK4A 3D4NA 1Z4LA 5U1PA 2VTBB 5AI9A 1KYXA 3OJEA 5CB4A 2LDBA 4CHGA 2FX3A 4ESVA 2CY0A 4KBGA 4UTNA 4QQFA 3LVQE 1Z0SA 5KI6A 1U65A 4W1PA 1WHSA 4AKTA 1G1AA 1TZCA 1W0JA 2IPLA 1YK1A 2JGRA 3DLIA 3I8OA 1F4LA 2UVPB 2H8KA 3EIFA 2BFFA 4PZ9A 2C2HA 2W0SA 1YCHA 4JEMA 4HL6A 3W4KA 4PYIA 1I7NA 1E3QA 1P5FA 1BEUB 2ONYA 1RKQA 3K96A 3OQIB 2BF4A 2R1VA 5ED4A 3JQGB 4OQMA 5TY0A 2FPPA 3IBTA 4KH0A 5IK2A 2H7XA 1JLLA 4LDPA 1JEQA 2YRWA 1KY3A 2EBHX 4Z99A 3SYRA 4D9NA 3GRAA 1G8HA 2HA5A 2ZYSA 3IPYA 3R77A 4BMSA 1FTQA 1DI0A 4ZQBA 2FW0A 4M0PA 3U4HA 1DAOA 2QD4A 1R10A 3HRHA 3HU3A 2D0OB 3FNBA 4C04A 2PGXA 4KQ2A 2NVBA 3GNSA 4R3WA 2NU8A 4B3IA 1OT3A 2FHPA 1M66A 6YASA 3Q85A 2EP8A 5TF4A 1WJGA 3W2EA 2JHFA 4IVRA 2V3WA 1L9XA 2EERA 1ZMOA 1Q3TA 2CLFB 2MR5A 2VBCA 1IMJA 1GCAA 1LTQA 1AQLA 2ZE8A 4O4JF 3Q8WA 4KXUA 4WXRA 1AA9A 4BE9A 4CMIA 2IHTA 3O82A 4RZ3A 3RUFA 3UQYS 4CVNA 2X8JA 3ZGLA 5AUQA 1XTKA 3HM9A 2VF7A 3ZE6A 1T1GA 2RHJA 2X0DA 4UHCA 5CFMA 1OKKA 4NCIA 2DB3A 2OFXA 3RRMA 2YXNA 5I47A 3D2AA 3SHFA 1W9HA 1QAOA 2NAFA 4U5YD 1W4CA 5KYYB 2OBVA 4INZA 3H6KA 3GCDA 1U1CA 3EXG2 1JLKA 1YVUA 4JJIA 4MJXA 3AETA 3L93A 4Z4FA 1U2QA 4EO9A 1IZYA 4EPRA 3TAHA 1G60A 5I8PA 2LP4Y 4L6IA 4TQ9A 3KQYA 3SHTA 4L7IA 3FKJA 5AE1A 1QRDA 3RYIA 5BWBA 2IDMA 1EDZA 1GUZA 5GVSA 3CRQA 4KXXA 4WV3A 2H2GA 1O92A 2VA9A 3K5WA 3BRSA 4Q01A 4AW9A 4IH4A 3UV6A 4E2ZA 3ESQA 1KE1A 1YD7A 2JHGA 4BVFA 4EI2A 3MOSA 4MW4A 1BTOA 3HUUA 4B4UA 2GFQA 4AJ9A 1U8TA 1Q17A 4MRMA 1PD0A 2IPMA 3SLKA 4QBKA 4F4JA 5K8JB 2CD9A 2F1JA 5E4JA 1OH5A 3OJLA 4BS9A 2XI4A 3G2OA 1ST3A 2DBQA 4RSMA 1AGRA 4F5DA 2KWIA 3VR0A 4LY0A 1KQ3A 2I6TA 1XZBA 2Y93A 3C15C 1K5GA 1BZYA 1LVHA 1ZONA 1X87A 1X14A 1DC6A 4J91A 1N3BA 1T3SA 1U99A 3A11A 5IM5A 3GRUA 5FF9A 3INYA 3FN4A 2HU5A 4RQTA 5HILA 3RB8A 3T99A 3HKEA 1LWNA 3HCFA 1DEKA 2G83A 2GZ2A 1G5RA 4EFDA 3L79A 3CVXA 1B41A 2HPAA 1Z8HA 3DOCA 1AMNA 2G67A 3SQWA 4PONA 1RVV1 3AKDA 4MVJP 3CF4G 2HUNA 1TQ8A 3OF3A 3B20A 1MXFA 1NDHA 1ZGBA 2QZSA 3MVEA 3QELA 4MUMA 1E7RA 3FYCA 5CYOA 4JOSA 2QHXA 3HJTA 2QLJA 5I9TA 1ISHA 3U7Q