1KKGA

Nmr structure of ribosome-binding factor a (rbfa)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
b'MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosome-binding factor A
publication title Solution NMR Structure of Ribosome-binding Factor A (RbfA), A Cold-shock Adaptation Protein from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2001-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1kkgA00
1K0RA 3IEVA 2E8FA 4JI0C 4B3RC 4GKKC 3T1HC 1USPA 3R9WA 1J5EC 1HNXC 4DCUA 4JI2C 2ATWA 1ZB9A 4LF5C 3JAMD 4XX2A 2E5LC 4DR1C 3CJEA 4DV7C 2E8CA 1XMQC 1WH9A 2VQEC 4X64C 2QL8A 4JI5C 2OPLA 5BR8C 4AQYC 4GKJC 2EGTA 3J80D 1N34C 4DV0C 4X62C 1L2FA 2UXBC 1QWIA 4YY3C 4JV5C 1IBKC 1N2FA 4DV2C 2D7VA 3EERA 4JI7C 1HH2P 2CXCA 4LF4C 2PT7G 4B3SC 4DR4C 2UUCC 4DR5C 2VQFC 4B3MC 4DUZC 1XNQC 1JOSA 1MKYA 1VLAA 3IEUA 1PA4A 3LUSA 1FJGC 3J81D 3I07A 3R9XA 4DV1C 2ZM6C 4LFCC 4LF8C 3AF6A 4LFAC 4NXNC 2YCBA 2HHHC 2E8EA 1IBMC 4JI4C 2DYJA 4X65C 4DR7C 4DR6C 1NYEA 2JMPA 1ZB8A 2HJGA 4NXMC 4DV3C 4DV4C 4YHHC 3OTOC 4DR2C 1HNZC 4X66C 2ASBA 1LQLA 2CY1A 4DCSA 4NOZA 4LFBC 4DV6C 5LMNC 2UUAC 4KHPC 4JYAC 4DCTA 2E7GA 1ML8A 2UXCC 2UU9C 4DCVA 4DR3C 4MTNA 4DUYC 1IBLC 2UXDC 1KKGA 4LF9C 4LF6C 2F4VC 1UKKA 1USPB 3AF5A 4JI1C 5IWAC 1N33C 1HNWC 4OX9C 4B3TC 4LF7C 4JI8C 1I94C 1XNRC 2PN2A 2XR1A 4DV5C 1N32C 1WF3A 2UUBC 2BJOA 4JI6C 4JI3C 2OPLB 4MH4A 5FLXD 3T1YC 5LMUC 5IT9D 2ONFA 1HR0C 5A2QD 4BSZA 2KZFA 3GKUA 1XMOC 4K0KC 1N36C 1EGAA
chains in the Genus database with same CATH superfamily
1K0RA 3A25A 5K8FA 3R9WA 3TDEA 1J5EC 1V60A 1ZB9A 1MD9A 2E5LC 4RLFA 4KTVA 1QM4A 4DV7C 3C5EA 4X64C 3IPLA 3GR0A 2WP0C 4RM2A 1N34C 5KEIA 4RLQA 2MMAB 5ADZA 2ZZNA 1RG9A 3IMLA 3UOWA 5AE3A 4R1LA 1P4EA 4I9FA 4LF4C 1MXCA 5DV9A 4DR5C 2VQFC 4ZJZA 1XNQC 2QVZX 5CZXA 2MCQA 3L8CA 5IFIA 3DLPX 3J81D 3L95X 2DYJA 4X65C 1NYEA 5AE2A 2ASBA 4DR2C 1NY8A 2P2MA 3NPDA 4DCSA 3CQ3A 4NOZA 4RVOA 2MM9A 5BUQA 3TQIA 1WCJA 5BURA 1VEHA 4DCTA 4R1MA 4MTNA 1IBLC 1KKGA 1P4EC 1T5DX 4G37A 2CU6A 4LF7C 4NDNA 3R44A 2OBVA 3I08A 2XR1A 1N32C 1WF3A 3K6RA 3E7WA 2OPLB 2QW0X 1MDBA 3KXWA 2WD9A 4RMNA 2ONFA 2D27A 2BH1X 2KZFA 1V26A 4K0BA 5H9UA 1M6XA 3T1HC 3VNQA 5T8TA 4IZ6A 3CW9A 4JI2C 2ATWA 1O92A 2E8CA 2P02A 1WH9A 2OPLA 5BR8C 2D28C 4AQYC 4FTFA 4DG8A 5JRHA 2DHMA 4DV0C 5BUSA 1L2FA 2P2FA 3EQ6A 4DR4C 5K85A 2UUCC 4B3MC 4DUZC 1UWDA 4FUTA 1MKYA 3SO4A 3UZ0A 3LNVA 4BC9A 3LGXA 3I07A 1M6XC 5BSWA 4DG9A 2YCBA 3RG2A 1IBMC 4JI4C 2D1SA 2JMPA 4NXMC 4DV3C 1V25A 4YHHC 4DV4C 4X66C 2D1TA 5E7QA 4PUGA 5LMNC 4KHPC 4I9GA 2NCLA 1ML8A 2UXCC 2UU9C 4RM3A 4DCVA 4G36A 3E7XA 4OYCA 1UKKA 1USPB 3AF5A 4R0MA 5IWAC 2P2QA 4B3TC 1XNRC 3NI2A 3N2QA 4JI3C 3T1YC 4MH4A 5FLXD 2Z51A 5LMUC 5A1IA 5BSUA 3A4IA 2P20A 3GKUA 5BSTA 3NYRA 4LE5A 3A9VA 1EGAA 2D1RA 5KYVA 3IEVA 4JI0C 1USPA 1IB8A 1HNXC 4WV3A 4DCUA 3S82A 3AY0A 4LF5C 3ETOA 3CQ2A 2JNVA 3LAXA 4L4QA 1PU1A 2ZZMA 4ISBA 2QL8A 5CZVA 1GPMA 2EGTA 3A9UA 3NYQA 3GR1A 2AYAA 2DPLA 4KTTA 3PBKA 4X62C 2UXBC 1XRCA 3LNOA 1QWIA 4YY3C 4JV5C 4PUHA 1N2FA 4L7IA 1HH2P 1XRAA 2VSQA 2PT7G 3DHVA 1JOSA 1XRBA 2P2JA 1VLAA 2P2BA 3LUSA 2KZ0A 3R9XA 5A19A 4ZLPA 4DV1C 4LF8C 4NXNC 3GPCA 2V7BA 4DR6C 4PHTA 2HJGA 3OTOC 1PG3A 1LQLA 2CY1A 3VNRA 1O93A 1PG4A 2VZEA 2M5OA 4EATA 4IR7A 4PROC 2QVYX 1P7LA 4GXQA 4DUYC 2UXDC 3ETCA 4FUQA 4LF9C 1ULTA 2QVXX 1HNWC 4OX9C 1MDFA 1I94C 2E0GA 4G1IA 2UUBC 1MXAA 2Y4OA 3PESA 1XHJA 1T5HX 5BSRA 5LCIA 5IT9D 5A2QD 4BSZA 4BCAA 3CQ1A 1XMOC 3N54B 1N36C 5A1GA 3FCCA 2D1QA 2E8FA 4B3RC 4GKKC 4D56A 5T8SA 4HPVA 4PUIA 3VNSA 3JAMD 3DAYA 4XX2A 4D4IA 4DR1C 3CJEA 1AMUA 1XMQC 1LCIA 2VQEC 4JI5C 4GKJC 3J80D 4OXIA 4D57A 1YJ7A 3TR3A 4L2ZA 1XS3A 1IBKC 1FLOA 4DV2C 2Y27A 2D7VA 3EERA 4JI7C 2CXCA 4B3SC 5KYTA 2M5HA 1RY2A 1O9TA 3IEUA 3H2TA 4GS5A 4U5YD 1PA4A 4ODJA 1FJGC 4RVNA 1MXBA 2ZM6C 4LFCC 3AF6A 4LFAC 5AE1A 5BSVA 2YWBA 2HHHC 2E8EA 3CW8X 4DR7C 1ZB8A 1HNZC 2Y4NA 5GTDA 2PROA 3UX3A 4PZPA 2KDNA 3RV2A 4LFBC 4DV6C 3PROC 2UUAC 1FUGA 4JYAC 2E7GA 3UEBA 2YX1A 4DR3C 2YWCA 3FCEA 3B7WA 4BC7A 1O90A 4LF6C 2F4VC 1BA3A 4D4GA 3A26A 4JI1C 1N33C 3UX2A 4TPSB 4JM1A 2OO4A 2PN2A 4DV5C 2BJOA 4BBYA 4GXRA 4JI6C 3O2EA 5BSMA 1HR0C 1TH5A 4WS9A 3TUFA 3G7SA 4K0KC 4JI8C
chains in the Genus database with same CATH topology
1K0RA 5K8FA 3R9WA 3TDEA 1J5EC 1ZB9A 1MD9A 2E5LC 4RLFA 4KTVA 1QM4A 4DV7C 3C5EA 4X64C 3IPLA 3GR0A 2WP0C 4RM2A 1N34C 5KEIA 4RLQA 5ADZA 1RG9A 3IMLA 3UOWA 5AE3A 4R1LA 4I9FA 4LF4C 1MXCA 5DV9A 4DR5C 2VQFC 4ZJZA 1XNQC 2QVZX 5CZXA 3L8CA 5IFIA 3DLPX 3J81D 3L95X 2DYJA 4X65C 1NYEA 5AE2A 2ASBA 4DR2C 2P2MA 3NPDA 4DCSA 4NOZA 4RVOA 5BUQA 3TQIA 5BURA 4DCTA 4R1MA 4MTNA 1IBLC 1KKGA 1T5DX 4G37A 4LF7C 4NDNA 3R44A 2OBVA 3I08A 2XR1A 1N32C 1WF3A 3E7WA 2OPLB 2QW0X 1MDBA 3KXWA 2WD9A 4RMNA 2ONFA 2D27A 2BH1X 2KZFA 1V26A 4K0BA 5H9UA 3T1HC 3VNQA 5T8TA 4IZ6A 3CW9A 4JI2C 2ATWA 1O92A 2E8CA 2P02A 1WH9A 2OPLA 5BR8C 2D28C 4AQYC 4FTFA 4DG8A 5JRHA 4DV0C 5BUSA 1L2FA 2P2FA 3EQ6A 4DR4C 5K85A 2UUCC 4B3MC 4DUZC 4FUTA 1MKYA 3SO4A 3UZ0A 3LNVA 4BC9A 3LGXA 3I07A 5BSWA 4DG9A 2YCBA 3RG2A 1IBMC 4JI4C 2D1SA 2JMPA 4NXMC 4DV3C 1V25A 4YHHC 4DV4C 4X66C 2D1TA 5E7QA 5LMNC 4KHPC 4I9GA 1ML8A 2UXCC 2UU9C 4RM3A 4DCVA 4G36A 3E7XA 4OYCA 1UKKA 1USPB 3AF5A 4R0MA 5IWAC 2P2QA 4B3TC 1XNRC 3NI2A 3N2QA 4JI3C 3T1YC 4MH4A 5FLXD 5LMUC 5A1IA 5BSUA 3A4IA 2P20A 3GKUA 5BSTA 3NYRA 4LE5A 3A9VA 1EGAA 2D1RA 5KYVA 3IEVA 4JI0C 1USPA 1HNXC 4WV3A 4DCUA 3S82A 4LF5C 3ETOA 3LAXA 4L4QA 4ISBA 2QL8A 5CZVA 1GPMA 2EGTA 3A9UA 3NYQA 3GR1A 2AYAA 2DPLA 4KTTA 3PBKA 4X62C 2UXBC 1XRCA 1QWIA 4YY3C 4JV5C 1N2FA 4L7IA 1HH2P 1XRAA 2VSQA 2PT7G 3DHVA 1JOSA 1XRBA 2P2JA 1VLAA 2P2BA 3LUSA 3R9XA 5A19A 4ZLPA 4DV1C 4LF8C 4NXNC 3GPCA 2V7BA 4DR6C 4PHTA 2HJGA 3OTOC 1PG3A 1LQLA 2CY1A 3VNRA 1O93A 1PG4A 2VZEA 4EATA 4IR7A 4PROC 2QVYX 1P7LA 4GXQA 4DUYC 2UXDC 3ETCA 4FUQA 4LF9C 1ULTA 2QVXX 1HNWC 4OX9C 1MDFA 1I94C 2E0GA 4G1IA 2UUBC 1MXAA 2Y4OA 3PESA 1T5HX 5BSRA 5IT9D 5A2QD 4BSZA 4BCAA 1XMOC 3N54B 1N36C 5A1GA 3FCCA 2D1QA 2E8FA 4B3RC 4GKKC 4D56A 5T8SA 4HPVA 3VNSA 3JAMD 3DAYA 4XX2A 4D4IA 4DR1C 3CJEA 1AMUA 1XMQC 1LCIA 2VQEC 4JI5C 4GKJC 3J80D 4OXIA 4D57A 1YJ7A 4L2ZA 1IBKC 4DV2C 2Y27A 2D7VA 3EERA 4JI7C 2CXCA 4B3SC 5KYTA 1RY2A 1O9TA 3IEUA 3H2TA 4GS5A 4U5YD 1PA4A 4ODJA 1FJGC 4RVNA 1MXBA 2ZM6C 4LFCC 3AF6A 4LFAC 5AE1A 5BSVA 2YWBA 2HHHC 2E8EA 3CW8X 4DR7C 1ZB8A 1HNZC 2Y4NA 5GTDA 2PROA 4PZPA 3RV2A 4LFBC 4DV6C 3PROC 2UUAC 1FUGA 4JYAC 2E7GA 4DR3C 2YWCA 3FCEA 3B7WA 4BC7A 1O90A 4LF6C 2F4VC 1BA3A 4D4GA 4JI1C 1N33C 4TPSB 4JM1A 2OO4A 2PN2A 4DV5C 2BJOA 4BBYA 4GXRA 4JI6C 5BSMA 1HR0C 3TUFA 4WS9A 3G7SA 4K0KC 4JI8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0R A;  3IEV A;  2E8F A;  4JI0 C;  4B3R C;  4GKK C;  3T1H C;  1USP A;  3R9W A;  1J5E C;  1HNX C;  4DCU A;  4JI2 C;  2ATW A;  1ZB9 A;  4LF5 C;  3JAM D;  4XX2 A;  2E5L C;  4DR1 C;  3CJE A;  4DV7 C;  2E8C A;  1XMQ C;  1WH9 A;  2VQE C;  4X64 C;  2QL8 A;  4JI5 C;  2OPL A;  5BR8 C;  4AQY C;  4GKJ C;  2EGT A;  3J80 D;  1N34 C;  4DV0 C;  4X62 C;  1L2F A;  2UXB C;  1QWI A;  4YY3 C;  4JV5 C;  1IBK C;  1N2F A;  4DV2 C;  2D7V A;  3EER A;  4JI7 C;  1HH2 P;  2CXC A;  4LF4 C;  2PT7 G;  4B3S C;  4DR4 C;  2UUC C;  4DR5 C;  2VQF C;  4B3M C;  4DUZ C;  1XNQ C;  1JOS A;  1MKY A;  1VLA A;  3IEU A;  1PA4 A;  3LUS A;  1FJG C;  3J81 D;  3I07 A;  3R9X A;  4DV1 C;  2ZM6 C;  4LFC C;  4LF8 C;  3AF6 A;  4LFA C;  4NXN C;  2YCB A;  2HHH C;  2E8E A;  1IBM C;  4JI4 C;  2DYJ A;  4X65 C;  4DR7 C;  4DR6 C;  1NYE A;  2JMP A;  1ZB8 A;  2HJG A;  4NXM C;  4DV3 C;  4DV4 C;  4YHH C;  3OTO C;  4DR2 C;  1HNZ C;  4X66 C;  2ASB A;  1LQL A;  2CY1 A;  4DCS A;  4NOZ A;  4LFB C;  4DV6 C;  5LMN C;  2UUA C;  4KHP C;  4JYA C;  4DCT A;  2E7G A;  1ML8 A;  2UXC C;  2UU9 C;  4DCV A;  4DR3 C;  4MTN A;  4DUY C;  1IBL C;  2UXD C;  1KKG A;  4LF9 C;  4LF6 C;  2F4V C;  1UKK A;  1USP B;  3AF5 A;  4JI1 C;  5IWA C;  1N33 C;  1HNW C;  4OX9 C;  4B3T C;  4LF7 C;  4JI8 C;  1I94 C;  1XNR C;  2PN2 A;  2XR1 A;  4DV5 C;  1N32 C;  1WF3 A;  2UUB C;  2BJO A;  4JI6 C;  4JI3 C;  2OPL B;  4MH4 A;  5FLX D;  3T1Y C;  5LMU C;  5IT9 D;  2ONF A;  1HR0 C;  5A2Q D;  4BSZ A;  2KZF A;  3GKU A;  1XMO C;  4K0K C;  1N36 C;  1EGA A; 
#chains in the Genus database with same CATH topology
 1K0R A;  3A25 A;  5K8F A;  3R9W A;  3TDE A;  1J5E C;  1V60 A;  1ZB9 A;  1MD9 A;  2E5L C;  4RLF A;  4KTV A;  1QM4 A;  4DV7 C;  3C5E A;  4X64 C;  3IPL A;  3GR0 A;  2WP0 C;  4RM2 A;  1N34 C;  5KEI A;  4RLQ A;  2MMA B;  5ADZ A;  2ZZN A;  1RG9 A;  3IML A;  3UOW A;  5AE3 A;  4R1L A;  1P4E A;  4I9F A;  4LF4 C;  1MXC A;  5DV9 A;  4DR5 C;  2VQF C;  4ZJZ A;  1XNQ C;  2QVZ X;  5CZX A;  2MCQ A;  3L8C A;  5IFI A;  3DLP X;  3J81 D;  3L95 X;  2DYJ A;  4X65 C;  1NYE A;  5AE2 A;  2ASB A;  4DR2 C;  1NY8 A;  2P2M A;  3NPD A;  4DCS A;  3CQ3 A;  4NOZ A;  4RVO A;  2MM9 A;  5BUQ A;  3TQI A;  1WCJ A;  5BUR A;  1VEH A;  4DCT A;  4R1M A;  4MTN A;  1IBL C;  1KKG A;  1P4E C;  1T5D X;  4G37 A;  2CU6 A;  4LF7 C;  4NDN A;  3R44 A;  2OBV A;  3I08 A;  2XR1 A;  1N32 C;  1WF3 A;  3K6R A;  3E7W A;  2OPL B;  2QW0 X;  1MDB A;  3KXW A;  2WD9 A;  4RMN A;  2ONF A;  2D27 A;  2BH1 X;  2KZF A;  1V26 A;  4K0B A;  5H9U A;  1M6X A;  3T1H C;  3VNQ A;  5T8T A;  4IZ6 A;  3CW9 A;  4JI2 C;  2ATW A;  1O92 A;  2E8C A;  2P02 A;  1WH9 A;  2OPL A;  5BR8 C;  2D28 C;  4AQY C;  4FTF A;  4DG8 A;  5JRH A;  2DHM A;  4DV0 C;  5BUS A;  1L2F A;  2P2F A;  3EQ6 A;  4DR4 C;  5K85 A;  2UUC C;  4B3M C;  4DUZ C;  1UWD A;  4FUT A;  1MKY A;  3SO4 A;  3UZ0 A;  3LNV A;  4BC9 A;  3LGX A;  3I07 A;  1M6X C;  5BSW A;  4DG9 A;  2YCB A;  3RG2 A;  1IBM C;  4JI4 C;  2D1S A;  2JMP A;  4NXM C;  4DV3 C;  1V25 A;  4YHH C;  4DV4 C;  4X66 C;  2D1T A;  5E7Q A;  4PUG A;  5LMN C;  4KHP C;  4I9G A;  2NCL A;  1ML8 A;  2UXC C;  2UU9 C;  4RM3 A;  4DCV A;  4G36 A;  3E7X A;  4OYC A;  1UKK A;  1USP B;  3AF5 A;  4R0M A;  5IWA C;  2P2Q A;  4B3T C;  1XNR C;  3NI2 A;  3N2Q A;  4JI3 C;  3T1Y C;  4MH4 A;  5FLX D;  2Z51 A;  5LMU C;  5A1I A;  5BSU A;  3A4I A;  2P20 A;  3GKU A;  5BST A;  3NYR A;  4LE5 A;  3A9V A;  1EGA A;  2D1R A;  5KYV A;  3IEV A;  4JI0 C;  1USP A;  1IB8 A;  1HNX C;  4WV3 A;  4DCU A;  3S82 A;  3AY0 A;  4LF5 C;  3ETO A;  3CQ2 A;  2JNV A;  3LAX A;  4L4Q A;  1PU1 A;  2ZZM A;  4ISB A;  2QL8 A;  5CZV A;  1GPM A;  2EGT A;  3A9U A;  3NYQ A;  3GR1 A;  2AYA A;  2DPL A;  4KTT A;  3PBK A;  4X62 C;  2UXB C;  1XRC A;  3LNO A;  1QWI A;  4YY3 C;  4JV5 C;  4PUH A;  1N2F A;  4L7I A;  1HH2 P;  1XRA A;  2VSQ A;  2PT7 G;  3DHV A;  1JOS A;  1XRB A;  2P2J A;  1VLA A;  2P2B A;  3LUS A;  2KZ0 A;  3R9X A;  5A19 A;  4ZLP A;  4DV1 C;  4LF8 C;  4NXN C;  3GPC A;  2V7B A;  4DR6 C;  4PHT A;  2HJG A;  3OTO C;  1PG3 A;  1LQL A;  2CY1 A;  3VNR A;  1O93 A;  1PG4 A;  2VZE A;  2M5O A;  4EAT A;  4IR7 A;  4PRO C;  2QVY X;  1P7L A;  4GXQ A;  4DUY C;  2UXD C;  3ETC A;  4FUQ A;  4LF9 C;  1ULT A;  2QVX X;  1HNW C;  4OX9 C;  1MDF A;  1I94 C;  2E0G A;  4G1I A;  2UUB C;  1MXA A;  2Y4O A;  3PES A;  1XHJ A;  1T5H X;  5BSR A;  5LCI A;  5IT9 D;  5A2Q D;  4BSZ A;  4BCA A;  3CQ1 A;  1XMO C;  3N54 B;  1N36 C;  5A1G A;  3FCC A;  2D1Q A;  2E8F A;  4B3R C;  4GKK C;  4D56 A;  5T8S A;  4HPV A;  4PUI A;  3VNS A;  3JAM D;  3DAY A;  4XX2 A;  4D4I A;  4DR1 C;  3CJE A;  1AMU A;  1XMQ C;  1LCI A;  2VQE C;  4JI5 C;  4GKJ C;  3J80 D;  4OXI A;  4D57 A;  1YJ7 A;  3TR3 A;  4L2Z A;  1XS3 A;  1IBK C;  1FLO A;  4DV2 C;  2Y27 A;  2D7V A;  3EER A;  4JI7 C;  2CXC A;  4B3S C;  5KYT A;  2M5H A;  1RY2 A;  1O9T A;  3IEU A;  3H2T A;  4GS5 A;  4U5Y D;  1PA4 A;  4ODJ A;  1FJG C;  4RVN A;  1MXB A;  2ZM6 C;  4LFC C;  3AF6 A;  4LFA C;  5AE1 A;  5BSV A;  2YWB A;  2HHH C;  2E8E A;  3CW8 X;  4DR7 C;  1ZB8 A;  1HNZ C;  2Y4N A;  5GTD A;  2PRO A;  3UX3 A;  4PZP A;  2KDN A;  3RV2 A;  4LFB C;  4DV6 C;  3PRO C;  2UUA C;  1FUG A;  4JYA C;  2E7G A;  3UEB A;  2YX1 A;  4DR3 C;  2YWC A;  3FCE A;  3B7W A;  4BC7 A;  1O90 A;  4LF6 C;  2F4V C;  1BA3 A;  4D4G A;  3A26 A;  4JI1 C;  1N33 C;  3UX2 A;  4TPS B;  4JM1 A;  2OO4 A;  2PN2 A;  4DV5 C;  2BJO A;  4BBY A;  4GXR A;  4JI6 C;  3O2E A;  5BSM A;  1HR0 C;  1TH5 A;  4WS9 A;  3TUF A;  3G7S A;  4K0K C;  4JI8 C; 
#chains in the Genus database with same CATH homology
 1K0R A;  5K8F A;  3R9W A;  3TDE A;  1J5E C;  1ZB9 A;  1MD9 A;  2E5L C;  4RLF A;  4KTV A;  1QM4 A;  4DV7 C;  3C5E A;  4X64 C;  3IPL A;  3GR0 A;  2WP0 C;  4RM2 A;  1N34 C;  5KEI A;  4RLQ A;  5ADZ A;  1RG9 A;  3IML A;  3UOW A;  5AE3 A;  4R1L A;  4I9F A;  4LF4 C;  1MXC A;  5DV9 A;  4DR5 C;  2VQF C;  4ZJZ A;  1XNQ C;  2QVZ X;  5CZX A;  3L8C A;  5IFI A;  3DLP X;  3J81 D;  3L95 X;  2DYJ A;  4X65 C;  1NYE A;  5AE2 A;  2ASB A;  4DR2 C;  2P2M A;  3NPD A;  4DCS A;  4NOZ A;  4RVO A;  5BUQ A;  3TQI A;  5BUR A;  4DCT A;  4R1M A;  4MTN A;  1IBL C;  1KKG A;  1T5D X;  4G37 A;  4LF7 C;  4NDN A;  3R44 A;  2OBV A;  3I08 A;  2XR1 A;  1N32 C;  1WF3 A;  3E7W A;  2OPL B;  2QW0 X;  1MDB A;  3KXW A;  2WD9 A;  4RMN A;  2ONF A;  2D27 A;  2BH1 X;  2KZF A;  1V26 A;  4K0B A;  5H9U A;  3T1H C;  3VNQ A;  5T8T A;  4IZ6 A;  3CW9 A;  4JI2 C;  2ATW A;  1O92 A;  2E8C A;  2P02 A;  1WH9 A;  2OPL A;  5BR8 C;  2D28 C;  4AQY C;  4FTF A;  4DG8 A;  5JRH A;  4DV0 C;  5BUS A;  1L2F A;  2P2F A;  3EQ6 A;  4DR4 C;  5K85 A;  2UUC C;  4B3M C;  4DUZ C;  4FUT A;  1MKY A;  3SO4 A;  3UZ0 A;  3LNV A;  4BC9 A;  3LGX A;  3I07 A;  5BSW A;  4DG9 A;  2YCB A;  3RG2 A;  1IBM C;  4JI4 C;  2D1S A;  2JMP A;  4NXM C;  4DV3 C;  1V25 A;  4YHH C;  4DV4 C;  4X66 C;  2D1T A;  5E7Q A;  5LMN C;  4KHP C;  4I9G A;  1ML8 A;  2UXC C;  2UU9 C;  4RM3 A;  4DCV A;  4G36 A;  3E7X A;  4OYC A;  1UKK A;  1USP B;  3AF5 A;  4R0M A;  5IWA C;  2P2Q A;  4B3T C;  1XNR C;  3NI2 A;  3N2Q A;  4JI3 C;  3T1Y C;  4MH4 A;  5FLX D;  5LMU C;  5A1I A;  5BSU A;  3A4I A;  2P20 A;  3GKU A;  5BST A;  3NYR A;  4LE5 A;  3A9V A;  1EGA A;  2D1R A;  5KYV A;  3IEV A;  4JI0 C;  1USP A;  1HNX C;  4WV3 A;  4DCU A;  3S82 A;  4LF5 C;  3ETO A;  3LAX A;  4L4Q A;  4ISB A;  2QL8 A;  5CZV A;  1GPM A;  2EGT A;  3A9U A;  3NYQ A;  3GR1 A;  2AYA A;  2DPL A;  4KTT A;  3PBK A;  4X62 C;  2UXB C;  1XRC A;  1QWI A;  4YY3 C;  4JV5 C;  1N2F A;  4L7I A;  1HH2 P;  1XRA A;  2VSQ A;  2PT7 G;  3DHV A;  1JOS A;  1XRB A;  2P2J A;  1VLA A;  2P2B A;  3LUS A;  3R9X A;  5A19 A;  4ZLP A;  4DV1 C;  4LF8 C;  4NXN C;  3GPC A;  2V7B A;  4DR6 C;  4PHT A;  2HJG A;  3OTO C;  1PG3 A;  1LQL A;  2CY1 A;  3VNR A;  1O93 A;  1PG4 A;  2VZE A;  4EAT A;  4IR7 A;  4PRO C;  2QVY X;  1P7L A;  4GXQ A;  4DUY C;  2UXD C;  3ETC A;  4FUQ A;  4LF9 C;  1ULT A;  2QVX X;  1HNW C;  4OX9 C;  1MDF A;  1I94 C;  2E0G A;  4G1I A;  2UUB C;  1MXA A;  2Y4O A;  3PES A;  1T5H X;  5BSR A;  5IT9 D;  5A2Q D;  4BSZ A;  4BCA A;  1XMO C;  3N54 B;  1N36 C;  5A1G A;  3FCC A;  2D1Q A;  2E8F A;  4B3R C;  4GKK C;  4D56 A;  5T8S A;  4HPV A;  3VNS A;  3JAM D;  3DAY A;  4XX2 A;  4D4I A;  4DR1 C;  3CJE A;  1AMU A;  1XMQ C;  1LCI A;  2VQE C;  4JI5 C;  4GKJ C;  3J80 D;  4OXI A;  4D57 A;  1YJ7 A;  4L2Z A;  1IBK C;  4DV2 C;  2Y27 A;  2D7V A;  3EER A;  4JI7 C;  2CXC A;  4B3S C;  5KYT A;  1RY2 A;  1O9T A;  3IEU A;  3H2T A;  4GS5 A;  4U5Y D;  1PA4 A;  4ODJ A;  1FJG C;  4RVN A;  1MXB A;  2ZM6 C;  4LFC C;  3AF6 A;  4LFA C;  5AE1 A;  5BSV A;  2YWB A;  2HHH C;  2E8E A;  3CW8 X;  4DR7 C;  1ZB8 A;  1HNZ C;  2Y4N A;  5GTD A;  2PRO A;  4PZP A;  3RV2 A;  4LFB C;  4DV6 C;  3PRO C;  2UUA C;  1FUG A;  4JYA C;  2E7G A;  4DR3 C;  2YWC A;  3FCE A;  3B7W A;  4BC7 A;  1O90 A;  4LF6 C;  2F4V C;  1BA3 A;  4D4G A;  4JI1 C;  1N33 C;  4TPS B;  4JM1 A;  2OO4 A;  2PN2 A;  4DV5 C;  2BJO A;  4BBY A;  4GXR A;  4JI6 C;  5BSM A;  1HR0 C;  3TUF A;  4WS9 A;  3G7S A;  4K0K C;  4JI8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...