1WCJA

Conserved hypothetical protein tm0487 from thermotoga maritima
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
molecule keywords HYPOTHETICAL PROTEIN TM0487
molecule tags Structural genomics, unknown function
source organism Thermotoga maritima
total genus 26
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1wcjA00
3CQ2A 2Z51A 3CQ1A 3LNOA 3UX3A 2M5OA 1WCJA 2CU6A 1VEHA 2M5HA 1TH5A 1XHJA 2JNVA 3CQ3A 3UX2A 1UWDA
chains in the Genus database with same CATH superfamily
3CQ2A 3A25A 4PUIA 3JAMD 1RG9A 4JI1C 4R1LA 2OPLB 4GXRA 4PROC 5GTDA 2E8EA 3TR3A 2Y27A 1N32C 2UXDC 4OX9C 1IBKC 4DV7C 4XX2A 5IFIA 3NI2A 3T1YC 4GKKC 4LF6C 5BSWA 1WCJA 3VNSA 2CXCA 2F4VC 3FCCA 2E5LC 4X66C 3AF5A 4JI2C 4G37A 5A19A 5AE1A 2P2JA 3FCEA 4OXIA 1MDBA 3LUSA 4DCUA 5BSMA 5A2QD 2ZZMA 3A4IA 4B3RC 2AYAA 1WF3A 1KKGA 2M5HA 2E0GA 2DYJA 2MM9A 2M5OA 3DHVA 4RLQA 4LFAC 4NOZA 3C5EA 3UZ0A 3CQ1A 3UX2A 3LNVA 4PUGA 4U5YD 5LCIA 4MH4A 3PESA 4DUYC 2HHHC 1O93A 4RVOA 1XMQC 3GR0A 4R1MA 4DG9A 4I9GA 2VZEA 5FLXD 3G7SA 4BC9A 1NYEA 5K8FA 1N34C 3NPDA 4RLFA 5IWAC 4K0KC 3AF6A 1FLOA 2D1TA 2D28C 1XRCA 4IR7A 3TQIA 4ODJA 2E7GA 1LQLA 1O92A 3R9XA 4L2ZA 2YCBA 3VNRA 3CW8X 4DR6C 4G1IA 1ML8A 3A9VA 2JMPA 1FJGC 2XR1A 1XHJA 3TDEA 4FUTA 2QVZX 4GKJC 4EATA 2VQFC 3PROC 1MXCA 2V7BA 3CW9A 4DCTA 1HR0C 4YY3C 3UEBA 3O2EA 2ASBA 4JYAC 5BSVA 4LF4C 4R0MA 3K6RA 1VLAA 3LNOA 2Y4NA 4RVNA 1V26A 2Z51A 3S82A 4YHHC 4B3TC 1UWDA 2HJGA 1QM4A 4BSZA 4KHPC 3J80D 1L2FA 4AQYC 4FTFA 1YJ7A 5KEIA 3EQ6A 3UOWA 3N54B 4DV2C 3B7WA 5CZXA 2D1RA 5A1IA 1M6XA 1O90A 4DR2C 1NY8A 2MCQA 1VEHA 2OO4A 5H9UA 1HNWC 2QL8A 3RV2A 2P2BA 1PG3A 2UU9C 1T5HX 2WP0C 4LE5A 2KZ0A 1FUGA 1QWIA 4D4IA 2QVYX 1J5EC 1XNRC 2D1SA 2D27A 4DV6C 3GR1A 3NYQA 5BSRA 3ETOA 2BH1X 2KDNA 4JM1A 4D57A 1I94C 3EERA 4TPSB 4JI3C 2CU6A 2D7VA 4LFBC 5JRHA 5BUQA 3LGXA 2ZZNA 4ZLPA 1TH5A 4OYCA 3LAXA 4D4GA 3DAYA 1LCIA 2JNVA 4JI8C 4DR3C 5BUSA 2OBVA 3R44A 3T1HC 4JI4C 3R9WA 4JI6C 1WH9A 1P4EA 5BURA 2E8FA 2QVXX 2P2QA 2Y4OA 5DV9A 1XNQC 2PROA 4BBYA 1JOSA 2E8CA 3OTOC 4I9FA 3IEUA 2ATWA 4PHTA 4K0BA 4G36A 4D56A 1XRAA 4RM3A 1ZB8A 4DR7C 3E7WA 2D1QA 5CZVA 1V25A 1MDFA 2YX1A 1IB8A 4KTVA 1IBMC 1ZB9A 3I08A 4DV5C 2DPLA 4DR5C 5AE2A 2P2MA 4L7IA 1RY2A 4KTTA 4RM2A 2UXCC 1MXBA 2P02A 5IT9D 4HPVA 3DLPX 1PG4A 4JI0C 4JV5C 3PBKA 4DV4C 4B3SC 4BC7A 5T8SA 3ETCA 5KYTA 2ONFA 1HH2P 2PT7G 1HNZC 1EGAA 1T5DX 4X64C 3L95X 5K85A 3GPCA 4JI7C 1XRBA 1USPA 5BSTA 1O9TA 5A1GA 5ADZA 4JI5C 5AE3A 4LF8C 1V60A 3IEVA 3AY0A 3I07A 3J81D 1N36C 1AMUA 2WD9A 4WS9A 4ZJZA 4DCVA 1GPMA 1P7LA 3A9UA 1BA3A 4LF9C 2NCLA 4DUZC 2CY1A 3CJEA 2UUBC 3H2TA 2VQEC 1P4EC 1K0RA 2QW0X 4NXMC 2ZM6C 1MD9A 1USPB 1PU1A 1N2FA 3TUFA 1XS3A 3UX3A 4DV0C 2EGTA 1MXAA 4DV1C 4LF7C 2P20A 5T8TA 4IZ6A 3RG2A 2UXBC 4WV3A 3SO4A 1ULTA 2PN2A 4DR1C 2DHMA 2BJOA 3A26A 2UUAC 5LMNC 4RMNA 4NDNA 4GS5A 2P2FA 4DV3C 5BR8C 4LF5C 4L4QA 3VNQA 2OPLA 3KXWA 1HNXC 1UKKA 2MMAB 3IPLA 1XMOC 4GXQA 2KZFA 1IBLC 3E7XA 4DCSA 4ISBA 2YWBA 4X62C 3GKUA 1MKYA 4B3MC 5E7QA 4LFCC 3L8CA 3CQ3A 4FUQA 3N2QA 5LMUC 3IMLA 2VSQA 3NYRA 4PUHA 4BCAA 5BSUA 4NXNC 4PZPA 1M6XC 5KYVA 4DR4C 1PA4A 4MTNA 1N33C 2YWCA 4X65C 4DG8A 2UUCC
chains in the Genus database with same CATH topology
3CQ2A 2Z51A 3CQ1A 3LNOA 3UX3A 2M5OA 1WCJA 2CU6A 1VEHA 2M5HA 1TH5A 1XHJA 2JNVA 3CQ3A 3UX2A 1UWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQ2 A;  2Z51 A;  3CQ1 A;  3LNO A;  3UX3 A;  2M5O A;  1WCJ A;  2CU6 A;  1VEH A;  2M5H A;  1TH5 A;  1XHJ A;  2JNV A;  3CQ3 A;  3UX2 A;  1UWD A; 
#chains in the Genus database with same CATH topology
 3CQ2 A;  3A25 A;  4PUI A;  3JAM D;  1RG9 A;  4JI1 C;  4R1L A;  2OPL B;  4GXR A;  4PRO C;  5GTD A;  2E8E A;  3TR3 A;  2Y27 A;  1N32 C;  2UXD C;  4OX9 C;  1IBK C;  4DV7 C;  4XX2 A;  5IFI A;  3NI2 A;  3T1Y C;  4GKK C;  4LF6 C;  5BSW A;  1WCJ A;  3VNS A;  2CXC A;  2F4V C;  3FCC A;  2E5L C;  4X66 C;  3AF5 A;  4JI2 C;  4G37 A;  5A19 A;  5AE1 A;  2P2J A;  3FCE A;  4OXI A;  1MDB A;  3LUS A;  4DCU A;  5BSM A;  5A2Q D;  2ZZM A;  3A4I A;  4B3R C;  2AYA A;  1WF3 A;  1KKG A;  2M5H A;  2E0G A;  2DYJ A;  2MM9 A;  2M5O A;  3DHV A;  4RLQ A;  4LFA C;  4NOZ A;  3C5E A;  3UZ0 A;  3CQ1 A;  3UX2 A;  3LNV A;  4PUG A;  4U5Y D;  5LCI A;  4MH4 A;  3PES A;  4DUY C;  2HHH C;  1O93 A;  4RVO A;  1XMQ C;  3GR0 A;  4R1M A;  4DG9 A;  4I9G A;  2VZE A;  5FLX D;  3G7S A;  4BC9 A;  1NYE A;  5K8F A;  1N34 C;  3NPD A;  4RLF A;  5IWA C;  4K0K C;  3AF6 A;  1FLO A;  2D1T A;  2D28 C;  1XRC A;  4IR7 A;  3TQI A;  4ODJ A;  2E7G A;  1LQL A;  1O92 A;  3R9X A;  4L2Z A;  2YCB A;  3VNR A;  3CW8 X;  4DR6 C;  4G1I A;  1ML8 A;  3A9V A;  2JMP A;  1FJG C;  2XR1 A;  1XHJ A;  3TDE A;  4FUT A;  2QVZ X;  4GKJ C;  4EAT A;  2VQF C;  3PRO C;  1MXC A;  2V7B A;  3CW9 A;  4DCT A;  1HR0 C;  4YY3 C;  3UEB A;  3O2E A;  2ASB A;  4JYA C;  5BSV A;  4LF4 C;  4R0M A;  3K6R A;  1VLA A;  3LNO A;  2Y4N A;  4RVN A;  1V26 A;  2Z51 A;  3S82 A;  4YHH C;  4B3T C;  1UWD A;  2HJG A;  1QM4 A;  4BSZ A;  4KHP C;  3J80 D;  1L2F A;  4AQY C;  4FTF A;  1YJ7 A;  5KEI A;  3EQ6 A;  3UOW A;  3N54 B;  4DV2 C;  3B7W A;  5CZX A;  2D1R A;  5A1I A;  1M6X A;  1O90 A;  4DR2 C;  1NY8 A;  2MCQ A;  1VEH A;  2OO4 A;  5H9U A;  1HNW C;  2QL8 A;  3RV2 A;  2P2B A;  1PG3 A;  2UU9 C;  1T5H X;  2WP0 C;  4LE5 A;  2KZ0 A;  1FUG A;  1QWI A;  4D4I A;  2QVY X;  1J5E C;  1XNR C;  2D1S A;  2D27 A;  4DV6 C;  3GR1 A;  3NYQ A;  5BSR A;  3ETO A;  2BH1 X;  2KDN A;  4JM1 A;  4D57 A;  1I94 C;  3EER A;  4TPS B;  4JI3 C;  2CU6 A;  2D7V A;  4LFB C;  5JRH A;  5BUQ A;  3LGX A;  2ZZN A;  4ZLP A;  1TH5 A;  4OYC A;  3LAX A;  4D4G A;  3DAY A;  1LCI A;  2JNV A;  4JI8 C;  4DR3 C;  5BUS A;  2OBV A;  3R44 A;  3T1H C;  4JI4 C;  3R9W A;  4JI6 C;  1WH9 A;  1P4E A;  5BUR A;  2E8F A;  2QVX X;  2P2Q A;  2Y4O A;  5DV9 A;  1XNQ C;  2PRO A;  4BBY A;  1JOS A;  2E8C A;  3OTO C;  4I9F A;  3IEU A;  2ATW A;  4PHT A;  4K0B A;  4G36 A;  4D56 A;  1XRA A;  4RM3 A;  1ZB8 A;  4DR7 C;  3E7W A;  2D1Q A;  5CZV A;  1V25 A;  1MDF A;  2YX1 A;  1IB8 A;  4KTV A;  1IBM C;  1ZB9 A;  3I08 A;  4DV5 C;  2DPL A;  4DR5 C;  5AE2 A;  2P2M A;  4L7I A;  1RY2 A;  4KTT A;  4RM2 A;  2UXC C;  1MXB A;  2P02 A;  5IT9 D;  4HPV A;  3DLP X;  1PG4 A;  4JI0 C;  4JV5 C;  3PBK A;  4DV4 C;  4B3S C;  4BC7 A;  5T8S A;  3ETC A;  5KYT A;  2ONF A;  1HH2 P;  2PT7 G;  1HNZ C;  1EGA A;  1T5D X;  4X64 C;  3L95 X;  5K85 A;  3GPC A;  4JI7 C;  1XRB A;  1USP A;  5BST A;  1O9T A;  5A1G A;  5ADZ A;  4JI5 C;  5AE3 A;  4LF8 C;  1V60 A;  3IEV A;  3AY0 A;  3I07 A;  3J81 D;  1N36 C;  1AMU A;  2WD9 A;  4WS9 A;  4ZJZ A;  4DCV A;  1GPM A;  1P7L A;  3A9U A;  1BA3 A;  4LF9 C;  2NCL A;  4DUZ C;  2CY1 A;  3CJE A;  2UUB C;  3H2T A;  2VQE C;  1P4E C;  1K0R A;  2QW0 X;  4NXM C;  2ZM6 C;  1MD9 A;  1USP B;  1PU1 A;  1N2F A;  3TUF A;  1XS3 A;  3UX3 A;  4DV0 C;  2EGT A;  1MXA A;  4DV1 C;  4LF7 C;  2P20 A;  5T8T A;  4IZ6 A;  3RG2 A;  2UXB C;  4WV3 A;  3SO4 A;  1ULT A;  2PN2 A;  4DR1 C;  2DHM A;  2BJO A;  3A26 A;  2UUA C;  5LMN C;  4RMN A;  4NDN A;  4GS5 A;  2P2F A;  4DV3 C;  5BR8 C;  4LF5 C;  4L4Q A;  3VNQ A;  2OPL A;  3KXW A;  1HNX C;  1UKK A;  2MMA B;  3IPL A;  1XMO C;  4GXQ A;  2KZF A;  1IBL C;  3E7X A;  4DCS A;  4ISB A;  2YWB A;  4X62 C;  3GKU A;  1MKY A;  4B3M C;  5E7Q A;  4LFC C;  3L8C A;  3CQ3 A;  4FUQ A;  3N2Q A;  5LMU C;  3IML A;  2VSQ A;  3NYR A;  4PUH A;  4BCA A;  5BSU A;  4NXN C;  4PZP A;  1M6X C;  5KYV A;  4DR4 C;  1PA4 A;  4MTN A;  1N33 C;  2YWC A;  4X65 C;  4DG8 A;  2UUC C; 
#chains in the Genus database with same CATH homology
 3CQ2 A;  2Z51 A;  3CQ1 A;  3LNO A;  3UX3 A;  2M5O A;  1WCJ A;  2CU6 A;  1VEH A;  2M5H A;  1TH5 A;  1XHJ A;  2JNV A;  3CQ3 A;  3UX2 A;  1UWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...