3GR0A

Periplasmic domain of the t3ss inner membrane protein prgh from s.typhimurium (fragment 170-362)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
186
structure length
186
Chain Sequence
LGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein prgH
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
total genus 69
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gr0A02
3GR0A 4ALZA 4G1IA 3GR1A
chains in the Genus database with same CATH superfamily
1WHVA 1KQGB 2DNQA 4G6VB 4NOZA 5JVGQ 2Z51A 4JI6F 1PJ6A 4QJVA 2X51A 1S4FA 5KG3A 2NXJA 1HI1A 1FRKA 2CRLA 3KMSA 1EKSA 4B17A 5F8HA 2FLPA 2WW8A 2QL5B 3EDQB 1D1UA 1IKWA 2B3TB 3UN3A 2ILZA 2NUHA 1FRLA 4WXWA 4MMOA 2B7CB 2YX7A 4B08A 1JJHA 2KHDA 3HZEA 4EZ6A 1EX8A 1IBLJ 5EN1A 4OYWA 2WAQD 1RAAB 3PZPA 4AL7A 3MXHP 3QYYA 4OJHA 4URQU 3LNVA 5DRKA 4J9RA 4KHPC 2XGPA 4ZA1A 1UEVA 4QYZK 2OHDA 4KTQA 3OPKA 1AYEA 4LBPA 1HA1A 3OFHA 3TZWA 4N5SA 2QTWA 5ETKA 3DAYA 2JRSA 4C4WA 5CXTA 2JFDA 1JXVA 1Y4ZB 3O3LA 2MMAB 1IKVB 4CLPA 4I0WA 1NPKA 1XMQC 5J2MB 2YNGB 3SCLE 1IKYB 1Q8LA 4TU8A 4M5LA 4PXEA 3SCJE 5C42B 2ADBA 3NL0A 2RHQB 1BGXT 1YTYA 4CTAB 2N7CA 1XR7A 4DR5C 4U95A 2UXCF 4USUA 1UTAA 3V6HA 2V2ZA 4F25A 2ALYB 1ZPWX 1TVRA 2PROA 5KFIA 2W2QP 4N41A 3C6TB 3KK3A 1MG7A 3HVTB 3HULA 2XMUA 5IS2A 4PXDA 3HJVA 4B3RC 2FGOA 4ZIWA 2DHGA 1EP4B 2FD2A 2J0SD 1J5EF 4J9NA 2ZDOA 2R7WA 2NYHA 2GGPA 4OZNA 4JI8C 3OXGA 1S6PA 4M95A 3PV8A 1AROP 2HSEB 2DRBA 2RUGA 2WHOA 4DV3J 3T41A 3HD1A 3V4MA 3OR1B 5U47A 3P3DA 4R5PB 4GKJJ 5E7OB 3MUVP 4NLXA 5DGBA 4USJC 1RACB 5L1IA 1MN9A 4NZ0A 3P6YC 4RLEA 3DFEA 1L3TA 3CSKA 4ITSA 2MY8A 4X4QA 1JLBA 4JM1A 2NCKL 2O67A 2WCXA 4O3QA 1HBNA 3L9ZA 4K4TA 2XS5A 2OTLS 2PT0A 4J9OA 2D28C 1TQLA 1F5AA 1K1SA 3ISNC 1NHVA 4YHHJ 4IDKB 3QZ8A 1NNDA 1Z2LA 4ZPCA 2HGLA 1IBLF 2VA2A 3K5PA 4ANEA 2V8PA 4RKUC 3BPDA 1X4CA 1LFPA 3DRRA 3IRXB 3OQ2A 1WEXA 4DG1B 1PG3A 3EVWA 4EGLA 2I0XA 5KFKA 4TU9A 1RHUB 5GMEA 2RT3A 2GQCA 4G37A 3IC1A 2BJDA 4DR4C 3C3LA 1Y7PA 5EUHA 4U7UD 2JC1A 2N3OA 4HACB 4TNOA 1NJIT 4F4XA 2DNRA 2WOMB 2MQ8A 3EVOA 3UI3A 4LF4C 3IAM9 2EEYA 1U1RA 4AL6A 4KKOB 1VHFA 4QWBA 2VPZB 3LAMA 3PJ9A 2RVJA 4PQUB 3T5HA 2DGTA 1KVJA 3MM7B 3KTQA 1I3OB 4A8SA 1YHQS 3FQLA 4I67A 4WJBA 2JLGA 2J6UA 1AB8A 5A1GA 5MAOA 3L8CA 2H65B 1RKJA 4JV5C 3ZTSA 1AXQA 3GJSB 3PCOB 3SFGA 2XB2D 3H2VE 5LSOA 2VG5B 4UOGA 1DARA 4IH6A 2XWYA 2Y0SD 3BKUA 2VL1A 2R7OA 3M8QA 4ECYA 1X9WA 2IM1A 2G0CA 1SIWB 5DV9A 2P02A 1H38A 1PGZA 4JI3C 2YKNB 4DV3F 2W2PP 3KJFB 3M4XA 3AT1B 5B09A 2IC3B 3G96A 4PEOA 1UMJA 1X4DA 3R9LA 1WG5A 2BUNA 4YUDA 4GKJF 1X4GA 4C0OC 1HL6A 1S1TA 3W2WA 2R7SA 1AFIA 3LP1A 3BKTA 5KFYA 2ACYA 1HPZB 3VNRA 2ZKTA 4I56A 1WNEA 3H5YA 2J7UA 3FEXB 1RHKB 2KJVA 3CCVS 4RW7B 5E3RA 3NG8A 2ZHOA 1XN9A 4WF9Q 4F4KA 1RAEB 2BMBA 2VQFJ 2R8GA 2DIUA 2HS3A 4K2JA 2E8EA 3GTYX 1RBOB 1JJ4A 4YHHF 3O44A 3WQPA 2CVEA 1O9TA 4DR3C 4ZK7M 4P9SA 4FNIA 2WBRA 3H2UB 4KGZB 4K4XA 2HAFA 2L08A 3WC2A 4USVA 3MUMP 2D27A 5DG9A 2MYFA 3NS6A 4JI7C 3N79A 2VBYA 4G1QB 5HLFA 3SQOP 1P9QC 4OV1A 3EMTA 1JXLA 1L3KA 4JI5C 3TA1A 3MAQA 4MH8A 4RJVA 3LANA 2BQUA 2DGUA 3GSIA 2VFUA 3HJFA 3BDPA 2UUTA 1M1KT 4MFBA 1R7IA 2QVYX 2KTQA 4NLVA 2KRBA 3A25A 3C6UB 4DOZA 2XMVA 1UKUA 4LF9J 3AFGA 2W9BA 2DEIA 3HHLB 1ZB9A 3HF5A 1OQ6A 3FBFA 3NCQA 1O51A 4MIAA 2G4BA 2EKYA 1OQ3A 1IJFB 5FLXD 2BJ1A 3A4IA 4LSZB 3QRQA 1FVSA 3NGTA 3TOQA 1TAUA 4KV8A 2V7BA 2EG1A 1X4FA 4RNOA 4PABA 1SQFA 2E7XA 5KFCA 1N0UA 2D1CA 3PR4A 2A3JA 1WF2A 4ID5B 1R89A 4HT5A 1QVGR 1BXNA 3PDNA 2CA9A 2GO8A 2AX0A 2GMJA 3F0NA 3MPYA 4CT8A 2QMUB 4B3SC 4DV7J 2CNLB 2MQNA 1C0UA 1VQOS 1WG1A 4TU7A 4ECSA 4B3MC 1B70B 1HFEL 1JLCA 2C3UA 1GX5A 2P2MA 5T8SA 5EWFA 2KKHA 2BE7D 3MDFA 4F04B 3AF5A 4DL6A 2ZH3A 1NB7A 3W2VA 3OTEA 1X5OA 1P4EA 1RA7A 2FTRA 2XNQA 1NZAA 1UCNA 5T14A 1PU1A 1MXBA 1UL3A 4IR1A 2CPJA 5IXUA 1FK9A 4AT1B 3JAMD 4B9MA 4WCEQ 1WTBA 1L3SA 3ILIA 5J1EA 3MR7A 1M5PC 6AT1B 5KG0A 1U1OA 5KAKA 1KOHA 5L1KA 2D1TA 4PAAA 4I6YA 2HURA 1ELOA 2HNDB 4CM2A 4KTVA 3AF6A 2FHOB 2VG6A 2XMKA 3H8YA 4JI4J 3HX9A 4RVOA 4N7TA 3HLUA 2MQOA 3BJYA 3M7VA 2HRTA 3CD6S 2AEJA 4DL2A 3KG1A 1KQKA 2JH3A 3M32A 3CB4A 2ZM6C 1ZZNA 3WIUA 1VQ5S 5L38A 4ID8A 4ZIVA 1TTHB 1H98A 2W9CA 1W2BR 1T95A 4ZPTR 3MAAB 1NK4A 2ZD1A 3THVA 3R7SB 2ASBA 3TAMB 5B7WA 3UZ0A 1SUQA 1U8WA 1URRA 1UETA 2IRYA 3DDIA 1Y10A 3NY0A 4NPOA 1RT2B 2V8DA 1Q8KA 3OTOJ 3IA0A 4ZP9A 2RH3A 1NK0A 1C2PA 3PJXA 5K20B 1FJGC 2AJQA 1ZZFA 4NCBA 1HNVB 3J80D 3C15A 1XMBA 1VBZA 3LUSA 5J2QB 1YZ6A 4ELTA 2J9DE 2DH8A 4AQYJ 4KHPF 4P2XA 4EATA 5ETLA 4O3SA 2Y1LB 2V2KA 4DV7F 2KDNA 1N33C 4FNHA 3DRXA 2MQLA 1O92A 4ES2A 1Y0HA 2XBPA 4DN0A 3KHLA 4C48A 5LJ5Y 3G6VA 2BDPA 1H3DA 3LF0A 1VJWA 5AXLA 3KHGA 3IN5A 5ETNA 2BW2A 4F26A 2WW4A 4KY3A 2K06A 2YQ1A 2RD5C 4H4MB 4ZVPB 2RQ4A 2YCBA 2DYAA 3DGPB 4LF6J 4ED4A 1ZS6A 4FN5A 3HPOA 1NK9A 3JYTA 4D56A 1U0HB 4XX2A 5J2NB 1U1NA 2XNRA 1HQUB 1RTIA 1RWPB 3HSGA 3M9OB 3PHEA 2OEJA 2XO7A 4AXIA 1S99A 4FYXB 4J9PA 2X1AA 1C0TA 1D09B 3DOLA 5I3QA 1YZ7A 2LCWA 1S9FA 1XRCA 1V60A 4JI4F 3PW5A 1ZTTA 4J91A 2W8LA 4OXIA 2AJ0A 4A8MP 1KC8T 1SQEA 2VODA 2XYGB 1DTQB 2LFVA 4BDPA 3ZTOA 3IWNC 1T05B 1JLFA 4WXOA 2Z0GA 5BSVA 3BGOP 2Y9HA 3LAXA 3BQ2A 2YWFA 3OR2B 1EIYB 5KG4A 2VASA 3G71S 5IWAC 5I42A 2LEPA 1MMDA 2E5GA 3B4MA 3MCNA 1FNOA 4Q7AA 1LWFA 1QVFR 2WVDA 4DR6J 1GMVA 5GMKa 2XEXA 3GSDA 4F67A 1V3RA 3OTOF 3A4TA 1FFSB 3PY8A 4NRUA 4EWTA 3NYQA 1NJXA 1GXTA 4IO1A 1NAQA 3M2VA 2ZE2B 4OJ1A 2MZSA 2CZ4A 3MTKA 9RUBA 2K1RB 5F8LA 2AGPA 3KLVA 2L9NA 3CPWR 3MPWA 3TANA 2QSFA 3Q8PB 1Q8IA 4AQYF 1KHWA 2C2KB 4JUZA 4A48A 2CQ1A 2CIMA 1XR5A 1DAXA 1RA6A 4NE9C 3DDNA 3OLBA 4QCLA 4HEA9 3WHIA 4C2MA 2XG8A 1FFGB 2D9PA 4OZ5A 2AT1B 4DLEA 1JX4A 1E6VA 5DM7Q 1RT7B 4TY9A 3LUYA 1OJ4A 3MFHA 1QLNA 1Q82T 2CADA 4ISBA 1CLFA 1W7WA 4CO3A 2R2UA 3TRGA 1D8YA 4LF6F 4E98A 1R8AA 1UA1A 5K8PA 7FDRA 4WIQA 2VH7A 1ZM9A 2CJQA 5FLXY 4UOHA 1DBDA 2H1YA 4I9GA 2FHMA 2RS2A 3CCES 2F4VC 1TKTA 1TZ0A 2XHCA 4LFAJ 1S49A 1IXKA 5HP1A 3HT0A 1N54B 1FRIA 1N5YA 2GJFA 2BH1X 3LAKA 2V69A 1U1LA 3UVJB 1OYEA 2P6SA 4NEYA 3AOBA 5GTDA 3JSRA 3M8PB 4TYAA 3VZIA 2WONB 2DJWA 3EERA 2K3IA 5BUSA 3MEDA 4FF4A 1YK9A 2QW0X 2R3VA 3NNHA 3GZ7A 3CJ5A 1FRHA 3CDUA 1VRQC 4DR6F 4UQGA 3VAGA 2FHKA 4U67Q 1YITS 1IWAA 4DMZA 3LP2B 3BPSP 1X4EA 3F44A 2BE2A 4NLYA 5D3GA 4Y65A 2F3JA 4WFNQ 4ZHRB 3TYTA 1YQHA 1TL1B 2QL7B 4KYZA 4PXCA 2R9LA 1HR0J 3MUTP 5E7QA 1JMTA 2BE9B 1LNQA 2MZQA 4LRAA 1UVIA 1S0MA 1FRXA 4DV4C 5DDPC 4F3OA 2ALZA 1P4EC 1PC4A 1Y3KA 3TARA 1C4AA 4IR7A 1HWJA 2D69A 4RVNA 4JI7F 4DS5A 3Q8UA 4W90B 3LP0B 4O44B 1TKXA 2NSCA 2XLIA 1JKHB 3VNQA 2ZJQQ 5F0WA 3HHDA 3MD3A 3W5XA 1REVB 1FF2A 1GMUA 1CJUB 6FDRA 3VALA 3V6DA 4ZPBA 4CNZA 3D0GE 4DF4A 4FVMA 3HFVA 1N0VC 3AODA 3WDOA 3NCPA 4L74A 1DZ5A 1BQNA 1FDBA 1X4BA 2ACMA 5B0EA 2I5JB 4UQTA 3IG1A 1VBXA 2WVBA 3MM6B 4O4GB 4GC6A 2W8KA 3QGGA 1LK5A 1QUVA 4CLKA 3PX6A 3MM8A 2OI2A 3P5BP 1IBKJ 3I31A 1HNXC 4PG7A 5IM0A 2DGOA 1UFLA 3IS9A 3JS9A 3QFHA 4NRTA 1ZAWA 4B02A 4BWJA 3KHRA 3M2UB 1MXAA 4ZVHA 1XMOJ 3QO9B 1RG9A 4LFAF 1BA3A 4IH7A 4ZCMA 4ZVGA 2QRRA 2HVIA 2GVZB 2DR6A 1TL7A 4Z2XA 1K8AT 2DGSA 2JEFA 2VIHA 2HMIA 2Y4OA 4YB5A 3R7BB 3FEZA 4TXSA 1OMSA 3C16A 1G7CB 3I9ZA 3ETMA 1YGYA 1AA1B 3GFXA 1J27A 4CH7A 4Y2CA 4G1PA 1YLXA 3QJPA 2EFNA 1H73A 4DV2J 1JLQB 5FDLB 4LSNB 3PJWA 2A2CA 2RF2B 1WSVA 2QLWA 3WZ0A 3PW0A 2D3O1 3M8WA 5CCLA 2RQKA 2MLZA 1HBUB 4OYMA 4M63A 4BC7A 3MEGB 1S9GA 4OX9C 2DGXA 2DNPA 4RNMA 1FKAF 5HMYA 3ITHB 3V4IB 2Y1JA 3CULA 1S7IA 4I7FA 1O5JA 4ED7A 3DLBA 3TI0A 4IRDA 1HR0F 2ROGA 4TY8A 3GIIA 1ROFA 2OPQA 4DUYC 3CC4S 4L2ZA 1RT1B 3DM2B 3SQGA 5F8MA 1GX6A 3ZNUA 3I0RA 1BE4A 1VBKA 4LRCA 1MNEA 5CAAA 1H0HB 1Y5LB 1EKRA 5AE2A 4KHRA 3VAKA 3R5CA 2LXUA 3LOUA 3ISZA 5L39A 1RI7A 1UZHA 1XQIA 2CDRB 4PKDB 1FE0A 4YY3C 4MIBA 1K44A 2MZRA 2PGCA 4YR2A 2KHCA 1F2HA 3FJ2A 3DRSB 2YXLA 3CJKB 4HDHA 3E2EA 1RTJA 4ED5A 1RBLA 5A19A 1IBKF 4EEYA 2MTLA 1YKWA 3QAUA 4N8OA 2DPLA 4Q45A 3KLGA 1QSLA 4IRCA 4HH0A 1XMOF 5E0OA 2GO9A 2VPYB 4W4MA 2BXJA 1X4AA 1TKDA 2OPLA 3QLHA 3JTOA 5GADU 1IWGA 4LF5C 1CC8A 3BQ1A 3W1YC 3ZTRA 2MZTA 2AD9A 3RG6A 4WU2A 1YJ9S 4F50A 1ZM4A 2ZH4A 3S82A 4DV2F 3GG0A 2IAJB 2B4OA 4BBYA 3J81D 1IQZA 3QAEA 2XI2A 1WI6A 3J7YI 1BHNA 2BKNA 4UT4A 2ZH6A 2VICA 2P2QA 3GU0A 2AEMA 3W5ZA 4X4RA 1RTZA 2DD8S 2K7JA 2C42A 1KLMA 5BYRA 2E7WA 3HZGA 2ERRA 5ETTA 4QWCA 1IBMJ 4QPTA 2R7XA 2JOQA 2D1SA 1FDAA 3HHLD 1Y9OA 2FVPA 2DNKA 1RJJA 2FHJD 4YS2A 3T1HJ 2Z57B 1HARA 4OLPA 4I68A 3DI6A 3NGDA 2RKIA 3UCGA 1A0OB 2MGZA 2AYBA 3OUYA 1SB6A 2KXNB 1NDPA 2DNMA 2M8DB 1IR0A 1JB0C 5K8OA 4EBEA 4DU8A 2Z2ZA 3TQ1A 3VVTA 1OYDA 1RKIA 4DPOA 1HLWA 3R2DJ 3N4WA 3VHQA 2RAQA 5CZXA 3KJQB 4OFZA 2OD6A 4Y2KA 1U4BA 4JI1C 2UUCJ 2PFFB 1VQ4S 1TV6B 1U26A 2R8KA 2VZ9A 4IFYB 5H9UA 3IR7B 1OY8A 2AYGA 5J2PB 5KFEA 2Z2YB 5BURA 4U5YD 1U49A 1N34C 1HNIA 1VJQA 1XNRJ 2E5JA 5KFXA 3I4PA 2AWZA 1YDLA 4J5OA 4NI2A 3QRPA 1KWMA 1T3NA 1G2EA 3I0SB 4YN3B 1DTTB 1S77D 4R0EA 3I96A 2DKOB 3AQPA 3QRRA 1ZETA 3ET6B 4PUOA 2YNFA 3G6YA 1FCAA 3KMQA 1LQLA 3NAHA 1HMVA 3QIDA 3I5BA 2FVSA 2RILA 1KOOA 3I08A 1FKPA 5G0RA 4ZPDA 2NCLA 5KEIA 4I9FA 2HNZB 2J7WA 4PR6A 4WP3A 2CZ9A 3H90A 4OJ3A 3BV8A 3GE9A 1UVLA 2VKZG 2XC9A 5KG6A 4PPZA 3RJMB 3W5YA 4R8UA 1RYRA 1NMEB 1VMBA 3QT7A 1FWLA 1IBMF 3HXMA 3DRYA 5AXKA 3TUPA 1Q5VA 4R0JA 1NBEB 1N4LA 1P7LA 2RMLA 3T1HF 1JIHA 5KFTA 3FFIB 1UAWA 2E7GA 4KJIA 1JLGB 1VLOA 2LDIA 3JSMA 1RTDA 2QSWA 3G6ES 3DOKA 3A8JA 3N6LA 4F7VA 2BR0A 1PBAA 2JLEA 3DKDA 3N01A 1CPZA 2HIQA 3TZYA 2BA9A 4NXNJ 4P2MA 4J9VA 2IFXA 3Q24A 3FBBA 2E0GA 4FUTA 3G2XA 2UUCF 2OELA 5BYSA 5HROB 2DNYA 3BBCA 4TQSA 4YQWA 3D6HB 4M1KA 3JQKA 1RWKB 1S72S 5JUMA 5IT9U 3TVYA 3ZC4A 3LGXA 4C98A 1B99A 2QE5A 2RHSB 1NEEA 3R5JB 2W9AA 2YNHB 3KXWA 2Q79A 2LDYA 2KYXA 1PYTA 1YSJA 4IR9A 5E2QA 3ZZUA 2IYGA 3ZZZA 1D9FA 1Q79A 4J37A 1VHIA 4MIWA 3PO4A 1FKOA 2FY8A 3WBZA 2ABYA 3MM5B 3IAS9 1FLOA 2D74B 4FDFA 2KFYA 3KNAA 5CYMA 4IUFA 1KVIA 4DUZJ 5L9NA 1AZSA 4ODJA 4LBHA 4P2FA 1S6OA 5ETRA 3V2UC 4IG0A 5KT2A 2UXDJ 2M5OA 3GPCA 2HEKA 5IQ6A 2OPRA 1XTZA 5KFAA 4DI6A 2VONA 3N5FA 2JHEA 2NXEA 2CQIA 4LSLB 3HMJG 3R3TA 2DT9A 4CYUB 1W25A 4K4VA 3QSIA 7AT1B 5A0YA 4ICLA 1IB8A 1KONA 1SC4B 4KFBB 3VAIA 5CYQB 4AE5A 3HO1A 3QT6A 3W65A 1CJKA 5KFSA 2RU9A 3CC2S 4ANCA 2HHTA 4ZVSB 1UEKA 2VDHA 4FTFA 2DR5A 4ZVEA 3C8YA 2M0GB 3OL7A 1QM9A 3MMBB 3RZAA 5L46A 2XULA 3DN9A 2HFZA 5D8HB 3KLFB 2I9SA 3NI2A 4L73A 4FF2A 1CVJA 3QSYB 2CJKA 3CJRA 2UVWA 1TUVA 3J80U 4O3RA 2R42A 4RZRA 1X60A 1TL4A 1CC7A 1HYSB 2VBWA 2J9CA 3KWMA 3QMQA 3GB0A 2AIRB 3AD7C 3VGTA 2DH7A 3U27A 3JXOA 4QIFA 4F3MA 5BSWA 4DX6A 1SCJB 1U6ZA 2LEAA 1CJVB 4MTNA 3ENQA 3UN5A 5C2GA 3PKMA 4X65J 5JRHA 3M6XA 4M5HA 4F0KA 4DS4A 3GMGA 1DQ8A 2KL8A 3D5MA 2RRNA 5B0GA 1HBMA 2DR7A 4U7UK 3AJDA 5A76A 4B9LA 4CI0B 1KTQA 2G2YA 3UQSA 2M9KA 1HQ2A 2EC2A 5CQGA 1RLDA 2AF6A 1NSKL 2YKMB 2OIHA 3OSPA 2EXUA 2CJXB 2P2BA 4IQMA 3EICA 4O0IA 5JVHQ 4KBIA 3T6JA 4UY8T 3RAXA 3W60A 2V4QA 2F1FA 1XRAA 3FSIA 3MGJA 2HYIB 4DUZF 1RUSA 5CH7B 3CDEA 2EFVA 1VQKS 2ZBRA 3M8SA 3N6MA 3K5LA 2CG8A 3KLIB 1DFDA 3SMZA 4N56A 2QT7A 3ILOA 4PG5A 3QIPA 3HK2A 3RU0A 2IY5B 1J5OB 4YP3A 1T9VA 3DLKA 1NSAA 3C19A 1FVQA 2D9OA 3R5AA 2E5LJ 1S1XA 1JWWA 2GC8A 4DSEA 3DU5A 5IC6B 1R8HA 2M5HA 2UVUA 1USPB 1SC3B 1L2FA 1TL3A 1P9YA 4QIEA 3Q89A 2Z2LA 1R27B 1FT8A 2V4RA 3MR5A 1UJ6A 2DNZA 4YOEA 4DV1C 4N47A 4F36A 2VF3A 3R5DA 3KK1B 4A8YA 1TELA 3IBWA 4M5GA 2DIVA 1UKKA 2KI2A 1X5SA 1VRTB 3KHHA 4MH4A 3U7JA 1C1BB 4WFBQ 4USKA 2QLFB 4OYCA 3UD5A 4DV5J 3C46A 1ULRA 1B7FA 1NJYA 1U48A 1OO0B 1U1PA 2FJVA 2PO4A 4KGKA 5E5NA 1KTVA 2V4JA 2D7SA 2V68A 1XBWA 4DG9A 1U7LA 2AGOA 4RW6B 2HRYA 4IFVA 4LF8J 1I94C 4DEZA 3A13A 4NOHA 4OZ0A 1HIYA 4OYZA 2YY3A 3PW2A 4BLGA 3OFFA 2AU0A 1JLEA 3X1LB 3V6KA 1W2IA 3CD5A 5IZHA 1ZA2B 4CRJA 5HI7A 1VCTA 3DLEB 4LQ9A 4YEAA 3GV5B 4OI1A 3BB5A 2C1EB 4BWMA 5BJRA 4DLGA 3TVZA 3G6XA 1RWOB 1WDDA 4QW8A 4NZ7A 2NPFA 2M3DA 2DNNA 2OPPB 1S79A 3QGHA 3UCUP 4BS2A 1ZA1B 1HKAA 1RWWB 2W4PA 1S9EA 4FXVA 3VVUA 1VIOA 4J7CA 3M8YA 1QE1A 1KFSA 4PWUA 1CQNA 2C2OB 4LF7C 3GONA 3I4HX 4OYBA 1RT3B 4RR5A 2PI5A 2UUBC 2OUGA 2AHOB 4K4ZA 4DN9A 3FRZA 3FCVA 4ZP6A 5ETVA 1FX4A 2GJ2A 3H0PA 4WWSA 3HT3A 2IVMA 2AW0A 1RCOB 1WTFA 1QTMA 3SXLA 3CF5Q 1T03A 1RAIB 3BEGB 3E7XA 1WKLA 3NRBA 2E5LF 4QR0A 3N54B 1N5TA 2KU7A 4DL4A 2XSJA 5K14A 2VG7B 2OH2A 2KT5A 1QSYA 4RW4A 4FS2A 2LEBA 2FY1A 1WC3A 1N36C 1SXLA 3DHWC 2VU5A 1VQ6S 4C11A 3VQTA 3N0VA 2BW7A 4QIGA 2Q3PA 2W2OP 4RBTA 3HFZB 2BJ8A 2RQCA 4DV6J 3WX8A 4AYBD 3OHBA 3J7A1 2OD4A 2QFIA 3BH7B 1K73T 4RL1A 4ZJLA 5KFBA 1RAJA 2ZJRQ 2ZVSA 2A0FB 4L4QA 3HHEA 3H59A 4J9UE 1KS2A 2BQ3A 4Q44A 2R7RA 4DV5F 3D1HA 3TEGA 2NREA 3KKFA 4FKXA 2HZCA 3ONQA 1HH2P 3BGLA 4F0MA 2VJUA 4RW9A 1YRUA 2L9WA 3Q8QB 1VOMA 4DDFA 1X5PA 5E33A 2ZH8A 4WYWA 4M5DB 1XERA 2VOOA 5DM6Q 4FBUA 3W7BA 1WC1A 4LF8F 3QGIA 1S6QB 4K4WA 3CCZA 1S48A 2ROPA 4J9LA 2AYMA 2B9YA 2VBXA 4X64C 3PBKA 2Y1IA 1LWCA 4NDNA 3ETCA 2VSQA 8ATCB 3NYRA 2GQ2A 5F8GA 1VQSA 3VAFA 2W7PA 1XJWB 4ED1A 1M6XC 4DR2C 3D6FB 2LU2A 2IRXA 1YBTA 3DCAA 2BJOA 4DR7J 2QX0A 2BVZA 4X62C 3PYDA 1MWZA 4ZCKA 1Y11A 1YRXA 2DY1A 2XMTA 3E8OA 5D77A 3ULHA 4ZDNA 3MPUB 2NSBA 4LUBA 1F6TA 1TMMA 2UV8G 1QM4A 5K8MA 5D0EA 2F8EX 5LMNJ 1FNXH 3RTVA 3IGVA 2IDLA 2AYEA 3E01A 1JNRB 1IKWB 5DZ7A 2XHWA 3UR0A 1NJZA 4UZBA 1S5ZA 3OTCA 4DXLA 4D4IA 1CG2A 3G8TA 5H9EJ 2R2SA 2D1QA 5E3CA 3MHYA 2ZZMA 5F0UA 2F8MA 3H4BA 2Z2MA 1N48A 4M5MA 1N6QA 3VZHA 1JK9B 1RISA 1RT4A 4C8KA 4DCVA 3CWJA 4DV6F 2GX8A 2FGCA 2ASJA 5A6WA 1YBUA 2WB4A 4NA3A 1Z2ZA 4WTYA 3D67A 2XMMA 1FXLA 4FZVA 1H7WA 5L9XA 1KFDA 1RGVA 4CH0S 4ZVUB 4O23A 3QZ7A 5F9NA 3EPGA 3IM9A 3OL6A 5D4LA 2YX1A 5A6PA 3SSSA 3TJAA 4ZLJA 2Y8YA 1RAGB 1HNZC 4NYZA 3HHNB 3HHLC 2XY5A 3IBFB 4KO0A 5GAGI 4I2PA 4UF4A 4RLQA 2QN6B 2DO4A 4V19J 2YWGA 1NY8A 1X8DA 4DX8H 1TVRB 1RWVB 2DHMA 3P8BB 3PFEA 5DO2A 4KB7A 1BLUA 3KK3B 2QV6A 3QT8A 2AJ4A 1LW0A 1FRMA 2V8HA 3U1NA 3NKYA 1XNQC 4DQSA 1PILA 2ADCA 1R31A 3AA8A 1WELA 4DL5A 1F2GA 3KDNA 4USTA 5KG2A 1UEUA 1QAJA 2GGPB 5KT3A 2QO3A 2C3MA 3GFYA 5A8RA 4DR7F 1S6PB 5LM7E 4WTOB 5H1SV 3CJ3A 3IM8A 2LQJA 2R8HA 5GAHU 3RRHA 3Q86A 3CJ0A 3HVWA 3CO0P 2J8SA 2DRAA 5LMUC 4RBVA 5DDQC 2LLZA 3CUNA 4DQQA 1TU0B 2MB0B 1I6JA 2P2FA 4Z7CA 2HVEA 5DG8A 5B0DA 2E9RX 2HQ3A 5C5JA 5LMNF 5F8IA 3TUZC 1VQPS 4FXDA 1SPBP 1GK8A 5FIIA 3GYXB 1JLBB 2VBZA 2E9ZA 1HBNB 5KT4A 1P27B 3OJSA 1MSWD 1JKHA 2ONFA 3FNNA 4DCUA 1OY6A 3VQSA 3NNAA 1NZ8A 2BANA 3ILJA 2DR8A 3BZQA 3DRRB 2DGWA 2XCAA 2QGFB 1X7VA 1SJRA 5KFNA 2YNIA 2OKQA 3I87A 1Q53A 3HD2A 2P5VA 4UOCA 5KFOA 1N52B 5IC4B 3IP0A 2VUGA 2MKJA 2YWHA 1M90T 4X66C 2OSRA 4A8XA 1UZDA 1HI0P 4ES1A 4OX7A 1RP5A 1SC1B 4LFBC 1IQTA 2YPZA 1UFWA 5EX0A 1R0BG 1T9UA 5D4OA 1KLNA 3TW0A 2J6SA 2BEFA 3QNWB 2RDDA 2X1FA 1RSCA 4QYRA 3HFKA 1RB0A 3KNGA 1SL2A 1T5DX 1IN0A 2C2DA 1S1VA 4JI0C 3HKZD 4LIWA 3K8VA 3AH6A 4I4BA 4DCSA 4RPFA 2QIFA 3I6PA 2LP4A 2FJWA 1KSPA 4KPCA 1UWAA 1K47A 3IRWP 1RAFB 1ML8A 5HVFA 1N32C 2LQ9A 4DL7A 2DEJA 4ZOSA 1C4CA 3BO4A 3M8QB 2CQCA 4E0DA 3DLGA 4I6WA 4GXQA 5MLCV 2W2MP 5E3PA 4NYOA 2MQPA 1RWXB 1T9WA 3OFEA 4QQBA 3M8RA 2V6AA 1T11A 5EGYA 3EJMA 5DS7A 2B9XA 4RNNA 4DV0C 2U1AA 3L95X 4D57A 2DGVA 4ETXA 4CO5A 1UWBA 3CVKA 5HQ8A 1GMWD 2E1RA 1VQMS 1S1TB 1MU2A 3W2WB 1KR4A 3LP1B 4GO7X 2IPOB 3I56S 1GH8A 2VHGA 3M6UA 1YWXA 5B0AA 2GVDA 2JEIA 4F4AA 3QATA 2B8PA 3MI7X 2LQ8A 3RB4A 3D1OA 1NUEA 2F63A 4TQRA 2WTFA 2R4FA 1HWLA 1YJRA 4B3OA 5BR8J 2POKA 2M88A 3EQ6A 3EXCX 3NS5A 2VZEA 2HG4A 4QZVB 1QUPA 5DGAA 4C9DA 1UFKA 3CMES 4FYDA 4P75A 5J1NA 2FB0A 3GYNA 1FUGA 2BM0A 4DHVA 4CWBA 2J0XA 3ZZTA 2E1CA 3FRYA 4NA1A 3BYRA 3H42A 2FVRA 4NMXA 3H2LA 3DOMA 4F02A 1G4CA 5HLFB 3V6JA 1EZZB 1WF0A 1O6XA 3OD2A 5HJXA 3P49B 4EBCA 5DLGA 3EDRB 1U1MA 1JLAA 3TDEA 2OMOA 5C25A 1FJCA 3D0IE 3GYGA 2E1PA 1R8BA 4MFBB 2EC0A 4I1TA 2VD3A 5ADZA 2M52A 4ZLNA 1LV5A 4I69A 3IBCB 3VAJA 2I6WA 5DQGA 4DR1J 2P9GA 1M5HA 1TFYA 4ZMMA 3MFIA 4Z37A 3Q0AA 1B0TA 2W9BB 1NKBA 2YTCA 1RU2A 2FJBB 2GAGC 3SZ2A 2KXFA 4ILRA 3R27A 2E66A 1B0VA 2DBBA 2HFUA 2HBQB 4ZVOB 3W62A 4CDIA 1X4HA 3CCMS 4B9NA 4KH0B 1VBYA 2K8GA 5T7LA 3NBPA 4KHMA 4QWEA 4B3TJ 4RU9A 2HLUA 2XMAA 2C2MB 2CPIA 5GMDA 2AV5A 4KV8B 2KM8B 2H3EB 1CULA 3MCOA 2ASDA 4LFCC 2CPHA 1ZAXA 3ZNJ1 3V81A 2MCQA 2PN2A 1MDBA 1RHJB 5JJBA 1NK5A 1T9YA 3VAMA 4U8YA 3TP2A 3PNIA 2X7IA 4ZPWR 4P6QA 3CJTA 2HVZA 3BR9A 3S8SA 2PA8D 2HBYB 5JXSA 2AJ2A 2EPIA 4MT1A 1C0UB 4C0HA 1RLCL 1JLCB 5DDRC 4D3HA 4GVBA 2V9KA 3M30A 4QU6A 4OHVA 4JYAJ 1S4EA 5BR8F 3CO9A 2GIRA 2E44A 5D4PA 2EFPA 1RQ0A 3UX3A 3G86A 5LL6d 3W2VB 2FDNA 1QWIA 2G9OA 1FK9B 2BRKA 2B5JA 5J1EB 4Q2MA 1M5VC 1UWDA 2R8IA 4NCGA 2Q1LA 2DPIA 3MECA 1BC6A 1MD9A 1SQGA 2ATCB 3PM9A 2CJBA 2WSEC 1JQGA 2XZWA 4Y2IA 4OHZA 2KB2A 4J9MA 4OHXA 2BX6A 2WBMA 4PQAA 2JEJA 1WF1A 2CWXA 4U8VA 2VG6B 2VJVA 2XYHB 3CJSA 2NXCA 2UU9C 2B4UA 2ZC4A 5DG7A 4KPYA 3IEUA 3EUNA 3CQ3A 1FESA 4C8NA 2ROEA 2XTJP 4DR1F 3M32B 3ILLA 3FDSA 4O0NA 1TKZA 3N5BA 2XS2A 1F60B 4NCAA 2F4FA 1N2FA 2DRDA 2WVFA 3F56A 2A6MA 1APSA 5HK4A 2W9CB 3LO3A 1WC0A 2ZD1B 1M1GA 4NZ6A 2CZVC 2UV8A 1RHRB 2HNZA 4A4JA 1HWIA 1SUQB 2VQEJ 1U02A 4DCJB 5KFVA 3CMQA 3M2RA 1P1TA 2R8JA 4B3TF 1TUWA 3J7Z5 5HBMA 3D3BJ 3R6LB 3P45B 2DPJA 3TWZA 1M5SA 4OQJA 2HRUA 1HHQA 1M5OC 4A8KA 2HHHC 3DMJA 4Y2AA 2HWTA 3C15B 3MCSA 2HHWA 8AT1B 1YVFA 5KFMA 2E1AA 2GMLA 2Q66A 1VK8A 1Y00A 2H48B 3BSAA 5KG7A 3MPDA 4JI6C 5IQQA 3CDBA 2CQGA 4NXMJ 3R9XA 2HHQA 2W01A 4YFUA 3B6BA 4XPCA 4EO6A 1U1QA 4A46A 3O5TB 3UWTA 4BHQA 2B4VA 4JYAF 4FXWA 3BO3A 1S1UA 5HMWA 3IEVA 5HVGA 4PG4A 2CUYA 1XC9A 5I3PA 5F41A 4CIOA 2UUAJ 3IWLA 5IFMA 3O8WA 3GCWP 3GIJA 3EZ5A 3TX0A 2PSZA 4UUWA 3E7WA 1TK8A 3JYTB 3JB9k 2FVCA 3NOGA 1LXNA 4RBUA 2AJFE 3AJ1A 4JI2J 1BUXA 1RTIB 5KFZA 3R1HA 2RS8A 1C0TB 2K2PA 3ENWA 1JXEA 5IT4A 3DOLB 1WOSA 3BBBA 4H54A 4K50A 2H54B 4J9KA 3Q8VA 5THWA 1B64A 1SJQA 1PO6A 4ECUA 1O0PA 2DYJA 2B6AA 1VRUA 2HZVA 1JLFB 3M8ZA 2O66A 4RWWA 1GMWA 5KOWA 4DV0J 3A8EA 3EVMA 5LMUF 3CEDA 2HVDA 3G87A 4X4OA 3CMAS 5I42B 2UXCC 3RBEA 2RJZA 3FK4A 1LWFB 2VQEF 1GTEA 1UPMB 2W4DA 2IHR1 1FD8A 3I55S 4LRBA 1BQMA 2HBZB 4F4YA 4OL8A 3EYZA 2BOAA 5KYTA 1LWEA 3SDEA 4ECRA 1J5EC 4MTPA 5H9FJ 1LEOA 1R0AA 3M2VB 4K0KC 1SH0A 3G8SA 4KR0B 2AP6A 3LW5C 3SEOA 1SBRA 2B0GA 2MKYA 1XR6A 4FUQA 4FBTA 3SSRA 1YJUA 5LOQA 1UW4A 3BQ0A 4NXMF 4KHPJ 4LJMA 3BF4A 3MM9A 5M2PA 6FD1A 5KFLA 5I4MA 2XWXA 3I07A 4AL5A 1JOSA 2L41A 2MY7A 5IV3A 2OMLA 2MQQA 4NX9A 1H2UX 1NK6A 2XQCA 3B54A 1NKEA 4NLOA 4IG3A 2BJ3A 5K5MA 4KGXB 1E6VB 1XMQJ 3UO0A 4X4TA 4OI0A 4Q2LA 1X31C 2HS0A 2LA6A 2J6TA 4IOAQ 1U6FA 4M5KA 3GWCA 3HP6A 1MN7A 2UUAF 4QBUA 4USWA 1DURA 1YJWS 4OYOA 1IUJA 4DR5J 3HVAA 1H6KX 2AZ3A 4U7CA 1YRTA 4ILMA 3TR5A 4G65A 4Y6IA 5KT5A 3N28A 4JI2F 2QVXX 3UR3C 3MEEA 2GHWA 3IXQA 2EFQA 3VGVA 5A2QU 1TKTB 5HP1B 1HHSA 4V19X 2AGQA 4P71A 1IM4A 4TPSB 1N5YB 2VA3A 1FD2A 4IKAA 4B3RJ 2XLJA 2QA1A 3D9BA 1WI8A 2R7VA 4DG8A 1U47A 4JOUA 3RBDA 4L3KA 4A8QA 2WVCA 5GVQA 4HH1A 3LQVA 2VFVA 4JI8J 3KK2A 1PAUB 1YBAA 2DNGA 2GIFA 7FD1A 2RSQA 4DV0F 2V0NA 3UD4P 3MR3A 3MEDB 3KJVA 2W1BA 2JZ5A 1WHYA 4DFKA 1NHKL 2XCPA 5EHHA 4OHWA 3C14B 3OV7A 1SC6A 3ZZOA 2ASLA 2EFOA 2AX1A 2JMPA 4H4KC 2WD9A 2YQ3A 2IJFA 2EI5A 2HQIA 3F73A 4OYPA 2BE2B 5D3GB 3DGVA 2CY1A 2YWCA 3OHAA 2KFZA 2BKPA 3LNOA 3RAQA 4ER8A 5DQHA 4QPXA 2XSFA 5KT6A 4DZ6A 1VQ7S 3GR0A 4DV3C 4ECQA 3G82A 2HWHA 4WP9A 3S7RA 4CO1A 2XMJA 4GKJC 3VTIA 1TKXB 2HZAA 2O1PA 1DQ9A 4DR4J 3Q2SC 4YB1P 3M1VA 3KK1A 2CXCA 2DGQA 3PEHA 3V6DB 4LF4J 3DRPA 2OBVA 2XI3A 1D8ZA 1RT5A 2ZBCA 4FYVB 3D66A 5HSPA 1XMQF 2YBVA 4PG6A 1BQNB 1KKHA 5AT1B 3H5XA 5HO4A 2QMXA 4PROC 3MMCA 1KD1T 2OO4A 2D3UA 3PO5A 3IG1B 3HSZA 1VS3A 3TNVA 4DR5F 5G4DA 4YHHC 1FRJA 1KDNA 5GAEI 3MM8B 3H98A 2ASYA 1ZH5A 3LALA 4LF1A 5A8KB 2YKQA 3RV2A 1QTNB 4JV5J 4DZDA 4H4OA 3IS9B 3CGIA 1AW0A 3QJLA 1MROA 2ATLA 1WD6A 3BSOA 1AFJA 4B3RF 2YKOA 1ICEB 1TL7B 4YB7A 3FMBA 1O93A 4HTJA 2V9WA 5KG1A 3C5EA 3C16B 2WRMA 4JI8F 3Q8YA 4Y34A 2FJDB 4JI3J 4WFAQ 3DYAA 3N6NA 3OSNA 4HHHA 1U45A 3KLHA 3ZTPA 3R2CJ 3G7SA 3MTJA 1UVMA 4OX6A 3OTDA 2FJXA 5KFHA 1HBOA 2VDIA 4WU3A 2NLWA 2G2OA 3I82A 4FP9A 3OL8A 4LBIA 2C3YA 1C1CA 1S9GB 4NLWA 4I7FB 5H9EK 1CJTA 2QYCA 5B0FA 2HLTA 3LGHA 1WEZA 1K1QA 2ZH7A 4DR3J 3PEJA 4TY8B 3OVAA 2NYIA 2OPQB 4LMZA 4AUKA 4EUVA 1PSDA 4R1MA 2MKSA 1WCJA 3MOJB 2VOPA 4K59A 5I3UA 1UJ4A 1ZPVA 4RW8A 3SQGB 1SJ4P 5F9LA 4WE1A 3BGRA 3MMAA 5KFUA 1JJCB 4JI7J 4TKTA 4DR4F 4NLTA 1OY9A 2ZBIA 2E8FA 4JI5J 3CNQP 4WKRA 4LF4F 2OFGX 2IVYA 2PT7G 1DHMA 2ZUGA 2P8IA 1Y5NB 4NLQA 4BSZA 2LU1A 4Y28C 3QQCD 1JNZB 2VQFC 2BYCA 2M5YA 3M6VA 1XIQA 4PHTA 2PIIA 4JV2A 4TLRA 2V50A 1RTJB 3AHPA 4C7QA 4BC9A 3BN4A 4JV5F 3MMJA 1S1WA 1VISA 2XZDB 3B82A 3KLGB 2HVHA 1KNZA 2O01C 1S76D 3VV2B 4ERDA 1WG4A 2WK4A 3H40A 4C8MA 4G36A 2DR9A 3ADAC 4DUTA 2OPLB 3QLHB 2IIHA 1MWYA 2GQQA 2VB6A 3VF0B 4F2RA 5M2RA 2RUSA 2UVRA 4JI3F 1EAYC 2RIJA 1LW2A 3G8QA 1FJEB 4RMNA 2PMHA 5EX3A 2KZFA 4HDGA 2DHSA 5A2QY 4OMFG 2KT2A 1NH7A 3WX4A 3W3SA 4LF9C 3K17A 4OZJA 3VWSA 3AD9C 3F41A 2BJEA 4B3SJ 3PTWA 3TUIC 1N88A 1K0TA 4O3OA 1KLMB 2RDJA 4B3MJ 4ZITA 1DLOA 2AQ4A 2BABA 1RHQB 4MKBA 2CDQA 3BSNA 1V26A 4A8WA 3KOAA 8RUCA 1R6VA 1U0SA 3BDEA 4DR3F 3DI6B 3PFOA 2P2JA 4XDDA 1SV5A 4RU2A 2RKIB 2MGZB 4ED8A 3OUYB 3A9VA 1Q86T 2N7YA 4MKYA 4ECTA 1MKYA 2HQGA 4XTTA 5KFGA 4IO9Q 1YI2S 4XO0A 4JI5F 2AYAA 5M2UA 3QGPA 5CD4A 3RR7A 4DV7C 3RW7A 3HSJA 5KFWA 1GXLA 1PIEA 1XK8A 3NXZA 3JQJA 1ACMB 2CQ0A 2P9CA 5D78A 2E9TA 1E6YA 4NLPA 3CXCR 2VFTA 1HNIB 4M94A 3GCXP 2ZM6J 4ZN3A 2JFKA 3RW6A 3PW7A 3IR5B 4NI2B 1NSQA 3J7ZT 3DLLQ 4IZ6A 4OYIA 1IKXA 2OLWA 1EQ0A 3H25A 1CS4A 4YR0A 4IQXA 2XZTB 2EFGA 4PYAA 3AQOA 2IVFB 2GZOA 3T3FA 3KXDA 2RE1A 1I51B 4PWDA 3KLEA 5F8NA 1PJ5A 1HQEA 4PUOB 1P6TA 2YNFB 2OP5A 3ZZPA 4KH1B 1HMVB 4J90A 2ZDPA 4CLFA 2R7QA 4JI4C 4ES3A 2FUG9 2B43A 4RNFA 3KUEA 1FKPB 5G0RB 2H5EA 4K5SA 1FJGJ 1RT6A 3AOAA 2FZCB 1VC0A 4K0KF 3HI9A 3TUFA 3N9UC 4J9QA 4L76A 1RTHA 4M5NA 4HTIA 4ELVA 4XK8C 4OX8A 1FX2A 3M05A 4I2QA 1KHVA 4R8UB 3CCJS 4B3SF 1MXCA 2FLLA 1N33J 1PYOB 4B3MF 2NQPA 3VNSA 3TVKA 4G1IA 3OJUA 1Q7LB 2KH9A 2LECA 1MLAA 1NB2A 1SH2A 1QAIA 4EYIB 3CW9A 1NSPA 4OI2A 2F7VA 3HVRA 2HNYA 2IMWP 3SCKE 1SKWA 2LKZA 3OTOC 4HI2A 4MYTA 3JSMB 1R8CA 1RTDB 3DOKB 2O5DA 2F8HA 4P74A 4PZPA 1TFWA 3S6EA 5HJYA 2KYZA 1RK8A 4AQYC 3BBFA 2DY9A 3NGUA 3OL9A 2YX4A 3NWGA 2ZOMA 2MDAA 2I38A 3HSDA 3LGNA 5ITHA 4UOFA 1BQXA 3MWBA 3US5A 3PRBA 4GS5A 2J7KA 3FMWA 2MSTA 2MHNA 2QA4G 2ZM6F 3KG4A 2CQHA 2ILYA 1EGAA 3JTNA 4LF6C 5C24A 1NPPA 5AXMA 1MW7A 1UA0A 5IWAJ 2MZJA 3B8HA 3POTA 1Q81T 3DHVA 1EETA 2JSXA 5AJ3J 5DLFA 1D3WA 2OPSA 3HCXA 4W92B 3VAHA 1M0SA 3GV7B 4PZVA 1FKOB 2HHXA 4O4RA 1Y3JA 1SKSA 4CO4A 3R1LA 5D6GA 1PCAA 5CYMB 1H72C 2ZWOA 1AZSB 5A8WA 4WP8A 1FJGF 2J9DA 4IG0B 3VCDA 4Q0BA 4JB8B 3O2IA 2DO0A 4C8OA 2OPRB 4USHA 2QVZX 1XHJA 1F9FA 2JLFA 3AB2B 3K0JA 2AMCB 4EU0A 3CD7A 2WVEA 4DWIA 2LMIA 3J81j 1NH8A 1R0CB 4ZVTB 3MZIA 2CQPA 1X9MA 2PMWA 1N33F 4FVCA 5A0YB 4QIVA 4ICLB 1YJ7A 3GV8B 1X0PA 2XS7A 2Z56B 2XLKA 4LE5A 2QZ8A 3T5KA 1TR0A 5FJ4A 1BY9A 4DR6C 1CJKB 4Y2MA 2VFSA 2PDAA 2W4CA 2G1DA 5KOXA 3OVSA 3W8PA 1B4SA 2COLA 3CCSS 1PC5A 4C8YA 2HGMA 3A3PB 4OZ2A 2ZNYA 1FI4A 3GKUA 3GLJA 1O90A 3AD8C 1U25A 2A10A 4O3PA 3UNYA 1EJ7L 1RDRA 3MEKA 1HI8A 4LREA 4IH5A 3UCZP 2KZZA 1RAOA 2F4VJ 4C0BA 4D3GA 1HD0A 4F4ZA 5D15A 1UVNA 2HFNA 2HW3A 3KUHA 3EM1A 4CQ1A 1FWKA 4XIUA 3PROC 1AT1B 1IKVA 4P7TA 5J2MA 2YNGA 4URSA 1IKYA 2H4YB 3J7YU 2ATWA 3LGMA 5C42A 1QJHA 1PJ7A 1J2VA 1VFJA 2XGQA 2PEBA 4CTAA 2MLXA 3X3UA 2RRBA 4DU7A 1HBMB 3KG0A 4S0MA 5IWAF 2IBOA 3R6GB 1P8GA 4ECWA 1I1GA 2P9EA 3MD1A 4CLSA 5AJ3F 4IOCQ 4NL5A 3C6TA 3UN2A 5D0HA 1Z4UA 3HVTA 1K9MT 2P20A 4LFAC 2HQCA 3CIZA 3T9NA 4WFXA 4ENOA 2M70A 1EP4A 5DJBA 2LXIA 2NZCA 2BZ2A 4FYWB 1WUUA 1AMUA 3L7UA 3JSYA 2HWIA 4RUCA 4ECXA 2X3GA 3UW1A 4DV4J 4AFFA 4NEZA 3QIPB 2IJNA 3OR1A 2KZMA 1N5QA 4KGVB 2VC1A 3DLKB 4CLUA 1ZOTA 2W25A 4R5PA 2CG4A 2FJEB 5ETOA 1S1XB 3BH6B 3SV4A 1IR2A 1P1LA 1WKKA 5IT9D 2WZ1A 1TL3B 2H9ZA 4NWBA 2GCFA 5FLXU 3CE8A 3O2EA 2VQFF 1L5UA 2D3ZA 3GIMA 4IDKA 2H5JB 2HJGA 4ZLLA 2ZITA 1HR0C 1XRBA 3CQ2A 1Y5IB 2HK2A 1HNXJ 2EKNA 2IJRA 1IM6A 3IRXA 5E3AA 4DG1A 1CBKA 1YX2A 1RADB 4K5RA 2C2NA 4YMEA 2F4VF 5KTQA 2Z4PA 2R2TA 3TQIA 2J8AA 2QC3A 2LVWA 3RR8A 2AEFA 2YH1A 4G3IA 4HACA 4RUHA 4RLFA 3AAWB 1QAXA 2IM3A 2WOMA 3CCLS 3T1AA 1L3VA 1H74A 4KKOA 1S7HA 2FPHX 2D1RA 3W63A 4PUIA 5KFRA 2V4JB 2X1BA 4WK1A 4R0MA 4PQUA 3MM7A 4IFVB 1Q0NA 3A3OB 3JAMU 1JLEB 1IBKC 3GP9A 3BGUA 4FPRA 1BWVA 4LF9F 2B56A 4IYQA 1UP1A 1H2TZ 5AE1A 3S1TA 4UTGA 1XMOC 2YWKA 4EFAC 3G9CA 4D4GA 3M9NB 2VG5A 4ZS6A 3GFHA 4JV1A 2M8HA 2JVOA 4U6PA 4OX9J 2X1GA 4WFZA 2DCUB 3TA2A 5A1IA 4WZQA 3GFZA 2C3OA 4AXJA 2E5HA 1S9EB 5K8FA 5H9FK 1S57A 4EI2A 4V1Ak 3L7OA 1SL0A 1QE1B 2RB7A 4DUYJ 4DV4F 2YKNA 3Q23A 4DV2C 3B7WA 1S10A 2IYIA 2IC3A 1M6XA 5C2CA 2AKWB 4URGA 2N82B 2ZZNA 1T03B 5F8JA 5HL7Q 2L3MA 2CPEA 3CIMA 3BN7A 4GVLA 1S6UA 2EVZA 3MAHA 2XSJB 1V5IB 5K14B 1HPZA 2QJ3A 4B9TA 1FXRA 5SZTA 4RW4B 4RW7A 3PYGA 4I64A 4YY3J 4NLDA 3PESA 2ZOGA 2Z58B 3T1YC 2ZH5A 4C11B 3CCRS 2HGNA 4ETZA 4HVZA 1SJFA 2JJ4D 1HNXF 3AXMA 4GRSA 4DSIA 3BKFA 2PI4A 3H2TA 2EK6A 2I8EA 3Q8RB 2V8GA 3R44A 2QL9B 5LJ3Y 3AOCA 4KT0C 3S01A 2CKWA 4G1QA 3GJRB 4WPAA 2XR1A 2GHPA 4Q8FA 3DU6A 3A8KA 1RZMA 4LF5J 1F9EB 4C3KA 3PXGa 3THPA 3K58A 4RW9B 1NO8A 4K0BA 3RB0A 3PG9A 5IFIA 3E3XA 2CNOB 4ZVQB 1ZM2A 4PXBA 3D2WA 4P52A 4DPUA 4CLWA 2M2BA 2O3DA 3CJ2A 4ALZA 4ILLA 2GV1A 2JC0A 1RAHB 2CNKB 3C6UA 1NRKA 3RAMA 1KBRA 5F3TA 1LWCB 2IDEA 5BSMA 4DCPB 3KDOA 3HHLA 3FSYA 2ZVIA 2FHJA 4DX7A 4EK2A 1ZTWA 5KFDA 1IVZA 4OX9F 4KC5A 2DK2A 3JTPA 1T3OA 4E2FB 3OT9A 3LWLA 3ZZ0A 2FVQA 4W98A 1T9XA 4DUYF 4NLGA 2UP1A 4MK8A 2E8CA 3TZXA 5L1JA 3D1QA 2HHPA 1S0VA 2KVQE 3RBXA 4ID5A 2ZH1A 1KN6A 1RCXB 4EBDA 3E01B 1HNWC 1X5TA 5D0RA 2DXFA 2W2NP 3NAIA 4JI1J 1SJ3P 1OSCA 4KE5A 4C8LA 2KVIA 3RB6A 2BBEA 4NLSA 1IBMC 1GT8A 1NK7A 4YY3F 2FC8A 2MXYA 5K8NA 1NDKA 4RM3A 1N6QB 1FDNA 3CD0A 1WJ9A 3T1HC 1JJ2R 1RT4B 1U6BA 1N34J 2APOA 2N4CA 2GIQA 3GIKA 3K6RA 2UUWA 3NWRA 1WSRA 4JBCA 3CTRA 3MCMA 3M6WA 4WBFA 1X9SA 2JDJA 1UVKA 3EXYA 5LXYA 2ZZTA 3K59A 2ZKUA 4LF5F 4F3QA 2HNDA 4Q8EA 2UUCC 5F3ZA 4E8UA 2N3LA 5HMXA 1KKGA 1RHMB 3K2YA 3D3CJ 2ZEJA 4KO0B 4QIWD 3NOCA 4I2PB 5LT5A 1NK8A 2DCLA 3H7HB 1N5VA 2MZ1A 1OPIA 3UOWA 3N2QA 3QWPA 1TK5A 1LW0B 5IV4A 1T5HX 1XNRC 2KM8C 3GQCA 3UFCX 3M9MB 1YJVA 3CDWA 1S0NA 1GQEA 2OGUA 2CPZA 5IT9Y 4QW9A 4RNHA 2C2ZB 4MK9A 3MAAA 3R7NB 1U2FA 2J0QD 2EBGA 3K8WA 3D7SB 2FZKB 3TAMA 3C14A 1QAYA 1SJ1A 5A8RB 3BYPA 3OBIA 4Q43A 1D9DA 3GJTB 3A9UA 4ANDA 3JAMY 1LXJA 3DHXA 1RT2A 3T9ZA 3L7PA 2Z30B 3NMAA 1RU1A 2HKEA 4EZ9A 1HNVA 4DX5A 3D4JA 5J2QA 5EWEA 4UY85 2J9EA 3D68A 2FZGB 3LH2S 1FEHA 2N4DA 2LQ5A 1HW9A 4C97A 4JI1F 2H4WB 4QWAA 4J9SA 1D0EA 2XMWA 4P73A 2ZBQA 4N76A 4FF3A 2BANB 4ZVFA 4FYYB 3FBEA 2BQRA 1N34F 3CCTA 2A1BA 3R5BA 2YNIB 1RWMB 4H4MA 2CU6A 2CXEA 2DHAA 4QU7A 1TAQA 4LVOP 4LT6A 2IM2A 4X4SA 3PIPQ 3DGPA 1T7PA 2CJ9A 2KN4A 5ETQA 5A8KA 4X2BA 1PYSB 3TJ8A 1U0HA 5J2NA 4NXNC 3D28A 3HKWA 1HQUA 1IBCB 4DSJA 2JX2A 3DXSX 1W26A 2B7BB 5FD1A 3ZZYA 3PYEA 3Q83A 5IT0A 2CAJA 2KRRA 3J80Y 1HWKA 1S1VB 4UUXA 4B9SA 2YQ0A 3PIOQ 4MYUA 2RQMA 1H7XA 1A6LA 1DTQA 5C7PA 5BUQA 3HHKA 1T05A 1CEZA 2YWEA 1FWPA 3A1YG 2J0WA 1F3VA 3OR2A 3O1LA 3GIRA 1U1KA 4Y00A 2PFDA 2MEWA 1BMQB 3DLGB 3VGUA 2QL8A 1WDTA 4CO2A 1LKZA 3Q22A 3OXLA 4DSFA 2XM3A 2R2RA 3BM7A 1Q95G 3FBCA 5GADI 2Q6CA 1UWBB 2DXDA 2MKKA 3ZZRA 4DUZC 1FTCA 3IFEA 3T1YJ 1MU2B 3B78A 1G1XA 2UXDC 2ZE2A 3E51A 4MJKA 3Q8SB 2M4MA 3L3CA 2QLJB 3PACA 2K1RA 3EE3A 2GNKA 2GVDB 2KFNA 3UDLA 2IMOA 2FC9A 1WEYA 5LSLA 3UEBA 3EZUA 3TX8A 4B3OB 2QEXS 5CA5A 4X4UA 1ULTA 1VIXA 1SIZA 1YG0A 2EWHA 2X3DA 1RXOB 1UPPA 1R3NA 2HQFA 1EQMA 4K4UA 3EGNA 1GTHA 3BSCA 3MPVA 1RT7A 2G0JA 1NYEA 2HFSA 4ED0A 3D0HE 3UD3P 3DOMB 2Y1RI 1Q1KA 1S59A 1MMNA 2EBEA 1N56A 3NP5A 1VLAA 1X0FA 1LQ9A 3AY0A 2C22A 4HPVA 2NZ4A 2BRLA 2QG9B 3HDSA 1JLAB 2MKHA 4ZJZA 5C25B 3QPIA 5DETA 2RU3A 2QA2A 3SSQA 2MJUA 1SKRA 2U2FA 2KZ0A 2NXUA 4UZCA 5BYQA 4DQRA 2L9DA 3UVJA 4PCQA 1LK7A 1AUSL 3M8PA 4X65C 2WONA 5HANA 2UZAA 4YDXA 1WH9A 1GEHA 2L48A 2B9EA 1F5BA 1YJTA 2J76E 2H51B 2ZH9A 4GC7A 3RB3A 4FKYA 2DITA 5HQLA 5T7LB 3NBPB 1F0XA 3LA0A 1HNWJ 2Y0BB 2C2EA 3PVXA 1CULB 3OLAA 1ZAVA 3NLCA 3T5LA 2GFFA 4TVAB 3EZOA 5LXRA 3LP2A 5J1PA 2MHEA 3V81B 4DPTA 4DSLA 3T1YF 1VQ8S 2LXFA 2Y3YA 4GKKC 4ZHRA 1R43A 1TL1A 1V5VA 4DV1J 2A6OA 4LVNP 4L3NA 1WC4A 2MKCA 1QD1A 3ZO7A 4MKVA 2CQ4A 3J81U 3KUGA 2WSCC 1NPRA 4CLTA 3DC2A 5ETPA 3SV3A 2I2YA 3TUJC 2FJAB 2Q43A 4GVBB 4LR7A 3M30B 5BXIA 3U1LA 1TP7A 3LP0A 4O44A 3PX4A 2CPFA 4P7VA 2CQBA 2IRUA 1RY2A 2E5LC 3GG1A 4M5IA 5GAGU 3SBMA 1REVA 2V63A 1Q7YT 4ZP7A 3NPDA 1CJUA 2G13A 5CABA 4LRDA 1VI7A 3TAQA 3DNCA 2B5JB 2WB1D 1VYAA 3L09A 2G2ZA 2PA3A 4NCGB 4OLOA 1FEEA 3MECB 2I5JA 4ZPVR 3FC9A 3MM6A 4O4GA 4LR8A 3P96A 3UDCA 1VC5A 1U8SA 5IOLA 1I94J 4K7QA 1KQSR 4WV3A 2JEGA 2JVRA 1L3UA 1M1HA 3P5TL 4QYZJ 3A8IA 2DH9A 3W9HA 3D54A 3M2UA 4UW2A 4NA2A 3K5NA 1GAOA 2KG1A 3QO9A 4RUAA 3FCEA 4PWWA 3DDKA 2VC0A 4K4YA 1SI9A 4DFPA 2GVZA 4L6V3 4DV5C 2YWWA 3W9JA 1GFWB 3D6MB 4Q5VA 4M5JA 1TKZB 3CDAA 2PN6A 1ZM3A 4NMLA 4OIXA 1LCIA 1NDLA 3TQEA 3AJ2A 4JP8A 1UVJA 1RABB 2XY7A 2CVIA 1PBUA 5HAOA 1PAEX 4LF7J 3ZFVA 4ED6A 4B9UA 2UUBJ 4U96A 4HLBA 4LF8C 2EGTA 4C3MA 1JLQA 5FDLA 4LSNA 1DRZA 1SH3A 3ICLA 3M2RB 5HBMB 5JMNA 1HNWF 2J5AA 2RF2A 4KTTA 1EARA 2DNLA 2MSSA 2UXBC 2V2VA 4X4NA 3ENVA 1U2RA 1SVDA 4N77A 3NMRA 3CCUS 4L75A 1LOUA 1HBUA 3DMJB 4PRFA 2FQQB 3MEGA 2NS1B 1HD1A 3ITHA 3RBZA 3KJNB 4HKQA 3V4IA 1N36J 1NLKL 3NS7B 4L72B 5T8TA 4DV1F 3VGSA 1NKCA 4RM2A 1EHWA 3A12A 1NJWA 3FCCA 2BJ7A 1B7YB 1RT1A 2HAIA 2OTJS 3DM2A 3AA9A 4USMA 4RWXA 3NGKA 3TA0A 1PA4A 1S1UB 2CJYB 2ZHAA 2D7VA 5L8RC 1FO1A 3UNGC 3H4DA 3MF5A 3LPYA 3RGIA 1YJNS 4HT7A 4EO8A 1UW9A 4Z7YA 1I94F 3DRSA 3CT9A 1VGYA 3CJKA 1XNRF 5KFPA 1VLYA 4DV6C 3QT5A 2OAUA 4X64J 3J7AN 3THTA 1ZYQA 4DQIA 2YPYA 1BWEA 3UPFA 4HHJA 2HK3A 1MWQA 4I6AA 2JNJA 3QBCA 1DJ0A 1Z1ZA 4R25A 4DR2J 2B6AB 1V9OA 3IGNA 1VRUB 1T02A 1GNKA 4X62J 3TZZA 5BSRA 2HHSA 2MLYA 1QY7A 1TUGB 1KEKA 2BJ9A 4Y3CA 3ENAA 2CPXA 4LRFA 4USIA 2E7VA 4XAKA 4LF7F 2H5IB 3B4DA 3PW4A 2UUBF 1PKUA 2IAJA 4DPYA 1TL5A 2GS8A 4CNYA 2HS4A 4DPWA 5DDOC 2DHXA 4PUGA 1BQMB 1HW8A 1CQMA 2XYPB 4RUBA 4EYHB 1LWEB 3SDEB 3GR1A 3ZTQA 2BOPA 4DSKA 1FXDA 1KVKA 2R7TA 3DLJA 4HYKA 4LQ3A 3RRGA 1R0AB 2DTJA 4ELUA 4KSEB 4FPIA 2NUUG 4WYLA 2AZ1A 1FJ7A 2DB1A 3EGWB 2C2RA 1F9HA 4DR7C 3QFWA 1T8EA 5K85A 5KFFA 1N36F 4CCHA 2CPYA 1FFWB 4ZVRB 3CJEA 3PHTA 5BSUA 2GW8A 5HQMA 4BCAA 3MM9B 4KGMA 3K57A 4H4KA 1WC5A 4NLRA 3TJ9A 2OFHX 3OW2R 3DLHA 1VQLS 4CZCA 1WACA 4CO0A 4CLLA 1OSDA 2B9WA 3K5OA 1V6HA 4IG3B 3BS9A 5LMNC 4KRWA 4NXNF 3MR2A 3SO4A 1R8PA 1M5KC 3ELHA 3EGZA 1I5OB 3AXKA 1TMJA 2BM1A 4OYAA 4GMKA 4OJGA 1G6BA 9ATCB 1HNZJ 2E29A 4ZJOA 3CW8X 1TV6A 5HVHA 2G0IA 5HMZA 3PRDA 4IFYA 2DNOA 2VFRA 3BGFA 3J81Y 3QJJA 4M8LA 4LIRA 5J2PA 3CCQS 3WIVA 1WHWA 2YKPA 3MEEB 2IA6A 3I32A 2CQDA 3SIPB 1F5CA 4C3LA 4NLUA 4X64F 3SI8A 1XNQJ 4OZLA 2YVSA 1REGX 4HR2A 3I0SA 2MQMA 1DTTA 2B4PA 3W64A 1RWUA 2HFVA 3SYZA 4WKYA 3RYLA 4DR2F 1MDFA 4HL9A 3ET6A 3KK2B 4DL3A 3ISND 4XPEA 5D4NA 2HHUA 4X62F 2RNEA 4DCOB 2HPUA 2GJIA 1LFWA 3KJVB 5LMUJ 5AE3A 3JSBA 3U1MA 4GKKJ 2UXDF 3R8YA 4U9RA 3G4SS 3RRKA 3IPLA 1B0PA 2PE8A 3MOZA 2JWNA 3FEYB 5HATA 2LA4A 2MKIA 1V3SA 2P6TA 4TLQA 3W9IA 1FA0A 3I9V9 4QOTA 3FUYA 1FHTA 1LWXA 3RUBL 3PR5B 1O8BA 4N8NA 4ZN1A 4DJBA 4DF8A 4YDDB 2QMWA 4OZ1A 2M7SA 2E5IA 3G82B 2DISA 2CFXA 3U02A 3FFIA 1V25A 2QLXA 2KO1A 4ZPAA 3IR6B 4MAKA 5AXNA 4KQZA 1JLGA 3MR6A 2ZJPQ 4P72A 3EPIA 4DL0C 3L4BC 5ETMA 3M1VB 4LF2A 2CJAA 2VPXB 3DRPB 4IRKA 4X66J 2I1RA 3FCHA 1VQNS 1D9AA 1RT5B 3CW2C 1WC6A 2E1MC 3O6QA 1WWHA 5B0CA 2XO6A 1ZBTA 4LFBJ 1URNA 2QYGA 3OFGA 3MMCB 1NU4A 4A8OA 2FYXA 1VR6A 5HROA 5EDWA 1YIJS 1HNZF 1FERA 3IO1A 3OVBA 2SXLA 3FCWA 5CCMA 3H5UA 2DXEA 1T9TA 2V8VA 4JI0J 1Q5YA 2ZH2A 4H4OB 4ZP8A 4RX6A 2BKOA 3C2PA 1K0RA 2CQ3A 4GXRA 1MROB 4X65F 3R5GA 1VC6A 2YNHA 5HN0A 2OSQA 1XNQF 1OPZA 2DHHA 1N32J 4MKAA 3H20A 3IWXA 1QSSA 2EG2A 3TR3A 2FLOA 4TN2A 2ZC3A 2GHVC 5KT7A 2UXBJ 2PC6A 5KFQA 5L1LA 4CP5A 4RO0A 1FDDA 2GA7A 3LTOA 3CJ8A 2KDOA 4A47A 4X84A 3MM5A 3UDVA 3GJQB 3W61A 2C28A 2JL9A 2MM9A 2V2QA 4OI4A 2GMHA 3DYAB 2G1HA 3PX0A 1S97A 3KLHB 4GKKF 3NCRA 4NASA 3SFUA 4F2SA 1HBOB 2KG0A 3OTBA 3FKBA 2WSFC 1TH5A 2LYVA 1VQ9S 1V3ZA 4OZ3A 2OEMA 4FS1A 1C1CB 1T94A 2HHVA 2RRAA 3FQKA 4LSLA 3HM9A 2VPWB 1FTRA 4CYUA 2ZHBA 1OWXA 1A7GE 1G3OA 4QWDA 1CJTB 2B51A 4R1LA 4KFBA 2CWKA 4QR1A 1AUDA 2R7UA 5T41A 3K5MA 5DQIA 4DCTA 5CYQA 4L7IA 2C3PA 4QR2A 2EW9A 3CCWA 5I3UB 3R9WA 4RW8B 2A2DA 4K2XA 3MMBA 4WE1B 3UE2A 4ZJQA 3BGRB 3MMAB 4IOBA 4OYXA 3W66A 5A2QD 3KLFA 5B08A 4DFJA 2PMZD 2HIYA 4ED3A 4X66F 2EK1A 3TO8A 2NR0A 2D41A 2DNHA 2W24A 1HYSA 4ZLPA 4LFBF 4ECZA 1GXUA 1IR1A 4A8FA 3BO2A 5BR8C 3K7RA 3CJ4A 1WOOA 4B9VA 2GAHC 2MMYA 1IBLC 4JI0F 1S1WB 1CJVA 3UDEA 4NYPA 1VDHA 2Y8WA 2JNVA 4CH1A 1OIAA 4PPDA 3IMLA 3V5RA 4DPXA 3KYLA 4YR3A 1N32F 3UX2A 1KRPA 2F40A 2AJ1A 3MURP 2FIUA 2MPUA 2Z8QA 3NEKA 2XY6A 2IM0A 2UXBF 2YKMA 1U2CA 1LW2B 1RYSA 1Q8BA 1U09A 4FF1A 4LFCJ 4X4VA 1MMLA 2HQDA 5EWGA 1R6YA 2VV5A 4DR1C 2CQ2A 4K8RA 4YB6A 3JQMA 5KYVA 2K7KA 1F1BB 1HWUA 1HHTP 1RBAA 1F3FA 2F9JA 1NCLA 3KLIA 2V94A 1DY3A 4O3NA 1DLOB 3GILA 4CM0A 5SUHA 4XDCA 1J5OA 3NGRA 1Q16B 5BSTA 1RE1B 5KG5A 4PG8A 1FE4A 1WORA 3I5AA 4B3TC 4HI1A 1NHUA 3R97A 3CC7S 4OI3A 1BD6A 2IA0A 4ZKAA 5KFJA 1XWLA 4C6AA 1SV5B 3LPEA 1XEZA 2DVIA 3A3NB 4TYBA 1USPA 2IBKA 2ZNZA 2V34A 1Q4RA 4ED2A 5GAHI 2YH0A 2ZUAA 1WHXA 5B0BA 2ZWPA 3EWGA 4ZCLA 1XS3A 5LSRA 2YKAA 1NDCA 3PKYA 1T0TV 2HFOA 2CYYA 1VRTA 2UU9J 3EGVA 4LR9A 4F4WA 4JYAC 1C1BA 1NM2A 3IMQJ 1S0OA 2KT3A 4F0HA 4KAIA 4WIIA 2A18A 1E6YB 3C66A 1WF3A 1KQFB 3D6TB 2QFJA 3T19A 5IM0B 3CJQA 4KIAA 1NXIA 1RWNB 1U24A 4AD6A 1WOPA 1IKXB 4WZMA 3AB4B 4OHYA 3EX7B 3I5CA 1CS4B 3FZBA 4CLYA 2VKRA 3NGSA 4RW6A 2D3OR 4PWDB 3VR1A 3KLEB 1HQEB 1Q78A 3T5JA 2Q6BA 1ZB8A 4C8ZA 3CQ1A 4OV6A 2HMIB 2YWBA 4P2SA 2CPDA 1OS5A 3DLEA 2OEKA 1KP6A 2NXNA 2ZBPA 5D0GA 3RG2A 4PUHA 4LFCF 1RT6B 2HHHJ 2F65A 3DXBA 2F5GA 2OPPA 3TEHB 5CZVA 4ZCIA 1RTHB 2HBRB 4ECVA 4Y0FA 1FNMA 4JI6J 4I2QB 3BREA 4HHUA 1VQYA 1RT3A 3OXFA 2Y4NA 3ETOA 1PG5B 2VQEC 3QWUA 2ZFHA 3SCIE 4JV0A 2F9DA 4OI6A 2OJ3A 3FVYA 5GAEU 3TAPA 2HNYB 5E41A 2CNNB 2VG7A 5CD4H 1CSJA 5E3QA 3BR8A 2MJNA 4CT9A 2BV3A 3PRVA 3I0RB 4ATNA 3H5SA 4X4PA 1ITPA 4P10A 1TK0A 2PD1A 5DZ6A 5ETSA 4DFMA 4MK7A 4NXMC 4F8RA 2FLNA 4CLZA 2RDIA 4DBQA 2K3KA 1N5SA 3Q2TC 5CHCB 2UU9F 1WKJA 2BACA 2V5HG 5K9FA 2QA4S 1VEHA 3P4UB 3PYFA 5RUBA 1QDUB 4DQPA 4PYDA 2QLBB 3W8GA 2W7AA 3LWMA 3ZXWA 1PG4A 3FGVA 3DLPX 2WP0C 2W7OA 4WFYA 2UUAC 2ZOFA 4K4SA 1GPMA 1S12A 3T6BA 4WS9A 4WK3A 3WC0A 5C24B 2Y27A 3A26A 5CYJA 1SL1A 2UXCJ 4M5DA 1B3TA 2V67A 2UVVA 3POTB 2NPIA 5LCIA 1EETB 4JI2C 1S6QA 1UJ5A 2OPSB 3K89A 1SKUB 1N8RT 3GPAA 3KFWX 4EMDA 1K0VA 4GO5X 1H2VZ 2LQBA 2KXHA 3NNCA 5A8WB 1J5EJ 1IJEB 2HHHF 3FSXA 1DQAA 4K0KJ 4Q0BB 1VK3A 2B8QA 1A9NB 3FZ2A 2KJWA 2PEHA 1EB0A 2P2CB
chains in the Genus database with same CATH topology
1D9DA 1WHVA 3I55S 1KQGB 3GE9A 1BQMA 4F4YA 1UVLA 2DNQA 4G6VB 4OL8A 4NOZA 3EYZA 5JVGQ 4JI6F 2VKZG 2XC9A 3A9UA 5KG6A 4PPZA 3JAMY 1LXJA 3DHXA 5KYTA 1LWEA 4R8UA 3SDEA 1RYRA 1RT2A 4QJVA 2X51A 3T9ZA 4ECRA 3L7PA 1VMBA 1S4FA 1J5EC 4MTPA 3NMAA 5KG3A 4EZ9A 1HNVA 1HI1A 5H9FJ 1R0AA 3M2VB 1FRKA 1IBMF 4K0KC 1SH0A 2CRLA 3G8SA 4KR0B 3HXMA 2AP6A 3LW5C 3KMSA 4B17A 3DRYA 5AXKA 5F8HA 3SEOA 5J2QA 4R0JA 2FLPA 1N4LA 5EWEA 1P7LA 1SBRA 2RMLA 2B0GA 2WW8A 3T1HF 4UY85 1JIHA 2J9EA 1D1UA 1XR6A 4FUQA 5KFTA 1IKWA 3LH2S 1FEHA 4FBTA 2B3TB 3SSRA 2N4DA 1YJUA 4NXMF 1UW4A 2ILZA 2LQ5A 3FFIB 4LJMA 3BF4A 3BQ0A 2NUHA 1UAWA 3MM9A 5M2PA 1HW9A 1FRLA 2E7GA 4C97A 6FD1A 4JI1F 4WXWA 5KFLA 4MMOA 4QWAA 5I4MA 4KJIA 4J9SA 2XWXA 1JLGB 2B7CB 3I07A 4AL5A 1JOSA 2L41A 2LDIA 1D0EA 2MY7A 2YX7A 4B08A 3JSMA 2XMWA 2OMLA 1RTDA 1JJHA 2KHDA 2QSWA 3DOKA 2MQQA 3HZEA 3N6LA 3G6ES 4NX9A 1H2UX 2BR0A 1NK6A 4EZ6A 2JLEA 1NKEA 4N76A 5EN1A 3N01A 4NLOA 1CPZA 2HIQA 4IG3A 4FF3A 2BANB 2WAQD 4ZVFA 2BA9A 5K5MA 3PZPA 1E6VB 4AL7A 2IFXA 3Q24A 3MXHP 3QYYA 4OJHA 4URQU 4X4TA 2BQRA 3LNVA 4OI0A 4Q2LA 5DRKA 2HS0A 2LA6A 1N34F 4J9RA 3CCTA 2J6TA 2XGPA 4IOAQ 2E0GA 1U6FA 4FUTA 4ZA1A 4KHPC 2A1BA 3R5BA 1UEVA 3GWCA 2UUCF 5BYSA 5HROB 2YNIB 3HP6A 2UUAF 4H4MA 2DNYA 4QBUA 2DHAA 4TQSA 4KTQA 3OPKA 4QU7A 1DURA 4YQWA 1YJWS 1IUJA 1HA1A 3OFHA 1TAQA 4LVOP 3HVAA 4LT6A 2IM2A 1H6KX 4X4SA 3PIPQ 4U7CA 3DGPA 4N5SA 1T7PA 4M1KA 2CJ9A 1YRTA 5JUMA 1S72S 2KN4A 5A8KA 4X2BA 4ILMA 3DAYA 2JRSA 3TR5A 3TVYA 5CXTA 4C4WA 2JFDA 3ZC4A 3LGXA 4Y6IA 1Y4ZB 3O3LA 5J2NA 4C98A 4NXNC 1IKVB 3D28A 5KT5A 3N28A 4JI2F 2QE5A 4I0WA 2QVXX 1XMQC 1NEEA 3HKWA 1HQUA 3UR3C 3MEEA 5J2MB 2GHWA 2YNGB 3SCLE 4DSJA 1IKYB 2JX2A 2EFQA 3DXSX 3IXQA 2B7BB 5FD1A 1Q8LA 3ZZYA 2W9AA 2YNHB 4TU8A 1TKTB 3KXWA 4PXEA 3SCJE 5C42B 5IT0A 5HP1B 3RV2A 2Q79A 2LDYA 1HHSA 4V19X 2AGQA 2KYXA 1IM4A 2ADBA 4TPSB 3NL0A 1BGXT 1N5YB 1YSJA 1YTYA 2VA3A 1FD2A 4IKAA 4CTAB 2N7CA 4IR9A 1XR7A 4DR5C 2XLJA 2QA1A 1WI8A 2R7VA 5E2QA 4DG8A 2KRRA 1U47A 3J80Y 3ZZUA 4JOUA 2UXCF 2IYGA 1HWKA 1S1VB 3RBDA 3V6HA 4UUXA 3ZZZA 4A8QA 4F25A 4B9SA 1D9FA 1Q79A 4MYUA 5GVQA 2RQMA 1H7XA 1A6LA 1TVRA 1ZPWX 3LQVA 4HH1A 2PROA 5KFIA 4J37A 1DTQA 4N41A 3C6TB 2VFVA 3KK2A 1YBAA 2DNGA 5BUQA 3HHKA 3KK3A 1T05A 3HVTB 1CEZA 2XMUA 2YWEA 4MIWA 3A1YG 5IS2A 3PO4A 4PXDA 1FKOA 2J0WA 3WBZA 7FD1A 2ABYA 2RSQA 3MM5B 3OR2A 4DV0F 3IAS9 2V0NA 3UD4P 3MR3A 3MEDB 2D74B 4B3RC 3O1LA 2FGOA 1U1KA 3KJVA 2KFYA 4Y00A 3KNAA 2JZ5A 1WHYA 2DHGA 5CYMA 4DFKA 4IUFA 1EP4B 1KVIA 2FD2A 5L9NA 2J0SD 1J5EF 3DLGB 4ODJA 2QL8A 4J9NA 2ZDOA 2R7WA 1S6OA 4CO2A 2XCPA 3V2UC 5KT2A 4IG0A 1LKZA 2GGPA 4OZNA 5EHHA 3Q22A 4JI8C 4OHWA 3OXGA 3GPCA 3OXLA 3OV7A 4DSFA 1S6PA 1SC6A 3ZZOA 4M95A 5IQ6A 3PV8A 2ASLA 2R2RA 1AROP 2OPRA 1XTZA 3BM7A 2DRBA 2RUGA 5KFAA 2WHOA 2EFOA 2AX1A 2JMPA 4H4KC 2WD9A 3V4MA 2YQ3A 2VONA 3N5FA 2IJFA 2JHEA 2EI5A 5GADI 2HQIA 2Q6CA 3F73A 3OR1B 2CQIA 4LSLB 5U47A 1UWBB 3HMJG 3R3TA 2DT9A 2MKKA 2BE2B 1W25A 3ZZRA 5D3GB 4K4VA 4DUZC 1FTCA 3IFEA 5A0YA 3P3DA 4R5PB 4ICLA 5E7OB 2CY1A 3OHAA 2KFZA 2YWCA 1KONA 1MU2B 3B78A 4NLXA 3MUVP 1G1XA 5DGBA 4KFBB 4USJC 3RAQA 2UXDC 2ZE2A 5L1IA 3VAIA 3E51A 4MJKA 4NZ0A 5CYQB 4AE5A 5DQHA 3Q8SB 2M4MA 3HO1A 4QPXA 3P6YC 4RLEA 2XSFA 5KT6A 3DFEA 3L3CA 3PACA 2K1RA 5KFSA 2GNKA 1VQ7S 2RU9A 2KFNA 3CC2S 1L3TA 3UDLA 3CSKA 4ITSA 2MY8A 2IMOA 3GR0A 2HHTA 4FTFA 4X4QA 1JLBA 2DR5A 4JM1A 4DV3C 2FC9A 1WEYA 4ZVEA 4ECQA 3C8YA 2M0GB 2O67A 2WCXA 2HWHA 4O3QA 3OL7A 3S7RA 5LSLA 1QM9A 3MMBB 1HBNA 3RZAA 4K4TA 2XS5A 3EZUA 3TX8A 4B3OB 4CO1A 2XMJA 2OTLS 2XULA 2PT0A 4J9OA 2QEXS 2D28C 4GKJC 3DN9A 1TKXB 2HFZA 3VTIA 1TQLA 2O1PA 5D8HB 1DQ9A 5CA5A 1F5AA 1K1SA 3ISNC 4X4UA 1ULTA 3KLFB 1NHVA 1VIXA 2I9SA 3Q2SC 3NI2A 4IDKB 1SIZA 1YG0A 2EWHA 3QZ8A 4FF2A 1CVJA 1NNDA 4YB1P 1Z2LA 2CJKA 4ZPCA 3M1VA 2HGLA 1IBLF 1R3NA 2UVWA 3KK1A 2VA2A 2CXCA 2DGQA 3PEHA 3V6DB 1TUVA 3K5PA 3DRPA 2OBVA 4O3RA 2XI3A 4K4UA 4RKUC 4RZRA 1D8ZA 1TL4A 1RT5A 1CC7A 1X4CA 1HYSB 2ZBCA 3EGNA 1LFPA 1GTHA 2J9CA 2VBWA 3BSCA 3DRRA 3IRXB 3KWMA 3OQ2A 1XMQF 1WEXA 3QMQA 4DG1B 3MPVA 1PG3A 1RT7A 4PG6A 4EGLA 2I0XA 5KFKA 1BQNB 4TU9A 3GB0A 3H5XA 1NYEA 5HO4A 2QMXA 4PROC 2RT3A 2GQCA 2OO4A 3MMCA 1KD1T 4G37A 3IC1A 2D3UA 3D0HE 4ED0A 3UD3P 3PO5A 3IG1B 2Y1RI 1Q1KA 2BJDA 1VS3A 1MMNA 2DH7A 2EBEA 3TNVA 3C3LA 1Y7PA 5EUHA 4DR4C 2JC1A 2N3OA 3NP5A 4DR5F 4TNOA 3U27A 1N56A 5G4DA 4QIFA 4F4XA 1NJIT 1VLAA 4YHHC 1FRJA 2DNRA 1X0FA 5GAEI 2WOMB 4F3MA 3MM8B 5BSWA 3H98A 2ASYA 1ZH5A 1LQ9A 3UI3A 4LF4C 3IAM9 1U6ZA 1U1RA 3AY0A 3LALA 5A8KB 2YKQA 2C22A 4HPVA 2NZ4A 2BRLA 2LEAA 4KKOB 1VHFA 4AL6A 3HDSA 1JLAB 4H4OA 3IS9B 2MKHA 4ZJZA 5C25B 4MTNA 3ENQA 3CGIA 1AW0A 3QPIA 5DETA 3QJLA 1MROA 2RU3A 4QWBA 2ATLA 1WD6A 2VPZB 3LAMA 2QA2A 3PKMA 3BSOA 5JRHA 2RVJA 3M6XA 3SSQA 2MJUA 1SKRA 4PQUB 1AFJA 3T5HA 4DS4A 2DGTA 3GMGA 1KVJA 2U2FA 3MM7B 3KTQA 2NXUA 1DQ8A 4B3RF 4A8SA 1YHQS 3FQLA 4I67A 2YKOA 3D5MA 4WJBA 2RRNA 5B0GA 1HBMA 2JLGA 2DR7A 2J6UA 5BYQA 4DQRA 4YB7A 3FMBA 5MAOA 1O93A 3L8CA 5A1GA 4HTJA 4U7UK 2L9DA 4B9LA 2V9WA 4CI0B 1KTQA 1RKJA 4JV5C 5KG1A 3UQSA 2M9KA 3C5EA 1AXQA 2WRMA 4PCQA 4JI8F 5CQGA 1LK7A 2AF6A 2YKMB 4Y34A 2FJDB 3M8PA 4X65C 2OIHA 3SFGA 2WONA 3OSPA 2UZAA 4YDXA 2P2BA 2XB2D 4IQMA 1WH9A 2L48A 3H2VE 5LSOA 4O0IA 2VG5B 4WFAQ 5JVHQ 4KBIA 1F5BA 1YJTA 1DARA 4IH6A 3T6JA 4UY8T 2J76E 3RAXA 2XWYA 2ZH9A 3DYAA 3N6NA 2V4QA 2F1FA 4GC7A 1XRAA 3FSIA 3RB3A 2Y0SD 3MGJA 2HYIB 2VL1A 4DUZF 2DITA 3OSNA 2R7OA 3M8QA 3KLHA 1U45A 5T7LB 5CH7B 3NBPB 3G7SA 1F0XA 3CDEA 3MTJA 2EFVA 4ECYA 1X9WA 1VQKS 1UVMA 4OX6A 2IM1A 3OTDA 2G0CA 1SIWB 2FJXA 5DV9A 3M8SA 5KFHA 1HBOA 4WU3A 2P02A 2C2EA 3PVXA 1PGZA 3N6MA 2NLWA 1H38A 3K5LA 3KLIB 1DFDA 3SMZA 3OLAA 4N56A 1ZAVA 3I82A 2QT7A 4JI3C 4FP9A 3NLCA 2YKNB 3OL8A 3T5LA 4DV3F 2GFFA 2C3YA 3M4XA 4PG5A 5LXRA 3QIPA 5B09A 3HK2A 3LP2A 2IC3B 3G96A 5J1PA 1C1CA 1S9GB 2MHEA 1UMJA 4NLWA 3RU0A 1X4DA 3V81B 1WG5A 1J5OB 2BUNA 4YP3A 4YUDA 4GKJF 3DLKA 1X4GA 4DSLA 3T1YF 4I7FB 1VQ8S 4C0OC 1HL6A 2LXFA 1FVQA 2D9OA 2QYCA 5B0FA 1S1TA 4GKKC 4ZHRA 2HLTA 3W2WA 1R43A 1TL1A 1WEZA 3R5AA 2R7SA 3LP1A 1AFIA 1K1QA 2ZH7A 4LVNP 1S1XA 4L3NA 1JWWA 2GC8A 3PEJA 4DSEA 5KFYA 2ACYA 4TY8B 3DU5A 2MKCA 3OVAA 2NYIA 2OPQB 4LMZA 1HPZB 3VNRA 1R8HA 2CQ4A 2ZKTA 2WSCC