1UWDA

Nmr structure of a protein with unknown function from thermotoga maritima (tm0487), which belongs to the duf59 family.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Biosynthetic protein
molecule keywords HYPOTHETICAL PROTEIN TM0487
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1uwdA00
2CU6A 3CQ1A 2M5OA 1WCJA 1TH5A 2M5HA 1XHJA 3CQ2A 3CQ3A 3UX3A 3UX2A 2Z51A 1VEHA 1UWDA 2JNVA 3LNOA
chains in the Genus database with same CATH superfamily
3I08A 3AY0A 2VZEA 5IFIA 1M6XA 5GTDA 2VQEC 1V26A 4DG8A 4XX2A 4GKJC 5BSWA 1WF3A 4DR3C 3RV2A 4KTVA 1I94C 2V7BA 2VQFC 1P7LA 4GXRA 2EGTA 4ZLPA 1MD9A 4K0BA 3S82A 5BUQA 2UXBC 2YWBA 1YJ7A 5BSTA 3IEVA 4WV3A 2VSQA 1USPB 4DR6C 4D56A 1P4EC 3DLPX 1RG9A 2D1SA 1IBKC 3GPCA 4D4IA 4PUHA 2QL8A 4I9GA 2E8CA 3IMLA 3LNOA 3NPDA 4LF8C 5AE2A 4DUYC 2F4VC 5CZVA 4BC9A 5FLXD 4KHPC 1HNZC 4DCTA 3GKUA 4JI0C 2OPLB 4OYCA 3E7XA 2M5HA 2ZZMA 3CQ3A 2UXCC 4G37A 5IWAC 3N54B 2BH1X 4L2ZA 1XNQC 4MTNA 5A1GA 1MDBA 3LNVA 2E5LC 3LAXA 3FCEA 1XNRC 1T5DX 4B3MC 5LMUC 4JI3C 4DV5C 1XRCA 5BURA 4LFBC 4RM2A 1XMQC 1WH9A 1NY8A 3NYQA 4IZ6A 4JI1C 4L7IA 4LE5A 4EATA 3J81D 1LQLA 3E7WA 2HHHC 2PROA 3R44A 4DCUA 2MM9A 4LF6C 2Z51A 3LGXA 3RG2A 5AE1A 3ETCA 4X64C 2WD9A 4DUZC 3I07A 4JV5C 3EQ6A 4DR4C 2P2JA 4DCSA 4RVNA 1VEHA 3VNSA 5BSRA 1TH5A 4X65C 1HNWC 1K0RA 1KKGA 2HJGA 2OBVA 3VNQA 3PROC 2CY1A 3TUFA 2XR1A 1ML8A 3B7WA 3CJEA 3UOWA 1UKKA 4YY3C 4JI2C 2M5OA 4DR2C 5KYTA 1N2FA 3A26A 1O90A 3CW9A 2OPLA 4GKKC 5CZXA 5ADZA 4TPSB 2ASBA 2KZ0A 2JNVA 4LFCC 3R9WA 1MDFA 4BBYA 5LMNC 3L8CA 4DV4C 2D28C 2OO4A 1FUGA 1NYEA 2CXCA 2AYAA 1V25A 4GS5A 2Y4OA 4L4QA 1IB8A 2P20A 4NOZA 2UUCC 5A19A 1UWDA 2PN2A 3NI2A 1HR0C 3A9UA 3GR0A 4PHTA 5JRHA 4PROC 3JAMD 3T1YC 1V60A 2ATWA 1PA4A 4DV1C 4DV2C 2E0GA 2D27A 5KYVA 3TQIA 1PG3A 3EERA 4JI5C 4OX9C 4R1MA 3ETOA 4X62C 5BSUA 5A2QD 1XMOC 2ZM6C 4K0KC 3A9VA 4B3SC 2KDNA 3H2TA 5BSVA 1ULTA 4DV0C 2QVYX 1RY2A 3AF5A 4ZJZA 5BUSA 4FUQA 2KZFA 2PT7G 4RLQA 2MCQA 1XS3A 4JI6C 4OXIA 4RLFA 2ONFA 3DAYA 1T5HX 2QVZX 4JI7C 2E8FA 4GXQA 2WP0C 1O93A 1QM4A 1M6XC 5K85A 1N32C 4NXMC 4G1IA 4HPVA 3VNRA 3NYRA 4JM1A 2YX1A 5T8TA 2UU9C 1J5EC 3CQ2A 2P2BA 4LF4C 3UX2A 4DCVA 4B3RC 1P4EA 3CQ1A 3SO4A 3O2EA 3FCCA 4DR1C 1XHJA 4PZPA 1EGAA 2QW0X 4LFAC 3AF6A 4PUIA 1VLAA 1PU1A 4BCAA 3DHVA 1AMUA 3C5EA 4JYAC 5IT9D 1N34C 3IPLA 4MH4A 4D57A 5LCIA 1L2FA 3TDEA 4LF7C 2E8EA 4LF9C 5AE3A 2UUAC 2Y27A 4AQYC 3R9XA 1FJGC 5T8SA 3K6RA 4D4GA 1JOSA 2P2MA 4ODJA 4JI4C 4RM3A 4X66C 3N2QA 1N36C 3IEUA 2DHMA 4BSZA 2UUBC 4PUGA 3UEBA 1MXBA 2JMPA 4G36A 4ISBA 1IBLC 1XRAA 1PG4A 4LF5C 3OTOC 3LUSA 1BA3A 1GPMA 5H9UA 3A25A 4DV6C 3PBKA 1MXCA 1MXAA 2CU6A 2D1TA 1IBMC 3J80D 3L95X 2BJOA 2YWCA 3G7SA 4R0MA 2DYJA 4U5YD 2YCBA 4FUTA 4DV7C 5E7QA 1O9TA 4FTFA 2P2QA 1HNXC 2D1RA 5KEIA 5DV9A 4B3TC 4DR7C 1FLOA 3T1HC 5BSMA 2NCLA 4DR5C 2Y4NA 3TR3A 2MMAB 2ZZNA 3KXWA 4NDNA 2D1QA 4DG9A 1O92A 3GR1A 4R1LA 3UX3A 3PESA 2UXDC 2E7GA 4NXNC 1QWIA 2DPLA 2P02A 3CW8X 4RMNA 5A1IA 1MKYA 2D7VA 4KTTA 4JI8C 4WS9A 1ZB9A 4I9FA 2QVXX 1USPA 1WCJA 1ZB8A 4RVOA 1XRBA 5K8FA 1N33C 4IR7A 4DV3C 4YHHC 1HH2P 3UZ0A 4BC7A 5BR8C 1LCIA 2P2FA 3A4IA
chains in the Genus database with same CATH topology
2CU6A 3CQ1A 2M5OA 1WCJA 1TH5A 2M5HA 1XHJA 3CQ2A 3CQ3A 3UX3A 3UX2A 2Z51A 1VEHA 1UWDA 2JNVA 3LNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU6 A;  3CQ1 A;  2M5O A;  1WCJ A;  1TH5 A;  2M5H A;  1XHJ A;  3CQ2 A;  3CQ3 A;  3UX3 A;  3UX2 A;  2Z51 A;  1VEH A;  1UWD A;  2JNV A;  3LNO A; 
#chains in the Genus database with same CATH topology
 3I08 A;  3AY0 A;  2VZE A;  5IFI A;  1M6X A;  5GTD A;  2VQE C;  1V26 A;  4DG8 A;  4XX2 A;  4GKJ C;  5BSW A;  1WF3 A;  4DR3 C;  3RV2 A;  4KTV A;  1I94 C;  2V7B A;  2VQF C;  1P7L A;  4GXR A;  2EGT A;  4ZLP A;  1MD9 A;  4K0B A;  3S82 A;  5BUQ A;  2UXB C;  2YWB A;  1YJ7 A;  5BST A;  3IEV A;  4WV3 A;  2VSQ A;  1USP B;  4DR6 C;  4D56 A;  1P4E C;  3DLP X;  1RG9 A;  2D1S A;  1IBK C;  3GPC A;  4D4I A;  4PUH A;  2QL8 A;  4I9G A;  2E8C A;  3IML A;  3LNO A;  3NPD A;  4LF8 C;  5AE2 A;  4DUY C;  2F4V C;  5CZV A;  4BC9 A;  5FLX D;  4KHP C;  1HNZ C;  4DCT A;  3GKU A;  4JI0 C;  2OPL B;  4OYC A;  3E7X A;  2M5H A;  2ZZM A;  3CQ3 A;  2UXC C;  4G37 A;  5IWA C;  3N54 B;  2BH1 X;  4L2Z A;  1XNQ C;  4MTN A;  5A1G A;  1MDB A;  3LNV A;  2E5L C;  3LAX A;  3FCE A;  1XNR C;  1T5D X;  4B3M C;  5LMU C;  4JI3 C;  4DV5 C;  1XRC A;  5BUR A;  4LFB C;  4RM2 A;  1XMQ C;  1WH9 A;  1NY8 A;  3NYQ A;  4IZ6 A;  4JI1 C;  4L7I A;  4LE5 A;  4EAT A;  3J81 D;  1LQL A;  3E7W A;  2HHH C;  2PRO A;  3R44 A;  4DCU A;  2MM9 A;  4LF6 C;  2Z51 A;  3LGX A;  3RG2 A;  5AE1 A;  3ETC A;  4X64 C;  2WD9 A;  4DUZ C;  3I07 A;  4JV5 C;  3EQ6 A;  4DR4 C;  2P2J A;  4DCS A;  4RVN A;  1VEH A;  3VNS A;  5BSR A;  1TH5 A;  4X65 C;  1HNW C;  1K0R A;  1KKG A;  2HJG A;  2OBV A;  3VNQ A;  3PRO C;  2CY1 A;  3TUF A;  2XR1 A;  1ML8 A;  3B7W A;  3CJE A;  3UOW A;  1UKK A;  4YY3 C;  4JI2 C;  2M5O A;  4DR2 C;  5KYT A;  1N2F A;  3A26 A;  1O90 A;  3CW9 A;  2OPL A;  4GKK C;  5CZX A;  5ADZ A;  4TPS B;  2ASB A;  2KZ0 A;  2JNV A;  4LFC C;  3R9W A;  1MDF A;  4BBY A;  5LMN C;  3L8C A;  4DV4 C;  2D28 C;  2OO4 A;  1FUG A;  1NYE A;  2CXC A;  2AYA A;  1V25 A;  4GS5 A;  2Y4O A;  4L4Q A;  1IB8 A;  2P20 A;  4NOZ A;  2UUC C;  5A19 A;  1UWD A;  2PN2 A;  3NI2 A;  1HR0 C;  3A9U A;  3GR0 A;  4PHT A;  5JRH A;  4PRO C;  3JAM D;  3T1Y C;  1V60 A;  2ATW A;  1PA4 A;  4DV1 C;  4DV2 C;  2E0G A;  2D27 A;  5KYV A;  3TQI A;  1PG3 A;  3EER A;  4JI5 C;  4OX9 C;  4R1M A;  3ETO A;  4X62 C;  5BSU A;  5A2Q D;  1XMO C;  2ZM6 C;  4K0K C;  3A9V A;  4B3S C;  2KDN A;  3H2T A;  5BSV A;  1ULT A;  4DV0 C;  2QVY X;  1RY2 A;  3AF5 A;  4ZJZ A;  5BUS A;  4FUQ A;  2KZF A;  2PT7 G;  4RLQ A;  2MCQ A;  1XS3 A;  4JI6 C;  4OXI A;  4RLF A;  2ONF A;  3DAY A;  1T5H X;  2QVZ X;  4JI7 C;  2E8F A;  4GXQ A;  2WP0 C;  1O93 A;  1QM4 A;  1M6X C;  5K85 A;  1N32 C;  4NXM C;  4G1I A;  4HPV A;  3VNR A;  3NYR A;  4JM1 A;  2YX1 A;  5T8T A;  2UU9 C;  1J5E C;  3CQ2 A;  2P2B A;  4LF4 C;  3UX2 A;  4DCV A;  4B3R C;  1P4E A;  3CQ1 A;  3SO4 A;  3O2E A;  3FCC A;  4DR1 C;  1XHJ A;  4PZP A;  1EGA A;  2QW0 X;  4LFA C;  3AF6 A;  4PUI A;  1VLA A;  1PU1 A;  4BCA A;  3DHV A;  1AMU A;  3C5E A;  4JYA C;  5IT9 D;  1N34 C;  3IPL A;  4MH4 A;  4D57 A;  5LCI A;  1L2F A;  3TDE A;  4LF7 C;  2E8E A;  4LF9 C;  5AE3 A;  2UUA C;  2Y27 A;  4AQY C;  3R9X A;  1FJG C;  5T8S A;  3K6R A;  4D4G A;  1JOS A;  2P2M A;  4ODJ A;  4JI4 C;  4RM3 A;  4X66 C;  3N2Q A;  1N36 C;  3IEU A;  2DHM A;  4BSZ A;  2UUB C;  4PUG A;  3UEB A;  1MXB A;  2JMP A;  4G36 A;  4ISB A;  1IBL C;  1XRA A;  1PG4 A;  4LF5 C;  3OTO C;  3LUS A;  1BA3 A;  1GPM A;  5H9U A;  3A25 A;  4DV6 C;  3PBK A;  1MXC A;  1MXA A;  2CU6 A;  2D1T A;  1IBM C;  3J80 D;  3L95 X;  2BJO A;  2YWC A;  3G7S A;  4R0M A;  2DYJ A;  4U5Y D;  2YCB A;  4FUT A;  4DV7 C;  5E7Q A;  1O9T A;  4FTF A;  2P2Q A;  1HNX C;  2D1R A;  5KEI A;  5DV9 A;  4B3T C;  4DR7 C;  1FLO A;  3T1H C;  5BSM A;  2NCL A;  4DR5 C;  2Y4N A;  3TR3 A;  2MMA B;  2ZZN A;  3KXW A;  4NDN A;  2D1Q A;  4DG9 A;  1O92 A;  3GR1 A;  4R1L A;  3UX3 A;  3PES A;  2UXD C;  2E7G A;  4NXN C;  1QWI A;  2DPL A;  2P02 A;  3CW8 X;  4RMN A;  5A1I A;  1MKY A;  2D7V A;  4KTT A;  4JI8 C;  4WS9 A;  1ZB9 A;  4I9F A;  2QVX X;  1USP A;  1WCJ A;  1ZB8 A;  4RVO A;  1XRB A;  5K8F A;  1N33 C;  4IR7 A;  4DV3 C;  4YHH C;  1HH2 P;  3UZ0 A;  4BC7 A;  5BR8 C;  1LCI A;  2P2F A;  3A4I A; 
#chains in the Genus database with same CATH homology
 2CU6 A;  3CQ1 A;  2M5O A;  1WCJ A;  1TH5 A;  2M5H A;  1XHJ A;  3CQ2 A;  3CQ3 A;  3UX3 A;  3UX2 A;  2Z51 A;  1VEH A;  1UWD A;  2JNV A;  3LNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...