4ZLPA

Crystal structure of notch3 negative regulatory region
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
253
structure length
241
Chain Sequence
PRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurogenic locus notch homolog protein 3
publication title Insights into Autoregulation of Notch3 from Structural and Functional Studies of Its Negative Regulatory Region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 62
structure length 241
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zlpA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4zlpA01
4ZLPA 5CZXA 5CZVA 2OO4A 3ETOA 3L95X
chains in the Genus database with same CATH superfamily
3DDNA 1K73T 5CYQA 2OHDA 2ZZNA 2BH1X 1CEZA 2DHGA 3DKDA 2LFVA 2BANB 4WZQA 2H54B 3Q24A 4WK3A 3POTA 2XMAA 4OYWA 4O3RA 3EE3A 4RX6A 2EK6A 2CPFA 5BYSA 1RISA 1YG0A 2CQIA 1FRIA 1KEKA 2KL8A 3R7SB 2V8GA 3MMCA 5K20B 2NPFA 1HWJA 4WTYA 3DRPB 2R7OA 2R8IA 3B7WA 3IRXA 4I7FA 1QM4A 3NOGA 4CRJA 3LH2S 4JI1F 4ZHRB 1RT3B 2DGOA 5LSOA 4Y2CA 1GPMA 3B78A 3CQ3A 3IO1A 3H98A 1MNEA 4NL5A 3SFGA 4RKUC 1KP6A 4I9GA 4JI1J 4FUQA 2HYIB 1FWKA 3OTEA 4AYBD 3RG6A 1S0VA 3NEKA 3QO9A 2H4WB 1BQXA 3M8ZA 4TY9A 3CMAS 2D3O1 1BGXT 4X4SA 1IBLF 5SUHA 4A8YA 4JI6F 1S9GB 2QEXS 1UEVA 2OUGA 2LQJA 2RKIB 2VBYA 2HMIB 5ETLA 1HNVA 3FFIB 3VAMA 5AE2A 1S6UA 3KXWA 3UI3A 1EETA 1TV6A 3K2YA 1IBLJ 3MPVA 5F0UA 4JI6J 2QL7B 4J7CA 4Y2AA 4IH7A 1N32C 5AXMA 3WHIA 3G82A 3JTPA 3Q23A 3N28A 4ICLA 5BSVA 3D68A 1UJ6A 2GO8A 4IZ6A 2G0JA 4L7IA 4LF5F 1VRUA 5BSUA 3EZUA 1Q82T 4N77A 2AW0A 1SUQA 2RUGA 1N34F 1RWVB 3UFCX 1XK8A 2E5JA 5BYQA 2E1RA 2ZUAA 2VU5A 3QRPA 3T6JA 5D3GB 5AXKA 2BE7D 4PYAA 2XGPA 2I2YA 1QAYA 3C6UB 4B9VA 2ZDPA 3UWTA 4J9UE 3LTOA 1Q5YA 3LUSA 1SQEA 3TEGA 4RLQA 2PSZA 2VKRA 3US5A 4TY8A 2YX4A 2Y1LB 3E51A 2DTJA 4TLQA 2KN4A 2YCBA 2AYMA 3E7XA 1PYSB 1UW9A 4NI2A 3C3LA 1O92A 3TWZA 1ZM2A 3ZZUA 5E7QA 4ZJLA 3PXGa 4UOFA 2DNPA 2OPRB 2W7PA 1K9MT 1WC6A 5AJ3J 1LW2B 4XIUA 2GIRA 4NEYA 3LO3A 2A6OA 4UOCA 5BR8F 3JSYA 2WOMA 1VHIA 4UW2A 2UU9F 4PG7A 3IM8A 3D6HB 2V67A 1UVNA 1OY9A 1ZZFA 2C3PA 3OTDA 2L41A 3KHGA 7FDRA 4ZVQB 5AE3A 3Q83A 2J9CA 5BR8J 1HWUA 1W2IA 3A8EA 2GO9A 1DFDA 2C2ZB 3UCGA 3CCSS 1FJ7A 2NSBA 4MIBA 4OX9C 5HBMA 2WCXA 2GNKA 3L7PA 4IQXA 2VDHA 1PG3A 2GZOA 4NMXA 1UEKA 3PEJA 4PUHA 4CO3A 1U47A 4WF9Q 2DB1A 3QLHA 1LKZA 1Q7YT 5A2QY 3H5UA 4YDXA 3NWRA 3RZAA 4XO0A 3RB4A 5BXIA 3CD7A 2KFNA 3L4BC 2HHPA 3VAIA 4ZP7A 2DCLA 2F4FA 2I6WA 2OMLA 1IVZA 2VUGA 1T9UA 5KFBA 1S4EA 4H4KC 1T9XA 3LWMA 3ZNUA 3BEGB 4KE5A 4X62F 2UUCF 4DL5A 4ZP8A 2CNKB 4CLPA 2DNZA 3ILLA 2P2MA 5KFOA 1Y4ZB 2QSWA 3FUYA 2KZFA 4OYXA 1RA7A 2UXDF 4X66F 1SB6A 5ITHA 1N36F 5ADZA 1CS4A 2P9CA 1FUGA 2HHXA 2C2MB 1KRPA 2UUCJ 2RS2A 3MR6A 2XQCA 2QT7A 1BQMA 3O3LA 4R0EA 2QX0A 4WK1A 3UN5A 5DV9A 1VJWA 1KFDA 3DNCA 1LNQA 4F2RA 2YWFA 1J5EC 4DUYF 4FPRA 5LJ5Y 4JUZA 2J5AA 5LMNC 5L1IA 3M8YA 2E5LC 3GU0A 5E5NA 2M5OA 2OPSA 5A8RA 1X4FA 3C14A 1ZH5A 2LDIA 4QWDA 1V3SA 2VODA 1I1GA 2FHJA 4DV1C 3VHQA 3MM8A 2JVOA 5A76A 2MLZA 5CHCB 4QWCA 5K8NA 1QAIA 4DUYJ 2H9ZA 2VQEF 1S6QB 4EUVA 1O90A 2R7UA 1ZAVA 1GH8A 4DV4F 3A1YG 1XNQC 2DY1A 1U49A 3OTOJ 1C1BA 1U7LA 2C2OB 3NPDA 3DMJB 4JB8B 2VBXA 4IRDA 3CNQP 2Z2MA 1Q8KA 2V9KA 2FQQB 1RHMB 2X1FA 1HFEL 4GXRA 4GMKA 1F5CA 1MMLA 1QLNA 2VQEJ 2GIQA 5HSPA 4DV4J 1DQ9A 5HN0A 2CUYA 3ISND 2VASA 3FGVA 4JV5C 1L3KA 1GMWD 3MEDA 1DQAA 4ZOSA 2E5GA 3SO4A 4U7UK 3DRRB 4PXCA 1SKWA 2D27A 2HK3A 2B9EA 1N5YA 2CKWA 4P75A 3H5SA 4MH8A 3JQKA 3DOMA 2HBRB 4M5DA 2YNHA 3SDEA 3GIRA 3T9NA 5J2NB 2OSQA 5L1LA 3H4DA 4IR1A 2NQPA 4WFAQ 3NNAA 3N6MA 3TVKA 3KHHA 4C8NA 1FTCA 2ASBA 3HZGA 4CNZA 9ATCB 2HRUA 3OVSA 3H59A 1CJVA 1M0SA 2K7JA 4DZDA 3O44A 1MDFA 4JI5J 4NOHA 5KFVA 2XWYA 3EVMA 4A8OA 2HZVA 1YZ7A 1N56A 1TL4A 2HQFA 2OTJS 2BBEA 1UCNA 1C4CA 3MTJA 3VQSA 4DSFA 4UY85 3KNAA 3OL6A 1WSVA 2JVRA 4WIQA 2CZ9A 3C46A 3OHBA 2AJ4A 3I31A 1S1XA 4WP8A 2GV1A 2C28A 2CQDA 3ZZPA 1FESA 3R97A 1NDKA 2XG8A 3LP1A 4KR0B 4F4WA 3ZZTA 3E3XA 4LIWA 2GVZB 3NS7B 1WDTA 1RJJA 1T5DX 2VD3A 3IM9A 1JIHA 1U6ZA 2C3OA 3SQGA 3X3UA 5GMKa 4KT0C 4JI8C 4YOEA 3OJSA 4C4WA 1QUPA 3CCJS 3FJ2A 3DOLA 3QSYB 1PJ6A 2FJDB 4IR9A 2HURA 1HQEB 1F2HA 1UWBB 2GHPA 3FSXA 2M88A 2QVXX 1NBEB 2J8AA 2MZJA 3H2UB 4LF8J 3KLHA 1AXQA 4DR1F 2HNDB 5KFWA 2V4RA 1F3FA 3K5PA 4GKKC 2WVEA 1VR6A 5D8HB 1WOOA 3QQCD 2IM2A 2GJFA 2MLXA 3AHPA 5A8KB 1WEZA 2CFXA 4F3QA 1PIEA 2U1AA 2KB2A 4FXVA 2MJUA 4NASA 2QE5A 2XMMA 3HI9A 2R8JA 4J9SA 4CTAB 3S8SA 3LQVA 4I56A 1TKZB 3AQPA 2B7BB 1RT2A 4ALZA 2CVIA 2HQDA 3CCQS 5I3QA 2J6UA 1UPMB 4JOUA 5THWA 2HQIA 1WWHA 2RF2B 4RM3A 1VFJA 3P5TL 1G7CB 5MAOA 1Z2LA 5AXNA 3O8WA 2Y27A 1CBKA 2HHSA 3AD9C 4WIIA 3V6HA 3NGTA 4I2QA 3QT8A 3TANA 3M8WA 4UQTA 4HPVA 2E5HA 3ENVA 2DIVA 4QR0A 3OW2R 3L8CA 4NLXA 1HHQA 3NP5A 2ZC4A 4TU7A 4LBPA 4ZIVA 4OX6A 4R0JA 3Q2TC 3CT9A 1X4BA 3PFEA 1HNXJ 1WG4A 3PW4A 2RQMA 2CY1A 1Y7PA 4DSEA 2OD4A 5FLXY 4ILLA 1WELA 4EYIB 1RTIB 1K0TA 4CI0B 4BDPA 2IAJA 1KKGA 2CG4A 1GT8A 2ZBQA 5T8TA 1T8EA 1YVFA 1MU2B 1W2BR 2FJWA 1S1TB 5B0CA 3DHWC 3V6DA 4RW6B 3GIIA 2K06A 2UXCC 2PA8D 2RH3A 4MFBB 4K4VA 4ATNA 3V4MA 4X65C 2FVSA 3M1VA 5A8WA 3VVUA 2G2YA 5CQGA 1T11A 2DRDA 1YKWA 4FF3A 2IJFA 1KTQA 2W25A 4DQPA 2XNRA 4EWTA 1OIAA 4MMOA 2B8PA 2R9LA 4FN5A 3TQIA 4DI6A 1OMSA 1A0OB 5GVQA 4K0KC 4W90B 3JSMB 4O4GB 1TKXA 3BH7B 3MAAB 4M5JA 2HIQA 5D0EA 5HLFA 1Y10A 3FVYA 3G6XA 4NA1A 3IFEA 2L08A 1SV5A 1YJ9S 3VQTA 4CLUA 3GV8B 1RAHB 2EG2A 4QPTA 1L3VA 1FNMA 1NPPA 1HI8A 1RWUA 4CLYA 3SSQA 4BWJA 2RE1A 1P4EC 1RCOB 4DV0F 1F0XA 3QWPA 1P9YA 3OR1A 4HI2A 5IT9U 3AAWB 1HNWF 4GVBB 4G1IA 1T9VA 4PHTA 3QJLA 3OVAA 1EKSA 1AT1B 5KG4A 4LBHA 1KDNA 3DLEA 1R8AA 5B0BA 1APSA 4DV5C 4R25A 3M9NB 4DR2F 1U1NA 2E1MC 1S1VA 4NLGA 2JMPA 2RRNA 2MCQA 5LJ3Y 4DV0J 1Q79A 2DXEA 2HWTA 4O0NA 2QYGA 5KFIA 1HNWJ 2Q1LA 5KYVA 1SIZA 3FDSA 4EYHB 2MXYA 4WFZA 1R6VA 3SCIE 3IWLA 1N5QA 2BJOA 4N7TA 4PROC 2QA4S 1F9HA 1XMBA 2FHOB 5KFXA 3QYYA 2DY9A 5EGYA 2P20A 1NU4A 1NK9A 2ZJRQ 4OHVA 4ZN3A 3VGTA 1U45A 3FSIA 1JK9B 1USPB 3ISZA 1REVB 4KGZB 2NZCA 3E8OA 2MDAA 3TRGA 3BH6B 5HQMA 5A1IA 4DXLA 4J91A 4UQGA 2V4JA 4YDDB 3U7JA 4DPTA 4HTIA 1RHUB 2HQ3A 3T1HF 3PZPA 2KH9A 1JLFA 2KFYA 3MM7A 3MOJB 2F1FA 2W1BA 3B4DA 3ZZZA 3KNGA 3L09A 3Q86A 4P10A 2IDLA 1S9EA 3O2IA 4K4YA 4V1Ak 2BR0A 1CG2A 2HZAA 5F3TA 1U8WA 1FO1A 5B08A 2M9KA 1VJQA 4RUBA 4ISBA 3IBFB 2NUUG 4DPYA 2XI3A 3QGIA 3T1HJ 3HDSA 2ADCA 4DUTA 3P6YC 3TO8A 4ES1A 1ULTA 5EX3A 4HYKA 2BDPA 4ES3A 3FBBA 3RG2A 4TU9A 4ZLLA 4QYZK 1IR1A 2IC3B 2CA9A 5L46A 2QL9B 1XEZA 3ET6B 1OPZA 1QE1B 5DZ7A 3MMAB 1HNIA 5ETTA 2VOPA 2NYIA 2JJ4D 1AW0A 2VG7A 3H2TA 1C0UB 5DZ6A 3I07A 4F8RA 1VQMS 1WOSA 2DHXA 1WORA 2G2OA 1J27A 1UJ5A 2OEMA 3MGJA 1NSQA 3R5BA 3PO5A 4FNIA 4IG3A 4RR5A 5E7OB 4RW4B 2B5JB 2DRBA 4Q43A 1U8SA 4NLUA 2EC0A 5LMUC 3OFHA 4O4RA 2RT3A 4NLSA 1RTDB 2KHDA 3MXHP 2RNEA 5EUHA 2IM1A 3R5JB 4I68A 2KM8B 5J2QA 1RT4A 1DAXA 1IKVB 4NZ6A 2EXUA 3EXYA 3CSKA 4KTTA 2MGZB 1UVJA 3TUPA 3QGGA 3O2EA 4HT5A 4JYAC 2QA4G 2YTCA 3I5AA 3KUHA 5H9FJ 4RW9A 4BS2A 3F0NA 4O3OA 1V5VA 1PAEX 4ELUA 4EI2A 3A12A 2W7OA 1QSYA 4MT1A 1N6QB 2DIUA 1P8GA 3UZ0A 2BJ1A 1T3OA 5AXLA 1NH8A 4J9RA 3PVXA 5KFTA 4N47A 4WE1A 3UO0A 5IT9D 4Q2LA 1VQ7S 1YX2A 3NAHA 2YPYA 2OPPB 1QAJA 1TL1B 3A3PB 3MR5A 2R7QA 5G4DA 1N0VC 2OGUA 5ETSA 2ONFA 2WRMA 1RWOB 4B3RC 3NNCA 4KTQA 4RVNA 4ERDA 1DTQB 1O93A 2XWXA 2MY7A 4C0BA 1T95A 3V81A 3M2VA 3GLJA 2NXNA 1T03B 4K7QA 3J81j 1X0FA 2UVWA 4USKA 2X7IA 3FCWA 1TR0A 2LQBA 3T6BA 4Y00A 3PYGA 3M30B 5JUMA 4KY3A 4PQAA 2YNGB 2B56A 4Y3CA 4CYUB 4WFNQ 1T7PA 5ETQA 5EX0A 3DRXA 3O5TB 1PSDA 3M32B 1F1BB 3SIPB 1C2PA 2VV5A 3PFOA 3W9JA 2Z57B 3T5HA 4LRDA 3TZZA 1ZB8A 1TFYA 2BJ9A 3UN2A 3F73A 2XMWA 3T1YF 4B9SA 4LQ9A 4D4GA 4YP3A 1MD9A 4F2SA 1GAOA 3HHLC 3DYAB 2HFZA 2RQCA 5E2QA 2B43A 1FNOA 4DL4A 4IFVA 2J9DE 2O67A 3HCXA 3LP0B 2ZFHA 5IFIA 4PAAA 3PW2A 2CADA 2B4VA 5M2PA 3T1YJ 3PCOB 1LW0A 5J2PB 1I94J 4OFZA 3RW7A 2E44A 3M9OB 4IOBA 3D5MA 1U25A 5HAOA 2ILYA 2QGFB 3EERA 1Q5VA 5IQQA 1TUGB 4ER8A 5B0AA 1YGYA 2FC8A 1AMUA 3NBPA 1IKYB 4ECQA 1P1TA 5DQIA 1WF1A 3L7UA 1JJ4A 1EZZB 2KZZA 3OSPA 2KXHA 4RW7A 4DSKA 1WG5A 1RU2A 3PHTA 1JLGB 1Q7LB 4X64C 3DXSX 3M6VA 3MM6A 2DH8A 5CH7B 1SL0A 3CDUA 3IG1A 3MMBB 4Q2MA 3I0SA 4DX5A 1JNZB 3D6MB 2RQKA 2MKCA 5I42B 3H90A 1FX2A 3LGHA 3TVYA 2JH3A 1ZA1B 1JOSA 4KQZA 1WHVA 1H0HB 3C6TB 1SKRA 3NG8A 5FJ4A 4DG1A 2CNNB 1SH3A 2DO4A 2NCKL 3HSDA 1H98A 3Q2SC 2VG5A 3HVWA 1N0UA 3QAUA 3SCLE 4RWXA 5EWGA 2D28C 2HQGA 2CQPA 4TQSA 1EIYB 1L3TA 3TZYA 3TJAA 4DSLA 5ETNA 3GB0A 2CPZA 2DT9A 3M05A 2C3UA 5T7LB 2EW9A 3FEZA 2R2UA 1U26A 4D4IA 4CT9A 1PGZA 2P2JA 2RS8A 2ERRA 3IGNA 1N32F 5HVGA 1Y5LB 3AOCA 5I3UB 4ZPVR 4LRBA 1OYEA 2Y8YA 2APOA 4B3SJ 3IS9A 3PX0A 2VG6B 3M8QB 5RUBA 3QT5A 3C2PA 4G65A 4HL9A 4ECXA 3LGNA 4JI7C 1N32J 1DZ5A 2E1CA 3CE8A 4OHWA 1TAUA 1RTZA 4USJC 3IWNC 5HROB 2BE2A 2A18A 4AXIA 2DH7A 2B8QA 5KFQA 4LMZA 3I55S 3UNGC 3IRWP 2NLWA 3GIMA 2AYGA 1M1GA 3MPWA 2UP1A 1P1LA 3PYDA 4ZKAA 3BR8A 2WTFA 2RRBA 1RLDA 4LF9C 1EARA 1HQUA 4RUHA 4PABA 2EVZA 4IDKB 1SC3B 4NLRA 2YX7A 4K4XA 2C2EA 2J0XA 4FVCA 3TYTA 3GG0A 1KQKA 3K5NA 2MMYA 1T94A 4R5PB 5T41A 3QFHA 4A47A 1RKJA 2DNLA 5E3QA 4HH0A 4NCBA 4OI2A 2BABA 1NK6A 2ZKTA 1BUXA 4URQU 1YRXA 4MJKA 4DQQA 3LWLA 3VF0B 4KGXB 3W63A 1RBLA 3JAMY 2ZUGA 1VK3A 3G71S 2HBQB 1B4SA 2A0FB 3DM2A 4R0MA 1I6JA 5H1SV 1WC5A 5D4OA 1WEYA 3MAQA 4MTPA 3AJ2A 2UV8G 4DS5A 3VGVA 2ZEJA 2BUNA 1RY2A 4KO0B 2V8VA 2E0GA 5IWAC 1CC7A 3J81U 3V5RA 1VQYA 3DI6A 1LK5A 4OX9F 3ITHB 2OPQB 3K7RA 1URRA 2R8GA 5C25B 4FYYB 3ZZYA 3W2WA 4CLKA 3GJTB 2MZTA 1AUDA 1X5TA 2YH1A 2YWKA 2GAHC 2VC1A 3M2RA 2ZH7A 1X31C 2FLLA 2FVQA 4C3KA 3I0RA 2VJVA 3I6PA 4CO0A 4OX9J 1KHWA 2JL9A 1NMEB 3PEHA 4NLDA 3QAEA 5KFAA 2QLWA 3PX6A 2XSJB 4YS2A 4EMDA 1JKHB 3TAPA 1NH7A 1HARA 4OHZA 1J5OA 2RRAA 4DQSA 4PXEA 4U67Q 2QLJB 3KTQA 2HJGA 5IC4B 4C11B 1REGX 2AKWB 3R7BB 2AF6A 1KVKA 3KDOA 4EEYA 3WX4A 1JLBA 2W9BB 3NY0A 1K47A 5GAGI 4C0HA 4CLTA 4G6VB 2JEIA 3FRZA 3RR8A 2PT7G 3H2LA 2FJXA 4I0WA 4OJ1A 3OFFA 1MSWD 4X84A 2ZH9A 4OYPA 3BSAA 1HL6A 4DCJB 4URGA 3FEXB 1J5EF 5D0GA 4I6AA 5IC6B 3L95X 5LMNF 2UXBC 4HACA 1OWXA 1PJ7A 2E5LF 3AFGA 2YKNA 1RHJB 1ICEB 4NXMJ 4CM2A 3MURP 1TELA 3OR2A 3R27A 1JLAA 3IR5B 3DLLQ 4DV1F 2KT2A 4UT4A 3BSOA 4WJBA 3V4IA 1KLMB 1N5VA 1J5EJ 2DPIA 4ZJQA 1QWIA 4NMLA 1Z2ZA 2E5LJ 1NDLA 1XNQF 3IWXA 4ZA1A 1HPZB 3K6RA 2BANA 5C24B 1Q8BA 3UD4P 2MZRA 1VC5A 3IGVA 3P45B 1GXTA 5HMXA 4ZVGA 2J6TA 4PWDB 3IMLA 1FRLA 3RJMB 5DDQC 3D4JA 2OAUA 3I32A 3OTOC 1EP4B 3D9BA 2PI4A 3VTIA 1XNQJ 3GMGA 2XCPA 1YJRA 2YKMB 4JV5F 2BYCA 2NXJA 4Q8FA 3UDEA 3KLFB 3UVJA 3B82A 3T9ZA 4DDFA 3DDKA 3DRPA 1NHUA 3CC2S 1U1KA 2PEHA 1IXKA 3J7ZT 4Z37A 2JZ5A 4ZHRA 1RT3A 5KFHA 2BJ3A 2YXLA 4JV5J 4LFCC 5KT3A 1KD1T 4B3MC 1WTBA 3VAKA 1S77D 2XC9A 1GMVA 2PI5A 3ENQA 3DLGB 3NMRA 1XERA 1SH2A 4TQRA 1KTVA 2PEBA 1UAWA 9RUBA 4C8YA 2GQ2A 2RVJA 1RQ0A 2YNFB 2G1DA 2A1BA 5KT6A 2QRRA 5EWFA 2YH0A 4EK2A 5C42B 4JI5C 4F3MA 1S9GA 3J81D 1LFWA 4U5YD 3R9LA 1YK9A 2RKIA 2HMIA 2WHOA 1JLCB 4V19X 1Q53A 1SXLA 2C2NA 1M6XC 2HHQA 5DG8A 5GAHI 1WOPA 4TU8A 4CO1A 5F9NA 3UR0A 2FZKB 2QZ8A 4KJIA 1O6XA 1FD8A 4JI8F 1X5SA 3KK1A 4D3GA 3POTB 4DV3C 1NZAA 3QBCA 4H4KA 4ZDNA 2BM0A 3L7OA 4JI2J 4XPEA 3QSIA 1YJNS 2VFTA 4JI0J 2L9WA 1S49A 4O23A 1FRKA 3MR2A 1F2GA 1UMJA 1BQNA 4BHQA 2E9RX 4ZPBA 2PE8A 3TA2A 1YITS 3HSGA 1GFWB 2DRAA 2WP0C 2MZ1A 2YWWA 3RRKA 4R1LA 1O0PA 4ETZA 4GKKF 4LF4C 1TK0A 3IR7B 1SVDA 1AZSA 5A1GA 5KFKA 2WBMA 4LF8C 1Y3JA 2YQ1A 5F41A 3GYXB 5KG1A 4ZP6A 5D3GA 4J90A 4KGVB 3C6UA 1H2VZ 5B0DA 3K5OA 3K58A 1FDNA 4GKKJ 3U02A 1W25A 4RNHA 2XMVA 2A2CA 4RUCA 4QR2A 1QVFR 1FRXA 1FK9A 2VONA 2IRUA 3CO9A 1R7IA 1UWAA 2OSRA 2UUAC 3NCQA 2DXDA 3QO9B 2QYCA 1LQLA 3BBCA 1URNA 2HPUA 3GJQB 2AZ1A 5L9NA 1YRUA 1U48A 1HD0A 3JQMA 2MZSA 6AT1B 2OPRA 3PKMA 1ZPWX 1BD6A 5KG5A 1HNVB 4IQMA 1T5HX 3ZTQA 4ZPDA 1KVJA 4PUGA 1NYEA 2IHR1 4GC6A 4CO4A 2HEKA 2LQ5A 4ELTA 1RAFB 2Y1JA 1KHVA 4Y28C 5LCIA 3THVA 5DGBA 4QOTA 4ICLB 5BSTA 3M8RA 1HNXC 1ZTWA 1R31A 4OZ2A 3AXKA 2CQ4A 3GYGA 3MPYA 2B9WA 1LWFB 3AH6A 2IM3A 2RSQA 4L74A 2UXCF 4I2PB 2BW2A 5KFMA 1SPBP 2BJ8A 2V94A 1X9SA 2J76E 4X65F 1LCIA 1B7FA 1YJUA 2BJDA 1RE1B 1T9YA 3GPAA 3NAIA 2DK2A 4L6V3 5A6PA 1A6LA 4PQUA 3CMES 4N8OA 4ED3A 1OY6A 2UXCJ 1NKCA 2FUG9 2I9SA 4ZCMA 4K0KF 2Y4OA 1IBMJ 4X65J 4TLRA 3GPCA 3M6WA 4MAKA 2LXUA 3M2UB 3JYTA 3BB5A 2CQCA 1R3NA 5J1PA 1VEHA 1HD1A 3B54A 3G6ES 2XTJP 3H0PA 4K2XA 1TAQA 1U1PA 4K0KJ 1DLOA 3VAHA 1F5AA 4Q0BA 2KZMA 4DF4A 3SSRA 2CPXA 4EZ6A 3EGZA 5L38A 1TU0B 1X60A 2A10A 5IV4A 2XULA 2YNIA 4W98A 4J9MA 4CH0S 1KKHA 1VQLS 1X4DA 3HM9A 3HSZA 4B9NA 3R2CJ 4DV5F 2E5IA 1A7GE 1EKRA 1HBOB 2DNOA 5D15A 4ZCLA 2CVEA 2ZBPA 1NKEA 2O66A 2BRKA 3FCVA 3CJRA 1P7LA 4YB7A 2H65B 4PG4A 3TQ1A 1HHTP 2KRBA 1S6QA 2K2PA 1VI7A 3LPEA 1IJFB 1XNRJ 1TFWA 1S0NA 4M5GA 2ZHOA 4OZ0A 2IA6A 2J6SA 4USTA 4DV5J 1XIQA 2XI2A 5DLGA 3TX0A 2RD5C 4LF6C 3MCMA 1GNKA 5KTQA 3K89A 1IQTA 4FYDA 4FYWB 2HNZB 4PRFA 2AV5A 4C3MA 5LSLA 1LV5A 5A2QD 4RBVA 1QDUB 5HQLA 1ZM4A 3DRRA 1RBOB 3BQ1A 2Z2LA 5CXTA 5DJBA 4WXOA 4QCLA 2CXEA 3HVAA 3BQ2A 2WB1D 2UVRA 3KJFB 1Y11A 2EK1A 5L8RC 5J2NA 3PV8A 3KOAA 1DJ0A 3K57A 4LF7J 4HR2A 5IV3A 4F26A 2QL8A 5K14A 3R1HA 3WQPA 4UUXA 2GQCA 1PILA 2H5EA 2V8PA 3N79A 4TVAB 4P9SA 3QRRA 3TR5A 4J9LA 3MAHA 1BQMB 5AT1B 4ANEA 3S7RA 1M1HA 1BE4A 1OY8A 1R8BA 2K3IA 4EZ9A 3K0JA 1RHQB 2CJKA 3OXLA 5D4LA 2CDQA 5C7PA 2CXCA 1KFSA 4ID8A 3MECB 2WSEC 4F02A 4A8WA 4F4KA 4ECRA 3OQ2A 2EC2A 1N48A 3D0GE 4MKYA 3C14B 1M5OC 3UEBA 4J5OA 2GMLA 4HDHA 3EGNA 2MQOA 2QL5B 1NM2A 1NK4A 2HSEB 3BV8A 2L9DA 1FLOA 4AL5A 2DR9A 3FQLA 2HVEA 1IQZA 3AD7C 3DOKA 2OPLB 2GVZA 4ECWA 2ALZA 2V4QA 2PA3A 1Q16B 2QV6A 1O5JA 1IWGA 5LXYA 4NCGB 3EWGA 1H2TZ 1RYRA 4F04B 5HP1B 2L48A 1GK8A 5LMUF 3HSJA 2CQGA 1HH2P 2EFVA 1HQEA 2LU1A 3IEUA 2V5HG 4DL2A 1B70B 1I3OB 1UWBA 1GEHA 1V3ZA 2RDJA 2CG8A 1M1KT 1BWVA 4XDDA 4DCOB 1M90T 1PJ5A 1D9AA 1JX4A 3DLPX 3MEDB 5I4MA 4DQIA 4YN3B 2N7YA 5LMUJ 4DPUA 4D3HA 4JYAF 2P9GA 2MKIA 3S82A 5GMEA 3PW7A 3DOMB 4OLOA 3ENAA 3G4SS 1D1UA 3R1LA 4I6YA 1ZM3A 2HIYA 4P52A 5EHHA 3FKBA 5J1NA 2XM3A 2E7XA 1FXRA 3GCWP 5GAGU 1NK8A 4DLGA 3A4IA 1VBZA 1H73A 1WF0A 1CJVB 4FNHA 4EO6A 2RF2A 2ZKUA 3NRBA 1RCXB 4NLQA 5A19A 3Q8YA 2RQ4A 4DBQA 2CRLA 4USMA 4BC9A 2DR5A 1HR0C 4B3RF 1IB8A 5LOQA 5ETKA 5F8NA 5E0OA 3GTYX 5HQ8A 1S1XB 4QWBA 1U02A 1XMOC 4QWAA 1TL7B 4QZVB 2UUWA 2K7KA 4R8UB 4DV7C 1UA1A 3EJMA 2B6AB 2KJWA 4RBTA 1FDAA 4B3RJ 2FHJD 2KVQE 3CW9A 4CLZA 2FB0A 1HBUB 1ZYQA 4BLGA 2E7WA 2ZH6A 3T5JA 1I5OB 2KTQA 4A8FA 4DV6C 2CPYA 1FA0A 1RTIA 3KKFA 1NPRA 2X3DA 2RILA 5JVGQ 3JTNA 5IFMA 5KFZA 5FDLB 3OFEA 4FYVB 4FZVA 2V68A 1MU2A 3H2VE 1ZTTA 5BUSA 3LGXA 2DNYA 4OV6A 2XZTB 2J7UA 4RW6A 1U6FA 3NYQA 1H72C 3BKFA 2WSFC 3CJ3A 2DGWA 5A0YA 3A4TA 4ED0A 2XHCA 4MFBA 3NL0A 1QAXA 3D28A 3B6BA 3HHDA 3GILA 1B0VA 5D4NA 4J9QA 2PROA 1TKTB 4LSLB 3LAKA 3CB4A 4KGMA 5LM7E 3QZ7A 1FRMA 4ITSA 3R6LB 3UE2A 4B9MA 1N54B 1UFWA 1IR0A 1S7HA 1RT2B 2UVUA 2EFGA 1OSCA 4DX6A 1HMVA 3JSMA 1SJRA 4O4GA 4YR2A 2QW0X 3MAAA 3ZZ0A 5LSRA 1S1WB 2KYZA 1PBAA 1I94C 3B8HA 1UZDA 4OQJA 2B4UA 2LMIA 3IP0A 2ZC3A 1Q1KA 4EGLA 1H2UX 4X64F 4I2QB 1MMNA 1YBTA 2BXJA 4DJBA 2ZWOA 2GMJA 4OZJA 1PG5B 4FVMA 4C8MA 1JXEA 3BGUA 3DLKB 2WONB 2OI2A 5GTDA 4ECVA 2Q66A 4X64J 2IVFB 5EDWA 2PO4A 5GAHU 4C98A 1U1MA 3TAQA 3DGVA 4DPWA 2DJWA 4ZS6A 2HS3A 4FYXB 1Y00A 4NCAA 1HW9A 2ZH8A 3CJ2A 3LAXA 2Y3YA 4KPYA 4G1QB 1WHYA 3MM9B 1QY7A 3SQOP 1IN0A 3C19A 4V19J 5K8PA 5FLXD 1S76D 2XBPA 3FBEA 3LNOA 1AYEA 2VFUA 1N5TA 2F40A 1YBAA 1S99A 2Z2ZA 1USPA 3FRYA 1OO0B 2UZAA 1G1XA 2Y0BB 2MQNA 1REVA 3F44A 4PZPA 2JNVA 3BQ0A 2IM0A 4QU6A 2K1RB 2CAJA 4ECSA 1XRBA 4HHJA 2Z8QA 3UDVA 4MH4A 1NJWA 4OYZA 4JI7F 4NZ7A 3N4WA 1TKXB 3GR0A 4NXNJ 5JRHA 1A9NB 4B3SC 3C66A 1VCTA 1BHNA 1S6OA 2CPEA 3UD3P 4Y34A 2IBOA 1FJEB 3H4BA 3N01A 1SQFA 1TL5A 1MW7A 4OYCA 2N4CA 3T5LA 2M0GB 2DHHA 3WZ0A 4KH1B 3KLGB 1KONA 3CPWR 5CA5A 2KI2A 8RUCA 1XMQC 1H38A 2V34A 3S6EA 3U1LA 4P2XA 4JI7J 2BZ2A 2XS7A 4LF9F 4ZLJA 4ELVA 1FKPB 2FVRA 2D74B 2F7VA 2IC3A 3KJNB 2W9CA 2UV8A 4UOGA 2JC0A 2VJUA 3SSSA 3ET6A 3QGHA 1QE1A 3WIUA 1IBKJ 3MMAA 2OFHX 3VNSA 2QLFB 2MQQA 2ATCB 3AODA 1C0UA 1S1VB 1CJKB 3DGPB 4NPOA 4LF9J 1RADB 3J7YU 5E3CA 4FBUA 4HEA9 1YSJA 1F3VA 1S4FA 1X0PA 4RW4A 2B5JA 2DGXA 3C16B 3TX8A 2LKZA 3AY0A 4OX7A 2ACYA 2RDDA 3N6LA 4A4JA 4PPZA 5F8MA 1TZ0A 1RTDA 5T8SA 4NDNA 2XY5A 1L3SA 5AJ3F 3NNHA 1R27B 4A48A 3UDLA 5K85A 3CO0P 3SBMA 4YQWA 3HKWA 2WBRA 1XHJA 2XLKA 3CQ2A 4JI4C 5IWAF 4WU2A 1X4GA 3BGLA 2V4JB 1VOMA 1IKVA 1D0EA 4OLPA 1X9MA 2FZCB 2MGZA 1FJCA 4OZ3A 2NXCA 1JLFB 1O51A 4OI1A 2M5YA 3NWGA 2BJEA 1FJGC 5K5MA 1S9EB 1XBWA 4RNNA 5IZHA 2ASJA 3C5EA 3SI8A 1HHSA 4P7TA 5IWAJ 2H1YA 1IKWB 1XTZA 1TK5A 2FY1A 4UZBA 2ASDA 1N6QA 2YKPA 3D1OA 1DRZA 1WC1A 2XS5A 3H40A 1RT5B 1XC9A 2CWXA 1JLEB 2RUSA 1VGYA 3GFXA 4F0HA 4BWMA 1YJVA 5GADU 4GKJJ 2OPPA 4M5LA 4OYAA 4IUFA 3I96A 1JMTA 2HRTA 4HHHA 2ILZA 4ZP9A 1YZ6A 4NRTA 2AYEA 2BV3A 3HVTA 4JM1A 4RMNA 5E33A 3BYPA 2VG7B 2ZZMA 4WYWA 2QJ3A 1EB0A 3X1LB 1S6PB 3R3TA 4ZPAA 2YKAA 1RSCA 4DZ6A 3UQSA 3J7Z5 1XWLA 2P2FA 2FJEB 1B64A 3D1QA 4USWA 2MSTA 1MWQA 2MMAB 2Z30B 5L1JA 2YNGA 2UXBF 1G6BA 2AEFA 4KPCA 1UETA 3UX2A 4ZVEA 1RTHB 2ZH5A 2XNQA 1KQSR 2JEJA 3W9HA 1OYDA 4LR8A 2EGTA 1WUUA 1RT4B 3WIVA 4NXMC 2XMJA 5ETMA 3MEGA 2UXBJ 1T9TA 1V26A 4A8QA 2MSSA 4FXDA 4MKVA 2YWEA 3LUYA 3DYAA 3HJVA 4MTNA 3ONQA 3ZFVA 2HWIA 3CW8X 2Y1RI 2KO1A 1B3TA 4K4ZA 1S48A 2C2KB 3LP0A 2BQ3A 4L3NA 3OL9A 1GXLA 4B3OB 3MEEA 2CNLB 2H5IB 3OTOF 3CJEA 4UY8T 4LSNA 2AZ3A 2B4PA 4OZ1A 1C1CA 2CJBA 2V6AA 3W3SA 5CD4H 6FDRA 1TP7A 2VDIA 2HG4A 1IKYA 2HFOA 2XY7A 3VZIA 3H7HB 1GX5A 2PN2A 1X7VA 3NLCA 4LFCF 1ZAXA 2HK2A 3NGKA 5KFJA 3V2UC 3RYLA 3R5CA 4B3MF 4M94A 3V81B 3W61A 5KFLA 3PG9A 1T0TV 2MHEA 2UUTA 5I42A 1FWPA 3D67A 5H9UA 1RAGB 3UN3A 2PFDA 4ZVPB 1NSKL 2ZJQQ 5GAEI 3HXMA 2V2ZA 3W2VB 1VIXA 2GGPB 4LFCJ 4RU2A 4DSIA 4UF4A 2ZM6F 3FBFA 2OMOA 3O1LA 3PDNA 3BO3A 5IM0A 4B3MJ 1SBRA 3P8BB 4JI5F 2FHMA 2P9EA 4Y65A 5CCMA 4WFBQ 2C2RA 1SC4B 2ZE2B 2VZEA 3ISNC 4LFBC 1DBDA 4F0MA 2NUHA 3TP2A 5K8MA 2ZM6J 2OFGX 3KJVA 1HBNB 2EBGA 2OLWA 1DURA 4FXWA 2WVBA 4ID5B 3TNVA 3GCXP 1K0VA 2IJNA 4DV3F 3U27A 4M63A 4I4BA 3IR6B 4MK9A 2PDAA 1M5HA 3V6KA 1VQKS 2LVWA 4KB7A 2VG6A 3M8QA 1G3OA 3PY8A 5KT2A 4TPSB 1JWWA 4L75A 4JI2C 2G9OA 4C0OC 4L3KA 3MR3A 5KFDA 3AT1B 4WFXA 4DV3J 4LF4F 4JI0C 4WPAA 1IM6A 5HROA 5CD4A 4MKBA 3D0HE 1CC8A 4WKRA 4LF8F 3ZZOA 4F7VA 2PC6A 3GONA 3SZ2A 2V7BA 1LQ9A 1QM9A 2ZBCA 4G37A 4GXQA 5L39A 3THTA 3G9CA 1HIYA 1IUJA 4LF4J 2F5GA 3GR1A 4P6QA 2KZ0A 4U9RA 2DHAA 3ETCA 3W7BA 2COLA 4L73A 5FD1A 4AXJA 1RUSA 5KAKA 2UUAF 2HHUA 2DHSA 4R5PA 1X8DA 4Y2MA 4ES2A 3P49B 2F4VC 1MLAA 4C8OA 3CDWA 1S72S 4OL8A 4OV1A 1G4CA 3TDEA 3IA0A 4CP5A 5BJRA 4EBDA 3GKUA 1HBMB 5KFPA 4Z2XA 2BQRA 3AF6A 3LPYA 1XRCA 2UUAJ 3DU5A 4RZRA 2GJ2A 1YHQS 3HHEA 3GJSB 4QW9A 4J9NA 3BGOP 2VPXB 4DV2J 2RMLA 1IKXB 3TA0A 1L3UA 1SJ4P 1N33C 2XLJA 3EGVA 3FCEA 4KO0A 4O0IA 4KTVA 4MK7A 2V69A 4OHXA 3CIZA 2NR0A 3E01A 3TUJC 1S79A 3BS9A 1AUSL 4M1KA 1R89A 1U1RA 1HNXF 3ITHA 2OPQA 5ETOA 4IOCQ 3DRYA 5IS2A 1R8CA 2HVDA 2IVMA 3G8QA 3OHAA 1KLNA 3ZXWA 2XO6A 5BSMA 2X3GA 4KKOB 2NS1B 1VBXA 2HNYB 3HD2A 5DG9A 4ZPCA 2YPZA 2LCWA 3FEYB 4YR0A 1OQ3A 1Y5IB 1ULRA 2G0IA 4IOAQ 3ULHA 2G1HA 2ZITA 2WW4A 1JKHA 1VHFA 2NSCA 2XR1A 4DCTA 2UUBC 5DQGA 1N4LA 4AD6A 4OYIA 3OUYB 3DDIA 2CQHA 1MMDA 4C11A 4K59A 1KQGB 1G2EA 4DR7C 3Q89A 3HO1A 4AFFA 2FJBB 3MOZA 2W9BA 1EX8A 2EI5A 1R0BG 2E7VA 3CCWA 1KS2A 1U6BA 1M6XA 1NB2A 4P2SA 1IBMC 4K4TA 2DD8S 3KK3B 1VQ4S 4K8RA 3SCKE 1WKJA 1N8RT 5HMYA 2Z51A 3LF0A 2ABYA 1U1QA 4L76A 3ILOA 3A9VA 3LP2B 3KDNA 4RLFA 3JAMD 3DM2B 1UVIA 5D78A 3KLIA 2CQ2A 4IH5A 3NGSA 5AE1A 2M7SA 3BN4A 1WI6A 1KLMA 2EFPA 2IFXA 1MN9A 1F5BA 2J9DA 3A3OB 4DPXA 2KDOA 3W9IA 3UW1A 2LECA 3DRSB 2MQ8A 3F56A 3N0VA 3I9ZA 1CJTB 1HPZA 3C15B 2I5JB 3NXZA 2D3UA 1P27B 5C24A 4PUOB 4N76A 4LBIA 2MLYA 2XY6A 3W2WB 1S59A 2IMOA 2RIJA 2BKOA 1AROP 2AYAA 2DR6A 4LF6F 2P2CB 4PWDA 1XNRC 2QC3A 3I0RB 2WW8A 1RWPB 1EP4A 3EGWB 3D6FB 1UTAA 2ZDOA 2M8HA 3KLFA 1H6KX 1KBRA 3WBZA 3I5CA 4X4RA 4YEAA 1O9TA 3CC4S 2E1AA 4LF6J 4WZMA 4ZCKA 2HLUA 1FRHA 4ECZA 3AOAA 3EPGA 2ZD1B 2F8HA 2O5DA 1MROA 3LNVA 3MPDA 1SCJB 1JLBB 1YBUA 1Y0HA 2YKOA 4NLTA 2A2DA 2EFNA 4ZJOA 3AF5A 2GW8A 3LALA 3DLGA 1YQHA 2HRYA 2YWCA 1JLQA 3UNYA 4MYTA 1HI0P 1QVGR 2F8EX 4LF7C 1XJWB 2KXFA 2WVDA 2YNFA 1RAIB 1S1UB 3HFVA 3Q8PB 2R4FA 4I67A 3N9UC 3CULA 5C42A 1LWXA 2CDRB 4NLOA 3CD6S 4KFBB 1TL3A 4DQRA 3A25A 1JLAB 4B3TC 2BM1A 3V4IB 4JI3J 1P6TA 2W4PA 5BYRA 1JLCA 4OJHA 3VAJA 4O44B 4Q8EA 3NYRA 4DFJA 1SIWB 1DTTB 1XR7A 1MDBA 1OJ4A 2FVPA 1T05B 1S0MA 5SZTA 4FTFA 4DSJA 3MMJA 1D3WA 1DY3A 4ZCIA 1SJFA 2CQ0A 2HS0A 5F8GA 4ED1A 2VICA 1UEUA 3HT0A 2FTRA 5KG0A 2QMWA 3PR4A 2NYHA 1F9FA 3KG0A 4W4MA 3VAFA 1PG4A 1MG7A 4DN0A 2RU9A 1R0CB 4YUDA 5H9EK 4ED8A 1KQFB 2FDNA 3KK2B 3HPOA 1BXNA 3DHXA 3QPIA 2AD9A 5G0RB 3M7VA 3UVJB 3HHLB 4ED2A 4FP9A 2QVZX 2W2PP 1S57A 2DNNA 2DO0A 1V6HA 2RJZA 2X1AA 3D0IE 3JB9k 2K8GA 4NYOA 4M95A 1YWXA 2CZ4A 3ETOA 1W26A 4DLEA 5J2MB 2NXEA 3GV7B 2XB2D 1RAOA 2QMUB 2MPUA 1WH9A 2Z58B 2ZVSA 3BM7A 4DS4A 3JSRA 3R7NB 4K4SA 4IH6A 2OH2A 2M4MA 1NJYA 1QTNB 1QSLA 4LJMA 3VGSA 1HR0F 4FKYA 3PJXA 2AJ0A 2HW3A 3GFZA 3RUBL 3BGFA 3KG4A 3ZTSA 3RRHA 4EATA 4HDGA 1XMOF 3FCCA 4DV7F 2MYFA 1RT7B 4OYBA 4PWWA 1NRKA 2EEYA 3FK4A 1H7XA 1HR0J 4LE5A 3WC0A 3TZWA 4RM2A 1UJ4A 1R0AB 1HWIA 2ZBRA 4U95A 3KK1B 4DV6F 1XMOJ 4DV7J 5CCLA 4KHPC 4C3LA 1BQNB 2MKYA 1NHKL 3K8WA 2G0CA 2YQ0A 1TTHB 2CQ1A 4U8YA 4YY3C 1ZPVA 3BGRA 3EPIA 2RAQA 2MEWA 1FXLA 2D9OA 1WF2A 3Q8SB 4Q7AA 3W5YA 4BBYA 1LWFA 2HFSA 5KYTA 4DV6J 5ETRA 4I2PA 2R8HA 1AZSB 2N7CA 4QWEA 3CDAA 5IXUA 5F8IA 3EQ6A 5DRKA 2C22A 3RTVA 4LF5J 3NS5A 5ETVA 2VFSA 4TYAA 1JJCB 4HHUA 2CPJA 2SXLA 4DPOA 2PD1A 1QTMA 1VC0A 2EKYA 1KSPA 4O3NA 2OO4A 3DC2A 1N34J 4OZ5A 2DGTA 2LXFA 2X51A 3PM9A 2VPYB 3M2UA 2G2ZA 2H5JB 3W62A 2OIHA 2DHMA 5GAEU 4LRAA 1FK9B 1LXJA 1NK5A 2R7WA 2AX1A 1I94F 4F67A 4Y0FA 2BQUA 2G13A 4K5RA 1RYSA 1F6TA 2ATLA 5B0GA 2KVIA 3JS9A 5CZXA 3T1AA 2AMCB 5HATA 2E66A 4YFUA 2W01A 2EFQA 2D3ZA 4K50A 4DL6A 3VVTA 2JOQA 4LRCA 2AEMA 2R7VA 1CPZA 1E6YB 4NX9A 4C8KA 2AYBA 4Z7YA 2N3OA 3SCJE 2CNOB 4EO8A 2H4YB 1FVQA 3D1HA 1HBOA 3UOWA 3NKYA 3BYRA 3FC9A 4NYPA 1FXDA 3M8SA 3LAMA 2Z4PA 1R8PA 1FKOB 3EUNA 4WTOB 2UU9J 4JV1A 5KFYA 4QBUA 2R3VA 1TVRB 5K8OA 4WXWA 1YJWS 2V2VA 4P2MA 2D7SA 2HHHC 1RI7A 3RR7A 1SJ1A 1QD1A 4DMZA 3CMQA 5HO4A 4QIEA 2HBYB 3R5DA 3M8PB 1TUVA 1X5PA 1PCAA 1TKDA 3PACA 2HNZA 3PTWA 3D7SB 2KJVA 2OJ3A 2KFZA 3BBBA 2IYIA 3FSYA 2B9YA 3VNQA 2AWZA 3MR7A 1VLYA 1Y3KA 4C8LA 5DQHA 4NRUA 4PQUB 4N8NA 1M5PC 4ZPWR 3G8TA 2ZWPA 1LEOA 3CJKB 4QYRA 3QJPA 1CULB 3NGDA 2IJRA 3H5XA 3OBIA 4OI0A 2CPDA 2VA2A 2VH7A 4B3SF 3JYTB 2ALYB 5HVFA 4ZLPA 4WP9A 2OP5A 3CCVS 5KFEA 1EJ7L 3RW6A 4BC7A 2QO3A 4YB5A 3EZ5A 2VA3A 1M5KC 2CQBA 4X62J 4IRCA 1RAEB 5DG7A 1XMQF 4NXNC 4ECUA 1LWEA 2GIFA 4QIWD 4F4ZA 1DLOB 3KMQA 3PESA 4Q0BB 4CO5A 3GJRB 2P5VA 2NZ4A 4PYDA 2O3DA 1V25A 2UXDJ 4X66J 2XMTA 3MECA 2WZ1A 1SC6A 1N36J 2D1TA 2QIFA 2C2DA 1UFLA 2YNIB 1F60B 2OBVA 2B7CB 1TQLA 3DXBA 3KLEB 1YLXA 3MF5A 1B0PA 4F0KA 5C2GA 1XMQJ 2R7SA 1FFGB 5LT5A 3O6QA 3OFGA 2YKQA 4WYLA 2G4BA 4ED4A 1IBKC 1HNZC 2OPLA 1WC4A 1VISA 2ACMA 4QIFA 4MYUA 4EBEA 4DL0C 3ENWA 2AJQA 1FDBA 2BW7A 1RT6B 2RU3A 4X4UA 1U0SA 3EVOA 4H4OB 2FVCA 4NCGA 1WHXA 2LQ8A 1RWXB 2YY3A 3TUFA 5HJYA 1VBYA 5HP1A 3SV4A 2D1QA 2ROPA 3G8SA 2HQCA 2GQQA 4C9DA 1R6YA 2Y1IA 1NLKL 3E7WA 1JJHA 1Q8LA 1FCAA 4KH0B 4RBUA 1NZ8A 5IOLA 4CLSA 1P9QC 4JI4F 1NY8A 4K2JA 1SKSA 5GMDA 2JSXA 2KT3A 3W1YC 1WACA 1RU1A 4JP8A 3K59A 4CT8A 1NCLA 3U1MA 2AGQA 1ITPA 2AGOA 3NGUA 1D8YA 1FJGF 3GQCA 2B9XA 1TH5A 5E41A 5C5JA 4CH7A 4HKQA 1S7IA 3G96A 4ZVUB 2W24A 3TR3A 4J9KA 1WC0A 2KHCA 4JI4J 4RJVA 4CH1A 1NJZA 4HH1A 4YB6A 3VNRA 3HVRA 5DO2A 5K14B 3MHYA 2DYJA 4FF1A 2ZNYA 5F9LA 4DR6C 3PR5B 4H4MB 1VQOS 1FJGJ 2CJ9A 2GCFA 1IM4A 2H48B 2BACA 3LANA 3MFIA 3KJQB 2YWBA 2R2TA 5KFNA 4Y6IA 4ETXA 4OIXA 2B3TB 3MM5A 2J9EA 4GKJC 3QZ8A 5KG6A 3ADAC 3T3FA 1RA6A 1TL7A 1WHWA 2HHTA 4R8UA 3DFEA 2MQPA 3AA8A 2B6AA 4RLEA 4DR4C 1VK8A 4IFYB 4ZVHA 1U0HB 3DOKB 3VAGA 3CEDA 4OI6A 1RWNB 4CNYA 2J8SA 1ZM9A 4IO9Q 1HBUA 1CQMA 2D3OR 1D9FA 2F3JA 4CLLA 4HTJA 2MKJA 1ACMB 3N5FA 1OSDA 2IA0A 3Q8QB 5FDLA 2WB4A 1RBAA 1Q8IA 3J80Y 3G7SA 2JLEA 3CD5A 1LXNA 4NXMF 1HYSA 2MZQA 1JQGA 1PU1A 3VR1A 4IG0B 4NOZA 4ECYA 1HI1A 2OEJA 2QFJA 5KFSA 3QIPB 2D69A 3W65A 5CYMB 1NK7A 4PPDA 3UCUP 1VRTA 2DGVA 5M2RA 2HWHA 3P96A 1ELOA 1LWCB 2GX8A 1TKTA 4LSLA 2R2RA 2JEGA 3KHLA 3BKTA 5J1EB 4Q44A 4H54A 1KOOA 4DR1J 2RDIA 1UW4A 4CM0A 3LOUA 3CCRS 4OZNA 4OYOA 2DGQA 3KMSA 3QWUA 4YHHC 1LOUA 3EVWA 1PAUB 2FGOA 2IRXA 3HULA 1S1WA 1FEEA 3D3CJ 3MEKA 4I6WA 5KG3A 3DLBA 1MKYA 2HZCA 4UOHA 4F36A 1FE0A 2B0GA 2CJYB 4QIVA 2QFIA 1VC6A 4XX2A 2JLGA 3GYNA 2LA4A 2EWHA 3PNIA 4BCAA 4AL6A 3TUZC 1WTFA 4AQYC 3DLKA 1UZHA 2WONA 2VPWB 4AUKA 4LRFA 4A8XA 2CJAA 2GVDB 2GHWA 4WV3A 1U09A 3TJ8A 2GHVC 3BO2A 2R42A 1L2FA 4ZVOB 1RTJB 1E6VB 1Q86T 1T3NA 5F8JA 4QQBA 1M5SA 4RW8B 4G1QA 3MM9A 4LFBF 3PROC 1D9DA 3J7A1 1VLAA 4KV8B 2JRSA 1C0TB 2BEFA 2KYXA 3HKZD 3SMZA 1CJUB 2U2FA 2ADBA 3H5YA 5A0YB 4C6AA 2EG1A 2YBVA 4WP3A 2D1RA 2FJAB 2MKHA 4LFBJ 2Q3PA 2I1RA 3GP9A 2ZM6C 2R7RA 1U1LA 1UVKA 1Q95G 3DHVA 2P2QA 4ENOA 2K1RA 2AIRB 2Z0GA 4C7QA 4TNOA 4ODJA 2CPIA 1RT1B 1KC8T 2F63A 4FS1A 3TOQA 2HGNA 4P74A 4NA3A 4JI2F 3TAMB 4F4AA 5D0HA 3Q0AA 1WC3A 1HMVB 1FFWB 4JI0F 3FFIA 2J0QD 3R8YA 1XQIA 4DCVA 5CYQB 1FFSB 3HX9A 1JXVA 3FNNA 4IRKA 3GFHA 3KLGA 4HI1A 5HMWA 1LFPA 1BA3A 4WCEQ 4LFAC 4ZN1A 4A8SA 3OD2A 1RP5A 2MKKA 2NPIA 1FKPA 2DCUB 2W2OP 2M52A 4DHVA 3MMCB 3G2XA 3M9MB 1WG1A 3OT9A 1HKAA 2LU2A 2ASYA 2F4VF 3CDBA 1CJKA 2J0WA 3DGPA 1Y5NB 2DYAA 3L9ZA 4HLBA 2VF3A 3IRXB 4I7FB 4G36A 4M8LA 4J9VA 1FF2A 4EFAC 3VZHA 1K44A 3TEHB 2AJFE 1X4AA 4RWWA 3TZXA 3D54A 4L72B 3KXDA 4P73A 2LP4A 3C16A 2WD9A 3TA1A 5A2QU 1RDRA 2F4VJ 4DR2J 3MWBA 2KXNB 3HLUA 3PW5A 2OELA 2MHNA 4W92B 1BY9A 4L2ZA 1N33F 4N5SA 4ZVRB 2IY5B 4USUA 5HK4A 3MUTP 1RAJA 3DLJA 3EXCX 3CW2C 2V63A 2QLBB 2UVVA 1V5IB 1RKIA 3BR9A 4DV2C 2HFUA 3WX8A 4GRSA 2ROGA 4TXSA 3CCUS 4FUTA 3OXFA 1S9FA 1PA4A 1KNZA 2YWGA 3RAXA 5D6GA 1LW2A 1NHVA 1N33J 1MXAA 1FKAF 1IKWA 2W8KA 4AT1B 1EETB 1TV6B 4F4YA 3ZTPA 3HMJG 3DAYA 1EQMA 2Y9HA 1SKUB 5KOWA 4DL3A 1RT5A 2PN6A 3HD1A 1JLEA 3H25A 3AJ1A 1CVJA 2J0SD 4PG5A 3FMBA 2E8EA 3J7YI 4DX7A 4P72A 4P7VA 3QJJA 3G82B 3QIDA 4KHMA 3CCTA 2UUBF 1MXBA 3BZQA 1N2FA 2EKNA 4F50A 4R1MA 4LVNP 2PFFB 1CSJA 3HK2A 4NLWA 2W9CB 4USHA 1L5UA 1VRUB 2R8KA 4DR7F 2LDYA 2W2NP 3ELHA 5DDPC 2R7XA 2FC9A 4IO1A 1GMWA 2V50A 3DU6A 5KG2A 1SUQB 2FIUA 4DFPA 4DR3C 1IBMF 2UUBJ 2XHWA 1S6PA 1VRQC 3BPDA 5DDOC 4LVOP 3OLAA 4DEZA 2D9PA 4DCPB 4E98A 3T19A 4DR7J 3MDFA 1FX4A 4DR5C 2E1PA 1ZA2B 3FCHA 3AD8C 1RTHA 4IYQA 1K8AT 4TY8B 1SH0A 1VLOA 3R5AA 1FT8A 2BVZA 1KR4A 1ZBTA 4OJGA 3RB3A 2BX6A 4NI2B 2VQFC 5GADI 1JB0C 1T02A 4RPFA 4FDFA 3MUMP 4ANDA 2D1CA 4TKTA 2W4DA 3I4HX 2WOMB 2PMZD 2W8LA 4B3OA 1XNRF 4DU7A 4URSA 2NREA 5FIIA 2Q79A 2JC1A 3N5BA 1UVMA 1D09B 2PMHA 4QU7A 3PBKA 3MD1A 1FD2A 3P5BP 1ZAWA 4HVZA 2ZH3A 2LEBA 3HJFA 1VQ5S 2QA2A 1VQ6S 3VGUA 5KOXA 2MM9A 4J37A 4PEOA 3OL8A 2OEKA 1S97A 4CLFA 5DLFA 5HBMB 4DUZC 4ED7A 3DMJA 3GIJA 2XS2A 4X2BA 4DG9A 2Q6BA 7FD1A 5DS7A 2BKNA 4YB1P 4GC7A 5L1KA 2PMWA 2V2QA 1WKKA 3HVTB 2BMBA 3QLHB 3VCDA 1KVIA 3N2QA 3M4XA 1RZMA 3K8VA 2OTLS 4KHRA 4XK8C 3ZTOA 3W2VA 4WU3A 1M5VC 4LF7F 1YI2S 5K8FA 2GGPA 4QW8A 2K3KA 5CZVA 3HHLD 1N52B 1VDHA 3CTRA 4N56A 2VPZB 4UUWA 4PKDB 2VFRA 4OX8A 4MIWA 5BURA 3G6YA 3HF5A 3D3BJ 4B3TF 2ZE2A 1RABB 2JDJA 2PGCA 1YIJS 2KG1A 3VWSA 4USIA 1CS4B 1AFJA 3B4MA 3MEGB 3Q8VA 3JTOA 2F9DA 1HBNA 2ZOFA 3EM1A 4LUBA 1PO6A 4B9UA 3UPFA 4JV0A 2AHOB 4OZLA 3TW0A 4JI3C 2HHWA 4ID5A 2HLTA 4B3TJ 3CDEA 4Q45A 2NCLA 4ED5A 4DWIA 1PYTA 2Z2YB 1XR5A 2XZWA 3MEEB 2GA7A 2OPSB 5A8RB 1BC6A 3ZTRA 4LSNB 2EPIA 3IBWA 4ANCA 3PKYA 2QMXA 1YTYA 3GG1A 4J9PA 3MM8B 1VQNS 3GFYA 1C1CB 2KM8C 2XEXA 2XYHB 2VKZG 1NDPA 1UKUA 3HFZB 3CF5Q 1H3DA 3CCES 1NUEA 1SQGA 1C1BB 1UL3A 2HKEA 2E29A 1KWMA 5IT0A 1ZZNA 1NPKA 3IEVA 3CJSA 3CJ8A 2JLFA 2VFVA 4CCHA 3R9WA 1QUVA 1RACB 5F3ZA 1FEHA 1IWAA 3TARA 1W7WA 4Q5VA 1HWKA 1U1OA 2GAGC 3ETMA 2Q6CA 3NCPA 2N3LA 1WD6A 4M5NA 1B99A 1VS3A 2AJ1A 4LR9A 4N41A 3SFUA 4WS9A 2IVYA 3GSIA 5FLXU 2HNDA 4QR1A 2HVHA 4MK8A 3R2DJ 3TI0A 5E3RA 4C48A 1FE4A 5IM0B 1N5YB 5A8KA 4HT7A 3BN7A 5ETPA 3A8JA 2PIIA 2JEFA 4M5DB 2YNHB 5HANA 3OXGA 3VV2B 1P4EA 1OS5A 1SJ3P 3R9XA 3SDEB 1I51B 2FD2A 4I69A 4JI1C 1HBMA 5F8LA 2AT1B 4CTAA 3CCMS 1XR6A 6FD1A 1TKZA 3I08A 3W8GA 4I1TA 5JXSA 3IPLA 3DCAA 2B4OA 1AB8A 1CQNA 3KJVB 3RV2A 1WI8A 1IKXA 4U7UD 2RHSB 2DXFA 4NWBA 5U47A 2XMUA 4KHPF 3A3NB 2LEPA 1V3RA 4AL7A 3GWCA 2R7TA 1IBLC 1HW8A 1R8HA 3W5ZA 4JI6C 2R2SA 1WJ9A 3RBXA 3UX3A 3F41A 4YY3F 2GJIA 2LXIA 2M3DA 4XPCA 4PUIA 4DG8A 1HA1A 2DGUA 4LREA 3N6NA 5KG7A 3LP1B 4KKOA 3OL7A 1NO8A 2HNYA 4KHPJ 1RWMB 3JSBA 2AGPA 2H3EB 3RB0A 1UP1A 3QT6A 1U2FA 3SQGB 3VALA 3W60A 4YY3J 5H9FK 3DOLB 4KBIA 2WVCA 1FTRA 1H7WA 4L4QA 3KUGA 2M2BA 5CABA 1QJHA 3OUYA 3W8PA 2VB6A 3KLHB 4LF5C 1RHKB 1S1TA 2CZVC 1WDDA 4FF4A 2DH9A 2WSCC 3CJTA 3NCRA 1KN6A 2D7VA 1N34C 4PXDA 2MTLA 3EX7B 4X4NA 3KK3A 2M8DB 4OI3A 4YR3A 1WF3A 4CIOA 3HZEA 3TQEA 3RU0A 4LQ3A 1PBUA 3NOCA 3LP2A 2LA6A 2A6MA 2IRYA 1MWYA 3DN9A 2MQLA 4OI4A 1ZOTA 1N5SA 1VMBA 4UZCA 2BA9A 2QN6B 2Q43A 1SI9A 2FGCA 1RG9A 2CIMA 1EAYC 5JJBA 5F0WA 3I82A 2KKHA 3DRSA 3ILJA 1WKLA 4PZVA 3E01B 2BOAA 3Q22A 1CJTA 3QGPA 1IR2A 2I5JA 3C15A 3HP6A 2Y0SD 4PUOA 2EFOA 3OV7A 2DVIA 2IMWP 2C3YA 1RWWB 2HHHF 1VQ9S 3FBCA 2KU7A 5BR8C 3Q8RB 1H74A 2VBZA 2UU9C 4GVBA 5KFUA 2JWNA 3QMQA 1DHMA 2DEIA 2DNRA 2EBEA 2CJXB 3ICLA 3QFWA 4I9FA 4X4VA 5BSRA 3KUEA 1YJTA 3RGIA 2HHHJ 2GMHA 3I9V9 1RB0A 2IAJB 5IQ6A 3CD0A 1UKKA 4G1PA 2QSFA 3PRDA 1FWLA 4Y2KA 2AP6A 3T41A 1BLUA 4FF2A 2ZD1A 4UTGA 1VQSA 1NXIA 1K0RA 2VHGA 2IDEA 2DGSA 2XYGB 4CDIA 3V6DB 3HHNB 2ZNZA 3CVKA 4FKXA 1SC1B 4KYZA 4U8VA 4NEZA 1TK8A 1HQ2A 3M1VB 5E3AA 5A8WB 2N82B 4NXNF 1VQPS 2QVYX 2W7AA 1WSRA 4A8MP 4B17A 1FDDA 4ZMMA 4K4UA 3Q8UA 3R5GA 1SL1A 4LT6A 2HS4A 1XRAA 1S1UA 4X62C 2UUCC 5HJXA 2ZVIA 4JBCA 3PW0A 3KLIB 1V9OA 4KFBA 3K5MA 1TMJA 5HLFB 2UXDC 4X66C 4DOZA 4QPXA 2W9AA 4I64A 5B09A 5D0RA 1N36C 3UDCA 4O44A 1SV5B 1IBKF 1DTTA 1HNZF 3W64A 5LMNJ 2CYYA 3I87A 4EBCA 3IAS9 1T05A 5JVHQ 4XDCA 1NB7A 3GE9A 4DV1J 3J7AN 2ZOGA 3KHRA 2YVSA 2AQ4A 4DUYC 3OR1B 1O8BA 4RNOA 1GQEA 2O1PA 1HNZJ 4PR6A 2KDNA 4RO0A 3DLEB 2V8DA 3KK2A 1RAAB 3AA9A 4FBTA 2WVFA 2QA1A 1HWLA 5G0RA 2L9NA 2WK4A 1WCJA 2E8CA 2DR7A 3ZZRA 3HHLA 3ZO7A 3MCNA 5KEIA 1ROFA 2ZHBA 5HMZA 4KC5A 2VQEC 2CJQA 8AT1B 2A3JA 4F4XA 1FNXH 3EDQB 4DV4C 4USVA 4WKYA 5KFCA 3CC7S 1PYOB 2W2QP 2J7WA 2Y4NA 3CJQA 1JJ2R 4ZIWA 2ASLA 1MROB 4IKAA 5J2MA 1OPIA 1RXOB 4YMEA 1CLFA 1DQ8A 4DR6F 2D1SA 1MN7A 1F9EB 2BE9B 2XZDB 3PIPQ 2HAFA 4PCQA 1JLQB 1RGVA 4ZPTR 2IBKA 2MKSA 1D8ZA 4ZJZA 1NK0A 4PG8A 1GX6A 3E2EA 4JV2A 1RHRB 3BBFA 3AJDA 3K5LA 1TUWA 3MM7B 2ZJPQ 3A8IA 4DR6J 2Z56B 3NMAA 4GKJF 1ZS6A 4X4TA 3RBDA 1TL3B 2PT0A 3BKUA 4DFMA 3FMWA 2XYPB 4ILMA 4NLYA 1RT7A 5IT9Y 1YRTA 3OTBA 5LXRA 4DR4F 3AXMA 4D57A 5DM7Q 4GS5A 4G3IA 2E8FA 5B7WA 1R0AA 3AQOA 1TL1A 2N4DA 1K1SA 1HLWA 3EICA 1RLCL 4LF1A 4XTTA 3A26A 3IBCB 4ZLNA 1PC5A 2LLZA 3RRGA 4FPIA 3OSNA 3NI2A 2XGQA 4DR4J 3OPKA 4EU0A 1HNIB 1DTQA 1KOHA 2V9WA 3D66A 4KGKA 5B0FA 3CIMA 3MI7X 3PO4A 1U24A 4DF8A 3EMTA 3OTCA 4B9LA 1NAQA 1T03A 3CUNA 4JI8J 2P2BA 1Z4UA 2VC0A 2MJNA 1Q0NA 3R6GB 2FJVA 3PYEA 4IG3B 2V0NA 3M30A 2RB7A 1X4EA 4M5IA 4CYUA 1FI4A 4DL7A 2ZH2A 3MD3A 5I3PA 3GZ7A 3FZBA 2HGLA 4LR7A 4GO5X 2QG9B 2B51A 3M32A 3WDOA 5HI7A 3MFHA 1X4CA 1X4HA 1UA0A 2I0XA 3RBZA 3CXCR 4M5HA 5KT5A 4YHHF 3AB2B 5J2QB 3MUVP 3ZC4A 3RBEA 4RVOA 2P6SA 4RU9A 3DLHA 2F9JA 4KAIA 5BSWA 4DR1C 1C4AA 5KFGA 1YJ7A 3TJ9A 1T9WA 3M6XA 3W5XA 3A13A 3V6JA 1SL2A 4RW9B 2P8IA 4OMFG 1GTEA 3SV3A 1S12A 5HL7Q 4YHHJ 4NLVA 4B02A 2QTWA 4K5SA 3EYZA 2AU0A 5J2PA 1X9WA 4AQYF 4QIGA 1E6YA 1YDLA 2CWKA 4NA2A 3NS6A 7AT1B 1FVSA 2KRRA 5L9XA 1N88A 1FRJA 2RHQB 2MQMA 4M5MA 1EQ0A 1EHWA 2HFVA 5KFRA 4RNFA 4WE1B 3IXQA 2M70A 2P02A 4M5KA 2JX2A 3RAQA 4F3OA 2DNHA 2BOPA 2V2KA 2BRLA 1Y9OA 3QRQA 2HVZA 1ZB9A 3AOBA 3U1NA 2FLNA 1FKOA 4AQYJ 1JLGA 4NE9C 2MY8A 3QNWB 5EWEA 2C1EB 1UWDA 1TVRA 2JFKA 3MMBA 1PKUA 4LSZB 1GTHA 2DNKA 3AB4B 3PRVA 2H51B 3M2VB 4E0DA 3BGRB 2XCAA 1ML8A 3PYFA 1MWZA 5DGAA 4D56A 1IBCB 2YX1A 3N54B 4E8UA 2BJ7A 3M8PA 3C6TA 1NKBA 2IYGA 3SEOA 3UR3C 3KFWX 2DPLA 2HBZB 1VQ8S 5CYJA 3THPA 2HVIA 4B9TA 3BSCA 3IC1A 5A6WA 2DKOB 2V8HA 3H20A 3BO4A 2FYXA 3BREA 1GMUA 3CJKA 5M2UA 5KT4A 1CULA 3A9UA 4GO7X 5IT4A 2LEAA 4K0BA 5T7LA 1NNDA 2JNJA 4BSZA 1BWEA 2LQ9A 3C8YA 2VIHA 5JMNA 2JHEA 3IAM9 1JXLA 2XO7A 3I5BA 3FQKA 3M6UA 4PXBA 1DARA 3JAMU 2BKPA 5MLCV 4IFVB 1J2VA 3LGMA 5K9FA 5I3UA 4DX8H 4X4OA 2W2MP 3TUIC 4LFAF 4P71A 4DFKA 4DCUA 3MZIA 3JXOA 1LW0B 1UFKA 2Y8WA 1JNRB 2W4CA 4ZVTB 1Q4RA 3ILIA 4RL1A 4E2FB 5D77A 1TMMA 1XS3A 3G86A 3KLEA 2DITA 4U6PA 1RK8A 2GFFA 2DEJA 1R43A 4LFAJ 3NBPB 2YQ3A 3MCOA 1X5OA 3CCLS 3K17A 4RW7B 4OJ3A 1Q78A 4LF2A 1RWKB 4WWSA 3BPSP 1RT6A 3MM6B 3MPUB 2ROEA 3UD5A 1SJQA 4H4OA 3IG1B 3GIKA 4F25A 3I0SB 2ZOMA 4DV0C 2FHKA 1FERA 4WFYA 5HVHA 4IDKA 1S0OA 4Z7CA 4ILRA 1V60A 1U2RA 2C42A 4FS2A 1HNWC 3KLVA 3HFKA 4DG1B 5C2CA 5E3PA 4Y2IA 3OLBA 2E9ZA 5F8HA 4ZVSB 4CZCA 2VG5B 3CQ1A 4DR2C 2HAIA 4CO2A 3H8YA 1NSPA 4DV2F 3BJYA 5D4PA 3D6TB 2F65A 2JFDA 4XAKA 2YWHA 3FZ2A 3SYZA 4QYZJ 3P3DA 3J80U 4A46A 3GV5B 3A8KA 2VSQA 4U7CA 2AJ2A 4C97A 2HFNA 2IPOB 4KRWA 3OJUA 5H9EJ 4A8KA 4TYBA 4KIAA 4O3SA 4NYZA 4RUAA 4H4MA 2IIHA 4IR7A 4TN2A 3TVZA 3CGIA 4K4WA 1S10A 1LWEB 2HGMA 1ZETA 3CCZA 3L3CA 3T5KA 5LL6d 1UPPA 3I56S 3IS9B 3PJWA 1NDCA 3D2WA 1PC4A 3T1HC 2VOOA 5C25A 1Z1ZA 3QT7A 2HHVA 3SXLA 4DR3F 2BE2B 2O01C 2GC8A 2DPJA 3PJ9A 2I38A 2KG0A 3JQJA 3CJ5A 4IFYA 1IJEB 1U0HA 2VZ9A 2AEJA 4U96A 3RB6A 4C2MA 4DU8A 4CLWA 1MXCA 2XSJA 4O3PA 4OYMA 3LA0A 4CWBA 1XN9A 4QJVA 2E7GA 4DN9A 4X4QA 4DR5F 2L3MA 1S5ZA 1GXUA 2VL1A 1AFIA 4GVLA 4DCSA 3HT3A 1WEXA 2FZGB 1OQ6A 1HQUB 4DR3J 1BMQB 3G6VA 1Q81T 1NSAA 2LYVA 3OVBA 2NXUA 5KT7A 1EGAA 3KG1A 1LK7A 3G87A 2DR8A 3PIOQ 3LW5C 4J9OA 4PG6A 2J7KA 2MB0B 4DR5J 3GSDA 3HHKA 2VQFF 4IG0A 8ATCB 3ZNJ1 4OHYA 1K1QA 3BDPA 3QIPA 2ZZTA 2FY8A 5CYMA 3BDEA 3H42A 2C3MA 1UVLA 4MIAA 4AE5A 1AA1B 1WNEA 2POKA 2KT5A 2I8EA 3IN5A 4O3QA 1LWCA 2CPHA 2DNGA 4ECTA 4WBFA 5DM6Q 5J1EA 1U4BA 2VQFJ 4RNMA 4P2FA 5T14A 1U2CA 5KFFA 4JYAJ 2VBWA 2ZHAA 2WAQD 5DDRC 3KWMA 3DI6B 2DBBA 2DISA 5DETA 4DUZF 2DNMA 2OKQA 4CQ1A 5BUQA 2M5HA 3CJ4A 1VYAA 4S0MA 3MM5B 1FHTA 2F8MA 3MTKA 2P6TA 3M2RB 2ATWA 4ED6A 3S1TA 3QATA 2FLOA 2CQ3A 2QLXA 2YKMA 3RAMA 1NJXA 4DUZJ 4NLPA 2GVDA 3CWJA 3KYLA 3NGRA 1NEEA 4X4PA 1QSSA 3PHEA 1RTJA 1J5OB 1E6VA 2OD6A 2X1GA 2XLIA 5CAAA 4RW8A 3EZOA 4OXIA 3I4PA 4LIRA 3PRBA 3CJ0A 3EDRB 4KV8A 2E9TA 3UCZP 4PWUA 1C0TA 3WC2A 2DNQA 4B08A 3R44A 1HYSB 3BF4A 3PX4A 3J80D 1CJUA 2D41A 4C8ZA 2X1BA 1B7YB 1NJIT 4ZITA 2FPHX 1VIOA 4JI3F 2ZH1A 2XSFA 5B0EA 1VRTB 2XMKA 2CU6A 3IMQJ 4MKAA 4HACB 2AX0A 3J81Y 2YKNB 2FLPA 2ZBIA 1RT1A 4KSEB 3OR2B 5EN1A 1VBKA 2GS8A 3BSNA 4ZVFA 1B0TA 3W66A 3S01A 3TAMA 2ZH4A 3MCSA 4ZK7M 4NZ0A 3P4UB 3T1YC
chains in the Genus database with same CATH topology
3DDNA 1VIXA 1CSJA 3G71S 3HK2A 4NLWA 2W9CB 4USHA 1K73T 5CYQA 1L5UA 2GGPB 2ZZNA 2BH1X 1VRUB 2R8KA 1CEZA 3DM2A 2DHGA 4R0MA 4RU2A 4DSIA 4DR7F 2LDYA 5DDPC 1I6JA 2ZM6F 2BANB 2R7XA 3O1LA 2OMOA 3PDNA 5H1SV 4WZQA 2FC9A 3BO3A 4IO1A 5IM0A 5D4OA 3Q24A 1WEYA 3MAQA 3DU6A 4MTPA 1SBRA 4WK3A 3POTA 5KG2A 1SUQB 2FIUA 3AJ2A 2UV8G 4JI5F 4DFPA 4DS5A 4DR3C 1IBMF 2FHMA 2P9EA 4Y65A 4RX6A 4O3RA 5CCMA 2BUNA 1RY2A 4WFBQ 2C2RA 2XHWA 1S6PA 5DDOC 2EK6A 2CPFA 5BYSA 2ZE2B 4LVOP 3OLAA 3ISNC 2VZEA 4LFBC 4DEZA 4KO0B 2V8VA 2E0GA 1DBDA 1RISA 1YG0A 2CQIA 1FRIA 2D9PA 1KEKA 5IWAC 1CC7A 3V5RA 2NUHA 4E98A 3T19A 1VQYA 3DI6A 3TP2A 5K8MA 1LK5A 2V8GA 4OX9F 3MDFA 3ITHB 3MMCA 2OPQB 4DR5C 2OFGX 3K7RA 1URRA 2R8GA 2NPFA 3KJVA 5C25B 3ZZYA 1HBNB 2EBGA 2OLWA 1HWJA 3W2WA 3FCHA 1DURA 4FXWA 1RTHA 2MZTA 4WTYA 1AUDA 3DRPB 1X5TA 2R7OA 2R8IA 2YH1A 4IYQA 2YWKA 4ID5B 3TNVA 2VC1A 3M2RA 1K0VA 2IJNA 2ZH7A 1K8AT 3B7WA 3IRXA 4DV3F 3U27A 2FLLA 4I7FA 2FVQA 4TY8B 4C3KA 4M63A 3I0RA 1SH0A 4I4BA 3IR6B 4MK9A 1QM4A 3R5AA 1FT8A 2BVZA 3LH2S 3I6PA 4JI1F 4CO0A 4ZHRB 1RT3B 2PDAA 2DGOA 1KR4A 1ZBTA 5LSOA 4OJGA 1KHWA 1M5HA 2JL9A 3PEHA 3RB3A 4NLDA 3V6KA 1VQKS 3QAEA 2LVWA 5KFAA 4KB7A 2VG6A 4Y2CA 3M8QA 2QLWA 1GPMA 2VQFC 3PX6A 2XSJB 1G3OA 3B78A 1JKHB 3IO1A 5KT2A 3TAPA 1NH7A 3PY8A 1JWWA 5GADI 1HARA 1JB0C 1T02A 4OHZA 1J5OA 4JI2C 2G9OA 4C0OC 3MR3A 2RRAA 4DQSA 3MUMP 3H98A 1HNWC 1MNEA 4NL5A 5KFDA 4WFXA 4LF4F 4JI0C 2D1CA 3SFGA 5HROA 4PXEA 4RKUC 4TKTA 2W4DA 4U67Q 4MKBA 4I9GA 3D0HE 1CC8A 3I4HX 4WKRA 3KTQA 2HJGA 2WOMB 4FUQA 4LF8F 2PMZD 2HYIB 2W8LA 4B3OA 4C11B 1XNRF 3ZZOA 2AF6A 3OTEA 2PC6A 4AYBD 4EEYA 3WX4A 1S0VA 4URSA 3QO9A 2NREA 1BQXA 3SZ2A 2V7BA 5FIIA 1JLBA 2Q79A 4TY9A 1LQ9A 2JC1A 2W9BB 3CMAS 3N5BA 1BGXT 1UVMA 1QM9A 2PMHA 4X4SA 2ZBCA 1IBLF 5GAGI 4QU7A 5SUHA 4C0HA 4A8YA 3PBKA 4G37A 4G6VB 2JEIA 3FRZA 4JI6F 5L39A 3THTA 3RR8A 3MD1A 2PT7G 4GXQA 3G9CA 1FD2A 1IUJA 1S9GB 2QEXS 1ZAWA 4HVZA 3H2LA 3GR1A 4P6QA 4I0WA 2FJXA 1UEVA 2ZH3A 2LEBA 3HJFA 1VQ5S 2LQJA 2QA2A 2RKIB 1VQ6S 4OJ1A 3OFFA 4U9RA 5KOXA 4X84A 1MSWD 2VBYA 2DHAA 4J37A 2ZH9A 2HMIB 3BSAA 1HL6A 1HNVA 4URGA 3OL8A 3ETCA 3W7BA 2COLA 3FEXB 3FFIB 1S97A 1J5EF 4I6AA 3VAMA 5AE2A 5DLFA 3L95X 1S6UA 5HBMB 5FD1A 3KXWA 4DUZC 3UI3A 4AXJA 4ED7A 5LMNF 1EETA 3DMJA 1TV6A 3GIJA 5KAKA 2UXBC 2XS2A 1OWXA 3K2YA 4X2BA 2E5LF 4DG9A 2Q6BA 2UUAF 2HHUA 7FD1A 2DHSA 5DS7A 4R5PA 4YB1P 2YKNA 1X8DA 4Y2MA 4ES2A 3MPVA 5F0UA 3MURP 4GC7A 4Y2AA 3P49B 2F4VC 5L1KA 3HVTB 3OR2A 3R27A 4C8OA 4IH7A 3CDWA 3QLHB 1JLAA 3IR5B 3VCDA 1S72S 3DLLQ 4OL8A 4DV1F 4OV1A 1KVIA 1N32C 2KT2A 3BSOA 3N2QA 4WJBA 3TDEA 3IA0A 3V4IA 1KLMB 3M4XA 5AXMA 5BJRA 1N5VA 4EBDA 3JTPA 3GKUA 3Q23A 1HBMB 3K8VA 3N28A 4ICLA 5KFPA 2DPIA 4KHRA 2OTLS 4Z2XA 2BQRA 5BSVA 1QWIA 4NMLA 4XK8C 3AF6A 3W2VA 4WU3A 1UJ6A 2GO8A 3LPYA 4IZ6A 1XRCA 1M5VC 4LF7F 4LF5F 1Z2ZA 1YI2S 4L7IA 5K8FA 1XNQF 3IWXA 2GGPA 3DU5A 4ZA1A 2GJ2A 4QW8A 1VRUA 2K3KA 1HPZB 4RZRA 1YHQS 3HHEA 5BSUA 5CZVA 4QW9A 2BANA 3EZUA 5C24B 4J9NA 1Q8BA 3UD4P 2MZRA 1Q82T 3HHLD 1N52B 1VC5A 2VPXB 3IGVA 4N77A 2AW0A 3CTRA 1SUQA 2RMLA 1IKXB 2RUGA 3TA0A 4N56A 1N34F 1L3UA 2VPZB 4UUWA 3UFCX 1XK8A 2E5JA 4PKDB 2VFRA 4OX8A 1SJ4P 1N33C 5BYQA 2XLJA 4MIWA 5BURA 1GXTA 5HMXA 4ZVGA 2E1RA 3FCEA 3G6YA 3HF5A 2J6TA 4PWDB 3IMLA 1FRLA 4B3TF 5DDQC 2ZE2A 2OAUA 4KO0A 3I32A 4O0IA 4MK7A 4KTVA 1EP4B 3OTOC 2JDJA 2PGCA 3CIZA 4OHXA 2PI4A 2NR0A 3VTIA 1YIJS 3E01A 3TUJC 3GMGA 2XCPA 3T6JA 1S79A 3BS9A 2KG1A 1YJRA 3VWSA 5D3GB 2YKMB 4USIA 5AXKA 4JV5F 4M1KA 1R89A 2XGPA 2I2YA 1QAYA 2BYCA 3C6UB 1U1RA 1HNXF 3ITHA 2ZDPA 4B9VA 2OPQA 4Q8FA 1AFJA 3B4MA 4IOCQ 3UWTA 3MEGB 3DRYA 5IS2A 3KLFB 3JTOA 2F9DA 3B82A 1HBNA 1R8CA 2ZOFA 3T9ZA 4LUBA 2IVMA 4DDFA 1PO6A 4B9UA 3UPFA 3DDKA 4JV0A 3LUSA 3DRPA 4OZLA 1NHUA 1SQEA 3TW0A 3G8QA 3OHAA 1KLNA 4JI3C 3CC2S 4RLQA 2HHWA 2PSZA 4ID5A 2HLTA 2VKRA 5BSMA 1U1KA 3US5A 2X3GA 2PEHA 4KKOB 2NS1B 1VBXA 4TY8A 3CDEA 1IXKA 2HNYB 3J7ZT 4Z37A 4Q45A 2YX4A 5DG9A 3FCCA 4ZPCA 4ED5A 4DWIA 2JZ5A 4ZHRA 1RT3A 5KFHA 2LCWA 3E51A 1XR5A 2DTJA 2XZWA 3FEYB 4TLQA 2KN4A 3MEEB 2AYMA 2YCBA 2GA7A 2OPSB 4LFCC 4YR0A 1OQ3A 1Y5IB 5A8RB 1ULRA 3E7XA 1BC6A 4IOAQ 3ULHA 4LSNB 5KT3A 1KD1T 2ZITA 2EPIA 3C3LA 4B3MC 1O92A 3IBWA 1WTBA 3VAKA 1S77D 1JKHA 2XC9A 2PI5A 1VHFA 3PKYA 2QMXA 3ENQA 2NSCA 3GG1A 4J9PA 1YTYA 3MM8B 1ZM2A 3ZZUA 5E7QA 1VQNS 3GFYA 3DLGB 2XR1A 1C1CB 2KM8C 2XEXA 4DCTA 2UUBC 2VKZG 3PXGa 3NMRA 1XERA 5DQGA 2DNPA 2OPRB 2W7PA 1N4LA 1K9MT 1UKUA 1LW2B 4XIUA 1SH2A 4TQRA 2GIRA 3OUYB 3LO3A 1KTVA 4UOCA 5BR8F 3JSYA 2WOMA 4UW2A 2UU9F 2CQHA 3CF5Q 1H3DA 1MMDA 4C11A 1UAWA 4PG7A 3CCES 4C8YA 4K59A 2GQ2A 1C1BB 2RVJA 1KQGB 1RQ0A 1UL3A 2YNFB 1G2EA 4DR7C 2E29A 2G1DA 5IT0A 1ZZNA 3HO1A 2A1BA 4AFFA 3IEVA 2FJBB 3MOZA 2W9BA 5KT6A 2EI5A 2JLFA 2QRRA 5EWFA 2YH0A 1UVNA 3CCWA 1KS2A 1U6BA 5C42B 2VFVA 4JI5C 4CCHA 4P2SA 4F3MA 1IBMC 1QUVA 3R9WA 1S9GA 1ZZFA 2DD8S 2C3PA 3OTDA 5F3ZA 2L41A 3KK3B 3KHGA 7FDRA 3J81D 1VQ4S 1FEHA 1LFWA 4U5YD 3TARA 4Q5VA 5AE3A 2RKIA 3SCKE 2J9CA 1HWKA 1U1OA 1N8RT 1HWUA 1W2IA 3A8EA 2WHOA 5HMYA 2HMIA 2GO9A 3LF0A 1DFDA 1JLCB 4V19X 2ABYA 2Q6CA 3NCPA 2N3LA 1WD6A 1VS3A 2AJ1A 3UCGA 3CCSS 2NSBA 1Q53A 4N41A 3SFUA 1SXLA 1U1QA 4WS9A 4MIBA 4OX9C 5HBMA 2HHQA 2IVYA 3A9VA 3LP2B 2WCXA 2GNKA 3L7PA 2HNDA 5DG8A 4QR1A 4IQXA 2HVHA 5GAHI 4MK8A 4TU8A 4CO1A 5F9NA 3UR0A 4RLFA 1PG3A 3JAMD 3DM2B 1UVIA 3TI0A 5E3RA 2QZ8A 5D78A 3KLIA 3PEJA 2CQ2A 4IH5A 4CO3A 1U47A 4KJIA 4WF9Q 4TPSB 1FE4A 1FD8A 4JI8F 5IM0B 5A8KA 1N5YB 5AE1A 2DB1A 3QLHA 2M7SA 4HT7A 1X5SA 3BN7A 4D3GA 3KK1A 3POTB 1LKZA 4DV3C 2PIIA 3BN4A 1NZAA 1Q7YT 4H4KA 1WI6A 4ZDNA 2BM0A 3L7OA 2JEFA 4M5DB 5A2QY 2YNHB 3OXGA 1KLMA 2EFPA 1OS5A 2IFXA 3H5UA 4YDXA 4XPEA 1SJ3P 3R9XA 3SDEB 2FD2A 3RZAA 2VFTA 1YJNS 4I69A 1F5BA 4XO0A 2L9WA 1S49A 4JI1C 4O23A 3RB4A 1FRKA 1HBMA 2J9DA 5F8LA 3MR2A 3CD7A 1F2GA 2KFNA 1UMJA 2KDOA 1BQNA 4CTAA 4BHQA 3UW1A 2E9RX 2HHPA 3VAIA 4ZPBA 2LECA 2PE8A 3TA2A 3DRSB 1XR6A 3CCMS 4ZP7A 6FD1A 2DCLA 1TKZA 1YITS 3I08A 2OMLA 3F56A 3N0VA 2VUGA 3I9ZA 1HPZA 2I5JB 5KFBA 4I1TA 5JXSA 4H4KC 2DRAA 2WP0C 3LWMA 2D3UA 2MZ1A 3IPLA 1P27B 3DCAA 5C24A 4PUOB 2B4OA 4N76A 1CQNA 3BEGB 4KE5A 3RRKA 4X62F 3KJVB 2XY6A 2UUCF 4R1LA 1O0PA 4ETZA 4GKKF 3W2WB 4DL5A 3RV2A 2IMOA 2RIJA 4LF4C 1WI8A 4ZP8A 1IKXA 1AROP 1TK0A