1KKGA

Nmr structure of ribosome-binding factor a (rbfa)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of Ribosome-binding Factor A (RbfA), A Cold-shock Adaptation Protein from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics
molecule keywords ribosome-binding factor A
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2001-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1kkgA00
4DUZC 4LFBC 4JI5C 3IEVA 1KKGA 1J5EC 4DV7C 1K0RA 2PN2A 2JMPA 1LQLA 2E8FA 2ATWA 2ASBA 3AF6A 4MTNA 4DCUA 4LF8C 2YCBA 2OPLB 3GKUA 2CY1A 4GKKC 4NXMC 3JAMD 4KHPC 3CJEA 3T1HC 1HNZC 1USPA 3T1YC 1IBLC 4JI8C 2E5LC 4GKJC 2PT7G 4DV2C 3I07A 1UKKA 4K0KC 1QWIA 4LF6C 1ML8A 4X66C 3LUSA 1I94C 4DV4C 1IBMC 1JOSA 4B3RC 2QL8A 1USPB 1IBKC 4LF9C 4AQYC 4DCVA 1N2FA 2HHHC 2UXDC 4LF4C 2UUAC 5LMUC 4DV0C 4BSZA 2VQEC 2UU9C 1N36C 1VLAA 4MH4A 4JI4C 1ZB8A 2HJGA 1EGAA 4B3TC 4JI1C 5A2QD 2E8EA 4X64C 2KZFA 2E7GA 3J80D 4DR1C 4JI3C 5FLXD 3IEUA 1N32C 4DV1C 4DCTA 4B3MC 1WH9A 1N33C 4OX9C 4DV5C 1PA4A 4LF7C 1WF3A 5LMNC 2XR1A 1L2FA 4YHHC 1XMQC 4JI2C 4DCSA 2VQFC 2E8CA 1MKYA 2UUBC 2D7VA 1HNXC 4JI7C 5IWAC 4LF5C 4DR5C 4NOZA 4B3SC 4JI0C 1ZB9A 5BR8C 2UXCC 4DV3C 1HNWC 2CXCA 1FJGC 1XNQC 4DUYC 4DV6C 1XMOC 3OTOC 4JV5C 2EGTA 3J81D 4DR7C 4YY3C 2UUCC 4LFCC 2ZM6C 1HR0C 2BJOA 4DR2C 1XNRC 4X62C 3AF5A 4JI6C 4X65C 2DYJA 4DR6C 4XX2A 5IT9D 2ONFA 3R9XA 4JYAC 1N34C 2UXBC 4DR3C 4NXNC 3EERA 4LFAC 1NYEA 3R9WA 2F4VC 2OPLA 4DR4C 1HH2P
chains in the Genus database with same CATH superfamily
2P2BA 3DAYA 1KKGA 4DV7C 2PN2A 3ETOA 2ATWA 2ASBA 4DCUA 3GR1A 2YCBA 2Y4OA 2OPLB 4GKKC 4KHPC 3CJEA 3LAXA 2QW0X 4WV3A 4K0BA 2KZ0A 2M5HA 4D57A 5BURA 3GPCA 3I07A 1UKKA 5T8SA 2VZEA 3LUSA 5BSUA 3UOWA 1USPB 2KDNA 1IBKC 4GXRA 3DHVA 1AMUA 1FUGA 1XRCA 1VLAA 1UWDA 4JI4C 2HJGA 4JI1C 5A2QD 4LE5A 1XRBA 4FUTA 5KYTA 4JI3C 3IEUA 1N32C 4DV1C 1FLOA 1WH9A 2Y27A 4OX9C 1WF3A 1V25A 3EQ6A 4RVNA 3UX3A 1P4EA 1L2FA 2OBVA 3S82A 4JI2C 4DCSA 2VQFC 2E8CA 2D28C 1HNXC 4JI7C 4LF5C 2WP0C 4DV3C 1HNWC 1XS3A 2D1RA 4DUYC 3CW9A 3VNRA 4PUHA 2EGTA 4YY3C 2QVYX 2BJOA 5BSMA 4GXQA 4X65C 1QM4A 4DR6C 3NPDA 5IT9D 2MMAB 2NCLA 5BUSA 2OPLA 2D1QA 4JI5C 1K0RA 4G36A 3NI2A 3E7XA 4LF8C 1BA3A 5DV9A 2CY1A 2P02A 3JAMD 1TH5A 2YX1A 1M6XC 2PT7G 3A25A 3I08A 4IZ6A 4L7IA 3PROC 3VNQA 3A9UA 3A26A 1I94C 4KTVA 4B3RC 2QL8A 3IPLA 4D4IA 5CZXA 4RM2A 2UU9C 1MDBA 3FCEA 4RM3A 1V26A 4RMNA 2E7GA 1WCJA 3J80D 3PBKA 5GTDA 2P2FA 5FLXD 4JM1A 3K6RA 4B3MC 1N33C 1PU1A 5AE2A 4DV5C 3B7WA 5IFIA 1PA4A 4I9GA 2P2QA 1MDFA 4DG9A 4YHHC 2D7VA 5IWAC 3TQIA 4DR5C 2DPLA 4L2ZA 5BSVA 2D27A 4PUGA 3KXWA 4D4GA 4EATA 1O90A 1ZB9A 1T5HX 3VNSA 3FCCA 4PUIA 4RVOA 3H2TA 4HPVA 4ISBA 5K85A 1RY2A 3OTOC 4DR7C 4ZJZA 3LNOA 4LFCC 1HR0C 1MXAA 1T5DX 4WS9A 2D1TA 4U5YD 4JI6C 5BUQA 4I9FA 3UEBA 1V60A 2UXBC 2P2JA 1O93A 4R1LA 4OXIA 3ETCA 1NYEA 1HH2P 3O2EA 5H9UA 3LNVA 2JMPA 1LQLA 3AF6A 4R1MA 4FTFA 3GKUA 2YWCA 4NXMC 1PG4A 5KYVA 4PZPA 3E7WA 1RG9A 1HNZC 1P4EC 1O92A 5CZVA 1IBLC 4RLQA 4JI8C 2YWBA 1IB8A 4TPSB 4K0KC 1ML8A 4X66C 2D1SA 3UX2A 1PG3A 4LF9C 4DCVA 1N2FA 2HHHC 4LF4C 3A4IA 4R0MA 4BSZA 3DLPX 1N36C 5ADZA 5AE1A 3PESA 4MH4A 3NYQA 4DG8A 5A1GA 4X64C 2KZFA 4OYCA 1MD9A 3R44A 3C5EA 3TUFA 3TR3A 4NDNA 5LMNC 2P2MA 5BSWA 2OO4A 3G7SA 3GR0A 1MKYA 3L95X 4NOZA 4JI0C 2BH1X 5BR8C 5BSRA 4D56A 2CXCA 1FJGC 3N2QA 2ZZMA 2MM9A 1LCIA 4JV5C 4FUQA 2UUCC 4GS5A 2M5OA 1XNRC 4X62C 5A1IA 2DYJA 4XX2A 4BBYA 5AE3A 3R9XA 4JYAC 3NYRA 2AYAA 1N34C 4DR3C 4NXNC 3EERA 3IMLA 1NY8A 4DR4C 4DUZC 4LFBC 3IEVA 2VSQA 1J5EC 2QVXX 3A9VA 2E8FA 3RG2A 4MTNA 5T8TA 1VEHA 2ZZNA 2WD9A 3T1HC 1USPA 3T1YC 2E5LC 4GKJC 3UZ0A 4DV2C 1QWIA 4LF6C 5BSTA 4BCAA 2JNVA 4DV4C 1IBMC 1JOSA 5KEIA 5LCIA 4AQYC 2UXDC 3LGXA 1MXCA 2P20A 2UUAC 2PROA 3SO4A 5LMUC 4DV0C 2VQEC 4ZLPA 5A19A 3L8CA 1ZB8A 1O9TA 1EGAA 2Y4NA 4B3TC 2E8EA 4PHTA 4DR1C 5JRHA 3CQ2A 5E7QA 4IR7A 4DCTA 3CQ1A 3CW8X 4LF7C 2XR1A 4KTTA 1XMQC 2E0GA 2UUBC 4G1IA 4G37A 1ULTA 1GPMA 3AY0A 4B3SC 2UXCC 1XRAA 3TDEA 3CQ3A 4ODJA 1XNQC 4DV6C 1M6XA 2Z51A 1XMOC 4PROC 2CU6A 3J81D 2ZM6C 4RLFA 4BC7A 1YJ7A 4DR2C 4L4QA 2QVZX 3AF5A 5K8FA 3RV2A 3N54B 1P7LA 2ONFA 2DHMA 4BC9A 2MCQA 4LFAC 3R9WA 1XHJA 2V7BA 2F4VC 1MXBA
chains in the Genus database with same CATH topology
2P2BA 3DAYA 1KKGA 4DV7C 2PN2A 3ETOA 2ATWA 2ASBA 4DCUA 3GR1A 2YCBA 2Y4OA 2OPLB 4GKKC 4KHPC 3CJEA 3LAXA 2QW0X 4WV3A 4K0BA 4D57A 5BURA 3GPCA 3I07A 1UKKA 5T8SA 2VZEA 3LUSA 5BSUA 3UOWA 1USPB 1IBKC 4GXRA 3DHVA 1AMUA 1FUGA 1XRCA 1VLAA 4JI4C 2HJGA 4JI1C 5A2QD 4LE5A 1XRBA 4FUTA 5KYTA 4JI3C 3IEUA 1N32C 4DV1C 1WH9A 2Y27A 4OX9C 1WF3A 1V25A 3EQ6A 4RVNA 1L2FA 2OBVA 3S82A 4JI2C 4DCSA 2VQFC 2E8CA 2D28C 1HNXC 4JI7C 4LF5C 2WP0C 4DV3C 1HNWC 2D1RA 4DUYC 3CW9A 3VNRA 2EGTA 4YY3C 2QVYX 2BJOA 5BSMA 4GXQA 4X65C 1QM4A 4DR6C 3NPDA 5IT9D 5BUSA 2OPLA 2D1QA 4JI5C 1K0RA 4G36A 3NI2A 3E7XA 4LF8C 1BA3A 5DV9A 2CY1A 2P02A 3JAMD 2PT7G 3I08A 4IZ6A 4L7IA 3PROC 3VNQA 3A9UA 1I94C 4KTVA 4B3RC 2QL8A 3IPLA 4D4IA 5CZXA 4RM2A 2UU9C 1MDBA 3FCEA 4RM3A 1V26A 4RMNA 2E7GA 3J80D 3PBKA 5GTDA 2P2FA 5FLXD 4JM1A 4B3MC 1N33C 5AE2A 4DV5C 3B7WA 5IFIA 1PA4A 4I9GA 2P2QA 1MDFA 4DG9A 4YHHC 2D7VA 5IWAC 3TQIA 4DR5C 2DPLA 4L2ZA 5BSVA 2D27A 3KXWA 4D4GA 4EATA 1O90A 1ZB9A 1T5HX 3VNSA 3FCCA 4RVOA 3H2TA 4HPVA 4ISBA 5K85A 1RY2A 3OTOC 4DR7C 4ZJZA 4LFCC 1HR0C 1MXAA 1T5DX 4WS9A 2D1TA 4U5YD 4JI6C 5BUQA 4I9FA 2UXBC 2P2JA 1O93A 4R1LA 4OXIA 3ETCA 1NYEA 1HH2P 5H9UA 3LNVA 2JMPA 1LQLA 3AF6A 4R1MA 4FTFA 3GKUA 2YWCA 4NXMC 1PG4A 5KYVA 4PZPA 3E7WA 1RG9A 1HNZC 1O92A 5CZVA 1IBLC 4RLQA 4JI8C 2YWBA 4TPSB 4K0KC 1ML8A 4X66C 2D1SA 1PG3A 4LF9C 4DCVA 1N2FA 2HHHC 4LF4C 3A4IA 4R0MA 4BSZA 3DLPX 1N36C 5ADZA 5AE1A 3PESA 4MH4A 3NYQA 4DG8A 5A1GA 4X64C 2KZFA 4OYCA 1MD9A 3R44A 3C5EA 3TUFA 4NDNA 5LMNC 2P2MA 5BSWA 2OO4A 3G7SA 3GR0A 1MKYA 3L95X 4NOZA 4JI0C 2BH1X 5BR8C 5BSRA 2CXCA 4D56A 1FJGC 3N2QA 1LCIA 4JV5C 4FUQA 2UUCC 4GS5A 1XNRC 4X62C 5A1IA 2DYJA 4XX2A 4BBYA 5AE3A 3R9XA 4JYAC 3NYRA 2AYAA 1N34C 4DR3C 4NXNC 3EERA 3IMLA 4DR4C 4DUZC 4LFBC 3IEVA 2VSQA 1J5EC 2QVXX 3A9VA 2E8FA 3RG2A 4MTNA 5T8TA 2WD9A 3T1HC 1USPA 3T1YC 2E5LC 4GKJC 3UZ0A 4DV2C 1QWIA 4LF6C 5BSTA 4BCAA 4DV4C 1IBMC 1JOSA 5KEIA 4AQYC 2UXDC 3LGXA 1MXCA 2P20A 2UUAC 2PROA 3SO4A 5LMUC 4DV0C 2VQEC 4ZLPA 5A19A 3L8CA 1ZB8A 1O9TA 1EGAA 2Y4NA 4B3TC 2E8EA 4PHTA 4DR1C 5JRHA 5E7QA 4IR7A 4DCTA 3CW8X 4LF7C 2XR1A 4KTTA 1XMQC 2E0GA 2UUBC 4G1IA 4G37A 1ULTA 1GPMA 4B3SC 2UXCC 1XRAA 3TDEA 4ODJA 1XNQC 4DV6C 1XMOC 4PROC 3J81D 2ZM6C 4RLFA 4BC7A 1YJ7A 4DR2C 4L4QA 2QVZX 3AF5A 5K8FA 3RV2A 3N54B 1P7LA 2ONFA 4BC9A 4LFAC 3R9WA 2V7BA 2F4VC 1MXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ C;  4LFB C;  4JI5 C;  3IEV A;  1KKG A;  1J5E C;  4DV7 C;  1K0R A;  2PN2 A;  2JMP A;  1LQL A;  2E8F A;  2ATW A;  2ASB A;  3AF6 A;  4MTN A;  4DCU A;  4LF8 C;  2YCB A;  2OPL B;  3GKU A;  2CY1 A;  4GKK C;  4NXM C;  3JAM D;  4KHP C;  3CJE A;  3T1H C;  1HNZ C;  1USP A;  3T1Y C;  1IBL C;  4JI8 C;  2E5L C;  4GKJ C;  2PT7 G;  4DV2 C;  3I07 A;  1UKK A;  4K0K C;  1QWI A;  4LF6 C;  1ML8 A;  4X66 C;  3LUS A;  1I94 C;  4DV4 C;  1IBM C;  1JOS A;  4B3R C;  2QL8 A;  1USP B;  1IBK C;  4LF9 C;  4AQY C;  4DCV A;  1N2F A;  2HHH C;  2UXD C;  4LF4 C;  2UUA C;  5LMU C;  4DV0 C;  4BSZ A;  2VQE C;  2UU9 C;  1N36 C;  1VLA A;  4MH4 A;  4JI4 C;  1ZB8 A;  2HJG A;  1EGA A;  4B3T C;  4JI1 C;  5A2Q D;  2E8E A;  4X64 C;  2KZF A;  2E7G A;  3J80 D;  4DR1 C;  4JI3 C;  5FLX D;  3IEU A;  1N32 C;  4DV1 C;  4DCT A;  4B3M C;  1WH9 A;  1N33 C;  4OX9 C;  4DV5 C;  1PA4 A;  4LF7 C;  1WF3 A;  5LMN C;  2XR1 A;  1L2F A;  4YHH C;  1XMQ C;  4JI2 C;  4DCS A;  2VQF C;  2E8C A;  1MKY A;  2UUB C;  2D7V A;  1HNX C;  4JI7 C;  5IWA C;  4LF5 C;  4DR5 C;  4NOZ A;  4B3S C;  4JI0 C;  1ZB9 A;  5BR8 C;  2UXC C;  4DV3 C;  1HNW C;  2CXC A;  1FJG C;  1XNQ C;  4DUY C;  4DV6 C;  1XMO C;  3OTO C;  4JV5 C;  2EGT A;  3J81 D;  4DR7 C;  4YY3 C;  2UUC C;  4LFC C;  2ZM6 C;  1HR0 C;  2BJO A;  4DR2 C;  1XNR C;  4X62 C;  3AF5 A;  4JI6 C;  4X65 C;  2DYJ A;  4DR6 C;  4XX2 A;  5IT9 D;  2ONF A;  3R9X A;  4JYA C;  1N34 C;  2UXB C;  4DR3 C;  4NXN C;  3EER A;  4LFA C;  1NYE A;  3R9W A;  2F4V C;  2OPL A;  4DR4 C;  1HH2 P; 
#chains in the Genus database with same CATH topology
 2P2B A;  3DAY A;  1KKG A;  4DV7 C;  2PN2 A;  3ETO A;  2ATW A;  2ASB A;  4DCU A;  3GR1 A;  2YCB A;  2Y4O A;  2OPL B;  4GKK C;  4KHP C;  3CJE A;  3LAX A;  2QW0 X;  4WV3 A;  4K0B A;  2KZ0 A;  2M5H A;  4D57 A;  5BUR A;  3GPC A;  3I07 A;  1UKK A;  5T8S A;  2VZE A;  3LUS A;  5BSU A;  3UOW A;  1USP B;  2KDN A;  1IBK C;  4GXR A;  3DHV A;  1AMU A;  1FUG A;  1XRC A;  1VLA A;  1UWD A;  4JI4 C;  2HJG A;  4JI1 C;  5A2Q D;  4LE5 A;  1XRB A;  4FUT A;  5KYT A;  4JI3 C;  3IEU A;  1N32 C;  4DV1 C;  1FLO A;  1WH9 A;  2Y27 A;  4OX9 C;  1WF3 A;  1V25 A;  3EQ6 A;  4RVN A;  3UX3 A;  1P4E A;  1L2F A;  2OBV A;  3S82 A;  4JI2 C;  4DCS A;  2VQF C;  2E8C A;  2D28 C;  1HNX C;  4JI7 C;  4LF5 C;  2WP0 C;  4DV3 C;  1HNW C;  1XS3 A;  2D1R A;  4DUY C;  3CW9 A;  3VNR A;  4PUH A;  2EGT A;  4YY3 C;  2QVY X;  2BJO A;  5BSM A;  4GXQ A;  4X65 C;  1QM4 A;  4DR6 C;  3NPD A;  5IT9 D;  2MMA B;  2NCL A;  5BUS A;  2OPL A;  2D1Q A;  4JI5 C;  1K0R A;  4G36 A;  3NI2 A;  3E7X A;  4LF8 C;  1BA3 A;  5DV9 A;  2CY1 A;  2P02 A;  3JAM D;  1TH5 A;  2YX1 A;  1M6X C;  2PT7 G;  3A25 A;  3I08 A;  4IZ6 A;  4L7I A;  3PRO C;  3VNQ A;  3A9U A;  3A26 A;  1I94 C;  4KTV A;  4B3R C;  2QL8 A;  3IPL A;  4D4I A;  5CZX A;  4RM2 A;  2UU9 C;  1MDB A;  3FCE A;  4RM3 A;  1V26 A;  4RMN A;  2E7G A;  1WCJ A;  3J80 D;  3PBK A;  5GTD A;  2P2F A;  5FLX D;  4JM1 A;  3K6R A;  4B3M C;  1N33 C;  1PU1 A;  5AE2 A;  4DV5 C;  3B7W A;  5IFI A;  1PA4 A;  4I9G A;  2P2Q A;  1MDF A;  4DG9 A;  4YHH C;  2D7V A;  5IWA C;  3TQI A;  4DR5 C;  2DPL A;  4L2Z A;  5BSV A;  2D27 A;  4PUG A;  3KXW A;  4D4G A;  4EAT A;  1O90 A;  1ZB9 A;  1T5H X;  3VNS A;  3FCC A;  4PUI A;  4RVO A;  3H2T A;  4HPV A;  4ISB A;  5K85 A;  1RY2 A;  3OTO C;  4DR7 C;  4ZJZ A;  3LNO A;  4LFC C;  1HR0 C;  1MXA A;  1T5D X;  4WS9 A;  2D1T A;  4U5Y D;  4JI6 C;  5BUQ A;  4I9F A;  3UEB A;  1V60 A;  2UXB C;  2P2J A;  1O93 A;  4R1L A;  4OXI A;  3ETC A;  1NYE A;  1HH2 P;  3O2E A;  5H9U A;  3LNV A;  2JMP A;  1LQL A;  3AF6 A;  4R1M A;  4FTF A;  3GKU A;  2YWC A;  4NXM C;  1PG4 A;  5KYV A;  4PZP A;  3E7W A;  1RG9 A;  1HNZ C;  1P4E C;  1O92 A;  5CZV A;  1IBL C;  4RLQ A;  4JI8 C;  2YWB A;  1IB8 A;  4TPS B;  4K0K C;  1ML8 A;  4X66 C;  2D1S A;  3UX2 A;  1PG3 A;  4LF9 C;  4DCV A;  1N2F A;  2HHH C;  4LF4 C;  3A4I A;  4R0M A;  4BSZ A;  3DLP X;  1N36 C;  5ADZ A;  5AE1 A;  3PES A;  4MH4 A;  3NYQ A;  4DG8 A;  5A1G A;  4X64 C;  2KZF A;  4OYC A;  1MD9 A;  3R44 A;  3C5E A;  3TUF A;  3TR3 A;  4NDN A;  5LMN C;  2P2M A;  5BSW A;  2OO4 A;  3G7S A;  3GR0 A;  1MKY A;  3L95 X;  4NOZ A;  4JI0 C;  2BH1 X;  5BR8 C;  5BSR A;  4D56 A;  2CXC A;  1FJG C;  3N2Q A;  2ZZM A;  2MM9 A;  1LCI A;  4JV5 C;  4FUQ A;  2UUC C;  4GS5 A;  2M5O A;  1XNR C;  4X62 C;  5A1I A;  2DYJ A;  4XX2 A;  4BBY A;  5AE3 A;  3R9X A;  4JYA C;  3NYR A;  2AYA A;  1N34 C;  4DR3 C;  4NXN C;  3EER A;  3IML A;  1NY8 A;  4DR4 C;  4DUZ C;  4LFB C;  3IEV A;  2VSQ A;  1J5E C;  2QVX X;  3A9V A;  2E8F A;  3RG2 A;  4MTN A;  5T8T A;  1VEH A;  2ZZN A;  2WD9 A;  3T1H C;  1USP A;  3T1Y C;  2E5L C;  4GKJ C;  3UZ0 A;  4DV2 C;  1QWI A;  4LF6 C;  5BST A;  4BCA A;  2JNV A;  4DV4 C;  1IBM C;  1JOS A;  5KEI A;  5LCI A;  4AQY C;  2UXD C;  3LGX A;  1MXC A;  2P20 A;  2UUA C;  2PRO A;  3SO4 A;  5LMU C;  4DV0 C;  2VQE C;  4ZLP A;  5A19 A;  3L8C A;  1ZB8 A;  1O9T A;  1EGA A;  2Y4N A;  4B3T C;  2E8E A;  4PHT A;  4DR1 C;  5JRH A;  3CQ2 A;  5E7Q A;  4IR7 A;  4DCT A;  3CQ1 A;  3CW8 X;  4LF7 C;  2XR1 A;  4KTT A;  1XMQ C;  2E0G A;  2UUB C;  4G1I A;  4G37 A;  1ULT A;  1GPM A;  3AY0 A;  4B3S C;  2UXC C;  1XRA A;  3TDE A;  3CQ3 A;  4ODJ A;  1XNQ C;  4DV6 C;  1M6X A;  2Z51 A;  1XMO C;  4PRO C;  2CU6 A;  3J81 D;  2ZM6 C;  4RLF A;  4BC7 A;  1YJ7 A;  4DR2 C;  4L4Q A;  2QVZ X;  3AF5 A;  5K8F A;  3RV2 A;  3N54 B;  1P7L A;  2ONF A;  2DHM A;  4BC9 A;  2MCQ A;  4LFA C;  3R9W A;  1XHJ A;  2V7B A;  2F4V C;  1MXB A; 
#chains in the Genus database with same CATH homology
 2P2B A;  3DAY A;  1KKG A;  4DV7 C;  2PN2 A;  3ETO A;  2ATW A;  2ASB A;  4DCU A;  3GR1 A;  2YCB A;  2Y4O A;  2OPL B;  4GKK C;  4KHP C;  3CJE A;  3LAX A;  2QW0 X;  4WV3 A;  4K0B A;  4D57 A;  5BUR A;  3GPC A;  3I07 A;  1UKK A;  5T8S A;  2VZE A;  3LUS A;  5BSU A;  3UOW A;  1USP B;  1IBK C;  4GXR A;  3DHV A;  1AMU A;  1FUG A;  1XRC A;  1VLA A;  4JI4 C;  2HJG A;  4JI1 C;  5A2Q D;  4LE5 A;  1XRB A;  4FUT A;  5KYT A;  4JI3 C;  3IEU A;  1N32 C;  4DV1 C;  1WH9 A;  2Y27 A;  4OX9 C;  1WF3 A;  1V25 A;  3EQ6 A;  4RVN A;  1L2F A;  2OBV A;  3S82 A;  4JI2 C;  4DCS A;  2VQF C;  2E8C A;  2D28 C;  1HNX C;  4JI7 C;  4LF5 C;  2WP0 C;  4DV3 C;  1HNW C;  2D1R A;  4DUY C;  3CW9 A;  3VNR A;  2EGT A;  4YY3 C;  2QVY X;  2BJO A;  5BSM A;  4GXQ A;  4X65 C;  1QM4 A;  4DR6 C;  3NPD A;  5IT9 D;  5BUS A;  2OPL A;  2D1Q A;  4JI5 C;  1K0R A;  4G36 A;  3NI2 A;  3E7X A;  4LF8 C;  1BA3 A;  5DV9 A;  2CY1 A;  2P02 A;  3JAM D;  2PT7 G;  3I08 A;  4IZ6 A;  4L7I A;  3PRO C;  3VNQ A;  3A9U A;  1I94 C;  4KTV A;  4B3R C;  2QL8 A;  3IPL A;  4D4I A;  5CZX A;  4RM2 A;  2UU9 C;  1MDB A;  3FCE A;  4RM3 A;  1V26 A;  4RMN A;  2E7G A;  3J80 D;  3PBK A;  5GTD A;  2P2F A;  5FLX D;  4JM1 A;  4B3M C;  1N33 C;  5AE2 A;  4DV5 C;  3B7W A;  5IFI A;  1PA4 A;  4I9G A;  2P2Q A;  1MDF A;  4DG9 A;  4YHH C;  2D7V A;  5IWA C;  3TQI A;  4DR5 C;  2DPL A;  4L2Z A;  5BSV A;  2D27 A;  3KXW A;  4D4G A;  4EAT A;  1O90 A;  1ZB9 A;  1T5H X;  3VNS A;  3FCC A;  4RVO A;  3H2T A;  4HPV A;  4ISB A;  5K85 A;  1RY2 A;  3OTO C;  4DR7 C;  4ZJZ A;  4LFC C;  1HR0 C;  1MXA A;  1T5D X;  4WS9 A;  2D1T A;  4U5Y D;  4JI6 C;  5BUQ A;  4I9F A;  2UXB C;  2P2J A;  1O93 A;  4R1L A;  4OXI A;  3ETC A;  1NYE A;  1HH2 P;  5H9U A;  3LNV A;  2JMP A;  1LQL A;  3AF6 A;  4R1M A;  4FTF A;  3GKU A;  2YWC A;  4NXM C;  1PG4 A;  5KYV A;  4PZP A;  3E7W A;  1RG9 A;  1HNZ C;  1O92 A;  5CZV A;  1IBL C;  4RLQ A;  4JI8 C;  2YWB A;  4TPS B;  4K0K C;  1ML8 A;  4X66 C;  2D1S A;  1PG3 A;  4LF9 C;  4DCV A;  1N2F A;  2HHH C;  4LF4 C;  3A4I A;  4R0M A;  4BSZ A;  3DLP X;  1N36 C;  5ADZ A;  5AE1 A;  3PES A;  4MH4 A;  3NYQ A;  4DG8 A;  5A1G A;  4X64 C;  2KZF A;  4OYC A;  1MD9 A;  3R44 A;  3C5E A;  3TUF A;  4NDN A;  5LMN C;  2P2M A;  5BSW A;  2OO4 A;  3G7S A;  3GR0 A;  1MKY A;  3L95 X;  4NOZ A;  4JI0 C;  2BH1 X;  5BR8 C;  5BSR A;  2CXC A;  4D56 A;  1FJG C;  3N2Q A;  1LCI A;  4JV5 C;  4FUQ A;  2UUC C;  4GS5 A;  1XNR C;  4X62 C;  5A1I A;  2DYJ A;  4XX2 A;  4BBY A;  5AE3 A;  3R9X A;  4JYA C;  3NYR A;  2AYA A;  1N34 C;  4DR3 C;  4NXN C;  3EER A;  3IML A;  4DR4 C;  4DUZ C;  4LFB C;  3IEV A;  2VSQ A;  1J5E C;  2QVX X;  3A9V A;  2E8F A;  3RG2 A;  4MTN A;  5T8T A;  2WD9 A;  3T1H C;  1USP A;  3T1Y C;  2E5L C;  4GKJ C;  3UZ0 A;  4DV2 C;  1QWI A;  4LF6 C;  5BST A;  4BCA A;  4DV4 C;  1IBM C;  1JOS A;  5KEI A;  4AQY C;  2UXD C;  3LGX A;  1MXC A;  2P20 A;  2UUA C;  2PRO A;  3SO4 A;  5LMU C;  4DV0 C;  2VQE C;  4ZLP A;  5A19 A;  3L8C A;  1ZB8 A;  1O9T A;  1EGA A;  2Y4N A;  4B3T C;  2E8E A;  4PHT A;  4DR1 C;  5JRH A;  5E7Q A;  4IR7 A;  4DCT A;  3CW8 X;  4LF7 C;  2XR1 A;  4KTT A;  1XMQ C;  2E0G A;  2UUB C;  4G1I A;  4G37 A;  1ULT A;  1GPM A;  4B3S C;  2UXC C;  1XRA A;  3TDE A;  4ODJ A;  1XNQ C;  4DV6 C;  1XMO C;  4PRO C;  3J81 D;  2ZM6 C;  4RLF A;  4BC7 A;  1YJ7 A;  4DR2 C;  4L4Q A;  2QVZ X;  3AF5 A;  5K8F A;  3RV2 A;  3N54 B;  1P7L A;  2ONF A;  4BC9 A;  4LFA C;  3R9W A;  2V7B A;  2F4V C;  1MXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...