1UWDA

Nmr structure of a protein with unknown function from thermotoga maritima (tm0487), which belongs to the duf59 family.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Biosynthetic protein
molecule keywords HYPOTHETICAL PROTEIN TM0487
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1uwdA00
2M5OA 2M5HA 2Z51A 3CQ1A 3UX2A 1VEHA 1WCJA 3UX3A 2CU6A 1XHJA 3CQ2A 2JNVA 3CQ3A 1TH5A 3LNOA 1UWDA
chains in the Genus database with same CATH superfamily
3TUFA 1QM4A 4DR2C 4X65C 2BJOA 2AYAA 2P2MA 3TR3A 3L8CA 5BSUA 4DV2C 1WCJA 4U5YD 5K8FA 2F4VC 1PG4A 2E8FA 2CY1A 4GXQA 5CZVA 3DAYA 2UUAC 1RG9A 2YX1A 2KZFA 2QL8A 4PUHA 4X62C 1NY8A 2CU6A 3L95X 2CXCA 3R9WA 1HNWC 4NOZA 2M5HA 5AE2A 1L2FA 2OO4A 1J5EC 1XRBA 2QVZX 3A26A 1MD9A 4OX9C 1N2FA 2ZM6C 4DV7C 1N34C 4LF5C 1N32C 3R9XA 4G1IA 2VQFC 3NPDA 3IMLA 2ZZMA 1XHJA 3O2EA 4X64C 3J81D 2V7BA 4NXMC 4FUTA 4BSZA 1USPA 1T5DX 2D7VA 4IZ6A 4DG8A 1PU1A 2YWBA 4ZLPA 2MM9A 3A9VA 2UUBC 4BBYA 4DUZC 4DR5C 4ISBA 5IFIA 3ETCA 4LF7C 2M5OA 4K0KC 3NYQA 1IBKC 2NCLA 1O90A 3TQIA 4WS9A 1NYEA 1M6XA 2E7GA 1M6XC 3JAMD 1MXAA 2ZZNA 2D28C 2OBVA 1P4EC 4KTVA 1LQLA 4RMNA 5AE1A 2UUCC 4DV0C 4GKJC 1I94C 4PROC 1MXCA 2E0GA 3VNRA 4PHTA 2MCQA 3GR0A 4BC7A 3GR1A 5BSRA 1O9TA 3N2QA 4I9GA 3UOWA 1LCIA 4GXRA 1O92A 3CQ3A 2QVXX 1VEHA 1XMOC 4JI3C 2QW0X 1HH2P 4AQYC 1FLOA 4RVNA 4NDNA 2DHMA 5ADZA 5T8SA 2D1RA 3PESA 2BH1X 1MKYA 3KXWA 3SO4A 3RG2A 4LFBC 1N36C 4LF4C 3PBKA 2P2BA 5BURA 3K6RA 3FCEA 1ULTA 4ODJA 1XRCA 1V60A 4OYCA 2OPLB 1USPB 2VQEC 2HJGA 5E7QA 3OTOC 4DR1C 1MXBA 4YY3C 5JRHA 4DR4C 3A4IA 4R1LA 1MDBA 4EATA 4YHHC 4JI8C 1V26A 3VNQA 3UZ0A 3H2TA 2D1TA 3DLPX 2VZEA 4D4GA 3T1HC 4RM3A 1WH9A 4L4QA 1XMQC 1EGAA 4PUIA 2P02A 1MDFA 4OXIA 2P20A 2JMPA 4JI2C 3VNSA 3CQ2A 5AE3A 4B3SC 3IPLA 1TH5A 4RVOA 5BR8C 3UX3A 3NYRA 2PT7G 1RY2A 2YWCA 4GS5A 5BSWA 4MTNA 1HR0C 2PROA 2DYJA 1KKGA 3E7WA 4GKKC 2OPLA 3AY0A 2PN2A 2EGTA 2MMAB 1HNZC 2UXBC 1XS3A 4D57A 4JYAC 5BSVA 5BSTA 2UU9C 2XR1A 1UWDA 4LF8C 4FUQA 4WV3A 4DV4C 5A19A 5T8TA 1UKKA 4R0MA 2ONFA 4JM1A 5GTDA 4DCVA 5A1GA 4DCTA 2Y27A 5IWAC 3LNOA 3RV2A 1IB8A 1VLAA 4D56A 5BSMA 2P2JA 4BCAA 1JOSA 4L7IA 4BC9A 1PA4A 3FCCA 5KYVA 4PUGA 3T1YC 4LFAC 4D4IA 4JI7C 2ASBA 1K0RA 4R1MA 4JI4C 5KEIA 2E5LC 1PG3A 3AF6A 2Y4OA 4B3RC 2D27A 3UEBA 4G36A 4NXNC 4LE5A 5CZXA 2WP0C 4RLQA 1IBLC 4DV1C 4LF9C 2VSQA 2YCBA 3LNVA 3IEVA 4JV5C 5BUSA 5LCIA 3S82A 3I08A 2HHHC 1FUGA 4RLFA 3NI2A 4TPSB 5H9UA 5KYTA 2D1SA 4JI5C 4IR7A 2D1QA 4KHPC 3IEUA 1BA3A 3A25A 1ML8A 1XNQC 3GKUA 4X66C 2KDNA 4G37A 1GPMA 3J80D 1HNXC 4LFCC 4I9FA 3A9UA 1N33C 1FJGC 4JI1C 3CJEA 3LGXA 5FLXD 3CQ1A 3EERA 5LMUC 5BUQA 3CW8X 2Y4NA 4DCSA 3DHVA 1ZB9A 4LF6C 1P4EA 2E8CA 3TDEA 3N54B 2WD9A 5IT9D 4MH4A 4FTFA 4DG9A 4JI0C 4K0BA 4DV5C 2KZ0A 3R44A 1ZB8A 2DPLA 3CW9A 1V25A 2Z51A 4HPVA 2E8EA 4DR3C 2QVYX 5DV9A 3B7WA 1QWIA 4XX2A 3E7XA 5LMNC 4DR7C 3AF5A 3C5EA 1O93A 2UXCC 3LAXA 3GPCA 1AMUA 1IBMC 2P2QA 3LUSA 3EQ6A 4DUYC 4DV6C 3UX2A 2ATWA 3I07A 1P7LA 4PZPA 3G7SA 2JNVA 4RM2A 1WF3A 4B3TC 4L2ZA 1T5HX 2UXDC 5A2QD 4JI6C 4ZJZA 5A1IA 1XRAA 2P2FA 4DR6C 4KTTA 3PROC 1YJ7A 4DCUA 4B3MC 4DV3C 1XNRC 3ETOA 5K85A
chains in the Genus database with same CATH topology
2M5OA 2M5HA 2Z51A 3CQ1A 3UX2A 1VEHA 1WCJA 3UX3A 2CU6A 1XHJA 3CQ2A 2JNVA 3CQ3A 1TH5A 3LNOA 1UWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5O A;  2M5H A;  2Z51 A;  3CQ1 A;  3UX2 A;  1VEH A;  1WCJ A;  3UX3 A;  2CU6 A;  1XHJ A;  3CQ2 A;  2JNV A;  3CQ3 A;  1TH5 A;  3LNO A;  1UWD A; 
#chains in the Genus database with same CATH topology
 3TUF A;  1QM4 A;  4DR2 C;  4X65 C;  2BJO A;  2AYA A;  2P2M A;  3TR3 A;  3L8C A;  5BSU A;  4DV2 C;  1WCJ A;  4U5Y D;  5K8F A;  2F4V C;  1PG4 A;  2E8F A;  2CY1 A;  4GXQ A;  5CZV A;  3DAY A;  2UUA C;  1RG9 A;  2YX1 A;  2KZF A;  2QL8 A;  4PUH A;  4X62 C;  1NY8 A;  2CU6 A;  3L95 X;  2CXC A;  3R9W A;  1HNW C;  4NOZ A;  2M5H A;  5AE2 A;  1L2F A;  2OO4 A;  1J5E C;  1XRB A;  2QVZ X;  3A26 A;  1MD9 A;  4OX9 C;  1N2F A;  2ZM6 C;  4DV7 C;  1N34 C;  4LF5 C;  1N32 C;  3R9X A;  4G1I A;  2VQF C;  3NPD A;  3IML A;  2ZZM A;  1XHJ A;  3O2E A;  4X64 C;  3J81 D;  2V7B A;  4NXM C;  4FUT A;  4BSZ A;  1USP A;  1T5D X;  2D7V A;  4IZ6 A;  4DG8 A;  1PU1 A;  2YWB A;  4ZLP A;  2MM9 A;  3A9V A;  2UUB C;  4BBY A;  4DUZ C;  4DR5 C;  4ISB A;  5IFI A;  3ETC A;  4LF7 C;  2M5O A;  4K0K C;  3NYQ A;  1IBK C;  2NCL A;  1O90 A;  3TQI A;  4WS9 A;  1NYE A;  1M6X A;  2E7G A;  1M6X C;  3JAM D;  1MXA A;  2ZZN A;  2D28 C;  2OBV A;  1P4E C;  4KTV A;  1LQL A;  4RMN A;  5AE1 A;  2UUC C;  4DV0 C;  4GKJ C;  1I94 C;  4PRO C;  1MXC A;  2E0G A;  3VNR A;  4PHT A;  2MCQ A;  3GR0 A;  4BC7 A;  3GR1 A;  5BSR A;  1O9T A;  3N2Q A;  4I9G A;  3UOW A;  1LCI A;  4GXR A;  1O92 A;  3CQ3 A;  2QVX X;  1VEH A;  1XMO C;  4JI3 C;  2QW0 X;  1HH2 P;  4AQY C;  1FLO A;  4RVN A;  4NDN A;  2DHM A;  5ADZ A;  5T8S A;  2D1R A;  3PES A;  2BH1 X;  1MKY A;  3KXW A;  3SO4 A;  3RG2 A;  4LFB C;  1N36 C;  4LF4 C;  3PBK A;  2P2B A;  5BUR A;  3K6R A;  3FCE A;  1ULT A;  4ODJ A;  1XRC A;  1V60 A;  4OYC A;  2OPL B;  1USP B;  2VQE C;  2HJG A;  5E7Q A;  3OTO C;  4DR1 C;  1MXB A;  4YY3 C;  5JRH A;  4DR4 C;  3A4I A;  4R1L A;  1MDB A;  4EAT A;  4YHH C;  4JI8 C;  1V26 A;  3VNQ A;  3UZ0 A;  3H2T A;  2D1T A;  3DLP X;  2VZE A;  4D4G A;  3T1H C;  4RM3 A;  1WH9 A;  4L4Q A;  1XMQ C;  1EGA A;  4PUI A;  2P02 A;  1MDF A;  4OXI A;  2P20 A;  2JMP A;  4JI2 C;  3VNS A;  3CQ2 A;  5AE3 A;  4B3S C;  3IPL A;  1TH5 A;  4RVO A;  5BR8 C;  3UX3 A;  3NYR A;  2PT7 G;  1RY2 A;  2YWC A;  4GS5 A;  5BSW A;  4MTN A;  1HR0 C;  2PRO A;  2DYJ A;  1KKG A;  3E7W A;  4GKK C;  2OPL A;  3AY0 A;  2PN2 A;  2EGT A;  2MMA B;  1HNZ C;  2UXB C;  1XS3 A;  4D57 A;  4JYA C;  5BSV A;  5BST A;  2UU9 C;  2XR1 A;  1UWD A;  4LF8 C;  4FUQ A;  4WV3 A;  4DV4 C;  5A19 A;  5T8T A;  1UKK A;  4R0M A;  2ONF A;  4JM1 A;  5GTD A;  4DCV A;  5A1G A;  4DCT A;  2Y27 A;  5IWA C;  3LNO A;  3RV2 A;  1IB8 A;  1VLA A;  4D56 A;  5BSM A;  2P2J A;  4BCA A;  1JOS A;  4L7I A;  4BC9 A;  1PA4 A;  3FCC A;  5KYV A;  4PUG A;  3T1Y C;  4LFA C;  4D4I A;  4JI7 C;  2ASB A;  1K0R A;  4R1M A;  4JI4 C;  5KEI A;  2E5L C;  1PG3 A;  3AF6 A;  2Y4O A;  4B3R C;  2D27 A;  3UEB A;  4G36 A;  4NXN C;  4LE5 A;  5CZX A;  2WP0 C;  4RLQ A;  1IBL C;  4DV1 C;  4LF9 C;  2VSQ A;  2YCB A;  3LNV A;  3IEV A;  4JV5 C;  5BUS A;  5LCI A;  3S82 A;  3I08 A;  2HHH C;  1FUG A;  4RLF A;  3NI2 A;  4TPS B;  5H9U A;  5KYT A;  2D1S A;  4JI5 C;  4IR7 A;  2D1Q A;  4KHP C;  3IEU A;  1BA3 A;  3A25 A;  1ML8 A;  1XNQ C;  3GKU A;  4X66 C;  2KDN A;  4G37 A;  1GPM A;  3J80 D;  1HNX C;  4LFC C;  4I9F A;  3A9U A;  1N33 C;  1FJG C;  4JI1 C;  3CJE A;  3LGX A;  5FLX D;  3CQ1 A;  3EER A;  5LMU C;  5BUQ A;  3CW8 X;  2Y4N A;  4DCS A;  3DHV A;  1ZB9 A;  4LF6 C;  1P4E A;  2E8C A;  3TDE A;  3N54 B;  2WD9 A;  5IT9 D;  4MH4 A;  4FTF A;  4DG9 A;  4JI0 C;  4K0B A;  4DV5 C;  2KZ0 A;  3R44 A;  1ZB8 A;  2DPL A;  3CW9 A;  1V25 A;  2Z51 A;  4HPV A;  2E8E A;  4DR3 C;  2QVY X;  5DV9 A;  3B7W A;  1QWI A;  4XX2 A;  3E7X A;  5LMN C;  4DR7 C;  3AF5 A;  3C5E A;  1O93 A;  2UXC C;  3LAX A;  3GPC A;  1AMU A;  1IBM C;  2P2Q A;  3LUS A;  3EQ6 A;  4DUY C;  4DV6 C;  3UX2 A;  2ATW A;  3I07 A;  1P7L A;  4PZP A;  3G7S A;  2JNV A;  4RM2 A;  1WF3 A;  4B3T C;  4L2Z A;  1T5H X;  2UXD C;  5A2Q D;  4JI6 C;  4ZJZ A;  5A1I A;  1XRA A;  2P2F A;  4DR6 C;  4KTT A;  3PRO C;  1YJ7 A;  4DCU A;  4B3M C;  4DV3 C;  1XNR C;  3ETO A;  5K85 A; 
#chains in the Genus database with same CATH homology
 2M5O A;  2M5H A;  2Z51 A;  3CQ1 A;  3UX2 A;  1VEH A;  1WCJ A;  3UX3 A;  2CU6 A;  1XHJ A;  3CQ2 A;  2JNV A;  3CQ3 A;  1TH5 A;  3LNO A;  1UWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...