1WCJA

Conserved hypothetical protein tm0487 from thermotoga maritima
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL PROTEIN TM0487
total genus 26
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1wcjA00
2CU6A 1UWDA 3CQ1A 3UX2A 2M5HA 2JNVA 2Z51A 3CQ3A 1VEHA 2M5OA 3UX3A 1WCJA 3CQ2A 3LNOA 1TH5A 1XHJA
chains in the Genus database with same CATH superfamily
4AQYC 1VLAA 4R1LA 3K6RA 3CW8X 3UOWA 4NXMC 5LCIA 4MH4A 1MDBA 4IZ6A 3R9WA 2D1RA 1FLOA 4K0BA 5ADZA 4K0KC 3E7WA 4ZJZA 3CW9A 3DLPX 4RVNA 4JI1C 1O9TA 4G37A 4B3SC 4JI6C 4I9FA 3SO4A 5K85A 5AE3A 4DR4C 4DUYC 4B3MC 2ONFA 4IR7A 3TQIA 5JRHA 3A25A 1FUGA 4U5YD 3LGXA 4X62C 1N2FA 1UWDA 2QVXX 3AF6A 4ZLPA 3O2EA 1N34C 1VEHA 2Y4OA 3LNOA 1ML8A 1XRBA 1USPB 2P02A 2DPLA 4PZPA 1HNXC 2PROA 2MM9A 3A9VA 4RM2A 3VNRA 2QVYX 4BCAA 4TPSB 2MMAB 1IBKC 4JI7C 2DYJA 4RVOA 4LF9C 3L8CA 4LE5A 4JI3C 4DG8A 2ZZMA 4LF5C 2NCLA 4DV7C 2WD9A 2UUCC 5BUQA 2E8FA 1V60A 3EERA 2EGTA 4DCTA 5BSUA 3VNSA 2V7BA 5T8SA 4OX9C 2F4VC 4DR6C 2E8EA 1LQLA 4RM3A 4DR7C 4D4IA 4GXQA 1WCJA 4DCUA 2CU6A 2HHHC 4G36A 1XMQC 1HH2P 3IEVA 4DR2C 3ETCA 4BBYA 3IMLA 4JI5C 4PUIA 5BSMA 2M5HA 1O93A 3H2TA 1RY2A 5KYVA 3T1YC 2Y27A 4YHHC 1I94C 1EGAA 4JM1A 5A2QD 3LNVA 1P4EC 1XRCA 2UXBC 2P2JA 4GKKC 3UEBA 4FUTA 2D1TA 1V25A 5IT9D 4LFBC 3ETOA 2PT7G 4KHPC 4DV1C 4LFAC 4BC7A 2VQFC 1P7LA 4X66C 3AY0A 2VSQA 4RLFA 4DV3C 4L2ZA 3B7WA 4D57A 4ODJA 3FCCA 5E7QA 3NI2A 1GPMA 2ZM6C 2D27A 2KZFA 4PUGA 2D1QA 4BSZA 2D28C 1RG9A 1NYEA 2QVZX 3L95X 3PBKA 1YJ7A 2E5LC 5BSRA 5BR8C 1V26A 3CQ3A 3FCEA 4XX2A 4R1MA 4RLQA 3IPLA 4JI0C 3GR0A 5A1GA 4B3TC 4JV5C 3PROC 1T5DX 3RV2A 1HNWC 2HJGA 4OYCA 3DAYA 3KXWA 3VNQA 3A26A 5K8FA 3J81D 1IBMC 2ASBA 2E7GA 5BSTA 1TH5A 3GR1A 1J5EC 4MTNA 2P2FA 1O90A 1MXCA 4DV4C 4L7IA 1PU1A 2D7VA 3N2QA 3AF5A 3JAMD 4PUHA 5IFIA 1MXAA 4DUZC 4HPVA 4PROC 3OTOC 3UX2A 4EATA 3E7XA 4NXNC 5LMNC 1P4EA 4DCSA 5GTDA 2YCBA 1O92A 4JI8C 3S82A 1MDFA 2VZEA 2E8CA 1FJGC 4DV6C 3I07A 2ZZNA 4PHTA 4GXRA 1BA3A 2UUBC 5KYTA 3CQ1A 1XNRC 5KEIA 3C5EA 4D56A 5H9UA 2P2BA 1JOSA 2M5OA 2YWBA 2Y4NA 4BC9A 4X65C 3G7SA 5A19A 3UX3A 4RMNA 2XR1A 3LAXA 3GPCA 2ATWA 1ULTA 3EQ6A 2KDNA 1L2FA 2JNVA 4JI2C 5AE2A 4LF7C 1KKGA 4NOZA 2MCQA 3UZ0A 4DR3C 2OO4A 2UXCC 2YX1A 5AE1A 4DV5C 4DR5C 5BURA 1UKKA 1MD9A 4KTTA 5T8TA 2D1SA 4GKJC 1NY8A 4LFCC 5IWAC 4OXIA 3DHVA 1XHJA 4JYAC 4DCVA 1ZB9A 2KZ0A 2YWCA 4L4QA 1QWIA 1N33C 1WF3A 1XMOC 4NDNA 4ISBA 1T5HX 1PG3A 3IEUA 2OPLA 3CQ2A 5BUSA 4FUQA 2Z51A 4DV0C 1N36C 1MKYA 3R9XA 5BSVA 3A4IA 2DHMA 2P20A 1N32C 1PA4A 3I08A 4LF4C 1HR0C 4WV3A 4FTFA 4YY3C 4DR1C 1K0RA 3TR3A 4I9GA 5A1IA 4LF6C 4DG9A 3CJEA 1PG4A 1XNQC 2QL8A 1M6XC 1IBLC 4G1IA 1QM4A 2PN2A 3TUFA 3T1HC 1MXBA 3NYQA 5FLXD 2JMPA 1LCIA 1XS3A 4B3RC 2P2MA 1AMUA 3LUSA 3RG2A 5DV9A 3NPDA 1M6XA 5LMUC 2WP0C 2UUAC 2CY1A 4R0MA 1XRAA 5CZVA 4WS9A 3N54B 2BH1X 2UXDC 2E0GA 4GS5A 1WH9A 3GKUA 1IB8A 2UU9C 5BSWA 3PESA 4D4GA 3A9UA 1HNZC 4X64C 4JI4C 3J80D 4DV2C 2OPLB 1USPA 4LF8C 2AYAA 1ZB8A 4KTVA 2BJOA 2P2QA 3NYRA 3R44A 2OBVA 5CZXA 3TDEA 2CXCA 2VQEC 2QW0X
chains in the Genus database with same CATH topology
2CU6A 1UWDA 3CQ1A 3UX2A 2M5HA 2JNVA 2Z51A 3CQ3A 1VEHA 2M5OA 3UX3A 1WCJA 3CQ2A 3LNOA 1TH5A 1XHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU6 A;  1UWD A;  3CQ1 A;  3UX2 A;  2M5H A;  2JNV A;  2Z51 A;  3CQ3 A;  1VEH A;  2M5O A;  3UX3 A;  1WCJ A;  3CQ2 A;  3LNO A;  1TH5 A;  1XHJ A; 
#chains in the Genus database with same CATH topology
 4AQY C;  1VLA A;  4R1L A;  3K6R A;  3CW8 X;  3UOW A;  4NXM C;  5LCI A;  4MH4 A;  1MDB A;  4IZ6 A;  3R9W A;  2D1R A;  1FLO A;  4K0B A;  5ADZ A;  4K0K C;  3E7W A;  4ZJZ A;  3CW9 A;  3DLP X;  4RVN A;  4JI1 C;  1O9T A;  4G37 A;  4B3S C;  4JI6 C;  4I9F A;  3SO4 A;  5K85 A;  5AE3 A;  4DR4 C;  4DUY C;  4B3M C;  2ONF A;  4IR7 A;  3TQI A;  5JRH A;  3A25 A;  1FUG A;  4U5Y D;  3LGX A;  4X62 C;  1N2F A;  1UWD A;  2QVX X;  3AF6 A;  4ZLP A;  3O2E A;  1N34 C;  1VEH A;  2Y4O A;  3LNO A;  1ML8 A;  1XRB A;  1USP B;  2P02 A;  2DPL A;  4PZP A;  1HNX C;  2PRO A;  2MM9 A;  3A9V A;  4RM2 A;  3VNR A;  2QVY X;  4BCA A;  4TPS B;  2MMA B;  1IBK C;  4JI7 C;  2DYJ A;  4RVO A;  4LF9 C;  3L8C A;  4LE5 A;  4JI3 C;  4DG8 A;  2ZZM A;  4LF5 C;  2NCL A;  4DV7 C;  2WD9 A;  2UUC C;  5BUQ A;  2E8F A;  1V60 A;  3EER A;  2EGT A;  4DCT A;  5BSU A;  3VNS A;  2V7B A;  5T8S A;  4OX9 C;  2F4V C;  4DR6 C;  2E8E A;  1LQL A;  4RM3 A;  4DR7 C;  4D4I A;  4GXQ A;  1WCJ A;  4DCU A;  2CU6 A;  2HHH C;  4G36 A;  1XMQ C;  1HH2 P;  3IEV A;  4DR2 C;  3ETC A;  4BBY A;  3IML A;  4JI5 C;  4PUI A;  5BSM A;  2M5H A;  1O93 A;  3H2T A;  1RY2 A;  5KYV A;  3T1Y C;  2Y27 A;  4YHH C;  1I94 C;  1EGA A;  4JM1 A;  5A2Q D;  3LNV A;  1P4E C;  1XRC A;  2UXB C;  2P2J A;  4GKK C;  3UEB A;  4FUT A;  2D1T A;  1V25 A;  5IT9 D;  4LFB C;  3ETO A;  2PT7 G;  4KHP C;  4DV1 C;  4LFA C;  4BC7 A;  2VQF C;  1P7L A;  4X66 C;  3AY0 A;  2VSQ A;  4RLF A;  4DV3 C;  4L2Z A;  3B7W A;  4D57 A;  4ODJ A;  3FCC A;  5E7Q A;  3NI2 A;  1GPM A;  2ZM6 C;  2D27 A;  2KZF A;  4PUG A;  2D1Q A;  4BSZ A;  2D28 C;  1RG9 A;  1NYE A;  2QVZ X;  3L95 X;  3PBK A;  1YJ7 A;  2E5L C;  5BSR A;  5BR8 C;  1V26 A;  3CQ3 A;  3FCE A;  4XX2 A;  4R1M A;  4RLQ A;  3IPL A;  4JI0 C;  3GR0 A;  5A1G A;  4B3T C;  4JV5 C;  3PRO C;  1T5D X;  3RV2 A;  1HNW C;  2HJG A;  4OYC A;  3DAY A;  3KXW A;  3VNQ A;  3A26 A;  5K8F A;  3J81 D;  1IBM C;  2ASB A;  2E7G A;  5BST A;  1TH5 A;  3GR1 A;  1J5E C;  4MTN A;  2P2F A;  1O90 A;  1MXC A;  4DV4 C;  4L7I A;  1PU1 A;  2D7V A;  3N2Q A;  3AF5 A;  3JAM D;  4PUH A;  5IFI A;  1MXA A;  4DUZ C;  4HPV A;  4PRO C;  3OTO C;  3UX2 A;  4EAT A;  3E7X A;  4NXN C;  5LMN C;  1P4E A;  4DCS A;  5GTD A;  2YCB A;  1O92 A;  4JI8 C;  3S82 A;  1MDF A;  2VZE A;  2E8C A;  1FJG C;  4DV6 C;  3I07 A;  2ZZN A;  4PHT A;  4GXR A;  1BA3 A;  2UUB C;  5KYT A;  3CQ1 A;  1XNR C;  5KEI A;  3C5E A;  4D56 A;  5H9U A;  2P2B A;  1JOS A;  2M5O A;  2YWB A;  2Y4N A;  4BC9 A;  4X65 C;  3G7S A;  5A19 A;  3UX3 A;  4RMN A;  2XR1 A;  3LAX A;  3GPC A;  2ATW A;  1ULT A;  3EQ6 A;  2KDN A;  1L2F A;  2JNV A;  4JI2 C;  5AE2 A;  4LF7 C;  1KKG A;  4NOZ A;  2MCQ A;  3UZ0 A;  4DR3 C;  2OO4 A;  2UXC C;  2YX1 A;  5AE1 A;  4DV5 C;  4DR5 C;  5BUR A;  1UKK A;  1MD9 A;  4KTT A;  5T8T A;  2D1S A;  4GKJ C;  1NY8 A;  4LFC C;  5IWA C;  4OXI A;  3DHV A;  1XHJ A;  4JYA C;  4DCV A;  1ZB9 A;  2KZ0 A;  2YWC A;  4L4Q A;  1QWI A;  1N33 C;  1WF3 A;  1XMO C;  4NDN A;  4ISB A;  1T5H X;  1PG3 A;  3IEU A;  2OPL A;  3CQ2 A;  5BUS A;  4FUQ A;  2Z51 A;  4DV0 C;  1N36 C;  1MKY A;  3R9X A;  5BSV A;  3A4I A;  2DHM A;  2P20 A;  1N32 C;  1PA4 A;  3I08 A;  4LF4 C;  1HR0 C;  4WV3 A;  4FTF A;  4YY3 C;  4DR1 C;  1K0R A;  3TR3 A;  4I9G A;  5A1I A;  4LF6 C;  4DG9 A;  3CJE A;  1PG4 A;  1XNQ C;  2QL8 A;  1M6X C;  1IBL C;  4G1I A;  1QM4 A;  2PN2 A;  3TUF A;  3T1H C;  1MXB A;  3NYQ A;  5FLX D;  2JMP A;  1LCI A;  1XS3 A;  4B3R C;  2P2M A;  1AMU A;  3LUS A;  3RG2 A;  5DV9 A;  3NPD A;  1M6X A;  5LMU C;  2WP0 C;  2UUA C;  2CY1 A;  4R0M A;  1XRA A;  5CZV A;  4WS9 A;  3N54 B;  2BH1 X;  2UXD C;  2E0G A;  4GS5 A;  1WH9 A;  3GKU A;  1IB8 A;  2UU9 C;  5BSW A;  3PES A;  4D4G A;  3A9U A;  1HNZ C;  4X64 C;  4JI4 C;  3J80 D;  4DV2 C;  2OPL B;  1USP A;  4LF8 C;  2AYA A;  1ZB8 A;  4KTV A;  2BJO A;  2P2Q A;  3NYR A;  3R44 A;  2OBV A;  5CZX A;  3TDE A;  2CXC A;  2VQE C;  2QW0 X; 
#chains in the Genus database with same CATH homology
 2CU6 A;  1UWD A;  3CQ1 A;  3UX2 A;  2M5H A;  2JNV A;  2Z51 A;  3CQ3 A;  1VEH A;  2M5O A;  3UX3 A;  1WCJ A;  3CQ2 A;  3LNO A;  1TH5 A;  1XHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...