3GR0A

Periplasmic domain of the t3ss inner membrane protein prgh from s.typhimurium (fragment 170-362)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
186
structure length
186
Chain Sequence
LGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
molecule keywords Protein prgH
total genus 69
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gr0A02
3GR0A 4ALZA 3GR1A 4G1IA
chains in the Genus database with same CATH superfamily
2Y9HA 1IBLC 4ELTA 1FVSA 2AYEA 2AX0A 2IRUA 3OQ2A 4J9OA 1R43A 2C2OB 1WSRA 2F8EX 3FFIB 4Z7YA 4A4JA 2ZD1B 3Q8UA 2QLFB 2V8VA 2R7OA 5DLGA 5K14A 3TAPA 5DQIA 1F5CA 4DI6A 4B3TC 3K59A 5A8KA 2ZH7A 1D0EA 4NLXA 4WE1A 2DO0A 2MZQA 1PYOB 2YPZA 5HVFA 3WDOA 1VQ7S 4F8RA 1VFJA 1FTRA 3MCOA 4MKAA 5DDQC 2KG0A 1NM2A 3BKFA 4CLKA 2XLIA 4DCVA 4AT1B 3QIDA 3LAXA 3MMAA 5LCIA 2JFDA 1IM4A 1WCJA 1HR0C 4KT0C 3OLAA 3BO2A 3ENWA 3CGIA 3DFEA 4MAKA 3J80Y 4XO0A 1W2BR 3CJSA 2FLNA 4IO9Q 4CLPA 1BMQB 2XS7A 4CDIA 2YWFA 2CJKA 3I5AA 1OY6A 4ZCLA 3JQJA 1KSPA 4WPAA 4WXOA 4ENOA 2HZVA 1RI7A 5IV3A 4PWUA 5HROA 3JXOA 3P3DA 4RW4A 3GR1A 2P8IA 4RNFA 2ASDA 1S9FA 2F4VJ 4G36A 4DV6C 4ILMA 1TUVA 1SPBP 2CPFA 2HAIA 1IKVB 1YJUA 2B51A 3ITHB 4P2SA 4NCGA 5SZTA 4R5PA 5JVGQ 2IA6A 1B99A 1S0NA 2G0JA 2E1MC 1JJCB 2LYVA 1JLGB 1YRTA 1X31C 1PC4A 4JI6F 3VAJA 3TUFA 2BE7D 2CWXA 2DIVA 3M8YA 1U45A 2DPIA 4OYCA 3BBCA 4M5IA 3IP0A 4PPZA 4PAAA 4DU7A 1K0TA 4XDCA 1E6VA 3K58A 2WVEA 1B0VA 3OR2B 2VDHA 2AV5A 1NB7A 4JUZA 5KFWA 3M2UB 1KOOA 2PGCA 3T3FA 4PWDB 1X5OA 2P9EA 2L3MA 1O6XA 2LECA 1FWPA 3HJFA 3GG0A 2Z4PA 2CNOB 3M32B 2POKA 1RT7A 4OYMA 3RZAA 2IM2A 4CLZA 4DPTA 1HNIA 3NRBA 1SUQA 3A3NB 3IS9B 4P74A 3QJLA 1DQ9A 1YLXA 4H4MB 4Q2MA 1ZM9A 1FDNA 2VQEF 1SIWB 1ULTA 3EGVA 2IHR1 3UN5A 2PN2A 1RT3B 2YNIA 2LEPA 3BBFA 2QIFA 3CDWA 3U1NA 3NGTA 5KG2A 4QWDA 2BRKA 4ZN1A 1DBDA 5LOQA 1NSQA 1IR2A 4O4GA 2NXNA 3Q0AA 5KFGA 5BSMA 4EK2A 1DTQA 1FNOA 3MUVP 4TXSA 1NNDA 1QJHA 2WB1D 3L7UA 2YX7A 4PKDB 5HMZA 2RDJA 1VQMS 3PY8A 4CLLA 4HVZA 4DMZA 3IRXA 4F4AA 4C97A 1DURA 1T02A 1WG1A 3CJ5A 2Z2ZA 4UOFA 3SCJE 3GIKA 4A8YA 4X4QA 3UD4P 3R7SB 1TK5A 2R8KA 3MMBA 2YQ1A 3GQCA 2R7TA 4RO0A 1WC5A 2MZRA 3LH2S 2AU0A 1JXLA 2IAJA 5D0HA 3SFGA 4MYTA 3GWCA 1YBTA 1OWXA 5KOWA 1RT2B 1JJ4A 2Y1LB 4P7TA 2NZ4A 3FSYA 2CYYA 3I08A 4M5DB 2AD9A 1U1MA 2HVHA 4MFBB 1XWLA 2NLWA 2VHGA 2MQQA 1XRCA 2YH0A 2G1DA 2QRRA 4IR1A 4IRKA 2R2RA 1M5PC 2DB1A 2YKOA 3QGGA 3AB4B 2CPJA 4W90B 2DYJA 2EKYA 4Y6IA 2OPSA 2VJUA 1DZ5A 5H9EK 1KLMA 3SXLA 3D6FB 3W65A 4KGMA 2D3O1 1SC6A 1EARA 3PRVA 2DNLA 2XZDB 1R0CB 1ZOTA 2NXUA 3T6BA 3KG4A 3CCQS 2OEJA 3WX8A 4ES3A 5LSOA 3EPGA 5ITHA 1RJJA 2J9DE 2AW0A 2VQEC 2WSEC 2LQ8A 2BBEA 3WC0A 1JK9B 2BMBA 3HD1A 2JX2A 1HNXF 1H73A 8RUCA 3NS6A 1P4EA 3G87A 1T8EA 3RW6A 3R7BB 1RHMB 4DUYF 4OI6A 3OXGA 4W4MA 2IRYA 1MMLA 1RQ0A 4WCEQ 2DRBA 4RR5A 4NI2A 3SV3A 4M8LA 4LFCC 2NSCA 2QC3A 1I5OB 3EDQB 1X9MA 5FLXD 2OPQB 4F0HA 6FD1A 3KK2B 4MIAA 2KO1A 2ALZA 2W2OP 5M2PA 2MQMA 1FRKA 1LK7A 3MAAB 1HARA 3FCVA 1NHKL 4FPIA 4UOCA 3W8PA 3R1HA 3A8IA 4KC5A 5I3UA 1U1RA 2SXLA 1FD8A 2CVEA 1WKKA 3HO1A 1NRKA 2AF6A 2HHPA 4F3MA 5H9EJ 4LFBC 1U8WA 2FZCB 1ZAVA 2HURA 2BVZA 3I5CA 3ZNUA 3QT5A 3NCRA 1Q95G 4JI4C 2ZH3A 4MT1A 2CXEA 1YJ7A 4P73A 2BKPA 2BRLA 4LSLA 4RZRA 3VAIA 4C8LA 4P2XA 5L8RC 3HX9A 3EGZA 2W9BB 3ENQA 1SJ3P 2VSQA 1DLOB 2DNPA 1F6TA 2QTWA 3DCAA 3F44A 4ES1A 2IC3B 2PA8D 2LU2A 4RU2A 1KN6A 3J81D 1JWWA 1Q0NA 4NXNF 3NS5A 1NSKL 4QPTA 1XMOC 3MM5B 3ZO7A 2ZM6C 5BR8J 3PYDA 1R31A 1S1WA 4Y34A 2R3VA 2PT0A 3OXLA 4WTOB 1P27B 2K06A 3R9LA 3MEDB 1U8SA 5IWAC 1MW7A 4LF5C 1PJ6A 1Q8BA 5F8HA 2CZ4A 2MKJA 5I4MA 1SJ4P 2MLXA 3M8WA 1FI4A 1FKOA 2I6WA 2ATWA 2DITA 2H4WB 2NUHA 4G65A 4WTYA 2HLUA 4KFBA 1S9GA 4HHHA 5DZ6A 1NJWA 2UUCF 2OTJS 2WP0C 1KKGA 5DDOC 2OI2A 2OUGA 3C6UB 3AD9C 4JYAJ 4I2QB 4DSIA 5D0GA 2CADA 4G1QA 3NNCA 2L9WA 5D6GA 4A8WA 2QW0X 4HI1A 2HWTA 1P8GA 1RWNB 5I42B 3Q89A 5FLXU 3IN5A 4DFPA 4I1TA 1NAQA 4MH8A 2H1YA 2RRBA 3CUNA 1TK8A 1PCAA 2GAGC 3E51A 3AOBA 1OMSA 2DHSA 5C5JA 2BJEA 5E0OA 3KHHA 1TKZB 2ZH5A 2NREA 4Q8FA 1HH2P 3QNWB 2P2JA 2DPJA 1DY3A 1AXQA 1Q79A 3DRRA 2XEXA 1JMTA 2H9ZA 3OD2A 1RT3A 1BXNA 1F1BB 2L08A 2U2FA 2YNIB 9RUBA 1YIJS 3BSCA 3JAMU 1VLAA 3J80D 1YZ6A 2OD6A 3IMLA 1K9MT 3ISNC 1AT1B 2RMLA 4NI2B 4XAKA 4F4ZA 1XNRJ 4QYZJ 1N2FA 4PUIA 4ZP7A 4BDPA 5BSUA 2NPIA 2HNDB 1QVFR 1VBKA 3BYRA 2DJWA 2RIJA 3Q8RB 4IH7A 2XYHB 3CD5A 4D3GA 3PW2A 4FP9A 4HL9A 5KT5A 4M5JA 4YQWA 1IBKJ 4F2RA 2ZZMA 3KLFB 2HRTA 1C1CB 3OTBA 4H4KA 3NY0A 1RAOA 2FVSA 1QSSA 2VG6B 3BDPA 4NL5A 3L7OA 4OYBA 3NNHA 3POTA 1X5SA 2B9YA 1RT2A 2CJAA 2ZDOA 4DN9A 1S6QB 1RWPB 1JLQB 2HQFA 2XMTA 5G0RA 2GV1A 3HI9A 3VVUA 4ZITA 1KWMA 2X7IA 3NS7B 2K8GA 2BJ3A 4PABA 2ZBRA 2HS3A 2RUSA 1VQSA 4P75A 2MJNA 2KM8B 4UW2A 3EQ6A 2W2MP 1TL1B 5EHHA 3GCWP 4R5PB 4K7QA 5CXTA 5IT9D 3ZZRA 1FE4A 3T9NA 2IPOB 1CS4B 3BGFA 1FESA 1MMDA 3DRYA 4FUQA 3ISZA 1ML8A 2FJDB 1SH0A 2GZOA 1SKSA 4FBUA 4J9RA 1U6ZA 4P71A 1HNWF 2EW9A 3SSSA 4DL7A 3R8YA 1K1SA 4LF2A 2R7VA 3PESA 2Z57B 3PCOB 4ZVQB 3BR8A 3DMJA 5IWAJ 3W63A 2A2DA 2FIUA 3A8JA 2BQRA 4DLGA 1QE1B 4DR3J 4BSZA 2Y1RI 4ELVA 1TKTB 1TL5A 4B08A 2Q3PA 2AEMA 3B82A 4CLWA 1RHUB 2B5JA 4ZP9A 1T05A 2UXDC 1IWAA 4PYAA 3NGKA 5H9UA 4OZ0A 3EXYA 4IFVA 2DNRA 4L6V3 3W5ZA 4WF9Q 2G2YA 5K85A 4DSJA 3CF5Q 2DPLA 4DQRA 3LUSA 2WVFA 4BC9A 1V3RA 4QPXA 5J2QB 3FKBA 1UWDA 2MPUA 3TZZA 1Q8KA 2W2QP 2N4CA 3CJ0A 3M1VB 5I42A 2XTJP 3KMSA 3K6RA 4KBIA 2RU9A 2J76E 3GJTB 1WTFA 3PX6A 1HNZF 3QSIA 3IMQJ 4M5HA 1FJGC 4M94A 2QX0A 1TAUA 4EZ6A 1FJGJ 2C2MB 3IR7B 4DL6A 2AGOA 3CQ1A 4K0BA 3OTOC 2N7CA 4PUOA 1RAJA 3U7JA 1ZTTA 2LVWA 5BSRA 1ZPVA 1FK9B 3DLGB 4L76A 3OHBA 2DGUA 4IQXA 2R2UA 3W3SA 2ZNZA 4KE5A 4DOZA 4OZLA 4L2ZA 2K2PA 2ZH2A 2GMJA 3UD5A 3MMJA 1UJ5A 3NYQA 2AQ4A 4KTQA 4K0KJ 3U1MA 1TMMA 1UVIA 3H5YA 2ILYA 4C8KA 1NYEA 1N32J 4K0KC 1I1GA 4U7UK 4CRJA 4HT7A 4DQPA 3DM2A 4FS2A 1TUWA 3JTNA 1FJ7A 3DLLQ 2PEHA 4K4SA 2GHPA 2AJ4A 1YHQS 3CJKB 3SEOA 3NGRA 3FVYA 1Y5NB 4MYUA 1WTBA 3Q8VA 3TA0A 2NQPA 3DHVA 4KQZA 1I94J 3GPAA 1SL0A 3L3CA 2WOMA 3JSYA 2M3DA 4IOCQ 1V3SA 4DR6C 3AD7C 1DTTA 2WBMA 1Q7YT 3R2DJ 4RNHA 2HQ3A 3HM9A 1MWZA 3VQTA 3KHLA 3DI6B 3ADAC 3V6JA 5KFKA 5A8KB 4V1Ak 3CCLS 2BOAA 4DR4F 4NCAA 3TJ8A 4C3KA 3HKZD 1T03B 4F2SA 5ETPA 2MGZB 1H7WA 1RHJB 2KT5A 4NRUA 1PO6A 1QAIA 1L2FA 2LKZA 1IBMF 2KFZA 2DGQA 1XMOJ 2V34A 2QYCA 4DL3A 1F0XA 3NGDA 4DFKA 4CM0A 2QFIA 4DJBA 2IFXA 2BA9A 1R3NA 1R0AA 3JAMD 1GNKA 2KB2A 3OR2A 4WWSA 5ETNA 4CWBA 3PROC 1RWMB 2BEFA 4DG1A 3UCZP 5GADI 1DQAA 4J91A 1VRTA 3SBMA 4MK7A 4IQMA 3RV2A 5KFQA 1YJNS 1W25A 4A8SA 2A18A 1MU2A 5J2PA 2Z56B 4E98A 3R44A 4DN0A 3M8QB 1LW2A 2J5AA 5EX3A 1N8RT 4WYWA 3DLPX 7FDRA 2XZTB 4I6WA 4LIRA 3E2EA 2J6SA 3RB3A 1YJVA 2VFSA 2B4PA 3N5FA 3BSOA 3R5CA 2HGNA 1XMQF 2MKSA 1PJ5A 2RQKA 3N01A 2PMHA 3GE9A 3O8WA 3D68A 1D8YA 4B9UA 2FDNA 1HIYA 2OLWA 4ITSA 4PG4A 5AJ3J 3N54B 1TFWA 5BR8F 2WRMA 4EMDA 5ADZA 2ZH6A 2FB0A 4EO6A 1SXLA 5K8OA 1EETB 4DZDA 3CJEA 1FRMA 1R7IA 1UCNA 2EFOA 2HSEB 1S10A 2FLPA 1EP4A 4TLRA 2Y4OA 5KYTA 1C0UA 4AE5A 2PMZD 2J0SD 2XI3A 1LWFB 4ZIVA 2B9WA 2N7YA 5M2UA 4K50A 4LMZA 2VBWA 2AX1A 2HWHA 5J2MB 3OFEA 4DR5F 2DRAA 1S6PB 2VUGA 4AUKA 2AMCB 3TVYA 1T5DX 4HPVA 1ZTWA 3S82A 1E6YB 5J1NA 2YNHB 3T1HC 3NMAA 4MK9A 4B3MF 2QV6A 3PYEA 3PYFA 4DR6J 1T9YA 3FSIA 1RUSA 3I4HX 3F73A 3UVJB 4F25A 3GU0A 2DY1A 1RT4B 4WP3A 3MAQA 2CPXA 2WW8A 2P20A 5IM0A 5B09A 3DU6A 3TR5A 4J90A 3KXWA 4YEAA 1T7PA 2XNQA 1H2VZ 3IBFB 4IH5A 1LQ9A 1N5YA 2KVQE 3PRBA 2OFHX 3PEHA 2DNNA 3W8GA 3Q8YA 1FE0A 3GJQB 5ETLA 4DCJB 4F50A 4QW8A 5HLFA 2C2KB 2UU9C 1FEEA 1TQLA 2XMVA 2Q6BA 1RAAB 1PAUB 2O67A 3S8SA 3P8BB 2FVRA 4QIVA 4YFUA 4KPCA 2DIUA 2OMLA 3M2RA 4KGVB 1UVLA 1GTEA 2D74B 4GXQA 2PFDA 2QA1A 4EBDA 5HVHA 4DV7F 3PW5A 4ZHRA 2WTFA 5K8FA 2DXDA 1HPZB 1TZ0A 4DUZC 3VHQA 3DHXA 4OX8A 2FHJA 4UQTA 2Z2LA 5C25A 1R8AA 4WFXA 4LR7A 3QRQA 3MM6B 1X4EA 1KHWA 2RRNA 3GCXP 4DV4F 4KHRA 2W4PA 4OX6A 5BUSA 2JL9A 4DX7A 1RWOB 2NXCA 3IC1A 2D3UA 2UZAA 2I2YA 3D7SB 5ETSA 2EK1A 3CCTA 1AMUA 2V2ZA 4DV0F 1QY7A 5BYSA 2V0NA 1ZM3A 5LL6d 2OJ3A 5F8JA 4WP8A 4ZVGA 4O4RA 3MHYA 4F26A 1WNEA 1SV5B 2AT1B 4ED7A 4QWBA 3MPUB 1L5UA 1K0VA 4KO0A 1TKZA 1YG0A 2XYGB 4KGXB 3HFKA 3GV5B 4R0MA 1NPPA 2RJZA 5BR8C 3DI6A 5HI7A 5T41A 4DG1B 2VONA 1S1VB 2VV5A 1RADB 1U26A 3CJ8A 2HLTA 2B9EA 1V26A 4U95A 3M9NB 4DR2J 1SJFA 2C2DA 1HI0P 1JJHA 1YGYA 2HK2A 3PEJA 4J37A 2W01A 4LF7F 1MNEA 4G3IA 3NKYA 2DHMA 2RE1A 2BX6A 4PXCA 1CULA 5IT9U 1FRIA 3KLGA 1FDDA 1XMBA 1VEHA 2MQNA 2LDIA 2V8PA 4AL5A 5HQ8A 1QVGR 3L4BC 4C11B 3FUYA 3M2RB 2CXCA 3D54A 4CTAA 3FCCA 3M30A 2JHEA 3CSKA 3M6UA 3OL8A 4ECXA 3GMGA 2BE2B 1C0TB 1YDLA 2QA2A 3OJUA 1WHWA 1ZETA 4NYOA 5HJXA 2UUAF 2JLFA 4O3OA 1JLQA 2R4FA 3ZZUA 1REGX 3FQLA 5A6PA 3JB9k 2J9CA 1T9TA 2YNGB 2O1PA 2W8LA 3DLGA 1C4CA 1FHTA 3HHLC 2UU9J 1LFWA 3ET6A 1IKXB 1B0TA 1CJTB 4ETXA 3RYLA 1KLNA 5LT5A 1MXCA 2E5LC 1CJUB 3HHLD 4TLQA 2VB6A 1U0HA 2PDAA 3SV4A 2FZGB 1FKOB 1L3SA 1CJKA 3QATA 1T5HX 1WDTA 2RU3A 3CULA 2GQ2A 1PG4A 2QMUB 4X4SA 1VGYA 3TJAA 1E6YA 2FVPA 4CM2A 2PN6A 2VPZB 5CYJA 2GIRA 4OYPA 4UOGA 3P49B 3OT9A 3PKMA 2OO4A 3KLIB 4X64J 1EHWA 3X1LB 4YDDB 2DTJA 2RUGA 3MM9B 2EPIA 4N8NA 1EGAA 4X64C 1RCOB 3O5TB 1FXRA 3M6WA 4DV0C 4PQUB 2AJQA 4ZDNA 3CD7A 3SYZA 4NOZA 1FJCA 1NPKA 4N8OA 3BQ1A 3RRKA 4QIFA 2W2PP 2JZ5A 2HS4A 5C24B 4OI0A 1HWJA 4DU8A 3LF0A 5IC4B 2BR0A 4KJIA 2E7XA 2RF2B 2Y1JA 2GHWA 3NLCA 3MR5A 3J7A1 4PXBA 5KFRA 1GEHA 5K9FA 2JOQA 1UWAA 4OX9F 4ZJZA 3OXFA 1RTHB 1FX2A 3J7ZT 3V4MA 3I0RA 3LPEA 5E3PA 4RM2A 3W5YA 3RRHA 3GFZA 1QAXA 2Y4NA 4DR2C 2G1HA 2QLBB 1T94A 2RDIA 4MJKA 4KPYA 2VZEA 3BSAA 4NXMF 3IEUA 3D28A 3POTB 3B8HA 5G4DA 1N4LA 4LF7C 2HQDA 3H2LA 4LUBA 4G37A 3H20A 2CAJA 4FXVA 2P9CA 4LF7J 2GNKA 4BS2A 4LFAJ 1R8HA 4DPXA 3NNAA 4IRDA 3E7XA 4ZVHA 2FYXA 1U6FA 2DHHA 4ED5A 2DY9A 4C0BA 4QCLA 3OHAA 5LMNC 1TR0A 1DLOA 3BN7A 4USJC 1UVMA 3R9WA 4MKYA 1LEOA 2DNKA 3ENAA 4TQSA 2UVRA 1RYSA 3IR6B 5C2GA 1TV6A 1U6BA 3LNOA 4M63A 3UQSA 3LP0B 3MR7A 1SV5A 4KKOA 1IQZA 1R27B 3BQ2A 1S79A 3BV8A 3TAMB 4IR7A 2LMIA 3UDCA 1XRBA 2W4CA 5FLXY 4QYZK 5B7WA 2EKNA 3G82B 1VHFA 5LMUF 3LP1B 3L09A 2E5GA 1HW8A 2OEMA 3MTKA 4QOTA 4BBYA 1VQ9S 4M5DA 3UDLA 2H3EB 3JQKA 4OHYA 5ETQA 5AT1B 3JS9A 4TNOA 2CY1A 2R7QA 2CQCA 2C3MA 4K4WA 3TVZA 3VNSA 4DPYA 5HBMA 1VOMA 5AE2A 1S1TA 3IR5B 2DNYA 1ZAXA 2CKWA 1PILA 2DGOA 1VMBA 2VG5A 3EMTA 3MDFA 4DV7C 4HI2A 1NPRA 2O3DA 3A9VA 4MTNA 3NXZA 2KL8A 5KFEA 3PJWA 2GO8A 2ASJA 3CXCR 2ZWOA 4Y2AA 4ECSA 3L7PA 1KVJA 5B0CA 4Y65A 3IBCB 1Q86T 4JI0F 1IBKF 2QEXS 3EGWB 3GFYA 3CJRA 4ZPAA 2F63A 3D6HB 3MEGA 4A46A 3G96A 2OBVA 4OXIA 2C2NA 1WHVA 5H9FJ 5A8WA 2XI2A 4KH0B 3ZZPA 1EQMA 3M8QA 1YWXA 2WB4A 1FK9A 2ZBCA 4DEZA 1R0BG 3CPWR 3TOQA 4EBCA 1WELA 1EIYB 2OEKA 4ED0A 4E8UA 2HMIA 5GADU 1YBAA 3N0VA 2G0IA 3BQ0A 3RBEA 2O5DA 1M5VC 3HVAA 2DGXA 2MKHA 1TV6B 2UV8A 4MTPA 3PW0A 2HBYB 2OSRA 4L3NA 3DNCA 2HNZA 3QIPB 3M1VA 2HGMA 2R7RA 4ATNA 1TL7A 2ZITA 3R3TA 2XGPA 1AFJA 1XNQJ 5E3RA 1IN0A 5K20B 2LA4A 3OBIA 5T8SA 5C25B 2XLJA 5CH7B 3C3LA 3S7RA 1S77D 3HHDA 3IBWA 3PJ9A 3LP2A 4NZ7A 2O66A 3SMZA 3KDNA 1S7IA 3G8SA 1HNZJ 4DX8H 3HK2A 4KFBB 2EGTA 4ZVFA 1S6PA 3U1LA 4C8ZA 4LQ9A 4DV6F 3IPLA 4KHPF 2YY3A 3ITHA 2CJBA 1WORA 3GV8B 5IT4A 3KJVA 1TK0A 4A8KA 4GKJJ 2GX8A 3I31A 5GAEU 1VBYA 4DSFA 1PC5A 3EVWA 4JI3C 3AHPA 3CCES 3I82A 1JQGA 4R25A 1KC8T 1LFPA 1RWVB 2E66A 1L3TA 1D1UA 4OJ1A 4NLDA 2W9AA 4FTFA 1RWXB 1K44A 4ZPCA 1ELOA 2EFPA 5IM0B 3C2PA 2D1QA 4IG0A 3EZUA 3ZTPA 2HFNA 4X4VA 4JI2J 2B5JB 2CVIA 2RHSB 4I9GA 2X1AA 3AJ1A 2QVXX 4QIEA 3MOZA 1FDAA 1S76D 1XR6A 3HDSA 1JJ2R 2ZUGA 1K73T 2VFUA 1BWVA 2KU7A 4RBVA 2L41A 2FUG9 2DGWA 2DNHA 1XN9A 4B3TF 2O01C 1YRXA 1RYRA 2JEJA 1N6QA 1YTYA 1KR4A 5ETVA 1Y10A 5ETRA 5J2QA 1NDCA 3LUYA 4NASA 1NEEA 2CPEA 3M05A 2OMOA 3THPA 3DRXA 1IJFB 1RT4A 3G6YA 3NG8A 2FQQB 3V6KA 1IBLJ 4JI4J 3EWGA 3MEEB 4QZVB 1M6XA 1REVB 3A26A 2MJUA 2HEKA 2XMJA 5GMKa 3KJQB 2VC1A 3K2YA 5KG5A 1L3VA 2GO9A 2FLOA 2HHHC 2QFJA 4NCGB 2IDLA 2HHHJ 2W8KA 1RU2A 3MM7A 4M5MA 1X4GA 1D09B 1XR7A 2KDNA 2VBYA 2MXYA 4ECTA 1U1PA 2KYXA 3CJKA 3A8EA 4DX5A 5CD4H 1RY2A 2QA4G 2FJVA 2KZFA 5IQ6A 5BSTA 4RW9A 4D4GA 3NGUA 1UW4A 3BO3A 2VPYB 1S7HA 4K4ZA 1WKLA 1U2CA 1ZBTA 3FEXB 3QMQA 1S1VA 2E8EA 2R8HA 1YJRA 4NA1A 2Q66A 2MMYA 3H25A 4ID8A 3HFZB 4IG3A 1KS2A 3EZ5A 2C2EA 4RMNA 1UZHA 2XY6A 1NDLA 1ZM4A 1Y3KA 2F4VF 1H6KX 4H4KC 1N32F 1HHTP 1NKEA 4JYAC 1HA1A 4B3SC 1HL6A 2J0QD 3NBPB 4DFJA 3HZEA 3BGRA 5KT7A 1WC3A 1X4AA 1ULRA 1HBMB 2HK3A 1LWFA 3FBBA 4OJGA 5BJRA 2C2RA 3CC4S 1S1UA 4C8MA 3R2CJ 3DN9A 4V19X 1VHIA 4YR0A 4I64A 2IIHA 1FJGF 2J8SA 4R8UA 3HVTB 1N33C 2LU1A 4DLEA 4CQ1A 2WVBA 2XGQA 2ASBA 4I2PB 2H54B 2D1TA 4X65C 1U09A 2ZKUA 4FVMA 4GVBB 5IT9Y 2G2ZA 5D4NA 3WIUA 4KAIA 3LGXA 2HQGA 2VF3A 4JV0A 3TUZC 3PZPA 1VQ5S 1FVQA 1ROFA 2FTRA 2D27A 4RVNA 4I4BA 3N5BA 1X9WA 5E5NA 3MR6A 1UL3A 4PG7A 4A8MP 1U0HB 1Q5VA 3KHGA 4X84A 1IWGA 2QE5A 3CQ3A 1LW2B 4N41A 1RB0A 2GVZB 2LDYA 1RWKB 1OYEA 2OIHA 4B3SJ 1JOSA 2V4RA 3W2VB 2D7VA 2V68A 2VKZG 3QQCD 2ZH9A 1NCLA 4FYWB 5LM7E 4LF6J 2J7KA 3ZTOA 2PD1A 1N5SA 2VFVA 1FA0A 1WD6A 5DRKA 5L1KA 3J7AN 4IZ6A 5AE3A 1AZSA 1D9DA 4A8FA 1J5EF 4HT5A 4TPSB 2VQFJ 3TARA 4D4IA 4LVNP 2RKIA 4TY8B 1T9XA 2Z2YB 1QTNB 2G0CA 1TL7B 3CTRA 3IGVA 3V6DB 4C0HA 3B4MA 2ADCA 2IYGA 2R7WA 4USMA 1JLFA 4LJMA 1LXJA 4UT4A 2ATCB 1TTHB 2GIQA 5DETA 3HVRA 4B3SF 3DGPA 3C6TA 5KFPA 1RTIB 4HHJA 4K59A 3UPFA 2B56A 5DQHA 4JI3J 4C9DA 1RTIA 4EU0A 4DQSA 4F0MA 1MXAA 1ZPWX 3FMWA 4XK8C 1HQEB 2MKCA 2JH3A 1HWUA 3J7YU 1NZ8A 3JYTA 3UEBA 2MZJA 2ZKTA 2XSFA 1SQFA 2ZBPA 2MZ1A 4X64F 1XTZA 4USWA 2EFQA 1SH3A 4I0WA 2WOMB 4ANEA 2P6SA 3A3PB 3NYRA 5FIIA 4Y00A 5F3ZA 1SJQA 5ETMA 4C0OC 4LBHA 4NRTA 5D0EA 1JXVA 1HBNA 1XMOF 3THTA 1DRZA 1CULB 4X4TA 5KFDA 4EYHB 4NLYA 1VRUA 1YRUA 4B9SA 3K7RA 4Z2XA 3GIRA 4F67A 5LXYA 4ECUA 4WFYA 2KFYA 1V3ZA 3VQSA 1T3NA 1VBZA 4FYVB 1NU4A 1HI1A 5HP1A 2AZ3A 4JI4F 4DCPB 1BD6A 1P9YA 2KJWA 2E7VA 2VBXA 2AZ1A 2X3GA 2LXFA 3CWJA 4ZIWA 2N82B 4M95A 1K0RA 2WONA 3UZ0A 3ILLA 5ETKA 3MAAA 3OW2R 3MCNA 3RJMB 1SBRA 1XQIA 3PHTA 5D4PA 4X4NA 1URNA 4RLQA 1DJ0A 4JI1J 3QT7A 4FXWA 5T14A 2FY8A 2BV3A 3QO9B 5U47A 3PX4A 3GIJA 1UFKA 2M70A 4JM1A 3VGVA 2VL1A 3Q86A 4M1KA 1WEZA 2VASA 5AE1A 3MECA 3DLHA 3PJXA 1G2EA 5FJ4A 2P2FA 2E1PA 4I69A 4DV2F 3JSRA 1VK3A 1RTZA 2B4UA 3C14B 1T11A 2LXIA 5KT6A 1RXOB 5HATA 1MMNA 1FNXH 4NCBA 1TL1A 4JP8A 2AWZA 1EKRA 4ICLB 2KRBA 4P2FA 4OV1A 1VQLS 1PA4A 2B7BB 2ZBIA 4EFAC 1JLGA 2HNYB 4UUXA 5CZVA 1N0UA 3UVJA 3Q24A 5K8PA 4AXIA 2PIIA 4Y2CA 5F9NA 2K1RB 5F9LA 1TL4A 3RAMA 4K0KF 3DXSX 3PNIA 1Q4RA 3RG6A 1KVKA 1RTHA 5AXMA 3C6TB 3AY0A 1QSLA 3MMCB 4WFAQ 3JSMA 3RR8A 1TVRA 2IM0A 1HMVA 2MY7A 1Y0HA 5AJ3F 1TL3A 1HBOB 1VISA 2ROPA 2J7WA 2VDIA 3CJTA 3MTJA 1BQNA 1SJ1A 2C1EB 4HHUA 3E3XA 4LIWA 5D77A 1QWIA 2GHVC 2EBGA 3GR0A 4NYZA 3UX3A 3GSIA 1UPPA 2WW4A 4CO1A 2C3OA 2C3UA 2DR6A 1OY8A 3EXCX 4YN3B 3TX8A 4CTAB 4IUFA 2MM9A 2HFSA 1CQNA 5MLCV 4U67Q 2MMAB 2F1FA 1X7VA 5B0FA 3ETCA 2GC8A 4DUZF 3LWLA 2ROGA 2FPHX 5FDLA 5F3TA 1ZAWA 2ZEJA 1VDHA 1WF1A 2HQCA 1GPMA 3KYLA 3FRZA 4PUOB 2UUAJ 4RW4B 2YWKA 5A8RA 2DK2A 3WX4A 4O0NA 3SO4A 1UEVA 1H38A 3CCVS 1BQMB 1U48A 1PU1A 2OGUA 2FGCA 1BQMA 2HBQB 2IMWP 3BEGB 1LK5A 5T7LA 1U25A 1F9FA 2EC2A 2JDJA 2RS8A 4DL0C 2AIRB 4BWMA 2W7OA 4CT8A 3P6YC 2QGFB 1B4SA 4K2JA 2BQUA 4X66J 1JLEA 3NOGA 5F8IA 5KFNA 2N3LA 2HHSA 4DR2F 1MDBA 1FDBA 2UUBC 4J5OA 1U1QA 2BH1X 3MI7X 2JJ4D 2HIQA 2DRDA 2OPSB 4WJBA 3TYTA 5D3GB 1PGZA 3MM6A 4G1IA 3BS9A 4P7VA 1RK8A 4RKUC 5MAOA 6FDRA 1GAOA 3A4TA 3KG0A 2ZH8A 2J8AA 2B7CB 2V94A 1RU1A 4W92B 1D3WA 1AB8A 1T03A 4MIWA 2AYMA 2D9PA 2LFVA 1FRJA 1M5SA 2YBVA 3BBBA 3L9ZA 2KT2A 3QGPA 5CYMA 3VGTA 5LJ5Y 2RF2A 3SIPB 3IWLA 3UDVA 2N3OA 4ILLA 3JTPA 1HD1A 3G86A 3K57A 1Q16B 2JVRA 4FS1A 2EG1A 3K8WA 2BE2A 5LXRA 2ASLA 2UUBF 4DR7J 2E5IA 1B64A 2A0FB 2OP5A 3CDUA 3NP5A 4DBQA 2F9JA 3IRXB 3Q8SB 2EFGA 3LNVA 3IO1A 5IC6B 4A8QA 1QLNA 2VFRA 5F0WA 3Q2TC 1S1XB 4YB7A 4GO5X 3DOLA 3ZFVA 1M5OC 1S1XA 4R1LA 1C2PA 2VJVA 1X0PA 1DARA 2UUWA 3K89A 4NWBA 3LGHA 4UUWA 1RP5A 1MXBA 3SFUA 4AQYC 5KTQA 3J80U 1GTHA 3C16A 1Y3JA 5CYQA 3OLBA 1KVIA 2RSQA 1ZZFA 2HNDA 1IKYB 2RD5C 3H98A 3OUYA 3MFHA 3CW8X 2HPUA 2IJNA 3QLHA 2UXCJ 4NLTA 2QL9B 4GXRA 5A1GA 2GQCA 3TA1A 3PRDA 3T5KA 1SH2A 4TQRA 1YBUA 4K4YA 4ERDA 2IJFA 4XTTA 5L9XA 1M5HA 4OI3A 4EWTA 1G1XA 2Y8WA 4L72B 1VQ8S 5F0UA 1S72S 1GXLA 4JI6C 5IS2A 4IRCA 2LQ9A 1WACA 1DHMA 4WU3A 1HD0A 3P5BP 5KFFA 3CE8A 3V6DA 2V7BA 4NA2A 3M8ZA 3VGSA 4ZLJA 2DYAA 2E8FA 4LF8C 1P6TA 2EWHA 3AQOA 2JEGA 3GP9A 3HHNB 5J2NA 2HZCA 3UWTA 1UA0A 4LF9C 5AXKA 4OIXA 1O5JA 1G6BA 1TL3B 2K7JA 8ATCB 4ZOSA 3IXQA 2HBZB 2EC0A 4RBUA 1VQOS 2UXBF 2UUBJ 3SZ2A 5HAOA 4DG8A 3DKDA 5GAGI 4Q5VA 1RAIB 4NYPA 3A25A 5K8MA 1BHNA 4FZVA 3PIPQ 2RRAA 1HR0F 1HYSB 3CJ2A 3RW7A 4OYAA 3PVXA 1HBNB 1CBKA 1HBOA 4J9SA 2VA3A 1H74A 2FJAB 4RX6A 4M5NA 1A9NB 4CI0B 2VICA 1Y00A 2NYIA 4OYIA 4BHQA 1V60A 4B9VA 3FJ2A 4A47A 2HVZA 6AT1B 2MSTA 5CCLA 1UWBB 2LEAA 2HFVA 3HULA 2JEFA 4OHZA 3AT1B 2BZ2A 1RWWB 2ZBQA 2G9OA 3R9XA 2PC6A 3I4PA 3OTOJ 2XMMA 5A19A 3HMJG 4DV4C 1UJ6A 2F8HA 2HKEA 3QWPA 5E3AA 2ZC4A 3A1YG 4PR6A 4A8XA 4X4PA 2KH9A 4ED6A 1M6XC 5IZHA 4QR0A 2BACA 3HT3A 3L8CA 3DHWC 1HNXJ 4TKTA 3IA0A 2AEFA 2VQFF 3EE3A 4K4VA 1JLFB 2D7SA 3PR5B 4YB5A 1VJWA 1VQPS 4AQYJ 3DRPA 5FDLB 1SL1A 2HWIA 5JMNA 4JV5F 5A76A 1TFYA 4IG3B 1NJYA 5KYVA 2J9EA 2J9DA 4RW8B 4EI2A 1IKYA 3D3CJ 3OR1A 4YR3A 2M8DB 4CH0S 3PHEA 4KY3A 1MDFA 2BJ1A 5A1IA 2K7KA 3ULHA 3KLEB 2KRRA 4D57A 3RTVA 4RLFA 1HQ2A 3DRSA 4YOEA 4CO4A 3D6MB 4A48A 3AFGA 1Q1KA 1VIXA 3FMBA 3MR3A 4DR3F 4GKKC 1SIZA 4J9VA 4OYWA 4GKKJ 4ELUA 1JLAA 4RVOA 1RISA 4OZ1A 3IM8A 2CIMA 4ED8A 4DV0J 4YY3F 2HIYA 3OSPA 3AOCA 1I51B 3C15A 3MCSA 4B3MC 2B9XA 1NHUA 2E44A 2I1RA 3D0GE 3LP1A 3BN4A 4GVBA 4P10A 1PJ7A 4RWWA 1J5OB 3PO5A 1RHQB 1O9TA 3DLKB 4OZNA 3BO4A 4DCTA 3DLKA 1S9GB 3FC9A 3KXDA 4HACA 1VS3A 4P52A 1FD2A 2WSCC 3KLGB 3G6VA 1HNVB 1UEKA 2Z58B 2U1AA 3KWMA 3MMAB 2D3OR 3D1OA 2ZM6J 3TR3A 1XR5A 1NHVA 2HW3A 5HQMA 1N6QB 4R1MA 2YX4A 3BDEA 4GS5A 2KHDA 1AUDA 2C42A 2OPRA 4H4OB 2OSQA 2FHKA 4ZVEA 1M5KC 3R5BA 4C98A 1HYSA 1J5EC 1C0TA 3ETOA 4TN2A 1B0PA 2Z0GA 3DYAA 3FZ2A 1UVJA 4JI0C 1OQ6A 4NLRA 1Q81T 1GMWA 3DOMA 2VODA 5DGAA 3MF5A 1Y4ZB 2R8GA 3H5SA 2FHMA 3FBEA 1XK8A 3UN3A 2DHXA 2CJYB 3QFWA 2YWGA 2DH8A 5B0AA 3TUPA 1WKJA 2RT3A 2W9BA 2CJ9A 1OSDA 1ZS6A 2W4DA 4WIQA 5E2QA 3VCDA 2UXCF 4E2FB 1S49A 4MK8A 4YDXA 3VTIA 4I7FB 4DS5A 3W9JA 3T1HF 4CO5A 3TUJC 4X4UA 1IXKA 3BB5A 9ATCB 3THVA 3KTQA 2ATLA 4KO0B 4QWEA 4P72A 4DV1J 3UW1A 3I87A 5EWGA 3HPOA 3MOJB 4ECRA 4HEA9 4B02A 3R5GA 5RUBA 1KEKA 2E5LJ 2PT7G 4AXJA 4PCQA 2E7WA 1SJRA 2APOA 1HW9A 3NCQA 4AYBD 1NUEA 3LP2B 1YKWA 3E8OA 4R0EA 3KUGA 3R5DA 5D3GA 5B0DA 4JI1C 4NLQA 2EI5A 3M8PB 2IDEA 2MHNA 1SUQB 2NS1B 3IS9A 3MM9A 3M8PA 3TWZA 3RR7A 2NCLA 1XNRC 1N32C 2GAHC 3QJJA 4Q8EA 3TDEA 3NCPA 3Q23A 2ZJPQ 1S0MA 1HWIA 1MROB 3UFCX 5KT3A 1I94F 2CQ2A 5HSPA 1B7YB 1LWCB 2M9KA 4DDFA 1S57A 5EGYA 3ZC4A 1RTDB 1FXLA 4WZMA 4CIOA 3ILOA 3GILA 4K4UA 4O3RA 3IFEA 3LALA 4NMLA 4Q43A 4RNOA 4FYXB 3VZHA 3J7YI 3E01A 1B7FA 5IXUA 2BJ8A 2OD4A 2LCWA 3EVMA 2NR0A 3J81Y 2HHVA 2M8HA 5A8RB 1XMQJ 1RHKB 4QR1A 5KG0A 3TVKA 4DZ6A 4LQ3A 2CU6A 3DRRB 2XYPB 4DPUA 3CC2S 3OVAA 4PZVA 4YB1P 3CD0A 3ENVA 5B0EA 3WIVA 4DV2J 3TANA 5DV9A 3MAHA 4KSEB 2W7PA 3G8TA 5H9FK 2ZHOA 3IEVA 3HFVA 3CDEA 4PXEA 5DLFA 1NMEB 1Y7PA 2CQ3A 2ILZA 3W2VA 4B9NA 1J5EJ 4QBUA 4LF8F 1XNRF 2KKHA 2Y0SD 2ZE2B 5E7OB 4FNHA 1OS5A 4K5SA 3M30B 3M6VA 4FF3A 2NCKL 5K8NA 4KTVA 5B08A 4MMOA 2RQ4A 1RBLA 2B3TB 3AD8C 3QGHA 2XMKA 4OX7A 1U24A 2JSXA 3BZQA 4LSNB 1KQSR 2J6TA 1OYDA 1RGVA 2JLEA 3KKFA 1TP7A 3CC7S 3NPDA 1NK9A 1HNZC 2B6AB 1Q82T 3FRYA 4OLPA 2BABA 4JI8C 5LMNJ 1KHVA 2QZ8A 1GXUA 2VU5A 3FGVA 3TZYA 1VLYA 3IG1A 1X4FA 2CPDA 4NLPA 3GLJA 4LFCF 4NLGA 3C5EA 5T7LB 4D56A 4OZJA 3UO0A 1VC5A 1BQXA 4ZKAA 1C0UB 2CPZA 2V8HA 3SCLE 2ACMA 2BYCA 2MLYA 3WQPA 3W9IA 1EQ0A 4DFMA 5HL7Q 1JLAB 1MG7A 2QMWA 1RBOB 1R89A 2YNFB 3MUTP 4DCUA 2V63A 2UVVA 2XSJA 3I9V9 4LR8A 3SDEA 1Q7LB 4CO0A 4PWDA 3RB4A 1RAEB 2IY5B 1SQGA 2CPHA 2VA2A 5L1LA 1H98A 2WZ1A 3ZNJ1 4O3QA 4CCHA 2BANA 3CCZA 3N6MA 2VH7A 1LNQA 4URSA 1ACMB 3IAS9 3GONA 3M9OB 1WC0A 4K4TA 4LE5A 3OVSA 3CCUS 4PQUA 4ZJLA 2D69A 2JMPA 4KHPC 3G9CA 1J27A 4C7QA 3D0HE 2FC8A 4RWXA 4N47A 2XC9A 4FYDA 1S97A 1CVJA 4JI5F 2P2BA 3KK1A 1R6YA 3RBDA 1ICEB 1FO1A 2ZVIA 2EVZA 4QIGA 2JNVA 2MYFA 3HVWA 3CJ4A 4WFZA 1AYEA 3M7VA 3MM7B 3T1HJ 2HRYA 2V4JA 2V4QA 3G8QA 5E3CA 2RQMA 1TUGB 1WSVA 2ACYA 4CZCA 3P4UB 3KJFB 5BURA 3MEDA 5A2QY 2FY1A 5HMYA 2CJXB 3OFGA 4ED2A 5T8TA 4WXWA 5KFAA 3D4JA 2CZ9A 2PMWA 2KXFA 4TYAA 2W1BA 4FN5A 3W9HA 4DUYC 4N5SA 4FF2A 2Q79A 1QD1A 5HMXA 4HYKA 1JIHA 5HK4A 5IQQA 1APSA 2PROA 3AODA 2GVZA 4USHA 4ZS6A 4XPCA 4F4XA 4TU7A 3MPYA 1NKCA 2CQIA 2E5JA 3Q8PB 4OHWA 2LA6A 1GK8A 1M1GA 2ZZTA 3VNQA 2QO3A 4ICLA 1QDUB 2CQBA 2RILA 3X3UA 1PAEX 3ILJA 1AZSB 2RDDA 1RKJA 4ISBA 1HWKA 4V19J 1KNZA 3T1YJ 4RPFA 4USKA 4NOHA 3HHLB 2JRSA 2ZFHA 1Y5LB 4LRBA 4OX9C 3HD2A 2I9SA 1MWQA 1URRA 4CLYA 1OPZA 2EBEA 3R5AA 4JI6J 4X2BA 1HNWC 4NLOA 4FXDA 1Z2LA 2OKQA 5C24A 4NDNA 4WK3A 2DO4A 3KLHA 1H0HB 2J0XA 4LBPA 3GKUA 2UUCC 3PXGa 4DV5F 2KT3A 4FUTA 2HZAA 2FJBB 4XDDA 3B78A 2K3IA 3SDEB 2FGOA 5I3UB 4C11A 3CMAS 3BKUA 1YJWS 4EO8A 4X65J 4K2XA 2E29A 2KI2A 2ZD1A 4ZCKA 1FRXA 1W26A 3LGMA 3K5LA 4O3SA 2F7VA 4KV8B 1UW9A 2ASYA 3MEGB 4CO2A 5KFMA 1CC7A 3G6ES 3NI2A 2CZVC 2FVCA 2IM1A 4HTJA 2QLWA 4OYZA 2ZWPA 2CNKB 1USPA 1CJVA 4ZA1A 4CYUA 2HHHF 3V81A 2PEBA 4Z37A 7AT1B 1S6OA 1JX4A 1MD9A 2BJOA 3DRSB 1S0OA 1RT6A 4TVAB 2DNMA 1KD1T 2HMIB 1WF3A 4DV1F 3KOAA 1FWKA 1YQHA 3FSXA 2UV8G 1TU0B 5CYQB 3VALA 1DQ8A 2HNYA 5CZXA 3P45B 1HQEA 2CQ1A 3QWUA 4RW9B 5LSRA 1KQGB 1RSCA 1PBAA 1T3OA 3DMJB 3I0SB 4NPOA 5KFUA 4WKYA 1U4BA 3HSZA 1GMWD 2PI4A 1FKPB 1QM4A 3DRPB 2B0GA 5KFJA 4DWIA 1V6HA 2E9TA 4LF4J 4B3OB 4Y3CA 3JSMB 3OFFA 1F9EB 3OPKA 3W62A 5IFMA 2B4OA 2YPYA 2YQ3A 1N54B 1U7LA 3MPDA 3KLHB 4J9PA 1ZYQA 2OPPB 2WVDA 1VR6A 3FBFA 2MQOA 1TKDA 3KLEA 2ZOGA 4G1QB 4ZK7M 1S1TB 4OYXA 3KNAA 1S59A 3KMQA 1X5TA 2HRUA 5HO4A 1U47A 1JLCA 2DCLA 2BANB 1WC6A 2E7GA 4J9QA 3MM8B 3ZZOA 3W5XA 2ZM6F 3OL9A 1YK9A 3ZTRA 4B17A 5IT0A 1P1LA 5EWFA 4JI3F 3NMRA 1RLCL 4R8UB 4EATA 1SVDA 5DG9A 3AF5A 5JUMA 4DR7F 2XY5A 1A0OB 4YHHJ 1PYTA 4R0JA 3UR3C 4N76A 2ZDPA 3J7Z5 3H4BA 2HHUA 1XHJA 4YHHC 3HZGA 1XEZA 5KG4A 2KXNB 3KK3B 4IDKA 3RG2A 2XNRA 3ZTQA 2XO6A 1CJUA 4DL4A 1EX8A 3V5RA 4LRAA 5A2QU 4IOBA 5JXSA 1RT5A 4JOUA 4RUBA 3JQMA 3IM9A 4EYIB 2ZH1A 5J1EB 3MURP 2DH7A 2V2KA 2RNEA 2OPLA 5EDWA 4LFCJ 4Q0BB 4FKYA 4DF8A 3DLBA 2J7UA 4M5GA 2MCQA 2WAQD 4LRDA 5F8LA 1IBLF 3F56A 4G1PA 8AT1B 2XM3A 2EXUA 3DXBA 4NLWA 3O44A 2R7SA 5BSVA 2JC0A 3DOKB 1X8DA 4L75A 2D41A 4LFBJ 3LPYA 2V2VA 1N52B 3PFEA 1XRAA 5B0BA 3UNGC 1NKBA 4ZP6A 1HNXC 4AQYF 1S0VA 3O3LA 5ETTA 4EBEA 3HKWA 2H5EA 1H72C 5E7QA 1Q78A 1X9SA 3D5MA 2E1AA 4RW8A 3GJRB 4USTA 4F36A 1N34J 2M5HA 3O2EA 3FCHA 3B6BA 1NH8A 4J9LA 4JI0J 1OIAA 2ZC3A 3JYTB 3VAKA 3AJDA 5GAHU 4ECZA 1SKWA 1CEZA 1Y5IB 2B43A 2LP4A 4OZ5A 3Q22A 1NJIT 2HAFA 2MTLA 3V4IA 4HLBA 2QSWA 4X65F 4Y0FA 1KONA 3T5HA 3PO4A 3DOLB 3M32A 1G4CA 2IM3A 5K14B 4K8RA 1TKXB 5AXLA 2OH2A 3DYAB 3R7NB 2MZSA 3CO0P 3LO3A 2DGSA 2KZ0A 4C6AA 3T5LA 4NMXA 2HHQA 4KTTA 2DXFA 4I56A 2MKIA 4ECYA 1FRHA 2CFXA 2Z30B 1FF2A 1WG4A 3H0PA 3LTOA 2GQQA 2HS0A 5DO2A 4F04B 5F8MA 2MQPA 2AYGA 1Y11A 4F4KA 3CT9A 3W61A 4P9SA 3TP2A 3N6NA 3EERA 4HACB 1KFDA 2ZUAA 3DGVA 2XS2A 1ZA1B 2F9DA 1N36F 4U9RA 2E9ZA 2WONB 3I55S 1WUUA 3R27A 1ZZNA 1FCAA 2R2TA 2MB0B 1LWXA 2AKWB 2BE9B 1FEHA 4RUCA 4XPEA 1I6JA 4B9TA 2D28C 2PA3A 1PYSB 3EM1A 4RUHA 1UP1A 5DS7A 1EETA 2A10A 2PO4A 4GC7A 3G7SA 1N5QA 1WJ9A 1N5VA 2DCUB 2UU9F 1XNQF 1XMQC 2L9NA 5KFIA 2NPFA 2PI5A 4XX2A 5JRHA 5HJYA 1JKHA 4C48A 5KG7A 4LRCA 3BM7A 1YSJA 3TZWA 4U5YD 3CDAA 4Q2LA 2LQ5A 4DV2C 1MLAA 5I3PA 3FQKA 5KEIA 3QZ7A 2W7AA 3DLEB 2BKNA 4X4RA 1NK7A 3WZ0A 2ZH4A 1UFLA 1AA1B 4Q7AA 4JI8F 2BJ9A 3KFWX 1H2UX 1PBUA 3BF4A 1Q53A 4I6YA 3SSRA 3TW0A 1KRPA 3EUNA 2VBZA 2ZOMA 1RKIA 3NGSA 2QJ3A 3H5XA 1IBCB 1U1KA 2BW2A 2H5IB 2DVIA 2MKYA 2E0GA 5DZ7A 3TAMA 3M9MB 4DL2A 2CQGA 1LV5A 2NXJA 2VG7B 1H3DA 1IBMJ 4LFAC 3FCWA 1H7XA 3QYYA 5F8GA 2ABYA 1RE1B 4RNMA 1X4HA 2X51A 4K5RA 4A8OA 4RU9A 1VC0A 4DR7C 4ZVOB 1NH7A 4EZ9A 4WU2A 2XB2D 5HMWA 5KOXA 2R7UA 4OLOA 1M0SA 5EWEA 4RW7B 3H90A 2DH9A 2XMWA 3ISND 4CH1A 1O90A 3MD1A 4C2MA 2F5GA 2FHOB 3GIIA 3VAFA 2VOOA 4B3RF 3KLFA 3Q2SC 2HVIA 3BKTA 5A0YB 1UKKA 4IOAQ 1HPZA 5KFXA 2VPXB 4PQAA 4F3OA 2BM1A 4ECVA 1GX6A 4WBFA 4OL8A 4JI2C 1L3KA 4ZCIA 2CDQA 1REVA 1R8BA 1LKZA 5THWA 4F3QA 4HTIA 1JB0C 4PYDA 2BUNA 3QPIA 4FVCA 5DQGA 3NL0A 1ITPA 4L73A 1RT6B 1SI9A 2YTCA 3B7WA 3C46A 1IKXA 1CJTA 2N4DA 4DV7J 2G4BA 2B8PA 3K5PA 2HFZA 2NUUG 2I5JB 4LFAF 1FFSB 3DM2B 2UUAC 3B54A 2HGLA 1VBXA 2BJDA 1T9VA 2IRXA 5JVHQ 4DQIA 4I7FA 1HBUB 1IJEB 3V6HA 1RLDA 2I8EA 4C8YA 5KG1A 1UJ4A 4CLTA 1FUGA 3JSBA 1D8ZA 4LT6A 1NJZA 3CW9A 3QO9A 2J0WA 3HCXA 2I38A 4YB6A 3TEGA 4RUAA 3KLIA 1YVFA 4LF8J 1LQLA 1CPZA 1T9WA 1TKXA 2V67A 1SL2A 3BR9A 1RT1B 3IWXA 4ZP8A 3AQPA 4CNYA 4I6AA 1WC4A 4MH4A 1WH9A 3N79A 3T19A 2DNZA 1KKHA 2QL7B 3ICLA 1HBMA 3OTOF 2JEIA 2P2MA 2NYHA 2A6MA 3NBPA 2FVQA 4H4OA 4OJHA 3AJ2A 1XNQC 1RAFB 1WI6A 2EFVA 5IOLA 2OTLS 3N28A 4Q44A 3FNNA 1X4CA 3MM8A 3GYNA 3GV7B 1WEYA 5KFBA 3M8RA 3AF6A 4RW6B 2HG4A 2JVOA 1WHXA 3ZXWA 1HR0J 3VZIA 1N36J 1FT8A 2RHQB 1TKTA 1LW0A 2CNLB 3I56S 5BYQA 3R5JB 1J5OA 1N36C 3HT0A 2M4MA 4B3RJ 3QZ8A 1NK5A 4BLGA 3H2UB 4PPDA 3H4DA 1WOSA 4AD6A 2CQDA 2P5VA 4C3MA 5HLFB 1SKUB 1HNWJ 1O0PA 4X62J 1Y9OA 3BJYA 1WG5A 1C1BA 4QWCA 4J9MA 5C7PA 1JNRB 1GQEA 4PXDA 3GZ7A 2IVFB 3U02A 3Q8QB 5FD1A 3BSNA 2XG8A 2AJFE 2AP6A 1K1QA 4N7TA 3EYZA 3CCJS 3DDKA 2LEBA 1S12A 4O4GB 3LGNA 1M90T 3S6EA 1C1CA 3RAXA 2H48B 2V6AA 4YY3C 4ZHRB 1H2TZ 4LVOP 4X66C 1XS3A 2AEJA 2W9CB 3UOWA 4LSZB 4XIUA 2DNOA 2GJ2A 1DTTB 4ZPTR 5CABA 4Q45A 2EEYA 2YKNA 1R8CA 3OTCA 3R1LA 2ERRA 2UXDJ 4RM3A 3OVBA 1HQUB 2A1BA 5E3QA 2ZHBA 3VAMA 4KIAA 3G82A 4JV2A 5BSWA 5D4LA 5BUQA 4U7UD 1F5AA 4HH1A 3OTEA 2D9OA 5CAAA 2I5JA 3KJNB 1GMVA 4ID5B 2UXDF 3PBKA 4L74A 4PROC 4ED3A 4IKAA 3RRGA 1VC6A 4LF6C 4HR2A 2CJQA 5DGBA 1N48A 1CSJA 4JV5C 5D8HB 2CQPA 1AFIA 1EJ7L 2Y1IA 2MZTA 3HF5A 1QE1A 1N33F 1T95A 1S9EB 1VQ4S 1C4AA 2Z8QA 1CG2A 2V8GA 2W2NP 3QBCA 4YY3J 1BWEA 2JFKA 2EFNA 1KTQA 4CLUA 1EB0A 1GT8A 2DISA 1WOOA 3TNVA 3HHEA 3W60A 4EUVA 3BGLA 2BQ3A 3VAGA 1N56A 2QL8A 3M8SA 2P02A 3TQIA 3RAQA 4WYLA 5CHCB 1RBAA 3VAHA 4B3TJ 3CD6S 2M88A 2Z51A 4JYAF 1VLOA 1PG3A 4ANDA 4GRSA 5DG7A 2Q1LA 3P96A 1FJEB 3KK1B 3UN2A 1O92A 4DHVA 3MWBA 3NWRA 4GVLA 5D0RA 3M2VA 3UE2A 3QSYB 4WIIA 4FBTA 2KVIA 5KFSA 1DFDA 3M2VB 2RVJA 3D3BJ 3PIOQ 1FLOA 5D78A 1TMJA 3QRRA 4AL7A 1QUPA 3LW5C 1V5VA 4F4WA 3D0IE 4NLVA 4MKVA 2OHDA 3KUHA 1SCJB 4ZN3A 4U7CA 2IBKA 3UCUP 3BH6B 1SC1B 3RB0A 2YKNB 2YQ0A 2BJ7A 1SC3B 3GG1A 4J7CA 3I0SA 4UF4A 4B3RC 4C8NA 1IVZA 2GCFA 2KHCA 3BYPA 1IR0A 2MQ8A 3D9BA 4NXNJ 2JWNA 4NXNC 4GKJF 4IDKB 3D2WA 4PHTA 1NK4A 1S6QA 2XMUA 2DEIA 4ZCMA 3VGUA 5L46A 5GAHI 3LQVA 3RGIA 3T9ZA 1MN9A 4PUHA 1V9OA 1X4BA 4DV6J 4QJVA 2KTQA 2OPPA 2FHJD 5HQLA 1HWLA 1IUJA 1UZDA 3BGOP 3KNGA 2B8QA 3CO9A 3D67A 4KYZA 1YITS 3T1YF 1DAXA 3V81B 3SSQA 4KR0B 3BH7B 3C14A 4U96A 2DR7A 1RZMA 1UVNA 5I3QA 3AOAA 3CCMS 1FKPA 2DR9A 2RQCA 5L1IA 1ZB9A 3KG1A 3OTDA 2C3YA 4DV3F 1NO8A 4OQJA 4EGLA 2HHXA 4LSNA 3FDSA 1JLCB 3HLUA 4YP3A 2NXEA 2XY7A 4LFBF 5EN1A 2GGPB 2OELA 4Z7CA 2WVCA 4Y2KA 1QAJA 4FNIA 3PX0A 2BKOA 3I5BA 3EDRB 2WHOA 5A6WA 1VRUB 4ZPBA 3KUEA 4DUZJ 2AGPA 1VYAA 4E0DA 2EK6A 1NY8A 3UX2A 4HKQA 3EJMA 4ID5A 3S01A 3TQEA 2OAUA 2CNNB 1MROA 4NZ0A 1YI2S 3N2QA 1SB6A 1TVRB 4FKXA 3G6XA 1EKSA 1NDKA 1Z2ZA 1PG5B 2LQJA 2YKAA 3F41A 4JBCA 4PG6A 1S4EA 4Y28C 1K8AT 1E6VB 5IWAF 4JI5J 2HFOA 2KN4A 4IR9A 5E41A 2E8CA 1RHRB 5HVGA 3OV7A 4DR5J 5KFLA 1YX2A 4NEZA 2G13A 3OFHA 3LWMA 5A0YA 3FEYB 1LW0B 2Y8YA 3D6TB 1U2RA 4DUTA 3H40A 1FKAF 1GXTA 1K47A 3UNYA 1HNIB 1S48A 2FC9A 2XHWA 3QT8A 3K5MA 3KK3A 5CQGA 5KFCA 2VIHA 3DOMB 4OYOA 2X1BA 2YNGA 1VJQA 3H5UA 1P4EC 2XCPA 1C1BB 2VPWB 5HN0A 2C28A 2MSSA 3CVKA 5GAEI 4DV5J 4TYBA 2UVWA 1USPB 2DD8S 3KDOA 4CH7A 1YZ7A 4LRFA 3A8KA 3LAKA 3CIMA 3PFOA 4BWJA 2DGVA 1FTCA 3T6JA 4ZLNA 2ZJRQ 5LMUJ 2D1RA 4LF5J 2OPLB 1QAYA 2HVEA 2V4JB 5LMUC 1S6UA 2ALYB 3DU5A 3CMES 4MFBA 4NA3A 3TRGA 1F60B 4ZVPB 4ZLPA 1M1HA 4UZBA 1BLUA 3DDNA 3T1AA 1P9QC 4MKBA 4FF1A 4ECWA 2M5OA 1NLKL 2YWWA 3ELHA 3EZOA 5HANA 4DS4A 1HHSA 2DBBA 4J9UE 2IAJB 4LF4F 2ZZNA 5BXIA 1FRLA 4ZVSB 1PIEA 3C15B 4DL5A 2RS2A 1VK8A 3HJVA 4NX9A 3CB4A 5C2CA 1UETA 3G4SS 5K5MA 5LMNF 1WEXA 3UDEA 2JLGA 3D1HA 4HDHA 4B9LA 2I0XA 2VQEJ 1HNVA 2HJGA 1RT1A 4URGA 1XERA 2GJIA 5B0GA 5KT4A 1SQEA 1VQKS 2VG5B 2FD2A 4PWWA 2DKOB 3C8YA 3MD3A 4NXMJ 4NXMC 4DR4J 3KHRA 4DG9A 4ANCA 2GGPA 1S1UB 1XIQA 3MGJA 5DJBA 3FCEA 1N5TA 1Z1ZA 2AJ1A 2EG2A 2M5YA 4G6VB 4GO7X 4ZVTB 1TH5A 1S4FA 4O0IA 1UEUA 3HXMA 5H1SV 4PUGA 4WK1A 1MKYA 4C4WA 1JXEA 1JNZB 1N0VC 4DCSA 4I2PA 3GPCA 1CJVB 2ZVSA 5EUHA 1N5YB 4I68A 2P2CB 7FD1A 3ET6B 3O1LA 4L4QA 3GFHA 4UOHA 4KH1B 2A3JA 5KFVA 3PYGA 3QRPA 1S5ZA 3A13A 3ZZZA 1Q5YA 3NAHA 4DR5C 3O2IA 4F0KA 1CJKB 2CQ4A 2YWEA 3AAWB 3C16B 3A9UA 5GAGU 1F2HA 2L48A 2ZE2A 2R9LA 2NSBA 1RA6A 2Z2MA 1WF0A 3QT6A 2XO7A 1VRQC 2ADBA 2VG6A 4ZVUB 4O3NA 2MEWA 2V9KA 3AXMA 1BUXA 1GFWB 2AYBA 2CQHA 1U1LA 2DT9A 3IRWP 1NJXA 4I9FA 5HROB 2YKMB 4YS2A 1UTAA 4DQQA 2ZNYA 1ZH5A 1D9AA 3LP0A 4KKOB 4OZ3A 2CQ0A 4M5KA 2QYGA 1G7CB 3L95X 1IM6A 4NEYA 2JNJA 3H2VE 2BOPA 5LSLA 4OI4A 3KJVB 4QR2A 1EP4B 4WP9A 1LWEA 2QSFA 2XWXA 1F2GA 2W25A 3DLEA 3OL6A 4ZPVR 5L1JA 2E5LF 4LBIA 1NBEB 2MLZA 4WS9A 1AUSL 1SC4B 5GTDA 2P2QA 1JLBA 1Z4UA 1F5BA 4IFYA 2R8IA 3T5JA 2F65A 2V50A 4NLSA 4FDFA 3RBXA 1JLEB 3SCKE 2E5HA 4JB8B 2XSJB 1NSAA 2MKKA 4RBTA 3M2UA 2HHWA 2YNFA 3TX0A 4TU8A 2KM8C 3EX7B 3FFIA 1S9EA 3PACA 3R97A 2FJWA 4QQBA 2ZJQQ 1ZB8A 1Q8IA 4ETZA 4P6QA 2Y3YA 2E1RA 2AJ0A 2CRLA 3GJSB 2ROEA 3HHKA 2W24A 4ER8A 2UUCJ 2VOPA 3C6UA 1RTJB 1MU2B 4NLUA 5J2PB 4LF9J 4DV1C 1RA7A 1O8BA 4UY8T 3VNRA 1PKUA 2K3KA 1X60A 2GJFA 2Q6CA 4USUA 2CDRB 4LF5F 1UWBA 5KG6A 2XULA 5CCMA 4ED1A 3MZIA 4UY85 2WK4A 4DR4C 4EEYA 3VR1A 5HP1B 4IH6A 4IYQA 3GB0A 4ZJOA 4WFBQ 5D15A 3BPDA 5KG3A 4JI7J 1R0AB 3E01B 2W9CA 3US5A 2QA4S 1U49A 4JI7F 2D1CA 4U6PA 3D66A 1S1WB 2UXBC 4LR9A 3AXKA 5KFTA 3HSJA 4NZ6A 4FYYB 1VQNS 2IYIA 3DOKA 2LLZA 2YKPA 3M4XA 4FF4A 2VC0A 2XHCA 4P2MA 3ONQA 1EZZB 3WBZA 1N88A 3V2UC 1BGXT 1I94C 3MCMA 3CCSS 3CQ2A 2R42A 1VI7A 3OUYB 1NB2A 1V5IB 3LAMA 4N56A 2DHAA 2IVYA 2X1GA 2XS5A 5J1EA 4DV4J 3RB6A 4QU6A 2YWCA 3DLJA 1X4DA 4GC6A 1GMUA 3H42A 1I3OB 2ZHAA 3CNQP 4JI1F 4ILRA 3W1YC 1CS4A 5AXNA 3KLVA 3PTWA 2AHOB 1EAYC 4CLFA 1KDNA 2CPIA 2FZKB 1PSDA 4X4OA 2QVYX 3NEKA 2YXLA 2CG8A 5JJBA 2V9WA 1QSYA 2H65B 2KXHA 1WWHA 5L38A 1ZM2A 3IG1B 3MEKA 5A8WB 2IMOA 3MUMP 1V25A 3AH6A 1TAQA 3K17A 4KGZB 2CPYA 2HVDA 2VG7A 3MR2A 2CA9A 2UP1A 3N4WA 2UXCC 5CYMB 4DV5C 4IFVB 1JLBB 3FK4A 4IFYB 4LF1A 1WHYA 2VKRA 3I9ZA 3HVTA 4JV1A 1WDDA 4OX9J 3IGNA 4O3PA 3HP6A 2UUTA 4RL1A 4DPOA 4DSKA 1B70B 4ZJQA 1F3VA 1F9HA 4ALZA 5KFHA 2XLKA 3QJPA 3MMBB 5IFIA 2QLXA 2YCBA 2OPRB 1YJTA 4PRFA 1WC1A 4HH0A 4USVA 4ED4A 3DAYA 2WBRA 4OI2A 1U1OA 4ZPWR 4B3MJ 2DEJA 4Y2IA 1T0TV 2XZWA 2MDAA 3OSNA 2KYZA 1VQYA 1OQ3A 1VQ6S 2V8DA 4X62F 4BCAA 2AGQA 1AW0A 1KBRA 2KDOA 2FLLA 1MSWD 1NK8A 3OL7A 3TUIC 1LWEB 1UPMB 1WF2A 2X1FA 4OFZA 3W66A 4KHPJ 1J2VA 2R8JA 2UVUA 2GMLA 4YUDA 3GSDA 4O44A 5C42A 5KFZA 2UXBJ 1HBUA 4OHVA 3QAEA 2HNZB 3BGUA 2M7SA 3J81j 3C19A 5ETOA 3EICA 3QGIA 1HQUA 3AA8A 4LF6F 2KZMA 3WC2A 2QL5B 4O23A 3H2TA 3DGPB 4URQU 1BE4A 3EGNA 3IAM9 1FNMA 4D3HA 3N9UC 5DM6Q 4CLSA 1F3FA 3SQGB 3TZXA 3OR1B 1N34C 4DX6A 3GFXA 3SQGA 4U8VA 3D1QA 3I32A 3MFIA 4ZVRB 2DXEA 4JI5C 3OJSA 1D9FA 4KHMA 3A4IA 1NXIA 2CWKA 3S1TA 4AL6A 4UTGA 2J6UA 4LF4C 1A7GE 2RAQA 2RB7A 2MGZA 4QW9A 2LQBA 4DUYJ 4FPRA 1B3TA 1QTMA 1IB8A 5DDPC 4PZPA 3UR0A 2GMHA 3DC2A 4J9KA 1SKRA 3I07A 5BYRA 1T9UA 4DF4A 1LXNA 3ZZTA 3CJQA 4I67A 4PG8A 3R6LB 3FEZA 3RU0A 3B4DA 2K1RA 3PW4A 1O51A 2Y0BB 1X5PA 1BC6A 1RACB 1S99A 4AFFA 2MY8A 1RWUA 3I0RB 5F8NA 3G2XA 2JC1A 4CP5A 2KFNA 1U0SA 2F40A 1HHQA 2XBPA 3T1YC 1BY9A 2QLJB 1RT7B 4L3KA 4USIA 1QM9A 3TQ1A 3QFHA 3BREA 2M52A 1U02A 2XMAA 3NOCA 2X3DA 4RJVA 1RT5B 3KK2A 4RNNA 2PFFB 4GKJC 2F4FA 4CO3A 1TELA 3CEDA 3DDIA 3QIPA 3QLHB 2KG1A 2KZZA 1U2FA 4KV8A 5DDRC 3MM5A 1KLMB 2QT7A 1LOUA 4N77A 3JAMY 5L39A 3MPWA 3MPVA 2XCAA 1XC9A 1MN7A 2KJVA 3PM9A 1VIOA 3TEHB 4DXLA 4UZCA 3ZZ0A 4BC7A 2DGTA 3RUBL 4QU7A 1JKHB 1RDRA 1NSPA 1RCXB 1IKVA 2IJRA 5F41A 3W64A 4ZMMA 5LJ3Y 2A6OA 1UKUA 1KFSA 4RLEA 3VF0B 2YWBA 2VD3A 1HI8A 1CLFA 1MWYA 2MQLA 2QN6B 1RABB 1RAHB 2HQIA 2WCXA 1OO0B 3BGRB 3HSDA 3I96A 1KTVA 1FERA 3JTOA 5KT2A 4O44B 1WOPA 5C42B 4YR2A 5J2MA 3F0NA 1NK0A 2AYAA 5GMEA 2NZCA 2YVSA 3W7BA 4X66F 4I2QA 2BDPA 3RBZA 2HFUA 2RH3A 4DV3C 3QAUA 2V5HG 4DV3J 4LREA 5SUHA 1X0FA 3V4IB 4WFNQ 3SI8A 2P9GA 3CIZA 3ILIA 3MMCA 1OSCA 1T05B 4B3OA 4WKRA 4WV3A 3TJ9A 2D3ZA 3UI3A 1WI8A 1VRTB 1CC8A 1UVKA 1VCTA 2L9DA 4C3LA 2XQCA 4JI8J 4DCOB 1IBMC 4QWAA 2V69A 5CD4A 2P6TA 4S0MA 2HYIB 3UD3P 4TU9A 2VFTA 4QIWD 2OFGX 3BPSP 4WE1B 3WHIA 3GTYX 4K4XA 3CJ3A 1IKWB 4JI2F 2C2ZB 4DR6F 1IKWA 5KFOA 1RTDA 4NE9C 1IQTA 4OV6A 1FFWB 2IA0A 3CDBA 1OY9A 3VV2B 1XJWB 2IBOA 1NDPA 2OPQA 4OJ3A 1HFEL 2GW8A 3MEEA 3CMQA 2H5JB 4ZPDA 5G0RB 3ZZYA 4CT9A 1OJ4A 1R6VA 2M0GB 3PV8A 4TY8A 3K8VA 4DR1F 2CG4A 1G3OA 4DSLA 2YKQA 1GX5A 2B6AA 2G2OA 3W2WA 2R2SA 3IWNC 2GS8A 2QG9B 3TAQA 2D1SA 3TI0A 1GH8A 1AROP 4HDGA 4YMEA 3PR4A 4B9MA 2IVMA 2YWHA 3MECB 3A3OB 5KAKA 2FJXA 3CCRS 3P5TL 2C22A 2DNQA 5GMDA 3ETMA 5HBMB 3PDNA 2YX1A 3CW2C 4OMFG 3K5OA 3PG9A 4F7VA 4DSEA 3R6GB 4DPWA 3LA0A 3CCWA 1UMJA 4Q0BA 2M2BA 4CNZA 3E7WA 4KB7A 2LXUA 1NK6A 3HSGA 1OPIA 3UCGA 1HKAA 1YJ9S 3TO8A 1N33J 2YH1A 1RG9A 5D4OA 1KP6A 1KQKA 1UFWA 3H59A 2BM0A 2DR8A 1P7LA 2WD9A 2COLA 4OHXA 1RAGB 3HHLA 3I6PA 1RTJA 1QUVA 1XBWA 4KRWA 1FWLA 1HLWA 4RW6A 1L3UA 1O93A 4L7IA 2DNGA 4U8YA 1N34F 1M1KT 4TY9A 1A6LA 4Y2MA 3GIMA 4ODJA 3Q83A 4ZLLA 2ZOFA 5KFYA 3PKYA 1IR1A 2CUYA 2XWYA 3T41A 2E1CA 2QVZX 2H51B 1BQNB 1U1NA 1LWCA 1UA1A 3J81U 4ECQA 1IBKC 4H54A 3FZBA 3FBCA 2C3PA 3LANA 5DM7Q 2AJ2A 2Y27A 4OI1A 2YNHA 3N6LA 3NWGA 3O6QA 3TA2A 4PEOA 4C8OA 3AA9A 3AB2B 3H7HB 4RW7A 3SCIE 2PE8A 3W2WB 3EPIA 4J9NA 3ZTSA 2HBRB 2VQFC 4OZ2A 1W2IA 4UQGA 4W98A 2A2CA 5E33A 1FFGB 3C66A 3U27A 2FJEB 3LOUA 2QMXA 4IO1A 1FX4A 3A12A 4H4MA 2B4VA 4LSLB 2DHGA 4X62C 2WSFC 3GYGA 5IV4A 3M6XA 1FXDA 2GA7A 4WZQA 2DR5A 2F4VC 3MXHP 5A2QD 1KOHA 2IC3A 4CYUB 2XR1A 1LCIA 1DTQB 1KQFB 4DR1C 1BA3A 4MIBA 1UAWA 4YHHF 4DR1J 2F3JA 2GFFA 4QYRA 2RKIB 5CA5A 3PW7A 3K0JA 4F02A 2PSZA 4GKKF 4DR3C 2GVDB 4PG5A 2V2QA 3GYXB 1W7WA 2GVDA 3SQOP 2HHTA 4JI7C 3H8YA 5EX0A 1Q8LA 2Q43A 3K5NA 5L9NA 4M5LA 1P1TA 2BXJA 4IG0B 2E9RX 5GVQA 2H4YB 1R8PA 5M2RA 4GMKA 2BW7A 1CQMA 2YKMA 1ZA2B 1HMVB 2GIFA 5J2NB 3VWSA 4F4YA 3EVOA 5DG8A 4KGKA 2R7XA 2F8MA 5J1PA 1NZAA 2ONFA 4JV5J 2MHEA 4LF9F 4ES2A 3NAIA 3VVTA 2VZ9A 3G71S
chains in the Genus database with same CATH topology
1IBLC 4ELTA 1FVSA 2AYEA 2AX0A 2IRUA 3OQ2A 4J9OA 1R43A 2F8EX 3FFIB 4A4JA 2ZD1B 2V8VA 2R7OA 5DLGA 5K14A 3TAPA 5DQIA 1F5CA 4B3TC 3K59A 5A8KA 2ZH7A 1D0EA 4NLXA 4WE1A 2DO0A 2MZQA 3WDOA 4F8RA 1VQ7S 1VFJA 1FTRA 4MKAA 5DDQC 2KG0A 4DCVA 2XLIA 3QIDA 3MMAA 2JFDA 1IM4A 1HR0C 4KT0C 3OLAA 3BO2A 3ENWA 3CGIA 3DFEA 4MAKA 3J80Y 4XO0A 1W2BR 2FLNA 4IO9Q 2XS7A 2CJKA 2YWFA 3I5AA 4ZCLA 1KSPA 4WXOA 1RI7A 4PWUA 5HROA 3P3DA 4RW4A 1S9FA 3GR1A 4RNFA 2ASDA 4G36A 4DV6C 4ILMA 1TUVA 2HAIA 2CPFA 3ITHB 1IKVB 1YJUA 2B51A 4R5PA 4P2SA 4NCGA 1ZH5A 5JVGQ 2IA6A 4LMZA 1S0NA 2E1MC 2LYVA 1JLGB 1YRTA 3TUFA 1PC4A 4JI6F 3VAJA 2DPIA 2DIVA 1U45A 4OYCA 4PPZA 1K0TA 4XDCA 1E6VA 3K58A 1B0VA 3OR2B 2AV5A 1NB7A 4JUZA 5KFWA 3M2UB 1KOOA 2PGCA 3T3FA 4PWDB 1X5OA 2P9EA 2L3MA 2LECA 3HJFA 3GG0A 2Z4PA 3M32B 3RZAA 2POKA 1RT7A 4F02A 2IM2A 1HNIA 3NRBA 1SUQA 3IS9B 3QJLA 1DQ9A 4Q2MA 4H4MB 1ULTA 1ZM9A 1FDNA 2VQEF 1SIWB 2IHR1 2PN2A 1RT3B 2YNIA 2LEPA 3CDWA 2QIFA 3U1NA 5KG2A 4QWDA 5J2QA 4JI0C 2BRKA 1DBDA 4O4GA 3Q0AA 5KFGA 5BSMA 1DTQA 1FNOA 3MUVP 4TXSA 1NNDA 1QJHA 2WB1D 4PKDB 2YX7A 5HMZA 2RDJA 1VQMS 3PY8A 3K0JA 3M9NB 4HVZA 4DMZA 3IRXA 3GIKA 4C97A 1DURA 1T02A 1WG1A 3CJ5A 3SCJE 4A8YA 3UD4P 1UKKA 4X4QA 1TK5A 2R8KA 3MMBA 3GQCA 2R7TA 2MZRA 1JXLA 3LH2S 2AU0A 2IAJA 3SFGA 4MYTA 3GWCA 1OWXA 5KOWA 1RT2B 1JJ4A 2NZ4A 4P7TA 3FSYA 2CYYA 3I08A 4M5DB 2AD9A 1U1MA 2HVHA 4MFBB 1XWLA 2NLWA 2MQQA 1XRCA 2YH0A 2G1DA 2QRRA 4IR1A 4IRKA 2R2RA 1M5PC 2DB1A 2YKOA 3QGGA 3AB4B 2CPJA 4W90B 2DYJA 2EKYA 4Y6IA 2OPSA 1DZ5A 1KLMA 3SXLA 4KGMA 1SC6A 2DNLA 3CCQS 3T6BA 1ZOTA 2NXUA 3KG4A 4ES3A 5LSOA 3EPGA 5ITHA 1RJJA 2J9DE 2AW0A 2VQEC 2WSEC 3WC0A 2BBEA 1HNXF 1JK9B 2JX2A 3NS6A 3RW6A 1T8EA 4DUYF 4OI6A 3OXGA 2IRYA 1MMLA 1RQ0A 4WCEQ 2DRBA 3SV3A 4LFCC 4M8LA 2NSCA 1X9MA 5FLXD 2OPQB 6FD1A 3KK2B 4MIAA 2KO1A 2ALZA 5M2PA 2MQMA 1FRKA 1LK7A 1HARA 5I3UA 4UOCA 3R1HA 5A19A 3CW8X 1U1RA 4KC5A 3HO1A 2SXLA 1FD8A 2CVEA 4LFBC 1NRKA 2AF6A 2HHPA 4F3MA 5H9EJ 3I5CA 1ZAVA 2BVZA 3NCRA 4JI4C 2ZH3A 1YJ7A 2BRLA 4LSLA 4RZRA 3VAIA 4C8LA 5L8RC 3HX9A 3EGZA 2W9BB 3ENQA 1SJ3P 2VSQA 1DLOB 2DNPA 4ES1A 3DCAA 1KN6A 3F44A 3J81D 2IC3B 2PA8D 2LU2A 4RU2A 1JWWA 4NXNF 3NS5A 4QPTA 1XMOC 3MM5B 2ZM6C 4Y34A 1R31A 1S1WA 2PT0A 3OXLA 1P27B 3MEDB 1U8SA 5IWAC 1MW7A 4LF5C 1Q8BA 5F8HA 2CZ4A 2MKJA 5I4MA 1SJ4P 1FKOA 2ATWA 2DITA 2NUHA 4WTYA 2WP0C 2HLUA 4KFBA 1S9GA 1NJWA 2OTJS 2UUCF 1KKGA 5DDOC 3C6UB 4I2QB 4DSIA 4G1QA 3NNCA 2L9WA 5D6GA 4A8WA 2QW0X 4HI1A 2HWTA 1P8GA 3LAXA 5I42B 4DFPA 3IN5A 4I1TA 1NAQA 4MH8A 3CUNA 2RRBA 1TK8A 3E51A 2DHSA 5C5JA 2BJEA 5E0OA 3KHHA 1TKZB 2ZH5A 2NREA 4Q8FA 1HH2P 2P2JA 2DPJA 1AXQA 1Q79A 3DRRA 2XEXA 1JMTA 2H9ZA 1RT3A 2L08A 2YNIB 1VLAA 2U2FA 1YIJS 3J80D 3BSCA 2OD6A 1K9MT 3ISNC 4F4ZA 2RMLA 4QYZJ 4XAKA 1N2FA 5BSUA 4ZP7A 4BDPA 2NPIA 2HNDB 1QVFR 3Q8RB 2DJWA 2RIJA 4IH7A 4D3GA 3CD5A 3PW2A 4FP9A 4HL9A 5KT5A 4YQWA 4F2RA 2ZZMA 3KLFB 1C1CB 3OTBA 4H4KA 2FVSA 1QSSA 2VG6B 3BDPA 4NL5A 3L7OA 3NNHA 3POTA 1X5SA 2B9YA 1RT2A 2CJAA 2ZDOA 4DN9A 1S6QB 2XMTA 1JLQB 5G0RA 2GV1A 3HI9A 2K8GA 2HS3A 3EQ6A 1VQSA 2MJNA 2KM8B 4UW2A 5IT9D 5EHHA 1TL1B 4R5PB 5CXTA 3ZZRA 1FE4A 3T9NA 3BGFA 1FESA 1MMDA 3DRYA 3ISZA 1ML8A 2FJDB 1SH0A 1SKSA 4FBUA 4J9RA 1U6ZA 2EW9A 3SSSA 4DL7A 2R7VA 1K1SA 3PESA 3BR8A 3DMJA 2A2DA 2FIUA 2BQRA 4DLGA 1QE1B 4BSZA 2Y1RI 4ELVA 1TKTB 1TL5A 4B08A 2Q3PA 1T05A 3B82A 2UXDC 2B5JA 4ZP9A 5H9UA 3NGKA 4OZ0A 3EXYA 4IFVA 2DNRA 4L6V3 4WF9Q 5K85A 4DSJA 3CF5Q 2DPLA 4DQRA 3LUSA 4BC9A 1V3RA 4QPXA 5J2QB 2MPUA 3M1VB 2N4CA 3CJ0A 5I42A 3KMSA 4KBIA 2RU9A 2J76E 1WTFA 3PX6A 1FJGC 4M94A 1TAUA 4EZ6A 4K0BA 3IR7B 4DL6A 2AGOA 2N7CA 4PUOA 1RAJA 3U7JA 1ZTTA 2LVWA 5BSRA 1ZPVA 1FK9B 3DLGB 3OHBA 4IQXA 2DGUA 3W3SA 2R2UA 4ERDA 2ZNZA 4KE5A 4DOZA 4OZLA 4L2ZA 2K2PA 2ZH2A 2GMJA 3MMJA 1UJ5A 3NYQA 2AQ4A 4KTQA 3U1MA 1UVIA 3H5YA 2ILYA 4C8KA 1NYEA 4K0KC 1I1GA 4U7UK 4HT7A 4DQPA 3DM2A 4FS2A 1FJ7A 3JTNA 3DLLQ 2PEHA 4K4SA 2GHPA 2AJ4A 1YHQS 3CJKB 3SEOA 1WTBA 3FVYA 1Y5NB 4MYUA 3TA0A 2NQPA 3DHVA 4KQZA 1SL0A 3L3CA 2WOMA 3JSYA 2M3DA 4IOCQ 1V3SA 4DR6C 1DTTA 2WBMA 1Q7YT 4RNHA 2HQ3A 3HM9A 1MWZA 3VQTA 3KHLA 3DI6B 3V6JA 5KFKA 5A8KB 3CCLS 4DR4F 4NCAA 4C3KA 1T03B 3HKZD 4F2SA 1QAIA 2MGZB 1H7WA 2KT5A 1PO6A 4NRUA 1L2FA 2LKZA 1IBMF 2KFZA 2DGQA 2QYCA 4DL3A 1F0XA 3NGDA 4DFKA 4DJBA 2IFXA 2BA9A 1R3NA 1R0AA 3JAMD 1GNKA 2KB2A 3OR2A 3PROC 4DG1A 3UCZP 5GADI 1DQAA 1VRTA 4MK7A 4IQMA 3RV2A 5KFQA 1YJNS 1W25A 4A8SA 2A18A 1MU2A 5J2PA 4E98A 3R44A 4DN0A 3M8QB 1LW2A 2J5AA 5EX3A 1N8RT 4WYWA 3DLPX 7FDRA 4I6WA 4LIRA 3E2EA 2J6SA 3RB3A 1YJVA 2VFSA 2B4PA 3N5FA 3BSOA 3R5CA 2HGNA 1XMQF 2RQKA 2MKSA 3N01A 3O8WA 2PMHA 3GE9A 4B9UA 1D8YA 2FDNA 4ITSA 2OLWA 4PG4A 3N54B 1TFWA 5BR8F 2WRMA 5ADZA 2ZH6A 2FB0A 4EO6A 1SXLA 5K8OA 1EETB 3CJEA 1FRMA 1R7IA 2EFOA 2FLPA 1S10A 1EP4A 4TLRA 2Y4OA 5KYTA 1C0UA 4AE5A 2PMZD 2J0SD 2XI3A 1LWFB 5M2UA 2B9WA 2N7YA 4K50A 3ETCA 2VBWA 2AX1A 2HWHA 5J2MB 3OFEA 4DR5F 2DRAA 1S6PB 2VUGA 4AUKA 3TVYA 1T5DX 4HPVA 1ZTWA 3S82A 1E6YB 5J1NA 2YNHB 3T1HC 3NMAA 4MK9A 4B3MF 2QV6A 3FSIA 3I4HX 3F73A 4F25A 1RT4B 3MAQA 2CPXA 2WW8A 2P20A 5IM0A 5B09A 3DU6A 3TR5A 3KXWA 4YEAA 1T7PA 2XNQA 1H2VZ 4IH5A 1LQ9A 1N5YA 3PRBA 2OFHX 3PEHA 2DNNA 5SZTA 2UU9C 1FE0A 4F50A 4QW8A 5HLFA 1FEEA 2XMVA 1TQLA 2Q6BA 2O67A 2FVRA 3S8SA 4QIVA 4YFUA 2DIUA 2OMLA 3M2RA 1UVLA 4GXQA 1GTEA 2D74B 3PW5A 2QA1A 4EBDA 4DV7F 4ZHRA 2WTFA 5K8FA 4DUZC 1HPZB 1TZ0A 3DHXA 4OX8A 2FHJA 4UQTA 2Z2LA 5C25A 1R8AA 4WFXA 3MM6B 1X4EA 1KHWA 2RRNA 4DV4F 4KHRA 2W4PA 4OX6A 5BUSA 2JL9A 3IC1A 2D3UA 2UZAA 2I2YA 2EK1A 3CCTA 1AMUA 4DV0F 1QY7A 5BYSA 2V0NA 1ZM3A 5LL6d 2OJ3A 5F8JA 4ZVGA 4O4RA 3MHYA 4F26A 1WNEA 1SV5B 4ED7A 1L5UA 4QWBA 1K0VA 4KO0A 1TKZA 1YG0A 5BR8C 3HFKA 3GV5B 4R0MA 2RJZA 3DI6A 5T41A 4DG1B 2VONA 1S1VB 2VV5A 1U26A 1V26A 2HLTA 5T8TA 1SJFA 1HI0P 2C2DA 1JJHA 1YGYA 3PEJA 4J37A 4LF7F 1MNEA 4G3IA 3NKYA 2RE1A 4PXCA 1FRIA 3KLGA 1FDDA 1XMBA 2MQNA 2LDIA 4AL5A 5HQ8A 4C11B 3M2RB 2CXCA 3D54A 4CTAA 3FCCA 3M30A 2JHEA 3CSKA 3M6UA 3OL8A 4ECXA 3GMGA 2BE2B 1C0TB 2QA2A 1WHWA 1ZETA 4NYOA 2UUAF 2JLFA 4O3OA 1JLQA 2R4FA 3ZZUA 3JB9k 3FQLA 5A6PA 2J9CA 2YNGB 2O1PA 2W8LA 3DLGA 1C4CA 1FHTA 3HHLC 1LFWA 1IKXB 1B0TA 4ETXA 3RYLA 1KLNA 5LT5A 1MXCA 2E5LC 3HHLD 4TLQA 3SV4A 2VB6A