4PUGA

Bola1 from arabidopsis thaliana
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
AIENRASRMREKLQKELEPVELVIEDVSYQHAGHAGMKGRTDDETHFNVKIVSKGFEGMNLVKRHRLVYHLLREELDTGLHALSIVSKTPSESP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BolA like protein
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 31
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 4pugA01
3O2EA 4PUIA 2DHMA 2MCQA 1XS3A 1NY8A 2MMAB 3TR3A 2KDNA 2MM9A 2NCLA 4PUGA 1V60A 5LCIA 2KZ0A 4PUHA
chains in the Genus database with same CATH superfamily
4DR6C 2OBVA 4OX9C 3PBKA 1RG9A 2E5LC 3GR0A 4RLQA 4DV1C 4DR4C 3E7XA 1FLOA 1LCIA 4DV5C 1T5DX 1WH9A 2Z51A 4BC7A 5T8SA 2YCBA 3N2QA 3H2TA 2P2FA 4X64C 1XHJA 4B3TC 4G36A 5BUSA 3LNOA 2QVYX 4B3MC 4DG9A 4B3SC 4DCTA 2VSQA 3KXWA 4NXMC 3ETOA 3NYQA 5BURA 3DAYA 4X65C 4DV0C 3A9UA 4R0MA 5AE1A 1BA3A 4JV5C 5KYVA 1K0RA 1P7LA 4EATA 1HNXC 2YWCA 4MH4A 4PUGA 2KZ0A 2DYJA 2PT7G 4DV6C 1MDFA 3VNRA 2UUAC 1P4EC 2UUBC 5GTDA 2D1QA 3RG2A 2JNVA 3NPDA 4I9FA 3UX3A 2HHHC 1UWDA 3CQ3A 4GKKC 3NYRA 4DUZC 3UX2A 4FUTA 4JI3C 4LFBC 4RLFA 3AF6A 4GXRA 4DUYC 1WCJA 2HJGA 3A9VA 1HH2P 4DV2C 3S82A 2P2MA 2MMAB 4BCAA 4JI7C 2P20A 1L2FA 2CXCA 1XS3A 3LUSA 1PA4A 3LGXA 4G37A 5CZXA 4JI8C 1HNWC 1MKYA 5JRHA 1VLAA 5LMNC 2OPLB 2CU6A 5KYTA 1M6XA 4D57A 5BSUA 4LFCC 5A1IA 2BH1X 1XRAA 5IWAC 3CW8X 4DR2C 1TH5A 5IFIA 4PZPA 2JMPA 4JI1C 4KHPC 2WP0C 4DG8A 4BBYA 4DR5C 4I9GA 3K6RA 1PG3A 3GPCA 4RM2A 5BSWA 1YJ7A 4X66C 1ML8A 4GS5A 2D1RA 4DR7C 5AE2A 2D1SA 2P02A 1XMOC 3GKUA 1WF3A 3TDEA 3LNVA 2VQFC 4JYAC 2KZFA 3TQIA 4DV7C 4JI4C 2Y27A 4TPSB 1IBKC 4BC9A 5BSRA 3DHVA 4L2ZA 3UZ0A 1QWIA 4AQYC 2XR1A 3T1YC 2ASBA 4WV3A 2DHMA 4MTNA 1MXAA 1USPB 5H9UA 1NY8A 4L4QA 3CQ2A 1MD9A 2D28C 4LF9C 5A2QD 2E8EA 3I07A 4RVOA 4PUIA 3J81D 1XNQC 4LFAC 2PROA 2VQEC 4B3RC 3J80D 4JI2C 1VEHA 5DV9A 1N33C 4IZ6A 1UKKA 4JM1A 2OPLA 3CQ1A 1I94C 1MXBA 2ZZNA 3R44A 1ULTA 4BSZA 5T8TA 1N2FA 2DPLA 3R9XA 2E8CA 2F4VC 4DCVA 2QVXX 1N36C 1V25A 1MDBA 2P2QA 2M5HA 4OYCA 2QL8A 4YHHC 4K0BA 4ISBA 2UXDC 4RM3A 4JI6C 3GR1A 3A26A 3G7SA 2EGTA 4ZLPA 2UXCC 3I08A 4PUHA 4D4IA 2E8FA 3AY0A 3CJEA 2UU9C 1RY2A 5BSMA 1PU1A 5A1GA 3TUFA 2E0GA 4LF6C 4LE5A 3JAMD 2UXBC 4NDNA 1FUGA 5BR8C 1XNRC 1FJGC 2MM9A 1KKGA 3DLPX 2ONFA 3C5EA 2PN2A 5ADZA 1IBLC 4XX2A 2KDNA 3E7WA 3A4IA 2D27A 2YX1A 1P4EA 5BSTA 3FCCA 3PESA 4KTTA 5K8FA 4D56A 4X62C 2BJOA 4DV4C 2E7GA 2P2BA 2NCLA 3IEUA 5LMUC 5E7QA 2QW0X 4DV3C 2P2JA 4LF5C 3O2EA 1JOSA 4G1IA 3EERA 2Y4NA 1USPA 1XMQC 3NI2A 3L8CA 3SO4A 1M6XC 1O93A 4DR3C 5BUQA 4DR1C 4WS9A 1IBMC 2D1TA 4HPVA 4JI0C 4LF8C 1O92A 5KEIA 1XRBA 3FCEA 3B7WA 4ODJA 5A19A 4LF7C 4FTFA 4RMNA 2WD9A 1AMUA 1O9TA 1MXCA 3RV2A 4K0KC 2UUCC 3IPLA 1N32C 3N54B 4L7IA 3VNQA 3AF5A 4NXNC 3UOWA 3LAXA 4U5YD 3ETCA 1J5EC 2M5OA 4GKJC 4ZJZA 5FLXD 5IT9D 3L95X 3OTOC 4FUQA 5LCIA 3IEVA 1IB8A 1N34C 5CZVA 5K85A 1ZB9A 1QM4A 1LQLA 1XRCA 1NYEA 2AYAA 1HNZC 2Y4OA 1EGAA 3VNSA 4IR7A 4R1MA 4RVNA 4LF4C 3UEBA 2VZEA 3PROC 3IMLA 3T1HC 4JI5C 5BSVA 1HR0C 3R9WA 4PHTA 2OO4A 1T5HX 2ZM6C 2V7BA 1GPMA 4D4GA 4YY3C 2YWBA 4KTVA 3TR3A 4R1LA 3EQ6A 1ZB8A 3CW9A 1PG4A 2MCQA 4DCSA 1O90A 1V26A 1V60A 2ZZMA 4GXQA 5AE3A 3A25A 4DCUA 2D7VA 2QVZX 4OXIA 4PROC 2CY1A 4NOZA 2ATWA
chains in the Genus database with same CATH topology
3O2EA 4PUIA 2DHMA 2MCQA 1XS3A 1NY8A 2MMAB 3TR3A 2KDNA 2MM9A 2NCLA 4PUGA 1V60A 5LCIA 2KZ0A 4PUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2E A;  4PUI A;  2DHM A;  2MCQ A;  1XS3 A;  1NY8 A;  2MMA B;  3TR3 A;  2KDN A;  2MM9 A;  2NCL A;  4PUG A;  1V60 A;  5LCI A;  2KZ0 A;  4PUH A; 
#chains in the Genus database with same CATH topology
 4DR6 C;  2OBV A;  4OX9 C;  3PBK A;  1RG9 A;  2E5L C;  3GR0 A;  4RLQ A;  4DV1 C;  4DR4 C;  3E7X A;  1FLO A;  1LCI A;  4DV5 C;  1T5D X;  1WH9 A;  2Z51 A;  4BC7 A;  5T8S A;  2YCB A;  3N2Q A;  3H2T A;  2P2F A;  4X64 C;  1XHJ A;  4B3T C;  4G36 A;  5BUS A;  3LNO A;  2QVY X;  4B3M C;  4DG9 A;  4B3S C;  4DCT A;  2VSQ A;  3KXW A;  4NXM C;  3ETO A;  3NYQ A;  5BUR A;  3DAY A;  4X65 C;  4DV0 C;  3A9U A;  4R0M A;  5AE1 A;  1BA3 A;  4JV5 C;  5KYV A;  1K0R A;  1P7L A;  4EAT A;  1HNX C;  2YWC A;  4MH4 A;  4PUG A;  2KZ0 A;  2DYJ A;  2PT7 G;  4DV6 C;  1MDF A;  3VNR A;  2UUA C;  1P4E C;  2UUB C;  5GTD A;  2D1Q A;  3RG2 A;  2JNV A;  3NPD A;  4I9F A;  3UX3 A;  2HHH C;  1UWD A;  3CQ3 A;  4GKK C;  3NYR A;  4DUZ C;  3UX2 A;  4FUT A;  4JI3 C;  4LFB C;  4RLF A;  3AF6 A;  4GXR A;  4DUY C;  1WCJ A;  2HJG A;  3A9V A;  1HH2 P;  4DV2 C;  3S82 A;  2P2M A;  2MMA B;  4BCA A;  4JI7 C;  2P20 A;  1L2F A;  2CXC A;  1XS3 A;  3LUS A;  1PA4 A;  3LGX A;  4G37 A;  5CZX A;  4JI8 C;  1HNW C;  1MKY A;  5JRH A;  1VLA A;  5LMN C;  2OPL B;  2CU6 A;  5KYT A;  1M6X A;  4D57 A;  5BSU A;  4LFC C;  5A1I A;  2BH1 X;  1XRA A;  5IWA C;  3CW8 X;  4DR2 C;  1TH5 A;  5IFI A;  4PZP A;  2JMP A;  4JI1 C;  4KHP C;  2WP0 C;  4DG8 A;  4BBY A;  4DR5 C;  4I9G A;  3K6R A;  1PG3 A;  3GPC A;  4RM2 A;  5BSW A;  1YJ7 A;  4X66 C;  1ML8 A;  4GS5 A;  2D1R A;  4DR7 C;  5AE2 A;  2D1S A;  2P02 A;  1XMO C;  3GKU A;  1WF3 A;  3TDE A;  3LNV A;  2VQF C;  4JYA C;  2KZF A;  3TQI A;  4DV7 C;  4JI4 C;  2Y27 A;  4TPS B;  1IBK C;  4BC9 A;  5BSR A;  3DHV A;  4L2Z A;  3UZ0 A;  1QWI A;  4AQY C;  2XR1 A;  3T1Y C;  2ASB A;  4WV3 A;  2DHM A;  4MTN A;  1MXA A;  1USP B;  5H9U A;  1NY8 A;  4L4Q A;  3CQ2 A;  1MD9 A;  2D28 C;  4LF9 C;  5A2Q D;  2E8E A;  3I07 A;  4RVO A;  4PUI A;  3J81 D;  1XNQ C;  4LFA C;  2PRO A;  2VQE C;  4B3R C;  3J80 D;  4JI2 C;  1VEH A;  5DV9 A;  1N33 C;  4IZ6 A;  1UKK A;  4JM1 A;  2OPL A;  3CQ1 A;  1I94 C;  1MXB A;  2ZZN A;  3R44 A;  1ULT A;  4BSZ A;  5T8T A;  1N2F A;  2DPL A;  3R9X A;  2E8C A;  2F4V C;  4DCV A;  2QVX X;  1N36 C;  1V25 A;  1MDB A;  2P2Q A;  2M5H A;  4OYC A;  2QL8 A;  4YHH C;  4K0B A;  4ISB A;  2UXD C;  4RM3 A;  4JI6 C;  3GR1 A;  3A26 A;  3G7S A;  2EGT A;  4ZLP A;  2UXC C;  3I08 A;  4PUH A;  4D4I A;  2E8F A;  3AY0 A;  3CJE A;  2UU9 C;  1RY2 A;  5BSM A;  1PU1 A;  5A1G A;  3TUF A;  2E0G A;  4LF6 C;  4LE5 A;  3JAM D;  2UXB C;  4NDN A;  1FUG A;  5BR8 C;  1XNR C;  1FJG C;  2MM9 A;  1KKG A;  3DLP X;  2ONF A;  3C5E A;  2PN2 A;  5ADZ A;  1IBL C;  4XX2 A;  2KDN A;  3E7W A;  3A4I A;  2D27 A;  2YX1 A;  1P4E A;  5BST A;  3FCC A;  3PES A;  4KTT A;  5K8F A;  4D56 A;  4X62 C;  2BJO A;  4DV4 C;  2E7G A;  2P2B A;  2NCL A;  3IEU A;  5LMU C;  5E7Q A;  2QW0 X;  4DV3 C;  2P2J A;  4LF5 C;  3O2E A;  1JOS A;  4G1I A;  3EER A;  2Y4N A;  1USP A;  1XMQ C;  3NI2 A;  3L8C A;  3SO4 A;  1M6X C;  1O93 A;  4DR3 C;  5BUQ A;  4DR1 C;  4WS9 A;  1IBM C;  2D1T A;  4HPV A;  4JI0 C;  4LF8 C;  1O92 A;  5KEI A;  1XRB A;  3FCE A;  3B7W A;  4ODJ A;  5A19 A;  4LF7 C;  4FTF A;  4RMN A;  2WD9 A;  1AMU A;  1O9T A;  1MXC A;  3RV2 A;  4K0K C;  2UUC C;  3IPL A;  1N32 C;  3N54 B;  4L7I A;  3VNQ A;  3AF5 A;  4NXN C;  3UOW A;  3LAX A;  4U5Y D;  3ETC A;  1J5E C;  2M5O A;  4GKJ C;  4ZJZ A;  5FLX D;  5IT9 D;  3L95 X;  3OTO C;  4FUQ A;  5LCI A;  3IEV A;  1IB8 A;  1N34 C;  5CZV A;  5K85 A;  1ZB9 A;  1QM4 A;  1LQL A;  1XRC A;  1NYE A;  2AYA A;  1HNZ C;  2Y4O A;  1EGA A;  3VNS A;  4IR7 A;  4R1M A;  4RVN A;  4LF4 C;  3UEB A;  2VZE A;  3PRO C;  3IML A;  3T1H C;  4JI5 C;  5BSV A;  1HR0 C;  3R9W A;  4PHT A;  2OO4 A;  1T5H X;  2ZM6 C;  2V7B A;  1GPM A;  4D4G A;  4YY3 C;  2YWB A;  4KTV A;  3TR3 A;  4R1L A;  3EQ6 A;  1ZB8 A;  3CW9 A;  1PG4 A;  2MCQ A;  4DCS A;  1O90 A;  1V26 A;  1V60 A;  2ZZM A;  4GXQ A;  5AE3 A;  3A25 A;  4DCU A;  2D7V A;  2QVZ X;  4OXI A;  4PRO C;  2CY1 A;  4NOZ A;  2ATW A; 
#chains in the Genus database with same CATH homology
 3O2E A;  4PUI A;  2DHM A;  2MCQ A;  1XS3 A;  1NY8 A;  2MMA B;  3TR3 A;  2KDN A;  2MM9 A;  2NCL A;  4PUG A;  1V60 A;  5LCI A;  2KZ0 A;  4PUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...