3GR0A

Periplasmic domain of the t3ss inner membrane protein prgh from s.typhimurium (fragment 170-362)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
186
structure length
186
Chain Sequence
LGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
molecule keywords Protein prgH
total genus 69
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gr0A02
4ALZA 3GR0A 3GR1A 4G1IA
chains in the Genus database with same CATH superfamily
5IWAJ 3S8SA 1N0UA 1SQEA 3D7SB 4OMFG 2H3EB 2J9CA 2V0NA 3OQ2A 1VI7A 4I6WA 2Q6BA 3CW9A 1PC4A 3G6XA 2B4OA 2P9GA 3PY8A 4KIAA 2XYGB 3QPIA 2CWKA 3NWGA 5DG7A 4ECQA 4ZPDA 1IWAA 2BMBA 2VUGA 3FEYB 3IGVA 3MM8A 1WOPA 3MECA 3FQLA 4UOHA 5KFEA 5G0RB 2DHAA 1FRLA 4X62J 3KLHB 1YIJS 4ED3A 2A18A 5KFUA 4F4AA 4JYAF 2V7BA 1OSDA 4OX9J 3C6TB 2CG8A 4I68A 2MZJA 3DGPB 2JC1A 2FJAB 4QIEA 2QT7A 4X4RA 4AL7A 4G1QB 1N34F 4O3RA 2BJOA 3LGMA 2AKWB 3M6UA 4JM1A 1VDHA 1UKUA 3AXMA 1FXLA 3H8YA 2IJRA 3GG0A 1B0VA 2E5IA 2WP0C 2V34A 2JWNA 2ZC4A 2DEJA 2AYEA 3MMAB 1Y5IB 3IP0A 4IR9A 5KFJA 1RT1B 2LQ9A 3H42A 3ICLA 2HHUA 2DNNA 3KJNB 4WS9A 4USJC 2FZCB 3OXGA 4PABA 4DWIA 3A12A 1PJ6A 5G4DA 2FY8A 4HYKA 4P2XA 4DL7A 3OTOC 2ZZMA 2EWHA 1CJVA 1FF2A 2DTJA 3T19A 4M5HA 2IRYA 2VA2A 3PO5A 4DV0C 1TKZA 1DY3A 3NP5A 3UX3A 5DZ6A 3LP0A 5IT4A 1S77D 3A8EA 2HHHC 2HHVA 4FS1A 2KT5A 3QGGA 4B9UA 3CD0A 4EI2A 2HYIB 1RWVB 2R7OA 2ZBIA 5DLFA 1BQNA 4G1IA 1IBKJ 2QE5A 1IVZA 2CNLB 4UZCA 3BKUA 3SCJE 2J9DE 2BJ1A 3BR8A 1HWKA 4ID8A 3LA0A 1HNZC 3J80D 2FZKB 3PJWA 3RG6A 1ZS6A 3AODA 4TU8A 4DV2F 2XGQA 4F4ZA 3HSZA 4YB6A 3SDEA 5K8OA 4LRFA 2VG7A 3D4JA 4CWBA 1S12A 4JI2J 2QYCA 4NLQA 2RD5C 3T1AA 2VG7B 4QU7A 1HH2P 3KOAA 4NA3A 3TJAA 4KC5A 2B5JA 3V6JA 1NAQA 2B51A 1SIZA 3K8WA 4AD6A 4DR3F 1AUSL 3OUYB 2FIUA 3PEJA 2ALZA 1U0SA 2HIYA 2IIHA 3VV2B 4NYOA 3X3UA 2PGCA 4BLGA 5EWEA 3R5GA 5IV3A 1N36F 4C8YA 2CVIA 4XK8C 2IC3B 1VR6A 1WHWA 4IKAA 2ZBRA 2VBYA 5HBMA 2Y1IA 1NUEA 4P73A 2D9OA 1FX4A 2GFFA 3P96A 3AD8C 3FNNA 1Y0HA 2HFOA 1PGZA 1FE4A 1J5EC 1FRHA 1RISA 3QIPB 1H98A 1LWFB 4PKDB 4A8YA 3PHEA 1FD2A 1WHXA 3RGIA 4OHYA 5KG6A 3OSPA 4D4GA 4MH4A 4OYOA 2WVCA 3IC1A 1D8ZA 3LQVA 4RU2A 4R1LA 1F2HA 5GADI 3VNRA 1FHTA 1NHVA 4OHVA 4EYHB 5ADZA 3GIMA 1IWGA 4BS2A 4N47A 4DR1J 2B43A 3I07A 1IUJA 4O4RA 5D4NA 3PVXA 5BR8C 3C8YA 3R7SB 2XLKA 2XMWA 1IN0A 2ZEJA 3TWZA 2X3DA 1IBLJ 1LWEB 4MJKA 4U8YA 2E9ZA 3I0SA 5LMNF 4LF6C 4X62F 2C2DA 3BDPA 1FJGF 1HPZB 4FUTA 4XPCA 3W64A 2ZJPQ 1REVA 1SC3B 2JLEA 4FKYA 1XR7A 3CCSS 5T14A 2HHTA 2KDNA 1SJFA 1NHUA 1EETA 5B0AA 4A8QA 4ECSA 4YDDB 1FRMA 1V6HA 2SXLA 1MLAA 4DR7J 1YBAA 2DGOA 3DHWC 2W8LA 1OS5A 4KRWA 2W9AA 4DV7C 1V3ZA 2HLUA 2O01C 4A4JA 2RS2A 2FJDB 4HH0A 1IR1A 1QSLA 1T95A 1KP6A 3TUFA 3BS9A 1OMSA 2YWHA 3JAMD 5ETTA 3NXZA 4LSLB 3K58A 2V50A 4OYBA 1M5PC 2ZM6C 4NMLA 3TOQA 5CCLA 3N54B 2OEMA 3TDEA 4ZVEA 2CA9A 3DRRB 3MMCA 4DR7C 3UQSA 5HAOA 4LF8C 4Z2XA 2QA2A 1SI9A 3MAHA 1AROP 3ULHA 5KG1A 1XERA 4B08A 1WKJA 2MEWA 1S9GA 3AA9A 5DDRC 5E2QA 2A3JA 1KFSA 2DIUA 2C1EB 1N54B 2BE9B 4UQTA 3ZXWA 4ZJOA 6FD1A 2FTRA 2N82B 2MQPA 2UXCJ 2HEKA 1N52B 2CDRB 3GB0A 4OHWA 4YB5A 4ZVPB 4WTYA 4YY3J 3J81j 3ZTPA 2OIHA 4U8VA 4C8ZA 3SSSA 3AOCA 4OV1A 3CCMS 5J2PA 3MEDB 4JV5F 3FEXB 4PWDA 5KFIA 5LSRA 2RF2B 3AB4B 4DU8A 4G65A 3THVA 1JLEA 2AGPA 4YHHF 4Y3CA 5AE3A 4RU9A 3J7AN 1XNQC 5HN0A 5D3GA 4WP9A 4Q44A 3EZ5A 4EFAC 4NX9A 4DCVA 3AQPA 4PPZA 4WFXA 1FVSA 1VLYA 2D3UA 4ZVSB 5HROB 2WCXA 4X65J 2H4YB 1VHFA 3MFIA 2EC0A 3H40A 4GKKF 2M52A 2GVZA 2YBVA 1VK8A 4BC7A 4ZCIA 3V2UC 1M5VC 5C42A 1HW8A 1D9DA 2R8GA 1VQKS 3C16A 1SV5B 2DY1A 2ILZA 2FHJA 2LEBA 1J5EF 1UJ4A 2J0QD 3RAMA 4GVLA 1D09B 5A76A 4DUZJ 2JZ5A 1CG2A 1K47A 1RT7B 2COLA 2CQ1A 3GJRB 2P8IA 3OTBA 3QQCD 3OVSA 4TN2A 2ATWA 4LBPA 3WX4A 1V9OA 4OYPA 4B17A 4UZBA 3M2RB 1HARA 2IRXA 3AOAA 2QL9B 2C3YA 2VFRA 5E33A 5KFLA 5JVHQ 1SC4B 4B9MA 3I56S 4K4SA 2K8GA 1S1WB 4F04B 2BA9A 5ETKA 4RVOA 4B3MC 2H5IB 1X5PA 4H4MA 3OLBA 3BN4A 2YTCA 1RWPB 1X4BA 4TVAB 1BQNB 1RUSA 1K9MT 1CPZA 1UP1A 1O5JA 2CJKA 4IR7A 4QBUA 3GP9A 3C6UA 3N6LA 4FYWB 4IH7A 2MLZA 4CO5A 3PX4A 4WWSA 1EIYB 4JI5J 3Q2TC 1RTHB 4NLGA 2KVQE 4EBDA 1M1KT 1RYRA 1WEZA 4DS5A 2LQJA 2HBZB 4ZVOB 2FDNA 2EKYA 1Q8KA 2AX0A 3EXYA 2AP6A 2RNEA 4IZ6A 1UJ6A 4MFBA 3T41A 4QW9A 1N56A 3BGRA 1RB0A 4LBIA 3ENQA 3TA2A 4WE1A 2VZEA 1D8YA 3MOJB 3QRQA 1UFLA 1LEOA 3QGPA 3A3OB 1AYEA 3M2UB 4KKOB 2DR7A 2UU9J 1V3RA 4WK1A 1B0PA 1H2UX 3AB2B 1TV6A 4V1Ak 2BQUA 4M5GA 1Y3KA 2V4QA 4F4XA 3H5SA 2JLGA 1C0TA 2GV1A 2VG5B 4LF2A 2HHPA 5D77A 4ZPAA 1RTJB 5KTQA 3D5MA 1YJRA 1SQGA 2V4JA 5THWA 1C0TB 2VG5A 5LXRA 4YB1P 1K0TA 4J90A 3K8VA 4TQRA 1DRZA 1N33F 3UI3A 3IS9B 2WVBA 3AD9C 4O3SA 1TR0A 2VPXB 1KBRA 4NCGB 3A9UA 4PYAA 1XS3A 3I96A 2ZJQQ 4DFPA 3HPOA 4ZLJA 2XS5A 5BSMA 5KFBA 4MH8A 1JB0C 3UR3C 3PKYA 1KTVA 1P7LA 3CCQS 4ZIVA 4ALZA 3MCMA 2VC1A 5HQLA 1OQ6A 4R1MA 1CC8A 2MQNA 4A8XA 1HNXJ 1FJGC 4JP8A 2NSBA 3VVTA 3SQOP 1RSCA 4I64A 2VQEJ 4J9SA 2GS8A 1RYSA 4NOZA 4RVNA 2ZE2A 4KGZB 1FKOB 3BDEA 3I4PA 4KT0C 4F3MA 1O92A 2ASBA 2ATLA 3DGPA 4DJBA 3Q83A 3QT6A 1IJEB 3KLVA 2HIQA 1U6FA 2QFJA 2E66A 3ETOA 3H7HB 1B99A 5C42B 1X31C 4ZP6A 5DDOC 1T05B 2ALYB 2D69A 2BKPA 4ODJA 2NS1B 5HVHA 4OI4A 2B3TB 2V2QA 5CZXA 4ZVQB 2PI4A 4DSIA 4EZ6A 1GH8A 2C3MA 2XZDB 4RW9A 5KG5A 2QLBB 4J9MA 4DF8A 3WX8A 3ETCA 4KTVA 4UOGA 3ZZYA 4LF6F 1RTIA 1VIXA 1VFJA 2UZAA 3NRBA 4NL5A 2LCWA 1S99A 3OHAA 3GLJA 2K2PA 2LEAA 1HA1A 4HTIA 4I4BA 4OX6A 3SCLE 5C24A 3DYAA 2Z4PA 1S76D 5LJ5Y 5C7PA 1JLQA 2Z57B 4ELVA 2Q3PA 2VBXA 4RW7B 4B3OB 1RACB 4RNNA 1FNOA 3IA0A 4DL5A 3M8PA 2VG6A 4LR7A 3PROC 2QJ3A 1SBRA 1XR6A 5ETVA 5IM0A 2A2DA 3KLGB 4QYRA 2J7UA 2VQFC 4QWDA 1C0UB 2L3MA 2BM0A 2AWZA 1S10A 3NCRA 3TX0A 2BZ2A 4KFBA 5F8JA 3WC0A 5JXSA 3TQIA 3T1YC 3I82A 3QJJA 4HPVA 3SXLA 2AJ1A 2GMLA 3BREA 3V4IB 4R0MA 5CA5A 3HHLC 2AYGA 4BCAA 2UUAC 3MEDA 5KG2A 2ZFHA 3HHEA 2C2ZB 2QLXA 3OBIA 5BR8J 3CTRA 2GVDA 1PAUB 1ZOTA 2FQQB 3HKWA 1YX2A 3O44A 4LRDA 4DSEA 2XY5A 2DY9A 3N2QA 4CO3A 4Y2CA 3BBCA 3DHXA 4DPWA 3FSXA 1NB2A 4N77A 2I8EA 2K06A 3DLHA 3EZOA 1WUUA 1CJKA 4QZVB 1FXDA 4B3SJ 1FKPA 1YBTA 4WKRA 4K4UA 1REGX 4A8SA 1FRIA 5JVGQ 4N76A 3WIUA 4RM3A 4RNMA 1ROFA 3WZ0A 4CLZA 2D3ZA 3SIPB 2D1CA 4LVNP 4JI8J 2OO4A 3QIPA 2H48B 1HBNA 1ULRA 2MKKA 5FD1A 3G6ES 2W9BB 3G71S 1HYSB 1KWMA 2J7KA 2F4VF 1WCJA 1WF3A 2MZ1A 1BQMB 3G82B 3HT0A 2GAHC 2HURA 4O0NA 4DXLA 3OV7A 3RBEA 2BQRA 4DX5A 3V6DB 1S1XA 3BGUA 4JB8B 4I2PA 4LF9F 2DYJA 3D6TB 4Y2AA 5BYSA 1H74A 1TK5A 3G7SA 4A8FA 5DG9A 2B8QA 2MY7A 4GO5X 3WIVA 3MMJA 2LFVA 1V25A 1MWYA 2GX8A 1NK9A 4DUZF 4YMEA 2DKOB 1F5CA 1I94J 5CZVA 4DV0J 3PBKA 2HWHA 1JJ2R 4E98A 2CRLA 2NXCA 1MN7A 3EGWB 2LXUA 3SV4A 2U1AA 3BZQA 3DMJB 5T8TA 4NLDA 3BBBA 4LFAJ 3HM9A 1UWBA 2B0GA 4OLPA 3LGXA 2VPYB 2L9NA 2CPDA 2EK1A 4QOTA 4UUXA 4DFKA 3P45B 1U2CA 1VQ8S 4ZMMA 2M8DB 2DRAA 4DV6C 5AJ3J 3MR5A 1O0PA 2GHVC 2POKA 5ETNA 1SJ4P 4FBTA 1G1XA 2WONB 2FHMA 1VMBA 4FNHA 1RU1A 4CTAB 3J81U 1KOOA 2K3IA 1Q7LB 1U24A 3HHKA 3LUYA 3KLFB 2ONFA 5D15A 4ES2A 4CDIA 5BUSA 4X65C 3I0RA 4HL9A 1YI2S 3AJ2A 4KO0A 5ETRA 5HQMA 1HFEL 2OELA 3GSDA 3HX9A 3MCNA 5J1EB 3SI8A 1UA1A 2JEIA 1VQPS 2UXCF 1HQUB 1RTJA 3CJQA 2PD1A 2BE2B 2VSQA 3A25A 1Q4RA 1VIOA 3H2TA 3VZHA 4H4KC 3BQ0A 2KZZA 4MK9A 2QL7B 2EG1A 2I6WA 2D1QA 2XMMA 4NLPA 4PQUA 2AGOA 2G0CA 1A7GE 2DB1A 3J7Z5 2XZWA 5FLXY 3LAKA 1VQ6S 4M5DB 3I5AA 3KMSA 2A10A 3DXSX 3PW7A 3CD5A 3VNSA 2LXIA 3TAMA 4P52A 1QM4A 1MW7A 3UDEA 2OMOA 5HVFA 2GVDB 2FLOA 3VCDA 1IKVB 1YJ7A 1SKSA 4YOEA 4ZK7M 4YB7A 3CJ2A 2YNIA 2Z30B 4HVZA 5BR8F 1SQFA 2IAJA 2QZ8A 2OH2A 2UUAF 2L08A 1HR0J 1MDFA 4CI0B 1U8SA 2XSJB 4CYUB 1SH2A 4PXCA 3T3FA 3HSDA 1DTQA 3KK1A 2GIRA 2L9DA 2HRUA 1FJGJ 4WF9Q 2IBKA 5GAHU 3JQJA 4J9NA 4EBEA 1N34C 2W9BA 1VISA 1S5ZA 4ELUA 1F5BA 2P6TA 4TNOA 5E7QA 5CYJA 2MCQA 1MMDA 3W2WA 3W9JA 2YVSA 4HDHA 1P6TA 1HNVB 5D0EA 3T5KA 1S1XB 1RK8A 1S1TB 1E6VA 1RHQB 1RKIA 2BACA 3KNGA 3KFWX 5EUHA 5LMUC 2R7UA 4K0KC 4I1TA 3A8KA 1RWXB 3A8IA 1CC7A 1S7IA 2C2MB 2RHSB 3IM8A 2P2QA 1VLOA 2HLTA 4RPFA 4RMNA 2HQCA 4DPXA 4LF4F 2HQGA 1WTFA 1O93A 3MEGA 1PAEX 5C2GA 1T9YA 3I55S 2LA4A 1O51A 3F73A 5A8KB 2E7XA 2FHJD 3AT1B 1H73A 1R8BA 3TZZA 2ZUAA 1NDLA 1S57A 3GR0A 4OZ2A 1HD1A 2BRKA 4KV8B 4U96A 4ZP7A 4CH0S 4ILLA 3Q8UA 1HBOA 3PYGA 2IY5B 1WI8A 3ILJA 2DJWA 4NLTA 4IOBA 2HVEA 3EVOA 3TVZA 1YDLA 3AHPA 4Y0FA 3CC7S 5KG3A 1T9VA 4P71A 4QR1A 3GFXA 1BLUA 4GKJF 1Z2LA 3H2VE 4YY3C 3DLEA 1R89A 1EQMA 2CJ9A 3QLHB 4RUAA 1HNXF 5HJXA 4AT1B 4ETZA 2MKIA 4OZ5A 4LFCF 3BYRA 3R5CA 4ZPTR 3MR6A 1PIEA 4HHHA 3KHRA 2G9OA 4RWXA 1IJFB 3EICA 2Z58B 3IBWA 2GIFA 2ZZNA 3HFVA 2GO8A 2GJFA 3LPEA 3RYLA 1R0BG 1RE1B 2Y0SD 1DTTA 3PHTA 2VBZA 2CQ2A 3W1YC 2ZUGA 5BYQA 3DOMA 1RT5B 4NA1A 1RT4B 1ZPVA 1BY9A 2DIVA 2W7AA 5CYMB 1N33J 1RT1A 1X5SA 1BQMA 1NSKL 3DOMB 3N9UC 4G1PA 2E9RX 4LRAA 5D0HA 3NAHA 2XHCA 4X66C 3CJKB 4RR5A 1FA0A 3OVBA 1WC6A 2DNKA 1YLXA 3M9NB 2NXJA 2JC0A 4CO1A 4FF3A 2OPLA 4D4IA 5BURA 4DV4C 3V6KA 1NNDA 1RHKB 2XYPB 1GK8A 1WWHA 1KTQA 3M8YA 2CJBA 4IG3A 5SZTA 4ID5A 3NG8A 2VC0A 3I32A 1WJ9A 2JL9A 2VDHA 3MI7X 1QM9A 1PYTA 1Y10A 4USTA 1VS3A 4PXDA 3SQGA 3WDOA 2VQFJ 3MXHP 1N5SA 1UPPA 2GMHA 5DETA 4ECVA 3TRGA 2KZFA 4EMDA 1GNKA 5IC4B 2NCLA 3Q0AA 4JI3J 5JRHA 2ABYA 1LWEA 1SH3A 1YK9A 1ZPWX 1EZZB 5C5JA 2L41A 4FYVB 3GQCA 4K4VA 2YWCA 4G36A 4RLFA 2DXDA 2ZH2A 2HGLA 2H5EA 3PXGa 3OL8A 1YVFA 1RHJB 2RRBA 3GTYX 3RRKA 3HHDA 2XMJA 1C1BA 2Z8QA 3MM5A 2MGZA 3IR7B 3E01A 5CH7B 5A8WB 3Q8SB 2ZH7A 2ZOGA 1NDKA 3PACA 3K5PA 2KJWA 3DC2A 1TVRB 1U2FA 2WONA 1FXRA 5HANA 2W4PA 5A8RA 4CTAA 5J1PA 1XNRC 4K4YA 2UXDC 1IBMF 1LQLA 4ITSA 1FVQA 2QVZX 4JI6C 2YH1A 3KK2A 2FVCA 3AA8A 3G6YA 4IH5A 4RW4B 3I6PA 3EE3A 4USHA 4C3LA 1PA4A 1RI7A 1LXJA 2QYGA 3QYYA 4K4TA 1CSJA 2WB1D 3FFIA 3W63A 1ZZFA 2E1MC 1RDRA 2M7SA 3O8WA 2R2TA 5LMUJ 2W25A 2ZVIA 3QATA 3C14B 3G8QA 3VGSA 1NPKA 4AL6A 4DL4A 3NKYA 1KVIA 3TR5A 2E8FA 5KFNA 4XO0A 1AZSA 3AJ1A 3TX8A 2C2EA 2QW0X 2XC9A 3WQPA 1LWFA 1S9GB 2KL8A 2ROEA 3OR2A 4IQMA 3IRXA 4OJ3A 3HJFA 1E6YB 4Q2LA 3VNQA 2EFNA 4QIGA 2B9EA 1YJ9S 4P2SA 2HAFA 4RBTA 3MMBB 4WCEQ 1NJWA 5A1IA 2XCAA 4ETXA 5GAGU 4ZHRA 3FKBA 4LF9C 1AT1B 2GA7A 1IR0A 1C1CA 1RZMA 2W1BA 3ZZTA 1T03A 3M2VB 1J2VA 1B7YB 2BJEA 6AT1B 3SMZA 1CS4B 4DPYA 4CH7A 2CQGA 4P7VA 3UO0A 1HI0P 3M4XA 2W9CB 2XNQA 2C2NA 3GJQB 4WV3A 4OI1A 2YKPA 3K7RA 1QVGR 1R7IA 1SC6A 4PUGA 2X51A 2L9WA 4YEAA 2K1RA 5FDLA 2ZH6A 4ECXA 2Y9HA 4ED5A 2GIQA 3BKFA 4FF1A 4DV1F 3MGJA 2EFGA 3MMAA 5B0DA 2NCKL 3IPLA 2OMLA 2ROGA 5K20B 3UVJA 3DKDA 1HNVA 1TAQA 3CJKA 1NJIT 4XAKA 3IG1B 2KVIA 1RT3B 2K3KA 2MHNA 3R8YA 3U7JA 2JFDA 3CW8X 4P75A 1NK4A 1YJUA 3TUPA 4ZS6A 5KT3A 3NOCA 2K7JA 1A9NB 3LP1B 2KI2A 1TKZB 2OD4A 3SCKE 1U48A 4M5MA 3GYGA 1S6UA 4A8OA 4X4NA 4NXNC 4JV0A 2E5JA 5KOWA 1XMOC 2EXUA 1JLQB 1I1GA 3DLLQ 2MQLA 2MKHA 4L74A 1FKAF 3TYTA 1M6XC 1DURA 1KKHA 4B3RC 1XRBA 4WFZA 3BEGB 4ED7A 2R7TA 4WXOA 4YN3B 2G2OA 4FZVA 1RA6A 5IS2A 4MKAA 1XNQJ 2V8HA 2AEJA 2HW3A 3FSYA 2UXBF 1QTMA 3DM2A 4M95A 4X4VA 1GXTA 3MD3A 4IR1A 2LU2A 2XMTA 3A3PB 2KXFA 2GGPB 3ISND 3ISZA 4O44A 3TQEA 5LMNJ 1YZ6A 2VIHA 1X9MA 1N5YA 4N8NA 3DDIA 3DRXA 1TL7A 4PYDA 1IBLF 4NA2A 4L4QA 1S0VA 3GV8B 2OLWA 3IFEA 3I4HX 1XBWA 2DO0A 4LBHA 1HWUA 3R5DA 2YX7A 4CT8A 5EWFA 4J9PA 4KR0B 5BSVA 3CMQA 3HI9A 4DUZC 2JFKA 2WSFC 1YRTA 2UUAJ 2QIFA 4WJBA 2HPUA 4NZ0A 5M2RA 5DQGA 1NSPA 2KH9A 3JYTA 5HMYA 4G37A 3NMAA 2KYXA 3N28A 9RUBA 5HMZA 2DRDA 3NS7B 3D68A 5A0YB 2QL8A 2N7YA 4C4WA 5KFVA 5B09A 3IMQJ 2NXNA 2MZRA 2XTJP 4AQYF 4EUVA 2MPUA 2UP1A 3JXOA 5HQ8A 1RT7A 4L76A 2HAIA 5ETOA 2Y4NA 3TJ9A 2F4VC 3FRZA 1PYSB 2DK2A 2F5GA 3KUGA 4QQBA 4C8OA 3QRRA 1DZ5A 2NPIA 2OPLB 3HD1A 1GTHA 1YKWA 5DQHA 3D9BA 1AB8A 2H1YA 2CPHA 4F0KA 1X0PA 3FCVA 4DV1J 3E7XA 2AZ3A 4PG7A 1KQFB 4DR3C 2ZHAA 4DV6F 3JSRA 1QWIA 3NYQA 1LFPA 3EVWA 3JSMB 3GKUA 3NGTA 4HHJA 2P02A 2LVWA 1NEEA 4WTOB 2W9CA 3JAMY 4J7CA 1T5HX 2R7SA 2E1CA 4XDCA 3BQ1A 3O3LA 2NR0A 2V68A 3WC2A 3IN5A 2RDJA 1TAUA 2MQQA 4CO0A 3LOUA 1WSRA 4IFVA 2RQ4A 2DVIA 3NMRA 2PSZA 1HQEA 2MGZB 2CYYA 4IFVB 1MG7A 1RAHB 2DO4A 1Y00A 2QMWA 2YWWA 2Z2ZA 3M32B 2V9KA 2RSQA 2YPZA 3ADAC 3OTDA 4YUDA 4LFAF 2MM9A 4DUYC 1I3OB 1JXLA 3BB5A 3ISNC 2CQ0A 5HP1A 1JLBA 4R8UB 4C11A 2M70A 1VEHA 1Z2ZA 5DS7A 4DOZA 2P2JA 3BN7A 1B70B 1T02A 2IVYA 2FB0A 3LW5C 4R8UA 1NBEB 4DV0F 3SYZA 5F9LA 1S6QB 1X5OA 2HNZB 3D66A 2KXHA 1LXNA 4C98A 1LOUA 4D3HA 2XHWA 4QWCA 1UA0A 3QGHA 4OLOA 4QYZK 1WF2A 1HHSA 2I0XA 1RQ0A 3FUYA 2HHWA 2YWKA 3NCPA 4GRSA 2DH9A 2HS4A 3FBBA 5ITHA 5L9XA 2ERRA 4LRCA 3QAEA 1XMQC 4Q43A 2CXCA 4R0EA 5IQQA 4KTQA 2B6AA 1W25A 4QCLA 2PMHA 1IBMJ 2EFOA 1Y4ZB 1H7XA 2MKYA 2O5DA 4WYWA 4B02A 5MAOA 1LK7A 1MU2A 1TMMA 2EVZA 3CJRA 3JQMA 5LL6d 5BSUA 3RJMB 1CBKA 1ZM9A 2GJ2A 3PRBA 4ZHRB 4OX9F 3J7A1 4JI8F 4P9SA 2Q6CA 4K4WA 1SKRA 1K44A 3PNIA 1NSQA 2BEFA 3V6HA 1FT8A 2HZVA 2N4CA 2VV5A 3MM8B 2I9SA 3C15A 3LAMA 3DRSB 5IT9Y 2C3PA 2UV8A 1IBKC 4OZ1A 1OJ4A 2D3OR 4FVCA 4B3TC 2KT3A 4IRCA 3T5JA 4JI3F 3DXBA 3GPAA 1Q7YT 1NDPA 1Q79A 1FEHA 2AW0A 2GVZB 4WIQA 4DUTA 1LFWA 2FZGB 2WOMB 3SO4A 2UVRA 3EX7B 2DNYA 1T3OA 3RAXA 4L7IA 1GMWA 1OPIA 2D41A 4GO7X 4LF5J 4GKJC 1TZ0A 2G1DA 4I9FA 3FC9A 4DFJA 5JMNA 3FJ2A 4MK7A 3G82A 3PYDA 3KDNA 3HSGA 4DCTA 3HVAA 2I2YA 2DPJA 1I5OB 1E6VB 4CLLA 2C2OB 2E44A 1RLDA 2YNFA 3RZAA 2BDPA 4OZ3A 3PKMA 5IZHA 2AJ4A 4AL5A 2WVFA 5K8PA 2DHHA 1RWNB 2FVQA 2NPFA 4NASA 2RS8A 4DV4J 4ANEA 2EG2A 2XMVA 4G6VB 4CQ1A 1NKCA 1HNWF 5IFIA 4NXMF 2PEBA 2ZDPA 1R0AB 1JKHA 1HNIB 5L39A 3RB3A 3POTB 2FJEB 1U8WA 2C3OA 1TQLA 3CC4S 3CCJS 1KVKA 3W2VA 4K7QA 3UZ0A 3Q89A 1BQXA 4LQ9A 1SUQA 1TK8A 4PUOA 3RW6A 3HHNB 1BD6A 2B7CB 2MHEA 2VFSA 1F2GA 1D9AA 2RIJA 2GJIA 1W2BR 4NRTA 1EQ0A 5DJBA 1N4LA 1P4EC 1RU2A 3GJTB 4C8MA 4WFBQ 3EPIA 3K0JA 2FYXA 4HKQA 2OUGA 3IWXA 2DH7A 1Q8LA 2R4FA 3GR1A 2G2ZA 1BWVA 2PN6A 1F1BB 3ET6A 3FZ2A 4WE1B 4C11B 4DL6A 1NK6A 4OI2A 2M8HA 2KG0A 1RAFB 1Y5LB 3EZUA 1FK9A 1HI8A 1RAGB 3ILLA 4K2JA 4B3RJ 1KN6A 2YWBA 5K8FA 4HR2A 4TYAA 4E0DA 3NS6A 2CQIA 2CDQA 2JDJA 4DR2C 3DRPB 4DG1B 3QWUA 3VGTA 2VH7A 2CAJA 2ZNZA 5B0BA 4R5PB 3E8OA 4CH1A 1FRJA 1SJQA 2R2SA 3VALA 4GS5A 2R9LA 5DO2A 3KJQB 3FCHA 4L75A 2V94A 2CJYB 4ATNA 2IA6A 1R43A 3D6HB 2MZTA 1L3KA 1R0CB 3CCES 1FO1A 2FJXA 3U1MA 1CULA 3CB4A 3SFUA 1S72S 2QA1A 3BH6B 1B64A 1T9WA 2P2BA 1WHYA 2LU1A 2GNKA 4FP9A 2MXYA 4CP5A 4ZVTB 3QGIA 3W5ZA 1VGYA 4NZ7A 2Y1RI 1JLCB 3R6LB 4DCUA 2IVFB 2AQ4A 2UV8G 2IA0A 2F9JA 2W2NP 3ZZOA 2KT2A 3EERA 4LFAC 2FJBB 3B78A 1JK9B 2MKJA 4HTJA 1NHKL 2B4VA 2PMZD 3M8QB 2P5VA 4PXEA 3ZZRA 2DBBA 4W90B 2IMOA 3R27A 3PM9A 3SZ2A 2B7BB 2LECA 1IKXA 3DN9A 2UXCC 1V60A 2Y4OA 3DOKB 1DBDA 4L3KA 1N6QB 1JQGA 1BA3A 3C46A 1JJCB 1TL5A 3KLIA 2K1RB 2CPXA 2AJFE 3KG4A 4ZPCA 2ZHBA 1X4GA 3MTJA 1LQ9A 4YFUA 2X7IA 1YQHA 3THPA 3PV8A 3FCEA 3SDEB 1Q81T 1WNEA 1X4FA 2HWTA 3JTNA 1VBZA 2P9EA 5AXKA 5A6PA 3IEUA 1PO6A 1CJUA 2XLJA 4WZQA 3CMES 5J2QA 3IG1A 2HRTA 5K14A 3M1VA 3I0RB 3KKFA 3D2WA 4LF7F 4OJGA 2KRRA 4KPCA 4BBYA 1FI4A 1KS2A 2F40A 3LH2S 4CLYA 4ZLLA 4X64C 4ANCA 3NGDA 1QE1A 5L1LA 3CD7A 1JXVA 1FWPA 2KFZA 2Y27A 2RH3A 2YNHA 2DHGA 5MLCV 5J1EA 1YJVA 3EDRB 1U25A 3UNGC 2J76E 2VFTA 3MM7B 2DT9A 4FPIA 4QIFA 4WU2A 4RUBA 5GAEU 3W65A 3KXWA 1BHNA 4DR6J 2W2PP 5KFWA 3ZC4A 5A8KA 2XS2A 4RX6A 1SIWB 1T9XA 1OIAA 4DS4A 3QBCA 3GV7B 5GADU 1U1PA 1JLAB 4ILRA 1KD1T 4R25A 1JLFA 3GWCA 1ZA2B 3MFHA 1LCIA 2QG9B 1Q95G 2YKOA 4Y2IA 2CNOB 4CLWA 3BSNA 1VQ4S 1IBCB 1MWQA 3NLCA 3PW2A 1XK8A 1Y5NB 3F41A 5AE2A 2IDLA 4H4OA 2LEPA 4RNHA 3TO8A 4EEYA 2ZOFA 1FTCA 1K1SA 5A2QY 2W01A 1M5KC 5A19A 4V19X 3DRSA 2YWEA 2ZKTA 5CHCB 5H9FK 3TR3A 4M5KA 2DGQA 3DLEB 3QLHA 4FNIA 4Q7AA 1ZH5A 2WVEA 1DLOA 2D28C 3ZNJ1 3MEEA 3H2LA 1AXQA 3B4MA 2B4UA 1RJJA 2FHKA 3DRPA 3IWLA 4OZLA 3PFEA 4TLRA 1TL3A 2AJ0A 3A3NB 4YHHJ 3CUNA 4DZDA 1X5TA 4OI0A 1Y3JA 3QFHA 2NZ4A 1FKPB 1NSAA 4I2QB 4J9LA 3RRHA 2OTJS 4K8RA 2W4CA 2WAQD 1M1GA 2KXNB 2HHXA 3CCZA 3KUHA 3BO3A 1ZTWA 2MKCA 3RBDA 4OYZA 1K73T 3UR0A 2PROA 2PIIA 3HT3A 4NXMJ 4KB7A 2YCBA 1SC1B 1O9TA 3IGNA 4ECUA 2E5LC 1KFDA 3RW7A 1PJ7A 2X3GA 2R7VA 2J6TA 4PUHA 1MN9A 3J81D 1RADB 2XWXA 2XBPA 4HT5A 2YH0A 1TFWA 3LF0A 1EARA 1SKWA 4DCSA 1AFIA 3Q23A 4ID5B 1Q5VA 3Q8YA 2BRLA 4PPDA 3CWJA 5KFAA 3GPCA 3EM1A 3NOGA 5DLGA 2M88A 4FN5A 5KFTA 3Q24A 4A48A 4K50A 1CEZA 1ELOA 2X1BA 3GMGA 4UW2A 5KFMA 4EYIB 4DV5J 4L2ZA 4X62C 3PG9A 1FDAA 2CNKB 4DG9A 3JSBA 2UUCF 1WG4A 5DGAA 4CLUA 1ZETA 1NJYA 1ZYQA 2CUYA 1Q86T 1NJXA 4LF8J 5CABA 1PC5A 3L7PA 3QO9B 3S1TA 4A8KA 4IDKA 5H9EJ 2VA3A 2OPSB 5BSWA 3CQ3A 4NRUA 5HP1B 4WK3A 1OYEA 1H3DA 3UDLA 4XIUA 3MM6A 4JI0F 2HHQA 1APSA 2OFGX 4M5IA 1FUGA 2DGSA 1NPPA 2E5HA 4I0WA 2XY6A 1NK8A 1RTZA 2HNDA 2PT7G 4F4KA 4FXVA 2VFUA 5F8LA 2W2OP 1XRAA 4OJHA 1O8BA 4NYPA 4DQRA 3Q86A 2R7WA 4MYUA 3NWRA 5F3TA 2H54B 1IM6A 4TKTA 4UF4A 2BR0A 4DN9A 2V4JB 4FPRA 1KR4A 3T6JA 2BE2A 1FX2A 5KT6A 2IM3A 1C4AA 3KWMA 7FDRA 5GMKa 3TQ1A 3T1HC 1WI6A 3M8ZA 5I3PA 5KFCA 4X64F 1N5QA 3RRGA 2VQFF 4OX9C 1R27B 2GQCA 1GX5A 2M4MA 2KRBA 1MWZA 1BE4A 4HH1A 5BJRA 1VQ7S 3KMQA 1WOSA 5FJ4A 2BJ9A 1UJ5A 1TKXA 4ENOA 3GE9A 1TL4A 4LMZA 4YR2A 4ECYA 2RB7A 3CDWA 2R8HA 4LSNA 1CJVB 1FNXH 3T1HJ 4ANDA 3M8QA 3MDFA 3EQ6A 4NOHA 3MCSA 1QAJA 1KQGB 4PCQA 4TYBA 4MKBA 1FLOA 2MJUA 3HVRA 2R8IA 4ECWA 1N8RT 4A8MP 2CADA 3GCWP 3BO4A 4DR3J 4FF2A 1FESA 2NYHA 2HGMA 1VYAA 2D74B 4QWAA 4KHMA 3PIPQ 1R8PA 3OXFA 2VU5A 1F3FA 1F3VA 1GT8A 2AHOB 4J91A 3C3LA 2YQ3A 3HVTA 1EX8A 1ZM3A 3SSRA 1UW4A 2FC9A 4RUHA 5A2QU 3NBPA 1TVRA 2XI2A 4DSFA 2BM1A 4OV6A 2DGWA 4A47A 5KFOA 1SL0A 4G3IA 4DV2J 2W24A 3UDCA 2BE7D 1KQSR 2M0GB 1RBOB 3MTKA 4BWJA 1D9FA 4M1KA 5ETQA 4PG8A 3DLKB 3K5NA 2OPQB 1IBKF 3VF0B 1C2PA 1HBMA 2APOA 2KZMA 3OR1B 5C24B 3BSOA 4DCPB 1L3UA 2E1AA 4JI8C 4F36A 4J9OA 1SCJB 1JJHA 4Q5VA 5J2MA 4JI5C 3K89A 1IKYA 4O3OA 4AQYJ 2J9EA 1YWXA 1VQ5S 1N32J 4N5SA 4PG4A 3TAPA 1HBUB 3GZ7A 5KFXA 2HFZA 4DCOB 2V8PA 4DLEA 2E9TA 2CJQA 4ZCKA 4OYCA 1X4EA 4WIIA 1T94A 2KG1A 4ZLPA 2V8GA 2A6MA 3CEDA 4XTTA 1M1HA 5IFMA 2BABA 1NCLA 2DNGA 2ZITA 3KJFB 4HT7A 4LIWA 1L3SA 2Q1LA 1YSJA 2QMXA 3D6MB 3QT7A 1FE0A 3EJMA 4AXIA 4C0HA 4QWEA 3MUMP 3K5MA 4CM0A 2R2RA 2JEFA 4LF7C 3DHVA 4F26A 3DU5A 4C2MA 2HK2A 2EPIA 5L9NA 3RUBL 2XCPA 1U7LA 2GW8A 3FBFA 2ZH4A 1H7WA 1ZAWA 2CFXA 2YQ1A 3MEEB 5G0RA 4YP3A 1CS4A 4GC6A 2VONA 5L1JA 2BW2A 3QWPA 1UEKA 3LP2A 4UOFA 2BH1X 3TAQA 1T9TA 1H2TZ 2J0SD 3KHGA 1S97A 4EU0A 2DGTA 1RT4A 2E7WA 4C0OC 1UVKA 2XO7A 1TK0A 1HR0F 5F8NA 2RKIB 2QC3A 4EK2A 3TARA 2Q79A 3HSJA 5AXMA 1XMOJ 2DRBA 4I67A 3BQ2A 4CT9A 2YKNB 3KLEB 2MZQA 2DNLA 3H20A 5CYMA 5J1NA 2RQCA 3GU0A 5IWAF 2H4WB 3T9NA 1JLGA 4DV5F 3G96A 2O1PA 3GIJA 3NCQA 2J8AA 2Q43A 3I31A 2HFUA 4KH1B 3R97A 1TH5A 4RM2A 3FCWA 2UXBC 1RWKB 2R3VA 3LP1A 1MXAA 4GXQA 3H98A 2CWXA 3AXKA 1L3TA 3KHLA 2ZOMA 2QGFB 1VOMA 4IG3B 4C7QA 2EC2A 4KHPJ 4PUIA 2VG6B 3LPYA 3VGVA 4HDGA 1WC5A 3C66A 1FJ7A 2V2VA 3JS9A 3HP6A 2Z2YB 2IM2A 1Y9OA 2FPHX 2OKQA 4KV8A 3KHHA 4URGA 1RAJA 3RTVA 1ULTA 1QAXA 4QR2A 3QZ7A 4O44B 2UVUA 3L8CA 3HVTB 4PROC 4U6PA 2QA4S 3E01B 2OEJA 2OPRB 1RHMB 2YKQA 2E29A 5A8WA 2BW7A 3VAMA 3V4IA 5C25A 3PR4A 1MXBA 1I94F 4CRJA 3ITHB 4ZDNA 1FFWB 1T9UA 3VAGA 4UY8T 1TL7B 1SXLA 3R6GB 4ZA1A 3BH7B 3VAHA 1F60B 5AJ3F 1L2FA 4C9DA 3Q2SC 5E0OA 2XS7A 3BKTA 1U6BA 5E3QA 5KFYA 5I42B 3CC2S 2UUBJ 3RV2A 3TANA 5GMDA 5B08A 1NRKA 1U26A 1UEUA 2JX2A 4KKOA 1X4CA 4X4UA 2RJZA 2P2CB 5DQIA 3BSCA 4NPOA 2EBEA 3ZO7A 3I08A 4KE5A 1KONA 2D27A 2HSEB 1U2RA 2XQCA 2V8DA 3SBMA 5IXUA 2DGUA 3J80U 1TUGB 4JI1J 4PQUB 1D0EA 1P1LA 2LDYA 3DFEA 3GCXP 4YDXA 3W9HA 4U7CA 2BOAA 5BUQA 5HI7A 1RT6A 1U1OA 5LMUF 4MIBA 1NO8A 3IO1A 3CULA 3UCUP 2FVPA 3L95X 4DR6F 1ZM2A 2CQ3A 1GXUA 2KZ0A 3PDNA 2LQBA 1XMOF 4ECZA 4J5OA 3M2RA 4O4GA 1YGYA 4B3SC 2DNMA 3OW2R 2ASJA 3KLHA 5EHHA 1TKTB 2F4VJ 4OX8A 4ZIWA 1VC5A 5IT0A 4F02A 2CPJA 4DV5C 1JNZB 4USKA 2BJ7A 4DPTA 1IKXB 1RGVA 3B82A 3NYRA 1S6PB 4S0MA 4OIXA 4K4XA 1HQEB 4IH6A 5KFQA 5D3GB 4DV1C 2Y3YA 1SJ1A 1UAWA 4B3SF 1EJ7L 1SKUB 2CU6A 2RUGA 4MMOA 1WEXA 2LQ8A 3GFHA 4WBFA 5D0GA 3RB4A 1XNRF 1UKKA 1XIQA 1FWKA 2HFVA 4WFNQ 1ACMB 4DHVA 4HHUA 5C2CA 1TELA 3ETMA 3R5BA 3PX6A 2AGQA 4KPYA 4M8LA 3MPUB 3UVJB 1WDTA 2OPPB 5KFHA 4NI2B 1Q8IA 5K14B 5H1SV 4DV3J 5M2PA 2PFFB 2D1TA 3A26A 3VVUA 8AT1B 2MJNA 2DPIA 1HL6A 2EI5A 1QSYA 4FTFA 5KG7A 1UFWA 3D54A 1NB7A 1HNZJ 3MUVP 4DX7A 3MHYA 1M5OC 3NNHA 2Y1JA 3MMCB 4Y2MA 4ED2A 1HQ2A 2R7QA 2RE1A 2W8KA 3NPDA 1U4BA 2B9XA 2O3DA 1JMTA 4AUKA 3EVMA 4DR4C 2D7VA 2WBRA 3IR6B 4DL0C 2E8CA 3H90A 3OSNA 5K85A 2Z2LA 1QDUB 4ECTA 3IRXB 4CLKA 4F8RA 1R6VA 1DQ9A 4ECRA 5T8SA 2N3LA 4JI7F 1IBLC 4TXSA 2BJ3A 2YXLA 4JI2F 4KTTA 1HLWA 2GGPA 5CQGA 1N5YB 4LF6J 1UCNA 2XEXA 4Y34A 1S49A 3H0PA 5F8MA 2ADCA 3PYEA 4OI6A 2LA6A 5H9UA 3LALA 4MKYA 4GKJJ 4HLBA 4JI6F 4P7TA 2W7OA 1XRCA 3ZZPA 1EHWA 2VBWA 3J7ZT 3D28A 2GQQA 5KFGA 3UE2A 1M6XA 2HNDB 3UWTA 4F3OA 4RLEA 2VKZG 2EW9A 4F7VA 4TY8A 4DG8A 2BXJA 5IOLA 3O5TB 4H4KA 2OGUA 1U1LA 2D1RA 1HNXC 3WHIA 1P4EA 1DJ0A 2Z0GA 1FD8A 3NS5A 3AOBA 1GEHA 3FGVA 5IC6B 1LW0B 1TL1A 3RR8A 2DHSA 2XULA 1PG4A 4DX8H 4ISBA 3GFZA 1XR5A 1RT3A 3TUJC 5GVQA 3RBZA 4OQJA 5F9NA 2Z56B 2QMUB 3M7VA 4N7TA 4PXBA 4JV1A 2M5HA 5SUHA 4OHZA 1BGXT 3PRVA 3HDSA 5F3ZA 1IXKA 5EN1A 4RO0A 3T1YJ 1AW0A 2ZBQA 2X1AA 2HKEA 2C22A 3P6YC 1RA7A 3SQGB 1B0TA 3D1HA 4ZVGA 4DV4F 1HNIA 5KOXA 2K7KA 1T11A 4B9LA 1BWEA 3M6VA 3FBEA 3M8PB 1N34J 3W2VB 1S59A 2DEIA 4DX6A 3K6RA 2P20A 2NLWA 4U95A 1XN9A 1X8DA 3IR5B 1C0UA 2HZAA 2RMLA 1ML8A 3DMJA 1UPMB 1EETB 2BJ8A 1HKAA 4URQU 4WYLA 5CAAA 2FUG9 2ZH5A 1UWBB 1IQTA 3ITHA 1MKYA 1BMQB 2CPZA 4JI1F 2JNJA 2AYMA 2PC6A 1U6ZA 3CDUA 3CDEA 2BJDA 3BGRB 4RKUC 4CZCA 3TZWA 4ER8A 2J6UA 2UUCJ 1USPA 5I3UB 3CJEA 4LFCC 1RBLA 1GFWB 5EX0A 2MQOA 1WD6A 3H2UB 2HNZA 5F0UA 1HBMB 3HHLD 4FYXB 2EFVA 4ILMA 1TV6B 4JI5F 3B8HA 4P6QA 3GYXB 3HD2A 2YKAA 4YR0A 4ES3A 4X4SA 4P72A 5E3PA 3SFGA 2IRUA 5D4PA 2J0WA 2RU3A 1BXNA 1T5DX 4DSLA 1IKYB 3HFZB 2UUCC 2VOPA 3M8RA 1WH9A 4JI7C 1AZSB 1RKJA 1NJZA 3OXLA 4F4YA 5D4LA 5LSLA 2UXDF 1U09A 3N79A 4USIA 4ZPBA 5CD4A 3O2EA 5KYVA 4DR5C 1K8AT 4M5NA 5D8HB 1QJHA 1VBXA 5J2PB 3PW4A 2UUTA 4F50A 1SVDA 4DR4F 1XHJA 2ASDA 4DSJA 2D9PA 4ZVUB 2MQ8A 4Z7CA 4C97A 4X66J 4O3PA 1GMVA 3JSMA 1QLNA 4U7UK 2OSQA 3MECB 3PFOA 4I56A 4HACB 1QAIA 1RCOB 4M5LA 2RRAA 3PO4A 2HGNA 3H59A 1FFGB 4QWBA 4CLSA 2J0XA 4N8OA 4NLVA 1REVB 5B0GA 3J7YU 1BUXA 5KFDA 3R2CJ 1SPBP 4NZ6A 4DUYF 3PJXA 2DH8A 1U0HA 1F9HA 2IHR1 3DLGA 3OFGA 4K5RA 4NDNA 1TL1B 2HVZA 3AJDA 2CXEA 2NREA 1WHVA 3D0GE 4F25A 4I6YA 2DCUB 2XSFA 3IXQA 1JLBB 4X66F 1KKGA 3A13A 3V5RA 1JLGB 2GO9A 1P1TA 1V3SA 4RBUA 2I5JB 4DR4J 1OWXA 3DYAB 4EZ9A 4TPSB 1PSDA 1VQYA 2I5JA 3K5LA 2GMJA 2VFVA 1LW2A 1J27A 4LR8A 3N0VA 5LM7E 3MR2A 4CNZA 4DN0A 2UXDJ 4KBIA 3AD7C 2XMUA 2P2FA 4NEYA 3C14A 4ZVHA 5D78A 2MY8A 4BWMA 2I38A 4IFYA 1X0FA 2YX1A 3LGNA 4MIWA 3W8GA 4KHPC 2QLWA 4Q0BB 2VL1A 3CE8A 4NMXA 1UWAA 3D0HE 3P8BB 1MXCA 5I3QA 1V5IB 2CQ4A 2V6AA 2UVVA 4DMZA 1GMWD 1RWMB 3KXDA 5EX3A 4YS2A 4B9TA 1OY9A 4GXRA 4B9NA 4KGVB 4RNFA 2C2KB 3QFWA 2DYAA 2YKMA 4OZ0A 4DQSA 1USPB 1FDBA 1GAOA 2DPLA 1WF0A 4PEOA 3M2VA 1ITPA 1TTHB 3SCIE 1VJWA 3H4DA 2QSFA 3BJYA 4L3NA 2R7RA 1DFDA 1S1VA 1S4EA 4PZVA 1HWLA 1F6TA 2DISA 2WTFA 4J9RA 4NCAA 4IO9Q 1FRXA 2ACYA 5IV4A 1WC0A 5HROA 4F3QA 4D57A 2UUBC 2G13A 2RQMA 1Y11A 2ATCB 3BGOP 2OJ3A 4WPAA 4AFFA 2HVDA 2KFYA 3LAXA 1P9QC 2CNNB 3EMTA 3MUTP 2V4RA 4GVBB 3D67A 3IS9A 4X4TA 2KB2A 2J8SA 1PJ5A 2LP4A 2VF3A 2HK3A 1HD0A 2HMIA 4W98A 3CQ1A 3CCTA 3BV8A 3UD5A 3ZTOA 3BSAA 2EK6A 2R8KA 4A8WA 4DR1F 3IMLA 2M3DA 1JWWA 4Z37A 2BBEA 2CQHA 5M2UA 3TW0A 4PAAA 2W7PA 3T1YF 3RB6A 1UMJA 1GTEA 2YNFB 4PG6A 2MMAB 2A1BA 3AF6A 2FLPA 5HATA 5KT2A 4BDPA 1OY6A 2HG4A 5FLXU 2A0FB 3I9ZA 2AEFA 1OSCA 2Z2MA 4TLQA 3MAQA 4NCBA 1Q5YA 2HFSA 5L38A 2XO6A 1KOHA 5D6GA 4FF4A 3LTOA 4NXNF 4FUQA 2NZCA 3D1QA 2P6SA 4I9GA 1A6LA 3CJ8A 1X9WA 3G8SA 3V81B 3EWGA 1M5HA 3TA0A 3LO3A 4PR6A 4X2BA 3F44A 4JI4C 3V81A 3DLBA 4I6AA 2BANB 1HWIA 2BYCA 3MEKA 3Q8RB 1FNMA 3KTQA 4CCHA 4LF1A 1VQNS 2MSSA 4DEZA 1VRUA 2OPSA 1WKLA 2DD8S 2QN6B 1C1BB 3CJ0A 3MM5B 3S6EA 1WF1A 3CO9A 1Q16B 4RW9B 4EO8A 5C25B 4TQSA 4DCJB 5J2QB 1PILA 2EFQA 4ZN1A 4NXNJ 4I69A 3E2EA 2AJQA 1TFYA 3R9WA 1A0OB 1RP5A 2B5JB 3BBFA 3DI6B 2F3JA 3DCAA 2F9DA 1WC4A 3D0IE 2KDOA 4M63A 2IBOA 4U9RA 1B7FA 3CT9A 3DGVA 3OL6A 3QAUA 2WW8A 3TVKA 2FJWA 2FGOA 2DR5A 4RJVA 5HL7Q 2ZH9A 2XZTB 3QMQA 1YITS 3BGLA 3GFYA 4URSA 1HNWJ 4LF5C 4MTPA 5KFRA 1WACA 1BC6A 5F41A 5J2MB 1DTTB 1X60A 2V67A 3BYPA 4X84A 3K5OA 3RR7A 3CXCR 3JAMU 3OJUA 3MURP 3CCUS 4JV2A 1SB6A 3OFEA 4OYAA 2UU9C 1EP4A 5J2NA 4OYIA 3EYZA 4KH0B 1ZAVA 1TMJA 1FDNA 1E6YA 2DNQA 5J2NB 1UW9A 5ETPA 5EDWA 4C8NA 5LT5A 4TU7A 3PX0A 1YTYA 1VBYA 4KJIA 3CJ4A 4WFYA 3W61A 1ZAXA 1PBAA 2PEHA 2ZBCA 4Y28C 1H2VZ 3T6BA 4Y65A 4RBVA 2VODA 1N33C 2IAJB 4U67Q 2IM0A 1R6YA 2RU9A 1U1RA 2ZE2B 1CJKB 1R3NA 3FDSA 2JMPA 4DV2C 1Y7PA 2WSEC 2LXFA 3P5BP 1NLKL 3CD6S 3KK1B 2BVZA 1SH0A 2PMWA 2QLJB 5CCMA 1DLOB 1NH8A 4ED0A 1HWJA 4BC9A 5GAEI 1EAYC 1S6PA 3MPYA 5F8HA 2RQKA 3T5LA 4PHTA 2ZDOA 1CQMA 4E2FB 4RW8B 1RBAA 5LMNC 3JTPA 3A8JA 1S0NA 4DQQA 1FWLA 3MR7A 3OD2A 4EO6A 4ZJQA 2E0GA 5A2QD 4P10A 1MROA 3CVKA 2F8MA 2NXUA 2F7VA 1U02A 2DITA 3M9OB 2X1FA 2XM3A 2DR9A 2VZ9A 1L3VA 1K1QA 4PWUA 1QE1B 1JNRB 3PYFA 4B9SA 2CQPA 4OHXA 1RT2B 4ZP8A 4DBQA 5CD4H 2XNRA 3MEGB 4QIVA 2CVEA 4A46A 4DU7A 1LWCB 1M5SA 5DRKA 3KYLA 4B3OA 1N36J 1NM2A 3CCVS 3ZTQA 3CCWA 3QIDA 3MR3A 1S9EB 4LFBF 4UTGA 3RG2A 4EATA 4IFYB 4WFAQ 2AU0A 3LWLA 1WORA 3CPWR 4C8KA 3FBCA 3JSYA 4PG5A 3KDOA 4PRFA 1HBOB 4DUYJ 3QRPA 1NZ8A 3VQTA 2HQFA 1XMQF 5ETMA 1LV5A 4GKKJ 2VOOA 1RTHA 4WXWA 1J5OA 1RTDB 3OHBA 2J6SA 1ZA1B 4OZNA 2AMCB 2I1RA 1KLMA 3HFKA 3M05A 4ZKAA 4QPXA 1U1NA 2XB2D 1MMLA 3S01A 3THTA 3NGKA 2GCFA 2FVRA 5BSRA 5AT1B 3GONA 4IDKB 4P2MA 5HJYA 3KLFA 3MPWA 1JLEB 2AZ1A 4XPEA 4C8LA 4DFMA 1MMNA 4GKKC 3SV3A 5LCIA 4Y2KA 4LFCJ 1EGAA 4IG0A 1NU4A 1URRA 3QJPA 7AT1B 4JI0C 2F8EX 2CZ4A 2WB4A 3CDAA 2AYBA 3ENWA 1GQEA 4NXMC 5LJ3Y 2V63A 3RBXA 2ZD1A 7FD1A 2OFHX 3J80Y 3A9VA 4DV6J 1UETA 5A0YA 3OFHA 1JXEA 2HRYA 2H51B 1QSSA 1W26A 1S7HA 5LOQA 3ZNUA 2LLZA 1ZB9A 3EGNA 1C4CA 1RWOB 2HQ3A 3Q8VA 2JNVA 3HHLB 2HBRB 1YRUA 2U2FA 2YKNA 2WZ1A 1P8GA 2CG4A 2XG8A 4HEA9 3KLEA 4DQIA 2JVRA 2NXEA 4I2PB 4OX7A 4N56A 1N88A 3R1HA 4DR2F 3HJVA 4B3MF 3E51A 1F5AA 2ZNYA 1F9FA 1TKXB 1WTBA 2KN4A 3GYNA 3L09A 1D1UA 2CIMA 1UVJA 5I4MA 2CY1A 2KHDA 4IO1A 4KAIA 4KHRA 5DDQC 2QRRA 4DR7F 3FZBA 2XSJA 4CYUA 1GX6A 3UCGA 3VR1A 4USUA 5LSOA 4V19J 3N4WA 4ED4A 1LK5A 3UPFA 1N6QA 3PTWA 3MAAA 2PA3A 2ZJRQ 2H5JB 3GSIA 4E8UA 2YPYA 2M9KA 3OTCA 1S0OA 1CVJA 3LGHA 3R9XA 2KFNA 1UVNA 2G2YA 3AF5A 3VHQA 1VRUB 2HWIA 4H54A 3TVYA 3G4SS 4JYAC 2J7WA 1TUVA 1HI1A 3HCXA 2EBGA 3QO9A 5AXNA 2HJGA 2E1PA 1VHIA 2O67A 3G6VA 3B54A 1RY2A 4FDFA 1G6BA 4IQXA 5D0RA 4TY9A 4DPUA 4DL3A 1WEYA 1NK0A 1RHUB 1FFSB 1LKZA 4RW4A 2QO3A 2OTLS 3FQKA 5IQ6A 1XNQF 4YR3A 4YHHC 1RT2A 4FYDA 2KTQA 2YNGA 2DCLA 1X9SA 4I7FA 4C3MA 4MK8A 3N6NA 3OPKA 3P3DA 2RVJA 4ED1A 1HQUA 1TKDA 4W92B 1R8AA 2ZHOA 2DGXA 3TZXA 2JRSA 3PW5A 3H4BA 5E5NA 1IM4A 1HHQA 2G1HA 2C3UA 3OTOJ 1UVLA 5L1KA 2OI2A 2JJ4D 3UNYA 4DR2J 1X4HA 2NSCA 3DRYA 5DGBA 3CIMA 3AH6A 1JLFB 1I51B 4ZCMA 1MNEA 5E7OB 2N7CA 1QAYA 3CDBA 4PWWA 4ED8A 1C1CB 1KDNA 1T03B 3K2YA 3MD1A 4ZP9A 5F0WA 5L46A 1LNQA 2DXEA 4P2FA 4LSNB 2MKSA 2D1SA 4XX2A 4J9VA 3R44A 3UCZP 2PT0A 3R5JB 3ILOA 2E5LF 5A1GA 2R2UA 3C15B 2V9WA 3A4IA 3ENAA 3ZFVA 4JI4J 3C6TA 1N0VC 3S82A 3IEVA 3NGRA 4DV3C 3ZZUA 2DNRA 4CLPA 1Q8BA 5AXLA 3Q8PB 4JI7J 2HZCA 2NUHA 4QR0A 1VBKA 3QNWB 4IOCQ 3KLIB 2AYAA 3I0SB 3FCCA 2E1RA 3L7UA 4MIAA 3QZ8A 4NE9C 4RWWA 3KJVB 2QV6A 3FSIA 2AD9A 3H5XA 4USVA 3PRDA 4K4ZA 5FDLB 3BM7A 4FXDA 1DARA 4GVBA 1I94C 3U1NA 4LFBC 8ATCB 1HBNB 4J37A 1PG5B 1XMBA 2P2MA 3G8TA 5IT9D 2EKNA 2FHOB 4RW6A 1SV5A 1NPRA 2KKHA 1G7CB 2RKIA 4FYYB 1Z1ZA 4NI2A 1ZZNA 2KHCA 4N41A 3NL0A 2DR6A 3T1HF 1HMVA 1MDBA 2MZSA 4M5JA 2N4DA 2AT1B 3NY0A 2BUNA 3G2XA 3OR1A 2QLFB 4QW8A 1ZTTA 3M6WA 3GIKA 1HNZF 5H9EK 2W2QP 1U45A 3UOWA 4AQYC 2Y8WA 2Q66A 3IBFB 4LFBJ 2HQDA 2JSXA 3PEHA 2ZBPA 4UOCA 5CXTA 2CPEA 2F4FA 2H9ZA 1WC3A 2V5HG 3KG1A 3U27A 3L3CA 4OYXA 2CQDA 2D7SA 5DZ7A 1RWWB 3ZTRA 2GQ2A 4X64J 3CJSA 3W5XA 1RAOA 4OYMA 1R0AA 3CQ2A 4LF9J 4JOUA 4BSZA 4D56A 2VQEC 1XNRJ 2MDAA 5HMWA 2BKOA 3DM2B 4UY85 5KT4A 4F2RA 1VJQA 4KFBB 2AIRB 2BANA 3UEBA 2A2CA 3QSIA 3HULA 3IRWP 5B7WA 5DM7Q 5FLXD 1UZDA 5K5MA 5T7LA 3UD3P 3AAWB 5E3CA 3HK2A 4LREA 4JYAJ 4J9KA 1CLFA 2V8VA 5A6WA 3G9CA 1KQKA 3VGUA 3GV5B 5KFSA 1NDCA 3CJ3A 2QFIA 5KAKA 2RF2A 2DNHA 4MFBB 1IKWB 2KYZA 3O6QA 4DQPA 2PN2A 3DOLA 1JIHA 1FDDA 3M30B 1IB8A 4FKXA 3LP2B 5KT7A 1KRPA 1XTZA 1MD9A 4G1QA 2HHHJ 4X4OA 3TUZC 4Q2MA 3CGIA 3T5HA 4LF8F 3NNCA 9ATCB 3W3SA 3FRYA 2ACMA 3G86A 2JH3A 2DXFA 1TUWA 3E3XA 1DHMA 3FMBA 3HMJG 4LQ3A 4ZJZA 4DR1C 5IT9U 1IQZA 1KVJA 2F8HA 4F0MA 2AX1A 3FK4A 3HLUA 4LJMA 2CKWA 4CO2A 1WELA 3R1LA 1R8CA 1RHRB 1KEKA 2D3O1 1PKUA 1FJEB 1T0TV 2CJXB 2HFNA 1HIYA 3L4BC 2BOPA 3MMBA 4DV7F 4LVOP 3QJLA 4AE5A 1WKKA 4ZCLA 3IAM9 3M8SA 4NLRA 2DNPA 3DU6A 4DSKA 3KUEA 5GAHI 1TKTA 5E41A 3KNAA 1WDDA 3R2DJ 1FJCA 1Q78A 3DLJA 2GAGC 2M2BA 4ZJLA 2Z51A 1PBUA 3CMAS 1N32C 4RL1A 1JKHB 4GC7A 2HVHA 3Q22A 2GC8A 1GXLA 1AFJA 2CPFA 3DOKA 5KYTA 4UQGA 4JI4F 1UL3A 1DTQB 3R3TA 3KG0A 4PUOB 3C5EA 3SEOA 5HLFA 4PZPA 1B4SA 2EEYA 4ICLB 2E5LJ 1F9EB 1S79A 5D4OA 3JB9k 1N5TA 2MYFA 5HLFB 2HNYA 1UFKA 1Q82T 1N2FA 5E3RA 4CLFA 4ERDA 3VAKA 5A8RB 1Q1KA 2ZH1A 4Q8EA 1WSVA 2DHMA 1QVFR 1G4CA 2ZWPA 3BR9A 2ZVSA 4KHPF 3DAYA 3W8PA 3OLAA 1NYEA 3DLKA 4XDDA 3UX2A 2OPPA 3KK2B 4B3TF 2IC3A 3PR5B 1RWUA 1ZBTA 2OEKA 2WHOA 1FK9B 4B9VA 2F65A 3FFIB 4FVMA 3V4MA 1P9YA 1R8HA 2QL5B 1EKSA 1NKEA 1ZB8A 5B0EA 4WP8A 4WU3A 4LF4J 3MOZA 4K0BA 2O66A 2M5OA 5CYQA 1S9EA 2C28A 3W66A 2BKNA 1VC6A 1JX4A 3MM7A 3BPSP 3DRRA 3K17A 4ES1A 4P74A 3MPVA 2QSWA 1WG1A 2YWFA 3CSKA 4ZOSA 3EXCX 1TU0B 4MTNA 4MKVA 2UVWA 2QVXX 3JQKA 1HNWC 5JJBA 4LIRA 2PE8A 5T7LB 2RILA 3VAIA 1VQ9S 3US5A 1XC9A 5K8NA 2VKRA 2XYHB 1OY8A 4NLWA 4IRDA 1MU2B 4LF4C 4O4GB 2G0IA 4LF7J 2Y1LB 4L73A 2YKMB 1KHVA 5HK4A 2A6OA 1KSPA 1WOOA 4L72B 1FKOA 3DNCA 1IKWA 3I87A 1QUVA 1OO0B 2UU9F 1U1KA 3AFGA 1O90A 2ZH3A 4DR5J 1S1VB 1X4DA 1RLCL 1FTRA 1YRXA 4O3QA 3HF5A 1HPZA 5K8MA 2MLYA 4ZITA 1UVIA 3DDKA 2R7XA 1S0MA 4CIOA 1OYDA 3L7OA 3ONQA 3EDQB 5KG4A 4NLOA 3FMWA 4TY8B 3R5AA 4Z7YA 5T41A 2DNZA 1RT5A 2WVDA 3NGSA 2DR8A 4C0BA 4DR5F 4JI3C 1JOSA 4OI3A 4CNYA 3QT5A 5ETLA 3NNAA 1PU1A 3W2WB 2XLIA 4QJVA 4B3MJ 4ELTA 5KEIA 4WKYA 1YG0A 1CJUB 3NAIA 2CQBA 4Y00A 4RNOA 1VK3A 2AJ2A 2XMKA 4LSLA 4O23A 4ZPWR 4IYQA 1VQSA 1RTIB 1V5VA 1SJ3P 1O6XA 2VDIA 4RW7A 3NGUA 2X1GA 3MCOA 1MSWD 3VTIA 1NY8A 2IM1A 1LW2B 3ELHA 3FVYA 1YBUA 5ETSA 3VAFA 4QYZJ 5KFFA 3HKZD 1S1WA 3NI2A 2IJFA 3PCOB 4NLXA 1ZM4A 3D1OA 3LNOA 5BSTA 1UTAA 4USWA 1SUQB 4ZN3A 2FLNA 1XWLA 4NYZA 3UN2A 2OP5A 1UWDA 3FEZA 4EGLA 1JLAA 2OPRA 1J5EJ 3MM9B 2MB0B 3C6UB 5HMXA 3M8WA 2EFPA 3UFCX 5KT5A 4F4WA 3B6BA 3CJ5A 2B9WA 3ET6B 4NLUA 2VB6A 1FCAA 2E5GA 2MMYA 3N5FA 5HO4A 3CF5Q 2IFXA 4X65F 1G3OA 1XMQJ 1KC8T 1P27B 3F0NA 4DI6A 3OUYA 5I42A 4WZMA 3DOLB 3M30A 3MM6B 5I3UA 3JYTB 3CCLS 3N6MA 3PW0A 4I7FB 3H5YA 3BF4A 2ROPA 4R5PA 4KO0B 1X7VA 4K5SA 3M2UA 3W62A 5CYQB 2ZD1B 2E7VA 4JUZA 3M6XA 1WG5A 1DAXA 3LANA 1T8EA 3D3CJ 4JV5J 2NQPA 2JEGA 3G87A 4MT1A 4I2QA 2PO4A 1FERA 3TJ8A 2R8JA 4J9UE 2ZKUA 1LW0A 1H0HB 2GHWA 2IDEA 1G2EA 2GZOA 4NCGA 4K0KF 3VZIA 2OBVA 2J9DA 5E3AA 4RUCA 2HMIB 1RT6B 2B8PA 2FC8A 3P49B 2B9YA 1VQLS 1VCTA 3HHLA 2ASLA 4OFZA 5JUMA 1CULB 1PYOB 3D6FB 5DG8A 4KGMA 2YY3A 4DL2A 1U49A 2WSCC 1S1UB 3KK3A 1R31A 1D3WA 1ICEB 2OSRA 4LRBA 4HI1A 4NWBA 3J81Y 5L1IA 4B3RF 4USMA 3Q8QB 4JI0J 1UEVA 2GHPA 4K59A 5H9FJ 1S48A 5FIIA 4JI1C 1F0XA 2AV5A 1VRQC 4DPOA 2WBMA 4H4MB 3ZTSA 1XEZA 2ZM6F 1RAAB 2LQ5A 5B0CA 2YNIB 4Y6IA 1RABB 2HHHF 4LF5F 2XR1A 3PJ9A 3UN5A 2ILYA 1T05A 2E7GA 4TU9A 2IJNA 3WBZA 4D3GA 4FS2A 1GPMA 2HBYB 2MLXA 3R7BB 4IUFA 1EKRA 3BGFA 4ICLA 3PESA 2PI5A 3OVAA 2QTWA 2IMWP 3S7RA 4GMKA 3UDVA 2P9CA 3UW1A 2KJVA 2KM8C 1SL1A 2FGCA 1U0HB 1VQOS 1VLAA 3NBPB 5K9FA 2ZM6J 2H65B 3T9ZA 4X4QA 4ZLNA 1HMVB 4IRKA 3CCRS 1UZHA 3N5BA 2IYGA 5B0FA 3X1LB 1QUPA 3QT8A 2R42A 3IBCB 2CPYA 3M1VB 3DI6A 4F67A 3PIOQ 4CLTA 3OJSA 3CIZA 3HXMA 2QEXS 3OTEA 4W4MA 2BQ3A 2XI3A 3D3BJ 3VAJA 3OT9A 2HS0A 2XGPA 2KU7A 5RUBA 5DV9A 4OZJA 3OFFA 3P5TL 1TP7A 3ZZZA 2RAQA 1LWCA 2JLFA 1RCXB 4ZVRB 4Q45A 3IAS9 4AYBD 1Q53A 1YJWS 1YJNS 3P4UB 1NK7A 1NKBA 4K0KJ 1V26A 4Q0BA 3TA1A 3H5UA 2V69A 4O0IA 3RB0A 2C2RA 5EGYA 1U1QA 3KLGA 3LWMA 4M5DA 1SL2A 1NZAA 2ZC3A 2BX6A 1M90T 3OR2B 1EB0A 1DQ8A 4EWTA 2VICA 2LYVA 3TNVA 3R9LA 2PA8D 3C2PA 4R0JA 2WK4A 2ZZTA 3H25A 3HZGA 1T3NA 2FVSA 2G4BA 3TAMB 2N3OA 2BV3A 2CZ9A 3L9ZA 4C48A 5IWAC 1IR2A 1KHWA 2DGVA 4QPTA 4H4OB 3W9IA 4LT6A 4JI2C 1FEEA 4HACA 1IKVA 2W4DA 1AA1B 4NLSA 5KFZA 1VRTA 3DDNA 3EGVA 3I5CA 3E7WA 5KFPA 1VRTB 3ENVA 1M0SA 5EWGA 1N48A 3I9V9 4JI6J 2WOMA 3GIIA 2VQEF 2XMAA 3JTOA 4K2XA 2PDAA 3KJVA 1RG9A 3DLGB 3O2IA 3W60A 1FRKA 2LMIA 2W2MP 3C16B 4KGKA 1MROB 1KNZA 1U47A 4RW6B 3GJSB 3IWNC 3A1YG 4QU6A 3N01A 2RHQB 1AUDA 2E8EA 4BHQA 1HYSA 3UD4P 2NUUG 4DF4A 2MTLA 1S1UA 3KK3B 4ZPVR 3U02A 4X4PA 3QSYB 3ZZ0A 1L5UA 2VD3A 4C3KA 3OL9A 2MSTA 2KM8B 1KLNA 2JHEA 2JVOA 1NXIA 1VC0A 4JBCA 2MQMA 2HS3A 4ED6A 3HO1A 3W7BA 3GG1A 4PQAA 3W5YA 4C6AA 2KO1A 3O1LA 3C19A 1HW9A 5IM0B 1Z4UA 2YX4A 3A4TA 4UUWA 2G0JA 1QY7A 5DM6Q 1W7WA 1T7PA 3OTOF 1H72C 2CJAA 2VASA 3RAQA 2YQ0A 4NLYA 4LSZB 5LXYA 1H38A 5GTDA 1U1MA 2C42A 3MZIA 4QIWD 1URNA 3HZEA 4DV3F 2WRMA 1S9FA 4U7UD 2FY1A 1QTNB 1KLMB 1PCAA 3MM9A 1RXOB 4DZ6A 4UT4A 5HSPA 4DLGA 4EBCA 4U5YD 2HNYB 2RDDA 1J5OB 1S4FA 2NYIA 1RTDA 2HHSA 2LDIA 3B4DA 1IBMC 2FLLA 3J7YI 3BPDA 1XJWB 3AY0A 1X4AA 4DDFA 3K59A 4PWDB 4CM2A 1LWXA 2OHDA 2J5AA 3HVWA 4IG0B 3R7NB 2ZH8A 3AQOA 4DR6C 3CNQP 6FDRA 1Q0NA 2JOQA 2FD2A 1I6JA 1NH7A 1S6QA 3CO0P 2DHXA 2RUSA 1GMUA 5GAGI 4L6V3 2ADBA 2YNGB 4DG1A 2WD9A 2HQIA 5BYRA 2UXBJ 2ZWOA 3CW2C 1W2IA 2XY7A 2OAUA 4LE5A 4KYZA 1WC1A 4OJ1A 8RUCA 5L8RC 2CZVC 5DDPC 3EPGA 3LNVA 4RZRA 1EP4B 2B4PA 2AEMA 2B6AB 2M5YA 4HI2A 2V2KA 2YWGA 2UUBF 4IOAQ 3MPDA 2JEJA 1N5VA 3PZPA 1QD1A 4MYTA 3V6DA 1NK5A 2IVMA 1N36C 2AF6A 2WW4A 2Y8YA 2QVYX 1HR0C 3NEKA 1OQ3A 4Q8FA 1JLCA 3EUNA 4KQZA 4NEZA 3VQSA 3LUSA 1YZ7A 4B3TJ 3F56A 1OPZA 1SJRA 2F63A 2VHGA 3ILIA 2UUWA 3U1LA 2L48A 1YJTA 3TI0A 2Y0BB 4YQWA 2EGTA 2ASYA 3I5BA 1UVMA 3TZYA 3EGZA 5BXIA 3LP0B 3MAAB 4FXWA 2PFDA 3VWSA 4OYWA 3SSQA 3MWBA 1TL3B 2VPZB 4OXIA 4RLQA 3GILA 2VPWB 2HVIA 5AE1A 1RAEB 5F8GA 3TEHB 4F2SA 2FJVA 4CO4A 1AMUA 1K0RA 2RDIA 1K0VA 3DLPX 5F8IA 1XQIA 2V2ZA 1DQAA 1S6OA 2CQCA 3MF5A 4RW8A 4AXJA 3M32A 3GIRA 2VJVA 4OL8A 1S1TA 2RRNA 3CJTA 4LUBA 4YY3F 4MAKA 1CJTA 1NMEB 4KY3A 1JJ4A 2OPQA 3UN3A 3TEGA 2RT3A 3TP2A 2DNOA 1CJTB 1RAIB 5HVGA 1PG3A 3IM9A 2F1FA 1B3TA 2XWYA 5KFKA 2B56A 2IPOB 3TUIC 2HBQB 4JV5C 3BO2A 2YNHB 4DV7J 5KG0A 2QA4G 1CQNA 4KGXB 3K57A 1N32F 3B7WA 3OL7A 2IYIA 4M94A 4KSEB 5HBMB 2CPIA 3RU0A 4FBUA 4F0HA 4J9QA 3M9MB 4O3NA 3POTA 2QX0A 4ZVFA 5U47A 1YHQS 2OD6A 1HBUA 1VQMS 1HHTP 2VJUA 2LKZA 5GMEA 4LR9A 1H6KX 4WP3A
chains in the Genus database with same CATH topology
3S8SA 1N0UA 1SQEA 4OMFG 2J9CA 2V0NA 3OQ2A 1VI7A 4I6WA 2Q6BA 3CW9A 1PC4A 3G6XA 2B4OA 2P9GA 3PY8A 4KIAA 3QPIA 3NWGA 5DG7A 4ECQA 4ZPDA 3MM8A 2VUGA 3FEYB 3IGVA 3MECA 3FQLA 5KFEA 5G0RB 2DHAA 1FRLA 3KLHB 1YIJS 4ED3A 2A18A 5KFUA 4JYAF 2V7BA 1OSDA 3C6TB 4I68A 2MZJA 4QIEA 2JC1A 2FJAB 4X4RA 2QT7A 4AL7A 1N34F 4G1QB 2BJOA 4O3RA 3LGMA 3M6UA 4JM1A 1UKUA 1FXLA 3H8YA 3GG0A 1B0VA 2E5IA 2WP0C 2JWNA 2ZC4A 3MMAB 2AYEA 1Y5IB 4IR9A 5KFJA 1RT1B 2LQ9A 3ICLA 2HHUA 2DNNA 4WS9A 4USJC 3OXGA 4DWIA 5G4DA 3OTOC 4DL7A 4HYKA 2ZZMA 2EWHA 1FF2A 2DTJA 3T19A 2VA2A 3PO5A 2IRYA 4DV0C 1TKZA 3NP5A 5IT4A 3LP0A 1S77D 3A8EA 2HHVA 4FS1A 2KT5A 3QGGA 4B9UA 3CD0A 2HYIB 2R7OA 2ZBIA 5DLFA 1BQNA 4G1IA 2QE5A 3KHRA 3SCJE 2J9DE 4ID8A 3BR8A 1HWKA 1HNZC 3J80D 3PJWA 4TU8A 4DV2F 2XGQA 4YB6A 3SDEA 5K8OA 2VG7A 2QYCA 4NLQA 2RD5C 3T1AA 2VG7B 4QU7A 1HH2P 3KOAA 4NA3A 4KC5A 2B5JA 3V6JA 1NAQA 2B51A 1SIZA 3K8WA 4DR3F 3OUYB 2FIUA 3PEJA 2ALZA 4NYOA 3X3UA 2PGCA 5EWEA 2CVIA 4XK8C 2IC3B 1WHWA 4IKAA 2VBYA 5HBMA 2Y1IA 2D9OA 2GFFA 3P96A 3FNNA 1Y0HA 2HFOA 1PGZA 1FE4A 1J5EC 1FRHA 1RISA 3QIPB 1H98A 1LWFB 4PKDB 4A8YA 3PHEA 1FD2A 1WHXA 4OHYA 5KG6A 3OSPA 4MH4A 3IC1A 1D8ZA 3LQVA 4RU2A 4R1LA 3VNRA 5GADI 1FHTA 1NHVA 4OHVA 4EYHB 5ADZA 3GIMA 4BS2A 4N47A 2B43A 3I07A 1IUJA 4O4RA 5D4NA 3PVXA 5BR8C 3C8YA 2XLKA 2XMWA 1IN0A 1LWEB 4MJKA 2E9ZA 3I0SA 5LMNF 4LF6C 4X62F 2C2DA 3BDPA 1FJGF 1HPZB 4FUTA 4XPCA 2ZJPQ 1REVA 2JLEA 1XR7A 3CCSS 5T14A 2HHTA 1SJFA 1NHUA 1EETA 5B0AA 4A8QA 4ECSA 4YDDB 1FRMA 1V6HA 2SXLA 1YBAA 2DGOA 3DHWC 2W8LA 1OS5A 4KRWA 2W9AA 4DV7C 1V3ZA 2HLUA 2O01C 4A4JA 2RS2A 2FJDB 4HH0A 1QSLA 1T95A 3TUFA 3BS9A 2YWHA 4LSLB 3K58A 1M5PC 2ZM6C 4NMLA 3TOQA 5CCLA 3N54B 3TDEA 4ZVEA 4DR7C 3DRRB 3MMCA 3UQSA 4LF8C 4Z2XA 2QA2A 1SI9A 3MAHA 1AROP 3ULHA 5KG1A 1XERA 4B08A 3AA9A 1S9GA 5DDRC 1KFSA 5E2QA 2A3JA 2UUBF 2DIUA 4UQTA 1N54B 6FD1A 2N82B 2MQPA 4V19J 2FTRA 1N52B 3GB0A 4OHWA 4YB5A 1QWIA 4WTYA 2OIHA 4C8ZA 3SSSA 4OV1A 3CCMS 5J2PA 3MEDB 4JV5F 3FEXB 4PWDA 5KFIA 5LSRA 2RF2B 3AB4B 3THVA 1JLEA 2AGPA 4YHHF 4Y3CA 5AE3A 4RU9A 1XNQC 5HN0A 5D3GA 4Q44A 3EZ5A 4EFAC 4NX9A 4DCVA 3AQPA 4PPZA 4WFXA 1FVSA 1VLYA 2D3UA 5HROB 3MFIA 2WCXA 4GKKF 2EC0A 1VHFA 3H40A 2M52A 1M5VC 4BC7A 1VK8A 4ZCIA 3V2UC 5C42A 1HW8A 1D9DA 2R8GA 1VQKS 1SV5B 2ILZA 2LEBA 2FHJA 1J5EF 2J0QD 1UJ4A 3RAMA 2JZ5A 1CG2A 1RT7B 2CQ1A 2COLA 3OVSA 2ATWA 3OTBA 4TN2A 3WX4A 1V9OA 4B17A 3M2RB 1HARA 2IRXA 2C3YA 2VFRA 5E33A 5KFLA 5JVHQ 4B9MA 3I56S 4K4SA 2K8GA 1S1WB 2BA9A 4RVOA 4B3MC 1X5PA 4H4MA 3OLBA 3BN4A 2YTCA 1X4BA 1BQNB 1K9MT 1CPZA 1UP1A 1O5JA 2CJKA 4IR7A 4QBUA 3C6UA 3N6LA 4IH7A 3Q2TC 4CO5A 3PX4A 1RTHB 4NLGA 4EBDA 1M1KT 1RYRA 1WEZA 4DS5A 2LQJA 2FDNA 2EKYA 2AX0A 3EXYA 2AP6A 2RNEA 4IZ6A 1UJ6A 4MFBA 4QW9A 1N56A 3BGRA 3ENQA 3TA2A 4WE1A 2VZEA 1D8YA 3MOJB 1UFLA 3QGPA 3M2UB 2DR7A 4KKOB 1V3RA 4WK1A 1B0PA 1H2UX 3AB2B 1TV6A 2BQUA 1Y3KA 2V4QA 4F4XA 3H5SA 2JLGA 1C0TA 2GV1A 2VG5B 4ZPAA 2HHPA 5D77A 5KTQA 1RTJB 3EPGA 3D5MA 1YJRA 5THWA 2V4JA 5LXRA 1C0TB 2VG5A 4YB1P 1K0TA 3K8VA 4TQRA 1DRZA 1N33F 3UI3A 3IS9B 4O3SA 3A9UA 1TR0A 2VPXB 4NCGB 3I96A 2ZJQQ 4DFPA 3HPOA 2XS5A 5BSMA 5KFBA 4MH8A 1JB0C 3UR3C 3PKYA 1KTVA 1P7LA 3CCQS 4ALZA 4R1MA 2VC1A 1OQ6A 1CC8A 2MQNA 4A8XA 2NSBA 4J9SA 4I64A 1RYSA 4RVNA 4NOZA 2ZE2A 4F3MA 1FKOB 3BDEA 3I4PA 4KT0C 1O92A 2ASBA 2ATLA 3DGPA 4DJBA 1IJEB 3KLVA 2HIQA 1U6FA 2QFJA 2E66A 3ETOA 5C42B 1T05B 4ZP6A 5DDOC 4ODJA 2NS1B 4OI4A 2B3TB 2PI4A 5CZXA 4DSIA 4EZ6A 1GH8A 2C3MA 4RW9A 5KG5A 4DF8A 4J9MA 3ETCA 4KTVA 3ZZYA 4LF6F 1RTIA 1VIXA 2UZAA 1VFJA 3NRBA 4NL5A 2LCWA 1S99A 3OHAA 2K2PA 2LEAA 1HA1A 4HTIA 4I4BA 4OX6A 3SCLE 5C24A 3DYAA 2Z4PA 1S76D 5LJ5Y 1JLQA 4ELVA 2Q3PA 2VBXA 4RW7B 4B3OB 4DL5A 4RNNA 1FNOA 3IA0A 3M8PA 2VG6A 3PROC 1SBRA 1XR6A 5IM0A 2A2DA 3KLGB 4QYRA 2J7UA 4QWDA 1C0UB 2L3MA 2BM0A 2AWZA 1S10A 3NCRA 2BZ2A 4KFBA 5F8JA 3WC0A 5JXSA 3TQIA 3T1YC 3I82A 3QJJA 4HPVA 3SXLA 2AJ1A 2GMLA 3BREA 3V4IB 4R0MA 5CA5A 3HHLC 2AYGA 4BCAA 2UUAC 3MEDA 5KG2A 2ZFHA 3HHEA 2QLXA 3OBIA 3CTRA 3HKWA 1ZOTA 2XY5A 4DSEA 3O44A 3N2QA 4CO3A 4Y2CA 3DHXA 3FSXA 4N77A 2I8EA 3DLHA 4QZVB 1FXDA 1FKPA 4WKRA 4K4UA 4A8SA 1FRIA 5JVGQ 4N76A 4RM3A 4RNMA 1ROFA 3WZ0A 2D3ZA 2D1CA 4LVNP 2OO4A 3QIPA 3G6ES 1HBNA 1ULRA 2MKKA 5FD1A 2W9BB 3G71S 1HYSB 2J7KA 2F4VF 2MZ1A 1BQMB 3RBEA 3OV7A 2BQRA 3V6DB 1S1XA 3BGUA 4I2PA 4LF9F 2DYJA 4Y2AA 5BYSA 1TK5A 3G7SA 4A8FA 5DG9A 2MY7A 4GO5X 3MMJA 1V25A 1MWYA 2GX8A 1NK9A 4DUZF 4YMEA 1F5CA 5CZVA 3PBKA 2HWHA 1JJ2R 4E98A 2CRLA 3EGWB 2LXUA 3SV4A 2U1AA 3BZQA 3DMJB 5T8TA 4NLDA 3HM9A 1UWBA 2B0GA 4OLPA 3LGXA 2VPYB 2L9NA 2CPDA 2EK1A 4QOTA 4UUXA 4DFKA 1VQ8S 2M8DB 2DRAA 4ZMMA 4DV6C 3MR5A 1SJ4P 1O0PA 2GHVC 2POKA 4FBTA 2WONB 1VMBA 2FHMA 4FNHA 4CTAB 1UA1A 2ONFA 1KOOA 2K3IA 1Q7LB 1U24A 3HHKA 3LUYA 3KLFB 5BUSA 4ES2A 4X65C 3I0RA 4HL9A 1YI2S 3AJ2A 4KO0A 1HFEL 3HX9A 3GSDA 5J1EB 3SI8A 2JEIA 1VQPS 2UXCF 1HQUB 1RTJA 2VSQA 2PD1A 2BE2B 1Q4RA 1VIOA 3H2TA 3VZHA 4H4KC 3BQ0A 2KZZA 4MK9A 2EG1A 2D1QA 2XMMA 4NLPA 4PQUA 2AGOA 2G0CA 1A7GE 2DB1A 3J7Z5 2XZWA 5FLXY 3LAKA 1VQ6S 4M5DB 3I5AA 2A10A 3DXSX 3PW7A 3CD5A 3VNSA 2LXIA 3TAMA 1QM4A 1MW7A 2OMOA 2FLOA 3VCDA 1IKVB 1SKSA 1YJ7A 4YOEA 4ZK7M 4YB7A 3CJ2A 2YNIA 4HVZA 5BR8F 2IAJA 2QZ8A 2OH2A 2UUAF 2L08A 1MDFA 4CI0B 1U8SA 2XSJB 1SH2A 4PXCA 3T3FA 3KK1A 1DTQA 2GIRA 2L9DA 2HRUA 4WF9Q 2IBKA 5GAHU 4J9NA 1N34C 4EBEA 2W9BA 4ELUA 1F5BA 2P6TA 4TNOA 5E7QA 5CYJA 1MMDA 3W2WA 2YVSA 4HDHA 1P6TA 1HNVB 3T5KA 1S1XB 1RK8A 1S1TB 1E6VA 1RKIA 2BACA 3KNGA 5EUHA 3KFWX 2R7UA 4K0KC 4I1TA 1CC7A 2P2QA 2HLTA 4RMNA 4LF4F 1WTFA 1O93A 3MEGA 3I55S 2LA4A 1O51A 3F73A 5A8KB 2E7XA 2FHJD 1R8BA 1HD1A 3GR0A 2BRKA 4KV8B 4ZP7A 4CH0S 4ILLA 1HBOA 1WI8A 4NLTA 2DJWA 4IOBA 3TVZA 3AHPA 4Y0FA 3CC7S 5KG3A 4QR1A 3GFXA 1BLUA 4GKJF 1Z2LA 3H2VE 4YY3C 3DLEA 1R89A 2CJ9A 3QLHB 4RUAA 1HNXF 4ETZA 2MKIA 4OZ5A 4LFCF 3MR6A 3R5CA 4ZPTR 2G9OA 4RWXA 1IJFB 3IBWA 2ZZNA 2GO8A 3RYLA 2Y0SD 1DTTA 2VBZA 2CQ2A 2ZUGA 5BYQA 3DOMA 1RT5B 4NA1A 1RT4B 1ZPVA 1BY9A 2DIVA 2W7AA 5CYMB 1RT1A 1X5SA 1BQMA 4G1PA 3N9UC 2E9RX 3NAHA 4X66C 3CJKB 1FA0A 3OVBA 2DNKA 3M9NB 4FF3A 2JC0A 4CO1A 2OPLA 4D4IA 5BURA 4DV4C 3V6KA 1NNDA 1WWHA 1KTQA 4IG3A 2CJBA 5SZTA 3P6YC 4ID5A 3NG8A 2VC0A 3I32A 3MI7X 2JL9A 1N36F 3SQGA