1UWDA

Nmr structure of a protein with unknown function from thermotoga maritima (tm0487), which belongs to the duf59 family.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
b'MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN TM0487
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Biosynthetic protein
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1uwdA00
1UWDA 1XHJA 1TH5A 2CU6A 3LNOA 2M5OA 1VEHA 3CQ2A 1WCJA 3UX2A 3CQ3A 3CQ1A 3UX3A 2JNVA 2M5HA 2Z51A
chains in the Genus database with same CATH superfamily
5CZXA 1P4EA 2ATWA 2MM9A 5KEIA 4LFBC 1N34C 4G37A 1TH5A 5BUSA 1V60A 4DV0C 3J80D 4NXNC 1XS3A 2ONFA 4L2ZA 5A19A 3FCCA 3N54B 5ADZA 2UU9C 4JI7C 3R9WA 3R44A 1XRBA 1MD9A 1T5DX 4NDNA 1QWIA 3TQIA 2PT7G 3GKUA 4JI3C 4OX9C 2E8FA 3EQ6A 4PUIA 3N2QA 5A1IA 3IEVA 3VNQA 1FUGA 4DV3C 4WS9A 3UX2A 4LF5C 1HNXC 3PESA 3TR3A 3L8CA 3NYRA 4U5YD 1K0RA 2QL8A 2DHMA 5LMUC 3RV2A 4X66C 4D56A 4RMNA 2QVZX 3AF6A 1M6XA 4G1IA 1MKYA 3RG2A 3DAYA 1MXAA 1XHJA 3S82A 4LF8C 1WCJA 4JM1A 4LF6C 1PU1A 3A26A 3EERA 1WH9A 3UZ0A 4DR4C 2QVYX 2ZZNA 2CU6A 5LMNC 4DCVA 4I9FA 2VZEA 1AMUA 3GR1A 2VQFC 3JAMD 3NYQA 4BBYA 3E7XA 4GXRA 4PHTA 3A4IA 4X62C 4RLFA 1N2FA 3VNRA 4B3RC 1IBLC 2HHHC 4NXMC 5E7QA 3NI2A 4KTVA 2MCQA 4DV2C 4AQYC 1XNRC 5KYVA 4BC7A 2YWBA 4YHHC 2D1QA 4RM3A 2XR1A 2Y4NA 2D7VA 1PG4A 2VQEC 3CQ3A 4GXQA 3AY0A 2DPLA 3B7WA 4ZJZA 3FCEA 3NPDA 4OXIA 4PROC 1HNZC 3LNOA 3T1YC 4DG8A 4BSZA 3J81D 1LCIA 2E0GA 4JI2C 2PN2A 4DCSA 3I07A 4DV1C 2CY1A 2EGTA 2Y27A 4RM2A 4RLQA 2P20A 3CW8X 1I94C 4DV5C 4R0MA 1MXBA 1PG3A 3LAXA 5DV9A 4GS5A 5BURA 4DUZC 2HJGA 5IFIA 1JOSA 2UUBC 4FUQA 5AE3A 3TDEA 1HNWC 3UEBA 4ISBA 1FJGC 2D28C 4GKJC 5JRHA 2UXCC 3PBKA 2KZFA 1P7LA 1IBKC 4DCUA 2F4VC 1MDBA 3CQ1A 1RY2A 1MXCA 5FLXD 4DUYC 2ASBA 4BC9A 2D1TA 4JI1C 4B3MC 3C5EA 2WD9A 4B3SC 4L4QA 2E8CA 3I08A 5GTDA 1T5HX 5IWAC 4PUHA 2ZZMA 4FUTA 3CW9A 5A1GA 2P2FA 4OYCA 4IR7A 1XNQC 4RVOA 2KZ0A 4D57A 1NY8A 1IB8A 4XX2A 3A9VA 4JI0C 2UXDC 3O2EA 3VNSA 1O90A 2P2JA 4DV7C 4YY3C 2P2MA 2YX1A 2CXCA 2Y4OA 5BSVA 3CQ2A 2PROA 1PA4A 3ETCA 4X64C 4G36A 4MH4A 2V7BA 2D27A 3GPCA 1ZB8A 1VLAA 4PZPA 2WP0C 1ML8A 3TUFA 3UOWA 4NOZA 4JI6C 2ZM6C 1XMOC 4X65C 4LFAC 4GKKC 5LCIA 3IPLA 1FLOA 1UKKA 2QVXX 2YCBA 4DV4C 1O92A 3LUSA 4LF7C 1NYEA 4JI8C 2P02A 1BA3A 2E8EA 5IT9D 1IBMC 1YJ7A 1RG9A 2M5OA 3ETOA 4IZ6A 4DCTA 3SO4A 2UUAC 1UWDA 1L2FA 3L95X 3H2TA 4TPSB 5BSMA 3R9XA 2OBVA 2VSQA 3IEUA 4DR2C 4K0KC 4DR7C 4R1MA 3LNVA 4LFCC 2BH1X 2DYJA 1GPMA 1P4EC 3DHVA 1N32C 5BSRA 4HPVA 3IMLA 5BUQA 4ODJA 1XMQC 3K6RA 4R1LA 1ZB9A 3UX3A 5T8TA 2UUCC 3T1HC 2OPLB 1HR0C 3DLPX 3LGXA 2JNVA 4B3TC 5BSUA 2UXBC 2OPLA 5CZVA 3E7WA 2AYAA 5BSTA 3A25A 3AF5A 4BCAA 2P2BA 5KYTA 1USPB 3PROC 2P2QA 2E5LC 1USPA 1LQLA 2QW0X 3A9UA 3G7SA 1XRCA 5H9UA 4RVNA 1N33C 4DR3C 4K0BA 4JI5C 5AE1A 2YWCA 4L7IA 4LE5A 1VEHA 3CJEA 2BJOA 4EATA 4JV5C 1V26A 4JI4C 4DR6C 5AE2A 2MMAB 4DV6C 5BSWA 4WV3A 5K8FA 1O9TA 4KHPC 4PUGA 3OTOC 2D1RA 2E7GA 1M6XC 1N36C 3KXWA 2OO4A 4JYAC 4D4GA 4FTFA 2Z51A 2JMPA 4ZLPA 1ULTA 2D1SA 1J5EC 1KKGA 1V25A 2KDNA 5K85A 5BR8C 1WF3A 1QM4A 1EGAA 1MDFA 1HH2P 3GR0A 4LF9C 4I9GA 4MTNA 4DR1C 4D4IA 4LF4C 1XRAA 5A2QD 4DG9A 4DR5C 4KTTA 2NCLA 5T8SA 1O93A 2M5HA
chains in the Genus database with same CATH topology
1UWDA 1XHJA 1TH5A 2CU6A 3LNOA 2M5OA 1VEHA 3CQ2A 1WCJA 3UX2A 3CQ3A 3CQ1A 3UX3A 2JNVA 2M5HA 2Z51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWD A;  1XHJ A;  1TH5 A;  2CU6 A;  3LNO A;  2M5O A;  1VEH A;  3CQ2 A;  1WCJ A;  3UX2 A;  3CQ3 A;  3CQ1 A;  3UX3 A;  2JNV A;  2M5H A;  2Z51 A; 
#chains in the Genus database with same CATH topology
 5CZX A;  1P4E A;  2ATW A;  2MM9 A;  5KEI A;  4LFB C;  1N34 C;  4G37 A;  1TH5 A;  5BUS A;  1V60 A;  4DV0 C;  3J80 D;  4NXN C;  1XS3 A;  2ONF A;  4L2Z A;  5A19 A;  3FCC A;  3N54 B;  5ADZ A;  2UU9 C;  4JI7 C;  3R9W A;  3R44 A;  1XRB A;  1MD9 A;  1T5D X;  4NDN A;  1QWI A;  3TQI A;  2PT7 G;  3GKU A;  4JI3 C;  4OX9 C;  2E8F A;  3EQ6 A;  4PUI A;  3N2Q A;  5A1I A;  3IEV A;  3VNQ A;  1FUG A;  4DV3 C;  4WS9 A;  3UX2 A;  4LF5 C;  1HNX C;  3PES A;  3TR3 A;  3L8C A;  3NYR A;  4U5Y D;  1K0R A;  2QL8 A;  2DHM A;  5LMU C;  3RV2 A;  4X66 C;  4D56 A;  4RMN A;  2QVZ X;  3AF6 A;  1M6X A;  4G1I A;  1MKY A;  3RG2 A;  3DAY A;  1MXA A;  1XHJ A;  3S82 A;  4LF8 C;  1WCJ A;  4JM1 A;  4LF6 C;  1PU1 A;  3A26 A;  3EER A;  1WH9 A;  3UZ0 A;  4DR4 C;  2QVY X;  2ZZN A;  2CU6 A;  5LMN C;  4DCV A;  4I9F A;  2VZE A;  1AMU A;  3GR1 A;  2VQF C;  3JAM D;  3NYQ A;  4BBY A;  3E7X A;  4GXR A;  4PHT A;  3A4I A;  4X62 C;  4RLF A;  1N2F A;  3VNR A;  4B3R C;  1IBL C;  2HHH C;  4NXM C;  5E7Q A;  3NI2 A;  4KTV A;  2MCQ A;  4DV2 C;  4AQY C;  1XNR C;  5KYV A;  4BC7 A;  2YWB A;  4YHH C;  2D1Q A;  4RM3 A;  2XR1 A;  2Y4N A;  2D7V A;  1PG4 A;  2VQE C;  3CQ3 A;  4GXQ A;  3AY0 A;  2DPL A;  3B7W A;  4ZJZ A;  3FCE A;  3NPD A;  4OXI A;  4PRO C;  1HNZ C;  3LNO A;  3T1Y C;  4DG8 A;  4BSZ A;  3J81 D;  1LCI A;  2E0G A;  4JI2 C;  2PN2 A;  4DCS A;  3I07 A;  4DV1 C;  2CY1 A;  2EGT A;  2Y27 A;  4RM2 A;  4RLQ A;  2P20 A;  3CW8 X;  1I94 C;  4DV5 C;  4R0M A;  1MXB A;  1PG3 A;  3LAX A;  5DV9 A;  4GS5 A;  5BUR A;  4DUZ C;  2HJG A;  5IFI A;  1JOS A;  2UUB C;  4FUQ A;  5AE3 A;  3TDE A;  1HNW C;  3UEB A;  4ISB A;  1FJG C;  2D28 C;  4GKJ C;  5JRH A;  2UXC C;  3PBK A;  2KZF A;  1P7L A;  1IBK C;  4DCU A;  2F4V C;  1MDB A;  3CQ1 A;  1RY2 A;  1MXC A;  5FLX D;  4DUY C;  2ASB A;  4BC9 A;  2D1T A;  4JI1 C;  4B3M C;  3C5E A;  2WD9 A;  4B3S C;  4L4Q A;  2E8C A;  3I08 A;  5GTD A;  1T5H X;  5IWA C;  4PUH A;  2ZZM A;  4FUT A;  3CW9 A;  5A1G A;  2P2F A;  4OYC A;  4IR7 A;  1XNQ C;  4RVO A;  2KZ0 A;  4D57 A;  1NY8 A;  1IB8 A;  4XX2 A;  3A9V A;  4JI0 C;  2UXD C;  3O2E A;  3VNS A;  1O90 A;  2P2J A;  4DV7 C;  4YY3 C;  2P2M A;  2YX1 A;  2CXC A;  2Y4O A;  5BSV A;  3CQ2 A;  2PRO A;  1PA4 A;  3ETC A;  4X64 C;  4G36 A;  4MH4 A;  2V7B A;  2D27 A;  3GPC A;  1ZB8 A;  1VLA A;  4PZP A;  2WP0 C;  1ML8 A;  3TUF A;  3UOW A;  4NOZ A;  4JI6 C;  2ZM6 C;  1XMO C;  4X65 C;  4LFA C;  4GKK C;  5LCI A;  3IPL A;  1FLO A;  1UKK A;  2QVX X;  2YCB A;  4DV4 C;  1O92 A;  3LUS A;  4LF7 C;  1NYE A;  4JI8 C;  2P02 A;  1BA3 A;  2E8E A;  5IT9 D;  1IBM C;  1YJ7 A;  1RG9 A;  2M5O A;  3ETO A;  4IZ6 A;  4DCT A;  3SO4 A;  2UUA C;  1UWD A;  1L2F A;  3L95 X;  3H2T A;  4TPS B;  5BSM A;  3R9X A;  2OBV A;  2VSQ A;  3IEU A;  4DR2 C;  4K0K C;  4DR7 C;  4R1M A;  3LNV A;  4LFC C;  2BH1 X;  2DYJ A;  1GPM A;  1P4E C;  3DHV A;  1N32 C;  5BSR A;  4HPV A;  3IML A;  5BUQ A;  4ODJ A;  1XMQ C;  3K6R A;  4R1L A;  1ZB9 A;  3UX3 A;  5T8T A;  2UUC C;  3T1H C;  2OPL B;  1HR0 C;  3DLP X;  3LGX A;  2JNV A;  4B3T C;  5BSU A;  2UXB C;  2OPL A;  5CZV A;  3E7W A;  2AYA A;  5BST A;  3A25 A;  3AF5 A;  4BCA A;  2P2B A;  5KYT A;  1USP B;  3PRO C;  2P2Q A;  2E5L C;  1USP A;  1LQL A;  2QW0 X;  3A9U A;  3G7S A;  1XRC A;  5H9U A;  4RVN A;  1N33 C;  4DR3 C;  4K0B A;  4JI5 C;  5AE1 A;  2YWC A;  4L7I A;  4LE5 A;  1VEH A;  3CJE A;  2BJO A;  4EAT A;  4JV5 C;  1V26 A;  4JI4 C;  4DR6 C;  5AE2 A;  2MMA B;  4DV6 C;  5BSW A;  4WV3 A;  5K8F A;  1O9T A;  4KHP C;  4PUG A;  3OTO C;  2D1R A;  2E7G A;  1M6X C;  1N36 C;  3KXW A;  2OO4 A;  4JYA C;  4D4G A;  4FTF A;  2Z51 A;  2JMP A;  4ZLP A;  1ULT A;  2D1S A;  1J5E C;  1KKG A;  1V25 A;  2KDN A;  5K85 A;  5BR8 C;  1WF3 A;  1QM4 A;  1EGA A;  1MDF A;  1HH2 P;  3GR0 A;  4LF9 C;  4I9G A;  4MTN A;  4DR1 C;  4D4I A;  4LF4 C;  1XRA A;  5A2Q D;  4DG9 A;  4DR5 C;  4KTT A;  2NCL A;  5T8S A;  1O93 A;  2M5H A; 
#chains in the Genus database with same CATH homology
 1UWD A;  1XHJ A;  1TH5 A;  2CU6 A;  3LNO A;  2M5O A;  1VEH A;  3CQ2 A;  1WCJ A;  3UX2 A;  3CQ3 A;  3CQ1 A;  3UX3 A;  2JNV A;  2M5H A;  2Z51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...