1WCJA

Conserved hypothetical protein tm0487 from thermotoga maritima
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
102
structure length
102
Chain Sequence
MSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN TM0487
publication title NMR Structure of the Conserved Hypothetical Protein Tm0487 from Thermotoga Maritima: Implications for 216 Homologous Duf59 Proteins.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 26
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1wcjA00
2CU6A 2Z51A 3CQ1A 2M5HA 1XHJA 2JNVA 1VEHA 3UX2A 1WCJA 3UX3A 3CQ2A 3CQ3A 3LNOA 1UWDA 1TH5A 2M5OA
chains in the Genus database with same CATH superfamily
4KTVA 4X66C 4FUQA 3IEVA 4B3RC 3ETCA 2VQFC 2CU6A 4RLQA 5DV9A 4L4QA 3VNSA 3L8CA 3DLPX 3EERA 2JMPA 5CZVA 4DUYC 4HPVA 2MCQA 3SO4A 2QVZX 4LFBC 4D4GA 4JYAC 5H9UA 2Z51A 3GR1A 1J5EC 4GS5A 4ODJA 3UX2A 4LFCC 1P7LA 4K0KC 4DG8A 4LF8C 4LF5C 5BUSA 1MXCA 2QW0X 3TR3A 2ZM6C 1JOSA 2KDNA 2E5LC 3IEUA 1NY8A 1XNQC 4BBYA 5KEIA 2YCBA 1FJGC 1VEHA 2KZ0A 1XMOC 4TPSB 1FLOA 2ZZNA 1HNZC 5BSRA 4X65C 2D28C 1PG4A 2HJGA 1PA4A 2NCLA 3A25A 3TUFA 4JI8C 2PN2A 1TH5A 5AE3A 4RM3A 1L2FA 4DCTA 4IR7A 5E7QA 4I9GA 5KYTA 3NYQA 4YY3C 1IBKC 3A9UA 4FTFA 5K85A 4B3TC 3IMLA 3DAYA 3J81D 4DR1C 4JI4C 4D57A 3T1HC 4DCSA 3CW9A 1MD9A 3E7XA 4ISBA 5BSMA 2YWCA 3J80D 2DHMA 3H2TA 2OPLB 1M6XA 3EQ6A 4BC7A 4WV3A 4LFAC 1P4EA 1ULTA 4PUGA 1WF3A 4X64C 4WS9A 4G36A 4DV5C 2P20A 3LNVA 3KXWA 3I08A 5A2QD 3N2QA 5LMUC 1LCIA 3UX3A 2P2QA 4RLFA 4DV1C 1GPMA 4BC9A 3CQ1A 5K8FA 4B3SC 1IBMC 2DYJA 5A1GA 5KYVA 2UXBC 4D56A 3A4IA 5BURA 4L7IA 3NI2A 1XS3A 4L2ZA 1N32C 1N33C 2D1SA 1XMQC 3NPDA 4ZJZA 2D7VA 2ONFA 3PESA 2WD9A 2UXCC 2HHHC 1PU1A 1N36C 5BUQA 4LE5A 4ZLPA 2BH1X 4NXNC 1T5HX 2D1TA 1UKKA 5LMNC 1FUGA 3NYRA 3DHVA 4DV4C 1PG3A 3CQ3A 5A19A 2UUBC 2P2MA 1HH2P 4LF9C 4JM1A 5BSUA 3TQIA 4DUZC 2OO4A 5IFIA 4OYCA 1O90A 2BJOA 1V25A 1WCJA 3FCCA 5BSTA 2V7BA 3LNOA 4JV5C 1MDFA 2P2BA 4DR5C 4PHTA 3A9VA 3K6RA 4JI0C 4YHHC 4DCVA 2XR1A 1MKYA 5AE2A 4NOZA 1QM4A 4G37A 1HR0C 3LGXA 5CZXA 3JAMD 1XNRC 3O2EA 1AMUA 3L95X 4RMNA 4DR4C 4KHPC 4NDNA 3IPLA 2P02A 2QVYX 2Y4OA 1YJ7A 3AF5A 4DV6C 2EGTA 2UUAC 2MMAB 3RV2A 1WH9A 3OTOC 1KKGA 2E8EA 2E8CA 2DPLA 4RVOA 2KZFA 4PZPA 4DV7C 4DV2C 4DR7C 3LAXA 3G7SA 2MM9A 3CQ2A 4LF7C 2AYAA 4JI3C 4MH4A 2ATWA 3R44A 1ML8A 5IT9D 2VQEC 1USPA 3VNQA 3R9XA 4B3MC 1MXAA 2OBVA 3B7WA 1XRCA 4MTNA 3GKUA 1IB8A 1ZB8A 2E7GA 4GXQA 1VLAA 4KTTA 4G1IA 3LUSA 3RG2A 2E8FA 4RVNA 2VZEA 4I9FA 1ZB9A 3T1YC 2M5OA 4DR2C 4RM2A 1K0RA 4JI7C 4OX9C 4D4IA 1N2FA 4LF6C 4IZ6A 5BSVA 3AY0A 4FUTA 4PROC 2PROA 4DG9A 2UU9C 1O93A 3GR0A 2D1RA 1QWIA 1EGAA 1O9TA 4U5YD 4LF4C 4PUIA 4GKKC 3VNRA 3TDEA 3S82A 2UXDC 5GTDA 2OPLA 1XRBA 2P2FA 3UZ0A 4DR3C 2ZZMA 2WP0C 5IWAC 4BCAA 1HNWC 1USPB 2QL8A 4DV0C 4DV3C 3N54B 1MDBA 4JI1C 2QVXX 1O92A 2YX1A 1MXBA 1N34C 1BA3A 1RY2A 2M5HA 4DR6C 2VSQA 3PBKA 1UWDA 1RG9A 3E7WA 5JRHA 3R9WA 4GXRA 1V60A 4PUHA 4R0MA 1IBLC 3PROC 3A26A 4GKJC 4R1LA 3UOWA 2CXCA 1XHJA 1V26A 2CY1A 2F4VC 2Y27A 1LQLA 2UUCC 1M6XC 4EATA 2D1QA 3GPCA 2PT7G 4JI5C 1NYEA 1P4EC 3ETOA 3FCEA 4BSZA 1I94C 2E0GA 2ASBA 2Y4NA 2JNVA 5BR8C 4DCUA 4JI6C 4X62C 5T8TA 3CJEA 3C5EA 1XRAA 2YWBA 1T5DX 4JI2C 4NXMC 4R1MA 4XX2A 5LCIA 5ADZA 5BSWA 4K0BA 2P2JA 5T8SA 3I07A 3UEBA 3AF6A 5AE1A 4OXIA 2D27A 5A1IA 5FLXD 1HNXC 3CW8X 4AQYC
chains in the Genus database with same CATH topology
2CU6A 2Z51A 3CQ1A 2M5HA 1XHJA 2JNVA 1VEHA 3UX2A 1WCJA 3UX3A 3CQ2A 3CQ3A 3LNOA 1UWDA 1TH5A 2M5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU6 A;  2Z51 A;  3CQ1 A;  2M5H A;  1XHJ A;  2JNV A;  1VEH A;  3UX2 A;  1WCJ A;  3UX3 A;  3CQ2 A;  3CQ3 A;  3LNO A;  1UWD A;  1TH5 A;  2M5O A; 
#chains in the Genus database with same CATH topology
 4KTV A;  4X66 C;  4FUQ A;  3IEV A;  4B3R C;  3ETC A;  2VQF C;  2CU6 A;  4RLQ A;  5DV9 A;  4L4Q A;  3VNS A;  3L8C A;  3DLP X;  3EER A;  2JMP A;  5CZV A;  4DUY C;  4HPV A;  2MCQ A;  3SO4 A;  2QVZ X;  4LFB C;  4D4G A;  4JYA C;  5H9U A;  2Z51 A;  3GR1 A;  1J5E C;  4GS5 A;  4ODJ A;  3UX2 A;  4LFC C;  1P7L A;  4K0K C;  4DG8 A;  4LF8 C;  4LF5 C;  5BUS A;  1MXC A;  2QW0 X;  3TR3 A;  2ZM6 C;  1JOS A;  2KDN A;  2E5L C;  3IEU A;  1NY8 A;  1XNQ C;  4BBY A;  5KEI A;  2YCB A;  1FJG C;  1VEH A;  2KZ0 A;  1XMO C;  4TPS B;  1FLO A;  2ZZN A;  1HNZ C;  5BSR A;  4X65 C;  2D28 C;  1PG4 A;  2HJG A;  1PA4 A;  2NCL A;  3A25 A;  3TUF A;  4JI8 C;  2PN2 A;  1TH5 A;  5AE3 A;  4RM3 A;  1L2F A;  4DCT A;  4IR7 A;  5E7Q A;  4I9G A;  5KYT A;  3NYQ A;  4YY3 C;  1IBK C;  3A9U A;  4FTF A;  5K85 A;  4B3T C;  3IML A;  3DAY A;  3J81 D;  4DR1 C;  4JI4 C;  4D57 A;  3T1H C;  4DCS A;  3CW9 A;  1MD9 A;  3E7X A;  4ISB A;  5BSM A;  2YWC A;  3J80 D;  2DHM A;  3H2T A;  2OPL B;  1M6X A;  3EQ6 A;  4BC7 A;  4WV3 A;  4LFA C;  1P4E A;  1ULT A;  4PUG A;  1WF3 A;  4X64 C;  4WS9 A;  4G36 A;  4DV5 C;  2P20 A;  3LNV A;  3KXW A;  3I08 A;  5A2Q D;  3N2Q A;  5LMU C;  1LCI A;  3UX3 A;  2P2Q A;  4RLF A;  4DV1 C;  1GPM A;  4BC9 A;  3CQ1 A;  5K8F A;  4B3S C;  1IBM C;  2DYJ A;  5A1G A;  5KYV A;  2UXB C;  4D56 A;  3A4I A;  5BUR A;  4L7I A;  3NI2 A;  1XS3 A;  4L2Z A;  1N32 C;  1N33 C;  2D1S A;  1XMQ C;  3NPD A;  4ZJZ A;  2D7V A;  2ONF A;  3PES A;  2WD9 A;  2UXC C;  2HHH C;  1PU1 A;  1N36 C;  5BUQ A;  4LE5 A;  4ZLP A;  2BH1 X;  4NXN C;  1T5H X;  2D1T A;  1UKK A;  5LMN C;  1FUG A;  3NYR A;  3DHV A;  4DV4 C;  1PG3 A;  3CQ3 A;  5A19 A;  2UUB C;  2P2M A;  1HH2 P;  4LF9 C;  4JM1 A;  5BSU A;  3TQI A;  4DUZ C;  2OO4 A;  5IFI A;  4OYC A;  1O90 A;  2BJO A;  1V25 A;  1WCJ A;  3FCC A;  5BST A;  2V7B A;  3LNO A;  4JV5 C;  1MDF A;  2P2B A;  4DR5 C;  4PHT A;  3A9V A;  3K6R A;  4JI0 C;  4YHH C;  4DCV A;  2XR1 A;  1MKY A;  5AE2 A;  4NOZ A;  1QM4 A;  4G37 A;  1HR0 C;  3LGX A;  5CZX A;  3JAM D;  1XNR C;  3O2E A;  1AMU A;  3L95 X;  4RMN A;  4DR4 C;  4KHP C;  4NDN A;  3IPL A;  2P02 A;  2QVY X;  2Y4O A;  1YJ7 A;  3AF5 A;  4DV6 C;  2EGT A;  2UUA C;  2MMA B;  3RV2 A;  1WH9 A;  3OTO C;  1KKG A;  2E8E A;  2E8C A;  2DPL A;  4RVO A;  2KZF A;  4PZP A;  4DV7 C;  4DV2 C;  4DR7 C;  3LAX A;  3G7S A;  2MM9 A;  3CQ2 A;  4LF7 C;  2AYA A;  4JI3 C;  4MH4 A;  2ATW A;  3R44 A;  1ML8 A;  5IT9 D;  2VQE C;  1USP A;  3VNQ A;  3R9X A;  4B3M C;  1MXA A;  2OBV A;  3B7W A;  1XRC A;  4MTN A;  3GKU A;  1IB8 A;  1ZB8 A;  2E7G A;  4GXQ A;  1VLA A;  4KTT A;  4G1I A;  3LUS A;  3RG2 A;  2E8F A;  4RVN A;  2VZE A;  4I9F A;  1ZB9 A;  3T1Y C;  2M5O A;  4DR2 C;  4RM2 A;  1K0R A;  4JI7 C;  4OX9 C;  4D4I A;  1N2F A;  4LF6 C;  4IZ6 A;  5BSV A;  3AY0 A;  4FUT A;  4PRO C;  2PRO A;  4DG9 A;  2UU9 C;  1O93 A;  3GR0 A;  2D1R A;  1QWI A;  1EGA A;  1O9T A;  4U5Y D;  4LF4 C;  4PUI A;  4GKK C;  3VNR A;  3TDE A;  3S82 A;  2UXD C;  5GTD A;  2OPL A;  1XRB A;  2P2F A;  3UZ0 A;  4DR3 C;  2ZZM A;  2WP0 C;  5IWA C;  4BCA A;  1HNW C;  1USP B;  2QL8 A;  4DV0 C;  4DV3 C;  3N54 B;  1MDB A;  4JI1 C;  2QVX X;  1O92 A;  2YX1 A;  1MXB A;  1N34 C;  1BA3 A;  1RY2 A;  2M5H A;  4DR6 C;  2VSQ A;  3PBK A;  1UWD A;  1RG9 A;  3E7W A;  5JRH A;  3R9W A;  4GXR A;  1V60 A;  4PUH A;  4R0M A;  1IBL C;  3PRO C;  3A26 A;  4GKJ C;  4R1L A;  3UOW A;  2CXC A;  1XHJ A;  1V26 A;  2CY1 A;  2F4V C;  2Y27 A;  1LQL A;  2UUC C;  1M6X C;  4EAT A;  2D1Q A;  3GPC A;  2PT7 G;  4JI5 C;  1NYE A;  1P4E C;  3ETO A;  3FCE A;  4BSZ A;  1I94 C;  2E0G A;  2ASB A;  2Y4N A;  2JNV A;  5BR8 C;  4DCU A;  4JI6 C;  4X62 C;  5T8T A;  3CJE A;  3C5E A;  1XRA A;  2YWB A;  1T5D X;  4JI2 C;  4NXM C;  4R1M A;  4XX2 A;  5LCI A;  5ADZ A;  5BSW A;  4K0B A;  2P2J A;  5T8S A;  3I07 A;  3UEB A;  3AF6 A;  5AE1 A;  4OXI A;  2D27 A;  5A1I A;  5FLX D;  1HNX C;  3CW8 X;  4AQY C; 
#chains in the Genus database with same CATH homology
 2CU6 A;  2Z51 A;  3CQ1 A;  2M5H A;  1XHJ A;  2JNV A;  1VEH A;  3UX2 A;  1WCJ A;  3UX3 A;  3CQ2 A;  3CQ3 A;  3LNO A;  1UWD A;  1TH5 A;  2M5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...