3GR0A

Periplasmic domain of the t3ss inner membrane protein prgh from s.typhimurium (fragment 170-362)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
186
structure length
186
Chain Sequence
LGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein prgH
publication title A conserved structural motif mediates formation of the periplasmic rings in the type III secretion system.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
total genus 69
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gr0A01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gr0A02
4ALZA 3GR1A 3GR0A 4G1IA
chains in the Genus database with same CATH superfamily
1O92A 4CLPA 3TWZA 1IR2A 2LLZA 2V34A 1JXVA 2OPQB 4DV1F 3IXQA 2O67A 1CS4A 5B09A 1UFLA 1GTHA 1RSCA 4HYKA 5F3ZA 2GW8A 4FS2A 3QAEA 4G36A 2Y27A 3NI2A 1BWEA 1SC6A 2FJAB 2DNYA 4LRBA 2A1BA 4NMXA 2XGPA 1TKTA 2B4VA 4IDKA 3GILA 1DQ8A 5C2GA 3TQIA 1QAYA 2ZWOA 3PJXA 2D1RA 2MHNA 3L7OA 2OTJS 2N3LA 3I6PA 1YJVA 5D4NA 3K0JA 2MHEA 4A8OA 2DT9A 1U1OA 2X1BA 4H4MA 4KH1B 4U7UK 1SXLA 2KDNA 4CH7A 4LBIA 1AB8A 3TVZA 4O3NA 4WK3A 5T7LB 2YNFA 4RNNA 3UNGC 5H1SV 5DGBA 2XHWA 2C2EA 2NXEA 1Y7PA 3FSIA 2GS8A 2JC0A 3LP1B 2DHAA 3MMAB 1S0MA 1UMJA 3BPSP 2ZH3A 4P75A 2CQBA 5FLXD 2X3GA 2O5DA 1BQMA 3CC2S 3KUHA 4R8UA 2WW4A 3W7BA 3MM9B 4FBTA 3G82A 5HANA 3OSPA 2DCLA 4HR2A 8RUCA 1HBNB 3D6HB 5KFFA 4G1QA 1J5OA 4L6V3 4DBQA 3LP0B 5EX0A 2XS7A 4DR7J 4NOHA 3ISNC 4RW6A 1P9QC 1X4GA 3KYLA 3CCTA 4C9DA 3W9HA 1M1GA 2MEWA 1N32J 4J37A 1TMJA 3T1HF 3IO1A 4EEYA 1V3ZA 1BQNB 3S7RA 3CSKA 2DKOB 1OY9A 4LSLA 2VC1A 5DM7Q 2IRYA 2FGCA 2MKHA 2VONA 3FCVA 5ETVA 2CPIA 4C11A 1NSKL 4NLTA 3BZQA 2E9RX 3RJMB 1DQ9A 3BS9A 1JLFB 6AT1B 4TU8A 3MECA 5F3TA 5K5MA 1WOPA 3Q0AA 3CO9A 2IAJA 1R27B 2I8EA 4JI8C 4LF9F 4M8LA 3ICLA 2AF6A 2HHQA 1TH5A 5CZVA 4DUTA 4P71A 1C1CA 2H48B 3PO4A 3R2DJ 3CWJA 5CH7B 1Q7LB 1M5VC 2BMBA 1NDLA 5BSRA 1X5TA 2APOA 3UCZP 2DRDA 3CO0P 3B54A 5I3PA 2W2QP 3QPIA 1XIQA 2MY8A 3T1AA 4DFPA 4DR5F 4F36A 5GADU 2ZOGA 1MDBA 4DQSA 1VQKS 5KFVA 1NBEB 2VF3A 2V4QA 1HBUA 4ZVEA 3HSJA 3GR1A 5GADI 3CCES 3JXOA 4ILLA 5L38A 4YY3C 3KNGA 4RUBA 5LXRA 2FJBB 5FLXY 1B7YB 4K7QA 4LE5A 2DD8S 2E5LC 3U02A 3FSXA 1T7PA 1HBMA 4NA1A 5CAAA 1NJIT 2DVIA 1Q78A 1AA1B 2W25A 3PW7A 2W7AA 4KB7A 4RBVA 1WKKA 3QZ7A 3EM1A 3ZTQA 1VBXA 3F44A 3H8YA 3LUYA 4HH0A 3BYRA 3JSMB 5KG0A 2J6TA 2ZE2A 1P9YA 1NU4A 5LL6d 1P4EC 4KBIA 3FVYA 5KYTA 2K06A 1GQEA 1Q8LA 4NEZA 1PYOB 2FVSA 1KEKA 4DLEA 2OP5A 1RTDB 3D0HE 4K2JA 4DFMA 3VVTA 2OELA 4IFYA 1GNKA 2E7XA 2VICA 1F0XA 3HZEA 1ULRA 2XY6A 4K0BA 3IEVA 1QVGR 4ZVOB 2XBPA 2P2CB 3NGUA 3VR1A 5KT7A 2HQIA 2HIQA 3EZUA 4HACB 2HHWA 1YK9A 2WB1D 1USPA 1WF1A 4JI7F 4F0MA 2UUCJ 2CXEA 4DX8H 1CLFA 4DQIA 3ZXWA 4JOUA 2J7KA 1KP6A 1F9EB 3OBIA 5B0BA 2JJ4D 1DZ5A 1UPMB 3GFHA 2C2NA 3U1MA 2V2VA 1LW0A 3R5DA 3T6JA 3M9MB 1CJTA 2B4UA 4DV2J 2ONFA 3BGUA 4RW9A 3KK1A 4PG8A 4USMA 1S1WA 3LWLA 1VC6A 3TW0A 3PX4A 3OTCA 4A4JA 1WI6A 2VZ9A 4X64F 4RUHA 1SJ4P 2ATWA 4NXMJ 1TKXB 2IM0A 2AX1A 3QGHA 2A6OA 1G7CB 5KFKA 3QT6A 3LOUA 3TX0A 2IY5B 1AYEA 1XMOJ 3K58A 4Y2MA 4URSA 2J76E 4YDDB 2ALZA 3L09A 4AXJA 3T1HC 3ETCA 3G87A 4C0HA 2DY1A 3CW2C 2G2OA 2H9ZA 1DRZA 1O90A 3G8SA 3EUNA 3HHKA 2IVFB 3DHXA 1Z2LA 2QSWA 3CMES 2VKZG 4QIGA 5D6GA 1VQ6S 3SDEB 1JMTA 3W9IA 1V26A 1U02A 3ILJA 4U5YD 5I3UA 4D56A 4LF8C 2Q66A 2MCQA 1R6VA 2QW0X 2IM1A 2RQMA 3P5BP 3Q8RB 5M2UA 4DPOA 1A6LA 4P9SA 5DGAA 3FEXB 4NCBA 2HNZA 4LF9C 2GHVC 2GVZA 5KFHA 1X5OA 4JV5C 1IKXA 1FEHA 1NPPA 5IM0B 3DRXA 1F3FA 3OJSA 4K4VA 1PSDA 3I32A 2RS2A 4FYYB 2VQFC 2CQ3A 5BXIA 4ZJZA 4KPCA 4NLWA 1Q8BA 5DQHA 1MWZA 1PG4A 1TUWA 1ZBTA 4J7CA 4N7TA 2LDIA 1S79A 3CQ1A 3BSNA 5KFEA 2J7WA 2JL9A 3R6LB 5HQLA 3FZ2A 3M7VA 1HWKA 4DR5C 3KNAA 2MQQA 2V9WA 3IM8A 1NK7A 4C8OA 3RB4A 2VU5A 2IC3B 5K9FA 2BJ1A 3A3OB 3JYTB 3HVTB 3MMBB 2EK1A 3DYAB 2IBOA 3EXYA 3ZTSA 5KFTA 4Y28C 1CC8A 1LFWA 4C0BA 3PCOB 3D6TB 2UUBJ 1HNIA 5ETQA 2YPYA 5F8LA 2X1FA 4I2PB 5L39A 1ZZNA 1MG7A 3SFGA 3F0NA 3CJ5A 4LF2A 1JLBB 2E1MC 1WC4A 5LM7E 4LR8A 3DM2B 4N77A 4J5OA 5KG5A 3HHLC 4I2QA 4JB8B 2W8LA 1XRBA 4I0WA 4QR2A 1HNWF 2LU1A 4QQBA 3HDSA 4O44B 2IRXA 2YWHA 2OEJA 4NLQA 1WEZA 4B3RF 2CKWA 1GX5A 4ZP7A 4DN9A 1RK8A 2C3YA 4LBHA 3W61A 4DV7C 2YH1A 2XS2A 1DJ0A 4P2FA 5AXLA 2PC6A 3TUFA 4ZLJA 2B56A 1UAWA 3JB9k 1RAAB 5KG2A 6FDRA 4A47A 4QWBA 2UP1A 3JAMU 1TV6B 4L76A 2DEJA 3D0IE 1JNZB 2NPIA 3ITHA 4OIXA 1YHQS 4DL3A 4PG4A 1FNOA 3HPOA 2CQ1A 4OV6A 3CJTA 1VBZA 4DV4J 4FF4A 1VLYA 1YJUA 5IFMA 4NXNJ 2FY8A 3MTKA 1H73A 3LWMA 4DV3C 2F4VJ 4CO2A 3P45B 1KDNA 1M1KT 1E6VA 4ZCMA 3VAGA 3RTVA 3UOWA 3FBFA 2AT1B 1B99A 1HNZJ 2RNEA 3EJMA 4BDPA 2MZTA 4OHWA 2PFDA 5ETNA 3C2PA 5CYQA 1KOOA 1RTHB 4LFAJ 2KVQE 4DSJA 5BURA 4UW2A 5K8FA 1CJVA 1ACMB 3MEGB 4JI3F 3K17A 4F4WA 1HQUA 2JMPA 4IH7A 2CAJA 2XQCA 2UV8A 4CM2A 1L3SA 4OYOA 4S0MA 3VNSA 4FYWB 1SL2A 4LF1A 1IJFB 1F9HA 4TU9A 5ETRA 2GCFA 4OI3A 2WW8A 4CLKA 3E51A 2LQ8A 4LF7F 1V9OA 3KJVA 3JQMA 1MXCA 2NQPA 4NMLA 3AY0A 4PXBA 2VG7A 3EVMA 3SSSA 1VHIA 4QWDA 3M2UB 4P6QA 4AFFA 1VQPS 3G8QA 3AD8C 2CXCA 4I4BA 1NDCA 1ZETA 1S9FA 2BXJA 1IB8A 2YWGA 2BE2A 3CJ8A 5GMEA 1YBAA 1MU2B 5DG9A 1PG5B 1URRA 4PPZA 2EBEA 1XERA 4NLDA 2IVMA 3AODA 2YWBA 2P20A 1F1BB 5HLFA 2EFNA 2R7QA 2LU2A 1CSJA 4LF5F 1O51A 1F5BA 1YJTA 1GXLA 3UR3C 5DQIA 4FXWA 1JLCB 4EBEA 2ZBPA 2VG6A 2OFHX 1NKEA 1RT2B 3K2YA 2ZUAA 1NHUA 2I5JB 3E2EA 2BJDA 5F0UA 2OPSA 1VQ5S 3K5OA 4GKKJ 4L73A 3R7NB 4FF3A 1SJ1A 3UEBA 2RHSB 4QU7A 2L41A 1CEZA 4FYVB 4C8KA 2CUYA 4ECYA 3KG1A 4UOCA 1GX6A 2DR7A 1RA7A 4ZVTB 4TNOA 2WAQD 2OI2A 3GONA 3MCNA 4KV8B 4K0KJ 3JQJA 4KE5A 4ZVUB 3US5A 4RKUC 4QYRA 2LMIA 7FDRA 4U6PA 3J81Y 1RHQB 4AT1B 2K3IA 4ETXA 1WKLA 1S7IA 4ED1A 1RISA 3GU0A 5F8IA 1MW7A 1R0CB 4U67Q 4KHPF 1PCAA 3H90A 3JAMD 3GSDA 4WIIA 1WG5A 3SQGA 2UVRA 2UVWA 3FMBA 3CC7S 1Y00A 2R8IA 1VQ9S 5C7PA 4M5JA 1XR7A 2PSZA 2V2QA 1T03B 3J7A1 2QGFB 4LJMA 1JX4A 4DCSA 2MZJA 2MZQA 2RKIB 2NUHA 5D0EA 1GTEA 3J80D 1Y9OA 3POTA 2CNLB 1AROP 4J9NA 4NWBA 4ZPBA 1TK8A 2E9ZA 4N47A 3U1NA 1B70B 1DURA 4B08A 2BACA 4HHUA 1FRIA 5SZTA 3A4IA 3TAMB 2F65A 3D7SB 2OTLS 1DTQB 4E0DA 1B7FA 5ETLA 5J1EA 2XGQA 3C14A 4X65F 5KFSA 4KFBB 3HD2A 4PKDB 4FVMA 4B02A 3R1HA 3M2RA 1IKWB 3TZZA 1UJ4A 2KDOA 2XMMA 1MMLA 1IR1A 4MK7A 3RAQA 4DR2F 3UVJA 1DAXA 4USKA 2J0XA 2ADCA 3EGWB 2PI5A 2UXBJ 1BD6A 3L8CA 2HQ3A 1HYSB 3P96A 4B17A 2L9DA 2LECA 3THVA 3PV8A 4GRSA 1U1MA 5A2QD 1X4CA 3IG1B 5IS2A 5IWAC 1Q1KA 5KFXA 4PG6A 3I0SB 3V4IB 3EDRB 1NZAA 4AL5A 1RT1B 3SZ2A 5LMUC 2NLWA 2CQCA 3W2WB 2Y8YA 3DLPX 4WKRA 1VBKA 4Q0BA 1E6YB 3DOKA 3VAIA 4L2ZA 5FD1A 1DLOA 1L3VA 2Y3YA 3BBBA 1RT3B 4NRUA 1N54B 3DLEA 2B51A 2M8DB 4PG7A 4JI3C 3BO3A 5ETSA 1P8GA 3VAFA 1YRTA 2C3MA 4OZLA 1RKIA 2MSSA 1TFYA 4NLVA 4OX9C 2CWKA 4UUXA 2KXHA 2OFGX 2X3DA 3IGVA 5D0GA 1MMDA 2U1AA 3EGVA 2IA6A 4LFCC 2XWYA 4DXLA 1Q81T 2B6AA 4DV6J 3M8PB 4GO7X 1YG0A 1M6XC 5L9XA 4Q2LA 3GWCA 1IBKJ 3K57A 3JAMY 1ZAWA 4LF7C 4MKYA 2VFUA 1UVNA 1OQ6A 3WX4A 1OIAA 3SCLE 1VJWA 3QGGA 1FRMA 4B9UA 4M5IA 3BSAA 3MCOA 3DOMA 3J80Y 2ROPA 4Y0FA 3Q2TC 1T02A 4ECZA 4TU7A 3PIOQ 3G4SS 1MWYA 2EGTA 3WX8A 3O8WA 3IMLA 2CRLA 2MLYA 3UCGA 4DR3C 3FCEA 2KYXA 1VQMS 2XC9A 1SUQB 1PC5A 1BMQB 4EMDA 1S6PA 1D8ZA 3PTWA 5K14A 4A8QA 3KHGA 2XLKA 3WHIA 4ZA1A 5A8RB 3T41A 3LF0A 4LBPA 4QWCA 3SMZA 2B8PA 2QLJB 2GA7A 1SQEA 1Q16B 5IQ6A 2VOPA 1RT7B 2H1YA 1RLDA 1LV5A 1S72S 2RF2A 1QM9A 3PIPQ 4C3KA 3QIPA 2VG5B 4J9RA 2KHDA 5C24B 4USHA 5A2QY 1FI4A 3I5CA 5I42A 1FF2A 3LALA 1UVIA 3MAQA 4LT6A 4AQYJ 3B4DA 2BQRA 3EXCX 2QFJA 3DDIA 3RRKA 2RRNA 3IRXA 4PABA 3OJUA 3K5NA 1X9SA 1N33J 1GMVA 3BGRB 2GQ2A 3UE2A 1SQFA 3V4MA 5DETA 2EBGA 3M30B 1W2IA 1GFWB 3ELHA 3N79A 3QLHA 4DQQA 1NK4A 4KHPC 3OVAA 4UOFA 3VNRA 1HI1A 2BKOA 3KLFA 3HF5A 1FXLA 1U24A 4DR4J 2YPZA 3R44A 3KLHA 2KG0A 2W4PA 1QLNA 4P2XA 3K89A 2EG2A 2IDEA 5E7OB 2VSQA 3TEHB 2V4RA 4GKJJ 4RW7A 4MYUA 3KHHA 4PHTA 4OYWA 3ET6A 3T1YJ 3NG8A 4H4KA 1EARA 3DGVA 3RB0A 3FEYB 1HR0J 3N2QA 5CQGA 2NR0A 3TJ8A 2ZZMA 3VGUA 3DNCA 4XAKA 2DNPA 3M8ZA 4QBUA 3I55S 3B6BA 2GIQA 4ELTA 2G2YA 4X4PA 2HHXA 3AOBA 4KIAA 4R0JA 1PAUB 4JUZA 4PUGA 1Q8KA 1UVJA 4JV1A 3W1YC 1PGZA 4ED6A 4X65C 3OHAA 2NCLA 2BDPA 4B9SA 4WE1B 3W2VB 1YDLA 2VZEA 4OFZA 2O01C 2NYHA 3E01A 1RT5B 4LR7A 3OR1B 3UPFA 1YJNS 1WDDA 5CHCB 2C22A 1HFEL 1HWIA 4DR6C 3PKYA 2B4OA 1I94C 2OPPA 1ZM9A 3MAHA 1XNRJ 2HRYA 3CCLS 2XSJB 2CA9A 5D0HA 1RZMA 4RLQA 2RUSA 1U6ZA 4LRAA 4I1TA 3O2EA 4PWUA 4MH8A 2IMWP 2EKNA 2ZH5A 1YRXA 1NK9A 4UUWA 2CADA 4LF4J 3VGVA 2J6SA 5LMNF 3MF5A 3PESA 1WC5A 3LO3A 4Z37A 2GVDA 1WKJA 3HVWA 2DXEA 1HARA 1RI7A 3EWGA 3TARA 2ZFHA 2V8VA 3UW1A 2HHPA 1U2RA 1FKPB 1KLMA 1LWCA 1N36J 4QJVA 4OJ1A 2FLNA 3V6KA 2IBKA 4R5PA 2RD5C 1BQXA 4WP3A 2OSRA 1T05A 2MKSA 2R8JA 1V25A 1RBAA 2PMZD 1IBLF 4WFZA 1Q0NA 3H5XA 4TVAB 4ZHRB 1CULB 2WD9A 1D1UA 3L7UA 1EETB 4GVBA 3SXLA 1RLCL 1Y4ZB 4QPTA 5E3CA 1O5JA 4V1Ak 1FDDA 2YQ0A 3FFIA 2B0GA 3IR6B 2MMAB 2BBEA 3ZZ0A 3TJ9A 1EB0A 4CLTA 1JXLA 3KJFB 1HNVA 4CLFA 3DRRB 4DG8A 4Q44A 5K20B 3TUPA 1NSQA 3C66A 3I0RA 4C7QA 1SJ3P 1IBMF 2VBZA 2I1RA 2E44A 1B0PA 4KO0B 1HNXC 1LWEB 1FWKA 2ZVIA 3OFEA 3P8BB 1M5PC 3KLEB 3QO9A 1S1UB 3MEDA 1WF2A 1NHKL 4FNIA 3TRGA 4IKAA 4O3SA 1ZAVA 3AJDA 2VC0A 3M4XA 2NPFA 5BUQA 5CABA 1J5EF 3GCXP 2HNYA 3MMJA 1D9FA 4KGXB 2HHHJ 2LXUA 2QL7B 3OFFA 4JI2F 2PFFB 3DCAA 1C0UA 2LP4A 4RR5A 4OJ3A 1N88A 3V81B 2JNVA 2FIUA 2V9KA 2LKZA 2H54B 3R5GA 4CT8A 1MROB 1RA6A 3ZNJ1 3MM6B 2KJWA 4YEAA 4UTGA 5IFIA 2P9GA 1M5OC 3TX8A 3QRPA 4F8RA 5J2NB 1JLEA 2IJRA 2NXNA 5J2QB 1H72C 1YZ7A 5IT0A 2UU9J 1TK5A 4J9LA 2EKYA 3D28A 5D4OA 3PNIA 2BW2A 1N6QB 4JV2A 5GMKa 1HH2P 3BEGB 1FA0A 1RDRA 1P7LA 1N5TA 3A13A 1TL7A 1YBUA 2HK2A 2VPWB 1I3OB 1REVA 4OLOA 3FMWA 1VYAA 1GT8A 4ECSA 1NO8A 4DPUA 3N6MA 3A26A 4DV1J 3UN2A 1CS4B 2DGXA 4J9VA 2B43A 2M9KA 3RZAA 2AMCB 4A8WA 1VQ8S 5BJRA 4RPFA 3O6QA 3ULHA 2MKIA 1F5CA 1M1HA 1ZM2A 1RWNB 4FKXA 2HIYA 4IDKB 3RV2A 2RHQB 1KFDA 3Q89A 1SH3A 4MIBA 5T8TA 1S4EA 4CDIA 2MQ8A 1S6UA 4OV1A 3T5JA 3GJQB 4X62F 4C2MA 1C4AA 2QMUB 2F8MA 1CBKA 4CZCA 1XNQC 2Y0SD 1ZPWX 1RAGB 4QW8A 1VQYA 2MQMA 3UDVA 3G9CA 3RRHA 3S01A 2ZKUA 4WCEQ 1HL6A 4B3TF 4YB1P 3I82A 1Y3JA 1FVSA 3M6WA 1KQGB 2VB6A 4LF6F 1EIYB 4PQUA 2ZBIA 4ZS6A 1QWIA 4UZCA 1R31A 1LCIA 3R2CJ 2E5IA 3D2WA 1BQMB 4DFJA 4CI0B 1U1LA 4R8UB 1H2TZ 3CIZA 3G82B 3VTIA 5LMNC 4IOAQ 5LCIA 3SSQA 2JWNA 2QLWA 1J5OB 2BYCA 4E2FB 3M05A 5BSMA 5EGYA 2L48A 4RUCA 3TUIC 3NEKA 2LEPA 4RW6B 3TI0A 2GV1A 1EJ7L 5LSLA 4DZDA 4RM3A 3N5FA 5DDQC 5A0YA 2WK4A 2ZD1B 1YBTA 1H38A 1TL3A 1IUJA 1IR0A 2LXIA 3TNVA 3NGKA 4PUHA 3TZWA 4IZ6A 4ZJQA 4LSLB 2FVPA 4P7TA 5KFOA 3I31A 2QVYX 4R1LA 2CPFA 1V3SA 3EZOA 2D1QA 2WB4A 3SBMA 4DEZA 4JI5F 3CMAS 2W24A 1ZAXA 2MM9A 1AMUA 3OL8A 2ZITA 2UUTA 2IAJB 4OYPA 2GQCA 5KT4A 4LIRA 2YNIB 4ZN1A 4F4KA 1RT6A 4LF9J 4D4IA 5ETMA 4WXOA 2E8EA 3T5LA 3NMRA 4UZBA 3DU6A 1WORA 2HFUA 3J81j 4OZNA 1C1CB 4CT9A 3IEUA 3M2VB 2D3O1 3R97A 1QUPA 2AYAA 1OO0B 2QVZX 3UN5A 2CY1A 4LFBC 4JI1F 1JLQA 3E8OA 5GVQA 4HH1A 4I67A 3DMJA 4MTNA 2DISA 2OD4A 1A9NB 5JVHQ 2FHKA 1HA1A 4ILMA 4V19X 4G65A 4DR5J 1RQ0A 3CCVS 4JI2C 1HBUB 2W7OA 2UVUA 4I6WA 2YX7A 2D1CA 4PCQA 4P74A 3W60A 2AJ2A 2HS4A 3HULA 1JKHA 1YITS 4WF9Q 2XLIA 2D3OR 2PGCA 1H7XA 1GEHA 4RWXA 2YBVA 2Y1IA 2HURA 1FXDA 4Q8EA 4QWEA 1GH8A 1Q5VA 1HBMB 2W1BA 4CM0A 4EZ9A 3DDKA 4M5MA 3T3FA 1S76D 1G1XA 4RLFA 1FTCA 3I4PA 3JTPA 3MAAA 3PW0A 1T9XA 1LOUA 2QT7A 4ATNA 2C2KB 1XC9A 3UN3A 4JI4J 4JYAF 2ZE2B 2HQGA 2WP0C 5ADZA 2R4FA 3R9WA 4UT4A 2M88A 1XHJA 4O3OA 3BQ2A 2HVEA 5AJ3F 3R5BA 4WZQA 3MCSA 2YWCA 4ZJOA 2SXLA 5DDRC 1RAFB 4DCPB 3EERA 3CD7A 5LT5A 1Y3KA 2W2OP 3GFXA 4O0IA 1SC3B 1VS3A 4WIQA 4ED7A 3LPEA 4IFYB 4F4AA 3DGPA 4C97A 4G1PA 3JSRA 2F1FA 2ZJRQ 1L3KA 1AUDA 5BR8F 2R2RA 4HKQA 1RACB 1S1VB 3CCWA 4DCVA 2YNGA 2PT7G 1LXJA 3IMQJ 3KJNB 4IR1A 1SVDA 1USPB 2BKPA 1VMBA 2P2MA 2IPOB 4JI7J 1DBDA 1FE4A 2BJ7A 4N5SA 4J91A 2XLJA 4PXDA 4Z7YA 3KMQA 4F0HA 3K5MA 1X5PA 4TY8B 1LW0B 4EBDA 1U6BA 2GFFA 4TN2A 4OI1A 5BYQA 2E9TA 4ELUA 3N4WA 4MKAA 3KK1B 4RJVA 1DFDA 3C6UB 3PRBA 1S1WB 3T5KA 4M5KA 1ZS6A 2DYAA 3BGLA 4U9RA 4XPEA 2DHHA 2Y9HA 4X64J 4OX8A 1NYEA 4CH1A 1TFWA 3M8YA 1XMQC 2H4YB 4IRKA 1O6XA 4OMFG 2C2MB 3CDAA 3D1OA 3UDCA 3PW5A 1APSA 4W90B 3AB2B 1TL1A 4USTA 3G86A 5DV9A 2YNHB 1IQTA 2LQBA 2FY1A 1PYTA 4JI6C 4UY8T 2ZDPA 2N82B 1Z1ZA 1MXAA 1EQMA 4HTIA 1U1NA 1LQLA 3W5YA 3LP1A 4NZ0A 1VQLS 1R3NA 2XMTA 2ZM6C 2Z30B 2UUAC 4RW8A 5A76A 3H40A 2C1EB 4ZK7M 4JI5C 3NWGA 4C48A 1WH9A 5H9FJ 2XB2D 1T8EA 7AT1B 4ANCA 2HRTA 2DPLA 5KOWA 1JJ4A 4PWDB 3DLJA 3CJSA 3QJPA 2DY9A 1H74A 4WV3A 3SYZA 1KKHA 1HMVB 8AT1B 3AF6A 2IM3A 2F8HA 2HNZB 1HBNA 2GVZB 2N4DA 3NCRA 3CUNA 2M2BA 5SUHA 1IKXB 3H98A 3QWUA 1RADB 2WVCA 4HHJA 5DO2A 3MR2A 3L7PA 4B3OA 2VUGA 3NGRA 4GS5A 5KYVA 3BB5A 4B3SF 3PDNA 4JI1C 4DL2A 2HFOA 1X0FA 3OTOJ 1IM4A 1UFKA 3UD4P 5E3AA 3MM7A 2CZ9A 1FJ7A 3IP0A 2IYGA 3DLGA 3NS5A 3PYDA 4DR1J 5F9NA 5KT6A 2KT5A 1DHMA 4I7FA 4PUOA 5MLCV 2NREA 3CJKA 2V2KA 3S8SA 5THWA 1I6JA 5E33A 1HNIB 3OVSA 4EUVA 1MN9A 4OQJA 2VQEF 5KFPA 1NK6A 1IM6A 3VAJA 3G8TA 4I2QB 1ZYQA 4USWA 1WCJA 1Y11A 2XS5A 3PROC 3MR5A 1HNWJ 3HXMA 5D0RA 1P1LA 4R0EA 1OQ3A 1WSRA 3G71S 4B3RJ 4YHHC 4EZ6A 4KKOA 2ZNYA 4C8YA 1J2VA 2E7VA 4X4RA 3QBCA 2CPYA 2PT0A 2UXDC 5HAOA 3J7YI 1S0OA 3WIUA 2XM3A 4JI0F 4RWWA 2IRUA 2KT2A 4DQRA 2CVIA 3ITHB 4LRDA 4ECTA 4OYIA 3R7BB 3QAUA 1C1BA 1S1TA 4X66C 1X4EA 4CLYA 3CULA 1VRTA 4OI4A 3TEGA 5J1NA 3V2UC 2R7UA 5KFZA 2V2ZA 2KRRA 1P27B 1PU1A 4YB6A 3GYGA 1F2HA 3EZ5A 4ITSA 1U8WA 1QAIA 2BR0A 2B7BB 2LCWA 4EATA 3Q8UA 1R0AB 5BR8C 2JX2A 3IWXA 1NXIA 2R2UA 1CJUB 2AJ0A 4DOZA 4O3QA 3R5AA 1UWBB 1N8RT 3RG2A 2YWWA 4TQSA 1S59A 2HLTA 1LWFA 1N5SA 3NNHA 3Q22A 5DM6Q 1WACA 2YWEA 4XDCA 2EFOA 2CU6A 4F4XA 4ZDNA 3ZZRA 5CYQB 3N6NA 4K4XA 3GYNA 5DS7A 3W63A 3E7WA 4K8RA 1CJVB 1UFWA 3Q86A 3Q8VA 4LQ9A 3BO2A 1ELOA 3VCDA 3GV8B 4W98A 4OYMA 2MGZA 1HQUB 1LNQA 1S9GA 3BKTA 2CQHA 1FE0A 3OL9A 4M5LA 3BDEA 1RBOB 2H5EA 3MPYA 3OXGA 2Y4OA 2R2SA 2EC0A 4HDHA 2PIIA 2AHOB 1T3NA 5F9LA 2DIUA 1RTZA 3JTOA 4YP3A 1UZDA 4LIWA 3KJVB 2QSFA 4LF7J 1RABB 1UVLA 4NPOA 4KTQA 4DV0J 1XBWA 2BM1A 2XMJA 3HMJG 1UTAA 2ZH2A 1S12A 2UUCF 1HI8A 1U0HB 5AE1A 4DPTA 1AZSA 2QLBB 4KHRA 2OBVA 3DHWC 3M8WA 3PHTA 4BC9A 2J0WA 2RU9A 2UXCJ 2BE2B 3MEKA 1IQZA 2ZUGA 1CVJA 2PD1A 4MKBA 3P5TL 3EQ6A 3V5RA 3VWSA 4WFNQ 3ADAC 4N8NA 2H3EB 2AJFE 2Z58B 5HLFB 4C8LA 5DLFA 2ZH6A 3ZZUA 4NA3A 3RAMA 4LF5J 1FDAA 3GLJA 1QDUB 1TTHB 2LA6A 1TUVA 4DSFA 3BKFA 5ETTA 4JI8F 4ER8A 1TKXA 1RAHB 4ZVSB 2BJ9A 4DR7C 3R5JB 1RAEB 1L2FA 2XNRA 3E3XA 1U25A 4ZPCA 4UY85 1FJEB 1N32C 1N2FA 4Q5VA 4GXRA 5F41A 2HRUA 4DF4A 4F50A 2R2TA 1D9DA 1K0TA 2B3TB 1G4CA 3KFWX 2W9AA 3LW5C 1RWMB 4YS2A 3ILIA 1F5AA 2B9XA 3M6VA 1ZB9A 2G0JA 2DHSA 3CD6S 4DL0C 3J7AN 3UQSA 5K85A 4K4TA 3O1LA 4YN3B 2HBZB 4KHPJ 4AL6A 4DL5A 4KAIA 4PR6A 3SQGB 3NOCA 2FLOA 1IWGA 3KUEA 3HKZD 2CYYA 5E2QA 1NJXA 2G2ZA 2H5IB 1QAJA 1XR6A 3NYRA 3FBBA 1SPBP 2O1PA 3POTB 2MDAA 3G2XA 1HPZB 3SO4A 1XWLA 3IN5A 2XO6A 4IO1A 1U49A 5HMYA 4U95A 2ZHOA 3W8GA 2K8GA 1WG1A 5GTDA 3OUYA 1VLAA 1T5HX 2MJUA 2PN6A 5KFNA 1FESA 1FFSB 5J1EB 2OIHA 3M2RB 2M8HA 1NB2A 4HLBA 4ECRA 3IAM9 4JI0C 3MPVA 1R6YA 2OMOA 3UVJB 3EICA 5DRKA 4MT1A 3DYAA 3PO5A 4DR2J 1N34J 4RZRA 2UUBF 3IWLA 4I2PA 1KQKA 2DRBA 2OO4A 1TVRA 2CQ0A 1FJCA 2HNDB 2GZOA 3D6FB 4MK8A 3R8YA 3CCUS 3CJRA 1N5YA 3H2VE 1RB0A 2PA8D 1SJQA 3IBWA 3MWBA 1IWAA 2FJXA 2M7SA 4Q0BB 1UEVA 4I9GA 3DOKB 2ILZA 2JEGA 2Z56B 4J9UE 2NXUA 4NYPA 2BQUA 1YRUA 3GR0A 3GIIA 1RKJA 1DLOB 1HWUA 1XEZA 3QGPA 1M0SA 3M8SA 5KFDA 1VBYA 2D41A 3DLEB 7FD1A 3JSYA 5RUBA 3BR8A 3M8QB 1TV6A 3G6XA 5F8HA 2GMHA 5IT9U 3DHVA 1MD9A 4ECQA 2V7BA 3ISND 4BC7A 1RHMB 2B6AB 4PYDA 4Q7AA 3N54B 4MMOA 4ES1A 2AZ1A 4H4OA 3D3BJ 2F4VF 5KTQA 3M1VA 3CJQA 2AW0A 1FRLA 2R7SA 1QY7A 2C3PA 2QV6A 4UQGA 1WHXA 2YKPA 2RB7A 3W8PA 1G2EA 1B4SA 3FCHA 2Y1LB 1TL5A 1RWWB 3DOMB 2UUCC 1EX8A 4Y65A 4ID8A 4LFAF 3V6HA 1NUEA 5BYRA 3RAXA 3FBCA 3GE9A 3EPIA 3MEGA 4RU9A 2EFQA 5IXUA 2F63A 4XDDA 4RLEA 2XHCA 2GHWA 1XQIA 3IC1A 2Y4NA 1S4FA 1UVKA 1BHNA 4Q2MA 2NSBA 1VISA 4DV2C 3VQSA 1S6PB 4TQRA 2VL1A 3NBPA 5HP1A 5K14B 4LF8F 4ZP9A 3D1QA 1NH7A 3KJQB 3A3NB 4USIA 1WDTA 4EO8A 4L7IA 2KFNA 1FKAF 3THTA 2KU7A 1RHKB 1KN6A 5LSOA 2KJVA 4NXMC 3HZGA 4JM1A 3H2UB 4NDNA 3TYTA 4KPYA 2LA4A 2RF2B 2N3OA 1YJ9S 2HWTA 2W2NP 4JV5F 3GJTB 3W5ZA 3M2UA 5J2PA 3ZNUA 4BLGA 2RE1A 4C8NA 1N5QA 4F2RA 2QYGA 3T5HA 2VQFF 2HQDA 4B9MA 2DGOA 3KK2B 3EDQB 3IRXB 5FJ4A 3H4DA 3L4BC 1A7GE 2QLFB 1EHWA 2P2QA 2HBYB 4KGVB 1N5VA 3QLHB 2EXUA 2VBYA 5JMNA 5KFLA 2RS8A 1Q53A 3KLFB 1U2CA 5HQ8A 1QSLA 4EYIB 5FDLA 2RT3A 4NEYA 2ASLA 1FFWB 4CO4A 3KLHB 2CJYB 3DDNA 2BOAA 3DI6A 4KY3A 2I5JA 1RYSA 2V6AA 2ZZNA 3V6DB 4RW7B 2FB0A 5BSTA 3IA0A 3ET6B 2I6WA 2M5YA 2ASYA 1VC0A 1OJ4A 3EGZA 3D0GE 4U8YA 1Y5NB 1S77D 3FRZA 3KLIA 1JLGA 3RBXA 2C28A 3TA0A 2HKEA 2CJAA 3D3CJ 5GAHU 4FYXB 4DV7F 4RL1A 3HD1A 3CXCR 4X4NA 5KFQA 1K8AT 1N0VC 4NYZA 2ZH4A 4CLWA 2K1RA 4O4RA 3FGVA 2FD2A 1FDNA 3E01B 2UUBC 5IT9D 3ENQA 4HEA9 4QR0A 1T03A 4IG0A 4ETZA 1LW2A 2CVEA 5KG1A 2RKIA 4O23A 5G0RA 4LVOP 3VZIA 3B82A 3PRDA 3UWTA 4FF1A 2Z2MA 4CNYA 4DV3F 4DCOB 4WFAQ 3FCWA 1K9MT 3OVBA 4HTJA 2JEJA 1OS5A 2J8AA 3FDSA 1QTNB 1KSPA 2DR6A 1HHQA 3GZ7A 1NEEA 5IZHA 2KI2A 3GPAA 1P4EA 5F8JA 4ED3A 3TAMA 3GFYA 2GVDB 1CJKA 2Y1JA 4DDFA 4KFBA 4JBCA 4ZPVR 5F8GA 2QA4S 4F02A 1BXNA 2FZGB 3QGIA 2AP6A 2IYIA 1KLMB 1VRUA 3PY8A 1LWCB 2KYZA 4IFVA 1HQ2A 3C15A 3B8HA 1UVMA 2RIJA 4DV4C 4R5PB 2RUGA 3SQOP 4NXNC 3GB0A 3KXDA 2PROA 3DLHA 1D3WA 1T05B 2VOOA 2F4VC 4M95A 2BRLA 2MLZA 2FTRA 4ZP6A 3L95X 1OYDA 4C3MA 2E7GA 1IBLJ 4TXSA 2KL8A 3QJJA 1ZTWA 2KN4A 1T9WA 3H4BA 4QIVA 4OI2A 3W2WA 1GXTA 2IDLA 2Z2LA 1L3TA 4GVBB 4M63A 4RUAA 2D1SA 1HNZC 2JNJA 3HM9A 2DTJA 5D4PA 4FF2A 4OZ0A 3FFIB 3ZZOA 5CYMA 3CJ4A 2FPHX 2HBRB 4LFAC 1WSVA 4ZP8A 1L3UA 3LP2A 3SI8A 4K4WA 2J6UA 2JRSA 2D74B 2KFYA 2QE5A 2QRRA 3SCKE 1MLAA 3QYYA 4HI2A 4YFUA 5CCMA 2OPRA 1ROFA 2AEFA 1K1SA 2Q6BA 1H2VZ 5T41A 1FT8A 4WFBQ 1U1QA 4PG5A 1IBMJ 1DY3A 3VV2B 3K7RA 1NPRA 1O93A 5D77A 1H0HB 3O2IA 3FC9A 2V68A 3M8PA 2E7WA 2AD9A 3RGIA 4F0KA 3UD5A 1IBKF 2VODA 4RVNA 1KD1T 1WI8A 2MMYA 3W3SA 4USVA 5IT9Y 4WKYA 2R7WA 3LPYA 2HFVA 1TKZA 1SL1A 1L5UA 3AF5A 4KR0B 2HNYB 1PBUA 1J5EJ 2Z0GA 2CPJA 2DR5A 1C0UB 2BVZA 3C8YA 1FKOA 3R7SB 3TR3A 3KXWA 1PKUA 3PJ9A 4LUBA 2DNKA 4L74A 1VC5A 1N4LA 2CNNB 2JDJA 2BUNA 3KUGA 3O5TB 2MXYA 4NLUA 3MD3A 1JLEB 3FQLA 3RBEA 1TP7A 1SV5A 3MM8A 1ZB8A 2JHEA 1IKVA 1UJ5A 4TLRA 1RBLA 2CFXA 1MWQA 3KLGA 4Q43A 2VPYB 2XNQA 1SBRA 4Z2XA 4J9KA 3N6LA 1X7VA 1NDKA 5E7QA 3CVKA 2OJ3A 1TL7B 1N52B 4GKKC 2Z2YB 1HWJA 4YUDA 1REVB 5IT4A 2AJ4A 2DIVA 3LA0A 5CA5A 2Y1RI 4LSNA 3UX2A 2MQNA 4WYLA 1IKYA 2A18A 5KFUA 2QJ3A 1C0TA 5C25B 2P2BA 1TAUA 3SSRA 3KDNA 1KRPA 3AQOA 4M1KA 4WFYA 5HROB 3B7WA 4MAKA 4EO6A 3ZZZA 5DDPC 2H51B 3HHLA 3I08A 2C2RA 4X62J 4ZVQB 1T3OA 3CDBA 1S6QA 2QA1A 5EWFA 3HFZB 4QIFA 1PIEA 1SQGA 1O8BA 3H25A 3PKMA 5HI7A 1WHVA 3VAKA 1SJFA 2P9EA 3Q2SC 3T1YF 4XO0A 1JJ2R 3GJRB 3WZ0A 2XEXA 3BREA 5IWAF 2BA9A 1RCXB 3MUMP 1CQMA 1WC0A 4MIAA 2B9YA 1TU0B 2PEBA 4M5NA 2DNHA 5LMUF 3NAIA 3GMGA 5LSRA 4B3TJ 2M5HA 2AGPA 1P6TA 1FDBA 4LF6J 4P73A 4L3NA 1B3TA 3PJWA 5B0CA 4I6AA 2B4PA 2DGVA 2AJ1A 3OFHA 3R27A 4URQU 2E8FA 3ENAA 1TAQA 1RTIB 3MR6A 4DSIA 4ZLLA 2FHJD 1FK9B 2ZBRA 2GX8A 2BE9B 3NGTA 1O0PA 2ZNZA 2KTQA 3W2VA 1REGX 2NXCA 4ZCKA 4ALZA 3H2TA 4HL9A 1V6HA 3A12A 4F26A 4OX9F 4NLYA 2GGPA 2UXBC 2V8GA 1RT5A 2BJ3A 2D3UA 3OR1A 1CG2A 1FJGJ 4LFCF 3PYGA 2AU0A 2V5HG 5KFBA 1YIJS 5A0YB 3BYPA 2Y8WA 1TL3B 1VIOA 4UOGA 3M8RA 2A3JA 2V4JB 3H2LA 2J5AA 2MY7A 3KTQA 2HG4A 4OZ3A 6FD1A 1RWXB 4FNHA 4ZVHA 3U27A 1JJHA 4F3MA 2HMIA 4I56A 4P72A 2Z8QA 4QW9A 2YX4A 3L3CA 4JI5J 1YQHA 1RT4B 2A2CA 1WC3A 5A6PA 3CCRS 2XG8A 5EX3A 5IOLA 3I07A 2HVHA 3FNNA 1ZZFA 3IGNA 2G1DA 4DR3F 5D78A 2CQPA 2FHJA 1MKYA 4NYOA 2C3OA 2HK3A 5F8NA 4DV6C 5IC4B 2BABA 4N41A 2VBXA 1IBKC 4TPSB 2DNRA 1XJWB 3K8VA 5KG3A 1JLQB 4JI1J 2P6TA 2DH9A 3LH2S 3CE8A 1UA1A 1RUSA 4ISBA 3DMJB 4L72B 3TAPA 3DRSA 3VQTA 2GJFA 2GHPA 5FLXU 1NB7A 1H3DA 2FZCB 4DS4A 1RCOB 2M3DA 3HX9A 1V5IB 5BUSA 4RW4A 3WQPA 1U09A 2FUG9 1JKHB 2DRAA 2B8QA 1IBCB 1FVQA 3MTJA 1M5SA 1B64A 1LWEA 2W8KA 4ZIWA 2WTFA 1KC8T 4LREA 2KXFA 2YQ3A 3W64A 2D28C 4L3KA 4JV0A 3MAAB 1JK9B 2FLLA 1UWDA 1S57A 1T9UA 2CIMA 2P8IA 2GIRA 3NOGA 2HHHF 4B3MJ 1X9WA 4JYAJ 3QFWA 4R25A 4A8MP 4AQYC 2HZAA 2DGWA 4URGA 4CLLA 1AFJA 4G3IA 5AJ3J 4K4UA 4U96A 1ZA2B 1DTTA 3MM6A 1FRJA 4EBCA 4WPAA 1N33C 1S1XA 2MKCA 1WJ9A 3DKDA 3IS9A 1KTVA 2E8CA 1JIHA 5ITHA 2VH7A 3LAXA 1K73T 5J2NA 1FWLA 4I68A 3DGPB 5J2QA 3AD7C 2JSXA 3C6TA 4WS9A 3CNQP 5BR8J 2MZSA 3ZZTA 1NSAA 2YNGB 4DR4C 3MZIA 1SJRA 4R0MA 2W9BA 2OEMA 3K59A 4HPVA 2IA0A 4FKYA 3HLUA 5KT3A 1LK7A 4NLSA 4GKJC 2QZ8A 3TVYA 2CPEA 2DR9A 4OYBA 3T1YC 1KOHA 2ZJPQ 3QSIA 4DR6F 2QL8A 1FCAA 1X8DA 1GAOA 1HR0C 4WXWA 3DOLA 1I94F 4PRFA 3K5PA 2QEXS 2XYPB 1YZ6A 4DZ6A 3I5AA 2QA4G 5KAKA 4O3PA 3HVAA 4WBFA 5ETPA 2PA3A 4NCGB 5L1LA 3DAYA 1PJ7A 1VGYA 3F73A 2FC9A 3TA1A 3RR7A 2OPLA 3TZXA 2PMHA 2M5OA 2BANA 1T9YA 1XS3A 2IMOA 1PC4A 5A6WA 2ZC4A 3TQEA 3UR0A 2OH2A 3VF0B 3QATA 5HVHA 1BGXT 5C42A 2HQFA 3I56S 1TL1B 3B4MA 2CG8A 4ICLA 3ISZA 3H20A 3BH6B 1T9VA 3BM7A 3W65A 4OYZA 2G4BA 1XNRC 4EU0A 4DG1A 2KG1A 4PZPA 4AXIA 3BJYA 3Q8YA 2F9DA 2ZH8A 2HAIA 3AAWB 3ZC4A 4FDFA 2HVZA 4KGKA 1N48A 4AE5A 1MSWD 4B9VA 4ZIVA 1NK8A 4RW8B 4J9QA 2BJEA 3C16A 4LF4C 1X9MA 4OHXA 5E3PA 4D4GA 4ODJA 1U1KA 5A1IA 3BN4A 4GXQA 4YMEA 4DCTA 1KR4A 3TANA 2WSCC 5KFMA 4NLRA 2WONA 2HVDA 4DUYF 1N36C 1M6XA 1BY9A 1T11A 3WC2A 3GV7B 4B3OB 3ILOA 3TR5A 1HNXF 1UW4A 2YY3A 1QE1B 1WD6A 1FD8A 2MKKA 1RU1A 2YVSA 3ZZPA 2IVYA 2ZD1A 3QRQA 1SB6A 2YH0A 3OL6A 4B3SJ 4WJBA 1KLNA 1QSYA 4NI2B 4ZLNA 2C2OB 1S9EA 2QL5B 2DGTA 1NZ8A 3MM7B 1QVFR 4DV5J 2ZHAA 1EAYC 2VIHA 1RHRB 3OR2A 3DLGB 1YVFA 1GXUA 5KFWA 4OLPA 4DSEA 3WC0A 1VHFA 1F9FA 4CO0A 3PFEA 4I7FB 4PUOB 1T94A 2EW9A 3CJKB 3VNQA 1EP4A 2YNIA 2LEAA 1S10A 1Q4RA 4NE9C 5C5JA 3QRRA 1HHTP 3UX3A 1PYSB 2VFSA 4K4ZA 2DXDA 5IQQA 2VQEJ 2W9CA 2WOMA 2KKHA 1RWUA 2AYGA 2QTWA 3FUYA 1HIYA 4ED2A 3M2VA 3P4UB 1XN9A 3AB4B 2KM8B 2YWKA 2HPUA 4DJBA 2CWXA 3D5MA 5BSWA 1GMWD 1X0PA 4KKOB 1WF3A 2C42A 1VDHA 2P02A 2EFPA 5F0WA 2E5JA 4DI6A 1IVZA 2HHHC 2BQ3A 3LAMA 4ERDA 3RR8A 3CIMA 1T9TA 3AA9A 3LAKA 2DH7A 2M4MA 3PEHA 3E7XA 5B08A 4JI0J 4QYZJ 4OJHA 1NJZA 2RJZA 1C1BB 1S1TB 5J1PA 1PJ6A 2BM0A 2HBQB 1VRTB 3DLBA 1U1PA 3N28A 1C2PA 2FVRA 1VI7A 3GIMA 4ELVA 2BV3A 2Q79A 2K7JA 4WTOB 1OSDA 4CO1A 2FVCA 2UU9C 4DF8A 3UNYA 4OX7A 2AYBA 4DFKA 1JWWA 3SEOA 1DQAA 4RM2A 2XYGB 5HBMA 1X4BA 1LWFB 5EWGA 3VALA 1JLAA 5JUMA 4HT5A 2RQKA 1XNQF 3JSBA 1MNEA 4LVNP 1GMWA 4QCLA 4JI4F 1JJCB 2OUGA 4CYUB 3KDOA 5A8WA 3RUBL 3CCZA 2YKOA 4DV1C 2MGZB 1S9GB 3FZBA 1YJWS 5KFYA 2JC1A 1U45A 4J9PA 3CCSS 3CJ0A 2G1HA 2R8HA 5EWEA 1MDFA 2V8HA 2V0NA 2YKAA 4KT0C 5G4DA 3M9NB 3CPWR 4CLUA 1OMSA 1NH8A 3GTYX 1K0VA 4NLOA 1SH0A 1FO1A 4I9FA 1WUUA 1U8SA 4MH4A 2LEBA 3CJ3A 1S1VA 2DGSA 1G6BA 2WHOA 2RSQA 2AIRB 3HFVA 3C5EA 3KK3A 2HWHA 3GSIA 5GAGU 1AZSB 3Q24A 3CQ2A 1RWVB 4ED0A 2E1CA 1Q95G 2VASA 4OZ1A 3P6YC 2DYJA 5GAGI 4IG3A 4TY8A 5M2PA 1W26A 4CO3A 2MKYA 1QD1A 2WSFC 5KFJA 2UV8G 1Q8IA 2KXNB 1OYEA 4O4GB 3C6UA 5C2CA 3IWNC 4DUZF 4OYCA 2J0QD 4FTFA 3T19A 1D9AA 2AGQA 3DLKB 3KKFA 3T6BA 4JI8J 1X4AA 4DUYC 2R7RA 3AJ2A 3IFEA 3T9NA 1ITPA 1S97A 1KONA 4DQPA 5HMWA 1YWXA 3J81U 2LFVA 3S1TA 4F2SA 5H9FK 1NNDA 2MPUA 2V50A 2YNHA 1HQEA 4ID5A 5DLGA 3D4JA 3GIKA 2NZCA 3BN7A 4LFBF 3MM5A 4MTPA 4DSLA 2LVWA 2CQIA 5HJXA 2QL9B 5H9UA 2YKQA 2LXFA 2HGMA 1TK0A 1UCNA 2ASBA 3AT1B 2J9DA 4RBTA 4PWDA 1BC6A 3SCJE 4DLGA 4J9MA 3C3LA 1HMVA 3NPDA 4A8XA 3A25A 1WTFA 4KJIA 3MD1A 3DN9A 4LMZA 4YY3J 3N5BA 3QJLA 4B9NA 5EN1A 4LR9A 2I9SA 2E5LJ 4M5DB 3R3TA 2PEHA 3Q8PB 3OTOF 1R0BG 4IH6A 3BV8A 2A0FB 1S0NA 3OUYB 2QMXA 1FTRA 1NSPA 4OJGA 4P2SA 3R9XA 4QZVB 5JVGQ 4N76A 2HGLA 1NM2A 3I9V9 1WF0A 2LDYA 1KVJA 3VVUA 3CD0A 1UEUA 4J9OA 4DR1F 2KZZA 4DMZA 5DG7A 2V8DA 4Y00A 2YX1A 2NYIA 4F04B 5D3GA 2GC8A 2BX6A 1TVRB 3CGIA 3BSOA 2JLEA 2KZMA 1TZ0A 3MURP 3AD9C 2RRAA 1TKTB 4PUIA 2OHDA 1N5YB 2QIFA 1JXEA 2D7SA 2XULA 2FJDB 3DRPA 1QSSA 3ZTPA 2Z2ZA 3NS7B 2ABYA 5CD4A 1YTYA 3AA8A 2N7CA 2D27A 3HSGA 4H4MB 3A1YG 4JI4C 1X5SA 3I5BA 2WVDA 3OSNA 3SCIE 2HWIA 3PYFA 1VK8A 2YNFB 1UZHA 4OHVA 2FHOB 4ZOSA 3SV3A 5DJBA 4G6VB 2BJOA 2YKNA 2Z57B 1KQSR 2PN2A 1CQNA 2JOQA 1PA4A 1NPKA 1XRCA 1NJWA 4F3OA 4CTAA 1RWKB 1S5ZA 3J7ZT 3AHPA 3FJ2A 4XX2A 2NZ4A 4H4OB 5L9NA 3J80U 4NOZA 3GG0A 3M1VB 4KYZA 4WK1A 2XMUA 1Z4UA 2X1AA 5D15A 3TAQA 3GQCA 3D1HA 3D6MB 1HWLA 3IRWP 1R0AA 1CJUA 2E1PA 1UWBA 5AXNA 4G1QB 5KFIA 4WP9A 2F7VA 3MEEA 4DX5A 1XMQF 3PFOA 3PVXA 4BBYA 2VA3A 4D57A 1CC7A 4RMNA 2JEIA 5A8KA 3J81D 4JI7C 1R8PA 1D0EA 1VEHA 5CYJA 4JI6F 4DL4A 2ASDA 3IBCB 1VOMA 4F67A 2MSTA 1FXRA 3T1HJ 4CQ1A 1S7HA 3A8KA 2MZRA 3BQ0A 1F2GA 2HS3A 2V69A 4C11B 2EPIA 3MPDA 2ZM6F 2UUAF 3H5UA 3NBPB 5HP1B 1IJEB 3PG9A 5J2MA 4B9LA 4LF8J 2XMWA 5A2QU 3MECB 2B7CB 4DUZC 2CPXA 3GG1A 2HS0A 4GO5X 4RBUA 1SIWB 4I69A 2DEIA 2GO8A 2HZVA 2W4DA 2ZKTA 3RRGA 1VQNS 4X64C 1NDPA 2EC2A 1RAIB 2Q3PA 1IXKA 3CMQA 3K5LA 4DV0F 3CB4A 1HI0P 2DHMA 3OLBA 2QVXX 2QG9B 2HLUA 5AXKA 1Q7YT 1A0OB 1WG4A 1KQFB 4IUFA 3IR7B 4JV5J 2M0GB 1U0HA 4F3QA 1X4HA 2DITA 5J2PB 2WBMA 1MXBA 3OTBA 2QA2A 1VQ7S 3HHNB 2UXCF 3MMCA 1VRQC 2L3MA 3HHDA 5CCLA 2VQFJ 5JRHA 3W66A 3RU0A 1M90T 4YOEA 2FJEB 2FJWA 1V5VA 4YDXA 4ZVFA 3BGFA 4X4UA 4I64A 2FQQB 4FPRA 1VFJA 4RU2A 2B9WA 3M32A 2GJIA 2YKMA 4OZ5A 4LSZB 3QSYB 4MFBA 1RXOB 2DK2A 5GMDA 3GV5B 3V6JA 5FDLB 4OZJA 4DCJB 2MQOA 5K8OA 3DI6B 2E5GA 3UDEA 2VKRA 5KFGA 2FVQA 4ZCIA 3ETMA 1TQLA 2QLXA 3I87A 5K8PA 4PYAA 3BO4A 1RYRA 3I9ZA 4QU6A 3LGXA 4IYQA 3OQ2A 3NS6A 2QX0A 4P2MA 2P2JA 4DX6A 2NSCA 3OTOC 3KLIB 4RVOA 1JLGB 2N4CA 4C8MA 1XMBA 4FPIA 4IR9A 5HMZA 1LEOA 4V19J 4K2XA 4YHHF 1KTQA 5HO4A 1ICEB 3QT8A 4DV7J 5B0DA 1HBOA 3KG4A 1ULTA 2UXDF 4KTVA 2VDIA 4ZPWR 4ZVGA 4DR1C 2K1RB 1F6TA 3S82A 3JTNA 4GC7A 1O9TA 4AUKA 3NKYA 3Q83A 3R6GB 4F7VA 2RDJA 4X66F 2I2YA 4IG0B 1HD1A 1LW2B 3RG6A 3NP5A 2RAQA 5G0RB 3ZFVA 4D3GA 5LJ3Y 1K1QA 1HPZA 1BLUA 1HNWC 4DV3J 5DQGA 1NY8A 3FCCA 3RYLA 4ED8A 2B5JA 2EI5A 1UP1A 4ED5A 1VLOA 3BBCA 4M5GA 1NK0A 2XI3A 4B3RC 1H6KX 1Y5IB 1SC4B 1NRKA 2HJGA 2CJBA 2QN6B 1KVKA 4QPXA 3H5YA 3JS9A 4P10A 2RMLA 2RQ4A 2ZJQQ 3EGNA 3F56A 4HDGA 4CO5A 3UO0A 3H7HB 1RTJA 1CJKB 3RB3A 2KFZA 1UWAA 4FN5A 3QFHA 1FFGB 2OPQA 1M5KC 1TELA 2BE7D 5BSUA 1ZM4A 1K44A 2XY5A 2V67A 1VRUB 1N34F 4RNOA 4IFVB 3BSCA 3C15B 3MGJA 2J0SD 1CJTB 2NXJA 2G9OA 1QJHA 1B0VA 2H65B 2RQCA 1GPMA 4TYAA 4RW9B 2OEKA 4CIOA 3C46A 5KEIA 2DGQA 3TJAA 3CW9A 2HNDA 2HQCA 5AT1B 4E98A 2DJWA 2C3UA 3DU5A 4L75A 1SCJB 3PM9A 4UOHA 2NCKL 2G13A 2B9EA 1M5HA 2EEYA 1FX2A 1V60A 2AEMA 5CYMB 2BKNA 2DPIA 4X4OA 4DL7A 1U48A 4HI1A 3LP2B 3CJ2A 2ERRA 2MB0B 3LGNA 2VHGA 2FLPA 3O44A 5T7LA 2VFVA 1N56A 1NLKL 3BGOP 3EX7B 1U6FA 3M8QA 5B0GA 2EWHA 3J7Z5 2OPRB 3VGSA 2ATLA 3MMAA 2R3VA 2RRBA 2W4CA 5I3UB 1U2FA 2D7VA 2GNKA 4NZ7A 2COLA 4K5RA 3HVRA 2DBBA 3BH7B 4FUTA 1S6OA 3DC2A 3MM9A 3CJEA 2OGUA 3RB6A 1UW9A 2DB1A 2ATCB 2IJFA 2KHCA 2GO9A 5L46A 2DNOA 4TYBA 4DU8A 4DV0C 2D9OA 3AFGA 2J9EA 1TKZB 3LP0A 2Q6CA 4DR7F 1Q5YA 4R1MA 5CZXA 2P9CA 5K8NA 1SKRA 2DHXA 4ZVRB 2IIHA 1P1TA 1N32F 2UXCC 4ES3A 3TUZC 1FKOB 4BHQA 4IRDA 3GYXB 5HL7Q 1BQNA 2FGOA 4PPDA 2CNKB 1GK8A 3OFGA 3FK4A 3HSDA 2H4WB 5EDWA 4ZPDA 3D54A 4M94A 4C98A 1SV5B 2VBWA 3MM8B 4F4ZA 4LF5C 1JLFA 1IKVB 2ZWPA 3Q8SB 3FRYA 4DL6A 2JH3A 4YB7A 4PROC 3PRVA 3KLGB 1J27A 1S49A 1KHVA 2LYVA 1ZM3A 1FUGA 3TVKA 3KG0A 1EKSA 5A1GA 2XZWA 2HHTA 2W2MP 8ATCB 3D67A 3CDUA 3K8WA 4LSNB 1F60B 4NZ6A 1NCLA 2YCBA 1MMNA 4AD6A 3MOJB 1IKYB 5MAOA 3KK2A 1R7IA 1SKWA 2BEFA 2Q43A 1C0TB 4H4KC 3EYZA 2KB2A 1BWVA 3N9UC 3ZZYA 3VGTA 5IV3A 5HJYA 1U0SA 4I6YA 2RVJA 2ACYA 4IRCA 2IJNA 4USUA 5E3RA 1WC1A 4HT7A 1ML8A 1Q86T 5HSPA 3HHLB 3NCQA 2M52A 2CQGA 3TA2A 1S0VA 1S6QB 5KFRA 1UA0A 9ATCB 4CRJA 2JEFA 3CDWA 3PX0A 3NY0A 3BBFA 3H59A 3V6DA 2OSQA 4J9SA 1H2UX 3OLAA 4DPWA 2GJ2A 5IWAJ 1XR5A 1E6VB 2JVOA 1RAOA 4UF4A 2DPJA 5LMUJ 4J90A 3A8EA 3H5SA 1YLXA 1U26A 3AOCA 2EFGA 4N8OA 4ECVA 5KT2A 4RO0A 1AW0A 1TMMA 2WRMA 1BA3A 1S48A 4ILRA 3JSMA 2J8SA 3ENVA 3DFEA 3EVOA 2XR1A 4JI3J 3THPA 3LGHA 3PW4A 1RU2A 3RBZA 2WVEA 4GC6A 4BWJA 4DR2C 2DNGA 1N34C 4ED4A 4Y2KA 2GGPB 4OX9J 4CP5A 4Y2CA 2DO4A 1RTDA 1WHYA 3OXFA 2OLWA 5DG8A 4LFCJ 2QFIA 2XSFA 4YB5A 5AXMA 3NAHA 3OL7A 1FLOA 3SFUA 3ETOA 3M6XA 2ZBQA 4ZVPB 5B0FA 2MYFA 2VPXB 1TR0A 4IOBA 2BW7A 2HMIB 4QIWD 2VG7B 3PR5B 1ZOTA 3CEDA 1YJ7A 4HACA 1YJRA 3TP2A 1XK8A 4WU2A 1VQOS 2ZC3A 2BOPA 2ROGA 3LGMA 3AQPA 1X31C 1WEYA 1WNEA 5AE2A 2KO1A 1XTZA 4IR7A 2R9LA 2R8GA 4DR3J 3H42A 2LQJA 2X1GA 4DV2F 3S6EA 2VFRA 1PBAA 1Y5LB 1VK3A 1UETA 4FP9A 4O3RA 4OYXA 4C0OC 3HI9A 2VG6B 2MQLA 4NXMF 2GMJA 4PEOA 3R1LA 3G6VA 4A46A 3DRSB 5ETOA 2OPSB 1NAQA 3HO1A 1XMOF 4OHYA 4CH0S 1LXNA 2J7UA 1EKRA 1I51B 5L1KA 4A8FA 1UEKA 4RW4B 1EZZB 3MFIA 4NX9A 4EI2A 4FUQA 1PO6A 3MUVP 4ECUA 1KFSA 2FHMA 4GVLA 3SDEA 4HVZA 3R5CA 2DCUB 3MPWA 2VFTA 4A8YA 4BWMA 9RUBA 3SIPB 1K0RA 5B0AA 2ADBA 2R7XA 2ZH1A 4P7VA 4YR0A 4BS2A 3D66A 3I4HX 3QT7A 4DWIA 3OD2A 2E1RA 2P2FA 3EPGA 3FQKA 5LOQA 1KBRA 2BZ2A 4A48A 1FD2A 3FBEA 2BH1X 5HATA 2A6MA 2O66A 1OY8A 3ILLA 2WBRA 2R7TA 3ENWA 5T8SA 2V94A 4Y2IA 2ASJA 5IM0A 1Q82T 2XCAA 1ZTTA 3P49B 2L9NA 1YGYA 4Q8FA 4OI0A 3LUSA 3QIDA 1DTTB 5EHHA 3IAS9 1S1XB 1WOSA 3IS9B 1SC1B 3AXKA 2E5HA 1OY6A 4PZVA 2OMLA 3MDFA 3C14B 2CJQA 5D8HB 3C6TB 4X65J 3HT0A 2IC3A 3QWPA 1RY2A 2Q1LA 1HLWA 3EVWA 3JYTA 3HVTA 4KGZB 3TUJC 3MMBA 2W9BB 2V8PA 4DPXA 3VAMA 4WZMA 1AUSL 3KHLA 3QT5A 3DXBA 1FEEA 4M5HA 1JLBA 2H5JB 3WDOA 2D1TA 3DM2A 1D8YA 3MPUB 1ZA1B 1WC6A 4K4SA 2QMWA 3DOLB 4DR6J 5KG6A 1I94J 3CW8X 4QWAA 1RGVA 4XPCA 4O44A 1NK5A 4EK2A 4C6AA 1TL4A 2ZH9A 3BQ1A 1NKCA 2Y0BB 2OPLB 3NNCA 3I96A 5C25A 3NGDA 2KT3A 2BANB 1RHUB 2AV5A 4DX7A 4WP8A 4IO9Q 3NYQA 3CDEA 1WOOA 5HROA 4ENOA 3NCPA 4QIEA 2L08A 4WWSA 3TQ1A 3GJSB 1NJYA 4KC5A 1AT1B 1QTMA 1RJJA 5C42B 2CDQA 4DV4F 2JFDA 2CJKA 3HK2A 3PR4A 4ICLB 4OHZA 4NXNF 4BCAA 2D69A 3MFHA 2W01A 1TUGB 3GP9A 4DG1B 4E8UA 3LTOA 2K2PA 2OD6A 3G7SA 2JFKA 2P6SA 3RW7A 4JP8A 2HZCA 4MK9A 1HNZF 1X4FA 2DNNA 3C16B 2AQ4A 2RDDA 2LQ5A 2F5GA 1YI2S 2CPZA 1KKGA 1RTHA 2BJ8A 2PMWA 1RTIA 2HHSA 3PYEA 3MI7X 3NMAA 5H9EK 1NKBA 1FK9A 3W62A 2WVBA 3UZ0A 4L4QA 1U1RA 4H54A 4ZJLA 2ZZTA 3WBZA 2XZTB 2RU3A 4G1IA 2WONB 3NRBA 4Y2AA 5HQMA 4IQXA 3P3DA 4DUYJ 1RHJB 4OZ2A 2OKQA 5JJBA 1U7LA 4IQMA 1HHSA 1FJGF 2GAGC 1N0UA 1EGAA 1HNXJ 4DCUA 3BF4A 3LQVA 3PW2A 2J9CA 3SV4A 2E1AA 5B7WA 1DARA 2QO3A 3A9VA 4MYTA 1IBLC 2DXFA 1YKWA 1VJQA 1GMUA 2WSEC 2GAHC 2R8KA 3X3UA 3A8JA 2JVRA 4XIUA 1RP5A 2V4JA 3GCWP 2KVIA 3UCUP 3FSYA 1S9EB 3W5XA 3TDEA 4X4QA 1T5DX 3OR2B 1SKUB 1FRXA 3QIPB 3IBFB 3QQCD 3RW6A 1XMOC 2UZAA 5L1IA 2AX0A 5I42B 2KRBA 5E3QA 1RT4A 2G0CA 2ZDOA 2C2DA 5LJ5Y 1EP4B 2ALYB 2AWZA 1MU2A 4N56A 2I38A 1LKZA 5E41A 2ZOFA 2VDHA 1IBMC 4YQWA 2W9CB 2WOMB 3ZO7A 2F9JA 2V63A 1X4DA 2C2ZB 3BPDA 4RX6A 2FJVA 3GPCA 2F3JA 2G0IA 4FZVA 1PJ5A 2ZHBA 1JLCA 2DNZA 2CZVC 3CCMS 4ZMMA 2ACMA 4RNMA 3BR9A 1RT2A 2KH9A 2WVFA 4P52A 4GKKF 2CZ4A 2NUUG 1J5EC 4IOCQ 1BUXA 1KNZA 4DSKA 3LANA 2WZ1A 1UKKA 3PX6A 4FBUA 3OHBA 3AXMA 2JLGA 3KLVA 1W25A 2ZEJA 2D3ZA 1QUVA 2WCXA 4CCHA 1VR6A 3VAHA 3MHYA 4FYDA 4K0KF 4WTYA 2DR8A 4KV8A 1D09B 3TZYA 3D68A 4OYAA 1FRKA 1I5OB 3AOAA 2XI2A 1UPPA 4KH0B 4X4SA 4FXDA 2ZVSA 2XMAA 2HFZA 3MOZA 4ZPAA 2FDNA 5GAHI 1Y0HA 3HT3A 5HBMB 1SL0A 1ZPVA 4FXVA 1OPIA 4C4WA 2AGOA 2CNOB 1H98A 2HHVA 1MN7A 4AL7A 4X4VA 5BSVA 1JLAB 2RH3A 3QZ8A 4CLSA 3X1LB 2HSEB 4X2BA 1XNQJ 1FRHA 4B3MF 1QAXA 2EVZA 3OW2R 3KOAA 3B78A 3HFKA 4KHMA 5A8WB 1SH2A 2OPPB 2RDIA 2N7YA 2A10A 2RILA 1LK5A 2MJNA 2VV5A 3QNWB 4DU7A 1R8AA 5KG4A 2UVVA 1NHVA 2OAUA 3G6YA 3F41A 4Y34A 2XY7A 3HJFA 4U7UD 4NLXA 1DTQA 1R89A 3CCQS 3UD3P 3A9UA 3OPKA 3CT9A 1SKSA 5KT5A 4LQ3A 2DNMA 5LMNJ 2LQ9A 1IKWA 2MTLA 5B0EA 1UJ6A 1R8BA 3GKUA 5T14A 4ES2A 2MZ1A 4X62C 4NA2A 1W7WA 4NASA 4K50A 2UXBF 3KK3B 2GQQA 2R7OA 4EWTA 3CC4S 4G37A 5EUHA 2UUWA 1HYSA 3MCMA 2E0GA 3C19A 3IG1A 5HN0A 2DNLA 3FKBA 3V4IA 3I0SA 2HFNA 4WU3A 1RT1A 4IG3B 2HHUA 4B3TC 3K6RA 2QYCA 3HHEA 4NCGA 5BYSA 1I1GA 4LF6C 1R8CA 4NLPA 4PQAA 5I3QA 2XYHB 1E6YA 1AFIA 2CDRB 5DZ6A 3MR7A 4PXCA 2CG4A 5ETKA 1KVIA 4DUZJ 4CLZA 1HNVB 1S99A 1RT3A 3A4TA 1OSCA 2EK6A 2F40A 2YTCA 4XTTA 2XTJP 2R7VA 4UQTA 2DNQA 3I0RB 2E66A 2I0XA 1HW9A 2DHGA 4MKVA 1FJGC 2MKJA 4YR3A 4NL5A 1UL3A 3GIRA 2BRKA 4ZN3A 4DV6F 2HW3A 3BKUA 1HQEB 2EFVA 3QO9B 4MIWA 3MEDB 1FERA 2DH8A 4ID5B 3OT9A 5HVGA 3MM5B 4LFBJ 3KHRA 5E0OA 5HVFA 4KQZA 4PXEA 4TY9A 3MR3A 1JNRB 2NS1B 1OWXA 3VZHA 1RE1B 3T9ZA 4F25A 1W2BR 2AYEA 3VHQA 4JI2J 3Q23A 2W2PP 2CQDA 5IV4A 3ZTRA 4TKTA 1WTBA 3NWRA 2VJVA 3PZPA 4Y3CA 4IH5A 2F8EX 1F3VA 3DLLQ 4PWWA 1NMEB 3PXGa 4Q45A 1ZH5A 2F4FA 4W4MA 1SUQA 5GAEU 3IM9A 4KTTA 5DZ7A 1TKDA 1PILA 3HHLD 1QE1A 2FC8A 5A8RA 1Z2ZA 3DRYA 3LNVA 1EQ0A 4BSZA 3A8IA 3CD5A 4USJC 5CXTA 1Y10A 2ZBCA 5GAEI 3H0PA 1G3OA 4NI2A 4FVCA 1RT7A 4DV5F 1T0TV 2EG1A 4K5SA 5F8MA 2YXLA 3OTEA 2KM8C 1HKAA 2VG5A 3G6ES 5C24A 2VPZB 4AQYF 1VQSA 3FEZA 1RG9A 4DHVA 5D3GB 4K0KC 4ZPTR 2P5VA 2HEKA 2CPDA 2M70A 3N01A 3HP6A 1URNA 3PACA 4ZLPA 1N33F 5KOXA 4K4YA 5KFCA 4W92B 4X4TA 1OPZA 3EMTA 4LRFA 2AJQA 1RWPB 1YX2A 3BGRA 4B9TA 4QOTA 1KWMA 3M30A 2CJXB 4XK8C 4WYWA 5L8RC 3R9LA 2KZFA 3DRPB 4QYZK 2O3DA 5IC6B 3NL0A 4LRCA 3GIJA 4DR4F 1K47A 3J7YU 4C3LA 4U8VA 4RNFA 1LFPA 2MLXA 2AKWB 4OI6A 3MUTP 2X7IA 2R42A 1PG3A 2CJ9A 4GKJF 4AYBD 3CTRA 1FNMA 4B3MC 5E5NA 4JYAC 5KG7A 1XRAA 3G96A 1HR0F 2YKNB 2DGUA 2Z51A 1AXQA 4MJKA 3UI3A 3ZTOA 4CTAB 4PQUB 3NLCA 4F4YA 2CQ4A 2FZKB 2XCPA 1WHWA 5A19A 2AZ3A 1R43A 4Z7CA 3CCJS 1JQGA 4NLGA 5HMXA 4O0NA 4WE1A 4U7CA 3L9ZA 3MEEB 5D4LA 1UKUA 2POKA 1JB0C 4ZCLA 1XMQJ 2U2FA 2HVIA 2W7PA 3HCXA 3A3PB 5A8KB 2K3KA 5CD4H 3KWMA 2AYMA 3MXHP 4DN0A 4JI6J 4CYUA 4ANEA 5H9EJ 1XNRF 1KS2A 2PI4A 2Z4PA 2IM2A 4KGMA 4QR1A 4OXIA 3KMSA 2XSJA 2GMLA 1C4CA 3ONQA 1X60A 2YWFA 5J2MB 2ZM6J 1B0TA 2HGNA 2UUAJ 5KFAA 3UFCX 4LF4F 3D9BA 1LQ9A 4EYHB 4NCAA 3U1LA 4FS1A 1VQ4S 1PAEX 5I4MA 3PBKA 4X84A 1JOSA 4DG9A 3JQKA 1RT6B 2XWXA 3U7JA 2CQ2A 1N36F 2GIFA 1FKPA 3GFZA 1WELA 4OX6A 2QC3A 1VIXA 2VD3A 3W9JA 2KZ0A 2VA2A 4A8SA 1KHWA 3AJ1A 3MMCB 4ANDA 4TLQA 3NNAA 4OL8A 3O3LA 4PAAA 3HSZA 3PEJA 1WWHA 3Q8QB 2HAFA 4ZKAA 4ZHRA 4EFAC 1CULA 4ECXA 5K8MA 1LWXA 4WFXA 1EETA 1RWOB 1HD0A 1YSJA 2A2DA 3M32B 2YKMB 2L9WA 4O4GA 2HYIB 1V3RA 5L1JA 2FYXA 3DXSX 3IR5B 1SIZA 4MFBB 2ZOMA 3OXLA 4Y6IA 4KSEB 3PHEA 2IHR1 2K7KA 1H7WA 3DLKA 2XMKA 3DRRA 3RBDA 2ILYA 1BE4A 2MQPA 2AEJA 4GMKA 4K59A 2VJUA 1IN0A 1FNXH 4ZITA 5DDOC 4KO0A 3NXZA 1FWPA 3M9OB 4NRTA 2ZH7A 2YQ1A 3OV7A 3WIVA 3KLEA 1S1UA 1R8HA 4B3SC 2J9DE 1RAJA 4YR2A 3EE3A 5HK4A 4DV5C 1QM4A 2PE8A 4YHHJ 3HJVA 4RNHA 1HBOB 4DS5A 1VCTA 1U47A 5M2RA 4C8ZA 5U47A 2UXDJ 3OTDA 1FHTA 4KRWA 4A8KA 2ROEA 2IFXA 3QMQA 3V81A 3CF5Q 2D9PA 2PDAA 5AE3A 2DO0A 4X66J 5LXYA 5JXSA 4YY3F 1MROA 2JLFA 4HHHA 2VQEC 2XZDB 3BDPA 2E5LF 2HFSA 3LNOA 4M5DA 3NGSA 2E29A 2UU9F 4CWBA 2XMVA 2B5JB 1CPZA 3N0VA 1WEXA 4D3HA 3UDLA 2JZ5A 1T95A 4EGLA 5FIIA 3TOQA 1FX4A 3M6UA 4CNZA 1N6QA 1HW8A 2XO7A 4DPYA 3IPLA 3CQ3A 3AH6A 2X51A 1U4BA 4ECWA 3TO8A 2CPHA 2PO4A 1Q79A 1RTJB 3HKWA 1SI9A
chains in the Genus database with same CATH topology
3O2IA 1O92A 3M8PA 2E7WA 2G13A 4CT8A 1MROB 2AD9A 1RA6A 3MM6B 2KJWA 1IBKF 4YEAA 2LLZA 2VODA 4RVNA 5IFIA 1KD1T 1M5HA 2P9GA 1M5OC 2OPQB 1WI8A 4DV1F 3IXQA 2MMYA 3W3SA 3TX8A 4F8RA 5CYMB 5J2NB 2O67A 2DPIA 1JLEA 4X4OA 5B09A 4DL7A 1UFLA 5J2QB 1U48A 1GTHA 4HYKA 5F3ZA 4HI1A 2GW8A 5IT9Y 3LP2B 5IT0A 4FS2A 3CJ2A 2ERRA 2MB0B 3LGNA 3QAEA 4WKYA 2FLPA 2R7WA 3LPYA 4G36A 3O44A 1TKZA 5T7LA 1SL1A 1L5UA 2Y27A 2VFVA 3NI2A 1N56A 1TK5A 4J9LA 3EX7B 3AF5A 4KR0B 2HNYB 1BWEA 1SC6A 2FJAB 2EKYA 1U6FA 3M8QA 5B0GA 3D28A 2EWHA 5D4OA 2DNYA 3PNIA 2Z0GA 3J7Z5 2CPJA 2A1BA 2OPRB 2BW2A 1N6QB 4JV2A 2XGPA 2DR5A 2ATLA 5GMKa 1C0UB 3BEGB 1FA0A 1RDRA 3MMAA 1HH2P 1TKTA 1P7LA 1N5TA 2BVZA 2B4VA 3C8YA 1FKOA 2RRBA 4IDKA 2W4CA 3KXWA 3GILA 2VPWB 5I3UB 1DQ8A 3TQIA 1U2FA 1REVA 4OLOA 1QAYA 3FMWA 2D7VA 2GNKA 4LUBA 2DNKA 1GT8A 2COLA 3PJXA 4NZ7A 4ECSA 2MHNA 3L7OA 1VC5A 4K5RA 1N4LA 2OTJS 1NO8A 3HVRA 2DBBA 2N3LA 4FUTA 1S6OA 3I6PA 1YJVA 2JDJA 3DC2A 5D4NA 3MM9A 3N6MA 2BUNA 3O5TB 3K0JA 2MHEA 3CJEA 2MXYA 4A8OA 4NLUA 2DT9A 3MD3A 1U1OA 3RB6A 2DGXA 1JLEB 2X1BA 3FQLA 4H4MA 3RBEA 2DB1A 4U7UK 2IJFA 1TP7A 1SV5A 2B43A 2KHCA 2GO9A 1SXLA 3MM8A 1ZB8A 2DNOA 4CH7A 4TYBA 2JHEA 1IKVA 2M9KA 4DV0C 3RZAA 3TVZA 1UJ5A 4O3NA 2D1RA 2D9OA 2J9EA 4WK3A 1TKZB 3LP0A 4TLRA 5T7LB 2Q6CA 4A8WA 2YNFA 4RNNA 4DR7F 2CFXA 3UNGC 3KLGA 5H1SV 1VQ8S 5BJRA 5DGBA 4Q43A 4R1MA 3O6QA 2XHWA 5CZXA 2P9CA 2VPYB 2XNQA 3ULHA 5K8NA 1SKRA 2DHXA 1SBRA 2C2EA 1Y7PA 2MKIA 3FSIA 2JC0A 1P1TA 4Z2XA 1F5CA 1ZM2A 3LP1B 3N6LA 4J9KA 1X7VA 2DHAA 3MMAB 1S0MA 1N32F 2UXCC 4ES3A 3TUZC 5E7QA 1UMJA 1FKOB 3CVKA 2OJ3A 4IDKB 3RV2A 4BHQA 1N52B 4GKKC 1KFDA 2ZH3A 1HWJA 1SH3A 4YUDA 2CQBA 1REVB 4IRDA 5FLXD 5IT4A 3GYXB 4MIBA 5T8TA 5HL7Q 1BQNA 2X3GA 2FGOA 2O5DA 1S6UA 2AJ4A 1BQMA 2DIVA 4OV1A 3CC2S 4PPDA 3T5JA 4R8UA 4X62F 4C2MA 1C4AA 5CA5A 3W7BA 3MM9B 3OFGA 4FBTA 2Y1RI 2F8MA 5EDWA 4LSNA 2MQNA 3OSPA 2DCLA 4ZPDA 4CZCA 5IWAC 3D54A 1XNQC 4M94A 1HBNB 4C98A 1SV5B 2Y0SD 2VBWA 4WYLA 3MM8B 4F4ZA 1IKYA 5KFFA 1ZPWX 4LF5C 1JLFA 1IKVB 3Q8SB 4G1QA 1J5OA 4L6V3 2A18A 3FRYA 4QW8A 4DBQA 1VQYA 2JH3A 2MQMA 5KFUA 4DL6A 4YB7A 3G9CA 3LP0B 4PROC 1C0TA 5EX0A 3RRHA 2XS7A 3KLGB 5C25B 3S01A 2ZKUA 4NOHA 3ISNC 1S49A 4RW6A 4WCEQ 1KHVA 2LYVA 1P9QC 2P2BA 1ZM3A 1X4GA 1FUGA 3KYLA 1TAUA 3CCTA 4C9DA 1HL6A 3SSRA 4B3TF 4YB1P 1KRPA 3I82A 1Y3JA 1FVSA 3M6WA 1KQGB 3AQOA 4J37A 2VB6A 4M1KA 4WFYA 4LF6F 3T1HF 5HROB 3IO1A 4PQUA 2ZBIA 4ZS6A 4EEYA 4MAKA 3B7WA 1QWIA 3TVKA 4EO6A 1V3ZA 1R31A 1BQNB 1LCIA 3KG0A 2E5IA 3D2WA 3ZZZA 1BQMB 5DDPC 5A1GA 3S7RA 4DFJA 4CI0B 2XZWA 3CSKA 1U1LA 4R8UB 3HHLA 3I08A 1H2TZ 3CIZA 2HHTA 4LSLA 3VTIA 3CDUA 3K8WA 5LMNC 4IOAQ 2VC1A 5DM7Q 2C2RA 2IRYA 4LSNB 1T3OA 1F60B 2FGCA 2MKHA 3CDBA 2VONA 1S6QA 4NZ6A 3SSQA 2QA1A 2CPIA 4C11A 5EWFA 4QIFA 4NLTA 3BZQA 2E9RX 2YCBA 1O8BA 3H25A 3VAKA 2JWNA 1MMNA 1WHVA 1DQ9A 5HI7A 3BS9A 1SJFA 3PKMA 3MOJB 1IKYB 5MAOA 3KK2A 2P9EA 3Q2SC 1JLFB 2QLWA 1R7IA 1J5OB 1SKWA 4TU8A 3T1YF 2BYCA 3MECA 5F3TA 5K5MA 4XO0A 3M05A 2Q43A 1JJ2R 1C0TB 4H4KC 3WZ0A 5BSMA 2XEXA 3BREA 5EGYA 5IWAF 2L48A 4RUCA 2BA9A 3TUIC 3MUMP 1CQMA 3CO9A 3EYZA 2KB2A 3Q0AA 2IAJA 4MIAA 2B9YA 2LEPA 4RW6B 3TI0A 3N9UC 2DNHA 5LMUF 3ZZYA 2GV1A 1R27B 2I8EA 4JI8C 5LSLA 3NAIA 3GMGA 4M8LA 4LF9F 4RM3A 3N5FA 5LSRA 4I6YA 2RVJA 3ICLA 5DDQC 5A0YA 2AF6A 2AGPA 1P6TA 2WK4A 2ZD1B 1FDBA 2HHQA 1H38A 2ACYA 4L3NA 4IRCA 1TL3A 1IUJA 1IR0A 2LXIA 2IJNA 3TNVA 3NGKA 3PJWA 5E3RA 5B0CA 4I6AA 1ML8A 4HT7A 2B4PA 2DGVA 1Q86T 3HHLB 2AJ1A 3NCQA 5CZVA 4IZ6A 3OFHA 2M52A 3R27A 4LSLB 4URQU 2FVPA 2E8FA 4P7TA 5KFOA 2CQGA 3I31A 1C1CA 3PO4A 1TAQA 1RTIB 3TA2A 3MR6A 1S0VA 1S6QB 5KFRA 1UA0A 4DSIA 2QVYX 3CWJA 5CH7B 1Q7LB 2CPFA 1V3SA 4R1LA 2FHJD 1M5VC 2D1QA 1FK9B 2WB4A 2JEFA 4DEZA 2GX8A 1O0PA 3CDWA 2ZNZA 3PX0A 2KTQA 4JI5F 3W2VA 3CMAS 2W24A 5BSRA 3H59A 3V6DA 1X5TA 1ZAXA 2OSQA 4ZCKA 4J9SA 1H2UX 4ALZA 3H2TA 2APOA 1AMUA 4HL9A 1V6HA 3UCZP 4F26A 4OX9F 3OL8A 3OLAA 4NLYA 2GGPA 5I3PA 2UXBC 2V8GA 2ZITA 1RT5A 2GJ2A 3QPIA 2UUTA 1XR5A 2D3UA 2IAJB 3OR1A 1CG2A 1E6VB 2JVOA 2MY8A 2GQCA 3T1AA 5KT4A 4DFPA 4LIRA 4DR5F 2YNIB 2DPJA 5GADU 4LFCF 2ZOGA 2AU0A 2V5HG 3A8EA 5KFBA 4F4KA 1MDBA 3H5SA 4DQSA 1U26A 1RT6A 1VQKS 1YIJS 5A0YB 5KFVA 4D4IA 4WXOA 1TL3B 2E8EA 2EFGA 4N8OA 4ECVA 3T5LA 1VIOA 2V4QA 3NMRA 5KT2A 1HBUA 3DU6A 3M8RA 2A3JA 1AW0A 2V4JB 3H2LA 4ZVEA 2J5AA 2MY7A 2WRMA 3GR1A 2HG4A 5GADI 3KTQA 6FD1A 4OZNA 1C1CB 4CT9A 3CCES 1BA3A 3IEUA 3M2VB 4FNHA 1S48A 4ILRA 4ZVHA 5L38A 3U27A 3JSMA 4ILLA 4YY3C 1JJHA 3ENVA 4F3MA 2HMIA 3KNGA 3DFEA 4I56A 2Z8QA 1QUPA 2FJBB 1OO0B 5LXRA 5FLXY 2YX4A 4QW9A 2AYAA 2CY1A 2QVZX 4LFBC 2XR1A 4JI1F 3THPA 1JLQA 3L3CA 4LE5A 3E8OA 3PW4A 2DD8S 1YQHA 2E5LC 5GVQA 1RT4B 4GC6A 4BWJA 4DR2C 2DNGA 1N34C 3U02A 4Y2KA 2A2CA 2GGPB 3FSXA 4HH1A 4I67A 5A6PA 4Y2CA 3DMJA 4MTNA 2DISA 2DO4A 1HBMA 3CCRS 1T7PA 2OD4A 4NA1A 1A9NB 5JVHQ 2FHKA 2XG8A 5EX3A 1NJIT 2DVIA 1Q78A 1RTDA 1HA1A 4ILMA 1WHYA 2W25A 4V19X 3I07A 2HVHA 3FNNA 3OXFA 2OLWA 5DG8A 2XSFA 3PW7A 2W7AA 1RQ0A 4KB7A 3CCVS 1ZZFA 4RBVA 4YB5A 5AXMA 3IGNA 2G1DA 4DR3F 3NAHA 5D78A 2CQPA 4JI2C 3QZ7A 3OL7A 1HBUB 2FHJA 2W7OA 1VBXA 3SFUA 3ETOA 2UVUA 1MKYA 3M6XA 3F44A 3H8YA 4I6WA 4NYOA 2YX7A 2C3OA 2D1CA 5F8NA 3LUYA 4DV6C 4PCQA 4HH0A 5B0FA 2MYFA 2VPXB 1TR0A 3JSMB 4IOBA 2BABA 2HMIB 4N41A 5KG0A 2J6TA 2HS4A 2ZE2A 4QIWD 2VBXA 1IBKC 4TPSB 2DNRA 1NU4A 2VG7B 1JKHA 3K8VA 5KG3A 3PR5B 1YITS 5LL6d 4WF9Q 1JLQB 4KBIA 2XLIA 1ZOTA 3CEDA 3FVYA 5KYTA 2D3OR 1YJ7A 2PGCA 1H7XA 1GQEA 1YJRA 2P6TA 3TP2A 1Q8LA 4RWXA 2DH9A 3LH2S 1XK8A 2Y1IA 3CE8A 4WU2A 1FXDA 1UA1A 4Q8EA 4QWEA 1VQOS 1GH8A 2ZC3A 4ISBA 3DMJB 2BOPA 1HBMB 4L72B 3TAPA 3DRSA 2FVSA 2ROGA 1KEKA 3VQTA 2OP5A 4DLEA 1RTDB 3D0HE 3LGMA 2GHPA 4EZ9A 3AQPA 3DDKA 1WEYA 1WNEA 4DFMA 5AE2A 1NB7A 1H3DA 3T3FA 1S76D 4DS4A 1G1XA 2KO1A 4RLFA 1XTZA 4IFYA 1FTCA 4IR7A 1GNKA 3I4PA 3JTPA 2R9LA 2R8GA 2E7XA 1F0XA 3PW0A 2M3DA 3HX9A 2LQJA 2X1GA 3HZEA 5BUSA 1ULRA 4DV2F 2XY6A 4K0BA 3IEVA 3S6EA 1QVGR 2VFRA 1LOUA 2XBPA 2QT7A 1Y5LB 1VK3A 1UETA 4RW4A 4ATNA 1XC9A 4FP9A 4JYAF 1U09A 2FUG9 2ZE2B 3VR1A 5KT7A 2HQIA 2HIQA 1JKHB 4O3RA 2DRAA 4C0OC 2WP0C 5ADZA 2R4FA 3EZUA 3R9WA 3HI9A 2HHWA 2WB1D 1FVQA 2VG6B 1USPA 2M88A 1WF1A 2MQLA 4NXMF 4JI7F 4O3OA 3MTJA 2GMJA 3BQ2A 5AJ3F