1UWDA

Nmr structure of a protein with unknown function from thermotoga maritima (tm0487), which belongs to the duf59 family.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN TM0487
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Biosynthetic protein
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1uwdA00
1VEHA 1UWDA 2JNVA 1TH5A 2M5OA 3LNOA 1WCJA 3UX2A 2M5HA 3CQ1A 3CQ2A 1XHJA 3CQ3A 2Z51A 2CU6A 3UX3A
chains in the Genus database with same CATH superfamily
1XNQC 2QW0X 1USPA 2E5LC 2VQFC 4DR1C 5BSVA 2HJGA 2ZZMA 1FLOA 5BSMA 2YWCA 5BR8C 1WH9A 4X62C 3CW8X 4BSZA 4RMNA 3VNRA 1HH2P 5GTDA 2P2BA 4X66C 2P2FA 4RVNA 1USPB 1O92A 2WP0C 3CQ2A 3LNVA 4GKKC 2BH1X 1P4EA 4YY3C 2OPLB 3N2QA 4JV5C 1XRBA 5A19A 3TDEA 2UUAC 3LUSA 4ISBA 4DG9A 4B3TC 4RVOA 2BJOA 2EGTA 4NXNC 4DV5C 5BUSA 4I9FA 2UUCC 5H9UA 5E7QA 1ZB9A 4PROC 5FLXD 1MD9A 4L4QA 5LMNC 5K85A 2AYAA 2KZFA 2CXCA 3NPDA 5IT9D 3C5EA 1MDBA 1FJGC 1V25A 1IBMC 2E7GA 3GKUA 3I07A 2M5HA 3JAMD 1HNXC 4GS5A 2KZ0A 1FUGA 3CJEA 3UOWA 1N32C 3LAXA 2E8EA 4PZPA 4DR7C 2D1TA 4X64C 2D28C 1HR0C 2MMAB 4DCVA 5KYVA 3NYQA 5BUQA 4DR2C 4KHPC 4OXIA 3A26A 3FCEA 4DV7C 3AY0A 1NYEA 4GXRA 3H2TA 4JI3C 5JRHA 2PN2A 3DLPX 4WS9A 4JI2C 1ML8A 2F4VC 2MCQA 1NY8A 3IEUA 4K0KC 1HNZC 1N33C 4DR4C 4DG8A 3PBKA 2P2QA 4ZLPA 2JNVA 4G1IA 2E8CA 4LF6C 4G36A 4KTVA 1LCIA 4OYCA 4GXQA 4PHTA 4PUIA 4DUZC 4FTFA 4G37A 4LF5C 3S82A 4D4GA 2D27A 1HNWC 4DV0C 4D4IA 1QWIA 2OPLA 3UX2A 2UXBC 1VEHA 4RLFA 1XS3A 3OTOC 4DR5C 3A25A 3TR3A 4BC7A 5CZVA 2ZZNA 3A9UA 4XX2A 5BSTA 4MTNA 4LFAC 1T5HX 1MKYA 2YX1A 3UEBA 1XNRC 2DHMA 2D1SA 2UUBC 2XR1A 4OX9C 4HPVA 4ODJA 3L95X 4RLQA 3VNSA 1PU1A 4NXMC 5KYTA 4ZJZA 4L2ZA 2ONFA 3LNOA 3E7WA 4BBYA 4B3MC 4DV1C 5DV9A 3PESA 2DYJA 3G7SA 4LF4C 3T1HC 5AE3A 3TUFA 2Y4NA 1YJ7A 3J81D 4B3SC 2YWBA 5BSRA 4R0MA 5BSWA 1BA3A 4B3RC 5LMUC 3A9VA 5AE1A 4YHHC 4R1MA 3VNQA 3CQ3A 4LF8C 4DR6C 4BC9A 2KDNA 1XMQC 3GR0A 4GKJC 4JM1A 4BCAA 3RV2A 2V7BA 1RG9A 3R44A 2VZEA 2UXCC 1TH5A 3R9XA 4AQYC 1PA4A 1PG3A 4EATA 2CY1A 4DCUA 4DV6C 1RY2A 5K8FA 1KKGA 1N36C 2NCLA 4MH4A 4JI1C 1XMOC 2D7VA 3R9WA 1M6XC 5LCIA 4DV4C 1I94C 4LFBC 4FUTA 5BSUA 3RG2A 3CW9A 1JOSA 1MDFA 4JI6C 1M6XA 3DHVA 1UKKA 3EERA 1UWDA 4RM3A 1J5EC 3A4IA 1XHJA 1ULTA 4JI5C 1O90A 1AMUA 5BURA 1XRCA 2VSQA 2MM9A 2CU6A 3ETCA 3EQ6A 5T8SA 3GPCA 4DUYC 4JI7C 3PROC 4DV2C 1IBKC 1VLAA 3E7XA 4DCSA 2Y27A 4JI8C 3NI2A 4WV3A 1O93A 2QL8A 4NDNA 4LE5A 2DPLA 2OBVA 3K6RA 5CZXA 1P4EC 1WF3A 2WD9A 1O9TA 4U5YD 1V60A 1EGAA 4D57A 2E0GA 3B7WA 4DR3C 2P02A 5A1IA 2Y4OA 1V26A 1WCJA 4R1LA 2QVXX 3UX3A 3T1YC 3L8CA 3AF6A 3J80D 4I9GA 2D1QA 2YCBA 1MXCA 4LF7C 4RM2A 2ASBA 4DV3C 1GPMA 1PG4A 2P20A 4JI0C 2PT7G 3SO4A 4FUQA 4KTTA 2QVZX 5A1GA 1XRAA 1LQLA 3IMLA 1P7LA 1IB8A 1K0RA 2HHHC 2UU9C 2E8FA 4DCTA 4NOZA 2JMPA 2P2MA 4D56A 4K0BA 2ATWA 2D1RA 4JYAC 1QM4A 3LGXA 3CQ1A 3AF5A 1MXBA 4L7IA 4PUGA 2OO4A 3IPLA 3N54B 3FCCA 3I08A 5IWAC 2PROA 2P2JA 3GR1A 4PUHA 1IBLC 4X65C 4JI4C 1N2FA 1ZB8A 2ZM6C 1MXAA 3TQIA 2QVYX 5ADZA 3O2EA 1T5DX 3ETOA 4LF9C 5IFIA 2Z51A 2UXDC 4IR7A 3NYRA 4LFCC 3IEVA 5KEIA 5A2QD 4IZ6A 5T8TA 2VQEC 4TPSB 3UZ0A 5AE2A 3KXWA 2M5OA 1N34C 1L2FA 3DAYA
chains in the Genus database with same CATH topology
1VEHA 1UWDA 2JNVA 1TH5A 2M5OA 3LNOA 1WCJA 3UX2A 2M5HA 3CQ1A 3CQ2A 1XHJA 3CQ3A 2Z51A 2CU6A 3UX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEH A;  1UWD A;  2JNV A;  1TH5 A;  2M5O A;  3LNO A;  1WCJ A;  3UX2 A;  2M5H A;  3CQ1 A;  3CQ2 A;  1XHJ A;  3CQ3 A;  2Z51 A;  2CU6 A;  3UX3 A; 
#chains in the Genus database with same CATH topology
 1XNQ C;  2QW0 X;  1USP A;  2E5L C;  2VQF C;  4DR1 C;  5BSV A;  2HJG A;  2ZZM A;  1FLO A;  5BSM A;  2YWC A;  5BR8 C;  1WH9 A;  4X62 C;  3CW8 X;  4BSZ A;  4RMN A;  3VNR A;  1HH2 P;  5GTD A;  2P2B A;  4X66 C;  2P2F A;  4RVN A;  1USP B;  1O92 A;  2WP0 C;  3CQ2 A;  3LNV A;  4GKK C;  2BH1 X;  1P4E A;  4YY3 C;  2OPL B;  3N2Q A;  4JV5 C;  1XRB A;  5A19 A;  3TDE A;  2UUA C;  3LUS A;  4ISB A;  4DG9 A;  4B3T C;  4RVO A;  2BJO A;  2EGT A;  4NXN C;  4DV5 C;  5BUS A;  4I9F A;  2UUC C;  5H9U A;  5E7Q A;  1ZB9 A;  4PRO C;  5FLX D;  1MD9 A;  4L4Q A;  5LMN C;  5K85 A;  2AYA A;  2KZF A;  2CXC A;  3NPD A;  5IT9 D;  3C5E A;  1MDB A;  1FJG C;  1V25 A;  1IBM C;  2E7G A;  3GKU A;  3I07 A;  2M5H A;  3JAM D;  1HNX C;  4GS5 A;  2KZ0 A;  1FUG A;  3CJE A;  3UOW A;  1N32 C;  3LAX A;  2E8E A;  4PZP A;  4DR7 C;  2D1T A;  4X64 C;  2D28 C;  1HR0 C;  2MMA B;  4DCV A;  5KYV A;  3NYQ A;  5BUQ A;  4DR2 C;  4KHP C;  4OXI A;  3A26 A;  3FCE A;  4DV7 C;  3AY0 A;  1NYE A;  4GXR A;  3H2T A;  4JI3 C;  5JRH A;  2PN2 A;  3DLP X;  4WS9 A;  4JI2 C;  1ML8 A;  2F4V C;  2MCQ A;  1NY8 A;  3IEU A;  4K0K C;  1HNZ C;  1N33 C;  4DR4 C;  4DG8 A;  3PBK A;  2P2Q A;  4ZLP A;  2JNV A;  4G1I A;  2E8C A;  4LF6 C;  4G36 A;  4KTV A;  1LCI A;  4OYC A;  4GXQ A;  4PHT A;  4PUI A;  4DUZ C;  4FTF A;  4G37 A;  4LF5 C;  3S82 A;  4D4G A;  2D27 A;  1HNW C;  4DV0 C;  4D4I A;  1QWI A;  2OPL A;  3UX2 A;  2UXB C;  1VEH A;  4RLF A;  1XS3 A;  3OTO C;  4DR5 C;  3A25 A;  3TR3 A;  4BC7 A;  5CZV A;  2ZZN A;  3A9U A;  4XX2 A;  5BST A;  4MTN A;  4LFA C;  1T5H X;  1MKY A;  2YX1 A;  3UEB A;  1XNR C;  2DHM A;  2D1S A;  2UUB C;  2XR1 A;  4OX9 C;  4HPV A;  4ODJ A;  3L95 X;  4RLQ A;  3VNS A;  1PU1 A;  4NXM C;  5KYT A;  4ZJZ A;  4L2Z A;  2ONF A;  3LNO A;  3E7W A;  4BBY A;  4B3M C;  4DV1 C;  5DV9 A;  3PES A;  2DYJ A;  3G7S A;  4LF4 C;  3T1H C;  5AE3 A;  3TUF A;  2Y4N A;  1YJ7 A;  3J81 D;  4B3S C;  2YWB A;  5BSR A;  4R0M A;  5BSW A;  1BA3 A;  4B3R C;  5LMU C;  3A9V A;  5AE1 A;  4YHH C;  4R1M A;  3VNQ A;  3CQ3 A;  4LF8 C;  4DR6 C;  4BC9 A;  2KDN A;  1XMQ C;  3GR0 A;  4GKJ C;  4JM1 A;  4BCA A;  3RV2 A;  2V7B A;  1RG9 A;  3R44 A;  2VZE A;  2UXC C;  1TH5 A;  3R9X A;  4AQY C;  1PA4 A;  1PG3 A;  4EAT A;  2CY1 A;  4DCU A;  4DV6 C;  1RY2 A;  5K8F A;  1KKG A;  1N36 C;  2NCL A;  4MH4 A;  4JI1 C;  1XMO C;  2D7V A;  3R9W A;  1M6X C;  5LCI A;  4DV4 C;  1I94 C;  4LFB C;  4FUT A;  5BSU A;  3RG2 A;  3CW9 A;  1JOS A;  1MDF A;  4JI6 C;  1M6X A;  3DHV A;  1UKK A;  3EER A;  1UWD A;  4RM3 A;  1J5E C;  3A4I A;  1XHJ A;  1ULT A;  4JI5 C;  1O90 A;  1AMU A;  5BUR A;  1XRC A;  2VSQ A;  2MM9 A;  2CU6 A;  3ETC A;  3EQ6 A;  5T8S A;  3GPC A;  4DUY C;  4JI7 C;  3PRO C;  4DV2 C;  1IBK C;  1VLA A;  3E7X A;  4DCS A;  2Y27 A;  4JI8 C;  3NI2 A;  4WV3 A;  1O93 A;  2QL8 A;  4NDN A;  4LE5 A;  2DPL A;  2OBV A;  3K6R A;  5CZX A;  1P4E C;  1WF3 A;  2WD9 A;  1O9T A;  4U5Y D;  1V60 A;  1EGA A;  4D57 A;  2E0G A;  3B7W A;  4DR3 C;  2P02 A;  5A1I A;  2Y4O A;  1V26 A;  1WCJ A;  4R1L A;  2QVX X;  3UX3 A;  3T1Y C;  3L8C A;  3AF6 A;  3J80 D;  4I9G A;  2D1Q A;  2YCB A;  1MXC A;  4LF7 C;  4RM2 A;  2ASB A;  4DV3 C;  1GPM A;  1PG4 A;  2P20 A;  4JI0 C;  2PT7 G;  3SO4 A;  4FUQ A;  4KTT A;  2QVZ X;  5A1G A;  1XRA A;  1LQL A;  3IML A;  1P7L A;  1IB8 A;  1K0R A;  2HHH C;  2UU9 C;  2E8F A;  4DCT A;  4NOZ A;  2JMP A;  2P2M A;  4D56 A;  4K0B A;  2ATW A;  2D1R A;  4JYA C;  1QM4 A;  3LGX A;  3CQ1 A;  3AF5 A;  1MXB A;  4L7I A;  4PUG A;  2OO4 A;  3IPL A;  3N54 B;  3FCC A;  3I08 A;  5IWA C;  2PRO A;  2P2J A;  3GR1 A;  4PUH A;  1IBL C;  4X65 C;  4JI4 C;  1N2F A;  1ZB8 A;  2ZM6 C;  1MXA A;  3TQI A;  2QVY X;  5ADZ A;  3O2E A;  1T5D X;  3ETO A;  4LF9 C;  5IFI A;  2Z51 A;  2UXD C;  4IR7 A;  3NYR A;  4LFC C;  3IEV A;  5KEI A;  5A2Q D;  4IZ6 A;  5T8T A;  2VQE C;  4TPS B;  3UZ0 A;  5AE2 A;  3KXW A;  2M5O A;  1N34 C;  1L2F A;  3DAY A; 
#chains in the Genus database with same CATH homology
 1VEH A;  1UWD A;  2JNV A;  1TH5 A;  2M5O A;  3LNO A;  1WCJ A;  3UX2 A;  2M5H A;  3CQ1 A;  3CQ2 A;  1XHJ A;  3CQ3 A;  2Z51 A;  2CU6 A;  3UX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...