4PUGA

Bola1 from arabidopsis thaliana
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
AIENRASRMREKLQKELEPVELVIEDVSYQHAGHAGMKGRTDDETHFNVKIVSKGFEGMNLVKRHRLVYHLLREELDTGLHALSIVSKTPSESP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords BolA like protein
total genus 31
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 4pugA01
4PUGA 2MCQA 2KDNA 2DHMA 1NY8A 3TR3A 1V60A 2KZ0A 1XS3A 2MMAB 4PUIA 5LCIA 3O2EA 4PUHA 2MM9A 2NCLA
chains in the Genus database with same CATH superfamily
2VZEA 1HH2P 4OXIA 4WV3A 4DR7C 2E8EA 4OYCA 2UXCC 2MMAB 2OO4A 3GR1A 3DAYA 3GKUA 2UUCC 5K85A 4JI5C 2HJGA 2UU9C 2MM9A 2ZZMA 1IBKC 1YJ7A 3TQIA 5A1IA 3OTOC 2QVXX 5GTDA 1AMUA 5BSWA 3EERA 1MKYA 4DR1C 4BC7A 2P02A 3N2QA 4MH4A 4L4QA 1RY2A 3CQ3A 3E7XA 3ETCA 3N54B 1IB8A 5BURA 1JOSA 4KTTA 4D57A 3H2TA 3CQ1A 4RLQA 1T5DX 4HPVA 4DV0C 2OPLB 1NY8A 1FUGA 2ZZNA 1IBMC 2Y4NA 2XR1A 1N2FA 3IEUA 2UXBC 4B3RC 4IR7A 2PN2A 4D4IA 2QVZX 4LF7C 2CU6A 4G37A 3GR0A 3IMLA 4MTNA 4BCAA 2P2MA 1V60A 5A1GA 2F4VC 1NYEA 4RLFA 4JI2C 2UXDC 3IPLA 3J80D 1WCJA 2WP0C 2Z51A 5FLXD 4XX2A 2KZFA 4YY3C 4DV6C 4DCSA 3UZ0A 2D1SA 2VSQA 1HNZC 1XNRC 1N32C 4B3SC 4ZLPA 3G7SA 3S82A 1UWDA 1RG9A 4BC9A 2AYAA 5LCIA 1L2FA 1V26A 1MDBA 4DR4C 3PROC 1V25A 3RV2A 2UUAC 3PESA 4DV7C 4NOZA 5KEIA 2JNVA 2Y4OA 4JI8C 5A2QD 1LCIA 3FCEA 2UUBC 2M5OA 3VNSA 1J5EC 2D28C 2QW0X 1QWIA 4DG8A 1BA3A 1PG4A 4DR3C 3T1YC 5JRHA 4X64C 2MCQA 1PU1A 1HNWC 1O9TA 4DG9A 4JI0C 3SO4A 2CXCA 4PHTA 1WH9A 4BSZA 3A4IA 1ML8A 4DUZC 2D1QA 1P7LA 3NPDA 2P2QA 3A25A 3VNQA 3A9VA 3LUSA 3EQ6A 5BSVA 4GXQA 3K6RA 3J81D 1ZB9A 3VNRA 2E8FA 2ZM6C 1XRCA 4JI1C 3LNOA 4AQYC 1MXAA 2V7BA 3NYRA 3ETOA 3NI2A 4FUTA 4RVNA 4LFAC 4PZPA 1K0RA 4DCUA 1MDFA 3FCCA 4PUIA 4DR6C 3JAMD 3A26A 2E7GA 5ADZA 1LQLA 3L8CA 4DV5C 5KYTA 1XMOC 2YWBA 3CW9A 1TH5A 3AF5A 1QM4A 1HNXC 4B3MC 2VQEC 1USPA 3I07A 4DR5C 1WF3A 2JMPA 4EATA 4JV5C 1XRBA 4R1LA 2M5HA 2DPLA 1N33C 1VLAA 1XRAA 3KXWA 4NDNA 1KKGA 2QL8A 3UOWA 4I9GA 5T8SA 4DR2C 4RM3A 2P2BA 3UX2A 4IZ6A 2HHHC 1HR0C 4PUHA 2P2JA 4B3TC 5KYVA 5LMNC 1O90A 3NYQA 4WS9A 5T8TA 1MD9A 4DCTA 4KTVA 1O93A 3CQ2A 4X66C 4GKKC 1ZB8A 2YCBA 4KHPC 2CY1A 4G36A 3A9UA 5AE1A 1N36C 5BR8C 3T1HC 2PT7G 2YX1A 3LNVA 1GPMA 5BSMA 1XS3A 2P2FA 2P20A 4L2ZA 4R0MA 2KDNA 2YWCA 1PG3A 2VQFC 1VEHA 2Y27A 1UKKA 4K0KC 3UX3A 4JI4C 5K8FA 4RM2A 4BBYA 2D1RA 4GXRA 2EGTA 2NCLA 5IFIA 1FJGC 1P4EA 2PROA 4I9FA 5BSRA 5AE3A 1XNQC 1M6XC 4LF9C 2ASBA 5CZXA 1MXCA 4NXMC 3CJEA 4G1IA 4PROC 2OBVA 1N34C 2QVYX 2D1TA 3O2EA 2E8CA 5BSTA 4ISBA 2ONFA 1MXBA 3R9XA 2E0GA 5BSUA 2BH1X 4L7IA 4ZJZA 4YHHC 3LAXA 4DV3C 4LF6C 4RVOA 1M6XA 4D4GA 3R9WA 4JI3C 3AF6A 3LGXA 2WD9A 1IBLC 4LFCC 1T5HX 5H9UA 4PUGA 4DCVA 3C5EA 5E7QA 4RMNA 5CZVA 3DLPX 1PA4A 4TPSB 3RG2A 3DHVA 1USPB 1I94C 3PBKA 4R1MA 3TDEA 4JYAC 2BJOA 3B7WA 3GPCA 4FUQA 3UEBA 4K0BA 4LE5A 4D56A 4ODJA 1FLOA 4NXNC 2DYJA 5IT9D 4OX9C 2DHMA 3TR3A 1P4EC 5A19A 1ULTA 2OPLA 4X62C 3AY0A 3TUFA 4DUYC 4U5YD 5AE2A 3IEVA 4DV1C 4LFBC 3E7WA 4X65C 4LF8C 4JI6C 5BUQA 2E5LC 2ATWA 5DV9A 4DV4C 2D27A 1XHJA 4GS5A 2D7VA 4GKJC 4LF4C 1O92A 3I08A 4LF5C 3R44A 4JI7C 4DV2C 2KZ0A 4FTFA 3L95X 5BUSA 1XMQC 5IWAC 5LMUC 1EGAA 3CW8X 4JM1A
chains in the Genus database with same CATH topology
4PUGA 2MCQA 2KDNA 2DHMA 1NY8A 3TR3A 1V60A 2KZ0A 1XS3A 2MMAB 4PUIA 5LCIA 3O2EA 4PUHA 2MM9A 2NCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUG A;  2MCQ A;  2KDN A;  2DHM A;  1NY8 A;  3TR3 A;  1V60 A;  2KZ0 A;  1XS3 A;  2MMA B;  4PUI A;  5LCI A;  3O2E A;  4PUH A;  2MM9 A;  2NCL A; 
#chains in the Genus database with same CATH topology
 2VZE A;  1HH2 P;  4OXI A;  4WV3 A;  4DR7 C;  2E8E A;  4OYC A;  2UXC C;  2MMA B;  2OO4 A;  3GR1 A;  3DAY A;  3GKU A;  2UUC C;  5K85 A;  4JI5 C;  2HJG A;  2UU9 C;  2MM9 A;  2ZZM A;  1IBK C;  1YJ7 A;  3TQI A;  5A1I A;  3OTO C;  2QVX X;  5GTD A;  1AMU A;  5BSW A;  3EER A;  1MKY A;  4DR1 C;  4BC7 A;  2P02 A;  3N2Q A;  4MH4 A;  4L4Q A;  1RY2 A;  3CQ3 A;  3E7X A;  3ETC A;  3N54 B;  1IB8 A;  5BUR A;  1JOS A;  4KTT A;  4D57 A;  3H2T A;  3CQ1 A;  4RLQ A;  1T5D X;  4HPV A;  4DV0 C;  2OPL B;  1NY8 A;  1FUG A;  2ZZN A;  1IBM C;  2Y4N A;  2XR1 A;  1N2F A;  3IEU A;  2UXB C;  4B3R C;  4IR7 A;  2PN2 A;  4D4I A;  2QVZ X;  4LF7 C;  2CU6 A;  4G37 A;  3GR0 A;  3IML A;  4MTN A;  4BCA A;  2P2M A;  1V60 A;  5A1G A;  2F4V C;  1NYE A;  4RLF A;  4JI2 C;  2UXD C;  3IPL A;  3J80 D;  1WCJ A;  2WP0 C;  2Z51 A;  5FLX D;  4XX2 A;  2KZF A;  4YY3 C;  4DV6 C;  4DCS A;  3UZ0 A;  2D1S A;  2VSQ A;  1HNZ C;  1XNR C;  1N32 C;  4B3S C;  4ZLP A;  3G7S A;  3S82 A;  1UWD A;  1RG9 A;  4BC9 A;  2AYA A;  5LCI A;  1L2F A;  1V26 A;  1MDB A;  4DR4 C;  3PRO C;  1V25 A;  3RV2 A;  2UUA C;  3PES A;  4DV7 C;  4NOZ A;  5KEI A;  2JNV A;  2Y4O A;  4JI8 C;  5A2Q D;  1LCI A;  3FCE A;  2UUB C;  2M5O A;  3VNS A;  1J5E C;  2D28 C;  2QW0 X;  1QWI A;  4DG8 A;  1BA3 A;  1PG4 A;  4DR3 C;  3T1Y C;  5JRH A;  4X64 C;  2MCQ A;  1PU1 A;  1HNW C;  1O9T A;  4DG9 A;  4JI0 C;  3SO4 A;  2CXC A;  4PHT A;  1WH9 A;  4BSZ A;  3A4I A;  1ML8 A;  4DUZ C;  2D1Q A;  1P7L A;  3NPD A;  2P2Q A;  3A25 A;  3VNQ A;  3A9V A;  3LUS A;  3EQ6 A;  5BSV A;  4GXQ A;  3K6R A;  3J81 D;  1ZB9 A;  3VNR A;  2E8F A;  2ZM6 C;  1XRC A;  4JI1 C;  3LNO A;  4AQY C;  1MXA A;  2V7B A;  3NYR A;  3ETO A;  3NI2 A;  4FUT A;  4RVN A;  4LFA C;  4PZP A;  1K0R A;  4DCU A;  1MDF A;  3FCC A;  4PUI A;  4DR6 C;  3JAM D;  3A26 A;  2E7G A;  5ADZ A;  1LQL A;  3L8C A;  4DV5 C;  5KYT A;  1XMO C;  2YWB A;  3CW9 A;  1TH5 A;  3AF5 A;  1QM4 A;  1HNX C;  4B3M C;  2VQE C;  1USP A;  3I07 A;  4DR5 C;  1WF3 A;  2JMP A;  4EAT A;  4JV5 C;  1XRB A;  4R1L A;  2M5H A;  2DPL A;  1N33 C;  1VLA A;  1XRA A;  3KXW A;  4NDN A;  1KKG A;  2QL8 A;  3UOW A;  4I9G A;  5T8S A;  4DR2 C;  4RM3 A;  2P2B A;  3UX2 A;  4IZ6 A;  2HHH C;  1HR0 C;  4PUH A;  2P2J A;  4B3T C;  5KYV A;  5LMN C;  1O90 A;  3NYQ A;  4WS9 A;  5T8T A;  1MD9 A;  4DCT A;  4KTV A;  1O93 A;  3CQ2 A;  4X66 C;  4GKK C;  1ZB8 A;  2YCB A;  4KHP C;  2CY1 A;  4G36 A;  3A9U A;  5AE1 A;  1N36 C;  5BR8 C;  3T1H C;  2PT7 G;  2YX1 A;  3LNV A;  1GPM A;  5BSM A;  1XS3 A;  2P2F A;  2P20 A;  4L2Z A;  4R0M A;  2KDN A;  2YWC A;  1PG3 A;  2VQF C;  1VEH A;  2Y27 A;  1UKK A;  4K0K C;  3UX3 A;  4JI4 C;  5K8F A;  4RM2 A;  4BBY A;  2D1R A;  4GXR A;  2EGT A;  2NCL A;  5IFI A;  1FJG C;  1P4E A;  2PRO A;  4I9F A;  5BSR A;  5AE3 A;  1XNQ C;  1M6X C;  4LF9 C;  2ASB A;  5CZX A;  1MXC A;  4NXM C;  3CJE A;  4G1I A;  4PRO C;  2OBV A;  1N34 C;  2QVY X;  2D1T A;  3O2E A;  2E8C A;  5BST A;  4ISB A;  2ONF A;  1MXB A;  3R9X A;  2E0G A;  5BSU A;  2BH1 X;  4L7I A;  4ZJZ A;  4YHH C;  3LAX A;  4DV3 C;  4LF6 C;  4RVO A;  1M6X A;  4D4G A;  3R9W A;  4JI3 C;  3AF6 A;  3LGX A;  2WD9 A;  1IBL C;  4LFC C;  1T5H X;  5H9U A;  4PUG A;  4DCV A;  3C5E A;  5E7Q A;  4RMN A;  5CZV A;  3DLP X;  1PA4 A;  4TPS B;  3RG2 A;  3DHV A;  1USP B;  1I94 C;  3PBK A;  4R1M A;  3TDE A;  4JYA C;  2BJO A;  3B7W A;  3GPC A;  4FUQ A;  3UEB A;  4K0B A;  4LE5 A;  4D56 A;  4ODJ A;  1FLO A;  4NXN C;  2DYJ A;  5IT9 D;  4OX9 C;  2DHM A;  3TR3 A;  1P4E C;  5A19 A;  1ULT A;  2OPL A;  4X62 C;  3AY0 A;  3TUF A;  4DUY C;  4U5Y D;  5AE2 A;  3IEV A;  4DV1 C;  4LFB C;  3E7W A;  4X65 C;  4LF8 C;  4JI6 C;  5BUQ A;  2E5L C;  2ATW A;  5DV9 A;  4DV4 C;  2D27 A;  1XHJ A;  4GS5 A;  2D7V A;  4GKJ C;  4LF4 C;  1O92 A;  3I08 A;  4LF5 C;  3R44 A;  4JI7 C;  4DV2 C;  2KZ0 A;  4FTF A;  3L95 X;  5BUS A;  1XMQ C;  5IWA C;  5LMU C;  1EGA A;  3CW8 X;  4JM1 A; 
#chains in the Genus database with same CATH homology
 4PUG A;  2MCQ A;  2KDN A;  2DHM A;  1NY8 A;  3TR3 A;  1V60 A;  2KZ0 A;  1XS3 A;  2MMA B;  4PUI A;  5LCI A;  3O2E A;  4PUH A;  2MM9 A;  2NCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...