1WCJA

Conserved hypothetical protein tm0487 from thermotoga maritima
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
b'MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN TM0487
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 26
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1wcjA00
3UX2A 3CQ1A 2M5OA 3CQ2A 1WCJA 3UX3A 1TH5A 1VEHA 2Z51A 2JNVA 1UWDA 3CQ3A 1XHJA 2M5HA 2CU6A 3LNOA
chains in the Genus database with same CATH superfamily
2MMAB 1ZB9A 4DV5C 4JI2C 1XMQC 4LF4C 3TUFA 2E8CA 5AE3A 1USPA 2Z51A 3J80D 5BSRA 3KXWA 5BSMA 4JI4C 5KYTA 1FLOA 2XR1A 1RG9A 3OTOC 1VEHA 2YWBA 2ATWA 1ZB8A 4WS9A 1JOSA 4DR3C 3SO4A 2HJGA 2MCQA 4DR7C 1N32C 2EGTA 5DV9A 3K6RA 1MKYA 1USPB 3GPCA 2D7VA 5H9UA 1L2FA 2UXBC 4I9FA 5GTDA 1LCIA 4PUIA 3A25A 4GXRA 1PG4A 1O92A 2HHHC 1V60A 3UEBA 3UOWA 1HR0C 4LF9C 4JI3C 5LMNC 5K8FA 4TPSB 1XMOC 3NI2A 4GXQA 4R0MA 3TQIA 1K0RA 4JM1A 2MM9A 4JI8C 4YY3C 3IEVA 5A1IA 3T1YC 2F4VC 5BURA 3N54B 2WP0C 2QVZX 4DR5C 3O2EA 2QVXX 4EATA 5A19A 4BCAA 2P20A 1MD9A 2VSQA 5LMUC 2V7BA 1RY2A 4X64C 2YX1A 1V26A 2YCBA 1ULTA 1HNXC 2CXCA 5K85A 3VNRA 2UUBC 5T8SA 1T5HX 4DV6C 2OO4A 1O9TA 4DR1C 2ZZMA 2WD9A 3A26A 1N33C 1YJ7A 4L7IA 4DV0C 2JMPA 5A2QD 1M6XC 2E5LC 4DCUA 4D4IA 3PBKA 5BSWA 2QW0X 2PROA 2OPLB 4KTTA 3RG2A 3C5EA 4D56A 5ADZA 2VQEC 4HPVA 1WCJA 3EQ6A 1HNZC 3FCCA 5IT9D 4IZ6A 1MDBA 4DR4C 1MXAA 2E0GA 2D27A 4DV4C 2BJOA 4X66C 4RVOA 4ISBA 1V25A 4BC9A 3N2QA 2E8EA 4B3TC 4I9GA 3J81D 3R9WA 5BUQA 3VNQA 2KDNA 3B7WA 1ML8A 4RVNA 3NYRA 4D4GA 2YWCA 4JI5C 4BC7A 4G1IA 2CU6A 2OBVA 1XRAA 4PHTA 4LF6C 4JYAC 4RLFA 3CJEA 5LCIA 3DAYA 4DCTA 4NXNC 3TDEA 4DUZC 1MXBA 1KKGA 2UUAC 2JNVA 3AF6A 2Y27A 1GPMA 2D1TA 1UKKA 2QVYX 4RM3A 3ETCA 3AY0A 3UX2A 1XNRC 5BSUA 1HH2P 3IPLA 4GKKC 4FUQA 2M5HA 3DHVA 2P2QA 3UZ0A 1MXCA 4MH4A 4BSZA 4OYCA 1QWIA 2UXDC 2DYJA 3NPDA 4LFCC 3GR1A 3A4IA 1LQLA 3GKUA 2ONFA 2PT7G 4FTFA 1I94C 1N2FA 1QM4A 3S82A 2P2BA 3CQ3A 3ETOA 2P2FA 4K0KC 3UX3A 4LF5C 3EERA 3GR0A 3LAXA 1IBMC 5IFIA 3RV2A 4PZPA 4L4QA 1XS3A 4DUYC 2E7GA 1TH5A 4R1LA 4DV1C 2KZ0A 1P4EC 3A9VA 4GS5A 1O93A 4ZJZA 4ODJA 3TR3A 4DR6C 4JI6C 4NXMC 5T8TA 1XNQC 5CZVA 2UU9C 5AE1A 4OXIA 4X65C 2VQFC 4DCVA 4PUGA 1UWDA 1AMUA 3PROC 4B3RC 2D1QA 4DCSA 1P7LA 5JRHA 4YHHC 1MDFA 3DLPX 3I07A 5CZXA 4B3SC 1BA3A 4KTVA 4RMNA 3VNSA 2ZM6C 4LFBC 4G37A 2BH1X 4DG9A 2ASBA 3JAMD 5A1GA 1VLAA 4DV2C 4DR2C 2E8FA 1XHJA 1IBLC 3AF5A 5BR8C 4JV5C 1PU1A 3R44A 3L95X 3L8CA 2DHMA 1IBKC 2D28C 4K0BA 3FCEA 1WH9A 4LE5A 2Y4NA 3CW9A 3CQ2A 1T5DX 3LUSA 4PUHA 2UUCC 4JI1C 3E7XA 2P2MA 2D1SA 3LGXA 2ZZNA 4LF8C 3E7WA 3R9XA 3H2TA 4BBYA 3NYQA 2P2JA 4LF7C 4RM2A 4ZLPA 4RLQA 5BSTA 4DV3C 2D1RA 4DV7C 1NY8A 2PN2A 2KZFA 2UXCC 2AYAA 3PESA 1HNWC 1J5EC 4GKJC 4DG8A 4XX2A 2NCLA 1PG3A 1PA4A 2M5OA 4AQYC 3G7SA 4IR7A 2DPLA 5E7QA 1IB8A 2Y4OA 3LNOA 1N34C 3CW8X 4KHPC 1M6XA 1XRBA 1EGAA 2OPLA 4NDNA 2CY1A 4PROC 5AE2A 1WF3A 4D57A 5KYVA 1P4EA 5BUSA 3I08A 4OX9C 4FUTA 5IWAC 5FLXD 5KEIA 4MTNA 2P02A 4X62C 4G36A 2VZEA 4NOZA 4B3MC 4JI7C 4R1MA 4U5YD 3A9UA 4LFAC 1FUGA 1FJGC 5BSVA 3IEUA 4L2ZA 3T1HC 1NYEA 4WV3A 3CQ1A 1XRCA 1O90A 3IMLA 3LNVA 2QL8A 1N36C 4JI0C
chains in the Genus database with same CATH topology
3UX2A 3CQ1A 2M5OA 3CQ2A 1WCJA 3UX3A 1TH5A 1VEHA 2Z51A 2JNVA 1UWDA 3CQ3A 1XHJA 2M5HA 2CU6A 3LNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UX2 A;  3CQ1 A;  2M5O A;  3CQ2 A;  1WCJ A;  3UX3 A;  1TH5 A;  1VEH A;  2Z51 A;  2JNV A;  1UWD A;  3CQ3 A;  1XHJ A;  2M5H A;  2CU6 A;  3LNO A; 
#chains in the Genus database with same CATH topology
 2MMA B;  1ZB9 A;  4DV5 C;  4JI2 C;  1XMQ C;  4LF4 C;  3TUF A;  2E8C A;  5AE3 A;  1USP A;  2Z51 A;  3J80 D;  5BSR A;  3KXW A;  5BSM A;  4JI4 C;  5KYT A;  1FLO A;  2XR1 A;  1RG9 A;  3OTO C;  1VEH A;  2YWB A;  2ATW A;  1ZB8 A;  4WS9 A;  1JOS A;  4DR3 C;  3SO4 A;  2HJG A;  2MCQ A;  4DR7 C;  1N32 C;  2EGT A;  5DV9 A;  3K6R A;  1MKY A;  1USP B;  3GPC A;  2D7V A;  5H9U A;  1L2F A;  2UXB C;  4I9F A;  5GTD A;  1LCI A;  4PUI A;  3A25 A;  4GXR A;  1PG4 A;  1O92 A;  2HHH C;  1V60 A;  3UEB A;  3UOW A;  1HR0 C;  4LF9 C;  4JI3 C;  5LMN C;  5K8F A;  4TPS B;  1XMO C;  3NI2 A;  4GXQ A;  4R0M A;  3TQI A;  1K0R A;  4JM1 A;  2MM9 A;  4JI8 C;  4YY3 C;  3IEV A;  5A1I A;  3T1Y C;  2F4V C;  5BUR A;  3N54 B;  2WP0 C;  2QVZ X;  4DR5 C;  3O2E A;  2QVX X;  4EAT A;  5A19 A;  4BCA A;  2P20 A;  1MD9 A;  2VSQ A;  5LMU C;  2V7B A;  1RY2 A;  4X64 C;  2YX1 A;  1V26 A;  2YCB A;  1ULT A;  1HNX C;  2CXC A;  5K85 A;  3VNR A;  2UUB C;  5T8S A;  1T5H X;  4DV6 C;  2OO4 A;  1O9T A;  4DR1 C;  2ZZM A;  2WD9 A;  3A26 A;  1N33 C;  1YJ7 A;  4L7I A;  4DV0 C;  2JMP A;  5A2Q D;  1M6X C;  2E5L C;  4DCU A;  4D4I A;  3PBK A;  5BSW A;  2QW0 X;  2PRO A;  2OPL B;  4KTT A;  3RG2 A;  3C5E A;  4D56 A;  5ADZ A;  2VQE C;  4HPV A;  1WCJ A;  3EQ6 A;  1HNZ C;  3FCC A;  5IT9 D;  4IZ6 A;  1MDB A;  4DR4 C;  1MXA A;  2E0G A;  2D27 A;  4DV4 C;  2BJO A;  4X66 C;  4RVO A;  4ISB A;  1V25 A;  4BC9 A;  3N2Q A;  2E8E A;  4B3T C;  4I9G A;  3J81 D;  3R9W A;  5BUQ A;  3VNQ A;  2KDN A;  3B7W A;  1ML8 A;  4RVN A;  3NYR A;  4D4G A;  2YWC A;  4JI5 C;  4BC7 A;  4G1I A;  2CU6 A;  2OBV A;  1XRA A;  4PHT A;  4LF6 C;  4JYA C;  4RLF A;  3CJE A;  5LCI A;  3DAY A;  4DCT A;  4NXN C;  3TDE A;  4DUZ C;  1MXB A;  1KKG A;  2UUA C;  2JNV A;  3AF6 A;  2Y27 A;  1GPM A;  2D1T A;  1UKK A;  2QVY X;  4RM3 A;  3ETC A;  3AY0 A;  3UX2 A;  1XNR C;  5BSU A;  1HH2 P;  3IPL A;  4GKK C;  4FUQ A;  2M5H A;  3DHV A;  2P2Q A;  3UZ0 A;  1MXC A;  4MH4 A;  4BSZ A;  4OYC A;  1QWI A;  2UXD C;  2DYJ A;  3NPD A;  4LFC C;  3GR1 A;  3A4I A;  1LQL A;  3GKU A;  2ONF A;  2PT7 G;  4FTF A;  1I94 C;  1N2F A;  1QM4 A;  3S82 A;  2P2B A;  3CQ3 A;  3ETO A;  2P2F A;  4K0K C;  3UX3 A;  4LF5 C;  3EER A;  3GR0 A;  3LAX A;  1IBM C;  5IFI A;  3RV2 A;  4PZP A;  4L4Q A;  1XS3 A;  4DUY C;  2E7G A;  1TH5 A;  4R1L A;  4DV1 C;  2KZ0 A;  1P4E C;  3A9V A;  4GS5 A;  1O93 A;  4ZJZ A;  4ODJ A;  3TR3 A;  4DR6 C;  4JI6 C;  4NXM C;  5T8T A;  1XNQ C;  5CZV A;  2UU9 C;  5AE1 A;  4OXI A;  4X65 C;  2VQF C;  4DCV A;  4PUG A;  1UWD A;  1AMU A;  3PRO C;  4B3R C;  2D1Q A;  4DCS A;  1P7L A;  5JRH A;  4YHH C;  1MDF A;  3DLP X;  3I07 A;  5CZX A;  4B3S C;  1BA3 A;  4KTV A;  4RMN A;  3VNS A;  2ZM6 C;  4LFB C;  4G37 A;  2BH1 X;  4DG9 A;  2ASB A;  3JAM D;  5A1G A;  1VLA A;  4DV2 C;  4DR2 C;  2E8F A;  1XHJ A;  1IBL C;  3AF5 A;  5BR8 C;  4JV5 C;  1PU1 A;  3R44 A;  3L95 X;  3L8C A;  2DHM A;  1IBK C;  2D28 C;  4K0B A;  3FCE A;  1WH9 A;  4LE5 A;  2Y4N A;  3CW9 A;  3CQ2 A;  1T5D X;  3LUS A;  4PUH A;  2UUC C;  4JI1 C;  3E7X A;  2P2M A;  2D1S A;  3LGX A;  2ZZN A;  4LF8 C;  3E7W A;  3R9X A;  3H2T A;  4BBY A;  3NYQ A;  2P2J A;  4LF7 C;  4RM2 A;  4ZLP A;  4RLQ A;  5BST A;  4DV3 C;  2D1R A;  4DV7 C;  1NY8 A;  2PN2 A;  2KZF A;  2UXC C;  2AYA A;  3PES A;  1HNW C;  1J5E C;  4GKJ C;  4DG8 A;  4XX2 A;  2NCL A;  1PG3 A;  1PA4 A;  2M5O A;  4AQY C;  3G7S A;  4IR7 A;  2DPL A;  5E7Q A;  1IB8 A;  2Y4O A;  3LNO A;  1N34 C;  3CW8 X;  4KHP C;  1M6X A;  1XRB A;  1EGA A;  2OPL A;  4NDN A;  2CY1 A;  4PRO C;  5AE2 A;  1WF3 A;  4D57 A;  5KYV A;  1P4E A;  5BUS A;  3I08 A;  4OX9 C;  4FUT A;  5IWA C;  5FLX D;  5KEI A;  4MTN A;  2P02 A;  4X62 C;  4G36 A;  2VZE A;  4NOZ A;  4B3M C;  4JI7 C;  4R1M A;  4U5Y D;  3A9U A;  4LFA C;  1FUG A;  1FJG C;  5BSV A;  3IEU A;  4L2Z A;  3T1H C;  1NYE A;  4WV3 A;  3CQ1 A;  1XRC A;  1O90 A;  3IML A;  3LNV A;  2QL8 A;  1N36 C;  4JI0 C; 
#chains in the Genus database with same CATH homology
 3UX2 A;  3CQ1 A;  2M5O A;  3CQ2 A;  1WCJ A;  3UX3 A;  1TH5 A;  1VEH A;  2Z51 A;  2JNV A;  1UWD A;  3CQ3 A;  1XHJ A;  2M5H A;  2CU6 A;  3LNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...