4ODJA

Crystal structure of a putative s-adenosylmethionine synthetase from cryptosporidium hominis in complex with s-adenosyl-methionine
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
Knots found
sequence length
386
structure length
386
Chain Sequence
EQFLFSSESVCSGHPDKLCDQISDAILDACLEQDPESFVACETCTKTGFIMVFGEITTKANVNYERVVRETVKEIGYDSEEKGLDYKTMDVIIKLEQQSNQIAGCVHVDKNVEDIGAGDQGMMFGYATNETKELMPLTHVLATSITRELDYIRMKGVSSRVGWLRPDGKAQVTVEYNCKHGVLIPKRIHTILVSVQHDENIENEEIREFVLENVIKKVCPSDLMDKETRILINPSGRFTIGGPAADAGLTGRKIIVDTYGGWGAHGGGAFSGKDATKVDRSGAYMARLVAKSIVFSGLCSRCLVQVSYGIGIARPLSLYINTFGTAKDGYNDTKLLEIVNKVFDFRPGILIKQLNLKSPIFKKTSSGGHFGRSEKEFLWEKPIILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
publication title Crystal structure of a putative S-adenosylmethionine synthetase from Cryptosporidium hominis in complex with S-adenosyl-methionine
rcsb
source organism Cryptosporidium hominis
total genus 135
structure length 386
sequence length 386
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4odjA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4odjA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4odjA03
5T8SA 3UOWA 2P02A 4NDNA 3A4IA 3SO4A 5A1IA 1FUGA 4HPVA 5A1GA 2YWCA 3TQIA 1GPMA 5H9UA 3TDEA 1O9TA 4L2ZA 1RG9A 4L7IA 3RV2A 1MXAA 4K0BA 1XRAA 1O90A 1MXBA 2YWBA 4L4QA 4LE5A 3S82A 2DPLA 4KTTA 1O92A 1P7LA 2OBVA 1QM4A 1XRBA 1XRCA 3IMLA 5T8TA 1O93A 4ODJA 1MXCA 4KTVA 5A19A 4WS9A
chains in the Genus database with same CATH superfamily
2Y27A 4FTFA 4LF6C 4LF8C 3SO4A 1HH2P 3I07A 3L95X 4NXMC 1QWIA 5BR8C 1I94C 4DR1C 4DV1C 1V25A 3GR1A 4IZ6A 4ODJA 2M5HA 3LGXA 4G37A 4NXNC 3EQ6A 3UOWA 5BSMA 4OXIA 3LUSA 5A1GA 3OTOC 2P20A 2YWCA 3PBKA 1PG3A 1LQLA 2VZEA 4GS5A 4JI6C 1EGAA 3IEUA 2D7VA 2OPLA 3S82A 4BC7A 4MTNA 3IEVA 4NOZA 5CZXA 1FLOA 4ZLPA 5KEIA 3VNSA 5LMNC 2UXDC 1MKYA 5K8FA 5IT9D 4RMNA 2MMAB 2E8CA 5E7QA 4AQYC 5LCIA 3TUFA 1T5HX 1YJ7A 2Z51A 5JRHA 1K0RA 4GKKC 5A19A 1PA4A 1WCJA 1V60A 3GKUA 3LNOA 5BUQA 5A1IA 1M6XC 4JI4C 2D1TA 3RV2A 4DUYC 4OYCA 1M6XA 1PU1A 3L8CA 4BCAA 2OBVA 2CXCA 3FCEA 1RY2A 1QM4A 4FUTA 5T8TA 4GXQA 1AMUA 1IBMC 5AE2A 4MH4A 1T5DX 5BSWA 1XS3A 3A4IA 2XR1A 4XX2A 4B3MC 1NY8A 1N36C 2E5LC 1P4EC 1RG9A 4DCTA 2CU6A 5BURA 2ONFA 2DHMA 3ETCA 5IFIA 2UUBC 5LMUC 4JI5C 4JV5C 3AF5A 5KYTA 4EATA 4YY3C 3R44A 2V7BA 2ASBA 4RLFA 4WV3A 1FUGA 1WH9A 3N54B 4RM3A 4JI1C 3NI2A 4B3RC 4JM1A 4L4QA 2E0GA 2MM9A 3UEBA 2DPLA 3VNQA 1P7LA 3CQ3A 2ATWA 4DV4C 3NYQA 1N33C 1KKGA 2D1RA 5T8SA 5AE1A 4NDNA 3CQ2A 4RLQA 1XMOC 1GPMA 2P2JA 4PHTA 3A9UA 4L2ZA 1MXAA 1TH5A 5GTDA 2OPLB 2OO4A 1XRCA 2YX1A 3T1HC 1HNZC 1XMQC 3H2TA 2VQEC 3CJEA 2JNVA 4HPVA 3E7XA 5CZVA 3PESA 4DV5C 4DG9A 2UU9C 5BSTA 4RVNA 1O90A 3PROC 4I9FA 4X65C 2BH1X 4D4IA 5BSVA 4DG8A 5K85A 2HHHC 4DV3C 4PUHA 3UX3A 2QL8A 1NYEA 2ZZNA 4DV2C 2P2MA 4LFCC 3CW9A 4ZJZA 3I08A 3AF6A 2QVYX 4DCUA 5AE3A 2D1SA 3A26A 2WD9A 3DHVA 2E8EA 2PROA 4D4GA 4DCVA 4BC9A 2EGTA 3LNVA 5KYVA 5ADZA 4LF9C 4PUGA 5FLXD 2KZFA 2P2FA 1UWDA 3TDEA 1O9TA 2F4VC 1VEHA 4L7IA 4RVOA 4DR2C 1IBKC 2ZM6C 3DAYA 1N32C 4I9GA 2D1QA 3ETOA 4JI7C 3GR0A 5BSRA 5DV9A 2E7GA 2QW0X 1P4EA 4TPSB 1N2FA 4B3TC 1MDFA 3KXWA 2MCQA 4DUZC 1MXCA 3R9WA 3LAXA 4G36A 3N2QA 1WF3A 3UX2A 3JAMD 3FCCA 4X62C 3J81D 3UZ0A 3G7SA 2ZZMA 3NYRA 1ML8A 3TR3A 2YWBA 4GKJC 4LFBC 2P2QA 2UXCC 2JMPA 3CQ1A 2CY1A 1XRBA 2NCLA 3GPCA 2UXBC 1MD9A 4R1MA 4WS9A 2KDNA 2QVXX 4BSZA 5A2QD 2VQFC 4LF5C 1HNXC 4LF7C 1USPA 2P2BA 1XNRC 1USPB 3VNRA 3NPDA 1ULTA 4DR7C 4K0BA 1V26A 4RM2A 4DR5C 3RG2A 3C5EA 1FJGC 1ZB9A 2UUAC 4PROC 4PZPA 4X66C 4JI2C 2D27A 4JI0C 4DR4C 4ISBA 1HR0C 2VSQA 2DYJA 4KTTA 4BBYA 4JI8C 2PT7G 2YCBA 3R9XA 3CW8X 4FUQA 4U5YD 4DR3C 1N34C 2P02A 3K6RA 2M5OA 1IB8A 2Y4NA 2E8FA 2QVZX 4DCSA 3T1YC 3TQIA 5H9UA 2Y4OA 3EERA 4R1LA 3A25A 1HNWC 4IR7A 1XRAA 3O2EA 1JOSA 1PG4A 4LE5A 4B3SC 1XNQC 3B7WA 4OX9C 3IMLA 1O93A 5IWAC 5BSUA 4KHPC 3IPLA 4DR6C 4LFAC 1LCIA 4GXRA 1VLAA 3DLPX 2AYAA 4DV0C 3A9VA 2HJGA 4DV7C 3E7WA 4YHHC 4LF4C 5BUSA 1ZB8A 1O92A 1BA3A 4D56A 4JI3C 2KZ0A 4DV6C 2WP0C 4KTVA 2UUCC 2PN2A 1L2FA 4R0MA 4K0KC 1IBLC 1UKKA 4D57A 3J80D 1XHJA 1MXBA 1MDBA 4X64C 4G1IA 2D28C 3AY0A 4PUIA 4JYAC 2BJOA 1J5EC
chains in the Genus database with same CATH topology
2Y27A 4FTFA 4LF6C 4LF8C 3SO4A 1HH2P 3I07A 3L95X 4NXMC 1QWIA 5BR8C 1I94C 4DR1C 4DV1C 1V25A 3GR1A 4IZ6A 4ODJA 3LGXA 4G37A 4NXNC 3EQ6A 3UOWA 5BSMA 4OXIA 3LUSA 5A1GA 3OTOC 2P20A 2YWCA 3PBKA 1PG3A 1LQLA 2VZEA 4GS5A 4JI6C 1EGAA 3IEUA 2D7VA 2OPLA 3S82A 4BC7A 4MTNA 3IEVA 4NOZA 5CZXA 4ZLPA 5KEIA 3VNSA 5LMNC 2UXDC 1MKYA 5K8FA 5IT9D 4RMNA 2E8CA 5E7QA 4AQYC 3TUFA 1T5HX 1YJ7A 5JRHA 1K0RA 4GKKC 5A19A 1PA4A 3GKUA 5BUQA 5A1IA 4JI4C 2D1TA 3RV2A 4DUYC 4OYCA 3L8CA 4BCAA 2OBVA 2CXCA 3FCEA 1RY2A 1QM4A 4FUTA 5T8TA 4GXQA 1AMUA 1IBMC 5AE2A 4MH4A 1T5DX 5BSWA 3A4IA 2XR1A 4XX2A 4B3MC 1N36C 2E5LC 1RG9A 4DCTA 5BURA 2ONFA 3ETCA 5IFIA 2UUBC 5LMUC 4JI5C 4JV5C 3AF5A 5KYTA 4EATA 4YY3C 3R44A 2V7BA 2ASBA 4RLFA 4WV3A 1FUGA 1WH9A 3N54B 4RM3A 4JI1C 3NI2A 4B3RC 4JM1A 4L4QA 2E0GA 2DPLA 3VNQA 1P7LA 2ATWA 4DV4C 3NYQA 1N33C 1KKGA 2D1RA 5T8SA 5AE1A 4NDNA 4RLQA 1XMOC 1GPMA 2P2JA 4PHTA 3A9UA 4L2ZA 1MXAA 5GTDA 2OPLB 2OO4A 1XRCA 3T1HC 1HNZC 1XMQC 3H2TA 2VQEC 3CJEA 4HPVA 3E7XA 5CZVA 3PESA 4DV5C 4DG9A 2UU9C 5BSTA 4RVNA 1O90A 3PROC 4I9FA 4X65C 2BH1X 4D4IA 5BSVA 4DG8A 5K85A 2HHHC 4DV3C 2QL8A 1NYEA 4DV2C 2P2MA 4LFCC 3CW9A 4ZJZA 3I08A 3AF6A 2QVYX 4DCUA 5AE3A 2D1SA 2WD9A 3DHVA 2E8EA 2PROA 4D4GA 4DCVA 2EGTA 3LNVA 5KYVA 4BC9A 5ADZA 4LF9C 5FLXD 2KZFA 2P2FA 3TDEA 1O9TA 2F4VC 4L7IA 4RVOA 4DR2C 1IBKC 2ZM6C 3DAYA 1N32C 4I9GA 2D1QA 3ETOA 4JI7C 3GR0A 5BSRA 5DV9A 2E7GA 2QW0X 4TPSB 1N2FA 4B3TC 1MDFA 3KXWA 4DUZC 1MXCA 3R9WA 3LAXA 4G36A 3N2QA 1WF3A 3JAMD 3FCCA 4X62C 3J81D 3UZ0A 3G7SA 3NYRA 1ML8A 2YWBA 4GKJC 4LFBC 2P2QA 2UXCC 2JMPA 2CY1A 1XRBA 3GPCA 2UXBC 1MD9A 4R1MA 4WS9A 2QVXX 4BSZA 5A2QD 2VQFC 4LF5C 1HNXC 4LF7C 1USPA 2P2BA 1XNRC 1USPB 3VNRA 3NPDA 1ULTA 4DR7C 4K0BA 1V26A 4RM2A 4DR5C 3RG2A 3C5EA 1FJGC 1ZB9A 2UUAC 4PROC 4PZPA 4X66C 4JI2C 2D27A 4JI0C 4DR4C 4ISBA 1HR0C 2VSQA 2DYJA 4KTTA 4BBYA 4JI8C 2PT7G 2YCBA 3R9XA 3CW8X 4FUQA 4U5YD 4DR3C 1N34C 2P02A 2Y4NA 2E8FA 2QVZX 4DCSA 3T1YC 3TQIA 5H9UA 2Y4OA 3EERA 4R1LA 1HNWC 4IR7A 1XRAA 1JOSA 1PG4A 4LE5A 4B3SC 1XNQC 3B7WA 4OX9C 3IMLA 1O93A 5IWAC 5BSUA 4KHPC 3IPLA 4DR6C 4LFAC 1LCIA 4GXRA 1VLAA 3DLPX 2AYAA 4DV0C 3A9VA 2HJGA 4DV7C 3E7WA 4YHHC 4LF4C 5BUSA 1ZB8A 1O92A 1BA3A 4D56A 4JI3C 4DV6C 2WP0C 4KTVA 2UUCC 2PN2A 1L2FA 4R0MA 4K0KC 1IBLC 1UKKA 4D57A 3J80D 1MXBA 1MDBA 4X64C 4G1IA 2D28C 4JYAC 2BJOA 1J5EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T8S A;  3UOW A;  2P02 A;  4NDN A;  3A4I A;  3SO4 A;  5A1I A;  1FUG A;  4HPV A;  5A1G A;  2YWC A;  3TQI A;  1GPM A;  5H9U A;  3TDE A;  1O9T A;  4L2Z A;  1RG9 A;  4L7I A;  3RV2 A;  1MXA A;  4K0B A;  1XRA A;  1O90 A;  1MXB A;  2YWB A;  4L4Q A;  4LE5 A;  3S82 A;  2DPL A;  4KTT A;  1O92 A;  1P7L A;  2OBV A;  1QM4 A;  1XRB A;  1XRC A;  3IML A;  5T8T A;  1O93 A;  4ODJ A;  1MXC A;  4KTV A;  5A19 A;  4WS9 A; 
#chains in the Genus database with same CATH topology
 2Y27 A;  4FTF A;  4LF6 C;  4LF8 C;  3SO4 A;  1HH2 P;  3I07 A;  3L95 X;  4NXM C;  1QWI A;  5BR8 C;  1I94 C;  4DR1 C;  4DV1 C;  1V25 A;  3GR1 A;  4IZ6 A;  4ODJ A;  2M5H A;  3LGX A;  4G37 A;  4NXN C;  3EQ6 A;  3UOW A;  5BSM A;  4OXI A;  3LUS A;  5A1G A;  3OTO C;  2P20 A;  2YWC A;  3PBK A;  1PG3 A;  1LQL A;  2VZE A;  4GS5 A;  4JI6 C;  1EGA A;  3IEU A;  2D7V A;  2OPL A;  3S82 A;  4BC7 A;  4MTN A;  3IEV A;  4NOZ A;  5CZX A;  1FLO A;  4ZLP A;  5KEI A;  3VNS A;  5LMN C;  2UXD C;  1MKY A;  5K8F A;  5IT9 D;  4RMN A;  2MMA B;  2E8C A;  5E7Q A;  4AQY C;  5LCI A;  3TUF A;  1T5H X;  1YJ7 A;  2Z51 A;  5JRH A;  1K0R A;  4GKK C;  5A19 A;  1PA4 A;  1WCJ A;  1V60 A;  3GKU A;  3LNO A;  5BUQ A;  5A1I A;  1M6X C;  4JI4 C;  2D1T A;  3RV2 A;  4DUY C;  4OYC A;  1M6X A;  1PU1 A;  3L8C A;  4BCA A;  2OBV A;  2CXC A;  3FCE A;  1RY2 A;  1QM4 A;  4FUT A;  5T8T A;  4GXQ A;  1AMU A;  1IBM C;  5AE2 A;  4MH4 A;  1T5D X;  5BSW A;  1XS3 A;  3A4I A;  2XR1 A;  4XX2 A;  4B3M C;  1NY8 A;  1N36 C;  2E5L C;  1P4E C;  1RG9 A;  4DCT A;  2CU6 A;  5BUR A;  2ONF A;  2DHM A;  3ETC A;  5IFI A;  2UUB C;  5LMU C;  4JI5 C;  4JV5 C;  3AF5 A;  5KYT A;  4EAT A;  4YY3 C;  3R44 A;  2V7B A;  2ASB A;  4RLF A;  4WV3 A;  1FUG A;  1WH9 A;  3N54 B;  4RM3 A;  4JI1 C;  3NI2 A;  4B3R C;  4JM1 A;  4L4Q A;  2E0G A;  2MM9 A;  3UEB A;  2DPL A;  3VNQ A;  1P7L A;  3CQ3 A;  2ATW A;  4DV4 C;  3NYQ A;  1N33 C;  1KKG A;  2D1R A;  5T8S A;  5AE1 A;  4NDN A;  3CQ2 A;  4RLQ A;  1XMO C;  1GPM A;  2P2J A;  4PHT A;  3A9U A;  4L2Z A;  1MXA A;  1TH5 A;  5GTD A;  2OPL B;  2OO4 A;  1XRC A;  2YX1 A;  3T1H C;  1HNZ C;  1XMQ C;  3H2T A;  2VQE C;  3CJE A;  2JNV A;  4HPV A;  3E7X A;  5CZV A;  3PES A;  4DV5 C;  4DG9 A;  2UU9 C;  5BST A;  4RVN A;  1O90 A;  3PRO C;  4I9F A;  4X65 C;  2BH1 X;  4D4I A;  5BSV A;  4DG8 A;  5K85 A;  2HHH C;  4DV3 C;  4PUH A;  3UX3 A;  2QL8 A;  1NYE A;  2ZZN A;  4DV2 C;  2P2M A;  4LFC C;  3CW9 A;  4ZJZ A;  3I08 A;  3AF6 A;  2QVY X;  4DCU A;  5AE3 A;  2D1S A;  3A26 A;  2WD9 A;  3DHV A;  2E8E A;  2PRO A;  4D4G A;  4DCV A;  4BC9 A;  2EGT A;  3LNV A;  5KYV A;  5ADZ A;  4LF9 C;  4PUG A;  5FLX D;  2KZF A;  2P2F A;  1UWD A;  3TDE A;  1O9T A;  2F4V C;  1VEH A;  4L7I A;  4RVO A;  4DR2 C;  1IBK C;  2ZM6 C;  3DAY A;  1N32 C;  4I9G A;  2D1Q A;  3ETO A;  4JI7 C;  3GR0 A;  5BSR A;  5DV9 A;  2E7G A;  2QW0 X;  1P4E A;  4TPS B;  1N2F A;  4B3T C;  1MDF A;  3KXW A;  2MCQ A;  4DUZ C;  1MXC A;  3R9W A;  3LAX A;  4G36 A;  3N2Q A;  1WF3 A;  3UX2 A;  3JAM D;  3FCC A;  4X62 C;  3J81 D;  3UZ0 A;  3G7S A;  2ZZM A;  3NYR A;  1ML8 A;  3TR3 A;  2YWB A;  4GKJ C;  4LFB C;  2P2Q A;  2UXC C;  2JMP A;  3CQ1 A;  2CY1 A;  1XRB A;  2NCL A;  3GPC A;  2UXB C;  1MD9 A;  4R1M A;  4WS9 A;  2KDN A;  2QVX X;  4BSZ A;  5A2Q D;  2VQF C;  4LF5 C;  1HNX C;  4LF7 C;  1USP A;  2P2B A;  1XNR C;  1USP B;  3VNR A;  3NPD A;  1ULT A;  4DR7 C;  4K0B A;  1V26 A;  4RM2 A;  4DR5 C;  3RG2 A;  3C5E A;  1FJG C;  1ZB9 A;  2UUA C;  4PRO C;  4PZP A;  4X66 C;  4JI2 C;  2D27 A;  4JI0 C;  4DR4 C;  4ISB A;  1HR0 C;  2VSQ A;  2DYJ A;  4KTT A;  4BBY A;  4JI8 C;  2PT7 G;  2YCB A;  3R9X A;  3CW8 X;  4FUQ A;  4U5Y D;  4DR3 C;  1N34 C;  2P02 A;  3K6R A;  2M5O A;  1IB8 A;  2Y4N A;  2E8F A;  2QVZ X;  4DCS A;  3T1Y C;  3TQI A;  5H9U A;  2Y4O A;  3EER A;  4R1L A;  3A25 A;  1HNW C;  4IR7 A;  1XRA A;  3O2E A;  1JOS A;  1PG4 A;  4LE5 A;  4B3S C;  1XNQ C;  3B7W A;  4OX9 C;  3IML A;  1O93 A;  5IWA C;  5BSU A;  4KHP C;  3IPL A;  4DR6 C;  4LFA C;  1LCI A;  4GXR A;  1VLA A;  3DLP X;  2AYA A;  4DV0 C;  3A9V A;  2HJG A;  4DV7 C;  3E7W A;  4YHH C;  4LF4 C;  5BUS A;  1ZB8 A;  1O92 A;  1BA3 A;  4D56 A;  4JI3 C;  2KZ0 A;  4DV6 C;  2WP0 C;  4KTV A;  2UUC C;  2PN2 A;  1L2F A;  4R0M A;  4K0K C;  1IBL C;  1UKK A;  4D57 A;  3J80 D;  1XHJ A;  1MXB A;  1MDB A;  4X64 C;  4G1I A;  2D28 C;  3AY0 A;  4PUI A;  4JYA C;  2BJO A;  1J5E C; 
#chains in the Genus database with same CATH homology
 2Y27 A;  4FTF A;  4LF6 C;  4LF8 C;  3SO4 A;  1HH2 P;  3I07 A;  3L95 X;  4NXM C;  1QWI A;  5BR8 C;  1I94 C;  4DR1 C;  4DV1 C;  1V25 A;  3GR1 A;  4IZ6 A;  4ODJ A;  3LGX A;  4G37 A;  4NXN C;  3EQ6 A;  3UOW A;  5BSM A;  4OXI A;  3LUS A;  5A1G A;  3OTO C;  2P20 A;  2YWC A;  3PBK A;  1PG3 A;  1LQL A;  2VZE A;  4GS5 A;  4JI6 C;  1EGA A;  3IEU A;  2D7V A;  2OPL A;  3S82 A;  4BC7 A;  4MTN A;  3IEV A;  4NOZ A;  5CZX A;  4ZLP A;  5KEI A;  3VNS A;  5LMN C;  2UXD C;  1MKY A;  5K8F A;  5IT9 D;  4RMN A;  2E8C A;  5E7Q A;  4AQY C;  3TUF A;  1T5H X;  1YJ7 A;  5JRH A;  1K0R A;  4GKK C;  5A19 A;  1PA4 A;  3GKU A;  5BUQ A;  5A1I A;  4JI4 C;  2D1T A;  3RV2 A;  4DUY C;  4OYC A;  3L8C A;  4BCA A;  2OBV A;  2CXC A;  3FCE A;  1RY2 A;  1QM4 A;  4FUT A;  5T8T A;  4GXQ A;  1AMU A;  1IBM C;  5AE2 A;  4MH4 A;  1T5D X;  5BSW A;  3A4I A;  2XR1 A;  4XX2 A;  4B3M C;  1N36 C;  2E5L C;  1RG9 A;  4DCT A;  5BUR A;  2ONF A;  3ETC A;  5IFI A;  2UUB C;  5LMU C;  4JI5 C;  4JV5 C;  3AF5 A;  5KYT A;  4EAT A;  4YY3 C;  3R44 A;  2V7B A;  2ASB A;  4RLF A;  4WV3 A;  1FUG A;  1WH9 A;  3N54 B;  4RM3 A;  4JI1 C;  3NI2 A;  4B3R C;  4JM1 A;  4L4Q A;  2E0G A;  2DPL A;  3VNQ A;  1P7L A;  2ATW A;  4DV4 C;  3NYQ A;  1N33 C;  1KKG A;  2D1R A;  5T8S A;  5AE1 A;  4NDN A;  4RLQ A;  1XMO C;  1GPM A;  2P2J A;  4PHT A;  3A9U A;  4L2Z A;  1MXA A;  5GTD A;  2OPL B;  2OO4 A;  1XRC A;  3T1H C;  1HNZ C;  1XMQ C;  3H2T A;  2VQE C;  3CJE A;  4HPV A;  3E7X A;  5CZV A;  3PES A;  4DV5 C;  4DG9 A;  2UU9 C;  5BST A;  4RVN A;  1O90 A;  3PRO C;  4I9F A;  4X65 C;  2BH1 X;  4D4I A;  5BSV A;  4DG8 A;  5K85 A;  2HHH C;  4DV3 C;  2QL8 A;  1NYE A;  4DV2 C;  2P2M A;  4LFC C;  3CW9 A;  4ZJZ A;  3I08 A;  3AF6 A;  2QVY X;  4DCU A;  5AE3 A;  2D1S A;  2WD9 A;  3DHV A;  2E8E A;  2PRO A;  4D4G A;  4DCV A;  2EGT A;  3LNV A;  5KYV A;  4BC9 A;  5ADZ A;  4LF9 C;  5FLX D;  2KZF A;  2P2F A;  3TDE A;  1O9T A;  2F4V C;  4L7I A;  4RVO A;  4DR2 C;  1IBK C;  2ZM6 C;  3DAY A;  1N32 C;  4I9G A;  2D1Q A;  3ETO A;  4JI7 C;  3GR0 A;  5BSR A;  5DV9 A;  2E7G A;  2QW0 X;  4TPS B;  1N2F A;  4B3T C;  1MDF A;  3KXW A;  4DUZ C;  1MXC A;  3R9W A;  3LAX A;  4G36 A;  3N2Q A;  1WF3 A;  3JAM D;  3FCC A;  4X62 C;  3J81 D;  3UZ0 A;  3G7S A;  3NYR A;  1ML8 A;  2YWB A;  4GKJ C;  4LFB C;  2P2Q A;  2UXC C;  2JMP A;  2CY1 A;  1XRB A;  3GPC A;  2UXB C;  1MD9 A;  4R1M A;  4WS9 A;  2QVX X;  4BSZ A;  5A2Q D;  2VQF C;  4LF5 C;  1HNX C;  4LF7 C;  1USP A;  2P2B A;  1XNR C;  1USP B;  3VNR A;  3NPD A;  1ULT A;  4DR7 C;  4K0B A;  1V26 A;  4RM2 A;  4DR5 C;  3RG2 A;  3C5E A;  1FJG C;  1ZB9 A;  2UUA C;  4PRO C;  4PZP A;  4X66 C;  4JI2 C;  2D27 A;  4JI0 C;  4DR4 C;  4ISB A;  1HR0 C;  2VSQ A;  2DYJ A;  4KTT A;  4BBY A;  4JI8 C;  2PT7 G;  2YCB A;  3R9X A;  3CW8 X;  4FUQ A;  4U5Y D;  4DR3 C;  1N34 C;  2P02 A;  2Y4N A;  2E8F A;  2QVZ X;  4DCS A;  3T1Y C;  3TQI A;  5H9U A;  2Y4O A;  3EER A;  4R1L A;  1HNW C;  4IR7 A;  1XRA A;  1JOS A;  1PG4 A;  4LE5 A;  4B3S C;  1XNQ C;  3B7W A;  4OX9 C;  3IML A;  1O93 A;  5IWA C;  5BSU A;  4KHP C;  3IPL A;  4DR6 C;  4LFA C;  1LCI A;  4GXR A;  1VLA A;  3DLP X;  2AYA A;  4DV0 C;  3A9V A;  2HJG A;  4DV7 C;  3E7W A;  4YHH C;  4LF4 C;  5BUS A;  1ZB8 A;  1O92 A;  1BA3 A;  4D56 A;  4JI3 C;  4DV6 C;  2WP0 C;  4KTV A;  2UUC C;  2PN2 A;  1L2F A;  4R0M A;  4K0K C;  1IBL C;  1UKK A;  4D57 A;  3J80 D;  1MXB A;  1MDB A;  4X64 C;  4G1I A;  2D28 C;  4JYA C;  2BJO A;  1J5E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...