3GR0A

Periplasmic domain of the t3ss inner membrane protein prgh from s.typhimurium (fragment 170-362)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
186
structure length
186
Chain Sequence
LGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Protein prgH
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 69
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gr0A02
3GR0A 4G1IA 3GR1A 4ALZA
chains in the Genus database with same CATH superfamily
3H42A 4O3PA 4Q45A 1PJ6A 3TQEA 3TANA 4AL5A 2R7RA 3WC0A 2KHDA 2EG1A 2CJYB 2ROPA 4NLGA 4TVAB 1DJ0A 1VI7A 2MKHA 3PM9A 1QVGR 1N32J 4CO1A 4TYAA 2AYEA 2X1BA 3EZOA 2ZZNA 3PO4A 7AT1B 4MIAA 4DSFA 1HR0J 4USUA 3VF0B 3HVTB 1UL3A 1M1HA 4L6V3 4KR0B 2MQLA 2B51A 2NCKL 1S10A 5GMKa 3A8EA 4MK7A 3I4HX 4RUBA 1MU2B 4I9GA 4LF4C 2HK3A 2UVUA 3MZIA 3JSRA 4A8OA 1U0SA 4DOZA 3KYLA 4NCAA 2XLJA 2HQIA 1EQ0A 3N01A 3E51A 2HRYA 1Z4UA 4ID5A 4DQPA 1EZZB 5I3QA 3EE3A 5E41A 4F2SA 1RABB 2CQHA 4HI1A 1UWDA 3RG2A 3I07A 2Y1RI 4FS1A 1RE1B 3LP2A 2DNNA 3ET6A 3SDEA 4XPEA 3CF5Q 4ZLJA 2L08A 4DR1J 1S76D 2D3ZA 3ZZOA 2RAQA 3T6BA 1SIWB 1ACMB 3MMBA 1QM9A 1S5ZA 3OL9A 3I0SA 1UA1A 6AT1B 3MEKA 2VPYB 1F5AA 1KQSR 3DOLB 1M1KT 3I08A 3QAEA 4GO7X 1KKGA 4A8MP 5CXTA 3MM6B 1IM4A 3CCTA 2MZRA 4I2PA 1NJYA 3V6HA 1YBAA 2Z2MA 3I5BA 1GXLA 4E2FB 3TZXA 4M5LA 3ZNUA 3S01A 4BCAA 3AOBA 4QBUA 3MOJB 1CULA 4ZLNA 2EVZA 1WF0A 4WFYA 2WBMA 3L7OA 1TL1A 2HGNA 4C3MA 5E3PA 1XWLA 2RRBA 3IR6B 3FCVA 3VAGA 4JV0A 4HH0A 2V8DA 2YKAA 5F8GA 3AXMA 2ZC3A 2CNKB 2F8HA 4YB6A 1QLNA 4YB1P 5E5NA 1JJ4A 3D6MB 3PV8A 1XTZA 4WTYA 4PABA 3KJVB 2KXHA 3TAMB 2QV6A 1JLFB 3HHLB 2YH0A 4I4BA 4LSLB 1JX4A 1MMDA 2ZEJA 4LF8C 1JJHA 3O2EA 3DI6A 4XDCA 1KQFB 4ELUA 3NCPA 3UPFA 4PUOA 2D1TA 2DIVA 4KC5A 2QGFB 1H6KX 2RMLA 4NX9A 2LFVA 2QT7A 1ZH5A 2H5JB 2QMUB 2JLFA 3KLFB 1O51A 4OIXA 4LFCF 1K47A 4PUHA 4DV4C 5ETLA 3ETCA 3FBEA 5KFIA 3T9ZA 3PROC 3EWGA 1NSAA 2HQDA 2PMZD 1FF2A 1O5JA 5KFWA 4OL8A 3IR7B 2QLWA 5A8KA 2JEFA 5CZXA 3CMAS 4MKBA 4C0BA 5JMNA 5BSRA 2GX8A 4PQUB 5BSMA 4RW6B 3VAJA 2IHR1 1S1XB 4CO4A 5KT7A 1HWKA 4X62C 1ICEB 4KGXB 2JOQA 4I69A 1OPIA 2GJFA 4RNOA 1PJ5A 1MG7A 2DNYA 1VR6A 4OJGA 2E9ZA 5IC4B 3MURP 1N2FA 3KDOA 2MGZB 2Z57B 3UVJB 2YWFA 2Z56B 3L4BC 1RAOA 5GAHI 4UTGA 4TY9A 3RW7A 3D0GE 4BS2A 5IT9D 5B0AA 2OPSB 3E7WA 4JOUA 3OW2R 2IA0A 4P9SA 1PG3A 2XY5A 3D6HB 4ODJA 1CJVB 4J9RA 1B7FA 1TL3A 2E1PA 2IAJB 4QR0A 4IR9A 2V2QA 3LNVA 1VGYA 1IBLF 2FC8A 2VQEJ 2A10A 1U26A 2XY7A 1S6PB 3BREA 4OHZA 3JXOA 3RYLA 5KFXA 4MAKA 1Q79A 1RTDA 2DGXA 1UKKA 2BH1X 2QRRA 5THWA 3P5BP 1JK9B 5FLXY 3ENWA 3K89A 3KUGA 3GFHA 1FWKA 4X84A 4ZP6A 3OTDA 1JNRB 4YQWA 2UUAC 2I1RA 2W24A 1UVLA 2XMMA 2YY3A 2KT2A 1FI4A 1M5VC 3CJTA 3CQ2A 3F41A 1REVB 3UD5A 1RZMA 4ZN3A 3FGVA 1MW7A 1VS3A 2QX0A 4Y3CA 4RNFA 3TI0A 4FF1A 1LWXA 5A19A 3L7PA 2KG0A 2OD6A 3H4BA 1T9WA 2XSFA 3RV2A 4N56A 1YRXA 1N33J 2HHHC 3QRPA 1MDBA 5F8HA 5F0UA 1NJIT 2VBXA 2ZH8A 3RZAA 3TA1A 4DL7A 1HBUB 3DOKA 5IQQA 2UUBJ 1ZM3A 1FXDA 5DG8A 2ONFA 3V6DB 1N5YB 3TJ9A 4J7CA 3P45B 1CS4A 4TYBA 4ELTA 4PZVA 1BUXA 5AXLA 3BSNA 4K0KC 3IBCB 4WFAQ 3GG0A 4L3KA 1YRUA 1S57A 2HAFA 4Q7AA 5LXYA 3G9CA 5J1NA 1G2EA 4LF7J 4ZKAA 3EXCX 2AV5A 3CC4S 4NYPA 5KFCA 2NXCA 3DC2A 2AW0A 3KOAA 2V6AA 1RT5B 2PA3A 2KFYA 1IKVB 2ZBIA 1F60B 1TUVA 4ZLPA 1UWAA 4Z7YA 2FVSA 2VQFF 4GVLA 2OPLB 4WXOA 4D4GA 2VPXB 3G82B 1D1UA 1KR4A 2YNIA 3L7UA 1WG4A 1Q7LB 2J9DE 1KNZA 1FDNA 3LUSA 3D3BJ 3BV8A 2Z4PA 1FK9A 3GMGA 4IO9Q 1RACB 1K0RA 1Q7YT 1SBRA 1MD9A 1S9EA 4DBQA 1EQMA 1Q53A 2QLFB 3G2XA 2VJVA 1HBOB 3K5NA 4PWDA 3UR0A 4ED3A 2BM0A 3TEGA 1E6VA 1WF3A 4EMDA 3B4MA 3LA0A 3CVKA 4ID8A 3OJUA 4N8NA 4CRJA 2LQ5A 5D15A 4FPRA 1SQEA 3EXYA 4D3GA 3HSDA 2F65A 2V67A 2DGTA 4NZ0A 1PG5B 2Y4OA 3C19A 4ER8A 2W2QP 4LF5C 4WU2A 2DHXA 4LF4F 3S8SA 3V81B 4AQYF 4QWBA 4NA2A 2PSZA 4A46A 4O44B 1U4BA 4OZJA 4JYAJ 3P4UB 2P2MA 2VASA 3MTKA 5DQGA 1RT6B 1ZOTA 4K4XA 2KVIA 2MKYA 3EX7B 5T7LA 5L1KA 1U0HA 1X9SA 3RTVA 3DLBA 2BDPA 1F9HA 4ALZA 4OQJA 2AWZA 3MMJA 3BO3A 1RWUA 4OHYA 4KKOA 4P72A 4ECUA 1XMOJ 1D9DA 2E9TA 4UF4A 2GCFA 2Z2ZA 3BQ2A 3VZHA 4LSNA 2J0WA 3M6WA 1HIYA 3Q0AA 3ENVA 2HZVA 4U96A 1JJ2R 2DNMA 2YPYA 4X4VA 5ETVA 3VGTA 2A6MA 3MCNA 4F3MA 4PG7A 4IH6A 4QWDA 4P73A 2W1BA 2OH2A 2P8IA 3AB2B 5C7PA 4JI1J 3DRSB 3ZTSA 2V8VA 3FDSA 2E1MC 2P5VA 4HACB 5A8WA 2FJEB 4M8LA 4DPWA 2VONA 4NXNC 2J0XA 2AGQA 1R6YA 1EP4A 1WHVA 3D1OA 2GVZA 5LSLA 4EO6A 1OYDA 4Y65A 3UDEA 2CA9A 4KHMA 2XTJP 1I6JA 3QT7A 1RT3A 1C0TB 1F9FA 3I82A 1F5BA 5CYMB 4EYHB 4HEA9 3QIPA 2FLNA 1XEZA 4H4KA 1S7HA 4OMFG 5KFHA 2G0JA 2R7XA 1TKZB 4N7TA 2RQKA 3IMQJ 5AXKA 2ZE2A 4DCOB 4RW7B 4ZCLA 3L8CA 2D41A 4GO5X 4ZCKA 3T5JA 4BC7A 2WZ1A 4KFBA 5EGYA 3SCKE 1Y00A 2Y8WA 4BC9A 3G86A 4FF3A 3JYTB 3KJNB 1HW8A 4B3TJ 4LF8F 2NR0A 4LE5A 2N7CA 3H2LA 2YWBA 3H5XA 1HQEB 3OR2A 5KFDA 1RWVB 2LA6A 3W62A 2W2OP 1MXAA 4F4YA 5IWAJ 2W8KA 1WOPA 1I3OB 3CJEA 4DV4F 1EJ7L 2DBBA 1X60A 2XLKA 2HQ3A 3OJSA 1C2PA 1VEHA 2KRRA 2QL9B 4YEAA 4K7QA 4M63A 1MMLA 3MM8A 1PKUA 1XN9A 3TA2A 1CQMA 3MCOA 4RKUC 2KU7A 4BWMA 1RQ0A 1YJUA 5KOXA 3KDNA 4L2ZA 1GMWD 3FEYB 4P7TA 2W2NP 3L3CA 1PBUA 3CJ2A 4Q43A 2JLGA 4ZITA 4C9DA 2VG6A 2XYHB 3DNCA 4X62F 2CAJA 3HZEA 4J9LA 1MN9A 1LOUA 2D1RA 3CDWA 1HFEL 3DGPA 3PTWA 1IBMJ 2KZMA 1VDHA 4F50A 4FYDA 3IAS9 4KB7A 3CDUA 2C2KB 4OYBA 2IVMA 3SMZA 4K4SA 1YSJA 3J7YI 3F0NA 2Q3PA 1RT1A 3CJ3A 2VODA 1MLAA 2FZCB 4CLZA 3A9VA 1RHQB 2WAQD 5J1EB 3D7SB 2R8KA 2CJKA 2IY5B 2PEHA 2C2MB 5A1GA 1FX4A 2MQMA 4B3OB 4XK8C 3FSYA 4MKAA 3AA8A 3GZ7A 3SSQA 1FCAA 2V69A 4NMLA 4JI3C 1RKIA 4OZ1A 2J7KA 2R8HA 4RW8A 2UU9J 2ZJQQ 1IVZA 1RP5A 4DF8A 9RUBA 4X66J 1H2VZ 1S6QA 2XSJB 3T3FA 3MEDA 1AZSB 1U1MA 1C0UA 4J9QA 2M8HA 5HBMB 2MHEA 5LSOA 4OX8A 2VC1A 3KLHB 4N5SA 4DV0C 3EMTA 3M4XA 4MKVA 2RQ4A 5BYQA 2VSQA 2ZKUA 3A1YG 3O5TB 2KT5A 4W92B 2UUAF 3BDPA 3QRRA 1HNWC 3OHBA 5B0CA 1RHUB 2C3PA 2MZJA 5DZ6A 4Y2CA 2Z0GA 4ZPAA 1VLYA 4C48A 3CCWA 5F8IA 1XC9A 3M1VA 4UY8T 3HCXA 3NS6A 1NXIA 2FGCA 1ITPA 2V34A 2N7YA 1Y0HA 2LA4A 4ZPTR 2R2TA 4J9UE 4RW4B 3U7JA 4UOGA 2KG1A 1RHKB 2DNKA 3V2UC 3RBXA 2HMIB 2HHHF 1S9GB 3QPIA 3Q8SB 3HPOA 2Y27A 1XIQA 1TFYA 5EX0A 3OL8A 2YKQA 3TUJC 3MDFA 4R0MA 2P02A 4O3OA 2GVDA 3E01B 5KFYA 4WK3A 4O3SA 3ZZZA 3JAMD 5BR8J 1KLNA 1N54B 2ZH7A 4AUKA 4ZVUB 3W2VA 2A3JA 3HD1A 1N34J 3G6VA 5SUHA 4DV5J 1CJUA 2DNGA 2V2ZA 2RQMA 3DN9A 5AXNA 3PCOB 3BKUA 1VRUB 2NLWA 1SJ3P 3BEGB 3A9UA 3AJ1A 3HSJA 4WP3A 2KTQA 2HVIA 2R8GA 4H4MA 1U7LA 5DZ7A 2QZ8A 2QLJB 1HNXF 4DQQA 2XCPA 1LWFB 3CDAA 3D6TB 5IZHA 4XTTA 3ICLA 3TUPA 3OUYA 4DQIA 1BE4A 4XO0A 3TUFA 2V9KA 3D1HA 1KQKA 3C14A 3MUMP 2YKMA 4DR4C 4QZVB 3MECA 3FCCA 1QWIA 1I94C 3MFIA 3G6YA 3QNWB 1F3FA 1KLMB 3IN5A 2XHCA 2AJ0A 2PD1A 3FBCA 3W5YA 2CPFA 2Y3YA 8RUCA 4DR3C 3KLGA 1HNIA 2K8GA 1Q8BA 3JSYA 2BMBA 4OYXA 2HFOA 3TAPA 4ZJQA 3ISNC 1QY7A 5J2MA 2YWWA 2DRBA 3KK1B 4AL6A 4NZ6A 3DYAB 2XYPB 1S1WB 3QT5A 3PHTA 1WD6A 3HM9A 2NSCA 2W9BB 3CCJS 2FB0A 3NNAA 5HLFA 3PVXA 4WIQA 2OIHA 1U8SA 2VOOA 2C2EA 4A8FA 3NMAA 4YHHJ 1QD1A 1RTIB 4YY3J 5E33A 1HBNB 4LF5F 4PAAA 2RDJA 2FYXA 2G1HA 1CQNA 2HHUA 4H4KC 2WVFA 1HNZC 3CO9A 2MKKA 4LVNP 4DDFA 2HBYB 4V1Ak 1UKUA 4B3MJ 4ERDA 2GV1A 4AXIA 4IO1A 3R9LA 2FUG9 2BQ3A 1TKXB 2DH9A 4DCTA 4JV1A 3M8YA 4KH0B 4JI2C 5I42B 1DLOA 3S6EA 3KK3B 4CTAA 3OR1B 4W90B 1X7VA 2QC3A 2BE2A 2GS8A 2QVYX 4TPSB 1N0VC 2YXLA 1CC8A 4RUHA 5A6WA 1R0AB 5J2PA 3M2RB 1F2GA 4WP8A 2ZOMA 1C4AA 3RRHA 3N28A 2BV3A 2CUYA 3BYRA 1N32C 1RBLA 3BSOA 4GC7A 3P3DA 4DPUA 1S99A 4NXNF 5HMZA 1T7PA 3M8ZA 2GQQA 3CJKA 1TV6B 5J2NA 1HR0C 2CU6A 5D4PA 4C4WA 5HSPA 1JLBB 3VTIA 1DURA 3KXWA 1BQNB 4DV3J 2BABA 3I87A 4JI6C 3CB4A 3H25A 2E1CA 2RF2B 2K1RB 1FXRA 4DX8H 4U8VA 3AT1B 5HK4A 2HHSA 1Z2ZA 4YR0A 1FD2A 4I6YA 5KG6A 2QSWA 3HFVA 4IOCQ 1JMTA 5LMUJ 1NM2A 2EG2A 5L46A 3GWCA 3PR5B 4NI2B 2HWHA 5IT9U 1AT1B 2JRSA 3TX8A 1UJ6A 1UMJA 4MJKA 3UZ0A 1SJQA 2W9CB 2AD9A 3SCJE 3LP0A 4CLSA 1T11A 3G6XA 4DWIA 1SV5B 4TU8A 4DV2J 2O66A 4F3OA 5BSUA 4DR1C 4DV7C 1XNRJ 4YDXA 2JEGA 3R3TA 4FVCA 3PEJA 4TXSA 3RAMA 2EW9A 2QL5B 1EARA 3CJRA 1H72C 3QGPA 2DNQA 1FRMA 2MQ8A 5A2QD 3WX4A 2F63A 4A4JA 2MY7A 1RISA 4ZPDA 1LWEB 3VAIA 1PYTA 4LSZB 5RUBA 1FFGB 4LIRA 5HROA 4CH1A 5LCIA 3SQGB 3VHQA 4KIAA 3UFCX 4DUYC 1JXLA 2ZM6C 3MMAB 1VIOA 1Q0NA 2C2OB 5G0RA 4B3SJ 1AUDA 3BQ0A 2BW7A 1MKYA 2Y0SD 3UD3P 4C6AA 1RAHB 4C11B 4IRDA 4WYLA 5M2PA 4DR5C 2KJWA 1DTTB 4KH1B 3W8GA 1RWPB 3MAAB 3RB0A 2AMCB 1L3KA 2F7VA 4G1IA 4K5SA 4MIBA 1UVMA 4X4UA 5KT3A 4F02A 4X64C 2QL7B 4HT5A 4M5DA 1ROFA 1NJZA 2EFQA 3J7Z5 3GV8B 4GKKJ 2CZ4A 3KLEB 1SUQB 2MLZA 2KZZA 2RT3A 1VCTA 1B64A 4DV1J 2MYFA 3D5MA 1QUVA 4M5IA 3NOCA 5FDLA 3Q8VA 5CABA 5D77A 3OXFA 3ADAC 2L9DA 2KXNB 4RU2A 3M6XA 3RB4A 2IC3A 1UA0A 2Z8QA 2XZDB 3OL7A 3GFZA 4LF6J 1VC6A 2FJAB 3G96A 3CCRS 2OMOA 2VV5A 3HJFA 2YNGA 5KG5A 1SL1A 4DV0F 2D3OR 1VMBA 2XMJA 3MD1A 3GILA 2H3EB 2RDIA 3R6LB 3QYYA 5D0EA 3DMJB 2YWEA 3A12A 1EGAA 2QFIA 3B8HA 4JI8J 2OSQA 4CM0A 4OYCA 1KONA 3CGIA 1BC6A 5K8OA 1V5VA 4H4OB 3JSMB 2R7WA 2ILZA 4IQXA 1YLXA 1S0VA 1RWOB 1GMUA 1UZDA 3ONQA 2FTRA 1S1TB 3BH7B 5IS2A 3T5LA 3BR8A 4NASA 1SI9A 3PYEA 3TNVA 3PRDA 1H7XA 1Q5YA 4WP9A 5J1PA 4LF9J 3UW1A 1H38A 5HVFA 4OI1A 3QGHA 5KFQA 4F04B 2DYJA 4USKA 5K5MA 4P71A 4I1TA 2BANA 2RD5C 4AD6A 4RMNA 3I56S 5L1JA 5HMXA 3TO8A 3BF4A 3JQKA 3G8QA 1B0PA 2VQEC 1YJNS 1JKHB 2D9PA 5HMWA 1Y4ZB 3A4TA 3D0IE 2RE1A 1NKCA 4YMEA 3MR3A 1ULTA 4RZRA 3VVUA 3K5MA 3WIVA 1RAIB 4LQ3A 4NCBA 2XEXA 1TVRA 3QO9B 1TAQA 3GIIA 3LAMA 1PCAA 1VQLS 2YKOA 2ZBPA 3QJLA 4PZPA 2UXBC 2IM0A 1S49A 3OLAA 1UW4A 2IMOA 2AEJA 4WF9Q 2NREA 2Z30B 1BQMB 4DR4F 4P2MA 1QE1B 4DMZA 2AGPA 3B7WA 4N8OA 2VL1A 1N36J 2DPJA 3KG0A 3LWMA 2OEKA 1RXOB 3L95X 4G1QB 2ROEA 3PKMA 1YQHA 2HEKA 4GMKA 4NOHA 2DGVA 3NP5A 2K2PA 4C8YA 2G4BA 1NPPA 4P2SA 1NRKA 3NPDA 4I0WA 1RGVA 2ASLA 4DR3F 1XQIA 1N33C 2V4QA 3NGRA 2QIFA 4KHPC 2EEYA 4PQAA 4WKRA 3PX4A 2CQ4A 4KRWA 1NK0A 1NHUA 2UUBC 2EK1A 3QBCA 2W4CA 1DHMA 1HNVB 5LT5A 2ZZMA 2OPQA 2C3UA 4Q0BB 2XZWA 2NXJA 1P9YA 3C6UA 4NYZA 3JQJA 4V19J 2HFNA 3TJAA 3LWLA 4DV6F 2V9WA 5E3AA 5C25A 2HW3A 2DPIA 1T02A 1R8CA 1YBTA 1BHNA 4TY8A 2XMWA 3H0PA 1YJ7A 2MQPA 4KGVB 3IM9A 3UE2A 1RY2A 4K4TA 2JNVA 1VYAA 4KV8B 3H20A 1RLDA 5ETTA 3R97A 1VQ4S 2P6TA 5CD4H 3D6FB 3R5GA 2IVYA 4C8NA 2XS7A 3OVAA 3CO0P 2LKZA 2B9EA 3NGTA 4JI2F 3NGUA 1JXEA 2O1PA 1TKTA 3MM9A 2G13A 3BJYA 3BO4A 3CCZA 4LRDA 1YJTA 2N3OA 2B4PA 2K7JA 2O5DA 3DLHA 1SPBP 4NRUA 5BURA 2QYCA 5U47A 2UXDJ 4CLFA 5HJXA 5LM7E 2XNRA 3DLLQ 1HW9A 1AW0A 1P27B 4CLYA 1IR0A 3MM7A 4E8UA 1XK8A 1H2UX 1S1UA 1N32F 5T41A 1X9WA 2EGTA 3CCSS 2DGQA 1U45A 3CE8A 1X5PA 2KFZA 5HQLA 1JLGA 3GJQB 3DOMA 2W9AA 4NLUA 2E5GA 1HR0F 1P7LA 4CO5A 3W8PA 2OPRB 2Q1LA 3PYFA 4I6AA 3OLBA 2LQBA 2W25A 5T14A 2C2DA 1X4AA 3U27A 2J7UA 3VGVA 1LFPA 2VBZA 5C5JA 3KK2B 3G71S 4IR1A 4JYAC 1YG0A 3POTA 5BSWA 2CQIA 4QOTA 3NL0A 2KB2A 1YZ6A 5KFNA 3CCMS 4DZ6A 3EGZA 2HS0A 5DO2A 2SXLA 4FF2A 2MLXA 4DX7A 3OTCA 3V4IA 4JP8A 4N47A 3T6JA 3R8YA 1Z2LA 1RT4A 2B0GA 5J2QA 2WOMB 4DLEA 1XMOC 1LW0A 2VOPA 4DR1F 2CJ9A 4ZVEA 3MM5A 1TKDA 4CLWA 1M5SA 4C7QA 3ETMA 3NGSA 3KLVA 5BYRA 2B5JA 4DG1B 3JAMY 3HX9A 3LH2S 3A8JA 5EDWA 2VU5A 1D9FA 4ZVHA 5HO4A 1FRHA 3KG1A 3FCWA 3TDEA 1S6PA 3MEGA 3CXCR 4KGMA 4Y0FA 3C16B 2KL8A 2ZJPQ 3J81D 3A3PB 2ZOFA 4B3RJ 1L2FA 3RAQA 2R8IA 1C1BB 2ZNYA 1N5SA 1M90T 3OHAA 2W7OA 1FUGA 3V4MA 1UFWA 3HVRA 3KHLA 1TZ0A 1XR7A 4ZPBA 4XAKA 1QVFR 2YPZA 4J90A 3UN2A 3HHDA 1WEZA 4DR5F 3MPDA 2VFUA 3NCQA 4CM2A 4NXMC 1QJHA 4J9MA 4FYWB 3JTOA 2P9GA 5A8RB 1Y3JA 5KFGA 2JZ5A 2HHXA 1VBYA 1U1KA 4X64F 5JRHA 4USTA 4F2RA 3JAMU 1YDLA 3MXHP 3C6TA 1B99A 1OQ3A 3W65A 2YKNB 2QN6B 3KHHA 5C2CA 4QW8A 2N3LA 3T1YC 2KDNA 3BQ1A 4GXRA 3H4DA 1WC5A 3MOZA 2JEIA 5IWAC 3QWPA 1LKZA 1HBUA 3IG1A 3AJDA 3MCMA 3K2YA 1S72S 3VR1A 3M9MB 3SQOP 3U1MA 2EFNA 3OV7A 3PW7A 4L3NA 1IKYB 4HPVA 3I0RA 1VQ5S 3RB6A 2B7BB 1AMUA 4Z37A 4OYOA 3H90A 4XX2A 2B6AB 3CC2S 4WKYA 4DS4A 3CJ8A 1DARA 4YR3A 1IKWB 5L1LA 5I3UB 1BY9A 2GIFA 3CULA 3CDEA 3N6MA 1Y7PA 2KJVA 3CCVS 3AHPA 2U1AA 5E7QA 6FDRA 5K85A 2ZH2A 4RNMA 1TK5A 2Y1LB 4B9NA 4KTVA 2APOA 2LU2A 2RSQA 1OY6A 2EXUA 4IRKA 3LALA 3TUZC 2B8PA 4J5OA 2V94A 4ZVSB 1AXQA 2MKCA 1OY9A 4NE9C 1SQGA 4JI0J 4DFKA 3IXQA 1KP6A 5EUHA 2J7WA 1NHVA 2VJUA 3IEUA 3PYDA 4JB8B 3MAQA 2ZITA 4RPFA 4U8YA 2ZH1A 4WJBA 1YKWA 2YX4A 4IFYA 3BZQA 2FHJD 5CD4A 3L09A 3CQ3A 3OSPA 3PX0A 4ZVPB 2WSEC 1JOSA 5E2QA 4KO0A 4ID5B 3NG8A 3A3OB 2R2UA 2UU9C 2VQEF 3VQSA 2L9WA 2PMHA 4X66C 4GS5A 2HRTA 4GRSA 1CLFA 2HQFA 5L9NA 1WG5A 1SC3B 1S0MA 2J9DA 3MR6A 4I64A 4C8ZA 2AJFE 3X3UA 4GKJJ 3UQSA 4USWA 4ZIVA 5DV9A 3LPEA 3HJVA 3LP2B 1S0OA 1BMQB 3SDEB 1B3TA 1NEEA 1L3VA 1J5EJ 3W5XA 4QYZK 1IQTA 1K9MT 3DLEA 3MMCB 3MMBB 4Q2LA 5GTDA 3I0SB 5CYQA 4DQRA 2XS2A 3M32A 4ZJZA 4N77A 1JJCB 5ETQA 1SCJB 2FVQA 1FVQA 4ECVA 2NZCA 4ECTA 5D0HA 3U1LA 2MLYA 1IBLJ 3M05A 1ZM4A 4I2PB 4NLTA 4QYRA 4ZA1A 1U6FA 2HVDA 2CDQA 4J9KA 3HHLC 3RJMB 3NS5A 1EETA 3AY0A 2DRDA 5F0WA 4OX9J 2XI3A 3M6UA 3EICA 4GC6A 4MTNA 1N33F 1R27B 3I32A 2J8AA 3N2QA 2PN6A 1CULB 4KHPF 2VB6A 4OZ3A 2G9OA 1TL1B 4ETXA 3DGVA 3R27A 5KFRA 5L38A 1TL7A 5GAEU 5B0DA 2UUBF 1W26A 2H5EA 2CPHA 3TRGA 4P52A 2IBKA 2YKPA 2CNOB 5BR8C 2GO8A 2WBRA 2GMLA 2QYGA 1UFKA 2W8LA 3QAUA 5A2QY 1WF1A 1N34C 3DLKA 5K14A 2HNDA 4ZCIA 4RO0A 4DV5C 7FD1A 2ZUAA 4ED4A 1CG2A 3FSIA 3O3LA 3A25A 2YNFA 2AIRB 1G3OA 2BEFA 1U1LA 2EFGA 2W7PA 4LF7F 4L7IA 3TZWA 5K20B 3V6JA 5KG4A 3DI6B 4CLLA 4PUOB 2ZNZA 3R2CJ 3O8WA 3M8WA 1Q1KA 4NLXA 2QL8A 2Y9HA 3CNQP 2JEJA 1GT8A 5A6PA 5CH7B 5HATA 4MYUA 1IUJA 2XR1A 3FBBA 3CD0A 5DGAA 4B08A 1J2VA 1GXUA 2A1BA 4IG3A 1KKHA 1SJ4P 3R5JB 5A8KB 1ZM9A 2ZVSA 4ECQA 4EZ9A 2KM8B 2NPFA 4P6QA 3DHWC 2J6UA 3DFEA 2EWHA 3VQTA 4DR2C 3CIMA 1WI8A 1IWGA 5ETOA 4F36A 2LQJA 1ZBTA 5DM7Q 3HT3A 5A2QU 4X65C 1B0VA 2RKIA 1S77D 3D1QA 1YZ7A 2LLZA 4CH7A 4OI0A 3AD8C 2D7SA 3UI3A 1TFWA 1R0CB 2BE7D 4M1KA 3VNQA 2DISA 2CPXA 1OWXA 4KAIA 1TMMA 4R1MA 2ADCA 4FYXB 4LIWA 1TUGB 4YY3C 2VH7A 1L5UA 4LBHA 3PW5A 1P9QC 2BVZA 4IQMA 1O92A 3OTOJ 1GPMA 3W66A 1XRAA 1TL3B 4JYAF 4IOAQ 4URQU 2HIQA 4Y34A 4B3MC 2ASYA 2BOPA 1H2TZ 1ML8A 1FJEB 4LBIA 1WSRA 4OJ1A 4F0KA 5HVGA 1RTDB 2NYHA 3RUBL 1XMOF 2AX1A 8AT1B 2FD2A 3PACA 4OI4A 2HVZA 3KLIA 3R9XA 1BXNA 4LF4J 1EB0A 2HQGA 5D0RA 1DTQA 5KFPA 5KG1A 3PX6A 3PFOA 1AFJA 3D0HE 3AXKA 4JI4C 4DSIA 4JI1F 2BA9A 1UW9A 4I2QA 4K2JA 1PC5A 1JLAA 4USIA 1TELA 1XS3A 2J9CA 1IBKJ 2EK6A 3FNNA 2QE5A 3SBMA 4YB7A 1WNEA 2AJQA 4FXWA 3Q89A 4PROC 4O3RA 4RUCA 9ATCB 1A6LA 2CPZA 4A8KA 1NDKA 3DOKB 1D9AA 3M2UA 3IWLA 3GQCA 3HT0A 1HLWA 3GYXB 2A6OA 2CWKA 3NWGA 3VGUA 4NXMF 3N5FA 1CS4B 5LMUC 2JC1A 2KYXA 3UDVA 3IWNC 3GSIA 3BGRA 4QWCA 4F4XA 3OTBA 3VNSA 1ZS6A 1VLAA 2HKEA 2M5YA 4OI2A 5HN0A 2P2CB 4WV3A 4DV2C 4URGA 1RJJA 4DF4A 5KFOA 2OPPA 5IWAF 2HAIA 3HHEA 4DPOA 3G6ES 1WEXA 1WC1A 3I9ZA 3LANA 3BPDA 2VQFC 4OLOA 2CQGA 2P2QA 2BRLA 3J80D 2X3GA 1FRLA 2V7BA 2ATCB 2VC0A 2CNLB 3PYGA 4EGLA 3O2IA 1C4CA 4HT7A 4BHQA 2YNIB 4ICLA 4IH7A 3MWBA 2AP6A 2W4PA 4MMOA 2GGPA 1FK9B 3CW9A 4WXWA 1EAYC 1OQ6A 2DR8A 3DHVA 4N41A 2QTWA 3MPUB 1RTHA 2VBYA 1S9EB 2VIHA 1N8RT 2COLA 4KHRA 1LXNA 2DEIA 1XRBA 2B3TB 4B3SC 2P6SA 4JV5J 4PWDB 3P6YC 1IBMF 1E6VB 2XMAA 4O4GA 4NZ7A 3DDKA 4JI7C 3Q86A 3GCWP 2WSFC 2IJNA 1TL5A 3M8QB 4A8QA 2IIHA 3W9IA 4QU7A 4IH5A 2AEMA 1PC4A 2AGOA 2BKOA 4DUTA 3HK2A 2B56A 4DL6A 4ECZA 1UPPA 4AQYC 3UNYA 1VQ6S 3SEOA 1VQ7S 1D8ZA 2XI2A 3R7SB 4KTQA 4X4OA 3BBCA 4DSEA 2JSXA 4X62J 1MWQA 4DV1C 4CYUA 2F5GA 1U1RA 2UU9F 4U6PA 2YQ0A 5T7LB 1U0HB 1YTYA 4X66F 4X4PA 2VG5A 4OLPA 1K1SA 5K9FA 4EZ6A 1T03A 2HYIB 1M5PC 4KKOB 3DRPA 1KBRA 3EGWB 4LF6C 1FDBA 1JLEA 1ZZNA 1EKRA 1ZB8A 1JIHA 1YHQS 4S0MA 1WHXA 2CPJA 1V3RA 2W2PP 4LSNB 1N0UA 4DSLA 3OSNA 1HPZA 1D0EA 2FZKB 2HWIA 3CD5A 4RLEA 1F0XA 1IR1A 4LRCA 4R25A 3HKZD 1NK8A 3T1HJ 1UFLA 5AJ3J 3VWSA 4JM1A 2GJIA 3GIKA 4ANDA 2QEXS 2NPIA 1U24A 4J37A 5A8WB 1EP4B 2HRUA 4PKDB 3AFGA 1RB0A 2GVZB 1G6BA 4CLTA 5B7WA 5B0BA 2BM1A 4C0HA 4O4RA 2BZ2A 2FY1A 2DNOA 1RT3B 4RU9A 2H65B 2K7KA 4LF9C 1FJ7A 4ILRA 3ZZ0A 3VZIA 4C2MA 2P9CA 3QIPB 3K57A 4P7VA 2L48A 1PYOB 5BR8F 2CJBA 2MB0B 1MXCA 5AT1B 2RDDA 3W2WB 1C1CA 1Q8IA 2FLLA 1N34F 2ZE2B 2F8MA 4I67A 2GA7A 3QZ8A 4ILLA 4DV5F 4Y2AA 4W4MA 1AROP 4KFBB 1HI1A 1GTHA 2MQNA 1YJ9S 5HJYA 1HMVA 4WYWA 4QIFA 4KPYA 2UVWA 2BJEA 4RLFA 5HMYA 3IS9A 3BKFA 4R5PA 2HHHJ 4IZ6A 1IXKA 3OR2B 2E8CA 4FF4A 4KJIA 5HP1A 2CG4A 1F9EB 2DYAA 4ED8A 3OVBA 1SXLA 1RAAB 3P96A 3UR3C 3UEBA 2F8EX 1EKSA 1XBWA 2Q6BA 4ES3A 3BGOP 3K7RA 2X3DA 1RTZA 1X4GA 3MM8B 3NRBA 4K0KJ 2V5HG 4RR5A 1N36C 2HSEB 2M2BA 4M5MA 3W61A 3OXGA 2DY9A 4DR2F 4ZHRA 2K3KA 2JNJA 2QVZX 1P4EC 2Y8YA 4CO2A 2OBVA 1SV5A 4QR1A 1FVSA 1Q82T 2VG6B 1CC7A 2A18A 3IRXA 2HZAA 5KFTA 4K50A 3H8YA 4K4WA 2ZDOA 3PKYA 4X65F 5KFSA 4YN3B 2OMLA 1F5CA 4DI6A 3PFEA 4HLBA 1X8DA 3DGPB 3J81U 4CZCA 2GIQA 4Q8FA 5LMNJ 3MR7A 3QJJA 2NS1B 5K8FA 4F4KA 3H2TA 1RT1B 1PU1A 5T8SA 4DX5A 4YY3F 1WF2A 3TVYA 4RW9A 2H54B 2CQ3A 3A13A 3ILJA 5F9LA 4DU8A 3GP9A 3K5LA 4FNHA 1NKBA 2R4FA 5LL6d 4MTPA 1U2CA 3MR5A 4I9FA 2ROGA 3Q8QB 1GMWA 1NK9A 3CC7S 2Z2YB 2N82B 4B3MF 1SKSA 1PSDA 3QLHA 4RW8B 2DNHA 1RAJA 3NEKA 2HQCA 1X4EA 5IV3A 3NBPA 1KFDA 1N5TA 4D4IA 5KEIA 5E3CA 4LJMA 4Y2MA 3MEDB 4PXCA 1C0UB 1L3TA 3PJ9A 4Y2KA 5KTQA 1VC5A 2YWGA 4QYZJ 3RRGA 2RS8A 4OJ3A 1QTMA 3CJQA 4F4ZA 4LFAC 5M2RA 3BKTA 3G8TA 4ZVFA 2DJWA 4DZDA 4JI4F 1KRPA 3KXDA 3UDCA 2AT1B 4O3QA 3M1VB 3AD9C 2HNYA 4R0JA 4NEYA 4GXQA 3N4WA 2D1CA 3NNCA 4HTIA 3QRQA 3QWUA 3F44A 4ZVQB 2O67A 3C66A 3AOAA 2D3O1 4DV3F 1YIJS 2RS2A 1BD6A 4WS9A 1G7CB 4Q5VA 4EFAC 2VHGA 2UP1A 2DHSA 2R2SA 3GB0A 1Y5LB 2FPHX 2GVDB 3AA9A 1WKLA 2GW8A 4A8YA 3Q2SC 3W60A 4HHJA 1L3SA 4F0MA 5CAAA 3TW0A 2ATWA 2VDIA 2OP5A 1LXJA 2J5AA 5LMUF 1NSQA 4R0EA 1FERA 3HVWA 3H7HB 4U7UK 3TR5A 1CJUB 1S1VA 3TZYA 1M6XA 3UNGC 3AB4B 1CBKA 5E3RA 4G37A 5DM6Q 1O9TA 3EZ5A 4C98A 4TN2A 5G4DA 3Q8PB 1OSCA 3GE9A 3CD6S 1HNXC 5HAOA 4DV2F 1JWWA 4M5JA 4H4MB 5FLXD 3AD7C 1XNRF 4ILMA 2XWYA 4L74A 2VZEA 1I1GA 1NB7A 3GFXA 4K4UA 1H98A 1AB8A 2XYGB 4WZQA 3KMSA 3OUYB 2V4JA 3C14B 2YKMB 5HQ8A 3MECB 2NXUA 4CT9A 4IFVA 1URNA 2IPOB 4IG0A 3J7AN 1FJGC 4MYTA 2EFOA 1SJFA 2E5LJ 5DJBA 3GJSB 2XMVA 1M1GA 3OTEA 2F9JA 4AL7A 2PE8A 3KHGA 3EQ6A 4E0DA 3UX2A 4KY3A 3KLGB 2GNKA 1UVKA 2LU1A 2V2VA 4B3SF 4P2FA 3SIPB 4QWEA 1U47A 4HYKA 2BX6A 3R7NB 3K6RA 1FKOB 2AYMA 5J2MB 4ZS6A 4TLQA 1FKPA 3TARA 4JI7F 1QSYA 5LJ3Y 2B9YA 1ZTTA 1NMEB 2E7WA 3IA0A 2IJRA 3AQPA 2MZ1A 1FNMA 2M3DA 4NLQA 1S6OA 5HLFB 4C8LA 2J6TA 2NYIA 1XNQJ 1FTRA 2W2MP 4CLKA 2O3DA 1WKKA 4X2BA 4FXVA 3TA0A 2YH1A 3KNGA 1WORA 3D3CJ 2W7AA 1J5OA 1SJRA 1CEZA 2YX1A 4LF1A 4GKKF 2IA6A 2QW0X 5KFEA 3BB5A 4DV1F 1GH8A 1LFWA 1MN7A 4RLQA 1ZTWA 2KKHA 4P10A 3E8OA 2CZ9A 1AFIA 4B9UA 5BSVA 4V19X 2CJQA 3GYNA 2D74B 2PGCA 1HWLA 2JFDA 1KHWA 1ZA2B 1U6BA 4LF6F 3DCAA 2BJ1A 2ALYB 3ZTOA 3DDIA 3N6LA 1DLOB 4CTAB 1T9YA 4F26A 2LMIA 2BE2B 4BBYA 1T3NA 3AH6A 2J0SD 2C42A 3HSGA 1UJ5A 3I5AA 3MFHA 2Y1IA 2A0FB 3CCUS 1RKJA 2DXDA 5J2PB 2G1DA 3BSAA 1KEKA 1WC0A 1DQ9A 2FLPA 4HTJA 1X31C 2WW8A 5EHHA 4KSEB 4JI3J 2DCUB 1LWCA 3Q22A 4JI8F 3TEHB 4J9OA 1X4FA 1RWXB 1HA1A 4R8UA 4ZDNA 2KZFA 3BYPA 5B0GA 5IV4A 3CJKB 4QPXA 5J2NB 2M70A 2MQQA 4XDDA 4QU6A 4ZVRB 1IJFB 3EZUA 2KZ0A 4JI0C 1IBCB 4Y6IA 2M8DB 1FWLA 2ZBRA 1FEEA 3M2VA 1VQYA 3H5SA 1BGXT 4LF9F 3VAMA 3CCLS 1R6VA 4PWUA 1HNWJ 2ZD1A 2CZVC 2F1FA 2C28A 1UPMB 2KO1A 2B7CB 1TU0B 5KFLA 2R9LA 2Y1JA 5AE1A 1OY8A 1VJWA 4HHHA 4G36A 5GAEI 1U09A 1X4HA 1SQFA 1GX5A 4FUTA 4CNYA 4GKJC 1OSDA 1BQXA 5DDOC 2Q6CA 3ZZTA 1UEKA 3K5OA 3GJRB 4I7FA 5H1SV 1HYSA 1U02A 3TVZA 2YCBA 3Q8YA 1UCNA 8ATCB 1HWUA 4DCSA 4IDKA 2HHTA 1WHYA 2DB1A 4NLPA 1UVNA 2I8EA 3RBZA 4DFJA 1J27A 1USPA 4KQZA 2E5JA 2GHPA 4NOZA 1RT7A 1YWXA 1TMJA 1I5OB 2UXCJ 1VFJA 1LCIA 1N36F 1L3UA 2CY1A 1HQUA 4LFBJ 2XLIA 4JI5C 1RWMB 5HROB 4OX9C 1CSJA 1HH2P 1U1QA 1U1NA 4HKQA 1OPZA 2GAGC 5CA5A 2PT0A 4RWWA 2MDAA 2LXFA 5G0RB 5C42A 3DHXA 1LV5A 1FNOA 2DGWA 1FO1A 2WW4A 1VK8A 2YVSA 4WTOB 4RNNA 3J80Y 2VFVA 2XO6A 3KKFA 5IOLA 4AXJA 4Z2XA 2FVCA 2CQ1A 4A48A 4I56A 5MLCV 3H5YA 3HFKA 1Q4RA 3SSRA 2IRXA 1I94J 2BW2A 2C1EB 3U1NA 1G4CA 1D3WA 4OYIA 1S59A 2OTLS 2HHQA 4M5DB 4RUAA 2MZSA 1NPKA 1V9OA 3M6VA 2PMWA 5H9FK 4HI2A 4UOHA 1KDNA 3IEVA 5IM0B 2RJZA 2ZFHA 3NYQA 4MH4A 4ISBA 2PT7G 2HLTA 2AZ3A 5FDLB 1N88A 1M6XC 5ETKA 1YJVA 1WCJA 4ES2A 2J9EA 4UQTA 1APSA 2Z2LA 1TL4A 2IC3B 4KT0C 2CQCA 2I5JA 3T1AA 3W3SA 4LMZA 3ZZRA 1YJWS 4ED2A 2YNGB 1Q81T 3EERA 1EIYB 4ZJOA 4LFAF 3HDSA 2Q43A 1KHVA 3J80U 3GJTB 2XB2D 3B54A 2FJDB 2VBWA 3IAM9 3BH6B 3VNRA 1HNZJ 2M0GB 5D3GA 3T5KA 5A0YA 4KE5A 3NOGA 4DU7A 3SYZA 2C22A 3BM7A 2BACA 4X4RA 2DHHA 2UUWA 3HFZB 1FKAF 1VHFA 3KUEA 2BRKA 2YWCA 3ENQA 4DPYA 1K44A 2PIIA 3QGIA 4NCGA 4RJVA 5CCLA 3CWJA 4DPTA 3NCRA 1SL0A 2ZWOA 4PXEA 3EM1A 3FRYA 3LP1A 2QMXA 1NDPA 1YJRA 5F8JA 3KJQB 3IBFB 5LOQA 3D54A 2GMJA 2BE9B 5KOWA 4DG8A 1CJKB 4ZCMA 4MH8A 2BJ9A 1VBXA 4IRCA 3I31A 3OTOC 3KJFB 1M5OC 2BANB 1VRTA 2MKIA 2WVEA 5L9XA 3D68A 1X5SA 4M94A 3H40A 3EPGA 4F4AA 4PXDA 3QT8A 4J9VA 2DVIA 2ABYA 3EDQB 1UWBA 2YQ1A 4LT6A 1RT2A 4RX6A 1SKRA 4HR2A 4JI6J 1HARA 4WCEQ 1NLKL 2DNRA 3M8PB 1TVRB 4ECRA 2F4VC 1NBEB 1X4CA 4P74A 4AYBD 1RUSA 3AF5A 3ZC4A 3S1TA 3RBDA 1WWHA 3F56A 4MFBA 4ZMMA 4NRTA 3C8YA 4QPTA 1QUPA 3KWMA 1JXVA 4RBUA 3FCEA 1E6YA 1NJXA 4NA3A 1FJGF 4TNOA 3DRRA 2E0GA 3UCZP 2A2CA 1T9TA 2ACYA 4B3RF 2AHOB 1IBKC 1RLCL 3ETOA 4DN0A 2JH3A 2V0NA 1RTJB 3IM8A 5HL7Q 3T9NA 3PY8A 3HZGA 4KGZB 3MEEB 4ZVGA 3W63A 3OFFA 4DV7J 1FHTA 4DR7C 3MMCA 2HVEA 4QW9A 3U02A 5K8MA 5BSTA 4OZLA 4CO0A 3AJ2A 2C2RA 3FJ2A 1HBMA 3LGXA 4ZPWR 2JVRA 3H98A 2OPQB 3K8WA 4DV6C 1YRTA 5C24A 3N5BA 1RWKB 2B9WA 1M5KC 1O93A 3C6UB 1PJ7A 4PCQA 2DGOA 2IM3A 4OI3A 5C25B 1PYSB 1ZB9A 4Y2IA 1W7WA 2FQQB 2VF3A 4TY8B 4WFZA 2J76E 1ZPWX 4FZVA 4DUYJ 4WFNQ 2ZM6J 2DHAA 1RU1A 1HWIA 1YI2S 3NLCA 3TJ8A 3QIDA 3K17A 3MUVP 1OS5A 3GPAA 2CNNB 2QMWA 3ISZA 2RRAA 2YNHA 2F3JA 1OYEA 2E44A 3DRXA 4XPCA 1WDTA 4PPZA 3N0VA 2Y0BB 1KC8T 2WONB 3IC1A 4LREA 4DR5J 2EBGA 5B09A 3DXSX 2ZH5A 5IT9Y 4GVBB 1LQLA 2FJXA 1IKXA 5IFIA 1TKTB 1WSVA 5ADZA 3MM9B 3PW0A 3FQKA 4OI6A 4HDGA 4OHVA 4X64J 2ZBQA 3X1LB 3HF5A 3ZZPA 4P75A 4OX6A 2DITA 2RH3A 4KBIA 2VG7A 3Q83A 2D27A 2DGSA 2E5IA 2VKZG 2POKA 1RA6A 5F3TA 1NNDA 2WK4A 2HG4A 4JV5C 2XZTB 3NAIA 2I9SA 3BS9A 3MM7B 1S1UB 2JJ4D 4USMA 3GYGA 1KTQA 3ITHA 1JLGB 2BQUA 1T8EA 3DOMB 1RCOB 1U1OA 3THVA 4PR6A 3DM2A 3KG4A 5DQIA 4JI0F 4USJC 3T5HA 3TWZA 3I55S 1ZAWA 3RBEA 2MJUA 2RB7A 2LCWA 2MTLA 3O44A 5KG7A 3FCHA 2AZ1A 2M4MA 3K59A 1H74A 1T9XA 3K58A 4O23A 1VQPS 3SZ2A 3FKBA 4DSJA 3POTB 2XWXA 1FFWB 3O6QA 4WE1A 4ZVTB 4OZ0A 4OYPA 3DRYA 1GTEA 2AJ4A 3PR4A 4GKJF 3V4IB 2VUGA 4M5GA 1TK8A 2VA3A 1LW2A 1RT4B 4ECWA 5J2QB 2QA4G 2MSSA 2MZTA 5DDQC 2D1QA 1J5EF 5IT4A 4U7CA 1LW0B 1UEUA 1VRQC 3MM5B 3OD2A 4EWTA 3LUYA 4EBDA 2L41A 3FQLA 2B5JB 1NHKL 2PA8D 5B0EA 3PJWA 1SJ1A 4CCHA 5I3PA 1H7WA 3T1HC 3PJXA 3CT9A 5IXUA 1X4DA 1T05A 3IPLA 1QSLA 1RAFB 3MEGB 3V6KA 1REGX 4NL5A 4JI5F 2AU0A 2FVRA 5KYVA 1NK4A 2KH9A 4OX9F 2HBRB 5KFFA 1WUUA 3M30B 3VVTA 3MGJA 1V60A 1ZA1B 3ULHA 2OHDA 2IDEA 1Y10A 4M95A 1S79A 2HFVA 2QLBB 2UXBJ 2DGUA 3BN4A 4RVOA 2HGLA 2HFUA 2MM9A 1Y3KA 1RWNB 4D56A 1UZHA 2JDJA 4B9TA 4RVNA 1NB2A 1A9NB 3FFIA 2DHGA 1F1BB 1XR5A 1MROA 3M7VA 4HH1A 2DK2A 2WCXA 3GIJA 2DNLA 1VQNS 4DUZJ 1F6TA 1FRXA 4FDFA 1K73T 3C6TB 3B6BA 4OV1A 5AE3A 4KHPJ 3SSSA 2GC8A 3ENAA 2V68A 4NPOA 2XS5A 5KT5A 5CHCB 2HIYA 4FNIA 3IG1B 4O0NA 2ACMA 4M5NA 1FWPA 4EYIB 3DLGA 2UUCJ 2JWNA 3DLJA 1N6QA 1RYSA 2E1RA 3F73A 1CJTB 3QZ7A 1OJ4A 1X4BA 2M7SA 3I0RB 4KTTA 3BBBA 2CQDA 1WG1A 4FS2A 3UOWA 1TUWA 5FLXU 1SVDA 3LW5C 2AYBA 2BXJA 4USVA 1UJ4A 5E7OB 3R1LA 2ZHAA 3C15A 1LNQA 1PAUB 3C3LA 5F8LA 3QFHA 4ZOSA 3CEDA 4ZVOB 3Q2TC 2G0CA 3HXMA 3K5PA 1GX6A 2G2ZA 1HQ2A 5H9EK 4NLYA 3CJ5A 3GFYA 1O6XA 5EWFA 4HHUA 1WC3A 2I2YA 2D69A 1K0VA 1QSSA 1HHQA 2AX0A 1JLCA 3IMLA 5LMNC 4OZ5A 2YQ3A 3HULA 3K0JA 4RBVA 1QAYA 1JLQA 2R7SA 1Y11A 4NEZA 5ETPA 1D8YA 2HBQB 1BWEA 4ANCA 3EPIA 3CJ4A 5K8NA 2KVQE 1V6HA 4DPXA 2RUSA 2XY6A 4IFYB 2GAHC 3OTOF 3UCUP 4CLPA 2R8JA 1V3ZA 1U25A 3DU6A 4KO0B 2MKSA 3BGFA 3DDNA 3FK4A 5KFBA 2JLEA 2HHWA 3HVTA 1R89A 1NH7A 3LPYA 1R7IA 3A8IA 3M8QA 1Q86T 4LR9A 5D6GA 1NCLA 3MR2A 2WVDA 2E8FA 1WH9A 1MU2A 1W2IA 5F9NA 3KTQA 2J0QD 2B9XA 2F4VF 3DLEB 2I38A 3UX3A 4DR6J 4F25A 1T94A 2IRYA 3IFEA 3C2PA 3UDLA 3UN3A 5CZVA 5CYQB 2DD8S 3PHEA 3M32B 2C3YA 2CQPA 4WIIA 2F9DA 2ZKTA 3LGMA 5KT4A 2FJBB 3QSIA 1T9UA 4WFXA 2FHJA 2PI5A 3WBZA 1HHSA 2HBZB 2D28C 4UY85 1EETB 7FDRA 1MWZA 1UP1A 5LJ5Y 2H1YA 2WVBA 1IBKF 2MZQA 3MPYA 1VQMS 2F4FA 4FXDA 3FMWA 4DR7F 4FVMA 3GU0A 3DOLA 3PDNA 1TL7B 2ZJRQ 4TU9A 4BDPA 5EWGA 2OGUA 1R3NA 3MM6A 3NXZA 1R31A 2XG8A 4OFZA 4DXLA 2RRNA 3CTRA 3M8RA 4NLSA 4M5HA 3TOQA 2DEJA 1F3VA 3HSZA 3DLKB 5K14B 4C8OA 2HNDB 4HVZA 4ELVA 2KM8C 3MHYA 3Q23A 3QFWA 4LF7C 4QIVA 5DLGA 2WSCC 3VAFA 2E66A 2YNFB 5FIIA 4O3NA 4F7VA 1XMQJ 1SH2A 2UVVA 2MMYA 5H9FJ 2MEWA 3R5CA 3OVSA 2P2JA 2CIMA 1YX2A 2PROA 2HHVA 4WBFA 3JB9k 1KQGB 4LRAA 2EI5A 2H9ZA 3CCES 3KJVA 4JV2A 2EC2A 3TAMA 4PEOA 2CG8A 1ZAXA 1MWYA 3J7ZT 1JLFA 3N79A 4NXMJ 3HHLA 2DPLA 3R9WA 3W2WA 3R6GB 4IG3B 3KMQA 4LSLA 1O0PA 3PBKA 2OEJA 4N76A 4K4VA 2XGPA 2Y4NA 1RAEB 1YBUA 4OZ2A 2E5LC 4MK8A 2V2KA 5DG9A 3NI2A 4X4QA 2R7VA 3PIPQ 3EGVA 2QVXX 1NSKL 3KLFA 4ZK7M 2QJ3A 3N54B 1TTHB 5DLFA 2FC9A 3T1YJ 5E3QA 4JV5F 4K5RA 2VFSA 3NKYA 3A4IA 4ZP9A 1KOHA 4TQRA 4BSZA 2CXEA 1B7YB 2RKIB 2IYIA 1FJCA 2UZAA 4LRFA 1SIZA 3ZTPA 1X9MA 4WPAA 1WI6A 1QAIA 1XNQC 2E7XA 4PQUA 4OHXA 3CPWR 4DG9A 4RW6A 3C46A 4K0BA 1S1XA 2CDRB 1NUEA 4LBPA 5GAGU 3O1LA 4PG4A 2CJXB 3D9BA 4XIUA 2Q79A 2F40A 2KXFA 4ES1A 2LYVA 3SCIE 4JUZA 1VQOS 3DXBA 3C5EA 2MGZA 2E9RX 3UVJA 2MY8A 1PAEX 5F41A 2L3MA 3GV5B 5KT6A 3P5TL 3GR1A 2OELA 4FYYB 4ECSA 2OPSA 1CVJA 1FT8A 1W2BR 3ZXWA 1CPZA 1FNXH 1F2HA 5KT2A 2HZCA 4WU3A 1CJVA 1RYRA 2OKQA 1Q8LA 5H9UA 1WTFA 3KLIB 2IAJA 2CWXA 1QM4A 2DO0A 5DQHA 1DTQB 2BKNA 2M5HA 4JI1C 4M5KA 3T1HF 1RHRB 5AJ3F 1SC6A 3M8SA 3HO1A 4BLGA 4LR7A 3DKDA 1RG9A 4U9RA 4I2QB 2HNZB 4OX7A 1DZ5A 4A47A 1R0BG 4OXIA 5IT0A 1VQKS 1JLAB 2B4UA 2HURA 2ERRA 1Q16B 2QO3A 1RCXB 2R7TA 2FJWA 1P8GA 1LK5A 1HWJA 2IM2A 2HVHA 3M9NB 1RI7A 1KD1T 2VFRA 1Q5VA 1WKJA 3M2UB 1FXLA 1XR6A 2DKOB 1N4LA 1REVA 1XMBA 2NQPA 4UOCA 4UZCA 2LDIA 1K1QA 2OFGX 3FSXA 4EEYA 2GIRA 3W64A 1WDDA 1NK6A 4B3TC 3WHIA 5ITHA 3BGRB 2K06A 5KG0A 1U2RA 5LXRA 5IFMA 4FBTA 3BDEA 1T95A 5MAOA 3LAKA 2IJFA 4QIWD 1T0TV 3D28A 2NSBA 2DHMA 4L4QA 1NAQA 3BO2A 2OPPB 4FBUA 3V6DA 1N5YA 1DRZA 2NUHA 3WIUA 2BJ8A 3PRBA 2OI2A 1WOSA 1Q8KA 1PILA 1XRCA 3TX0A 3H2UB 4K0KF 2CYYA 2UXCC 4YUDA 3OQ2A 4OHWA 4LFBC 1H73A 4ICLB 1VBKA 4OJHA 2FDNA 2GGPB 2JMPA 2UV8G 1RT5A 1IKVA 1RTHB 2XQCA 4LFCJ 3RU0A 3RGIA 1IBMC 2GZOA 2IM1A 4ETZA 4DX6A 1WC6A 3MPVA 2BJOA 1XERA 1TAUA 4ZP7A 1KVIA 5BYSA 1OO0B 5IC6B 2OJ3A 2OPLA 2P9EA 4O4GB 3OFEA 3FZBA 3G82A 3RAXA 1PGZA 5LMNF 1SH0A 4CIOA 4LRBA 4E98A 2OSRA 1FDDA 2CKWA 4B9MA 2GQ2A 3NNHA 4WZMA 2V63A 2OFHX 2ZH3A 1WELA 4DR2J 2KI2A 4F67A 3CMQA 2VKRA 3OPKA 1HBOA 2B4VA 2ZZTA 5B0FA 2MQOA 2AYGA 5LSRA 4HDHA 1MSWD 1HKAA 3FC9A 1PBAA 2W01A 2R7OA 4BWJA 3H5UA 3P8BB 1JQGA 2OD4A 3SI8A 1FKOA 4CYUB 4X65J 2IBOA 3T41A 4X4NA 4G65A 2VG5B 2MCQA 4YB5A 2AJ1A 3ET6B 5EX3A 2LEBA 4USHA 3HLUA 4OYZA 1T03B 3RG6A 5KYTA 3DRPB 2VA2A 2JX2A 1JLEB 3ISND 1NZ8A 4D3HA 1SKUB 1Q78A 2C2NA 3ILIA 3V81A 2BR0A 2QA4S 3NGKA 1IB8A 2ASJA 2D3UA 4O44A 1HPZB 2E29A 4AT1B 4RBTA 2LEPA 4PWWA 3VAKA 2ZC4A 4ZIWA 3PXGa 1RT6A 2AF6A 4X4TA 2ADBA 1NKEA 3KFWX 5BUSA 1FDAA 4IYQA 4J9PA 4FP9A 1N5QA 1IN0A 3CDBA 4CO3A 2YWKA 2BKPA 2H4YB 3UWTA 3K8VA 1FD8A 5B08A 1IJEB 3H2VE 2QA1A 2WD9A 4F8RA 3VAHA 2FHOB 3FZ2A 3WX8A 3I9V9 3TZZA 5D78A 4ED7A 2I6WA 3G7SA 2FLOA 5GADU 4K4ZA 2WTFA 4NLVA 4LVOP 1SB6A 3LGNA 3ILLA 2NZ4A 5D4OA 3OBIA 1FX2A 4Z7CA 3DRSA 1RAGB 2JFKA 1QDUB 2VZ9A 4HACA 4JI4J 4OYAA 2OAUA 1DBDA 1C1CB 3B4DA 2MXYA 4LUBA 5SZTA 3CJ0A 4FTFA 1MDFA 3OFHA 2ATLA 3HI9A 2DRAA 1HMVB 1C0TA 3A8KA 2LXIA 3UN5A 5CYMA 4DSKA 2N4CA 3IS9B 2LDYA 3QGGA 4R5PB 3FRZA 4C0OC 1U2FA 4L73A 5HP1B 1JNZB 1TKZA 1UVIA 2H4WB 4A8SA 3WC2A 2RVJA 3CSKA 1FRKA 5JVHQ 2XBPA 5K8PA 4RW7A 3NS7B 1SH3A 3FBFA 1R8AA 3JYTA 2LEAA 3I96A 4Y00A 1V25A 1M5HA 3FMBA 1RDRA 2E5LF 1HQEA 2E5HA 1MMNA 2L9NA 3JTNA 4ZHRB 2MKJA 1UAWA 5DG7A 2EPIA 2E7GA 3G87A 2WB4A 2HFSA 2GJ2A 5H9EJ 3IRXB 3GIMA 3JQMA 1R8BA 4C8MA 2KYZA 1WACA 2IFXA 1VJQA 4TQSA 1VQSA 3QMQA 3MCSA 4G6VB 1WTBA 2VQFJ 1T5DX 1S97A 2FY8A 4YHHC 2YWHA 4EBEA 3HKWA 3CW8X 1R43A 2NUUG 1XNQF 6FD1A 1G1XA 3PO5A 3IWXA 5FJ4A 4PYDA 3E3XA 4ITSA 2QSFA 3G8SA 4NA1A 1KTVA 4RW9B 4AFFA 3M9OB 1NZAA 2GQCA 2K3IA 1KSPA 2PFDA 4IR7A 2CPDA 1UVJA 2MHNA 1DY3A 1DQAA 2MSTA 5HI7A 4DJBA 2EFPA 3R7BB 3QLHB 2R42A 3J81j 2FHMA 4JI7J 4J91A 3W1YC 3NBPB 2LQ9A 2ZHOA 1U49A 1BWVA 4L75A 5J1EA 2FGOA 4R1LA 3ZO7A 4B3OA 1P4EA 1KS2A 4AQYJ 1ZYQA 3I5CA 2LQ8A 3WQPA 3LQVA 2LVWA 3AAWB 1YK9A 5DS7A 3IO1A 4UOFA 5IM0A 3AF6A 1XHJA 3IBWA 4JI3F 1ULRA 1VLOA 2XSJA 3TQIA 4F0HA 1AZSA 2HNYB 4HL9A 2DTJA 4UT4A 4CNZA 1SKWA 3BBFA 2N4DA 2BUNA 2R2RA 4DV3C 5HBMA 1VISA 3KLHA 4D57A 2HJGA 2MJNA 2X1GA 2HLUA 4CQ1A 3IRWP 3PESA 2OO4A 2U2FA 2CQBA 4OV6A 3HP6A 1UEVA 1HNWF 2DY1A 3PRVA 3G4SS 3THTA 5D4NA 4RW4A 1HI0P 4B3TF 4ZJLA 3DLPX 1S1VB 3IR5B 2GFFA 2HMIA 2AEFA 2CADA 1S9GA 5FD1A 1MNEA 1TP7A 1XNRC 3WZ0A 2WVCA 2X7IA 2HK2A 3TR3A 3LAXA 4U7UD 2B8QA 3E01A 1O90A 3KUHA 3THPA 4C97A 2VFTA 1X0FA 4LF2A 2R7QA 1R8PA 1GFWB 4KPCA 1CJKA 5CCMA 3QJPA 2Z58B 2EBEA 1KVKA 3TP2A 2KRBA 2J8SA 2V4JB 4RWXA 3W5ZA 2HS3A 5I4MA 2UXCF 5KFZA 1RBOB 4IFVB 4LFBF 1H0HB 4IG0B 1VRUA 4LF8J 4DEZA 1VHIA 3ZTRA 4YFUA 5F3ZA 3TYTA 4PUIA 2XMTA 2MPUA 2DH8A 4ENOA 3PW2A 3GSDA 1A0OB 2M88A 2OEMA 1DFDA 5KFVA 1LWFA 4UZBA 3CQ1A 3M8PA 4DV4J 2E8EA 4UUXA 2M52A 2IYGA 3R2DJ 1K8AT 1S0NA 1FKPB 2V8HA 2ALZA 4ED5A 4IUFA 1FE0A 4B9VA 5F8NA 1KLMA 1PG4A 2EKNA 2E7VA 1RK8A 2QFJA 1I94F 4FN5A 1BLUA 4X4SA 5L8RC 2NXEA 1ZPVA 2CFXA 3CMES 4GKKC 5L39A 3E2EA 3TAQA 1J5OB 1GK8A 4ZPVR 4DUZC 1T9VA 3TQ1A 1K0TA 5BXIA 1FEHA 1RTJA 3GCXP 3KK1A 5EWEA 3BGUA 3MEEA 4TU7A 3DYAA 5KG3A 1VQ9S 2XM3A 4G1PA 1S1WA 4B02A 3SXLA 5BUQA 2W9BA 2RU9A 4RL1A 2UUCC 2RHSB 1BA3A 5GMEA 3Q8UA 4CP5A 3QT6A 1T5HX 4PUGA 1RTIA 4FPIA 1HBNA 3R1HA 2CQ0A 4MIWA 2ILYA 3EVOA 1P1TA 3MTJA 4B17A 1Y9OA 1TH5A 3D4JA 4ZLLA 3D2WA 5ETSA 2VDHA 3NMRA 4W98A 5KG2A 1HNZF 1RHJB 4WWSA 4JI8C 2RNEA 2V8PA 3L9ZA 4ANEA 2HHPA 4CT8A 3GLJA 4C3LA 3LNOA 2XMUA 4LQ9A 1FTCA 1FRIA 1TKXA 1LWCB 3A3NB 5BJRA 3SO4A 5I42A 2WONA 4PXBA 3KK3A 4R8UB 3OR1A 2G2OA 3PW4A 4TLRA 1OIAA 2P20A 1S9FA 2DXFA 3RRKA 4RM3A 4GVBA 2GO9A 3IGVA 2R3VA 3MD3A 4DS5A 4EBCA 4DL2A 2UUAJ 1R0AA 3JS9A 3M2VB 3M2RA 2DXEA 2CRLA 5A1IA 2PO4A 4RM2A 3UO0A 2ZWPA 4LFAJ 2DIUA 1RHMB 2R7UA 5GAHU 4EK2A 4U5YD 2ZD1B 3NGDA 3ZZYA 4NLOA 4H54A 2NCLA 4DCPB 4J9SA 5CQGA 3VV2B 3J81Y 2X51A 2ZOGA 2WHOA 1TV6A 4ED0A 2DR9A 1JLBA 4DCJB 1BQNA 3LF0A 2BJ7A 2XC9A 2ZH4A 4Q8EA 4IOBA 3MAHA 4FKXA 4WK1A 1R8HA 1AYEA 1XJWB 1H3DA 3BN7A 1NSPA 1S7IA 2RF2A 1FE4A 2K1RA 3HVAA 4JI6F 2UUTA 2VICA 4CI0B 3IGNA 4I7FB 1KOOA 3CUNA 1EHWA 1HYSB 1LEOA 1IR2A 1RBAA 3GV7B 5KFMA 4DR6C 2H51B 2W4DA 2XCAA 2BJDA 4IDKB 2AQ4A 1TQLA 3B78A 2WRMA 1S4FA 2ASDA 2DT9A 1SL2A 2M5OA 2VPWB 1USPB 2G2YA 4NI2A 5F8MA 1RT7B 5DDRC 2DNPA 5HVHA 2RHQB 2W9CA 1HQUB 2YX7A 4NMXA 4QIEA 4UUWA 1GXTA 2PEBA 3B82A 2FIUA 3A26A 3BR9A 3SFGA 4CLUA 1NYEA 1HNXJ 3TVKA 4EO8A 5C42B 1PIEA 4DV7F 3AODA 1N52B 2CQ2A 3HHKA 4QR2A 5KAKA 4YHHF 4ED6A 1HD0A 4TKTA 1LWEA 3AQOA 2G0IA 2V4RA 1PA4A 3OL6A 3NYRA 1URRA 4EATA 3SQGA 3VGSA 4F4WA 1FJGJ 3V5RA 3MMAA 3GG1A 2D7VA 1U8WA 1XMQC 2RU3A 4DUYF 2ZM6F 5JVGQ 3M30A 1Y5NB 4Q2MA 3BGLA 2M9KA 2XULA 4OYWA 3EGNA 2C3MA 1V26A 4C11A 2KN4A 2RILA 4Q44A 1S6QB 1DTTA 5GAGI 3MAAA 1GNKA 3R5BA 2ZUGA 1AUSL 2H5IB 4MT1A 2IDLA 1FLOA 3H59A 2QG9B 3CJSA 2BBEA 2CJAA 2I5JB 3LO3A 4LF5J 2FZGB 3D67A 3S82A 1Y5IB 1NJWA 1U1PA 1NK7A 3KLEA 4I68A 1SUQA 2UV8A 4PG5A 2UXDC 4NLDA 2YBVA 3BSCA 2E1AA 2FJVA 4CDIA 2P2BA 3E7XA 3MF5A 2AYAA 2V8GA 4K2XA 5D3GB 5A0YB 1VOMA 4QQBA 2RUGA 4AE5A 3CW2C 1CJTA 4Y28C 2X1AA 2KT3A 4NCGB 4CH0S 1U6ZA 3CIZA 1V5IB 3JTPA 1WC4A 2CPIA 4KGKA 3LP1B 2PI4A 1MXBA 1A7GE 3LTOA 3IP0A 3W9JA 3DMJA 2DCLA 1YVFA 1NK5A 3W2VB 4B9SA 2GMHA 4B9LA 4MK9A 2CXCA 1FA0A 4H4OA 3JSMA 1VRTB 1N56A 1ZAVA 1SC4B 3DAYA 4NXNJ 3ZZUA 3OXLA 2CPYA 1S48A 2ZDPA 1S1TA 1YGYA 4PG6A 1SC1B 3HHNB 3D66A 1KN6A 4JBCA 1VQ8S 2EFVA 2X1FA 1UWBB 3T19A 1RT2B 1HL6A 2GHWA 5KFKA 1NU4A 2LECA 4O0IA 4ED1A 1O8BA 2Z51A 3ILOA 2HWTA 4IKAA 1ZETA 2DO4A 4MFBB 1LK7A 2LXUA 3LOUA 2AJ2A 1RWWB 1P1LA 1Q95G 2ZHBA 2KDOA 1X0PA 3VCDA 1JKHA 1YITS 2HS4A 5AXMA 1E6YB 1B4SA 3R5DA 4B3RC 1NH8A 4YR2A 4LR8A 1HHTP 3SFUA 3DRRB 2PDAA 3PNIA 2OTJS 1HNIB 1X5TA 3QO9A 3PG9A 4PHTA 1OMSA 5JXSA 2B4OA 3GONA 2JVOA 1VIXA 1HD1A 3ZTQA 3RR7A 2UXBF 4J9NA 3US5A 4ECYA 1BQMA 1WHWA 1QE1A 4G3IA 5KFJA 4URSA 3P49B 1HBMB 3R5AA 1VBZA 4G1QA 5C24B 5GMDA 1DQ8A 3EVWA 3CCQS 3QATA 3TUIC 4U67Q 1DAXA 1N48A 5JJBA 2D9OA 5KFUA 1B0TA 3KHRA 4JI5J 4DHVA 2XMKA 4DUZF 4EUVA 1QAJA 4NLWA 1NDLA 2D1SA 1RA7A 4DCVA 3ZNJ1 5JUMA 3RB3A 4YDDB 1HNVA 4FYVB 5M2UA 5AE2A 2BYCA 3HHLD 3GIRA 2YNHB 3EJMA 4Q0BA 2UUCF 1IWAA 3DU5A 2PFFB 4DL3A 2DR5A 1T3OA 3HD2A 1I51B 5KFAA 2EC0A 4QCLA 2ZVIA 3MUTP 4DCUA 1NDCA 2DR7A 3MPWA 3GTYX 1NY8A 1IKXB 2H48B 5CYJA 2IRUA 1WEYA 2OUGA 4CWBA 3GKUA 3CD7A 3BPSP 4U95A 2RQCA 2P2FA 4KV8A 4YOEA 3I4PA 4EU0A 2XO7A 1GEHA 3Q24A 4DL5A 2VG7B 2NXNA 3FEXB 4LFCC 2WP0C 4NDNA 4PRFA 4FUQA 2DH7A 5HQMA 4F3QA 1Z1ZA 4NWBA 3QQCD 1UTAA 3ITHB 1S6UA 3FVYA 2A2DA 3DM2B 4DV0J 1X5OA 4L76A 3Q8RB 3J7YU 5C2GA 4RNHA 2BOAA 3RW6A 2VPZB 2Q66A 3ELHA 1M0SA 1S12A 2FHKA 3FEZA 4K59A 4PG8A 3NWRA 2XNQA 1ELOA 2YTCA 2XGQA 3LP0B 4UW2A 4WE1B 4YS2A 4DFPA 3J7A1 2GHVC 5GADI 1N5VA 2ASBA 2OPRA 1J5EC 3PIOQ 2BQRA 5D0GA 1LW2B 1PO6A 2QA2A 4OYMA 2C2ZB 1U48A 4ZN1A 1ZM2A 4I6WA 5HANA 3RR8A 2CVIA 3KK2A 3MI7X 4DR6F 3I6PA 4A8XA 1WJ9A 2RIJA 3HMJG 3EDRB 1QAXA 1KFSA 5DDPC 2FVPA 1IBLC 4DL4A 4K4YA 3GR0A 1RSCA 1RU2A 4MKYA 2CVEA 1NPRA 2QLXA 4EI2A 2ZH9A 5E0OA 3OT9A 5DGBA 1T05B 5T8TA 1FRJA 2XHWA 4FKYA 5ETRA 2HFZA 4DQSA 2JHEA 2WOMA 3SV4A 2PN2A 3GPCA 3W9HA 2KHCA 1KVJA 4DFMA 3N6NA 3VALA 4DG1A 2WB1D 2F4VJ 5GVQA 1S4EA 1W25A 2V50A 2C3OA 3KNAA 1NO8A 4NLRA 4DR4J 1TR0A 4QIGA 1VK3A 2DNZA 4ECXA 3R44A 1HI8A 3FFIB 1GMVA 2ZBCA 4C3KA 4P2XA 3C16A 4PYAA 4ZPCA 3NY0A 3EUNA 1MROB 1WOOA 1GQEA 1V3SA 4QWAA 2HNZA 5IQ6A 1IQZA 5DETA 2HGMA 1QTNB 2O01C 1C1BA 3ZFVA 3WDOA 4DR3J 4K8RA 5A76A 1AA1B 4KYZA 5DRKA 1ZZFA 1XMQF 2JC0A 2OLWA 4ZP8A 3UCGA 3AOCA 1UETA 3LGHA 1FESA 1JB0C 4OZNA 2UVRA 4DR7J 1TK0A 1B70B 4WFBQ 3S7RA 3DLGB 4ATNA 1KWMA 1N6QB 5A8RA 3EVMA 3UD4P 2ZH6A 2AKWB 4DV6J 4DN9A 2B43A 1P6TA 2MMAB 3FUYA 2KFNA 1EX8A 4NYOA 2JL9A 4QJVA 5D8HB 5EN1A 4L72B 2YKNA 2UXDF 3NAHA 4DL0C 4YP3A 3C15B 3SCLE 5ETNA 3PZPA 5L1IA 2HPUA 3N9UC 2DR6A 2J6SA 2PC6A 4UQGA 3T1YF 1RADB 2CPEA 2EKYA 2IVFB 2VD3A 5D4LA 3JSBA 1IKYA 1LQ9A 4A8WA 1IM6A 1D09B 2B6AA 5ETMA 4JI2J 1JLCB 3OFGA 3QSYB 3PEHA 1VC0A 1IKWA 2I0XA 5I3UA 4C8KA 3W7BA 2BJ3A 1FFSB 2IMWP 4PPDA 1GAOA 2LP4A 1JLQB 3EYZA 3SV3A 4DLGA
chains in the Genus database with same CATH topology
2JMPA 1HNXC 5J1PA 4DV2F 3UW1A 1JWWA 4O3PA 4H4MB 4Q45A 1H38A 2UV8G 5FLXD 1RT5A 3TANA 2R7RA 4OI1A 1IKVA 1XNRF 3WC0A 4AL5A 4ILMA 2XWYA 1RTHB 2KHDA 2VZEA 2EG1A 3QGHA 1I1GA 2ROPA 5KFQA 3RU0A 1NB7A 1IBMC 4NLGA 2DYJA 2IM1A 3GFXA 4K4UA 5K5MA 4R0MA 4ETZA 1DJ0A 4I1TA 2BANA 1H98A 3MPVA 2BJOA 2RD5C 1XERA 1VI7A 1TAUA 4ZP7A 3I56S 4RMNA 2MKHA 5L1JA 1KVIA 5HMXA 3KMSA 3PM9A 4WZQA 3TO8A 1QVGR 5BYSA 1OO0B 3BF4A 3OUYB 2OJ3A 2OPLA 4CO1A 2P9EA 4O4GB 3G8QA 4TYAA 2AYEA 2V4JA 3OFEA 3FZBA 1B0PA 2X1BA 2ZZNA 2VQEC 3PO4A 3RAXA 1YJNS 2YKMB 5HQ8A 1PGZA 4MIAA 5LMNF 3MECB 2NXUA 1JKHB 4DSFA 1SH0A 3VF0B 4CT9A 4IFVA 1URNA 3HVTB 1UL3A 2D9PA 4L6V3 4IG0A 4KR0B 2MQLA 1FJGC 5HMWA 4MYTA 1Y4ZB 2B51A 3D0IE 2EFOA 2RE1A 4CIOA 1S10A 1SJFA 1NKCA 5DJBA 4E98A 2XMVA 4YMEA 3OTEA 5GMKa 3MR3A 2F9JA 3A8EA 4RZRA 1ULTA 2OSRA 3K5MA 4AL7A 4MK7A 3I4HX 1FDDA 2CKWA 2PE8A 4LQ3A 4NCBA 1MU2B 3KHGA 4B9MA 2GQ2A 2XEXA 3NNHA 1TVRA 3QO9B 4I9GA 4WZMA 4LF4C 1TAQA 3EQ6A 2OFHX 3LAMA 3GIIA 2ZH3A 1WELA 2UVUA 4E0DA 3MZIA 3JSRA 4A8OA 2YKOA 2KI2A 1VQLS 4F67A 3KLGB 4DOZA 2GNKA 2VKRA 3OPKA 1HBOA 3KYLA 4NCAA 3QJLA 1UVKA 2LU1A 4PZPA 2UXBC 2XLJA 4B3SF 2B4VA 5B0FA 2HQIA 2IM0A 2MQOA 2AYGA 4QWEA 3N01A 1U47A 4HYKA 1S49A 5LSRA 1FKOB 3E51A 4HDHA 1MSWD 2AYMA 3OLAA 5J2MB 2HRYA 4ZS6A 2R7OA 4TLQA 1FKPA 1UW4A 4BWJA 3H5UA 1Z4UA 4ID5A 4DQPA 2IMOA 2OD4A 3SI8A 3TARA 1FKOA 4JI7F 4WF9Q 1QSYA 5LJ3Y 2B9YA 5I3QA 2IBOA 1ZTTA 2NREA 1BQMB 4DR4F 5E41A 2E7WA 1QE1B 4F2SA 4X4NA 4DMZA 3IA0A 2AGPA 3B7WA 2CQHA 4HI1A 3AQPA 2MZ1A 4N8OA 2VL1A 2DPJA 1FNMA 2M3DA 3KG0A 4NLQA 3LWMA 1S6OA 2VG5B 5HLFB 4C8LA 2J6TA 2NYIA 3RG2A 4YB5A 3L95X 3I07A 2AJ1A 1FTRA 2Y1RI 4G1QB 5EX3A 2O3DA 2ROEA 4FS1A 3PKMA 2LEBA 4USHA 3HLUA 1YQHA 4X2BA 4FXVA 1T03B 4GMKA 4NOHA 2DGVA 3TA0A 3NP5A 3LP2A 2DNNA 2K2PA 3DRPB 2YH1A 3KNGA 2VA2A 2G4BA 4C8YA 3SDEA 2JX2A 4P2SA 1JLEB 4XPEA 3CF5Q 3ISND 1NRKA 3NPDA 4I0WA 1RGVA 4D3HA 2ASLA 2L08A 1Q78A 2W7AA 4DR3F 1J5OA 1N33C 1SJRA 1CEZA 2YX1A 2V4QA 3V81A 2QIFA 2BR0A 2D3ZA 3ZZOA 1S76D 4GKKF 2QA4S 2IA6A 3T6BA 1SIWB 2QW0X 3NGKA 4KHPC 3MMBA 1QM9A 2ASJA 3OL9A 5KFEA 2D3UA 3I0SA 4O44A 4PQAA 4WKRA 1HPZB 2E29A 1UA1A 3PX4A 3BB5A 3MEKA 2CQ4A 2VPYB 1F5AA 4RBTA 4KRWA 1NK0A 1NHUA 2LEPA 3VAKA 4DV1F 1KQSR 2ZC4A 1GH8A 3DOLB 3PXGa 2UUBC 1M1KT 3I08A 1RT6A 1LFWA 2AF6A 2EK1A 4RLQA 3QAEA 4X4TA 2W4CA 4GO7X 2ADBA 4A8MP 1ZTWA 1DHMA 2KKHA 1KKGA 1NKEA 5CXTA 3KFWX 3MM6B 1HNVB 5LT5A 1IM4A 2ZZMA 3E8OA 5BUSA 1FDAA 2OPQA 4IYQA 4J9PA 1AFIA 3CCTA 2MZRA 2C3UA 4Q0BB 2XZWA 4I2PA 4FP9A 1N5QA 1IN0A 3CDBA 4B9UA 3C6UA 5BSVA 4V19X 4NYZA 2CJQA 3GYNA 4CO3A 3V6HA 1NJYA 1YBAA 2D74B 2Z2MA 2HFNA 4V19J 2PGCA 3LWLA 1HWLA 4DV6F 2JFDA 1KHWA 2YWKA 1GXLA 3I5BA 1U6BA 4LF6F 3DCAA 2V9WA 5E3AA 5C25A 3UWTA 2HW3A 3N6LA 2DPIA 3K8VA 1DLOB 1T02A 1FD8A 1R8CA 5B08A 3S01A 1IJEB 3H2VE 4CTAB 2QA1A 4TY8A 4BCAA 2LMIA 4F26A 2BE2B 4QBUA 3MOJB 4BBYA 1T3NA 2WD9A 4F8RA 2EVZA 2XMWA 3AH6A 3VAHA 1YJ7A 1WF0A 2J0SD 2FHOB 2C42A 3FZ2A 2MQPA 4WFYA 1UJ5A 2WBMA 3I5AA 3MFHA 3L7OA 2Y1IA 1TL1A 3UE2A 1RY2A 4K4TA 2HGNA 3I9V9 4C3MA 4KV8B 3H20A 5E3PA 1XWLA 2RRBA 3IR6B 3CCUS 1RKJA 5D78A 5J2PB 4ED7A 3G7SA 2FLOA 2G1DA 3VAGA 3BSAA 4JV0A 5GADU 1VQ4S 4HH0A 4K4ZA 2V8DA 1KEKA 2YKAA 5F8GA 2P6TA 4NLVA 2WTFA 4LVOP 5CD4H 1DQ9A 2ZC3A 1SB6A 3LGNA 2FLPA 2F8HA 2NZ4A 4YB6A 5D4OA 3OBIA 1QLNA 2IVYA 4C8NA 4HTJA 4YB1P 3DRSA 5E5NA 1JJ4A 2WW8A 5EHHA 4KSEB 3PV8A 2XS7A 2DCUB 1LWCA 3Q22A 4JI8F 3OVAA 4J9OA 2JFKA 2LKZA 2VZ9A 2OAUA 1XTZA 4WTYA 1DBDA 1X4FA 1C1CB 3KJVB 3B4DA 2KXHA 3TAMB 1HA1A 2QV6A 4R8UA 2MXYA 4JI2F 4ZDNA 4LUBA 5SZTA 1JLFB 1JXEA 2KZFA 3HHLB 3CJ0A 2O1PA 5B0GA 1TKTA 4FTFA 2YH0A 1MDFA 3OFHA 4I4BA 4LSLB 3CJKB 2M70A 5J2NB 4QPXA 2MQQA 2ATLA 4XDDA 1JX4A 1MMDA 3MM9A 2G13A 3HI9A 4QU6A 1IJFB 2DRAA 3BJYA 3BO4A 1HMVB 3CCZA 3EZUA 1JJHA 4LF8C 1YJTA 4JI0C 1C0TA 2B4PA 2N3OA 4Y6IA 2M8DB 2K7JA 2LXIA 1FEEA 2O5DA 1VQYA 3DI6A 3M2VA 4XDCA 1KQFB 3H5SA 3NCPA 3UPFA 4ELUA 1BGXT 5CYMA 4LF9F 3VAMA 4DSKA 2N4CA 2DIVA 3IS9B 2D1TA 2LDYA 4KC5A 3QGGA 4R5PB 1H6KX 3FRZA 3DLHA 2RMLA 4NX9A 4PWUA 3CCLS 2QT7A 4C0OC 4NRUA 5BURA 1U2FA 1ZH5A 2QYCA 5U47A 2JLFA 3KLFB 5HP1B 1O51A 4OIXA 4LFCF 1JNZB 2XNRA 2ZD1A 2CZVC 2F1FA 1TKZA 4DV4C 2C28A 3DLLQ 5KFIA 1UVIA 1HW9A 4A8SA 3ETCA 1AW0A 1P27B 3T9ZA 3PROC 3WC2A 2RVJA 2KO1A 1IR0A 3CSKA 3MM7A 4E8UA 1FRKA 2B7CB 1XK8A 1H2UX 2PMZD 5KFLA 2R9LA 2Y1JA 1FF2A 1S1UA 5AE1A 5T41A 1N32F 5JVHQ 2XBPA 1X9WA 3CCSS 2EGTA 1O5JA 2DGQA 3CE8A 5K8PA 1U45A 4RW7A 1X5PA 5KFWA 4OL8A 1SH3A 3IR7B 2KFZA 1JLGA 1VJWA 3DOMA 2QLWA 5A8KA 2W9AA 4G36A 4NLUA 2JEFA 2E5GA 5CZXA 1HR0F 1P7LA 4CO5A 1R8AA 3CMAS 5GAEI 1U09A 3JYTA 2LEAA 3I96A 4Y00A 1V25A 1M5HA 1X4HA 4MKBA 4C0BA 1GX5A 3FMBA 4FUTA 4CNYA 1RDRA 2E5LF 2GX8A 1OSDA 1BQXA 5BSRA 5DDOC 1HQEA 4GKJC 2OPRB 2Q6CA 2Q1LA 4PQUB 5BSMA 3ZZTA 2E5HA 1MMNA 2L9NA 3JTNA 4RW6B 3VAJA 4ZHRB 4I6AA 2MKJA 3OLBA 1UAWA 5DG7A 2IHR1 2LQBA 3K5OA 2W25A 1S1XB 2EPIA 4I7FA 5H1SV 5T14A 2C2DA 1HYSA 1X4AA 2E7GA 2VSQA 3U27A 4CO4A 2WB4A 2J7UA 3TVZA 5KT7A 2YCBA 1HWKA 4X62C 2GJ2A 1HWUA 1LFPA 2VBZA 2JOQA 5H9EJ 5C5JA 3IRXB 3KK2B 3GIMA 4DCSA 4I69A 4IDKA 1OPIA 3G71S 1R8BA 4C8MA 2HHTA 2KYZA 1WACA 4IR1A 2IFXA 1WHYA 4RNOA 4TQSA 2DB1A 1VQSA 4NLPA 1UVNA 4JYAC 2I8EA 3QMQA 3MCSA 4DFJA 2DNYA 4G6VB 1USPA 4KQZA 1WTBA 4OJGA 1T5DX 1YG0A 2E5JA 3POTA 5BSWA 2GHPA 2E9ZA 2CQIA 1RT7A 1S97A 4NOZA 4QOTA 3NL0A 1YWXA 2KB2A 5KFNA 3MURP 3CCMS 4YHHC 2YWHA 3EGZA 4EBEA 2HS0A 3HKWA 5DO2A 1VFJA 3CW8X 1LCIA 1N36F 2SXLA 1N2FA 1R43A 2NUUG 4FF2A 2MGZB 1L3UA 2CY1A 1HQUA 2YWFA 1XNQF 2XLIA 6FD1A 3OTCA 3V4IA 1G1XA 4N47A 5GAHI 3T6JA 3PO5A 4TY9A 3IWXA 5FJ4A 1Z2LA 1RT4A 2B0GA 5J2QA 4JI5C 2WOMB 3RW7A 3D0GE 4BS2A 3E3XA 5HROB 4OX9C 1CSJA 4DLEA 4ITSA 2QSFA 1XMOC 5IT9D 1HH2P 3G8SA 1U1QA 4NA1A 5B0AA 1U1NA 4HKQA 1KTVA 1LW0A 1OPZA 4RW9B 2VOPA 2OPSB 4DR1F 2CJ9A 4AFFA 4JOUA 4ZVEA 3E7WA 3OW2R 3MM5A 5CA5A 3M9OB 2IA0A 1TKDA 2PT0A 1NZAA 2GQCA 2K3IA 4RWWA 1PG3A 1M5SA 4C7QA 2XY5A 1KSPA 2MDAA 2LXFA 5G0RB 5C42A 4ODJA 3DHXA 1LV5A 4J9RA 1FNOA 1B7FA 2DGWA 3KLVA 5BYRA 2B5JA 4DG1B 3JAMY 1FO1A 4IR7A 1TL3A 3HX9A 3LH2S 2IAJB 4QR0A 4IR9A 1VK8A 5EDWA 2YVSA 3LNVA 2CPDA 1VGYA 4RNNA 1IBLF 3J80Y 1D9FA 2VFVA 4ZVHA 2FC8A 1UVJA 3KKFA 5HO4A 2MHNA 1FRHA 1DQAA