1KKGA

Nmr structure of ribosome-binding factor a (rbfa)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosome-binding factor A
publication title Solution NMR Structure of Ribosome-binding Factor A (RbfA), A Cold-shock Adaptation Protein from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2001-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1kkgA00
2PT7G 4B3RC 4XX2A 1N33C 4JI7C 3AF5A 1WF3A 1XMQC 3OTOC 1JOSA 2XR1A 1KKGA 1QWIA 4X64C 4K0KC 1IBMC 1WH9A 4DV1C 2CXCA 3GKUA 1N34C 1XNRC 3JAMD 4AQYC 4DCSA 2ONFA 4LFCC 5A2QD 4JI5C 4X65C 4DV3C 4B3TC 1IBLC 3R9XA 5BR8C 1UKKA 1ZB9A 2JMPA 4LF4C 3R9WA 4DR3C 2E8FA 2HJGA 4DUZC 4LF5C 1N2FA 4NXMC 1HNXC 5IT9D 1XNQC 4GKKC 2EGTA 2UUCC 4LF9C 2D7VA 2UXDC 1N36C 3J81D 3IEVA 3CJEA 3AF6A 1I94C 2OPLB 2QL8A 4LF7C 4NOZA 2YCBA 4JI0C 3J80D 2VQFC 2UUBC 4KHPC 4JI2C 4LFBC 4YY3C 2E8CA 3T1HC 5FLXD 4OX9C 2HHHC 3LUSA 2UU9C 4JI3C 4MTNA 2ZM6C 2VQEC 1EGAA 2ASBA 4B3SC 4NXNC 3IEUA 2ATWA 1NYEA 4JI8C 2E7GA 4DR5C 1HR0C 2DYJA 1N32C 1ZB8A 5LMNC 2OPLA 4DCVA 1K0RA 4JYAC 2E5LC 4YHHC 2F4VC 4LFAC 3T1YC 4JV5C 1PA4A 4LF6C 1LQLA 2UXCC 1J5EC 4DV0C 2BJOA 4GKJC 2UXBC 2CY1A 1MKYA 3EERA 2KZFA 4DCUA 4DV6C 4DV7C 1HNZC 5LMUC 1XMOC 1HNWC 1FJGC 4DV4C 1USPA 3I07A 4LF8C 1L2FA 4X66C 4DR7C 4DR4C 4X62C 4DUYC 4DR1C 4DR6C 1USPB 4BSZA 4JI4C 4B3MC 1ML8A 2PN2A 4JI6C 4MH4A 1VLAA 1IBKC 4DCTA 4DR2C 4DV5C 2E8EA 1HH2P 4JI1C 5IWAC 4DV2C 2UUAC
chains in the Genus database with same CATH superfamily
4BC9A 2KZ0A 1MDBA 4RM3A 2D27A 4R1LA 3E7XA 2ZZNA 2D1SA 1QWIA 4BBYA 4X64C 5A1GA 1N34C 3JAMD 2QVXX 4D4GA 4DCSA 3VNSA 4IR7A 4I9GA 2MM9A 3R9XA 5BR8C 1ZB9A 2P2MA 5JRHA 2PROA 5ADZA 4DUZC 1N2FA 4RVOA 5H9UA 5K85A 4GKKC 3GR1A 1QM4A 5LCIA 4RM2A 4LF9C 3J81D 3AF6A 3B7WA 3CQ3A 3VNQA 4NOZA 2YCBA 2YX1A 3GR0A 3LGXA 3UOWA 4YY3C 2E8CA 2HHHC 2P20A 5BSTA 2ZM6C 1FUGA 4L2ZA 4OXIA 1TH5A 2ATWA 1YJ7A 4DR5C 1NY8A 1HR0C 1MDFA 1N32C 5DV9A 5LMNC 1BA3A 5A19A 1RY2A 2OPLA 5BUQA 5BUSA 1MXBA 1AMUA 1MXCA 5BSVA 1K0RA 1V25A 4JYAC 2OO4A 2F4VC 4LFAC 3T1YC 1V60A 1PA4A 1LQLA 2ZZMA 1WCJA 4DV0C 2BH1X 4K0BA 4GKJC 1MKYA 3EERA 3VNRA 1HNZC 4ZLPA 3L8CA 1HNWC 5CZXA 1O9TA 5CZVA 4DR4C 4DR6C 4BSZA 3A9VA 4L7IA 1ML8A 4MH4A 5GTDA 1O92A 2JNVA 5BSRA 4DCTA 3IMLA 3CW8X 4XX2A 5A1IA 4LE5A 3AF5A 3KXWA 2XR1A 5BSUA 3NYRA 3PROC 1IBMC 1WH9A 4GXQA 3GKUA 3SO4A 2P2FA 1XNRC 4AQYC 4JI5C 4X65C 4B3TC 2VSQA 2JMPA 1XRBA 2HJGA 1O93A 4G36A 5IT9D 1XNQC 2EGTA 1XRAA 2D28C 2UUCC 3CQ2A 4G37A 3CQ1A 3LNOA 3CJEA 2QL8A 4ODJA 5K8FA 2VQFC 4LF7C 2UUBC 3NI2A 1XS3A 3T1HC 5BURA 4L4QA 2VQEC 3O2EA 3E7WA 4B3SC 4NXNC 5T8SA 2QW0X 2V7BA 5IFIA 1V26A 2DYJA 1FLOA 1ZB8A 4RVNA 2P02A 4DG8A 4DCVA 2AYAA 2P2BA 3A4IA 2OBVA 4JV5C 2BJOA 5AE1A 4ZJZA 4RLQA 4DV7C 5AE3A 1XMOC 1PU1A 4DV4C 3I07A 4LF8C 1L2FA 4PUHA 4JI4C 2M5OA 4JI6C 1MXAA 2QVZX 3ETOA 3CW9A 1HH2P 4DV2C 2UUAC 3A26A 3LAXA 2PT7G 4R0MA 2DHMA 4JI7C 1WF3A 1XMQC 3TDEA 4PROC 1KKGA 4KTVA 4EATA 4DV1C 1UWDA 4LFCC 4BC7A 5A2QD 4PUIA 1UKKA 4PUGA 4R1MA 2WP0C 4DR3C 3R9WA 2E8FA 3ETCA 1P4EA 4NXMC 1HNXC 3UX3A 4HPVA 3TR3A 1LCIA 2P2JA 2UXDC 5KYTA 2OPLB 4JI0C 4LFBC 5FLXD 3LNVA 4JI3C 3FCEA 3TQIA 2ASBA 3IEUA 2Y4NA 4RLFA 5BSWA 1O90A 4JI8C 3UEBA 3C5EA 3FCCA 2D1RA 4I9FA 5KYVA 4FUQA 3L95X 4D56A 2MMAB 1ULTA 3EQ6A 2E5LC 4YHHC 5AE2A 4LF6C 2CU6A 2UXCC 1J5EC 2MCQA 3DHVA 1M6XA 2UXBC 3N2QA 1XRCA 1P4EC 4D4IA 4DCUA 4DV6C 2Z51A 5LMUC 1FJGC 4GS5A 4IZ6A 4X66C 4DR7C 4DUYC 4DR1C 1USPB 4B3MC 4KTTA 3S82A 1PG4A 1P7LA 4DR2C 4GXRA 4JI1C 3GPCA 3I08A 4B3RC 1N33C 5T8TA 1T5DX 3N54B 2WD9A 3OTOC 2Y4OA 1JOSA 4U5YD 4G1IA 4K0KC 2VZEA 2CXCA 3AY0A 2YWBA 2ONFA 4ISBA 3DLPX 4DV3C 1IBLC 3UX2A 2D1QA 4WV3A 4NDNA 4LF4C 4LF5C 1M6XC 2NCLA 1PG3A 3G7SA 4PZPA 3RG2A 2D7VA 2P2QA 3DAYA 1N36C 3R44A 3IEVA 1I94C 3J80D 4KHPC 4JI2C 4TPSB 4OX9C 3LUSA 2UU9C 3UZ0A 2M5HA 1VEHA 4MTNA 3A9UA 1EGAA 3A25A 2Y27A 1NYEA 2E7GA 4JM1A 5E7QA 1GPMA 4OYCA 3PESA 4RMNA 3K6RA 1XHJA 4FUTA 4BCAA 3NPDA 2DPLA 5KEIA 1MD9A 2CY1A 1IB8A 4PHTA 3IPLA 3H2TA 4D57A 4FTFA 2KZFA 5BSMA 4WS9A 3NYQA 4DG9A 1USPA 2KDNA 1T5HX 1RG9A 2D1TA 2QVYX 3TUFA 2E0GA 3PBKA 4X62C 3RV2A 2PN2A 1VLAA 1IBKC 4DV5C 2E8EA 2YWCA 5IWAC
chains in the Genus database with same CATH topology
4BC9A 1MDBA 4RM3A 2D27A 4R1LA 3E7XA 2D1SA 1QWIA 4BBYA 4X64C 5A1GA 1N34C 3JAMD 2QVXX 4D4GA 4DCSA 3VNSA 4IR7A 4I9GA 3R9XA 5BR8C 1ZB9A 2P2MA 5JRHA 2PROA 5ADZA 4DUZC 1N2FA 4RVOA 5H9UA 5K85A 4GKKC 3GR1A 1QM4A 4RM2A 4LF9C 3J81D 3AF6A 3B7WA 3VNQA 4NOZA 2YCBA 3GR0A 3LGXA 3UOWA 4YY3C 2E8CA 2HHHC 2P20A 5BSTA 2ZM6C 1FUGA 4L2ZA 4OXIA 2ATWA 1YJ7A 4DR5C 1HR0C 1MDFA 1N32C 5DV9A 5LMNC 1BA3A 5A19A 1RY2A 2OPLA 5BUQA 5BUSA 1MXBA 1AMUA 1MXCA 5BSVA 1K0RA 1V25A 4JYAC 2OO4A 2F4VC 4LFAC 3T1YC 1PA4A 1LQLA 4DV0C 2BH1X 4K0BA 4GKJC 1MKYA 3EERA 3VNRA 1HNZC 4ZLPA 3L8CA 1HNWC 5CZXA 1O9TA 5CZVA 4DR4C 4DR6C 4BSZA 3A9VA 4L7IA 1ML8A 4MH4A 5GTDA 1O92A 5BSRA 4DCTA 3IMLA 3CW8X 4XX2A 5A1IA 4LE5A 3AF5A 3KXWA 2XR1A 5BSUA 3NYRA 3PROC 1IBMC 1WH9A 4GXQA 3GKUA 3SO4A 2P2FA 1XNRC 4AQYC 4JI5C 4X65C 4B3TC 2VSQA 2JMPA 1XRBA 2HJGA 1O93A 4G36A 5IT9D 1XNQC 2EGTA 1XRAA 2D28C 2UUCC 4G37A 3CJEA 2QL8A 4ODJA 5K8FA 2VQFC 4LF7C 2UUBC 3NI2A 3T1HC 5BURA 4L4QA 2VQEC 3E7WA 4B3SC 4NXNC 5T8SA 2QW0X 2V7BA 5IFIA 1V26A 2DYJA 1ZB8A 4RVNA 2P02A 4DG8A 4DCVA 2AYAA 2P2BA 3A4IA 2OBVA 4JV5C 2BJOA 5AE1A 4ZJZA 4RLQA 4DV7C 5AE3A 1XMOC 4DV4C 3I07A 4LF8C 1L2FA 4JI4C 4JI6C 1MXAA 2QVZX 3ETOA 3CW9A 1HH2P 4DV2C 2UUAC 3LAXA 2PT7G 4R0MA 4JI7C 1WF3A 1XMQC 3TDEA 4PROC 1KKGA 4KTVA 4EATA 4DV1C 4LFCC 4BC7A 5A2QD 1UKKA 4R1MA 2WP0C 4DR3C 3R9WA 2E8FA 3ETCA 4NXMC 1HNXC 4HPVA 1LCIA 2P2JA 2UXDC 5KYTA 2OPLB 4JI0C 4LFBC 5FLXD 3LNVA 4JI3C 3FCEA 3TQIA 2ASBA 3IEUA 2Y4NA 4RLFA 5BSWA 1O90A 4JI8C 3C5EA 3FCCA 2D1RA 4I9FA 5KYVA 4FUQA 3L95X 4D56A 1ULTA 3EQ6A 2E5LC 4YHHC 5AE2A 4LF6C 2UXCC 1J5EC 3DHVA 2UXBC 3N2QA 1XRCA 4D4IA 4DCUA 4DV6C 5LMUC 1FJGC 4GS5A 4IZ6A 4X66C 4DR7C 4DUYC 4DR1C 1USPB 4B3MC 4KTTA 3S82A 1PG4A 1P7LA 4DR2C 4GXRA 4JI1C 3GPCA 3I08A 4B3RC 1N33C 5T8TA 1T5DX 3N54B 2WD9A 3OTOC 2Y4OA 1JOSA 4U5YD 4G1IA 4K0KC 2VZEA 2CXCA 2YWBA 2ONFA 4ISBA 3DLPX 4DV3C 1IBLC 2D1QA 4WV3A 4NDNA 4LF4C 4LF5C 1PG3A 3G7SA 4PZPA 3RG2A 2D7VA 2P2QA 3DAYA 1N36C 3R44A 3IEVA 1I94C 3J80D 4KHPC 4JI2C 4TPSB 4OX9C 3LUSA 2UU9C 3UZ0A 4MTNA 3A9UA 1EGAA 2Y27A 1NYEA 2E7GA 4JM1A 5E7QA 1GPMA 4OYCA 3PESA 4RMNA 4FUTA 4BCAA 3NPDA 2DPLA 5KEIA 1MD9A 2CY1A 4PHTA 3IPLA 3H2TA 4D57A 4FTFA 2KZFA 5BSMA 4WS9A 3NYQA 4DG9A 1USPA 1T5HX 1RG9A 4X62C 2D1TA 2QVYX 3TUFA 2E0GA 3PBKA 3RV2A 2PN2A 1VLAA 1IBKC 4DV5C 2E8EA 2YWCA 5IWAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PT7 G;  4B3R C;  4XX2 A;  1N33 C;  4JI7 C;  3AF5 A;  1WF3 A;  1XMQ C;  3OTO C;  1JOS A;  2XR1 A;  1KKG A;  1QWI A;  4X64 C;  4K0K C;  1IBM C;  1WH9 A;  4DV1 C;  2CXC A;  3GKU A;  1N34 C;  1XNR C;  3JAM D;  4AQY C;  4DCS A;  2ONF A;  4LFC C;  5A2Q D;  4JI5 C;  4X65 C;  4DV3 C;  4B3T C;  1IBL C;  3R9X A;  5BR8 C;  1UKK A;  1ZB9 A;  2JMP A;  4LF4 C;  3R9W A;  4DR3 C;  2E8F A;  2HJG A;  4DUZ C;  4LF5 C;  1N2F A;  4NXM C;  1HNX C;  5IT9 D;  1XNQ C;  4GKK C;  2EGT A;  2UUC C;  4LF9 C;  2D7V A;  2UXD C;  1N36 C;  3J81 D;  3IEV A;  3CJE A;  3AF6 A;  1I94 C;  2OPL B;  2QL8 A;  4LF7 C;  4NOZ A;  2YCB A;  4JI0 C;  3J80 D;  2VQF C;  2UUB C;  4KHP C;  4JI2 C;  4LFB C;  4YY3 C;  2E8C A;  3T1H C;  5FLX D;  4OX9 C;  2HHH C;  3LUS A;  2UU9 C;  4JI3 C;  4MTN A;  2ZM6 C;  2VQE C;  1EGA A;  2ASB A;  4B3S C;  4NXN C;  3IEU A;  2ATW A;  1NYE A;  4JI8 C;  2E7G A;  4DR5 C;  1HR0 C;  2DYJ A;  1N32 C;  1ZB8 A;  5LMN C;  2OPL A;  4DCV A;  1K0R A;  4JYA C;  2E5L C;  4YHH C;  2F4V C;  4LFA C;  3T1Y C;  4JV5 C;  1PA4 A;  4LF6 C;  1LQL A;  2UXC C;  1J5E C;  4DV0 C;  2BJO A;  4GKJ C;  2UXB C;  2CY1 A;  1MKY A;  3EER A;  2KZF A;  4DCU A;  4DV6 C;  4DV7 C;  1HNZ C;  5LMU C;  1XMO C;  1HNW C;  1FJG C;  4DV4 C;  1USP A;  3I07 A;  4LF8 C;  1L2F A;  4X66 C;  4DR7 C;  4DR4 C;  4X62 C;  4DUY C;  4DR1 C;  4DR6 C;  1USP B;  4BSZ A;  4JI4 C;  4B3M C;  1ML8 A;  2PN2 A;  4JI6 C;  4MH4 A;  1VLA A;  1IBK C;  4DCT A;  4DR2 C;  4DV5 C;  2E8E A;  1HH2 P;  4JI1 C;  5IWA C;  4DV2 C;  2UUA C; 
#chains in the Genus database with same CATH topology
 4BC9 A;  2KZ0 A;  1MDB A;  4RM3 A;  2D27 A;  4R1L A;  3E7X A;  2ZZN A;  2D1S A;  1QWI A;  4BBY A;  4X64 C;  5A1G A;  1N34 C;  3JAM D;  2QVX X;  4D4G A;  4DCS A;  3VNS A;  4IR7 A;  4I9G A;  2MM9 A;  3R9X A;  5BR8 C;  1ZB9 A;  2P2M A;  5JRH A;  2PRO A;  5ADZ A;  4DUZ C;  1N2F A;  4RVO A;  5H9U A;  5K85 A;  4GKK C;  3GR1 A;  1QM4 A;  5LCI A;  4RM2 A;  4LF9 C;  3J81 D;  3AF6 A;  3B7W A;  3CQ3 A;  3VNQ A;  4NOZ A;  2YCB A;  2YX1 A;  3GR0 A;  3LGX A;  3UOW A;  4YY3 C;  2E8C A;  2HHH C;  2P20 A;  5BST A;  2ZM6 C;  1FUG A;  4L2Z A;  4OXI A;  1TH5 A;  2ATW A;  1YJ7 A;  4DR5 C;  1NY8 A;  1HR0 C;  1MDF A;  1N32 C;  5DV9 A;  5LMN C;  1BA3 A;  5A19 A;  1RY2 A;  2OPL A;  5BUQ A;  5BUS A;  1MXB A;  1AMU A;  1MXC A;  5BSV A;  1K0R A;  1V25 A;  4JYA C;  2OO4 A;  2F4V C;  4LFA C;  3T1Y C;  1V60 A;  1PA4 A;  1LQL A;  2ZZM A;  1WCJ A;  4DV0 C;  2BH1 X;  4K0B A;  4GKJ C;  1MKY A;  3EER A;  3VNR A;  1HNZ C;  4ZLP A;  3L8C A;  1HNW C;  5CZX A;  1O9T A;  5CZV A;  4DR4 C;  4DR6 C;  4BSZ A;  3A9V A;  4L7I A;  1ML8 A;  4MH4 A;  5GTD A;  1O92 A;  2JNV A;  5BSR A;  4DCT A;  3IML A;  3CW8 X;  4XX2 A;  5A1I A;  4LE5 A;  3AF5 A;  3KXW A;  2XR1 A;  5BSU A;  3NYR A;  3PRO C;  1IBM C;  1WH9 A;  4GXQ A;  3GKU A;  3SO4 A;  2P2F A;  1XNR C;  4AQY C;  4JI5 C;  4X65 C;  4B3T C;  2VSQ A;  2JMP A;  1XRB A;  2HJG A;  1O93 A;  4G36 A;  5IT9 D;  1XNQ C;  2EGT A;  1XRA A;  2D28 C;  2UUC C;  3CQ2 A;  4G37 A;  3CQ1 A;  3LNO A;  3CJE A;  2QL8 A;  4ODJ A;  5K8F A;  2VQF C;  4LF7 C;  2UUB C;  3NI2 A;  1XS3 A;  3T1H C;  5BUR A;  4L4Q A;  2VQE C;  3O2E A;  3E7W A;  4B3S C;  4NXN C;  5T8S A;  2QW0 X;  2V7B A;  5IFI A;  1V26 A;  2DYJ A;  1FLO A;  1ZB8 A;  4RVN A;  2P02 A;  4DG8 A;  4DCV A;  2AYA A;  2P2B A;  3A4I A;  2OBV A;  4JV5 C;  2BJO A;  5AE1 A;  4ZJZ A;  4RLQ A;  4DV7 C;  5AE3 A;  1XMO C;  1PU1 A;  4DV4 C;  3I07 A;  4LF8 C;  1L2F A;  4PUH A;  4JI4 C;  2M5O A;  4JI6 C;  1MXA A;  2QVZ X;  3ETO A;  3CW9 A;  1HH2 P;  4DV2 C;  2UUA C;  3A26 A;  3LAX A;  2PT7 G;  4R0M A;  2DHM A;  4JI7 C;  1WF3 A;  1XMQ C;  3TDE A;  4PRO C;  1KKG A;  4KTV A;  4EAT A;  4DV1 C;  1UWD A;  4LFC C;  4BC7 A;  5A2Q D;  4PUI A;  1UKK A;  4PUG A;  4R1M A;  2WP0 C;  4DR3 C;  3R9W A;  2E8F A;  3ETC A;  1P4E A;  4NXM C;  1HNX C;  3UX3 A;  4HPV A;  3TR3 A;  1LCI A;  2P2J A;  2UXD C;  5KYT A;  2OPL B;  4JI0 C;  4LFB C;  5FLX D;  3LNV A;  4JI3 C;  3FCE A;  3TQI A;  2ASB A;  3IEU A;  2Y4N A;  4RLF A;  5BSW A;  1O90 A;  4JI8 C;  3UEB A;  3C5E A;  3FCC A;  2D1R A;  4I9F A;  5KYV A;  4FUQ A;  3L95 X;  4D56 A;  2MMA B;  1ULT A;  3EQ6 A;  2E5L C;  4YHH C;  5AE2 A;  4LF6 C;  2CU6 A;  2UXC C;  1J5E C;  2MCQ A;  3DHV A;  1M6X A;  2UXB C;  3N2Q A;  1XRC A;  1P4E C;  4D4I A;  4DCU A;  4DV6 C;  2Z51 A;  5LMU C;  1FJG C;  4GS5 A;  4IZ6 A;  4X66 C;  4DR7 C;  4DUY C;  4DR1 C;  1USP B;  4B3M C;  4KTT A;  3S82 A;  1PG4 A;  1P7L A;  4DR2 C;  4GXR A;  4JI1 C;  3GPC A;  3I08 A;  4B3R C;  1N33 C;  5T8T A;  1T5D X;  3N54 B;  2WD9 A;  3OTO C;  2Y4O A;  1JOS A;  4U5Y D;  4G1I A;  4K0K C;  2VZE A;  2CXC A;  3AY0 A;  2YWB A;  2ONF A;  4ISB A;  3DLP X;  4DV3 C;  1IBL C;  3UX2 A;  2D1Q A;  4WV3 A;  4NDN A;  4LF4 C;  4LF5 C;  1M6X C;  2NCL A;  1PG3 A;  3G7S A;  4PZP A;  3RG2 A;  2D7V A;  2P2Q A;  3DAY A;  1N36 C;  3R44 A;  3IEV A;  1I94 C;  3J80 D;  4KHP C;  4JI2 C;  4TPS B;  4OX9 C;  3LUS A;  2UU9 C;  3UZ0 A;  2M5H A;  1VEH A;  4MTN A;  3A9U A;  1EGA A;  3A25 A;  2Y27 A;  1NYE A;  2E7G A;  4JM1 A;  5E7Q A;  1GPM A;  4OYC A;  3PES A;  4RMN A;  3K6R A;  1XHJ A;  4FUT A;  4BCA A;  3NPD A;  2DPL A;  5KEI A;  1MD9 A;  2CY1 A;  1IB8 A;  4PHT A;  3IPL A;  3H2T A;  4D57 A;  4FTF A;  2KZF A;  5BSM A;  4WS9 A;  3NYQ A;  4DG9 A;  1USP A;  2KDN A;  1T5H X;  1RG9 A;  2D1T A;  2QVY X;  3TUF A;  2E0G A;  3PBK A;  4X62 C;  3RV2 A;  2PN2 A;  1VLA A;  1IBK C;  4DV5 C;  2E8E A;  2YWC A;  5IWA C; 
#chains in the Genus database with same CATH homology
 4BC9 A;  1MDB A;  4RM3 A;  2D27 A;  4R1L A;  3E7X A;  2D1S A;  1QWI A;  4BBY A;  4X64 C;  5A1G A;  1N34 C;  3JAM D;  2QVX X;  4D4G A;  4DCS A;  3VNS A;  4IR7 A;  4I9G A;  3R9X A;  5BR8 C;  1ZB9 A;  2P2M A;  5JRH A;  2PRO A;  5ADZ A;  4DUZ C;  1N2F A;  4RVO A;  5H9U A;  5K85 A;  4GKK C;  3GR1 A;  1QM4 A;  4RM2 A;  4LF9 C;  3J81 D;  3AF6 A;  3B7W A;  3VNQ A;  4NOZ A;  2YCB A;  3GR0 A;  3LGX A;  3UOW A;  4YY3 C;  2E8C A;  2HHH C;  2P20 A;  5BST A;  2ZM6 C;  1FUG A;  4L2Z A;  4OXI A;  2ATW A;  1YJ7 A;  4DR5 C;  1HR0 C;  1MDF A;  1N32 C;  5DV9 A;  5LMN C;  1BA3 A;  5A19 A;  1RY2 A;  2OPL A;  5BUQ A;  5BUS A;  1MXB A;  1AMU A;  1MXC A;  5BSV A;  1K0R A;  1V25 A;  4JYA C;  2OO4 A;  2F4V C;  4LFA C;  3T1Y C;  1PA4 A;  1LQL A;  4DV0 C;  2BH1 X;  4K0B A;  4GKJ C;  1MKY A;  3EER A;  3VNR A;  1HNZ C;  4ZLP A;  3L8C A;  1HNW C;  5CZX A;  1O9T A;  5CZV A;  4DR4 C;  4DR6 C;  4BSZ A;  3A9V A;  4L7I A;  1ML8 A;  4MH4 A;  5GTD A;  1O92 A;  5BSR A;  4DCT A;  3IML A;  3CW8 X;  4XX2 A;  5A1I A;  4LE5 A;  3AF5 A;  3KXW A;  2XR1 A;  5BSU A;  3NYR A;  3PRO C;  1IBM C;  1WH9 A;  4GXQ A;  3GKU A;  3SO4 A;  2P2F A;  1XNR C;  4AQY C;  4JI5 C;  4X65 C;  4B3T C;  2VSQ A;  2JMP A;  1XRB A;  2HJG A;  1O93 A;  4G36 A;  5IT9 D;  1XNQ C;  2EGT A;  1XRA A;  2D28 C;  2UUC C;  4G37 A;  3CJE A;  2QL8 A;  4ODJ A;  5K8F A;  2VQF C;  4LF7 C;  2UUB C;  3NI2 A;  3T1H C;  5BUR A;  4L4Q A;  2VQE C;  3E7W A;  4B3S C;  4NXN C;  5T8S A;  2QW0 X;  2V7B A;  5IFI A;  1V26 A;  2DYJ A;  1ZB8 A;  4RVN A;  2P02 A;  4DG8 A;  4DCV A;  2AYA A;  2P2B A;  3A4I A;  2OBV A;  4JV5 C;  2BJO A;  5AE1 A;  4ZJZ A;  4RLQ A;  4DV7 C;  5AE3 A;  1XMO C;  4DV4 C;  3I07 A;  4LF8 C;  1L2F A;  4JI4 C;  4JI6 C;  1MXA A;  2QVZ X;  3ETO A;  3CW9 A;  1HH2 P;  4DV2 C;  2UUA C;  3LAX A;  2PT7 G;  4R0M A;  4JI7 C;  1WF3 A;  1XMQ C;  3TDE A;  4PRO C;  1KKG A;  4KTV A;  4EAT A;  4DV1 C;  4LFC C;  4BC7 A;  5A2Q D;  1UKK A;  4R1M A;  2WP0 C;  4DR3 C;  3R9W A;  2E8F A;  3ETC A;  4NXM C;  1HNX C;  4HPV A;  1LCI A;  2P2J A;  2UXD C;  5KYT A;  2OPL B;  4JI0 C;  4LFB C;  5FLX D;  3LNV A;  4JI3 C;  3FCE A;  3TQI A;  2ASB A;  3IEU A;  2Y4N A;  4RLF A;  5BSW A;  1O90 A;  4JI8 C;  3C5E A;  3FCC A;  2D1R A;  4I9F A;  5KYV A;  4FUQ A;  3L95 X;  4D56 A;  1ULT A;  3EQ6 A;  2E5L C;  4YHH C;  5AE2 A;  4LF6 C;  2UXC C;  1J5E C;  3DHV A;  2UXB C;  3N2Q A;  1XRC A;  4D4I A;  4DCU A;  4DV6 C;  5LMU C;  1FJG C;  4GS5 A;  4IZ6 A;  4X66 C;  4DR7 C;  4DUY C;  4DR1 C;  1USP B;  4B3M C;  4KTT A;  3S82 A;  1PG4 A;  1P7L A;  4DR2 C;  4GXR A;  4JI1 C;  3GPC A;  3I08 A;  4B3R C;  1N33 C;  5T8T A;  1T5D X;  3N54 B;  2WD9 A;  3OTO C;  2Y4O A;  1JOS A;  4U5Y D;  4G1I A;  4K0K C;  2VZE A;  2CXC A;  2YWB A;  2ONF A;  4ISB A;  3DLP X;  4DV3 C;  1IBL C;  2D1Q A;  4WV3 A;  4NDN A;  4LF4 C;  4LF5 C;  1PG3 A;  3G7S A;  4PZP A;  3RG2 A;  2D7V A;  2P2Q A;  3DAY A;  1N36 C;  3R44 A;  3IEV A;  1I94 C;  3J80 D;  4KHP C;  4JI2 C;  4TPS B;  4OX9 C;  3LUS A;  2UU9 C;  3UZ0 A;  4MTN A;  3A9U A;  1EGA A;  2Y27 A;  1NYE A;  2E7G A;  4JM1 A;  5E7Q A;  1GPM A;  4OYC A;  3PES A;  4RMN A;  4FUT A;  4BCA A;  3NPD A;  2DPL A;  5KEI A;  1MD9 A;  2CY1 A;  4PHT A;  3IPL A;  3H2T A;  4D57 A;  4FTF A;  2KZF A;  5BSM A;  4WS9 A;  3NYQ A;  4DG9 A;  1USP A;  1T5H X;  1RG9 A;  4X62 C;  2D1T A;  2QVY X;  3TUF A;  2E0G A;  3PBK A;  3RV2 A;  2PN2 A;  1VLA A;  1IBK C;  4DV5 C;  2E8E A;  2YWC A;  5IWA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...