1KKGA

Nmr structure of ribosome-binding factor a (rbfa)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of Ribosome-binding Factor A (RbfA), A Cold-shock Adaptation Protein from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics
molecule keywords ribosome-binding factor A
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2001-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1kkgA00
1HNXC 4JI3C 2VQEC 4JV5C 3AF5A 2HJGA 2QL8A 3CJEA 3AF6A 4LFBC 1FJGC 4DV1C 2E8CA 1HNZC 3IEUA 4DV4C 5BR8C 1LQLA 1J5EC 3T1YC 4DUYC 3J80D 2E5LC 2UXCC 2UU9C 1IBKC 4LF6C 4JI4C 3R9XA 4DR7C 1N34C 4DUZC 4KHPC 5FLXD 4NOZA 2F4VC 4X62C 3LUSA 2ATWA 2E7GA 2VQFC 4LFAC 2UXBC 4K0KC 2YCBA 2CXCA 4DCTA 2D7VA 1QWIA 3EERA 3R9WA 1ZB9A 4DCUA 2UUAC 4LFCC 1WF3A 4NXMC 1XNRC 2UXDC 1KKGA 4NXNC 4DV6C 2UUCC 4JI2C 4JI6C 5LMUC 3J81D 2ASBA 1L2FA 2EGTA 4DCSA 4B3SC 4JYAC 4GKKC 1JOSA 4LF5C 2CY1A 4DR4C 4GKJC 2E8EA 1MKYA 2JMPA 4YY3C 2PN2A 4LF7C 4LF8C 4JI8C 3IEVA 2XR1A 4DV7C 3GKUA 4AQYC 1XMOC 1USPB 1VLAA 4JI7C 4B3MC 4JI5C 3I07A 1USPA 1NYEA 2DYJA 4DV3C 4DR1C 5LMNC 1XNQC 2HHHC 5IWAC 4DV2C 4OX9C 1UKKA 1N36C 2PT7G 4LF4C 4X64C 1N2FA 3OTOC 4DV5C 4DR6C 4DV0C 4JI0C 4DR3C 1IBMC 2E8FA 2ZM6C 2BJOA 4DR2C 4JI1C 4XX2A 1K0RA 4YHHC 2KZFA 4MTNA 3JAMD 1HR0C 1IBLC 4MH4A 4BSZA 1EGAA 1WH9A 1ZB8A 2OPLB 1PA4A 1XMQC 2OPLA 4LF9C 1N32C 1HH2P 3T1HC 2ONFA 5A2QD 1HNWC 1I94C 4B3TC 4X65C 1N33C 1ML8A 4X66C 4DR5C 4DCVA 5IT9D 4B3RC 2UUBC
chains in the Genus database with same CATH superfamily
2E0GA 2VQEC 3IEUA 5BUQA 2P2MA 3GR0A 2OBVA 3PBKA 3TDEA 4BCAA 3T1YC 4DUYC 2E5LC 4FTFA 4HPVA 1IBKC 3LNOA 4JM1A 3UX3A 1O90A 3R9XA 2NCLA 2MCQA 4RMNA 4NOZA 2P2JA 4K0KC 4BC9A 2YCBA 3UOWA 4PZPA 1XRBA 4RLFA 3O2EA 4DCUA 3RV2A 3DAYA 1XNRC 4ZJZA 3L8CA 2WD9A 2UUCC 4JI2C 3IMLA 5LMUC 2EGTA 4B3SC 4JYAC 5JRHA 4GKKC 4I9FA 5BSWA 4IZ6A 4GKJC 1QM4A 5IFIA 4LF7C 4PUGA 1IB8A 4LF8C 3IEVA 3GKUA 4D4GA 1PG4A 5BSUA 1VLAA 4JI7C 2DYJA 4DV3C 1M6XA 2HHHC 1MXBA 4DV2C 1M6XC 1P4EA 2PT7G 3L95X 1N2FA 3LAXA 1MD9A 4BC7A 4DV0C 1IBMC 3A9UA 5ADZA 3NI2A 3CW9A 2M5HA 4DR2C 3N54B 5DV9A 3CQ2A 5AE3A 4MTNA 3GPCA 4FUQA 2M5OA 4ZLPA 3VNQA 2P02A 3TUFA 3A26A 1WH9A 4D57A 3ETOA 2V7BA 4L7IA 2OPLA 1N32C 1HH2P 5A1GA 4L2ZA 5T8SA 5BUSA 1AMUA 4DR5C 3PESA 2HJGA 2QL8A 3AF6A 1FJGC 4DV1C 3A4IA 4D56A 4DV4C 1LQLA 3FCCA 3J80D 3DHVA 2UU9C 4LF6C 2YWBA 5LCIA 3RG2A 4KHPC 2D1TA 5FLXD 1TH5A 3PROC 3LUSA 2ATWA 4G37A 4K0BA 2UXBC 3E7XA 4DCTA 1P7LA 1QWIA 2AYAA 3R9WA 1ZB9A 2KDNA 4RM3A 2UUAC 4NXMC 3J81D 3AY0A 2CY1A 4DR4C 2Y4OA 4KTVA 3KXWA 4R0MA 4IR7A 4JI8C 4WV3A 4LE5A 1RG9A 5KYVA 1XHJA 3C5EA 4JI5C 1USPA 3NPDA 1NYEA 1XRCA 2ZZNA 2D27A 2YX1A 4EATA 4OX9C 1LCIA 2OO4A 4OYCA 4DG9A 4JI0C 1ULTA 3G7SA 2QVYX 2E8FA 4GS5A 5H9UA 2BJOA 4XX2A 1K0RA 1P4EC 1HR0C 1MXCA 4BSZA 5KYTA 4U5YD 1PA4A 5BSTA 4R1MA 3NYRA 5A2QD 1HNWC 4X65C 1N33C 5IT9D 1O92A 2UUBC 4JI3C 3LGXA 3CJEA 4LFBC 2E8CA 3E7WA 5AE2A 5BR8C 4G1IA 1J5EC 1V25A 2UXCC 1O9TA 3UX2A 1PU1A 3A25A 4DR7C 1N34C 4DUZC 2F4VC 3EQ6A 4X62C 2E7GA 4L4QA 2VQFC 2D7VA 1O93A 5BSMA 1PG3A 4LFCC 2WP0C 1KKGA 4NXNC 1T5HX 4JI6C 4PHTA 4RVOA 1WCJA 3R44A 1JOSA 2P2BA 4LF5C 4PROC 3UZ0A 3CQ1A 2E8EA 5BSRA 1V26A 1MKYA 2PN2A 3ETCA 2XR1A 3A9VA 1XS3A 2Z51A 1NY8A 4PUHA 4D4IA 3NYQA 2Y27A 3I07A 2QVXX 1XNQC 5IWAC 1UKKA 1N36C 4NDNA 3OTOC 4DV5C 4RM2A 4DR3C 2MMAB 4G36A 4ISBA 4DG8A 4JI1C 4PUIA 3JAMD 2KZFA 1RY2A 5KEIA 4TPSB 4MH4A 5CZVA 1EGAA 4FUTA 1BA3A 2P20A 4GXRA 1V60A 4BBYA 5GTDA 5BSVA 2MM9A 3B7WA 2QVZX 4LF9C 2KZ0A 2ZZMA 1I94C 4B3TC 2BH1X 1ML8A 1MDBA 4X66C 1XRAA 4WS9A 4B3RC 1HNXC 4JV5C 3AF5A 3CQ3A 1HNZC 2P2QA 3CW8X 2VSQA 3S82A 2Y4NA 5CZXA 2DPLA 4JI4C 3IPLA 1UWDA 2PROA 3TR3A 4LFAC 1VEHA 5T8TA 2CXCA 4OXIA 2D1RA 3EERA 3K6RA 1WF3A 3H2TA 5E7QA 2UXDC 4DV6C 2ASBA 1L2FA 4DCSA 4R1LA 4I9GA 2JMPA 4YY3C 5AE1A 1FLOA 3GR1A 2P2FA 4RVNA 4DV7C 1YJ7A 4AQYC 4KTTA 1XMOC 1GPMA 1USPB 4B3MC 1FUGA 3SO4A 4GXQA 5A1IA 4DR1C 3N2QA 5LMNC 3VNRA 4LF4C 5K85A 4X64C 2D28C 4DR6C 2QW0X 2VZEA 3LNVA 2YWCA 1MXAA 2ZM6C 1T5DX 5K8FA 2CU6A 3I08A 4YHHC 1IBLC 3TQIA 3UEBA 2JNVA 2D1SA 1ZB8A 4ODJA 2OPLB 2D1QA 3FCEA 1XMQC 2DHMA 4RLQA 3T1HC 2ONFA 3DLPX 5A19A 1MDFA 3VNSA 4DCVA 5BURA
chains in the Genus database with same CATH topology
2E0GA 2VQEC 3IEUA 5BUQA 2P2MA 3GR0A 2OBVA 3PBKA 3TDEA 4BCAA 3T1YC 4DUYC 2E5LC 4FTFA 4HPVA 1IBKC 4JM1A 1O90A 3R9XA 4RMNA 4NOZA 2P2JA 4K0KC 4BC9A 2YCBA 3UOWA 4PZPA 1XRBA 4RLFA 4DCUA 3RV2A 3DAYA 1XNRC 4ZJZA 3L8CA 2WD9A 2UUCC 4JI2C 3IMLA 5LMUC 2EGTA 4B3SC 4JYAC 5JRHA 4GKKC 4I9FA 5BSWA 4IZ6A 4GKJC 1QM4A 5IFIA 4LF7C 4LF8C 3IEVA 3GKUA 4D4GA 1PG4A 5BSUA 1VLAA 4JI7C 2DYJA 4DV3C 2HHHC 1MXBA 4DV2C 2PT7G 3L95X 1N2FA 3LAXA 1MD9A 4BC7A 4DV0C 1IBMC 3A9UA 5ADZA 3NI2A 3CW9A 4DR2C 3N54B 5DV9A 5AE3A 4MTNA 3GPCA 4FUQA 4ZLPA 3VNQA 2P02A 3TUFA 1WH9A 4D57A 3ETOA 2V7BA 4L7IA 2OPLA 1N32C 1HH2P 5A1GA 4L2ZA 5T8SA 5BUSA 1AMUA 4DR5C 3PESA 2HJGA 2QL8A 3AF6A 1FJGC 4DV1C 3A4IA 4D56A 4DV4C 1LQLA 3FCCA 3J80D 3DHVA 2UU9C 4LF6C 2YWBA 3RG2A 4KHPC 2D1TA 5FLXD 3PROC 3LUSA 2ATWA 4G37A 4K0BA 2UXBC 3E7XA 4DCTA 1P7LA 1QWIA 2AYAA 3R9WA 1ZB9A 4RM3A 2UUAC 4NXMC 3J81D 2CY1A 4DR4C 2Y4OA 4KTVA 3KXWA 4R0MA 4IR7A 4JI8C 4WV3A 4LE5A 1RG9A 5KYVA 3C5EA 4JI5C 1USPA 3NPDA 1NYEA 1XRCA 2D27A 4EATA 4OX9C 1LCIA 2OO4A 4OYCA 4DG9A 4JI0C 1ULTA 3G7SA 2QVYX 2E8FA 4GS5A 5H9UA 2BJOA 4XX2A 1K0RA 1HR0C 1MXCA 4BSZA 5KYTA 4U5YD 1PA4A 5BSTA 4R1MA 3NYRA 5A2QD 1HNWC 4X65C 1N33C 5IT9D 2UUBC 1O92A 4JI3C 3LGXA 3CJEA 4LFBC 2E8CA 3E7WA 5AE2A 5BR8C 4G1IA 1J5EC 1V25A 2UXCC 1O9TA 4DR7C 1N34C 4DUZC 2F4VC 3EQ6A 4X62C 2E7GA 4L4QA 2VQFC 2D7VA 1O93A 5BSMA 1PG3A 4LFCC 2WP0C 1KKGA 4NXNC 1T5HX 4JI6C 4PHTA 4RVOA 3R44A 1JOSA 2P2BA 4LF5C 4PROC 3UZ0A 2E8EA 5BSRA 1V26A 1MKYA 2PN2A 3ETCA 2XR1A 3A9VA 4D4IA 3NYQA 2Y27A 3I07A 2QVXX 1XNQC 5IWAC 1UKKA 1N36C 4NDNA 3OTOC 4DV5C 4RM2A 4DR3C 4G36A 4ISBA 4DG8A 4JI1C 2KZFA 5KEIA 1RY2A 3JAMD 4TPSB 4MH4A 5CZVA 1EGAA 4FUTA 1BA3A 2P20A 4GXRA 4BBYA 5GTDA 5BSVA 3B7WA 2QVZX 4LF9C 1I94C 4B3TC 2BH1X 1ML8A 1MDBA 4X66C 1XRAA 4WS9A 4B3RC 1HNXC 4JV5C 3AF5A 1HNZC 2P2QA 3CW8X 2VSQA 3S82A 2Y4NA 5CZXA 2DPLA 4JI4C 3IPLA 2PROA 4LFAC 5T8TA 2CXCA 4OXIA 2D1RA 3EERA 1WF3A 3H2TA 5E7QA 2UXDC 4DV6C 2ASBA 1L2FA 4DCSA 4R1LA 4I9GA 2JMPA 4YY3C 5AE1A 3GR1A 2P2FA 4RVNA 4DV7C 1YJ7A 4AQYC 4KTTA 1XMOC 1GPMA 1USPB 4B3MC 1FUGA 3SO4A 4GXQA 5A1IA 4DR1C 3N2QA 5LMNC 3VNRA 4LF4C 5K85A 4X64C 2D28C 4DR6C 2QW0X 2VZEA 3LNVA 2YWCA 1MXAA 2ZM6C 1T5DX 5K8FA 3I08A 4YHHC 1IBLC 3TQIA 2D1SA 1ZB8A 4ODJA 2OPLB 2D1QA 3FCEA 1XMQC 4RLQA 3T1HC 2ONFA 3DLPX 5A19A 1MDFA 3VNSA 4DCVA 5BURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX C;  4JI3 C;  2VQE C;  4JV5 C;  3AF5 A;  2HJG A;  2QL8 A;  3CJE A;  3AF6 A;  4LFB C;  1FJG C;  4DV1 C;  2E8C A;  1HNZ C;  3IEU A;  4DV4 C;  5BR8 C;  1LQL A;  1J5E C;  3T1Y C;  4DUY C;  3J80 D;  2E5L C;  2UXC C;  2UU9 C;  1IBK C;  4LF6 C;  4JI4 C;  3R9X A;  4DR7 C;  1N34 C;  4DUZ C;  4KHP C;  5FLX D;  4NOZ A;  2F4V C;  4X62 C;  3LUS A;  2ATW A;  2E7G A;  2VQF C;  4LFA C;  2UXB C;  4K0K C;  2YCB A;  2CXC A;  4DCT A;  2D7V A;  1QWI A;  3EER A;  3R9W A;  1ZB9 A;  4DCU A;  2UUA C;  4LFC C;  1WF3 A;  4NXM C;  1XNR C;  2UXD C;  1KKG A;  4NXN C;  4DV6 C;  2UUC C;  4JI2 C;  4JI6 C;  5LMU C;  3J81 D;  2ASB A;  1L2F A;  2EGT A;  4DCS A;  4B3S C;  4JYA C;  4GKK C;  1JOS A;  4LF5 C;  2CY1 A;  4DR4 C;  4GKJ C;  2E8E A;  1MKY A;  2JMP A;  4YY3 C;  2PN2 A;  4LF7 C;  4LF8 C;  4JI8 C;  3IEV A;  2XR1 A;  4DV7 C;  3GKU A;  4AQY C;  1XMO C;  1USP B;  1VLA A;  4JI7 C;  4B3M C;  4JI5 C;  3I07 A;  1USP A;  1NYE A;  2DYJ A;  4DV3 C;  4DR1 C;  5LMN C;  1XNQ C;  2HHH C;  5IWA C;  4DV2 C;  4OX9 C;  1UKK A;  1N36 C;  2PT7 G;  4LF4 C;  4X64 C;  1N2F A;  3OTO C;  4DV5 C;  4DR6 C;  4DV0 C;  4JI0 C;  4DR3 C;  1IBM C;  2E8F A;  2ZM6 C;  2BJO A;  4DR2 C;  4JI1 C;  4XX2 A;  1K0R A;  4YHH C;  2KZF A;  4MTN A;  3JAM D;  1HR0 C;  1IBL C;  4MH4 A;  4BSZ A;  1EGA A;  1WH9 A;  1ZB8 A;  2OPL B;  1PA4 A;  1XMQ C;  2OPL A;  4LF9 C;  1N32 C;  1HH2 P;  3T1H C;  2ONF A;  5A2Q D;  1HNW C;  1I94 C;  4B3T C;  4X65 C;  1N33 C;  1ML8 A;  4X66 C;  4DR5 C;  4DCV A;  5IT9 D;  4B3R C;  2UUB C; 
#chains in the Genus database with same CATH topology
 2E0G A;  2VQE C;  3IEU A;  5BUQ A;  2P2M A;  3GR0 A;  2OBV A;  3PBK A;  3TDE A;  4BCA A;  3T1Y C;  4DUY C;  2E5L C;  4FTF A;  4HPV A;  1IBK C;  3LNO A;  4JM1 A;  3UX3 A;  1O90 A;  3R9X A;  2NCL A;  2MCQ A;  4RMN A;  4NOZ A;  2P2J A;  4K0K C;  4BC9 A;  2YCB A;  3UOW A;  4PZP A;  1XRB A;  4RLF A;  3O2E A;  4DCU A;  3RV2 A;  3DAY A;  1XNR C;  4ZJZ A;  3L8C A;  2WD9 A;  2UUC C;  4JI2 C;  3IML A;  5LMU C;  2EGT A;  4B3S C;  4JYA C;  5JRH A;  4GKK C;  4I9F A;  5BSW A;  4IZ6 A;  4GKJ C;  1QM4 A;  5IFI A;  4LF7 C;  4PUG A;  1IB8 A;  4LF8 C;  3IEV A;  3GKU A;  4D4G A;  1PG4 A;  5BSU A;  1VLA A;  4JI7 C;  2DYJ A;  4DV3 C;  1M6X A;  2HHH C;  1MXB A;  4DV2 C;  1M6X C;  1P4E A;  2PT7 G;  3L95 X;  1N2F A;  3LAX A;  1MD9 A;  4BC7 A;  4DV0 C;  1IBM C;  3A9U A;  5ADZ A;  3NI2 A;  3CW9 A;  2M5H A;  4DR2 C;  3N54 B;  5DV9 A;  3CQ2 A;  5AE3 A;  4MTN A;  3GPC A;  4FUQ A;  2M5O A;  4ZLP A;  3VNQ A;  2P02 A;  3TUF A;  3A26 A;  1WH9 A;  4D57 A;  3ETO A;  2V7B A;  4L7I A;  2OPL A;  1N32 C;  1HH2 P;  5A1G A;  4L2Z A;  5T8S A;  5BUS A;  1AMU A;  4DR5 C;  3PES A;  2HJG A;  2QL8 A;  3AF6 A;  1FJG C;  4DV1 C;  3A4I A;  4D56 A;  4DV4 C;  1LQL A;  3FCC A;  3J80 D;  3DHV A;  2UU9 C;  4LF6 C;  2YWB A;  5LCI A;  3RG2 A;  4KHP C;  2D1T A;  5FLX D;  1TH5 A;  3PRO C;  3LUS A;  2ATW A;  4G37 A;  4K0B A;  2UXB C;  3E7X A;  4DCT A;  1P7L A;  1QWI A;  2AYA A;  3R9W A;  1ZB9 A;  2KDN A;  4RM3 A;  2UUA C;  4NXM C;  3J81 D;  3AY0 A;  2CY1 A;  4DR4 C;  2Y4O A;  4KTV A;  3KXW A;  4R0M A;  4IR7 A;  4JI8 C;  4WV3 A;  4LE5 A;  1RG9 A;  5KYV A;  1XHJ A;  3C5E A;  4JI5 C;  1USP A;  3NPD A;  1NYE A;  1XRC A;  2ZZN A;  2D27 A;  2YX1 A;  4EAT A;  4OX9 C;  1LCI A;  2OO4 A;  4OYC A;  4DG9 A;  4JI0 C;  1ULT A;  3G7S A;  2QVY X;  2E8F A;  4GS5 A;  5H9U A;  2BJO A;  4XX2 A;  1K0R A;  1P4E C;  1HR0 C;  1MXC A;  4BSZ A;  5KYT A;  4U5Y D;  1PA4 A;  5BST A;  4R1M A;  3NYR A;  5A2Q D;  1HNW C;  4X65 C;  1N33 C;  5IT9 D;  1O92 A;  2UUB C;  4JI3 C;  3LGX A;  3CJE A;  4LFB C;  2E8C A;  3E7W A;  5AE2 A;  5BR8 C;  4G1I A;  1J5E C;  1V25 A;  2UXC C;  1O9T A;  3UX2 A;  1PU1 A;  3A25 A;  4DR7 C;  1N34 C;  4DUZ C;  2F4V C;  3EQ6 A;  4X62 C;  2E7G A;  4L4Q A;  2VQF C;  2D7V A;  1O93 A;  5BSM A;  1PG3 A;  4LFC C;  2WP0 C;  1KKG A;  4NXN C;  1T5H X;  4JI6 C;  4PHT A;  4RVO A;  1WCJ A;  3R44 A;  1JOS A;  2P2B A;  4LF5 C;  4PRO C;  3UZ0 A;  3CQ1 A;  2E8E A;  5BSR A;  1V26 A;  1MKY A;  2PN2 A;  3ETC A;  2XR1 A;  3A9V A;  1XS3 A;  2Z51 A;  1NY8 A;  4PUH A;  4D4I A;  3NYQ A;  2Y27 A;  3I07 A;  2QVX X;  1XNQ C;  5IWA C;  1UKK A;  1N36 C;  4NDN A;  3OTO C;  4DV5 C;  4RM2 A;  4DR3 C;  2MMA B;  4G36 A;  4ISB A;  4DG8 A;  4JI1 C;  4PUI A;  3JAM D;  2KZF A;  1RY2 A;  5KEI A;  4TPS B;  4MH4 A;  5CZV A;  1EGA A;  4FUT A;  1BA3 A;  2P20 A;  4GXR A;  1V60 A;  4BBY A;  5GTD A;  5BSV A;  2MM9 A;  3B7W A;  2QVZ X;  4LF9 C;  2KZ0 A;  2ZZM A;  1I94 C;  4B3T C;  2BH1 X;  1ML8 A;  1MDB A;  4X66 C;  1XRA A;  4WS9 A;  4B3R C;  1HNX C;  4JV5 C;  3AF5 A;  3CQ3 A;  1HNZ C;  2P2Q A;  3CW8 X;  2VSQ A;  3S82 A;  2Y4N A;  5CZX A;  2DPL A;  4JI4 C;  3IPL A;  1UWD A;  2PRO A;  3TR3 A;  4LFA C;  1VEH A;  5T8T A;  2CXC A;  4OXI A;  2D1R A;  3EER A;  3K6R A;  1WF3 A;  3H2T A;  5E7Q A;  2UXD C;  4DV6 C;  2ASB A;  1L2F A;  4DCS A;  4R1L A;  4I9G A;  2JMP A;  4YY3 C;  5AE1 A;  1FLO A;  3GR1 A;  2P2F A;  4RVN A;  4DV7 C;  1YJ7 A;  4AQY C;  4KTT A;  1XMO C;  1GPM A;  1USP B;  4B3M C;  1FUG A;  3SO4 A;  4GXQ A;  5A1I A;  4DR1 C;  3N2Q A;  5LMN C;  3VNR A;  4LF4 C;  5K85 A;  4X64 C;  2D28 C;  4DR6 C;  2QW0 X;  2VZE A;  3LNV A;  2YWC A;  1MXA A;  2ZM6 C;  1T5D X;  5K8F A;  2CU6 A;  3I08 A;  4YHH C;  1IBL C;  3TQI A;  3UEB A;  2JNV A;  2D1S A;  1ZB8 A;  4ODJ A;  2OPL B;  2D1Q A;  3FCE A;  1XMQ C;  2DHM A;  4RLQ A;  3T1H C;  2ONF A;  3DLP X;  5A19 A;  1MDF A;  3VNS A;  4DCV A;  5BUR A; 
#chains in the Genus database with same CATH homology
 2E0G A;  2VQE C;  3IEU A;  5BUQ A;  2P2M A;  3GR0 A;  2OBV A;  3PBK A;  3TDE A;  4BCA A;  3T1Y C;  4DUY C;  2E5L C;  4FTF A;  4HPV A;  1IBK C;  4JM1 A;  1O90 A;  3R9X A;  4RMN A;  4NOZ A;  2P2J A;  4K0K C;  4BC9 A;  2YCB A;  3UOW A;  4PZP A;  1XRB A;  4RLF A;  4DCU A;  3RV2 A;  3DAY A;  1XNR C;  4ZJZ A;  3L8C A;  2WD9 A;  2UUC C;  4JI2 C;  3IML A;  5LMU C;  2EGT A;  4B3S C;  4JYA C;  5JRH A;  4GKK C;  4I9F A;  5BSW A;  4IZ6 A;  4GKJ C;  1QM4 A;  5IFI A;  4LF7 C;  4LF8 C;  3IEV A;  3GKU A;  4D4G A;  1PG4 A;  5BSU A;  1VLA A;  4JI7 C;  2DYJ A;  4DV3 C;  2HHH C;  1MXB A;  4DV2 C;  2PT7 G;  3L95 X;  1N2F A;  3LAX A;  1MD9 A;  4BC7 A;  4DV0 C;  1IBM C;  3A9U A;  5ADZ A;  3NI2 A;  3CW9 A;  4DR2 C;  3N54 B;  5DV9 A;  5AE3 A;  4MTN A;  3GPC A;  4FUQ A;  4ZLP A;  3VNQ A;  2P02 A;  3TUF A;  1WH9 A;  4D57 A;  3ETO A;  2V7B A;  4L7I A;  2OPL A;  1N32 C;  1HH2 P;  5A1G A;  4L2Z A;  5T8S A;  5BUS A;  1AMU A;  4DR5 C;  3PES A;  2HJG A;  2QL8 A;  3AF6 A;  1FJG C;  4DV1 C;  3A4I A;  4D56 A;  4DV4 C;  1LQL A;  3FCC A;  3J80 D;  3DHV A;  2UU9 C;  4LF6 C;  2YWB A;  3RG2 A;  4KHP C;  2D1T A;  5FLX D;  3PRO C;  3LUS A;  2ATW A;  4G37 A;  4K0B A;  2UXB C;  3E7X A;  4DCT A;  1P7L A;  1QWI A;  2AYA A;  3R9W A;  1ZB9 A;  4RM3 A;  2UUA C;  4NXM C;  3J81 D;  2CY1 A;  4DR4 C;  2Y4O A;  4KTV A;  3KXW A;  4R0M A;  4IR7 A;  4JI8 C;  4WV3 A;  4LE5 A;  1RG9 A;  5KYV A;  3C5E A;  4JI5 C;  1USP A;  3NPD A;  1NYE A;  1XRC A;  2D27 A;  4EAT A;  4OX9 C;  1LCI A;  2OO4 A;  4OYC A;  4DG9 A;  4JI0 C;  1ULT A;  3G7S A;  2QVY X;  2E8F A;  4GS5 A;  5H9U A;  2BJO A;  4XX2 A;  1K0R A;  1HR0 C;  1MXC A;  4BSZ A;  5KYT A;  4U5Y D;  1PA4 A;  5BST A;  4R1M A;  3NYR A;  5A2Q D;  1HNW C;  4X65 C;  1N33 C;  5IT9 D;  2UUB C;  1O92 A;  4JI3 C;  3LGX A;  3CJE A;  4LFB C;  2E8C A;  3E7W A;  5AE2 A;  5BR8 C;  4G1I A;  1J5E C;  1V25 A;  2UXC C;  1O9T A;  4DR7 C;  1N34 C;  4DUZ C;  2F4V C;  3EQ6 A;  4X62 C;  2E7G A;  4L4Q A;  2VQF C;  2D7V A;  1O93 A;  5BSM A;  1PG3 A;  4LFC C;  2WP0 C;  1KKG A;  4NXN C;  1T5H X;  4JI6 C;  4PHT A;  4RVO A;  3R44 A;  1JOS A;  2P2B A;  4LF5 C;  4PRO C;  3UZ0 A;  2E8E A;  5BSR A;  1V26 A;  1MKY A;  2PN2 A;  3ETC A;  2XR1 A;  3A9V A;  4D4I A;  3NYQ A;  2Y27 A;  3I07 A;  2QVX X;  1XNQ C;  5IWA C;  1UKK A;  1N36 C;  4NDN A;  3OTO C;  4DV5 C;  4RM2 A;  4DR3 C;  4G36 A;  4ISB A;  4DG8 A;  4JI1 C;  2KZF A;  5KEI A;  1RY2 A;  3JAM D;  4TPS B;  4MH4 A;  5CZV A;  1EGA A;  4FUT A;  1BA3 A;  2P20 A;  4GXR A;  4BBY A;  5GTD A;  5BSV A;  3B7W A;  2QVZ X;  4LF9 C;  1I94 C;  4B3T C;  2BH1 X;  1ML8 A;  1MDB A;  4X66 C;  1XRA A;  4WS9 A;  4B3R C;  1HNX C;  4JV5 C;  3AF5 A;  1HNZ C;  2P2Q A;  3CW8 X;  2VSQ A;  3S82 A;  2Y4N A;  5CZX A;  2DPL A;  4JI4 C;  3IPL A;  2PRO A;  4LFA C;  5T8T A;  2CXC A;  4OXI A;  2D1R A;  3EER A;  1WF3 A;  3H2T A;  5E7Q A;  2UXD C;  4DV6 C;  2ASB A;  1L2F A;  4DCS A;  4R1L A;  4I9G A;  2JMP A;  4YY3 C;  5AE1 A;  3GR1 A;  2P2F A;  4RVN A;  4DV7 C;  1YJ7 A;  4AQY C;  4KTT A;  1XMO C;  1GPM A;  1USP B;  4B3M C;  1FUG A;  3SO4 A;  4GXQ A;  5A1I A;  4DR1 C;  3N2Q A;  5LMN C;  3VNR A;  4LF4 C;  5K85 A;  4X64 C;  2D28 C;  4DR6 C;  2QW0 X;  2VZE A;  3LNV A;  2YWC A;  1MXA A;  2ZM6 C;  1T5D X;  5K8F A;  3I08 A;  4YHH C;  1IBL C;  3TQI A;  2D1S A;  1ZB8 A;  4ODJ A;  2OPL B;  2D1Q A;  3FCE A;  1XMQ C;  4RLQ A;  3T1H C;  2ONF A;  3DLP X;  5A19 A;  1MDF A;  3VNS A;  4DCV A;  5BUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...