3GR0A

Periplasmic domain of the t3ss inner membrane protein prgh from s.typhimurium (fragment 170-362)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
186
structure length
186
Chain Sequence
LGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
molecule keywords Protein prgH
total genus 69
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gr0A02
3GR1A 4G1IA 3GR0A 4ALZA
chains in the Genus database with same CATH superfamily
2AHOB 3CDUA 3GCWP 5IZHA 4LF7J 4OI3A 1WDDA 1YJWS 2YNIA 1G6BA 2ZDPA 1KTVA 3CD5A 1AT1B 5CZVA 5C5JA 3QZ7A 4DR4C 3GJRB 3RR7A 4M5NA 2RB7A 1RTIB 2W9CA 1NYEA 2BOAA 4QU7A 1J5EC 4WTYA 2RRAA 1NK6A 1KVJA 2DNRA 4DR5J 1CJTA 2CFXA 2W1BA 1V3ZA 3MCMA 4HI1A 4ZP6A 2ZH9A 2OTJS 1N52B 2E7VA 4I2PB 2Y1JA 2M5HA 4GKKC 3KK2A 2FVQA 3R5GA 4OZNA 2K3KA 3QLHA 2XMJA 4QIWD 3B54A 1FJGJ 3QYYA 4QCLA 4G6VB 3TARA 1UA0A 2KKHA 3A8EA 3ZTRA 4TYAA 4YDDB 3MAQA 2UXDJ 2GJ2A 4GVBA 1JJ4A 4DDFA 4O3NA 3OVSA 3TNVA 2M2BA 2Y4NA 4RKUC 3BO4A 2FJBB 3CIZA 2KXNB 1R0AB 4X65F 2WTFA 1V6HA 2VG5B 4JI3J 1REGX 2VBWA 1FD2A 4OX8A 4WYLA 3RUBL 1XHJA 3J80Y 2RHSB 1S4FA 1FVQA 2V8VA 2ASYA 3CD7A 2QTWA 1FESA 2FPHX 1V26A 1RQ0A 3N2QA 3KLFA 3G6YA 1WG1A 4IR7A 1M6XA 3BSNA 5IXUA 3D6FB 1NSQA 1LFPA 1T0TV 5MAOA 2QSWA 5KT7A 2XCAA 5A0YB 4A8KA 1ZM9A 2XULA 2Z2LA 4K2JA 4ZVFA 5KFIA 1FFGB 3SV4A 4R8UB 2HK3A 2V67A 4CCHA 1OY9A 2V9WA 1R8CA 3I9ZA 1S1UA 1TAQA 4UTGA 2KZZA 3PBKA 1HKAA 2VF3A 1XERA 4N8OA 4UZBA 2H48B 4F2SA 5GMKa 2NUUG 2P9EA 2JC0A 1M5OC 4JI2J 5BYRA 4EGLA 2JMPA 2DCLA 3FEXB 3OHAA 2GZOA 1MWQA 2JLFA 3WX4A 1N34J 2RE1A 4C4WA 1NHKL 4C48A 4C8ZA 1UEKA 1B4SA 2DH8A 1PILA 2WHOA 4LREA 1FNMA 5KFOA 1JLAB 3V6JA 2PMWA 1U1QA 2BJDA 2QX0A 5CQGA 2VFSA 1RHJB 4ZKAA 4MKAA 2FVSA 4XPEA 2DTJA 1XJWB 3DM2A 4K5RA 1UKKA 2CXCA 3LAXA 3EGWB 1B70B 3LGNA 1ZAXA 4PROC 2QIFA 2I5JA 5HBMB 5F3ZA 5F8GA 1WELA 3CJ2A 1WWHA 2MZTA 3OXFA 1VQ9S 2IBKA 1VR6A 2KZFA 2DY9A 1GXLA 3PO4A 4J9UE 2BYCA 2IC3A 2VFTA 1TKTA 2HFZA 4USVA 1T9XA 1UVJA 1S5ZA 2Z58B 4K2XA 5A2QU 2WVDA 3IGNA 1RCXB 3AOCA 3UN5A 3UW1A 3HVTB 5J1EA 2Y4OA 2AYEA 2MQOA 2G9OA 2ZEJA 2VQFJ 4YY3J 1MMNA 2HS3A 4CLWA 1TZ0A 2XNQA 1YI2S 4M5LA 3WHIA 2HLTA 2DXDA 3BGFA 2NPIA 3ET6B 3UR3C 2Y1IA 2AYAA 2EK6A 2YQ3A 3R5DA 4QR2A 2MGZB 1USPB 4QWDA 3NGTA 2EK1A 2LEPA 3HSZA 2PMZD 4OHZA 3CNQP 3I9V9 4V19J 1S48A 2OD4A 5A0YA 4CRJA 2C3UA 1O93A 4B3TC 1F5AA 2ZJQQ 3QQCD 2E5GA 3PEHA 5L46A 2PSZA 4KE5A 4ZDNA 2JHEA 4WXWA 3VGSA 1GAOA 2P2FA 3ZZRA 5J2MB 5E3PA 1DURA 3OD2A 1N56A 3OL8A 2WOMA 4FS2A 1B64A 2DNKA 2C2NA 1CC7A 2R2SA 2UUBJ 2G4BA 1SIWB 2B4OA 4H4OA 3SCKE 4ANDA 4BBYA 4DV5J 3TI0A 2BQRA 4IR1A 4IO1A 1HYSB 2O1PA 1N54B 2E5JA 3LPEA 4MKBA 1T3NA 1O51A 1PG3A 3C16A 1M1KT 1JXVA 2C1EB 3IM8A 2APOA 4LRAA 3EZOA 4NLYA 2J9DE 4OZLA 1HWIA 1RT5B 5K8OA 4JI5F 3AHPA 3G82A 1X4GA 3P3DA 5F41A 3MEDA 5B08A 3T1YJ 3VNQA 3P5BP 3IPLA 2EFPA 1IKVA 2MLZA 3OQ2A 2B43A 3EVOA 3HF5A 4PHTA 2KN4A 4FYWB 4J9MA 3BYPA 3SSQA 1Q81T 1QVFR 1HWUA 1RAAB 1FD8A 2YWHA 2V8GA 3MM5B 1U0HA 3TA2A 3LO3A 5B7WA 4USHA 3N28A 4EK2A 4ZHRA 4O23A 3TANA 4PYAA 5JMNA 2AKWB 2B51A 3EWGA 3AD7C 1KHVA 1LWEA 1NPPA 2MPUA 1FKPA 1AFJA 1ZPWX 1TKXB 1PO6A 3ZZOA 4CM2A 1KN6A 3CO9A 2QA4G 3NY0A 5HAOA 1HIYA 1NB7A 5LMUF 3F73A 4KC5A 3P4UB 1JLGA 5LT5A 1URRA 1CULA 1MLAA 3PACA 2ZH5A 1VQ6S 2YWWA 3KDNA 5B0CA 4MIWA 3GCXP 1YJVA 4ERDA 1P7LA 1N88A 2PD1A 1YJNS 1S1TA 2VHGA 2A10A 2OHDA 2Y0SD 3PTWA 4QWAA 3CCTA 3PX6A 4PXBA 4JI7J 2WZ1A 2PN6A 3N4WA 1PG5B 3KKFA 2ATLA 1Q16B 2RNEA 3LALA 2R8GA 2LQ8A 2DNNA 2C3PA 5HVGA 4X4RA 3IC1A 3HHLB 3I0SB 3M05A 5GVQA 2AJ2A 3IG1B 4WFXA 3KLIA 3M9NB 3MR5A 2ZVSA 1HR0J 3DOMA 1RTHB 1SQEA 2ZE2A 2Y9HA 3WC2A 4X4TA 1FRIA 2D3ZA 3MCOA 3M8QA 4TN2A 3SCLE 3TQIA 4FNIA 3NS5A 3N5FA 4OI2A 3CCWA 2HQGA 1HPZA 4OMFG 1NKEA 2EC0A 3T1HC 3G82B 3RBXA 1M5VC 1HQUA 3CVKA 4K7QA 3VAIA 4WWSA 1N36F 4BC9A 3BH6B 4DR6J 1PYTA 3V6KA 3I55S 4JI6F 3D67A 4QIGA 4LF5C 1RCOB 1Q1KA 3Q0AA 1T02A 1YQHA 4YB5A 3CJSA 4NL5A 1OMSA 2O66A 4DV3F 3Q89A 4LRCA 3HHEA 1WJ9A 4X2BA 4P7TA 1GK8A 1PJ6A 3OHBA 4RVOA 2BKOA 4HT7A 4DFJA 1O92A 2CJKA 5A1GA 2EWHA 1JMTA 2MLXA 3O8WA 4OQJA 3EPIA 1H0HB 3VF0B 3IXQA 3HO1A 4EZ9A 1CULB 2KU7A 5RUBA 1FRJA 2XY7A 4MKVA 1OSCA 1RYSA 1U6ZA 2HWTA 2ROPA 4DF8A 3J7ZT 2CJQA 3I4HX 3K8WA 2VPZB 4QWBA 3CCSS 1BQXA 3IWNC 1M1GA 1L3SA 1LQ9A 4RR5A 2YQ1A 3JTPA 4CYUB 1YJRA 2MQLA 2J6TA 3DDKA 1E6VA 4X4SA 2W8KA 1O9TA 2IC3B 1TMJA 3LAMA 2XI2A 5BUQA 3IGVA 3PYDA 2DHAA 3PRVA 3ENVA 4DXLA 5LMNF 5KYVA 3EX7B 4H4KA 1D8ZA 3AOBA 1KQFB 4CLFA 4RNMA 1W7WA 2XTJP 2ZBCA 4P52A 4BS2A 3PYGA 3DDNA 4B9LA 5C42A 4USIA 3IMQJ 2O5DA 3TZZA 1MD9A 2J7WA 5IV3A 3M8QB 2M5OA 3LP2A 4DV4F 4QR0A 1LW2B 2OSRA 4B3MJ 2HHQA 2A6MA 4DSKA 2DB1A 2YQ0A 2I8EA 4N8NA 1WCJA 4NYZA 3VGUA 5CXTA 4TU8A 4DCJB 1S0MA 1X5TA 1H74A 2ZH6A 4YS2A 3BB5A 1UFLA 9ATCB 4DV6F 1VRTA 2W4DA 3W8GA 1QDUB 4HHHA 1B99A 4O3OA 2ZH1A 3UD4P 4ECQA 4FYYB 1R3NA 2OBVA 4M5GA 4DPUA 1Q82T 3AODA 4C8YA 1S76D 2KVIA 2WOMB 1FCAA 3MF5A 4OZ5A 4JUZA 1D8YA 2IM0A 3KUGA 2W7AA 1X4HA 3DI6A 1Q86T 1YG0A 2BRKA 3KG4A 1NKCA 1SI9A 1FRXA 2QA4S 2EBEA 3W3SA 4Y28C 3TZWA 1ZBTA 1NK8A 1X9MA 3C6UA 1IBLC 1QSSA 4ED0A 2WBRA 2GW8A 1C4AA 4P2MA 1VISA 3N01A 3R97A 4CTAA 2DR5A 2BVZA 4U7UD 1A9NB 3K0JA 1S57A 1CS4B 2WBMA 4DR3C 4ES1A 2XO7A 2KG0A 1V5IB 2R7XA 3ZTPA 4I9GA 4C3LA 1VQNS 2IJFA 5F9LA 4LBPA 5DM6Q 1E6YB 3NI2A 4I2QA 3R2CJ 4YQWA 1KFSA 1CJTB 2D3UA 2P5VA 2Y1RI 2AX0A 4R0JA 4Y65A 4CM0A 5CAAA 1VBZA 4IRDA 4HPVA 1I3OB 4P75A 2GMLA 4F3QA 3A12A 1VC5A 4HT5A 5DDRC 3OJUA 2UUCJ 1M5PC 2D1RA 4XIUA 2PA8D 1HMVB 1S10A 5KFFA 3D1OA 4DL0C 1JK9B 1CJVA 2X1GA 3NOCA 4C11B 4P2XA 5DDPC 1BY9A 1W25A 5BR8J 3H40A 1A0OB 4B3SJ 1FUGA 2P2QA 1TV6B 4UOFA 1HI1A 1JNRB 1BLUA 2HQCA 4NEYA 4WU3A 3RYLA 2P8IA 3ENAA 1R8PA 1B0PA 1HH2P 2YCBA 4Y34A 2LQJA 2IDLA 4U8YA 2HFNA 2AF6A 2CPEA 5F8MA 5KG3A 1T5DX 1SC6A 2IY5B 1S1WB 1S6PA 2HVEA 1H72C 2AU0A 5M2PA 4G3IA 1SL2A 4UOCA 2W8LA 2AYBA 3Q2SC 3HCXA 3IEVA 1QD1A 1X4EA 4TLRA 3FMBA 1I1GA 5KFAA 3V6DA 2N3LA 3AD8C 3QO9A 3EDRB 2M5YA 2OFHX 3M6UA 3MFIA 4DV0F 1URNA 4C0BA 2XCPA 5KG2A 5E3CA 5G4DA 3KHRA 5DG7A 4NLUA 3F41A 1OQ3A 3FCHA 4CLUA 1RT4A 1NK0A 3LWLA 1Q5VA 1SC3B 2XG8A 3MTJA 5BSRA 2ZOGA 4RJVA 2BZ2A 4K59A 4RW4B 2BANB 1DTQA 3TR5A 1N5YA 1ZZFA 4USWA 3H25A 4M95A 5ETVA 1RYRA 2NUHA 4NLTA 4TLQA 3TVKA 4OHXA 2M9KA 3MEGA 1EB0A 4RBTA 5EUHA 2DNMA 2AZ1A 3OL6A 1UP1A 3CQ3A 4JV5C 1U2FA 4KIAA 2MKCA 2D1TA 4PZPA 4NCGB 3N54B 2OP5A 2GQ2A 1PSDA 2IIHA 3A3NB 3SIPB 1QUVA 4OI1A 2HPUA 2ASBA 1D9FA 4DQSA 2R8JA 4DX8H 5IV4A 4RNHA 3C2PA 1VLYA 3KJQB 5HVHA 3WIVA 4DL6A 2GCFA 3BDPA 1RG9A 1NK9A 2QVXX 2XSFA 2YNHB 5C24A 2NXEA 4ELVA 1RJJA 1Q5YA 4C97A 4KB7A 4J9RA 2H5IB 1VLAA 2NSCA 1RU1A 2FZKB 3FDSA 1X4DA 3KUHA 1VLOA 3OT9A 4FF4A 2MM9A 2YVSA 2FJDB 1AMUA 3W2WA 1HWKA 3CJKA 4E98A 8RUCA 4B9TA 1I94C 3HVRA 2YWGA 2DO4A 1IM6A 4OZJA 1T03B 3K2YA 5J1PA 3C8YA 4LR9A 3GFYA 3ZTQA 2VD3A 2HBYB 1XR5A 4IH6A 3GFXA 1DY3A 1S79A 3MAAA 4ECWA 4GKJC 3MPDA 2DGTA 1ZETA 1RP5A 1F9HA 2QVZX 4DFPA 1YBUA 4WFZA 1GMWD 4QZVB 1K1QA 3BEGB 2BDPA 4OYBA 2HHUA 3GSDA 4X62J 1XRAA 2D28C 2VFVA 4F26A 2DNOA 3VAKA 3TZXA 1S1TB 4L6V3 2WP0C 2QN6B 2RF2A 1HNXC 4HHUA 4R0EA 4ZP9A 1UWDA 2FHJA 5BSMA 4YB7A 2L9DA 1UFWA 2CJAA 2GGPB 4L75A 3CJRA 3CMQA 4I69A 4QOTA 4ETXA 5J1NA 4XO0A 2QFIA 2OUGA 2FLOA 2CQCA 4IG0A 5D0RA 3UN3A 3NYRA 4ZPVR 3W1YC 2KJVA 3RV2A 5HMYA 1X0PA 2HNDA 2VODA 4FNHA 4JBCA 3J7YU 4RW6B 1S1VA 2WD9A 3BDEA 3ZXWA 2XS2A 1WSRA 2P2CB 5BSVA 2WVEA 2KFYA 3PX0A 2DHMA 4F4KA 2OAUA 3CQ2A 1IKWA 1D09B 4YDXA 3HMJG 4U96A 1SV5B 1TKXA 1SJ1A 3VAFA 1JLCA 2FC9A 2LQBA 2CNOB 2FJWA 2DRAA 2UXCC 4AUKA 3MM8A 4QWCA 4DFMA 2AJ4A 2ACMA 5E3RA 4CO1A 3RRGA 2ZM6C 1NU4A 5CD4A 3PR5B 5J2QA 5EHHA 3SYZA 1KC8T 5THWA 4K4TA 1Q95G 2Z30B 2E5LF 2WB4A 3IBWA 3BN4A 2HBRB 3C14B 2LXUA 4K4ZA 2XWYA 5LOQA 5DGAA 3AD9C 2ILYA 1PU1A 1WACA 2C42A 2ZITA 2VQFF 1WC1A 3LANA 3W62A 3J7AN 2RAQA 1XS3A 3NPDA 1JLFA 4ZMMA 2HZCA 2QYGA 2W2PP 3LAKA 4ILMA 2D1QA 5D78A 4NPOA 1CBKA 4JI8F 3HSGA 2Y0BB 4KV8A 3EM1A 3ZTOA 3C46A 1C1CB 4EBCA 2UXBF 4MTNA 4N47A 5DETA 2FTRA 3G6XA 4Q8EA 1EZZB 1RABB 2Z2ZA 2V4QA 2V8HA 4EBEA 4GKJJ 1TL1A 2YKAA 3IMLA 4XK8C 3UEBA 1XNRJ 1S0OA 1WOPA 4EYHB 3DLEA 4R1LA 5D4LA 4NXNC 2RIJA 3W9JA 1S72S 1SQFA 2E7WA 4IQMA 1VYAA 4ECTA 3RG2A 2W7OA 2J8SA 2UUCF 3L9ZA 1LKZA 1QTMA 4UQTA 3WC0A 2BUNA 3UOWA 2HFUA 2VU5A 3VCDA 4LVNP 3UDCA 2CVIA 3NS7B 2MB0B 1T11A 2EFVA 4R1MA 2R2TA 1FDAA 4DV2C 1KLMB 3SDEA 1RWXB 1DJ0A 1XNRF 2CU6A 2E1MC 2HYIB 3W8PA 4DR1C 1OQ6A 2CKWA 5H9FK 3PCOB 1RAIB 2N4CA 5HANA 3GWCA 4F4XA 1KSPA 4HACB 3E01A 2NXUA 4OLOA 4YB6A 1F6TA 2G0JA 4RWXA 3I4PA 4KFBA 4ZJLA 3UNYA 2CQ1A 2RU3A 1VC0A 5JJBA 2DPIA 3A3OB 1C1BB 1DAXA 1IBLJ 4ZVQB 1VMBA 4CNYA 4LFAJ 1T03A 2FB0A 1U0HB 3MM8B 1FWPA 4NMLA 2VDIA 5K5MA 4K4VA 1H7WA 1X60A 1LK7A 2FJEB 1Q7LB 2LP4A 5T8SA 1X0FA 3HJVA 3MAAB 4LSZB 5C25A 3W61A 2OMOA 3ZZYA 4J90A 5I42B 3CE8A 1W2IA 4C8OA 4L7IA 2V0NA 3QSIA 3R7BB 4KKOA 4RZRA 2V4JB 1U8SA 2V9KA 3Q22A 2RDJA 1R43A 2L9WA 3VZHA 3J7Z5 5F8JA 3QZ8A 3B6BA 1NDKA 4DV5C 2RMLA 1SC1B 3E7WA 3BM7A 2BJ1A 4MTPA 2HGMA 3G9CA 2IRUA 4NXMC 2VPWB 4URGA 2BBEA 2KI2A 1U45A 1NSKL 1SUQB 2VDHA 4M5IA 3NGSA 4F3OA 4QU6A 5KFKA 2XMMA 1SJRA 2IVMA 4HLBA 2YX4A 2FVCA 2BJEA 2RQ4A 4G65A 5E0OA 3SQGA 3W2VA 4N5SA 1VQMS 2C22A 1PIEA 1U49A 1V60A 3H42A 4OI0A 2PMHA 2N3OA 2HNDB 4PRFA 4X62C 4LF4F 2I9SA 2W9BB 3OR2B 2I1RA 3MZIA 3D3BJ 2IRXA 1HBUB 3H5XA 1Y4ZB 2B0GA 5JUMA 2HFSA 3D3CJ 2F1FA 1E6YA 4LQ9A 3TP2A 1GEHA 1VQYA 2J9CA 3N0VA 2MCQA 4LUBA 1TL3A 5KFBA 2OPLB 4F4ZA 2D3OR 3HVAA 2B8QA 1YJ9S 5IFMA 4DLGA 3PKMA 3MXHP 4JI4C 1XMOC 4K4XA 4KHPF 3JSBA 4IZ6A 2DNZA 4OX9C 1X4BA 4DV1J 4HACA 1IKXB 1TVRB 1U6FA 2RD5C 3AB2B 1KFDA 2EFNA 4QBUA 5CZXA 2R7RA 2CZ9A 1HNVB 5D15A 4C8LA 1R8AA 2JFKA 3AF6A 2E1RA 3HFKA 4XTTA 5CABA 4I7FB 1HA1A 2R7WA 4M63A 5CYQB 4P74A 2Y8WA 2P6TA 1VCTA 3DHXA 1A7GE 3MEKA 4IYQA 4P6QA 4ZJQA 3MFHA 3H5SA 3DFEA 2DCUB 5B09A 5GAEU 2IPOB 1LQLA 4F0KA 2M3DA 4DUZJ 3P96A 3HD1A 4QYZJ 3A9UA 1SL0A 3BGUA 1UAWA 3WBZA 1RBLA 5F8LA 3POTA 5EN1A 3L3CA 4ZVEA 2ZKUA 1U2CA 4D3GA 5JVGQ 1ULRA 2ZKTA 2HAFA 3AJ2A 1TAUA 4DCUA 1HWJA 3QIDA 1F9FA 3MPVA 3S1TA 5DJBA 3E7XA 3K5OA 1VIOA 3UDLA 4GC7A 4A8WA 1GQEA 1HNIB 1KQGB 2JWNA 3B8HA 3QJJA 2W2QP 3M2VA 4JI3C 1RT7B 2V8PA 2MZ1A 5F9NA 4KPYA 2IM3A 3W2VB 1S1XA 3TJ9A 4JB8B 2EC2A 3RR8A 1X4CA 4KHMA 5HO4A 4UQGA 3S01A 4ZLPA 1D0EA 3J81D 2SXLA 4WP8A 2MZSA 5L39A 2WAQD 4Y2CA 3THTA 1F9EB 4RWWA 2BR0A 5C42B 1DZ5A 1YSJA 4PWUA 1S99A 4ILLA 3O1LA 4KFBB 5BURA 3HHKA 5JXSA 3UDEA 1P27B 3M32B 4RW8B 3MPUB 3GJSB 3UCGA 4DSEA 1LW2A 4M94A 4DV7F 4NA2A 4MKYA 2FC8A 3I5CA 3PHTA 3QAEA 4USJC 3NLCA 2JSXA 1RB0A 3CDBA 1G4CA 1QJHA 3IR7B 4QW9A 3FNNA 4NEZA 2MMAB 2HVHA 3NCPA 3RB3A 2OPQB 3JAMU 3K58A 2D27A 3TQ1A 3DOKB 4WJBA 5FLXU 3ETMA 4B9VA 2HFVA 2GVZB 4RUAA 5D3GA 4B3RC 2ZZMA 4LRBA 1XMQC 2KO1A 5F0WA 3KMSA 3NAIA 4LT6A 4O3QA 1N0VC 5L8RC 3Q8PB 4LRFA 3THVA 1BC6A 5HQLA 4X4NA 5DQGA 5LMUJ 3CGIA 2CQPA 3DXBA 1L3VA 4Q2LA 2B5JA 4U8VA 1SUQA 1ZAVA 2LMIA 3DRXA 4C3KA 3T1HJ 2OPSA 1N5SA 3R5BA 4I64A 3FSXA 1RTDA 2NZ4A 5DZ6A 2WVFA 2OSQA 1LOUA 1ZPVA 2UUAJ 1DTQB 3CCUS 3R3TA 1GPMA 3RAXA 5AXNA 1OWXA 5C2GA 4MK7A 3CO0P 1HPZB 2H54B 3MEEA 4PUIA 4X66C 3V2UC 1RWNB 5D4PA 2XMVA 4WPAA 2JX2A 3UWTA 3W5XA 2C28A 3MM6B 1IKYB 1N6QA 4WE1A 1U02A 3KHGA 3U27A 3WDOA 2B8PA 3QSYB 3PJWA 3CCVS 4LFBC 3OLAA 3FKBA 2VPYB 5C25B 2UUBF 3GG1A 3ZZUA 3EYZA 2XQCA 2ZH8A 4C7QA 3QRPA 3VHQA 3M30A 2CQ4A 3BSAA 1U25A 1BQMA 4KRWA 4QPXA 1VQ5S 3GONA 4ER8A 2XO6A 1LWFA 2MSTA 3M9MB 3I08A 3GIIA 3R9LA 4USMA 1HNXF 2JNVA 3T1YC 5H9EJ 3TUFA 1Q8IA 1GT8A 3QNWB 2E8EA 2OD6A 2QMUB 3HULA 4XDDA 5LXYA 1QM9A 3EVMA 3FBEA 5K20B 2CYYA 1M5KC 1NDPA 4RW6A 2RQMA 4AD6A 4I6YA 2JRSA 4DEZA 2HLUA 2E9RX 1VBYA 1VHIA 1XN9A 1T9UA 3IFEA 2HHWA 1MMLA 3KK2B 1NJWA 2YNFB 1ZTWA 2HGNA 4DQIA 3R2DJ 4X4PA 1KVKA 2FYXA 2HZAA 3I5AA 5A76A 3ZTSA 3HSDA 2UVUA 1K0RA 4XDCA 2AGPA 1Y5IB 5F8HA 2VOPA 1HBOB 2GAHC 2XZWA 1HQUB 2OJ3A 3C15B 2B5JB 3NCRA 4O0NA 4ZITA 4GS5A 4O3SA 1IR2A 4FZVA 3JTOA 3VAJA 4IDKA 4MIAA 3SXLA 2ADBA 1VBXA 4IUFA 2HQIA 2DEJA 2LFVA 4LFCJ 4DR6C 1GTEA 5DLFA 1F60B 2C2MB 4N41A 4YY3F 3JAMY 2GHWA 2DNGA 2UV8G 3FQLA 4G1QB 2YKMA 3TVYA 2YH1A 2EKYA 3RGIA 4ED4A 2R8IA 1FK9A 2ASJA 1NO8A 2GO9A 4KYZA 5CYQA 4K4YA 5ETKA 5G0RA 2MXYA 3KFWX 1Q8BA 1P8GA 5EDWA 4ED1A 1OYEA 2W2OP 1S7IA 3R7NB 3S7RA 3HFVA 4W90B 4DG9A 4U7CA 2DHSA 2H4WB 4PABA 1NK5A 4L74A 4I2PA 3M2RB 1CVJA 3R5AA 3OFGA 4NLOA 2JEJA 1PG4A 5A8RA 1SV5A 3Q23A 1X9WA 1FXLA 3H5YA 1YRTA 3B4MA 2OPPA 3TO8A 5D6GA 2DEIA 4IH7A 2C2DA 5IT9U 2F7VA 2OO4A 4F7VA 3IAS9 4PWDA 1TQLA 1R8BA 2J9EA 4YR3A 1IWAA 4ALZA 2B9YA 4F3MA 3MHYA 2HIYA 4CI0B 4DCOB 1FDBA 3NAHA 1WDTA 3MR6A 1YHQS 2HWHA 2PFDA 3FFIA 2B4VA 5I3UB 2ZJPQ 2DHHA 4NXMJ 2B3TB 1FKOA 5KFDA 1VQ8S 2W01A 1ZM3A 1RAOA 1S6QA 3HVWA 4MFBB 4P7VA 5CHCB 2NPFA 5EX0A 2NZCA 4ZPBA 5HVFA 4NX9A 3LP2B 4DG8A 3VALA 2FHKA 1EKRA 3AJ1A 1WHVA 3PRDA 1W2BR 1B0VA 4N76A 4USUA 1U1RA 2YWKA 3NNAA 3I31A 5KT4A 4LF5J 4X65J 1NZAA 1RDRA 2COLA 2ZOMA 3O44A 1TR0A 2A0FB 4IFVA 5AXLA 4I68A 4C0HA 1T05A 4IRKA 3LNVA 2UU9J 3NG8A 2P02A 1P6TA 3A25A 3AOAA 2MZQA 3HZEA 3Q86A 3CUNA 2FVRA 4YR2A 5J2NA 4B08A 4X65C 2F9JA 1FA0A 3J80U 2DYAA 3HX9A 2KT2A 1H2UX 1VDHA 2DH9A 3D0HE 3LTOA 4M5DB 4OZ0A 3UI3A 4DU7A 1WHWA 3D0IE 2VIHA 4WP3A 2IA6A 3RTVA 3DAYA 3SDEB 4ETZA 4RBUA 3ULHA 4IOBA 3PO5A 5K8NA 1TK8A 1HQ2A 4DR2C 2KXHA 4M5KA 5BYQA 2GIQA 1X5SA 5C24B 2UXDC 2QZ8A 3CJ8A 5GAEI 3KNAA 1ZA1B 4WFYA 5AXKA 4CO2A 2DNLA 3FQKA 5DDOC 1FF2A 5EWFA 3EXCX 4KY3A 3G96A 2DGUA 4J9OA 1HHQA 2Y8YA 1REVB 3KWMA 2JOQA 3M8PA 4J9VA 3NGKA 4MH8A 4ZOSA 3TUZC 4KQZA 4LF7F 3AFGA 2UUBC 2YBVA 3N6LA 5DDQC 4WFNQ 2P20A 1ZA2B 2YNIB 1PJ5A 4JP8A 4RNOA 3GILA 4HI2A 5KG7A 4OHVA 4FF3A 4UT4A 1JLEA 1KOOA 2XMTA 4N56A 4FS1A 2KRRA 3PW5A 2ACYA 3CD0A 3FFIB 3K89A 2BM0A 4ID5A 4PR6A 3K5LA 1WEYA 2FHMA 4G1IA 1L3KA 3JYTB 1RLDA 2B6AB 2XS7A 2UUWA 2D41A 3W63A 2UUAF 1NY8A 2RQCA 3JAMD 1S1UB 4DQQA 2BE7D 4H4KC 1OPZA 3O6QA 2DR9A 3BJYA 3G6VA 3M30B 3QJPA 1U4BA 5IT9Y 4ITSA 4RW4A 3QJLA 3DMJB 4ED3A 3CXCR 1R0CB 4FUTA 1GX5A 4U95A 4OYWA 3L95X 4C2MA 4K4WA 2B4PA 2OLWA 4RVNA 2H5EA 3TZYA 1HQEA 5MLCV 2BE2A 5A2QY 1RHMB 3P49B 3HJFA 2KTQA 4FBTA 4YOEA 4Y0FA 4KTQA 1WUUA 1BHNA 1WTBA 1GMWA 4DG1B 1ACMB 1MW7A 5AJ3J 4LF8J 2QL7B 2YPZA 3MWBA 3DM2B 4RPFA 2WVCA 3T5KA 2X3DA 2VZ9A 2HRUA 4KGKA 1DRZA 1HYSA 4ZJZA 3E51A 3Q8QB 4CLSA 1EHWA 4NRTA 2C2RA 4BHQA 4N7TA 2NXCA 1N5TA 2EEYA 2JH3A 2UXCJ 1W26A 3JSYA 3J7YI 5T8TA 3S82A 4DV6C 4LF8C 3VWSA 5KFQA 1RXOB 1UWBA 2YXLA 5ETNA 1RT6B 2L08A 4LJMA 2HK2A 4OX7A 3I56S 4B3MC 4QWEA 3M8PB 2DGQA 3LOUA 2M7SA 5ETLA 3KLEA 2C2OB 5IQQA 1NJYA 3BQ1A 1RHKB 2MY8A 4DV0J 2CWXA 4RLEA 4BWMA 2CQGA 3BS9A 3D0GE 3DCAA 1JJHA 4A8YA 2M52A 3WX8A 3PX4A 4B3TJ 3NL0A 4Q0BA 1VBKA 4HTIA 2QG9B 1RHQB 3LF0A 2BA9A 4KSEB 3IA0A 1P9QC 4JYAJ 2ZVIA 2XSJB 2ONFA 3MEGB 3D6TB 5A8WB 3OFFA 1Q4RA 2W25A 4ZJOA 4CT8A 2VZEA 3OTOC 5HROA 2OIHA 4B3RF 2N4DA 3R9XA 2GO8A 2H1YA 5KG6A 1FJCA 5BUSA 4J9LA 1VIXA 1M1HA 3EGNA 1TL7B 4CLYA 2JFDA 3V81A 1JWWA 5J2NB 1ELOA 3ETCA 5BR8C 2GS8A 4IFYB 1SH2A 3MM7B 3KOAA 4WS9A 2OKQA 3HXMA 3OVBA 1FNXH 5E7QA 4UF4A 3L09A 1MN9A 2M8DB 2GFFA 2XM3A 4PKDB 2P9CA 3BR8A 4DPXA 4F04B 4B3OB 3IBFB 3E2EA 4FVCA 3DGPB 2QLJB 2B56A 2ZH2A 5EWEA 1Q79A 3VVTA 3A13A 3G8TA 1TUVA 4MJKA 4RM2A 2XS5A 3PM9A 4NA1A 5I3QA 4DV1F 5K8FA 1NCLA 1ITPA 2H4YB 4OFZA 3BQ0A 3FCCA 1TP7A 1X9SA 2FLNA 3DLGB 1VQSA 1WC0A 2J0XA 3KUEA 2PDAA 4NWBA 3OPKA 2PA3A 3Q8RB 2ZHBA 4F4WA 1FRMA 5DO2A 4YUDA 1O6XA 4AXJA 4J9KA 1MSWD 4FPIA 1AFIA 4WU2A 3O2IA 4C98A 5IWAJ 1OPIA 4PUOB 5A2QD 3DRYA 3PJ9A 4X66F 4B9UA 2OPQA 2ADCA 3A9VA 1CQMA 4HH0A 1UW4A 2F4VF 3CB4A 3GZ7A 2A3JA 4ZP7A 3OW2R 4LF6J 5D8HB 2VSQA 2MMYA 3CJTA 4KR0B 2D1CA 2V4JA 3A3PB 3F56A 3HSJA 3ITHB 2HKEA 4FTFA 3D54A 1UKUA 2DISA 4LFAC 4R25A 4GVBB 4KV8B 4JV5J 2BW7A 2AEFA 3LUSA 4O44B 8ATCB 1SKRA 5A8WA 5DV9A 2VICA 2AJ0A 1FRHA 3NGDA 4PPZA 2OEMA 4WTOB 2ATWA 4I56A 3MMCB 3V81B 4WZQA 1VJWA 3UVJB 3AT1B 3IG1A 3W64A 2DPJA 1KHWA 3OR2A 2Y1LB 2QO3A 4A8FA 4L76A 4OHYA 4IG3B 5IWAF 1HR0C 3CJ0A 4GO7X 4WE1B 2CQ3A 1Q8KA 2QYCA 4ZS6A 4LSNA 2M0GB 3JSMB 3CCES 2G13A 2BRLA 4X64F 4CLKA 2FUG9 2ALZA 1L5UA 1JJ2R 1TL3B 3GV5B 3HLUA 4QJVA 1K0VA 2OPLA 4EEYA 2OPRB 1VQPS 2PGCA 4WK3A 1I6JA 2A2CA 3FEYB 2Y3YA 3G2XA 2KG1A 3OSPA 2DNHA 2VA2A 3KLHB 2GX8A 2UZAA 3OFEA 4DR5C 1XNQC 3ISNC 4QYZK 1KWMA 4M5MA 3VQTA 1LXNA 2B9WA 3FUYA 4GC6A 1EX8A 2FGCA 2B9XA 3BPSP 3FZBA 3OTCA 5IC6B 3CCQS 1KRPA 1XBWA 3FMWA 3RB0A 1M5HA 2RVJA 3TX0A 1FE0A 3QPIA 1DTTB 1TMMA 6FD1A 1O0PA 1ZYQA 2KFZA 1WF3A 4DCPB 2HNZA 4JI1J 4L2ZA 2Q43A 5HJYA 2XLIA 2ASLA 4ODJA 4USKA 1HBNA 1I94F 4DQPA 2RH3A 3FBBA 3H2LA 1WG5A 1YK9A 3GV7B 1UVLA 4O0IA 2KXFA 4F8RA 3DOLA 1QAIA 4DFKA 2IAJB 1NEEA 2MKYA 2QLBB 1U09A 4EU0A 4CH1A 2XB2D 1NSAA 2MKSA 2NSBA 1PBUA 4JV0A 3U1LA 2JEIA 2NS1B 2K06A 3A4TA 1PYOB 1UJ4A 3G8SA 4JYAC 3QWUA 1JIHA 3TAQA 3VTIA 3JQJA 2VONA 1RWWB 2HWIA 3P45B 1ICEB 4TYBA 4DSJA 2YKMB 3IP0A 3R5CA 3KXWA 3V4MA 1FHTA 4TY8B 2EG2A 4ED2A 4EO8A 4NRUA 3R5JB 3KHLA 2CQ2A 4O3RA 3K8VA 1FRLA 1C4CA 1ZZNA 4PG5A 2AD9A 3JSMA 2CPHA 4CT9A 2NR0A 3UZ0A 2M70A 2EFGA 3D28A 1GXUA 1IBKJ 1IBKF 4ECSA 2VOOA 3PESA 4FYVB 4QIVA 2DGWA 2FZCB 2K7JA 1NDLA 2HVDA 2DGSA 2ZWOA 4MAKA 4EFAC 3SZ2A 3EMTA 1JKHA 4XX2A 3O5TB 3ENWA 4I67A 3FRYA 1PYSB 2XHWA 1P1LA 1LNQA 5KFMA 1WF0A 2D9PA 2DRDA 2VUGA 4M5DA 1U26A 2DXEA 3H98A 2CJBA 4DR7C 1C2PA 1ZAWA 2AIRB 3T6JA 4I1TA 9RUBA 5HQMA 2HQ3A 3Q83A 1U1LA 4ZK7M 1U8WA 2YX7A 1RTZA 1KLNA 4F2RA 4FF1A 1N32F 4LF9C 1HWLA 1YLXA 1U24A 2PFFB 1N33C 1YBAA 2CNKB 3CULA 1HBNB 4KTVA 1WC4A 2FJXA 4DUZF 5M2RA 4DR2F 4MIBA 1EJ7L 4DSLA 4JI1C 1LW0B 3CT9A 2VQFC 4RW7A 1HNZC 4Q8FA 3CJ4A 3AA9A 3ZNUA 1O8BA 4ISBA 1H38A 5C7PA 4DWIA 4ZVHA 3DLGA 4H4MA 1WD6A 2OFGX 4X84A 4U7UK 2YKQA 5GADU 1SJ3P 4JI8C 3M6XA 1S1XB 2PO4A 2DGOA 2YNHA 1IKYA 3EUNA 1IWGA 3GLJA 3Q8YA 3ZZPA 4CO0A 5HN0A 1RTIA 2B6AA 3GIJA 2W9CB 1VRTB 2A6OA 3B4DA 5AE3A 4W92B 5BYSA 2PT7G 5LJ3Y 2ZD1B 4K0KF 4IDKB 4B9NA 3IS9A 1ZM2A 5KT6A 5ETQA 5J2PA 2G2OA 3C5EA 2B7CB 2R7TA 2UUCC 1XRBA 1ZM4A 4HDGA 4GKKF 1MG7A 1NM2A 1JLBA 2OGUA 2RS8A 3ILJA 1HI0P 1MXBA 1G2EA 5U47A 5E2QA 1MWYA 2DPLA 1PC4A 3ZZTA 2ZNYA 3TAPA 4I6WA 3QGGA 4DV2F 3HDSA 1T8EA 1XNRC 2VPXB 1HNZJ 3M8ZA 3CC7S 3O3LA 3D6MB 3UD5A 4CZCA 4X64J 2M88A 1AW0A 4ECXA 3UNGC 2YH0A 5B0EA 3TEGA 3DLBA 3PROC 2VG5A 5IQ6A 2GVZA 5D3GB 2L9NA 4DUYJ 1FWLA 1NHVA 3OBIA 4URSA 5A8KB 3BQ2A 3NMRA 4S0MA 2AJFE 3AB4B 2Z2MA 1TUGB 1WI6A 5HBMA 3DRPA 1RT1B 3MECB 3MR7A 4PG7A 2V2QA 4OYOA 4Q2MA 4RW9A 3DLLQ 2JNJA 4F4YA 2BACA 3DOLB 4BLGA 4NDNA 2DIUA 1CQNA 5DM7Q 1WTFA 3PFOA 4Z37A 1YJUA 1R0AA 2DR8A 2R4FA 3QO9B 2J6UA 4KAIA 4OJHA 4ELTA 1LCIA 4KGXB 3HHDA 1H3DA 4A48A 2FZGB 1ROFA 3AXKA 3CJ5A 2RHQB 1HMVA 2VKZG 1TFYA 4RLQA 4B3MF 5GMEA 1HLWA 2WW8A 3TEHB 4DLEA 1UVKA 2IVFB 2MGZA 2WK4A 4ZLJA 2AMCB 3DRRB 2BJ8A 1X31C 2ZH7A 1TV6A 2GMHA 1S9EA 5L1LA 1NJIT 4FYDA 1YJ7A 2I6WA 1NDCA 2BOPA 3IRXA 1RWKB 3EXYA 3GV8B 2KFNA 2I0XA 3FK4A 1FNOA 4R5PA 5E5NA 5J2PB 2ATCB 2ABYA 3EICA 1F0XA 3T5HA 1U1KA 2DR7A 1JOSA 1F5BA 3JB9k 2F5GA 4ECRA 4WZMA 3QRRA 2VH7A 1S9GB 4CWBA 2V69A 2CQIA 3HHLD 1BA3A 1Y0HA 1TKTB 2JVRA 1JLQA 2QSFA 4P73A 3UN2A 3UCUP 3LGXA 2AYGA 4OX9F 1Q53A 1K47A 4NASA 3T19A 3ADAC 1DLOA 3CCMS 5HLFA 3D7SB 4ZIVA 2ILZA 4KGVB 1D1UA 3OL7A 4GKJF 2KDNA 3QMQA 1CJUA 2XR1A 2J0WA 2RSQA 3D5MA 2QW0X 5A8KA 1IKVB 3IBCB 3H2VE 1NK7A 3L8CA 2IJRA 2W4CA 1RT1A 3FBCA 4JOUA 5DGBA 1EP4B 1FXDA 1YRXA 3OR1A 4GRSA 4M5HA 1HHSA 4OJGA 1SB6A 1RKJA 1JXLA 1QM4A 1ZB8A 4DV1C 3FRZA 4C8NA 4NYOA 3QRQA 3D9BA 4C3MA 4AQYC 3BKFA 3DLKB 2J5AA 2E8CA 4ZPCA 4HTJA 4W98A 1RUSA 1UCNA 2X1BA 2ZOFA 5E3QA 2FHOB 2ZFHA 4YN3B 5GAGU 2QC3A 5GAHI 2E44A 4B3TF 2W2MP 4I0WA 1NK4A 3ET6A 3NWGA 3OL9A 1C0TA 3DGVA 1SPBP 1QAJA 3I07A 5C2CA 1JLFB 2U2FA 1UL3A 2Q66A 4O4GA 1TTHB 3OTEA 3WQPA 4DUYF 3H7HB 2QLFB 2CAJA 3OUYA 4ED5A 1EGAA 1NPRA 5KFEA 2MEWA 1C1CA 4FPRA 5FJ4A 1Y3JA 5T41A 5E41A 2UXCF 1X8DA 1BQNA 3M2RA 1FJGC 3SQOP 2G1DA 2CPJA 2F8MA 2HJGA 3RG6A 4D4GA 4R0MA 4ZCLA 4Q44A 5LCIA 2AGOA 2D9OA 3DN9A 4PG6A 3H2UB 3CJKB 1P9YA 2G0CA 3FGVA 1WG4A 2CZVC 2YTCA 3ICLA 3L4BC 3QGHA 3MR3A 1S9GA 1D9AA 2K3IA 3A8KA 3HHLC 1CJKB 3H90A 3NGUA 4ZVGA 1KTQA 3SSSA 2GHVC 1HW9A 1EQ0A 3ZO7A 5KFZA 1VQ7S 5A1IA 1OY8A 1XK8A 3AH6A 1RADB 4DSFA 5ETRA 4B9SA 2E7XA 1DLOB 4A8SA 1G1XA 1N33J 4PXEA 2LVWA 1WC6A 1FE4A 1WEZA 4OV6A 4CNZA 4J9NA 5F8NA 3R7SB 2Q6BA 1N4LA 4A8MP 4X64C 5CA5A 1BWVA 2PC6A 4OZ3A 1U6BA 3ITHA 1JXEA 2QA2A 4FDFA 2VG7A 4PG4A 5ETTA 2W9BA 4AL7A 1BMQB 4UOHA 2POKA 5F0UA 1UVIA 4K4UA 4NE9C 2RKIB 4K4SA 1JQGA 2LA6A 1Q78A 3GPCA 4PXDA 3OV7A 1GX6A 2CQBA 1MU2A 4DN9A 4Q5VA 1X5PA 3M8WA 4LE5A 1U7LA 5LJ5Y 1T9YA 2CG4A 2IA0A 3W5ZA 4MT1A 2VQEJ 1PBAA 5KG1A 2D3O1 1SBRA 3RRKA 4ED6A 1UMJA 4DPTA 3PV8A 2V6AA 4DSIA 3HT0A 2KYXA 3BYRA 4Q7AA 5AE2A 2FVPA 1IUJA 2LA4A 1YZ6A 1NLKL 1IR0A 1VFJA 3PJXA 4QPTA 4IG3A 3F0NA 3MOZA 2OPPB 4P2SA 3W66A 5LSLA 1VS3A 3GIKA 4DR1F 1ZH5A 1ULTA 2F3JA 1ZB9A 4Q45A 4RUCA 2N82B 2ZE2B 3BREA 4J9QA 4IO9Q 4ID8A 4ECYA 2R9LA 1IJEB 4DR7J 2AX1A 3GTYX 4RW9B 1MXCA 1QUPA 2OPRA 2HW3A 3A26A 3M8RA 3UDVA 4JI7C 3BO3A 3A4IA 3CW8X 1S49A 4X4VA 1K44A 1TL4A 4OI4A 1S9FA 4KGMA 2IBOA 2XHCA 1N0UA 2YNGB 4CP5A 2ZZTA 2IRYA 4DBQA 4DV3J 1HNWJ 5KYTA 3MMJA 1S6UA 3KLIB 2BW2A 4TPSB 1UJ5A 3MM5A 5LSOA 1WHYA 1ML8A 5HMZA 1UZDA 3VGTA 7FD1A 2ZHAA 1N48A 4LF5F 3W7BA 4D3HA 1UEVA 3E01B 1GTHA 3NNHA 2R7QA 3CIMA 5SZTA 4DZ6A 2FLLA 1T9VA 3KK3B 4DV3C 1C1BA 4OJ1A 3RZAA 4F0HA 2UU9F 1RSCA 4Q0BB 1R7IA 4JI6C 3BBCA 3Q8UA 5IS2A 5KOXA 1T05B 1HNWF 1RACB 1T5HX 4XPCA 1KQSR 1VQ4S 4NXMF 3JQMA 3UX3A 2LDYA 1TELA 4Y2MA 3N6NA 3OTDA 2DGVA 1TL1B 5HMXA 3PIOQ 1TFWA 2P2MA 1YWXA 4RBVA 1S7HA 5DG8A 3HKWA 3OSNA 2EW9A 3FBFA 4HVZA 4ANEA 3KJVB 2BX6A 2YPYA 3D6HB 1C0UA 5KFYA 2VQEF 1MROB 3MM9B 1PAUB 2OEJA 1MU2B 2UUTA 1ZOTA 3AJDA 4F36A 1XIQA 2CUYA 2KVQE 4NMXA 3LP0B 2JZ5A 2V63A 3HM9A 2KZ0A 5FD1A 3RJMB 3FJ2A 1T95A 2HVIA 4DL3A 1KNZA 4KO0B 3VQSA 1FTCA 3PW2A 2NXNA 3M6VA 4A4JA 1XMBA 3P8BB 5T7LA 1VQOS 4JI4J 5LSRA 2XEXA 1WKLA 2FY8A 3PW7A 4UUXA 4ZVPB 3SV3A 1N33F 1DQ8A 3MMCA 4B3SF 2NLWA 2QT7A 3BZQA 1QAXA 2HQDA 2LCWA 3GB0A 5D4NA 3TA1A 3EZ5A 1PAEX 1E6VB 5IC4B 3IR5B 5KFSA 1PA4A 4V19X 3M9OB 1RT3B 2OI2A 2DNYA 2GAGC 3JS9A 3EE3A 4LR8A 4RMNA 2HHHF 3ONQA 4C6AA 2BEFA 1PGZA 4NXNJ 2HRTA 2DRBA 1R27B 2OPSB 2EG1A 3LGHA 1QE1B 4NLGA 2KRBA 1HHTP 3BGRB 1N5QA 5DQIA 2XYGB 5BSTA 2GA7A 1VHFA 4LBHA 3J81U 3G87A 2IMWP 2HSEB 4G1PA 4K0KC 3P5TL 2W24A 1NH8A 1YX2A 4O4GB 3TYTA 4LF4J 4DI6A 1M5SA 3ENQA 5D0HA 4ZCMA 3DHWC 1B7FA 3KDOA 2MHNA 1BWEA 6FDRA 2FGOA 2ZC4A 3A8JA 1PKUA 1IBCB 3QFHA 3LNOA 2MZJA 1FERA 4JI3F 1B7YB 2H9ZA 3KHHA 4RU9A 3DRSB 5K14B 3H2TA 3CCRS 3VNRA 4F4AA 5EWGA 4AL5A 4IFYA 3VVUA 5K8MA 3D2WA 4LF2A 2ZC3A 3UVJA 4CDIA 1L2FA 4LIRA 1NAQA 2C2EA 1A6LA 3A1YG 4DU8A 1TKDA 1QVGR 3D66A 3QBCA 1FJGF 4C8KA 3MDFA 1U1OA 4LF6F 2XLJA 1SQGA 1FXRA 1IBLF 3H4BA 3CC4S 4OZ1A 3KJNB 5GAHU 1RT5A 2XYHB 4Z7YA 2YWBA 3DYAB 2AGQA 2MQ8A 3LUYA 5DRKA 3MEDB 3V6DB 1S0NA 2YX1A 2AW0A 2OMLA 3OJSA 5FLXY 4GO5X 4OV1A 4AYBD 3MEEB 1OO0B 1SXLA 3DDIA 1HBMA 2P6SA 4CO4A 1Z4UA 1KEKA 1IBMF 1XTZA 3BBBA 1UW9A 3QT8A 3KLVA 3DRRA 3VAGA 2RUSA 1N6QB 2ERRA 2WSEC 4GVLA 3CMES 4PUOA 4I4BA 1HBOA 1WSVA 3IO1A 4LBIA 1XMQF 2BJ7A 5KFRA 1U0SA 1KOHA 2E5HA 2E5IA 4FYXB 4TY9A 2CPIA 1SIZA 2UV8A 5I3PA 4RNNA 3C6TA 1BUXA 5CYMA 1R6YA 2HIQA 3KXDA 1JLGB 1H2TZ 3SBMA 4LF7C 3JSRA 1XNQJ 5KT5A 1J5EJ 1DQ9A 3SCIE 1GFWB 1RAGB 4DR2J 2UP1A 4DR4F 2ROEA 3RBZA 3GIMA 2R8KA 5B0FA 8AT1B 1NJZA 3J7A1 4C11A 3SI8A 5HQ8A 4B3RJ 2MYFA 1I5OB 3G4SS 1ZTTA 1N34F 3BSCA 2HHXA 1RE1B 4ICLB 3U1MA 3KMQA 2A1BA 4IQXA 4GXQA 3DGPA 4FXDA 2FD2A 4DMZA 3M8YA 1IXKA 4WCEQ 2UUAC 3VGVA 3IWLA 2DGXA 4F67A 2UXBJ 2YNGA 2HZVA 1EAYC 2ZM6J 1OYDA 4NLVA 2DKOB 4DV0C 2QFJA 4LQ3A 1FFSB 1RT4B 1L3UA 2WB1D 3T6BA 2DXFA 3PVXA 3X3UA 2HHHJ 4I2QB 1KVIA 3EPGA 4U5YD 3GR1A 2AV5A 1TU0B 4LRDA 2ZBQA 1GH8A 4OJ3A 2C3OA 3T41A 2EVZA 2G2ZA 3K57A 2E7GA 3QAUA 2X1FA 4EATA 5IFIA 3MMAA 3CDAA 3PZPA 1VGYA 1TK5A 3G7SA 4OXIA 3I32A 3D1QA 1YRUA 2Z0GA 1JNZB 3NBPB 2M8HA 2B4UA 3U1NA 1T3OA 4HHJA 1YDLA 3BSOA 2CQDA 1RBAA 2ZUAA 2DYJA 3OUYB 4LF8F 5KOWA 2V68A 1X4FA 2HRYA 4OI6A 3UD3P 4MH4A 4CLZA 3MD3A 4IG0B 2LEBA 4KJIA 1VRQC 4DV2J 3R1LA 4AXIA 2ZBIA 4NI2A 2GQCA 3X1LB 1KKHA 2CPFA 3OR1B 5HP1B 4DR1J 2HMIB 5BSWA 3OXGA 3CPWR 2CPDA 4PWDB 2FIUA 5FLXD 2BXJA 2VBXA 2G1HA 3CSKA 4JI0J 4L4QA 2IVYA 4WFBQ 4ELUA 1J27A 3SFUA 1J5OB 5KT3A 1FJEB 3PDNA 5KG4A 3D4JA 3BPDA 5D0EA 2XMUA 3UO0A 3OTOF 3NYQA 1T94A 3RBDA 1K9MT 2HQFA 1RAEB 2LQ5A 1X4AA 3U02A 3DYAA 4CIOA 4LFCC 2WRMA 4PQUB 2V4RA 4NLXA 4JI0F 5KFPA 2C2ZB 5GADI 1UVMA 2NXJA 3ISZA 3JQKA 1V5VA 3FEZA 3PFEA 5CCMA 1QWIA 4WK1A 3FSYA 3GP9A 3QT5A 4G1QA 4USTA 5JVHQ 2H5JB 3QGIA 4NOZA 2CQHA 5I42A 1Y10A 1Q7YT 1B3TA 1T7PA 1AYEA 5HK4A 3W65A 1JLEB 3HKZD 2BKPA 4E8UA 1Z1ZA 2DD8S 4MMOA 2JLEA 1JKHB 1JLAA 4HDHA 4DX7A 3T1AA 1CC8A 1RHUB 3B82A 1VK8A 2H65B 1S1VB 3RU0A 3C6TB 5CYMB 3TJAA 2R7VA 2Z57B 2YNFA 4KH1B 1KDNA 2Z4PA 2E8FA 1IKWB 1SCJB 1NBEB 2GGPA 1AUDA 3DI6B 3DKDA 1VEHA 4KGZB 2QE5A 4E0DA 4WKYA 4FXWA 2MLYA 2R42A 2MTLA 2F4VC 1UTAA 2VG7B 4DN0A 2DK2A 1R0BG 3C66A 2KDOA 1REVA 1VRUB 5J2QB 3CJEA 1LW0A 4DPOA 1YIJS 2IJNA 4TY8A 3CCJS 2RKIA 3NMAA 1KD1T 1K0TA 4DCSA 1F2GA 4YR0A 3IR6B 3PYEA 4X4OA 4ZLNA 2E5LC 2IMOA 4H4MB 4LFAF 1MXAA 1RU2A 2F4VJ 4JI5C 1R31A 1UPMB 3ISND 3N5BA 3PEJA 4RW8A 1KR4A 1YVFA 5DZ7A 5KFXA 2ZM6F 4JI7F 2KM8B 3RB6A 4FP9A 4EMDA 4YHHF 4PXCA 5BSUA 2XY6A 1X7VA 4TQSA 3ZC4A 2KM8C 2PIIA 2ZZNA 3TDEA 3BF4A 4IFVB 1WH9A 3IRXB 4WXOA 4A46A 3ILOA 2UU9C 2UXBC 1RGVA 4BCAA 1BXNA 2MKHA 3LWMA 3BO2A 3QT6A 4DX5A 1RY2A 1G7CB 2VG6B 1MROA 2VBZA 3MM9A 4ZVTB 5IOLA 3KJFB 1SKSA 3AQPA 4KH0B 2HGLA 1RTJA 2XMKA 3AXMA 2JVOA 3CEDA 5DQHA 2W4PA 2KZMA 3HD2A 7FDRA 3GIRA 4FXVA 5M2UA 1D9DA 5CD4H 4ZPTR 2R2RA 1O90A 2LU2A 4L73A 3NNCA 3K5MA 1RTDB 3RW6A 4RUBA 4BSZA 3OVAA 3OLBA 3D1HA 3MCNA 3GJQB 1J5EF 2DBBA 3QATA 2BE9B 5IT4A 2RDIA 2DY1A 5KFNA 1XNQF 3HK2A 4RM3A 1IBMJ 2N7YA 3E8OA 1K1SA 4DS4A 4ES3A 4B9MA 5L1JA 4ECZA 2PEBA 2XWXA 4OYZA 1SH3A 2C2KB 3MM7A 3ZNJ1 2DHGA 3L7PA 3K17A 1UA1A 4OYCA 2CDQA 1RT3A 4PWWA 4F0MA 3SEOA 5CYJA 3EJMA 3KG0A 1NJXA 3BV8A 4YHHJ 1WKJA 4EZ6A 1V25A 3UFCX 1IN0A 5KFLA 4P10A 3L7OA 4NA3A 3C14A 3CWJA 3EZUA 3GU0A 2XY5A 1SJFA 3BKTA 1LWXA 2BJ9A 1PC5A 5KFGA 4ZN1A 5KFWA 1FX2A 2EFOA 2R7OA 3T1HF 5K85A 3PKYA 4D57A 2BKNA 5KG5A 2ZH4A 2HHHC 3FC9A 1MMDA 1CSJA 5B0AA 5KFJA 2CIMA 2ZJRQ 3H5UA 1EKSA 2QV6A 1H6KX 3AQOA 3C16B 4OYMA 4PG8A 5H1SV 2XSJA 1J2VA 5LXRA 1M6XC 1DARA 4BC7A 1YTYA 2PROA 1RBOB 2CJ9A 3Q8VA 4NZ7A 2DH7A 1EQMA 3GYNA 3CJQA 3W9IA 4WF9Q 2W2NP 1HNXJ 4DL4A 1HFEL 2A2DA 4TXSA 3VZIA 4J9PA 1I51B 4ZVSB 4H54A 3WIUA 4ZIWA 2QGFB 3PYFA 4NCGA 2PT0A 1RISA 4BWJA 1RTJB 5D0GA 2CADA 1SVDA 2J7KA 2J7UA 2MQMA 3NXZA 3R1HA 3TUPA 1Y00A 2GHPA 2QEXS 4OYIA 3CF5Q 4ED7A 3J81j 4NLRA 4PCQA 1HNZF 4IRCA 1HNIA 4QW8A 3I0RB 1LXJA 4J91A 4DV6J 4X62F 1NUEA 1GMUA 3CDEA 3K5PA 2D7VA 2HNYB 2KJWA 3M1VB 1IKXA 1TVRA 2KHCA 3G6ES 1WC3A 2CVEA 4ECVA 1NPKA 1EP4A 3RRHA 4CO5A 4PQUA 1HBMB 2JDJA 2LQ9A 1TKZA 2K1RA 3PW0A 4EO6A 4I7FA 5LMNC 3NRBA 2KHDA 4UOGA 4JI4F 4LF9F 1WEXA 2Q3PA 4ZLLA 1U1MA 2X1AA 4ZVUB 2BE2B 1Z2LA 4OLPA 3M32A 5LM7E 1UWAA 4F25A 1BE4A 2LEAA 3E3XA 3PR4A 1U47A 3O2EA 5HL7Q 3GQCA 3UX2A 3RAQA 3I6PA 5LMNJ 1NRKA 2JJ4D 2RJZA 1HD0A 3OTOJ 2LDIA 3IM9A 3MI7X 2ALYB 2LU1A 1KKGA 2VBYA 4ZN3A 1YJTA 1AB8A 2KH9A 2CG8A 4PPDA 1QTNB 2QL5B 2V94A 2Z8QA 5K9FA 3TOQA 2EI5A 4RLFA 1VQKS 1GMVA 4GMKA 4DF4A 3R44A 1NNDA 4RUHA 2MZRA 2E9ZA 5ADZA 2XC9A 1AUSL 2MKKA 1APSA 2E9TA 3EDQB 3DHVA 1FKOB 4O4RA 5H9FJ 4Y2AA 3TR3A 2WONA 1YGYA 3PW4A 3KLEB 1KBRA 1NB2A 3FSIA 2FJVA 5KEIA 3ZZ0A 4D4IA 3TRGA 1N36J 4DR6F 2K8GA 5ITHA 3CQ1A 2IAJA 3QT7A 5T14A 3Q24A 3QFWA 4DR3J 2Q79A 1R6VA 3DLKA 2CDRB 2X7IA 1U2RA 1NH7A 3EVWA 4J37A 1P1TA 4EI2A 4JI6J 2RDDA 3UR0A 3T9ZA 1NHUA 2VASA 2HNYA 2F9DA 2D69A 3M1VA 1YITS 1FX4A 4ZPDA 3VV2B 2MKIA 2RU9A 3OFHA 3G71S 5IM0B 2H3EB 1CG2A 3MUTP 5GTDA 1YZ7A 2J0SD 4NYPA 3QLHB 2QVYX 4DV7C 3BR9A 3W9HA 2GJIA 4DL2A 1HR0F 5ETPA 4B02A 1UETA 2QL8A 2XNRA 4HEA9 2CQ0A 2L3MA 4UW2A 1SC4B 3FCWA 2EBGA 1RWUA 4QIFA 2P2JA 2Z51A 1GXTA 1EARA 4PYDA 1FLOA 3KK1B 2AJQA 1V3SA 1VOMA 4E2FB 2GV1A 3T9NA 3TW0A 1N8RT 4RNFA 1EIYB 2FY1A 1S1WA 3DRSA 5K14A 4WP9A 3FZ2A 4IKAA 3DLEB 3M2UA 1OY6A 5E7OB 4DOZA 1RI7A 2D74B 2HURA 1RT7A 2IFXA 2GIFA 4J7CA 4FN5A 2GJFA 1KQKA 4Q43A 1JJCB 1SKWA 3K59A 4TU7A 1M0SA 1FRKA 2M4MA 3TAMA 3KLFB 5FDLB 4DR4J 1MDBA 4KHRA 4NCAA 3R6GB 4LMZA 2N7CA 3IAM9 4URQU 2ZBRA 1DFDA 2DJWA 2CXEA 3I96A 2R2UA 1S59A 3THPA 2CPYA 3GMGA 2CZ4A 4EBDA 4RW7B 1PJ7A 1SKUB 1XMQJ 3R8YA 1YKWA 4JI5J 3DU5A 2GVDB 4LFCF 1TKZB 2K1RB 4K50A 5CCLA 3BBFA 1AXQA 3MM6A 1V3RA 5EGYA 2NREA 3DC2A 5G0RB 4DG1A 1S77D 2UVWA 1OJ4A 2CJYB 2C3MA 3NEKA 3T1YF 4BDPA 4AT1B 1SJQA 2XI3A 3HZGA 4ECUA 2B7BB 2G2YA 2VFRA 3KG1A 2HG4A 4A47A 1VC6A 3KJVA 2J76E 1LEOA 2NYHA 3H20A 4AL6A 2BMBA 2LXFA 4KT0C 3CD6S 3LW5C 1J5OA 3LQVA 3LP0A 2W9AA 2LECA 1XRCA 4F02A 1JLBB 2E1PA 2VKRA 5BXIA 4AQYF 1UFKA 1DQAA 2F8HA 4KO0A 2VA3A 4X4UA 4JV5F 1T9TA 2B9EA 1CEZA 5HSPA 2WCXA 4GXRA 1V9OA 1S12A 1QAYA 1IBKC 1FO1A 4X4QA 4MYUA 2DNPA 5HI7A 2XMWA 4OYPA 2GNKA 5L9XA 1IR1A 1WOOA 3KK3A 4AFFA 1USPA 3TJ8A 3BKUA 1UZHA 1XQIA 2E29A 2AJ1A 2BANA 4LSLB 4LVOP 5GMDA 1OSDA 5KG0A 4EUVA 1VQLS 3ILLA 1FDDA 4ZVOB 1QY7A 1RWVB 4ES2A 2HNZB 3ETOA 3OXLA 3BGRA 3SSRA 4DV4J 4CLPA 1G3OA 2HBQB 1Y11A 2F40A 1BQMB 2RF2B 2YKOA 1OIAA 4TNOA 2GC8A 1FEEA 5A8RB 1WF1A 2AEMA 2L48A 4OX6A 4OYXA 4M1KA 5ETSA 5AE1A 2VC1A 3GG0A 3T5JA 2KT3A 4HL9A 1SJ4P 1FK9B 2F8EX 2HBZB 2H51B 4OZ2A 4L3NA 2V2KA 4PAAA 5E3AA 4DS5A 5K8PA 1XMOF 4DV4C 4NZ0A 2QJ3A 3TX8A 2LXIA 3CW9A 1MKYA 1S9EB 1VRUA 2Z56B 3R27A 4JI2F 1U1NA 4IH5A 2E5LJ 2DR6A 4HH1A 5A6WA 2XMAA 3S6EA 4JI8J 1RWMB 2DITA 2DT9A 4FBUA 3B7WA 1L3TA 2MDAA 2D7SA 2WONB 3H0PA 2YY3A 3LGMA 3QGPA 2WVBA 3CMAS 2HHTA 2AT1B 4MK8A 2MJNA 3N9UC 5HATA 1WKKA 4QIEA 5BJRA 3V5RA 2ZDOA 2OELA 3NWRA 5B0BA 2YWCA 4C0OC 4Z2XA 1AZSB 3TQEA 5I3UA 2IHR1 4U9RA 2MQPA 1F1BB 1TL5A 1RK8A 4R8UA 5KFHA 3MURP 1RKIA 3HVTA 1F3FA 5J1EB 3MMBA 1FKPB 4M5JA 1MNEA 4NLSA 4JV2A 4MK9A 1BD6A 2GQQA 4DQRA 2BM1A 2V8DA 3TVZA 4EYIB 1XR7A 3CCZA 3NCQA 3FCEA 3ZFVA 2ZUGA 2CPZA 2DNQA 3DLHA 1K8AT 4ZPAA 5AT1B 1AA1B 1VK3A 5L1KA 4DR3F 4DZDA 4HR2A 1LWCA 1P4EA 3GPAA 5JRHA 3TA0A 2GVDA 1WI8A 2BABA 5EX3A 1XR6A 3U7JA 4WFAQ 5H9EK 2RUGA 3IWXA 4YEAA 1DHMA 3MCSA 5J2MA 4R5PB 3VAHA 4HKQA 5HJXA 1XC9A 2IYIA 4P72A 4PQAA 5KTQA 3RB4A 2UXDF 2MQQA 3MOJB 3W2WB 2MQNA 1S97A 2U1AA 3MTKA 2DO0A 2ZBPA 2ZHOA 4P9SA 2VB6A 4Y6IA 4A8XA 4PEOA 4F50A 4RU2A 1NSPA 1QLNA 3GKUA 2WW4A 4XAKA 3R6LB 1BGXT 4CH7A 2MJUA 1RA7A 3RBEA 1WNEA 1LK5A 4ATNA 4YFUA 2BV3A 2V50A 2KYZA 4DHVA 1JB0C 4UY8T 1HNWC 1JLCB 1S6OA 2QRRA 1N2FA 5FDLA 3DLJA 1NXIA 3G86A 3M6WA 4ZCKA 4ID5B 3SQGB 3WZ0A 2IDEA 4MYTA 2OH2A 1Z2ZA 2RRBA 4MFBA 4PZVA 2JL9A 3CJ3A 5F8IA 1RA6A 4Y2IA 5DG9A 1FVSA 2F4FA 2YKNA 3Q8SB 2NYIA 4RO0A 4HYKA 3KTQA 4K0KJ 1IVZA 4ZPWR 3JXOA 4OYAA 4ZHRB 5L38A 3CC2S 4J5OA 4LF9J 5IT9D 1GNKA 3MPWA 2DVIA 3B78A 1LWEB 2FDNA 3MR2A 1NZ8A 4NLQA 5KAKA 4IOCQ 4KHPJ 2BJOA 2E0GA 4KTTA 2K7KA 4K5SA 1FKAF 3PHEA 1HQEB 2R3VA 1WF2A 3A8IA 5A6PA 5LL6d 1N32J 3I5BA 2D1SA 4UY85 2YWEA 2FQQB 3KYLA 2QLWA 2ASDA 2JEGA 4QQBA 1QSYA 3M8SA 4WIIA 4NLWA 2W7PA 1HNVA 4JM1A 5HROB 3HHNB 1TUWA 3QIPA 3GR0A 4DUTA 3DMJA 2VFUA 4JV1A 1LWCB 4G36A 3Q2TC 4C8MA 3GYGA 1F2HA 2CA9A 2X51A 2VV5A 1RT2B 5DLGA 1H98A 1BQNB 1UEUA 1DBDA 1UPPA 2MY7A 4J9SA 1N5VA 2NCLA 4TVAB 1UWBB 3I0SA 3IN5A 1KLMA 4RX6A 2HFOA 4DV7J 4IOAQ 5HP1A 2HMIA 3POTB 4DCTA 2CRLA 2DHXA 2JEFA 1HBUA 4CLTA 4DV5F 2PN2A 2HHPA 3LP1A 4CH0S 3FCVA 4YB1P 2BQ3A 4QYRA 1TH5A 2HEKA 4ZA1A 2XGPA 2RQKA 4B17A 2KB2A 2V2VA 2QA1A 4O3PA 2MKJA 3M2VB 2HHSA 3JYTA 1AZSA 2IYGA 3W60A 2QMXA 5L1IA 1RLCL 3GSIA 3V6HA 4CO3A 4ZCIA 3PRBA 1SL1A 4EWTA 4DUYC 4ED8A 3N79A 1FT8A 3MMAB 6AT1B 2VL1A 3T5LA 2QMWA 4KKOB 3NBPA 2VG6A 3PIPQ 3ILIA 1Y5LB 1R8HA 1RAHB 1H2VZ 3BGLA 1FWKA 1WC5A 2HS0A 2NCKL 3PG9A 3UQSA 3KLGB 1U1PA 5D4OA 3EERA 2KT5A 3TUIC 4KBIA 4DL5A 2E1CA 2FLPA 4OX9J 1O5JA 5I4MA 1IJFB 3V4IB 3HHLA 3S8SA 4NCBA 4B3OA 3D68A 5HLFB 4G37A 2ZNZA 2GMJA 4DJBA 1HARA 3SO4A 3DOMB 1F3VA 1RWPB 3DXSX 1CJUB 5B0DA 5BR8F 3BN7A 3C6UB 2BJ3A 1FFWB 2CNLB 2OEKA 4TU9A 1TL7A 2HVZA 4FKXA 4LFBJ 2MSSA 1KP6A 3OTBA 4CTAB 5HMWA 5KFCA 3EQ6A 3MD1A 1IBMC 4CQ1A 2Q6CA 1MN7A 4Y2KA 1CS4A 2XGQA 2JC1A 2LKZA 4LR7A 4NZ6A 2Z2YB 1XMOJ 5L9NA 3MGJA 2WSCC 2JLGA 2XYPB 3CW2C 1WHXA 4Y00A 1MWZA 2J9DA 2K2PA 2YKPA 3CCLS 2ZD1A 1NKBA 3HPOA 3FVYA 3LH2S 1CLFA 1EETB 3I0RA 4YMEA 4W4MA 2PI4A 3GE9A 3LP1B 3G8QA 4WBFA 2YWFA 2EKNA 1NMEB 4ANCA 2AWZA 2LYVA 3GFZA 1RZMA 3DU6A 3H4DA 1M90T 4P2FA 5DS7A 3RAMA 2P9GA 1RAFB 5KT2A 3T3FA 1N34C 2P2BA 3SCJE 3C3LA 3MPYA 4YP3A 3KK1A 4O44A 2LLZA 1LV5A 5B0GA 2CJXB 1F5CA 2CY1A 5H9UA 2R8HA 4M8LA 2R7UA 1MDFA 2MHEA 4WYWA 4A8QA 2AQ4A 2HHVA 1FJ7A 4U67Q 4K0BA 1SH0A 4C9DA 4AQYJ 3MUMP 4V1Ak 1Y3KA 2O3DA 4D56A 1CJKA 1K73T 3GYXB 1S6PB 1QSLA 3TWZA 2G0IA 2V2ZA 2J8AA 3V4IA 4I9FA 1HI8A 2V5HG 1WOSA 2RRNA 4CLLA 1KS2A 5IWAC 3H8YA 1LFWA 2J0QD 5T7LB 2XBPA 1FEHA 1PCAA 2VC0A 3RW7A 4ENOA 2BQUA 3CTRA 1R89A 5E33A 4FF2A 4GKKJ 4FKYA 4N77A 1HL6A 3NKYA 5CH7B 5D77A 1KONA 2DIVA 2IM1A 2YKNB 2F63A 3KLHA 2PE8A 4Y3CA 4NLDA 1S0VA 4OIXA 4NXNF 4X66J 4OL8A 1HD1A 5A19A 3DLPX 2AP6A 3I82A 4DR5F 4LSNB 1S4EA 5LMUC 4RL1A 5KFTA 2RS2A 3VNSA 2VQEC 3QWPA 2PI5A 1IM4A 3HFZB 2QL9B 3AF5A 3UCZP 1N5YB 2UVRA 4ZVRB 3J80D 3TUJC 1EETA 1FTRA 1Q0NA 1QE1A 2CNNB 1IQTA 4PUHA 3K5NA 4IR9A 4PUGA 5KFUA 4OHWA 5GAGI 3H59A 1H73A 2AZ3A 4I6AA 2WSFC 3GFHA 2O67A 3SMZA 3IRWP 2C3YA 5AXMA 4L72B 3MUVP 4DCVA 1LWFB 1VI7A 2L41A 1OS5A 3QIPB 2ROGA 4Z7CA 1Q8LA 3I87A 3N6MA 2XLKA 1Y7PA 4ILRA 1JLQB 1YBTA 3NP5A 4LIWA 5IM0A 4LFBF 4B3SC 2I38A 3HI9A 3KLGA 3M4XA 3P6YC 1RT2A 1DTTA 1H7XA 2E66A 2FJAB 3MAHA 4NOHA 2VJUA 1JX4A 3LPYA 4NLPA 2I2YA 3NOGA 4FVMA 4JI0C 4KPCA 2X3GA 3BH7B 2OTLS 2EGTA 4DPWA 4L3KA 1X5OA 4JI2C 2XZTB 2HS4A 1HW8A 4TKTA 3UE2A 3CDWA 3J81Y 1RTHA 4FUQA 4LSLA 1N36C 3ELHA 2EPIA 4DL7A 1XWLA 3PNIA 3C15A 3M2UB 4JYAF 4WV3A 3MMBB 3PY8A 2IM2A 1UVNA 5IT0A 2HAIA 3SFGA 3PXGa 4DPYA 5ETMA 3VAMA 2O01C 3NGRA 3TAMB 2VJVA 5KFVA 3KNGA 3IEUA 2F65A 2V7BA 2XZDB 3EGZA 1RT6A 1C0TB 2GIRA 3L7UA 4UZCA 2V34A 1AROP 3LA0A 4K8RA 3DOKA 4WIQA 1CJVB 2RILA 3AA8A 3IS9B 3UPFA 1T9WA 1C0UB 1WORA 4LF1A 3HT3A 4LF4C 1ZS6A 2ZH3A 1UJ6A 2CPXA 4TQRA 2EFQA 2ZWPA 1Y5NB 3GJTB 4DR7F 3R9WA 1RAJA 3AAWB 2QLXA 3F44A 4QR1A 3EGVA 5FIIA 4A8OA 4LF6C 3BGOP 3W5YA 1TK0A 4YY3C 1B0TA 4WKRA 1CPZA 1P4EC 2I5JB 2AEJA 2Y27A 4KHPC 1N32C 3M7VA 2AYMA 2EXUA 5AJ3F 4UUWA 3C19A 2Q1LA 2KL8A 3K7RA 1FDNA 4H4OB 4AE5A 1I94J 2J6SA 1IB8A 2RT3A 4DX6A 4DUZC 2E1AA 4JI1F 5F3TA 4CYUA 4YHHC 3HP6A 1FI4A 3DNCA 3DRPB 3MECA 3NS6A 1RHRB 4ICLA 3ZZZA 3AY0A 4U6PA 3US5A 1XEZA 2A18A 1VJQA 1Y9OA 2PEHA 4P71A 1IQZA 1RWOB 3JTNA 4ZP8A 2UVVA 3VR1A 1S6QB 5SUHA 5ETOA 2CWKA 4NI2B 7AT1B 1U48A 2R7SA 2BH1X 2NQPA 2FHJD 3K6RA 1D3WA
chains in the Genus database with same CATH topology
3CDUA 5IZHA 4OI3A 1YJWS 1TFWA 2YNIA 1G6BA 2ZDPA 1KTVA 3CD5A 5CZVA 5C5JA 3QZ7A 4DR4C 3RR7A 2RB7A 1RTIB 2W9CA 1NYEA 4QU7A 1J5EC 4WTYA 2RRAA 1NK6A 1KVJA 2DNRA 2OTJS 2CFXA 1V3ZA 4ZP6A 4HI1A 2ZH9A 1N52B 4I2PB 2Y1JA 4GKKC 3KK2A 2FVQA 4OZNA 4QIWD 2K3KA 3QLHA 2XMJA 3QYYA 4QCLA 4G6VB 3TARA 1UA0A 2KKHA 3A8EA 4TYAA 4YDDB 3MAQA 2GJ2A 1JJ4A 4DDFA 4O3NA 3OVSA 3TNVA 2M2BA 2Y4NA 4RKUC 3BO4A 2FJBB 3CIZA 2KXNB 1R0AB 4X65F 2WTFA 1V6HA 2VG5B 2VBWA 1FD2A 4OX8A 4WYLA 3J80Y 1S4FA 1FVQA 2V8VA 2ASYA 3CD7A 1FESA 2FPHX 1V26A 1RQ0A 3N2QA 3KLFA 3G6YA 1WG1A 4IR7A 3BSNA 5IXUA 1LFPA 5MAOA 5KT7A 2QSWA 2XCAA 4A8KA 5A0YB 1ZM9A 2XULA 2Z2LA 4ZVFA 5KFIA 3SV4A 5F8JA 4R8UB 2V9WA 1R8CA 3I9ZA 1S1UA 1TAQA 2KZZA 3PBKA 1XERA 4N8OA 4F2SA 5GMKa 2NUUG 2P9EA 2JC0A 1M5OC 2JMPA 5BYRA 4EGLA 2DCLA 3FEXB 3OHAA 2JLFA 3WX4A 2RE1A 4C8ZA 2DH8A 2WHOA 1PILA 5KFOA 1FNMA 1JLAB 3V6JA 1U1QA 2BJDA 5CQGA 2FVSA 2VFSA 4ZKAA 4MKAA 4XPEA 2DTJA 3DM2A 1UKKA 4K5RA 2CXCA 3LAXA 3EGWB 3LGNA 4PROC 1ZAXA 2UUBC 2QIFA 2I5JA 5HBMB 5F3ZA 5F8GA 1WELA 3CJ2A 1WWHA 2MZTA 3OXFA 1VQ9S 2IBKA 2KZFA 3PO4A 1GXLA 2BYCA 2IC3A 2VFTA 1TKTA 2HFZA 1UVJA 4K2XA 3IGNA 3UW1A 3HVTB 5J1EA 2Y4OA 2AYEA 2MQOA 2G9OA 1MMNA 2HS3A 1TZ0A 2XNQA 1YI2S 2HLTA 3BGFA 2NPIA 3UR3C 2Y1IA 2AYAA 2EK6A 2YQ3A 3R5DA 4QR2A 2MGZB 1USPB 4QWDA 2EK1A 2LEPA 2PMZD 4OHZA 3I9V9 4V19J 1S48A 2OD4A 5A0YA 2C3UA 1O93A 4B3TC 1F5AA 2ZJQQ 2E5GA 3PEHA 2PSZA 4KE5A 4ZDNA 2JHEA 4WXWA 1GAOA 2P2FA 3ZZRA 5J2MB 5E3PA 1DURA 1N56A 3OL8A 2WOMA 4FS2A 1B64A 2DNKA 1CC7A 2R2SA 2G4BA 1SIWB 2B4OA 4H4OA 3SCKE 3TI0A 4BBYA 2BQRA 1HYSB 4IR1A 4IO1A 2O1PA 1N54B 2E5JA 4MKBA 1T3NA 1PG3A 1O51A 1M1KT 4NLYA 2APOA 2J9DE 4OZLA 1HWIA 1RT5B 5K8OA 4JI5F 3AHPA 1X4GA 3P3DA 5F41A 3MEDA 5B08A 4JI7C 3VNQA 3IPLA 2EFPA 1IKVA 3OQ2A 2B43A 3HF5A 4PHTA 2KN4A 4J9MA 3SSQA 1Q81T 1QVFR 1HWUA 1FD8A 2YWHA 2V8GA 3MM5B 3TA2A 3LO3A 5B7WA 4USHA 3N28A 4ZHRA 3TANA 4O23A 2B51A 1AFJA 1KHVA 1LWEA 2MPUA 1KN6A 1FKPA 1ZPWX 1TKXB 1PO6A 3ZZOA 3CO9A 2QA4G 1NB7A 5LMUF 3F73A 4KC5A 1JLGA 5LT5A 1URRA 1VQ6S 3PACA 2ZH5A 5B0CA 4MIWA 4ERDA 1YJVA 1P7LA 1N88A 2PD1A 1YJNS 1S1TA 2A10A 2Y0SD 3PX6A 4QWAA 3CCTA 4PXBA 2PN6A 3N4WA 3KKFA 2ATLA 1Q16B 2RNEA 3LALA 2R8GA 2DNNA 2C3PA 4X4RA 3IC1A 3HHLB 3I0SB 3M05A 5GVQA 4WFXA 3IG1B 3KLIA 3M9NB 3MR5A 2ZVSA 3DOMA 1RTHB 1SQEA 2ZE2A 3WC2A 4X4TA 1FRIA 2D3ZA 4TN2A 3M8QA 3SCLE 3TQIA 4FNIA 3NS5A 3N5FA 4OI2A 3CCWA 1HPZA 4OMFG 1NKEA 4CCHA 1HQUA 3CVKA 3VAIA 1N36F 4BC9A 3V6KA 3I55S 4JI6F 4QIGA 4LF5C 1Q1KA 3Q0AA 1T02A 1YQHA 4YB5A 4NL5A 2O66A 4DV3F 3HHEA 4X2BA 4P7TA 3OHBA 4HT7A 4DFJA 1O92A 2CJKA 5A1GA 2EWHA 1JMTA 3O8WA 4OQJA 3EPIA 1H0HB 3VF0B 3IXQA 3HO1A 4EZ9A 2KU7A 1FRJA 2XY7A 1OSCA 1RYSA 1U6ZA 2HWTA 2ROPA 4DF8A 3J7ZT 2CJQA 3I4HX 3K8WA 2VPZB 4QWBA 3CCSS 1BQXA 3IWNC 1L3SA 1LQ9A 3JTPA 1YJRA 2MQLA 2J6TA 3DDKA 1E6VA 4X4SA 2W8KA 1O9TA 2IC3B 3LAMA 2XI2A 5BUQA 3IGVA 2DHAA 5LMNF 3ENVA 5KYVA 3EX7B 4H4KA 1D8ZA 1KQFB 4RNMA 2ZBCA 4BS2A 3DDNA 4B9LA 5C42A 4USIA 2O5DA 1MD9A 2J7WA 3M8QB 3LP2A 4DV4F 4QR0A 1LW2B 2OSRA 2HHQA 4DSKA 2DB1A 4N8NA 2I8EA 4NYZA 5CXTA 4TU8A 1S0MA 1X5TA 2ZH6A 3BB5A 1UFLA 4DV6F 1VRTA 2W4DA 4O3OA 2ZH1A 3UD4P 4ECQA 1R3NA 2OBVA 1Q82T 1S76D 2KVIA 2WOMB 1FCAA 3MF5A 4OZ5A 4JUZA 1D8YA 2IM0A 2W7AA 1X4HA 3DI6A 1Q86T 1YG0A 2BRKA 3KG4A 1NKCA 1SI9A 1FRXA 2QA4S 2EBEA 3W3SA 4Y28C 1ZBTA 1NK8A 1X9MA 3C6UA 1IBLC 1QSSA 4ED0A 2WBRA 2GW8A 1C4AA 2DR5A 3N01A 4CTAA 3X1LB 1A9NB 2BVZA 3K0JA 4DR3C 2WBMA 4ES1A 2XO7A 2KG0A 2R7XA 4I9GA 4C3LA 1VQNS 2IJFA 5F9LA 5DM6Q 3NI2A 1E6YB 4I2QA 4YQWA 1KFSA 2P5VA 2D3UA 2Y1RI 4R0JA 2AX0A 4Y65A 1VBZA 4IRDA 4HPVA 2GMLA 4F3QA 1VC5A 4HT5A 5DDRC 3OJUA 1M5PC 2D1RA 4XIUA 2PA8D 1HMVB 5KFFA 3D1OA 4DL0C 1JK9B 2X1GA 4C11B 5DDPC 3H40A 1BY9A 1W25A 1FUGA 2P2QA 1TV6B 1HI1A 1JNRB 1BLUA 4WU3A 3RYLA 1R8PA 1B0PA 1HH2P 2YCBA 4Y34A 2LQJA 2HFNA 2AF6A 2CPEA 5F8MA 5KG3A 1T5DX 1SC6A 1S1WB 1S6PA 2AU0A 5M2PA 4G3IA 4UOCA 2W8LA 2AYBA 3Q2SC 3IEVA 1X4EA 4TLRA 3FMBA 1I1GA 5KFAA 3V6DA 2N3LA 3QO9A 3MFIA 3M6UA 2M5YA 2OFHX 4DV0F 1URNA 1AW0A 4C0BA 2XCPA 5KG2A 5E3CA 5G4DA 3KHRA 5DG7A 4NLUA 3F41A 1OQ3A 3FCHA 1RT4A 1NK0A 3LWLA 3MTJA 5BSRA 2XG8A 2ZOGA 2BZ2A 4K59A 4RW4B 2BANB 1DTQA 3TR5A 1N5YA 1ZZFA 3H25A 4M95A 1RYRA 2NUHA 4NLTA 4TLQA 3TVKA 4OHXA 2M9KA 3MEGA 5EUHA 4RBTA 2DNMA 3OL6A 1UP1A 4JV5C 1U2FA 4KIAA 2MKCA 2D1TA 4PZPA 4NCGB 3N54B 2OP5A 2GQ2A 1PSDA 1QUVA 4OI1A 2HPUA 2ASBA 1D9FA 4DQSA 2R8JA 4DX8H 3C2PA 4RNHA 1VLYA 4DL6A 3BDPA 1RG9A 2GCFA 1NK9A 2QVXX 2XSFA 2YNHB 5C24A 4ELVA 1RJJA 4C97A 4J9RA 4KB7A 1VLAA 2NSCA 3FDSA 4FF4A 1X4DA 2YVSA 2FJDB 1AMUA 3W2WA 1HWKA 3CJKA 4E98A 4B9TA 1I94C 3HVRA 2YWGA 2DO4A 4OZJA 1T03B 3K2YA 5J1PA 3C8YA 3GFYA 2VD3A 1XR5A 4IH6A 3GFXA 1S79A 4GKJC 4ECWA 2DGTA 1ZETA 1RP5A 2QVZX 4DFPA 4WFZA 4QZVB 1K1QA 3BEGB 2BDPA 2HHUA 3GSDA 1XRAA 2VFVA 4F26A 2DNOA 3VAKA 1S1TB 4L6V3 2WP0C 2RF2A 1HNXC 4R0EA 4ZP9A 2FHJA 5BSMA 4YB7A 2L9DA 1UFWA 2CJAA 2GGPB 4ETXA 4I69A 4QOTA 5J1NA 4XO0A 4IG0A 2FLOA 2CQCA 3NYRA 4ZPVR 2KJVA 3RV2A 5HMYA 1X0PA 2HNDA 2VODA 4FNHA 4JBCA 3J7YU 4RW6B 1S1VA 2WD9A 3BDEA 2XS2A 5BSVA 2KFYA 3PX0A 3PESA 4F4KA 2OAUA 1IKWA 4YDXA 3HMJG 1SV5B 1TKXA 1SJ1A 3VAFA 2LQBA 1JLCA 2FC9A 2FJWA 2DRAA 2UXCC 4AUKA 3MM8A 4QWCA 4DFMA 2AJ4A 5E3RA 4CO1A 3RRGA 2ZM6C 1NU4A 3PR5B 5J2QA 5EHHA 3SYZA 1KC8T 5THWA 4K4TA 2E5LF 2WB4A 3IBWA 3BN4A 4K4ZA 2LXUA 2XWYA 5DGAA 2ILYA 1WACA 2C42A 2ZITA 2VQFF 3NPDA 3LANA 1JLFA 4ZMMA 2HZCA 3LAKA 4ILMA 2D1QA 5D78A 4NPOA 4JI8F 4KV8A 2UXBF 3C46A 1C1CB 4EBCA 4MTNA 4N47A 5DETA 2FTRA 3G6XA 4Q8EA 2V4QA 4EBEA 2V8HA 3IMLA 1TL1A 2YKAA 4XK8C 4EYHB 4R1LA 3DLEA 4NXNC 5D4LA 2RIJA 1S72S 2E7WA 4IQMA 3RG2A 2W7OA 2UUCF 1LKZA 1QTMA 4UQTA 3WC0A 2BUNA 3UOWA 3VCDA 4LVNP 3UDCA 2CVIA 2MB0B 4R1MA 2EFVA 2R2TA 1FDAA 4DV2C 1KLMB 3SDEA 1XNRF 1DJ0A 2E1MC 2HYIB 4DR1C 1OQ6A 2CKWA 2N4CA 4F4XA 3GWCA 1KSPA 4YB6A 3E01A 2NXUA 4OLOA 4WF9Q 4RWXA 3I4PA 4KFBA 2RU3A 2DPIA 2CQ1A 1VC0A 5JJBA 1C1BB 1DAXA 1VMBA 4CNYA 1T03A 2FB0A 3MM8B 4NMLA 5K5MA 1H7WA 1LK7A 2FJEB 1Q7LB 5T8SA 1X0FA 5C25A 2OMOA 3ZZYA 5I42B 3CE8A 1W2IA 4C8OA 4L7IA 2V0NA 4RZRA 4KKOA 2V4JB 1U8SA 2V9KA 3Q22A 1R43A 2L9WA 3VZHA 3J7Z5 3QZ8A 4DV5C 2RMLA 3BM7A 4MTPA 2HGMA 3G9CA 2IRUA 4NXMC 2VPWB 4URGA 2BBEA 2KI2A