1WCJA

Conserved hypothetical protein tm0487 from thermotoga maritima
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL PROTEIN TM0487
total genus 26
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1wcjA00
3UX3A 3LNOA 2JNVA 3CQ1A 2Z51A 1TH5A 2M5HA 2M5OA 2CU6A 1WCJA 3CQ3A 1UWDA 1VEHA 3UX2A 3CQ2A 1XHJA
chains in the Genus database with same CATH superfamily
2D27A 2DPLA 3UEBA 1USPB 1N34C 5T8TA 3SO4A 4WS9A 5BSVA 3FCEA 3KXWA 1HNZC 1P4EA 3A9VA 3CJEA 2UUCC 4LFAC 2E8FA 2EGTA 4RM3A 4GXRA 4I9FA 1N32C 1FJGC 2OPLA 2QL8A 3EERA 5BSRA 4X66C 3A9UA 1O9TA 5KYVA 3TR3A 4YY3C 4JI0C 1FUGA 5BUSA 5CZXA 4OYCA 5DV9A 4D56A 1USPA 3CW8X 4G36A 3GR0A 2PT7G 2P2QA 5AE1A 2QW0X 2DYJA 2QVZX 2XR1A 2P20A 3E7XA 2QVYX 4RVNA 1PG4A 5LMUC 4RLFA 4PROC 4ZJZA 4YHHC 4BBYA 3CQ3A 4TPSB 5IFIA 2BH1X 4HPVA 4GKJC 4LF5C 4XX2A 1XRBA 5JRHA 4KHPC 5BSTA 4LF4C 3FCCA 2UUAC 5K85A 4I9GA 4LFCC 1NYEA 4L4QA 1PU1A 3LAXA 2E8EA 3DHVA 1N33C 2OPLB 5AE2A 1XNQC 5A2QD 4DV7C 1I94C 1QWIA 1HR0C 4DV0C 1O93A 4DCSA 4DV1C 5FLXD 4G1IA 2D1SA 4D4IA 5A1IA 1L2FA 2ONFA 3IEUA 4DCUA 3N2QA 4B3MC 2ZZMA 2CY1A 3AF6A 3LUSA 3TUFA 2KZFA 1IBMC 2E0GA 3CQ1A 3PESA 4IR7A 2UXDC 4B3TC 4LE5A 4DR6C 4ODJA 4WV3A 4PHTA 2HHHC 4JI4C 2AYAA 2YWBA 2E8CA 3RV2A 4JI2C 4JI1C 1XHJA 3A25A 4GS5A 1HH2P 1N36C 1MXCA 5BR8C 2V7BA 4MH4A 3DAYA 4R0MA 1BA3A 2ZZNA 3AF5A 4OX9C 3J81D 2P2BA 5BSMA 4DG8A 2Y4NA 4G37A 4ISBA 4DV3C 2P02A 3J80D 1T5DX 3H2TA 2F4VC 2E7GA 3LGXA 4JI5C 1KKGA 3S82A 4DR2C 4EATA 4NDNA 4DUZC 2E5LC 4KTTA 2MMAB 1V26A 1ZB8A 1XNRC 3GR1A 4DCTA 4L7IA 2MCQA 4R1LA 5H9UA 2ATWA 3A4IA 4DV5C 4DV2C 2JNVA 3LNVA 3L95X 4K0BA 2YCBA 5BURA 4GXQA 3CQ2A 2VQEC 1K0RA 3UOWA 5A1GA 1UWDA 3UZ0A 2D7VA 2M5OA 4BC9A 1IBKC 2OBVA 3T1YC 3K6RA 3C5EA 2Z51A 4RLQA 3VNRA 5K8FA 4KTVA 2ASBA 2CXCA 3O2EA 1ULTA 3NYRA 4JM1A 3VNSA 1IBLC 2OO4A 4LF7C 1XMQC 4DV4C 1P7LA 5GTDA 1VEHA 1LQLA 1MD9A 2UXBC 1JOSA 1MXAA 1RY2A 1V60A 4PUHA 4RMNA 3UX3A 4DUYC 2UU9C 4B3SC 4FUQA 1EGAA 1RG9A 3LNOA 1TH5A 1N2FA 2Y27A 1UKKA 4DR5C 4RVOA 1MDBA 3T1HC 4U5YD 4DG9A 2D1TA 4OXIA 3OTOC 2CU6A 4JI6C 5A19A 5E7QA 3NPDA 5IWAC 2D1QA 2YX1A 3PROC 2WP0C 4JV5C 5ADZA 4L2ZA 3NI2A 4PZPA 5BSWA 2VQFC 1PA4A 1FLOA 3PBKA 4JI8C 4D57A 4R1MA 4JYAC 4BC7A 2Y4OA 2KZ0A 4DR1C 4NOZA 4DR7C 4X65C 1XMOC 2NCLA 3B7WA 3R44A 4FTFA 1AMUA 2M5HA 4X62C 2BJOA 4X64C 5KEIA 5LMNC 2PN2A 5BSUA 4DR4C 2P2FA 4IZ6A 3IPLA 1M6XA 3VNQA 1VLAA 2YWCA 1P4EC 1GPMA 3R9WA 3I07A 2QVXX 1YJ7A 4ZLPA 3I08A 1MXBA 3GKUA 3NYQA 2P2JA 1O92A 3N54B 2PROA 3A26A 5IT9D 1MKYA 1ZB9A 3GPCA 1XRAA 3G7SA 4NXNC 1WH9A 1MDFA 4AQYC 4LF6C 5BUQA 1NY8A 3E7WA 4JI7C 4B3RC 1J5EC 5LCIA 4BSZA 1QM4A 2DHMA 4LF9C 4DR3C 5KYTA 3R9XA 4D4GA 2MM9A 2UUBC 1XRCA 2WD9A 2VSQA 1ML8A 3ETCA 4PUGA 4NXMC 2VZEA 2D1RA 5T8SA 4LF8C 4K0KC 3IEVA 4LFBC 3EQ6A 4FUTA 1HNXC 2ZM6C 4RM2A 1PG3A 3UX2A 1V25A 3ETOA 5CZVA 2KDNA 3L8CA 3JAMD 4JI3C 4BCAA 4DV6C 2HJGA 1T5HX 4PUIA 1WCJA 2JMPA 2P2MA 1IB8A 3IMLA 1O90A 1M6XC 3DLPX 2UXCC 1LCIA 4GKKC 3AY0A 4DCVA 1HNWC 2D28C 1WF3A 5AE3A 3TQIA 3TDEA 3CW9A 1XS3A 3RG2A 4MTNA
chains in the Genus database with same CATH topology
3UX3A 3LNOA 2JNVA 3CQ1A 2Z51A 1TH5A 2M5HA 2M5OA 2CU6A 1WCJA 3CQ3A 1UWDA 1VEHA 3UX2A 3CQ2A 1XHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UX3 A;  3LNO A;  2JNV A;  3CQ1 A;  2Z51 A;  1TH5 A;  2M5H A;  2M5O A;  2CU6 A;  1WCJ A;  3CQ3 A;  1UWD A;  1VEH A;  3UX2 A;  3CQ2 A;  1XHJ A; 
#chains in the Genus database with same CATH topology
 2D27 A;  2DPL A;  3UEB A;  1USP B;  1N34 C;  5T8T A;  3SO4 A;  4WS9 A;  5BSV A;  3FCE A;  3KXW A;  1HNZ C;  1P4E A;  3A9V A;  3CJE A;  2UUC C;  4LFA C;  2E8F A;  2EGT A;  4RM3 A;  4GXR A;  4I9F A;  1N32 C;  1FJG C;  2OPL A;  2QL8 A;  3EER A;  5BSR A;  4X66 C;  3A9U A;  1O9T A;  5KYV A;  3TR3 A;  4YY3 C;  4JI0 C;  1FUG A;  5BUS A;  5CZX A;  4OYC A;  5DV9 A;  4D56 A;  1USP A;  3CW8 X;  4G36 A;  3GR0 A;  2PT7 G;  2P2Q A;  5AE1 A;  2QW0 X;  2DYJ A;  2QVZ X;  2XR1 A;  2P20 A;  3E7X A;  2QVY X;  4RVN A;  1PG4 A;  5LMU C;  4RLF A;  4PRO C;  4ZJZ A;  4YHH C;  4BBY A;  3CQ3 A;  4TPS B;  5IFI A;  2BH1 X;  4HPV A;  4GKJ C;  4LF5 C;  4XX2 A;  1XRB A;  5JRH A;  4KHP C;  5BST A;  4LF4 C;  3FCC A;  2UUA C;  5K85 A;  4I9G A;  4LFC C;  1NYE A;  4L4Q A;  1PU1 A;  3LAX A;  2E8E A;  3DHV A;  1N33 C;  2OPL B;  5AE2 A;  1XNQ C;  5A2Q D;  4DV7 C;  1I94 C;  1QWI A;  1HR0 C;  4DV0 C;  1O93 A;  4DCS A;  4DV1 C;  5FLX D;  4G1I A;  2D1S A;  4D4I A;  5A1I A;  1L2F A;  2ONF A;  3IEU A;  4DCU A;  3N2Q A;  4B3M C;  2ZZM A;  2CY1 A;  3AF6 A;  3LUS A;  3TUF A;  2KZF A;  1IBM C;  2E0G A;  3CQ1 A;  3PES A;  4IR7 A;  2UXD C;  4B3T C;  4LE5 A;  4DR6 C;  4ODJ A;  4WV3 A;  4PHT A;  2HHH C;  4JI4 C;  2AYA A;  2YWB A;  2E8C A;  3RV2 A;  4JI2 C;  4JI1 C;  1XHJ A;  3A25 A;  4GS5 A;  1HH2 P;  1N36 C;  1MXC A;  5BR8 C;  2V7B A;  4MH4 A;  3DAY A;  4R0M A;  1BA3 A;  2ZZN A;  3AF5 A;  4OX9 C;  3J81 D;  2P2B A;  5BSM A;  4DG8 A;  2Y4N A;  4G37 A;  4ISB A;  4DV3 C;  2P02 A;  3J80 D;  1T5D X;  3H2T A;  2F4V C;  2E7G A;  3LGX A;  4JI5 C;  1KKG A;  3S82 A;  4DR2 C;  4EAT A;  4NDN A;  4DUZ C;  2E5L C;  4KTT A;  2MMA B;  1V26 A;  1ZB8 A;  1XNR C;  3GR1 A;  4DCT A;  4L7I A;  2MCQ A;  4R1L A;  5H9U A;  2ATW A;  3A4I A;  4DV5 C;  4DV2 C;  2JNV A;  3LNV A;  3L95 X;  4K0B A;  2YCB A;  5BUR A;  4GXQ A;  3CQ2 A;  2VQE C;  1K0R A;  3UOW A;  5A1G A;  1UWD A;  3UZ0 A;  2D7V A;  2M5O A;  4BC9 A;  1IBK C;  2OBV A;  3T1Y C;  3K6R A;  3C5E A;  2Z51 A;  4RLQ A;  3VNR A;  5K8F A;  4KTV A;  2ASB A;  2CXC A;  3O2E A;  1ULT A;  3NYR A;  4JM1 A;  3VNS A;  1IBL C;  2OO4 A;  4LF7 C;  1XMQ C;  4DV4 C;  1P7L A;  5GTD A;  1VEH A;  1LQL A;  1MD9 A;  2UXB C;  1JOS A;  1MXA A;  1RY2 A;  1V60 A;  4PUH A;  4RMN A;  3UX3 A;  4DUY C;  2UU9 C;  4B3S C;  4FUQ A;  1EGA A;  1RG9 A;  3LNO A;  1TH5 A;  1N2F A;  2Y27 A;  1UKK A;  4DR5 C;  4RVO A;  1MDB A;  3T1H C;  4U5Y D;  4DG9 A;  2D1T A;  4OXI A;  3OTO C;  2CU6 A;  4JI6 C;  5A19 A;  5E7Q A;  3NPD A;  5IWA C;  2D1Q A;  2YX1 A;  3PRO C;  2WP0 C;  4JV5 C;  5ADZ A;  4L2Z A;  3NI2 A;  4PZP A;  5BSW A;  2VQF C;  1PA4 A;  1FLO A;  3PBK A;  4JI8 C;  4D57 A;  4R1M A;  4JYA C;  4BC7 A;  2Y4O A;  2KZ0 A;  4DR1 C;  4NOZ A;  4DR7 C;  4X65 C;  1XMO C;  2NCL A;  3B7W A;  3R44 A;  4FTF A;  1AMU A;  2M5H A;  4X62 C;  2BJO A;  4X64 C;  5KEI A;  5LMN C;  2PN2 A;  5BSU A;  4DR4 C;  2P2F A;  4IZ6 A;  3IPL A;  1M6X A;  3VNQ A;  1VLA A;  2YWC A;  1P4E C;  1GPM A;  3R9W A;  3I07 A;  2QVX X;  1YJ7 A;  4ZLP A;  3I08 A;  1MXB A;  3GKU A;  3NYQ A;  2P2J A;  1O92 A;  3N54 B;  2PRO A;  3A26 A;  5IT9 D;  1MKY A;  1ZB9 A;  3GPC A;  1XRA A;  3G7S A;  4NXN C;  1WH9 A;  1MDF A;  4AQY C;  4LF6 C;  5BUQ A;  1NY8 A;  3E7W A;  4JI7 C;  4B3R C;  1J5E C;  5LCI A;  4BSZ A;  1QM4 A;  2DHM A;  4LF9 C;  4DR3 C;  5KYT A;  3R9X A;  4D4G A;  2MM9 A;  2UUB C;  1XRC A;  2WD9 A;  2VSQ A;  1ML8 A;  3ETC A;  4PUG A;  4NXM C;  2VZE A;  2D1R A;  5T8S A;  4LF8 C;  4K0K C;  3IEV A;  4LFB C;  3EQ6 A;  4FUT A;  1HNX C;  2ZM6 C;  4RM2 A;  1PG3 A;  3UX2 A;  1V25 A;  3ETO A;  5CZV A;  2KDN A;  3L8C A;  3JAM D;  4JI3 C;  4BCA A;  4DV6 C;  2HJG A;  1T5H X;  4PUI A;  1WCJ A;  2JMP A;  2P2M A;  1IB8 A;  3IML A;  1O90 A;  1M6X C;  3DLP X;  2UXC C;  1LCI A;  4GKK C;  3AY0 A;  4DCV A;  1HNW C;  2D28 C;  1WF3 A;  5AE3 A;  3TQI A;  3TDE A;  3CW9 A;  1XS3 A;  3RG2 A;  4MTN A; 
#chains in the Genus database with same CATH homology
 3UX3 A;  3LNO A;  2JNV A;  3CQ1 A;  2Z51 A;  1TH5 A;  2M5H A;  2M5O A;  2CU6 A;  1WCJ A;  3CQ3 A;  1UWD A;  1VEH A;  3UX2 A;  3CQ2 A;  1XHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...