1UWDA

Nmr structure of a protein with unknown function from thermotoga maritima (tm0487), which belongs to the duf59 family.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords HYPOTHETICAL PROTEIN TM0487
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1uwdA00
1UWDA 1TH5A 1XHJA 3UX2A 2JNVA 2CU6A 1WCJA 2Z51A 3LNOA 2M5OA 3CQ3A 1VEHA 3CQ1A 2M5HA 3CQ2A 3UX3A
chains in the Genus database with same CATH superfamily
5AE1A 2D7VA 1N34C 1JOSA 2Y4OA 5T8TA 3OTOC 1LQLA 1RG9A 3CQ2A 2E7GA 5GTDA 3AF6A 4DV1C 3LGXA 4EATA 2DPLA 2E8CA 1ULTA 2CY1A 3G7SA 3K6RA 5BURA 2QVXX 4DR1C 2E8FA 3GR0A 4LFBC 1FUGA 4GS5A 4JI4C 4TPSB 1HR0C 2UU9C 1XMOC 4GXQA 1GPMA 5T8SA 4WS9A 4RVOA 4U5YD 3GPCA 4FUQA 3TQIA 4I9FA 4PUGA 2JNVA 5JRHA 2P2FA 4NXNC 3ETCA 3I08A 5A19A 3L8CA 3IEVA 3T1YC 1UWDA 2UXCC 2CXCA 1USPB 3GR1A 1T5HX 4DR6C 4IZ6A 4X66C 2ZM6C 4DV7C 4PROC 3IEUA 3AF5A 4JI7C 1MXBA 2WP0C 4K0BA 4R1MA 1HNWC 1T5DX 5BSMA 1K0RA 3N2QA 5E7QA 1KKGA 4DV2C 3LAXA 4DG9A 1XNQC 4DR2C 3AY0A 4BBYA 1LCIA 2HHHC 2PROA 4DR7C 3TR3A 5A1IA 3A26A 4R1LA 3VNSA 2KZFA 3KXWA 2HJGA 3LNOA 5KYTA 3RV2A 1O90A 1NYEA 4RMNA 4HPVA 2YWBA 3UOWA 1IBMC 4G1IA 3UX2A 2Y27A 2VQFC 4JYAC 2CU6A 2VSQA 1EGAA 5KEIA 3B7WA 4FTFA 5CZVA 1XRCA 2D28C 2V7BA 2AYAA 2KZ0A 4MTNA 5FLXD 3NI2A 2QL8A 1XRBA 4DCSA 2D27A 2JMPA 1VLAA 3NPDA 3H2TA 1ZB9A 4FUTA 4JI5C 4DV4C 4JI1C 4JI8C 2P2MA 1MDFA 5BSVA 3TUFA 1IBLC 5H9UA 4NDNA 2D1SA 5IT9D 5IFIA 2E5LC 1O92A 4G36A 4LF6C 2OPLA 2VQEC 5LMNC 4YHHC 3UZ0A 2BH1X 5DV9A 2KDNA 4R0MA 2ZZMA 3A25A 3CJEA 3IMLA 4D4GA 1HNXC 1I94C 3R44A 2UXDC 5KYVA 1WH9A 4K0KC 4JI6C 2QVYX 4JI2C 3FCEA 4RLFA 5K8FA 1BA3A 3LNVA 4LF7C 2YWCA 1V25A 2MCQA 4I9GA 1M6XA 3UX3A 1YJ7A 3A9UA 3CW9A 1ZB8A 4DV5C 1VEHA 4DUZC 3J81D 4DR5C 2PN2A 4D4IA 4ZLPA 3CQ1A 3R9XA 1PU1A 5K85A 1O93A 4DG8A 3RG2A 5IWAC 2P20A 3DHVA 1O9TA 4BSZA 1UKKA 3IPLA 3C5EA 4B3SC 3O2EA 4L2ZA 1HH2P 3EQ6A 3DAYA 2EGTA 5BUSA 1XRAA 4GKJC 4NXMC 2UUBC 4DCVA 2PT7G 1V60A 3CW8X 1MXCA 2ONFA 4DCTA 4RM3A 3UEBA 5BUQA 4JI3C 3EERA 2M5HA 4MH4A 4WV3A 4ISBA 1V26A 3VNQA 4X62C 2ZZNA 1XS3A 2DHMA 1M6XC 2D1TA 3N54B 3SO4A 1RY2A 3DLPX 4PZPA 4DCUA 3PROC 1XNRC 2P02A 4KTTA 3JAMD 3J80D 4IR7A 3GKUA 1USPA 4RVNA 2DYJA 1N33C 3I07A 2E8EA 1NY8A 4LE5A 2OBVA 1XHJA 5AE2A 2Y4NA 2ASBA 2P2JA 1P4EA 3VNRA 1P7LA 3FCCA 2NCLA 4PUIA 2YX1A 2UUAC 3PESA 4GXRA 2XR1A 4L4QA 2BJOA 4DV3C 4LF8C 4X65C 3R9WA 2YCBA 1J5EC 4ZJZA 1N32C 4G37A 4NOZA 4D57A 3CQ3A 1ML8A 4LFAC 1IB8A 2QVZX 3E7WA 2D1RA 4B3TC 1MKYA 4D56A 4GKKC 5CZXA 5BSUA 2MM9A 3NYQA 3TDEA 3ETOA 4OYCA 3T1HC 4OXIA 4DV6C 5BR8C 1WCJA 2Z51A 2M5OA 2UXBC 1XMQC 4JM1A 4B3RC 2QW0X 4DR4C 4BC7A 4YY3C 1PG4A 4BCAA 2F4VC 3A9VA 3A4IA 4PHTA 1WF3A 4ODJA 1N36C 5LCIA 4AQYC 4B3MC 4LF9C 4LFCC 2E0GA 4LF5C 4PUHA 1PG3A 4RM2A 1P4EC 4X64C 3LUSA 2OPLB 4KTVA 1MD9A 1TH5A 4LF4C 2VZEA 4JI0C 3S82A 4JV5C 1FJGC 2ATWA 1N2FA 5A1GA 3L95X 1AMUA 1L2FA 2WD9A 4RLQA 5BSRA 4DUYC 3NYRA 3E7XA 2UUCC 1QM4A 5AE3A 1HNZC 1MXAA 2OO4A 2P2QA 1IBKC 5BSWA 5LMUC 4BC9A 2P2BA 2MMAB 4OX9C 3PBKA 4XX2A 2D1QA 1FLOA 4KHPC 4L7IA 4DV0C 4DR3C 5A2QD 1QWIA 5BSTA 1MDBA 1PA4A 5ADZA
chains in the Genus database with same CATH topology
1UWDA 1TH5A 1XHJA 3UX2A 2JNVA 2CU6A 1WCJA 2Z51A 3LNOA 2M5OA 3CQ3A 1VEHA 3CQ1A 2M5HA 3CQ2A 3UX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWD A;  1TH5 A;  1XHJ A;  3UX2 A;  2JNV A;  2CU6 A;  1WCJ A;  2Z51 A;  3LNO A;  2M5O A;  3CQ3 A;  1VEH A;  3CQ1 A;  2M5H A;  3CQ2 A;  3UX3 A; 
#chains in the Genus database with same CATH topology
 5AE1 A;  2D7V A;  1N34 C;  1JOS A;  2Y4O A;  5T8T A;  3OTO C;  1LQL A;  1RG9 A;  3CQ2 A;  2E7G A;  5GTD A;  3AF6 A;  4DV1 C;  3LGX A;  4EAT A;  2DPL A;  2E8C A;  1ULT A;  2CY1 A;  3G7S A;  3K6R A;  5BUR A;  2QVX X;  4DR1 C;  2E8F A;  3GR0 A;  4LFB C;  1FUG A;  4GS5 A;  4JI4 C;  4TPS B;  1HR0 C;  2UU9 C;  1XMO C;  4GXQ A;  1GPM A;  5T8S A;  4WS9 A;  4RVO A;  4U5Y D;  3GPC A;  4FUQ A;  3TQI A;  4I9F A;  4PUG A;  2JNV A;  5JRH A;  2P2F A;  4NXN C;  3ETC A;  3I08 A;  5A19 A;  3L8C A;  3IEV A;  3T1Y C;  1UWD A;  2UXC C;  2CXC A;  1USP B;  3GR1 A;  1T5H X;  4DR6 C;  4IZ6 A;  4X66 C;  2ZM6 C;  4DV7 C;  4PRO C;  3IEU A;  3AF5 A;  4JI7 C;  1MXB A;  2WP0 C;  4K0B A;  4R1M A;  1HNW C;  1T5D X;  5BSM A;  1K0R A;  3N2Q A;  5E7Q A;  1KKG A;  4DV2 C;  3LAX A;  4DG9 A;  1XNQ C;  4DR2 C;  3AY0 A;  4BBY A;  1LCI A;  2HHH C;  2PRO A;  4DR7 C;  3TR3 A;  5A1I A;  3A26 A;  4R1L A;  3VNS A;  2KZF A;  3KXW A;  2HJG A;  3LNO A;  5KYT A;  3RV2 A;  1O90 A;  1NYE A;  4RMN A;  4HPV A;  2YWB A;  3UOW A;  1IBM C;  4G1I A;  3UX2 A;  2Y27 A;  2VQF C;  4JYA C;  2CU6 A;  2VSQ A;  1EGA A;  5KEI A;  3B7W A;  4FTF A;  5CZV A;  1XRC A;  2D28 C;  2V7B A;  2AYA A;  2KZ0 A;  4MTN A;  5FLX D;  3NI2 A;  2QL8 A;  1XRB A;  4DCS A;  2D27 A;  2JMP A;  1VLA A;  3NPD A;  3H2T A;  1ZB9 A;  4FUT A;  4JI5 C;  4DV4 C;  4JI1 C;  4JI8 C;  2P2M A;  1MDF A;  5BSV A;  3TUF A;  1IBL C;  5H9U A;  4NDN A;  2D1S A;  5IT9 D;  5IFI A;  2E5L C;  1O92 A;  4G36 A;  4LF6 C;  2OPL A;  2VQE C;  5LMN C;  4YHH C;  3UZ0 A;  2BH1 X;  5DV9 A;  2KDN A;  4R0M A;  2ZZM A;  3A25 A;  3CJE A;  3IML A;  4D4G A;  1HNX C;  1I94 C;  3R44 A;  2UXD C;  5KYV A;  1WH9 A;  4K0K C;  4JI6 C;  2QVY X;  4JI2 C;  3FCE A;  4RLF A;  5K8F A;  1BA3 A;  3LNV A;  4LF7 C;  2YWC A;  1V25 A;  2MCQ A;  4I9G A;  1M6X A;  3UX3 A;  1YJ7 A;  3A9U A;  3CW9 A;  1ZB8 A;  4DV5 C;  1VEH A;  4DUZ C;  3J81 D;  4DR5 C;  2PN2 A;  4D4I A;  4ZLP A;  3CQ1 A;  3R9X A;  1PU1 A;  5K85 A;  1O93 A;  4DG8 A;  3RG2 A;  5IWA C;  2P20 A;  3DHV A;  1O9T A;  4BSZ A;  1UKK A;  3IPL A;  3C5E A;  4B3S C;  3O2E A;  4L2Z A;  1HH2 P;  3EQ6 A;  3DAY A;  2EGT A;  5BUS A;  1XRA A;  4GKJ C;  4NXM C;  2UUB C;  4DCV A;  2PT7 G;  1V60 A;  3CW8 X;  1MXC A;  2ONF A;  4DCT A;  4RM3 A;  3UEB A;  5BUQ A;  4JI3 C;  3EER A;  2M5H A;  4MH4 A;  4WV3 A;  4ISB A;  1V26 A;  3VNQ A;  4X62 C;  2ZZN A;  1XS3 A;  2DHM A;  1M6X C;  2D1T A;  3N54 B;  3SO4 A;  1RY2 A;  3DLP X;  4PZP A;  4DCU A;  3PRO C;  1XNR C;  2P02 A;  4KTT A;  3JAM D;  3J80 D;  4IR7 A;  3GKU A;  1USP A;  4RVN A;  2DYJ A;  1N33 C;  3I07 A;  2E8E A;  1NY8 A;  4LE5 A;  2OBV A;  1XHJ A;  5AE2 A;  2Y4N A;  2ASB A;  2P2J A;  1P4E A;  3VNR A;  1P7L A;  3FCC A;  2NCL A;  4PUI A;  2YX1 A;  2UUA C;  3PES A;  4GXR A;  2XR1 A;  4L4Q A;  2BJO A;  4DV3 C;  4LF8 C;  4X65 C;  3R9W A;  2YCB A;  1J5E C;  4ZJZ A;  1N32 C;  4G37 A;  4NOZ A;  4D57 A;  3CQ3 A;  1ML8 A;  4LFA C;  1IB8 A;  2QVZ X;  3E7W A;  2D1R A;  4B3T C;  1MKY A;  4D56 A;  4GKK C;  5CZX A;  5BSU A;  2MM9 A;  3NYQ A;  3TDE A;  3ETO A;  4OYC A;  3T1H C;  4OXI A;  4DV6 C;  5BR8 C;  1WCJ A;  2Z51 A;  2M5O A;  2UXB C;  1XMQ C;  4JM1 A;  4B3R C;  2QW0 X;  4DR4 C;  4BC7 A;  4YY3 C;  1PG4 A;  4BCA A;  2F4V C;  3A9V A;  3A4I A;  4PHT A;  1WF3 A;  4ODJ A;  1N36 C;  5LCI A;  4AQY C;  4B3M C;  4LF9 C;  4LFC C;  2E0G A;  4LF5 C;  4PUH A;  1PG3 A;  4RM2 A;  1P4E C;  4X64 C;  3LUS A;  2OPL B;  4KTV A;  1MD9 A;  1TH5 A;  4LF4 C;  2VZE A;  4JI0 C;  3S82 A;  4JV5 C;  1FJG C;  2ATW A;  1N2F A;  5A1G A;  3L95 X;  1AMU A;  1L2F A;  2WD9 A;  4RLQ A;  5BSR A;  4DUY C;  3NYR A;  3E7X A;  2UUC C;  1QM4 A;  5AE3 A;  1HNZ C;  1MXA A;  2OO4 A;  2P2Q A;  1IBK C;  5BSW A;  5LMU C;  4BC9 A;  2P2B A;  2MMA B;  4OX9 C;  3PBK A;  4XX2 A;  2D1Q A;  1FLO A;  4KHP C;  4L7I A;  4DV0 C;  4DR3 C;  5A2Q D;  1QWI A;  5BST A;  1MDB A;  1PA4 A;  5ADZ A; 
#chains in the Genus database with same CATH homology
 1UWD A;  1TH5 A;  1XHJ A;  3UX2 A;  2JNV A;  2CU6 A;  1WCJ A;  2Z51 A;  3LNO A;  2M5O A;  3CQ3 A;  1VEH A;  3CQ1 A;  2M5H A;  3CQ2 A;  3UX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...