4ZLPA

Crystal structure of notch3 negative regulatory region
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
253
structure length
241
Chain Sequence
PRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into Autoregulation of Notch3 from Structural and Functional Studies of Its Negative Regulatory Region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Neurogenic locus notch homolog protein 3
total genus 62
structure length 241
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zlpA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4zlpA01
2OO4A 3L95X 5CZVA 4ZLPA 3ETOA 5CZXA
chains in the Genus database with same CATH superfamily
3FFIA 2JH3A 3HM9A 1RGVA 2CQ1A 3G87A 3H5XA 1WC4A 3MMAA 4KGMA 4A8YA 1CJVB 3VGUA 4QW8A 4NI2B 1E6VA 3FSIA 1JNRB 4ZHRB 4IH6A 3I4PA 1O9TA 4DQPA 4AQYF 1VISA 3MM8B 1S77D 2PMZD 4KSEB 4L74A 2YWCA 3MM7B 2XLKA 4K4ZA 2HS3A 2Y8WA 2WCXA 4ZPDA 4NOZA 1ACMB 3BR8A 4IO1A 2VHGA 3W64A 1Q82T 1BMQB 1S0OA 3PNIA 3H90A 5HMZA 2W9BA 2F40A 4L73A 1SJ4P 4TKTA 2VOOA 4DF4A 1MWQA 3EPGA 4AXIA 1NEEA 1NSAA 1X0FA 2IC3B 1I1GA 2V67A 4LF6F 1WH9A 2HFUA 3A25A 2LXFA 4LSZB 4TQRA 3IN5A 2JNJA 1HD0A 1HKAA 3HJVA 5HBMB 1MU2A 3DYAA 4LSLA 5HVGA 2KH9A 4IO9Q 4CNZA 1M5OC 3CULA 1GPMA 1LQLA 2V2QA 2FTRA 3N0VA 5KT7A 2AGQA 1T9UA 1BWEA 1YJTA 4OYCA 4XDDA 3R5GA 1YBTA 1TKXA 1YJ9S 5CD4A 1OYDA 1K73T 4B9LA 3R5JB 4X4PA 1CBKA 5KFMA 2VFTA 1HBMB 3OHAA 3M9NB 4ED0A 4NASA 2BQRA 3NI2A 1CG2A 2N7YA 4DEZA 3MMJA 5KT6A 1J5EC 1CQNA 2XWXA 3TR5A 3JB9k 3OSPA 1FJEB 4ISBA 4DV5F 3V2UC 5HQLA 3UR0A 5CQGA 5HO4A 1T7PA 3ZZUA 5HSPA 4ILLA 3GJSB 4NPOA 3VGVA 2DGWA 2LYVA 1CPZA 2ATWA 2J9EA 1HMVB 1HL6A 6AT1B 4DV1J 1I94F 1NJZA 1F9HA 4A8FA 2WVDA 4N5SA 1MLAA 1PG5B 2WHOA 5FDLA 2J0XA 4RL1A 2IA0A 2F4VJ 4FNHA 4K2JA 1MNEA 4CLPA 3J81j 1HWLA 4DR6C 5L46A 1H73A 1RT3B 1RHRB 1S1XB 1PYTA 2C3UA 3C6UB 3H98A 3SIPB 3N28A 4BC9A 1NK8A 1UZDA 4PQUA 2BBEA 3M8QA 2NCLA 3MPUB 2IRYA 4JI0F 1JX4A 2FJAB 4LQ3A 2V4QA 5KFIA 2OD4A 2AD9A 4P2XA 3CCSS 1U1PA 5LMNC 2LQ5A 2Y3YA 3N5BA 4MT1A 3FNNA 2RHSB 1T03A 4X2BA 3W5XA 1U2FA 5CXTA 4DR4J 3MWBA 4NEZA 1FNMA 4GVBB 2JEJA 1IKWA 2HFSA 4TU8A 2IVFB 1EQ0A 3AQPA 4C3KA 3DLEB 3UX3A 1T05B 2ZJRQ 1FESA 1C0UA 2HGMA 3NGKA 2PT0A 4ZVHA 4F8RA 1Y4ZB 2LA6A 4F36A 4MJKA 2FJEB 2W24A 4CT8A 4OJ3A 1XEZA 1S6PA 2HQ3A 4DL2A 2DR7A 2XZTB 5E3QA 2KN4A 3CDUA 3VHQA 2R8IA 4J9SA 5ETLA 2YWEA 4DMZA 5KG4A 1RE1B 1KHVA 4L76A 3SMZA 3BZQA 3Q8RB 1RT4A 1B7FA 2RHQB 4HL9A 8AT1B 1RKIA 5BURA 2J9DA 1NPPA 2LXIA 1C0UB 1U26A 4O23A 5IT0A 4Y2AA 5KFKA 2FLPA 3ZZ0A 4DI6A 4JI2J 3IFEA 1PILA 3MR6A 4Q0BA 1MG7A 3Q0AA 5F8IA 2DHMA 1VC5A 4KFBA 1RTZA 2VQFC 4KHPF 2JLEA 2HAFA 3TANA 4O3PA 4NZ6A 4JUZA 5KFXA 2Y9HA 4OV6A 4B3RJ 5ETTA 4EYHB 3C8YA 3G6XA 1FXRA 4UUXA 1HARA 4HT5A 3NS6A 4I4BA 4LRDA 1T9YA 2DGSA 3MR7A 2QC3A 4DSEA 3W2VB 4ED5A 4KHPJ 4DZDA 4G6VB 1C1CA 2GX8A 1RP5A 3BBCA 4I1TA 1YLXA 1RWXB 4O0NA 4M8LA 1Q7YT 4C8MA 4D4GA 3KK1A 4DR4C 1JLQB 2P2JA 1SJRA 2ILZA 4R5PB 1DJ0A 2R4FA 2RSQA 1N36C 4ECWA 4S0MA 1FI4A 1N48A 4CH0S 4RNOA 4XAKA 5ETVA 4DL0C 4B3TJ 5IS2A 5I3PA 2FIUA 4RWXA 2MM9A 1KTVA 4O0IA 1YGYA 2P5VA 4LE5A 2ZZNA 5T41A 4Y3CA 3T1YJ 2UUCJ 2HQCA 2XR1A 1X4GA 1NU4A 2DD8S 2GFFA 5K8MA 1ZM9A 4Y2KA 5DZ7A 3RUBL 2W8KA 1VBYA 2KKHA 1U24A 1JB0C 3MURP 4JI3J 2HNDB 1OMSA 1K44A 3CJQA 2M88A 1FWKA 1WHYA 1VBZA 1UJ4A 4OJHA 2WSCC 3CVKA 3RRHA 2QFIA 2XB2D 2F8MA 4HDGA 2IRUA 4DV5J 3M05A 3SDEA 1V25A 1VJQA 1N5VA 3FEXB 4ECUA 1Q16B 2VH7A 4KFBB 1GT8A 1VQKS 1B70B 2LQJA 3T9ZA 3ZTPA 4DR2J 2CYYA 2DY9A 4HLBA 4U8VA 2JZ5A 4DR7F 4ZCLA 3DMJA 1QWIA 5JRHA 3R8YA 2M4MA 2ZKTA 4KRWA 1KONA 4KHMA 4WFAQ 3W8GA 1KN6A 1SH2A 5C25B 3DRSA 3KLFA 1U1NA 3ZTOA 3LAKA 3CQ2A 2FGCA 2CQ0A 2BM1A 3IBWA 5C42A 3K0JA 4OZ2A 5LXYA 3U1NA 1EX8A 4DR3F 2OMLA 3K5NA 2DXDA 4IQMA 1LK7A 5GAHU 2HLTA 1N4LA 4JV2A 2YWFA 5C24A 2CUYA 3D5MA 2L3MA 2BR0A 2C2ZB 3HFVA 4M5LA 5B0BA 2DGUA 1FRIA 2OO4A 2RNEA 2ZH8A 4HYKA 4YHHF 1KQSR 4FZVA 4J90A 1UJ6A 2XMVA 2ZWOA 1LXNA 4FYXB 5IWAC 1FJGC 5CYMB 1VRTB 1U1MA 2HVHA 2W9AA 3KK3A 1O51A 4NE9C 2V50A 3SV3A 2MPUA 4V1Ak 4RW8B 3Q24A 4CIOA 3M8SA 1JXEA 1YRUA 5C24B 1WC0A 1NJIT 3I4HX 3VALA 1ZAXA 2DNZA 3BGOP 3I0SB 4F0MA 1S9GB 1S1UB 3CD7A 4DPYA 2V68A 4FBTA 2W2OP 2ZBPA 1G7CB 2JOQA 2D7SA 2E5HA 3OTDA 2RJZA 4UZBA 3PX4A 1S1TA 1DBDA 4PUIA 4KPYA 1V3ZA 1V60A 1RCOB 3W2VA 2P2FA 3FCVA 2E5IA 1N34F 2P2MA 3MCNA 3PIPQ 4ZPCA 3FDSA 2QG9B 4RUHA 4QWCA 1FXLA 3C5EA 4QIGA 1AZSA 3BPSP 1RZMA 2YH1A 2AJ4A 4ZVTB 4JB8B 2QIFA 3M2VA 2WW4A 4QR1A 3TR3A 1Y3JA 3H2TA 4UUWA 2DT9A 3A13A 4RNFA 2XI3A 3M9MB 2HS4A 3GKUA 1WEYA 4WTYA 2EFOA 1YJRA 3UNGC 2XO6A 4DV4F 3UVJA 4DSIA 1NH7A 2P9GA 2H5IB 4I67A 5FLXD 3OR2B 3DRRB 2GQQA 1F9FA 4J9KA 3Q8YA 1YX2A 2RB7A 3NMAA 1FKPA 3T6BA 2Y1LB 3LH2S 1D8ZA 1JLQA 3DXSX 4OYZA 2HHSA 5KOXA 1P27B 1EETA 4IQXA 4WE1A 1Q7LB 4CLYA 1H2UX 3OUYB 1WJ9A 3KG1A 3UPFA 1Y10A 3A12A 4X66J 3AT1B 4EK2A 4K0KC 4NCBA 2XWYA 2R7VA 4P75A 2P2BA 1XWLA 1RAFB 3CDWA 1YKWA 2QX0A 4HHHA 1V3RA 3AAWB 4QYZK 4AFFA 1U02A 2XTJP 1RB0A 3MCSA 2HHTA 4TYAA 1T03B 3KJVA 1HWIA 1VDHA 2K3IA 2ZOFA 2ZKUA 4PWUA 3U27A 4FF2A 4D3HA 2MQPA 4OYIA 1UVLA 2AEMA 3BM7A 1VLOA 2DR9A 2QYCA 4NX9A 3CIMA 2Z51A 1R7IA 2UUTA 1DTTB 4DR1J 4DZ6A 2XBPA 4KR0B 1FA0A 1HNIA 1BWVA 2QL7B 3HVAA 3MTKA 5LM7E 1S72S 4NDNA 2CPFA 3Q8UA 1HQUB 2AF6A 1AZSB 4OI3A 4A48A 5B09A 5K8NA 2GA7A 5KT3A 1SCJB 1BQNA 2H1YA 3EZUA 2VPXB 4C8NA 5LSLA 4X64F 4O44B 1RAOA 5AE1A 5DM7Q 4RU2A 2N4DA 3BSAA 3KUHA 4LMZA 4WS9A 3VAJA 4ECTA 2ZH2A 1PBUA 5C25A 4JI5C 1YDLA 5DS7A 1JWWA 2ZC3A 2DNKA 2MLYA 4HH0A 2PDAA 1FVQA 3EVMA 1FWPA 2V34A 4YB1P 2VIHA 1RHKB 4B17A 1XIQA 2IJFA 3M8YA 4Y00A 3CF5Q 3KXDA 2G0JA 3IG1A 4DL5A 4RW4A 4C11A 2H54B 3M8ZA 3S7RA 2B9EA 3R2DJ 3NWGA 2B9WA 4OYXA 4CYUB 5A2QD 2HFZA 3MEGA 4M5HA 3CC7S 1CQMA 3NS7B 3QNWB 3L4BC 1RT1B 2W2NP 4B3TC 4KKOB 4DCSA 4CLWA 2UUBC 2OMOA 4WXOA 2FB0A 2J9CA 2QFJA 3ETMA 1D9DA 4LRBA 3OSNA 1NPKA 2P9CA 3BO2A 1ZZFA 2RF2A 2W8LA 3DLPX 1FF2A 4PRFA 1K0TA 4DV3F 3GG1A 2Z2YB 3J7YI 1RG9A 1F5AA 3NYRA 4P2FA 1TL3A 4RUBA 1RKJA 1RYSA 2DYJA 2W2MP 2DR6A 3MUTP 3EMTA 5I42B 1D0EA 3RW6A 3ETCA 4OI0A 3KUEA 2KZ0A 2VFUA 1KTQA 2FJBB 4MIAA 3LP1A 4KO0A 5B7WA 1Y11A 1RT3A 1S1XA 5BXIA 3TJ9A 5EDWA 2PA8D 1DLOA 2C1EB 2B9YA 4JYAF 5LSOA 3ADAC 2XG8A 4IKAA 1RT2A 4ZMMA 3LTOA 5GADU 5GAEU 2MXYA 1FKPB 1T8EA 3FCWA 3HZEA 1N5TA 5CYQB 3W1YC 5B08A 4RUCA 5DG7A 1MMNA 3EE3A 1FKAF 3RR7A 3J7AN 1G2EA 4HPVA 1NZ8A 3H7HB 3NEKA 4GKJJ 1X8DA 2MQNA 1JOSA 2E1PA 1BXNA 3PCOB 5CZXA 5K85A 4PXDA 3CW2C 3OFHA 3AXKA 3G71S 3IGNA 5H9EJ 3RG2A 1RTIB 2G0IA 2ZZTA 4O4RA 2MZ1A 3TUZC 3P49B 3B78A 5HJYA 4DV6F 5LT5A 3TUFA 1WC3A 3I6PA 4EWTA 2Y1JA 3SZ2A 3HK2A 1N32C 4WJBA 3EWGA 1YK9A 2E5JA 3LP0A 5B0CA 2HW3A 4PWDA 5HP1A 2OGUA 1F6TA 4J9UE 1S9EB 4KPCA 3EXYA 5KFUA 3RAXA 4GO5X 1RU1A 2J6SA 4LF9C 1V5IB 3AOCA 4HTIA 4OYAA 4HHJA 3IGVA 1VQSA 2FHJA 4DPTA 2CJKA 2GJ2A 4P2MA 4U7UD 1REVB 3W60A 2GIRA 1NK9A 1O8BA 3A8KA 3AFGA 3BBFA 4CH1A 2MZQA 2OEJA 2UZAA 4NXNF 2BOAA 5KFAA 4ZOSA 2UV8A 1KQGB 3ET6A 2J0QD 3TYTA 2E1CA 2P20A 1ZA1B 1JLAA 4YY3F 3EPIA 4MK9A 4B9TA 1MMLA 2BJOA 5A1GA 2D1TA 1Q8IA 1M1KT 4LRAA 1YITS 1I3OB 3L95X 5BSMA 4X64J 2DH9A 5ADZA 4G36A 4R8UA 1MWZA 3TQIA 4NLTA 2CG4A 2XMTA 1TAUA 2AIRB 5ETMA 3LNVA 1M6XC 2B7BB 2DHXA 1YRXA 1RAHB 5KFVA 4F25A 2E8FA 2ZH6A 2XSJA 1X9SA 1M5HA 3EQ6A 4PZVA 3H4BA 3GJRB 2MY8A 4F3QA 1YWXA 4DV7C 2CKWA 3MMCB 2MQ8A 5DQHA 5DDOC 3LO3A 2MZSA 3QSIA 3WIVA 4DR5J 1LFWA 1M90T 3SFGA 4ALZA 4K59A 2QE5A 4WFBQ 1F5BA 2BJDA 2GHVC 3HVRA 1FD2A 1FRLA 4NLSA 1TK5A 2FZKB 3NAIA 1MDBA 4IFVB 4EO6A 3CQ1A 3X3UA 1NZAA 3GIIA 3GZ7A 3RBXA 2LMIA 2FHMA 2X1BA 2EI5A 3VR1A 3TUPA 2AWZA 3LGXA 2BE2B 4LIWA 3OD2A 3JSMB 3N01A 1XHJA 3OBIA 1NJWA 2PEHA 4IR9A 2Q79A 3B8HA 3TEHB 4PG4A 1MMDA 2FLNA 1HNXC 2FJDB 1KSPA 3NNCA 1TKZA 2V8DA 2OKQA 3O3LA 4DX5A 5L9XA 5EWGA 1W25A 1UEKA 4DSJA 4UQTA 3CJ5A 2DY1A 2L48A 2C3PA 2V8HA 2H48B 3R97A 3ZO7A 3A26A 1VCTA 1H72C 1JLEB 4DSKA 1NRKA 5D78A 3E2EA 1RHQB 4OFZA 4UY85 3SO4A 2CPEA 2R7XA 2JVOA 2GMLA 1YTYA 2K1RB 3UO0A 4ZLJA 5J1EA 1KEKA 3CCQS 4Q43A 1VHFA 3RRKA 8ATCB 3LP2B 5KFNA 4YOEA 2XS2A 1QVFR 1SUQA 2I5JA 4ECVA 3T1YC 4IRKA 2YPZA 3Q8SB 1WKLA 4ZJQA 3CJ3A 4NLRA 1S57A 3PYFA 4ZJLA 3W5ZA 2B7CB 3AD9C 3UFCX 2HHHJ 4NXNJ 1PU1A 3TNVA 1GMUA 2R2SA 3HDSA 2YKNB 2ZBRA 3BS9A 4URSA 4M5NA 3LF0A 4JV0A 3FRZA 1J5OB 4ES3A 2W25A 4OI1A 5F3ZA 2IIHA 1IWGA 4OZ1A 3SSQA 3MF5A 1UKKA 3I9ZA 4JI2C 1JIHA 2IDLA 4C48A 2O3DA 3Q86A 3PW7A 3NL0A 3SV4A 1HR0J 1RADB 3CCLS 4DCVA 3KDOA 1JMTA 4QJVA 2JEGA 1Q8BA 2RS2A 1VMBA 4IG0A 3UX2A 4ID5A 1IBLJ 4RW9A 5HQMA 1OJ4A 4L72B 3C46A 2Z2MA 2ZVSA 3LGMA 3QYYA 4YN3B 4ZVPB 1XR6A 4M5KA 4ZCKA 3IWLA 2B0GA 1MROA 2VQFJ 6FD1A 5J2NB 1V3SA 2ALYB 1CC7A 4CDIA 3JAMU 4YR2A 1P7LA 3R5AA 4NCGA 2OH2A 3FBBA 4NLYA 3PV8A 4LREA 2YQ1A 2MLZA 3KOAA 3BPDA 3M6UA 4RM2A 3JTPA 4XPEA 2UXCF 1WOOA 2D3UA 3B4DA 3GYNA 3FCHA 4UZCA 2HWTA 4JI7J 2DCUB 2Z57B 2M2BA 2ZBIA 1FCAA 3QGHA 5J2MA 5BYRA 2IMWP 2NR0A 2V0NA 1RACB 5L38A 1HBUB 3ENWA 2IFXA 1NLKL 1YG0A 2PSZA 1M5KC 1R0BG 5F8GA 4TVAB 2XI2A 4F4WA 3IR7B 2CNNB 4P71A 1TELA 1F2GA 2WAQD 1EP4B 2ZWPA 3EGWB 3ENQA 5ETSA 4F04B 3MM7A 5C5JA 4A8MP 5BSUA 3GP9A 3VF0B 2G9OA 2Q1LA 3HKZD 4ED8A 2CJAA 3A1YG 4DQQA 3TQ1A 2DB1A 5ETPA 3BYPA 4OHYA 2HNYA 2W1BA 4OZNA 4PWWA 4USVA 2SXLA 3KHHA 3FQLA 4U7UK 5IV4A 2H65B 2XEXA 3NBPA 1BQXA 1WF1A 5D15A 4U96A 3U7JA 1GH8A 2CNOB 1RT6A 2MSTA 2WB1D 1EP4A 4QBUA 2OTLS 1FX2A 2IM0A 5D0RA 1VQ7S 4OX9J 2AV5A 3HHEA 2JLGA 1JNZB 4G37A 4NLPA 3VCDA 1HYSB 3DRSB 5IFIA 2FC8A 3KFWX 2C22A 4K4VA 3FRYA 1R8HA 2DBBA 5K9FA 5L39A 5LCIA 1P1LA 1N56A 4V19X 1SC4B 1ITPA 4RVNA 3CJTA 3NCRA 2Q3PA 4FP9A 4RBUA 4YB5A 2DEIA 2MYFA 5B0GA 1HQ2A 2A3JA 2MMYA 3I55S 1KOOA 4MFBB 5JUMA 1U8WA 3ICLA 2CPXA 4XK8C 1S7IA 2D3O1 1OSDA 2FVRA 3OR2A 1TVRA 1RAJA 3HSGA 4CO0A 2VU5A 1YBUA 2MKSA 4Z37A 3KG4A 1Q5YA 2RUGA 1U25A 3POTA 2QLXA 3BKTA 4ETXA 3NMRA 3SSSA 4M5MA 2ZZMA 2ZUAA 2FYXA 2VQEC 1M0SA 4NOHA 4EBEA 2G13A 2UUAF 2MQQA 5IQ6A 1QE1A 3K5LA 2OI2A 2NS1B 1Q8KA 4P52A 5HJXA 3QMQA 1NNDA 4FF4A 2BRLA 4LBIA 3UD4P 2F9DA 3DRPA 2QYGA 2CJQA 1ZB9A 3G8QA 1GXUA 2EFGA 1HWKA 1RTJB 2V2ZA 2OFHX 4NEYA 4QR2A 3MCOA 2ZHBA 4DSFA 4TU7A 1UVNA 3POTB 5JVHQ 1LWEA 2B4PA 4IR7A 2V94A 4C3MA 4FF1A 2QA4S 5IM0A 1LWFB 4CO4A 2R7RA 4TXSA 4WF9Q 1UPMB 2RKIB 1WI6A 5CCMA 4NLWA 2V5HG 2VG7B 4MFBA 1WSRA 5K14B 4KQZA 3W5YA 4YY3J 1PSDA 3AH6A 2DH8A 5D0EA 4MYUA 1IQZA 1Q78A 1KR4A 1WOSA 2BE7D 3VQSA 1DTQB 4URGA 2AU0A 4I68A 3EZOA 4I6AA 1SVDA 2OP5A 1L2FA 3A8EA 1CJTA 3MCMA 1N6QA 2E1RA 1KQKA 3UR3C 3GPCA 2W7OA 4LFAJ 2HPUA 1HNWC 5HVFA 2WSFC 4USHA 3J80U 3K58A 2XMKA 2QLFB 1TKTA 3OW2R 3DLEA 3U1MA 3DI6B 3CCVS 1K1SA 1O6XA 3FC9A 1CLFA 1YJVA 2VD3A 2I2YA 4C0OC 4DR1C 2O67A 1VS3A 3L7UA 2DNMA 4OX9F 3QLHA 5HANA 3R7NB 4ATNA 4N8NA 5U47A 2I6WA 1B0TA 4RZRA 2Y1IA 1VQLS 2QL8A 4JI7C 1IBMC 4DPUA 4LBHA 2OEMA 2MTLA 4GKKC 3V6JA 4B02A 1JLGA 2QMUB 4ES2A 1A0OB 3H2LA 1IR2A 4JI6F 3BDPA 2XS5A 3R7BB 2EKNA 4PCQA 5C42B 3VAMA 4KHPC 4ICLB 2P2CB 2QZ8A 2LKZA 4BWMA 2KXNB 3BQ1A 1DQAA 4DUYJ 3K5OA 2BH1X 4DV6C 2Y0BB 3VV2B 5A8KA 3V81A 3DHXA 4CO2A 4YS2A 1U2RA 4FNIA 3DHVA 3T19A 2EKYA 1RABB 3SDEB 2YKOA 4EGLA 4KGZB 3DRRA 2Y27A 3L09A 1RT7A 5KFDA 3LQVA 3CD6S 1X4HA 5L1LA 5EN1A 1F5CA 3BKFA 1REGX 2B5JA 2C2KB 3DOMA 3PDNA 2A6MA 2A2CA 2I9SA 3C19A 1LEOA 4EMDA 1CVJA 1CULA 4AL5A 1IBKC 2N3LA 3ITHB 1QM9A 3JXOA 4RW8A 1GX5A 1HNIB 1XK8A 3MPVA 4X84A 1LOUA 3T5HA 2H9ZA 2HHHC 1K8AT 4DFJA 4PG5A 4F2RA 5CYMA 4TY9A 2QA1A 3MAQA 1HBNB 1SQFA 2ZOGA 3CJKA 2CQ3A 3LW5C 4Y65A 3NP5A 4K5SA 3C3LA 5D4OA 2JEFA 1H38A 4F4YA 4DCOB 3T1HC 4U6PA 4KIAA 3H25A 3KJVB 3CW8X 1A6LA 5DQIA 3DXBA 3IRXB 4LFCC 3BV8A 1R43A 3ZFVA 4CNYA 3GR1A 1S12A 2YBVA 2VBZA 1GXLA 2RT3A 5F0WA 4QWDA 3T1HF 1VQOS 3DLLQ 2EC0A 3HVTA 4LVNP 3O44A 3RRGA 4E0DA 2BANB 3LAMA 1XRCA 2VA3A 2KT5A 1QUVA 1UETA 1C1CB 4MTPA 4WBFA 3CMQA 2IRXA 2D1QA 2VSQA 1FK9B 1YI2S 1HD1A 3W63A 3MEDA 1LWEB 4G1QA 2FJWA 2OPQA 4KH1B 4OHXA 2HHHF 3HFZB 2JC0A 2HWHA 3IBCB 5DETA 3KYLA 2GMJA 3BGLA 2XCPA 1HNWF 1WNEA 5IZHA 1C1BB 3JSBA 2DNPA 3OL8A 5BJRA 4ZVSB 2DXEA 4AD6A 2J6UA 2PN2A 3T5LA 1BE4A 2FD2A 3W65A 1HNWJ 2CPHA 2PC6A 1PC4A 3G82B 1S1VB 3FFIB 4ANEA 3VAHA 2LDYA 2E9TA 4YB6A 3VVUA 4P73A 3I32A 5DRKA 5G0RB 2VV5A 3LA0A 3ISND 4FUQA 2KJVA 3M2VB 3TOQA 3PRDA 1T0TV 5FIIA 3R9LA 3WC0A 5A0YB 5DM6Q 3G6YA 1JLFB 1WC6A 3HHLA 4DR7J 4JM1A 1XC9A 1OWXA 5J2MB 4ZJZA 2APOA 2M3DA 3KG0A 4M5IA 3OL9A 4FXDA 1U0HB 2YKMB 3PG9A 2KO1A 3QRQA 2UUAC 1TZ0A 1RA7A 4OX8A 1HQUA 2VODA 4DR2C 4RW7B 2KI2A 2BA9A 3CJ8A 3QT5A 2YKAA 4C6AA 3T5KA 3K5PA 2VKRA 2R7SA 5IT9D 4TU9A 2KG1A 4OZJA 5KFRA 2RRAA 5BSWA 3BSCA 3GFHA 3VNSA 4IYQA 5KOWA 1NHUA 1HPZB 2MQMA 2WW8A 2DNLA 1YJNS 2RU3A 2NYIA 4NLUA 4KTVA 2OSQA 1WHWA 3W9JA 4ZPVR 3CO9A 4ZVEA 1K47A 1VRTA 3ZZTA 2EG1A 4RM3A 4CT9A 4I2QA 4O3RA 1VK3A 2JL9A 5DLFA 1TFYA 2I38A 4D4IA 3OVSA 2E0GA 5B0AA 3TZXA 4WZQA 4U7CA 2I1RA 2FHKA 3MMBA 4YP3A 3H4DA 3K59A 1HWUA 1RK8A 3CDAA 3Q23A 4ERDA 1HR0C 1ICEB 3DOLA 4I0WA 5HATA 3J7A1 4LF7J 3DCAA 1OPIA 3DFEA 2U2FA 2VPYB 4DUYF 3NYQA 2AYBA 3OTBA 1ULTA 2XYPB 1BLUA 4CTAA 2ZJQQ 2DHGA 3O1LA 3PM9A 2HGNA 1HMVA 1UP1A 4EYIB 4X4QA 5A1IA 1U0HA 1T94A 2YKMA 1HHQA 2BABA 3D3CJ 3ONQA 2YNFA 1VBXA 3I5AA 4FXVA 3I9V9 3X1LB 4LF1A 4P6QA 3RJMB 2VDHA 1ZM4A 4OI4A 2HNZA 4E8UA 2CVEA 2EWHA 2MKCA 1E6YB 4U8YA 5G4DA 4A4JA 4IG3A 3RZAA 2BRKA 2OSRA 2BVZA 4KH0B 4ZIWA 3VGTA 3UN3A 3AF5A 3N9UC 3KNGA 4H4MA 4P7VA 1UKUA 3MEEB 5A8RA 1SL0A 3M8PA 3CTRA 1R3NA 2J8SA 3B82A 1UPPA 3TVZA 3IBFB 3N79A 2D74B 5AXLA 5KFTA 1TK0A 2H3EB 3JYTB 4Q5VA 2CQCA 2HURA 3SI8A 3HSZA 3QGIA 4UY8T 3I08A 1RT2B 4FKYA 5GMKa 3DLKB 5A19A 2AX0A 2DPIA 3UW1A 2YNFB 1S6PB 1UFLA 1XRAA 2FVCA 3DLHA 1QD1A 1Y00A 2CQ2A 4H4KC 4YHHC 2HLUA 4G1IA 4G65A 3VGSA 4B3OA 3BN7A 3D1HA 1ZOTA 2VG5A 3IR6B 5KT4A 2YWGA 3HSJA 1RY2A 4PG8A 1OQ6A 5A6WA 1IR1A 2LU1A 1LW0B 4K4YA 5KYVA 1HHSA 1BY9A 1HNZC 2FJXA 3FBFA 4J37A 3UEBA 3R6LB 1XTZA 4YR0A 1HA1A 3EJMA 3OQ2A 1JJCB 3C15B 2Q66A 4C4WA 3O2EA 2W7PA 1S6QB 4RNHA 1FNXH 1F3VA 2MKKA 4ELUA 3DLGA 3M4XA 2ZDOA 3UN2A 4LQ9A 1SKSA 4L2ZA 3HHLC 3KHLA 2K2PA 4RBTA 2X3DA 3TZYA 5KT5A 3FCCA 2Z30B 4OIXA 4IOAQ 4X4UA 3TVYA 1RWOB 3V4IB 4YQWA 2KT3A 2MSSA 1NK6A 2UXCC 1NY8A 3QZ7A 2QV6A 3SEOA 3UNYA 3QJLA 2CPIA 4J9MA 3KHRA 2WBMA 2PO4A 3RB3A 2DIVA 3W61A 5LMUJ 5F9NA 3HULA 3MTJA 4R25A 1JJ4A 2DGVA 4PPDA 4CO3A 2Y1RI 1UWDA 3IPLA 3TUJC 3RBDA 1GFWB 3HHKA 3N2QA 4TQSA 2GVZB 5CHCB 4BBYA 3DDNA 1I6JA 1EZZB 3DU6A 3W3SA 2FLOA 2UU9C 3CD0A 3HP6A 4YUDA 4IFVA 2FY1A 4DQSA 2CDRB 4K5RA 4J9RA 3IEUA 4I9GA 3C2PA 1QE1B 1KHWA 4DV2J 2E9ZA 1Q1KA 3VNQA 3PESA 2O1PA 3WQPA 2CJYB 1XERA 3D6TB 2QL9B 2ADBA 2XHCA 3DLGB 3HHLD 5A8WB 2R2UA 2PFFB 4IFYB 2HNDA 1JLAB 1W7WA 2YTCA 5KFCA 3KK2B 2OUGA 2YX4A 5L1IA 1ZTTA 3KJNB 4ZIVA 2YWBA 2CA9A 2GIQA 1QTNB 1TUGB 5LXRA 3K5MA 4LF8F 1SJFA 4JI7F 4M5DA 3R2CJ 5LJ3Y 2NUUG 1FTCA 4ZP7A 1XBWA 2M7SA 2D27A 1LWCA 4L3NA 4PUHA 3K17A 4N76A 2KFYA 2HVZA 1N6QB 3NGDA 2IA6A 1WC5A 4N7TA 2LP4A 2J7WA 2LQ8A 3PX0A 4NXMC 4X62C 3CJ4A 4NLQA 3NNHA 3J7YU 1T9TA 4QWEA 3JYTA 4KGXB 4JI4F 3MXHP 3FQKA 1SC3B 5H9UA 1PYSB 2G1HA 2R7OA 3EZ5A 1MW7A 3F0NA 4H4OA 1L3TA 1QAIA 1X31C 2CAJA 2V8PA 2IYGA 1UEVA 2VC0A 1YJUA 3QIDA 1TP7A 1Q53A 2LU2A 3AA9A 4MKVA 4MYTA 1VQ6S 3VAFA 4F3OA 3D28A 3PYEA 3GFYA 1T5DX 4DHVA 2L08A 3MFHA 1S48A 2D3ZA 4ZCMA 3TW0A 2HIQA 5BSRA 1NKCA 4FYVB 2KXHA 2BACA 4FVMA 1RAEB 1RU2A 2LFVA 3AA8A 4DXLA 3OR1A 4Z2XA 3DM2A 2YNIB 2L9NA 2M70A 3OTOJ 3D1OA 3S1TA 3I87A 2DNNA 5K8PA 3D2WA 2GNKA 1U1KA 4XPCA 3HPOA 2CVIA 1IBMF 1QSYA 3TP2A 3I31A 1C0TB 4Q8EA 3HZGA 3OTEA 2ZM6C 1RBAA 4EU0A 5K20B 1SB6A 2IBOA 1NO8A 4PAAA 2FDNA 4B3RC 4DR1F 1N5QA 4WCEQ 4GRSA 4YHHJ 4K4TA 2D41A 1HYSA 4MKAA 4ID5B 1KLMA 4P7TA 1BD6A 4WFZA 2MB0B 4X65J 2VOPA 5HMYA 1KP6A 4YY3C 1BGXT 1PKUA 3W8PA 1WI8A 4X62F 1TL1B 1DFDA 3PEJA 4FPRA 3D6FB 1GK8A 2QO3A 2JX2A 3M6VA 4OZ3A 3G96A 4JOUA 3THTA 4ANCA 2XULA 3GV8B 2V9WA 3PJ9A 2UV8G 5I3UA 4ZLPA 3MMAB 3KTQA 3BB5A 4DCPB 4M5JA 4ZCIA 2XZDB 4FN5A 1AROP 4EI2A 1YIJS 2VZEA 4QPXA 2C2DA 4LF7C 4DV3C 2VASA 4LFAC 1Q4RA 5CABA 1OY8A 2A0FB 4GMKA 3G86A 2ASJA 3AOBA 1R8CA 1C0TA 2R2RA 3TEGA 4LF9F 4MKYA 2UUBF 4TLRA 3AB4B 3LPEA 2DNQA 2QTWA 1CS4A 2L41A 2XLIA 3S82A 2EG2A 3DMJB 4URQU 2UVVA 4LF8J 2DNOA 1HBUA 1U7LA 3LGHA 2Q43A 5THWA 5KYTA 2GVZA 4ZA1A 1SH3A 5E3AA 2AZ1A 2VBWA 1S4EA 2FPHX 3MPWA 4MK7A 5CA5A 3OR1B 3T1AA 3TA0A 3KLEB 4DV4J 4IOCQ 1SQGA 1FRKA 1WHXA 1UW9A 2BZ2A 2XSFA 1IKXB 4USIA 5IM0B 2EPIA 2M5HA 1TU0B 4R1MA 2VG6B 4JI8C 3R9WA 3L7PA 3TO8A 2Z8QA 2MJNA 3MECA 5J2PB 1FKOB 4NYOA 1TK8A 4RMNA 1S1VA 5T7LA 3QPIA 1NK0A 3THPA 1TUVA 2DRBA 1FVSA 2XY7A 3GJQB 3RGIA 3WX4A 3G6ES 1S5ZA 1NYEA 1IKVB 2M8HA 4LSNB 2YKNA 3CO0P 1XNRJ 2V2KA 4IDKB 4WZMA 3EICA 2B6AB 2NCKL 1AFIA 3TDEA 2BUNA 2Z4PA 1RLCL 3TAMA 1R8BA 5HROB 1U6BA 1C2PA 5E7OB 2XM3A 1KOHA 3QGPA 1RT6B 2XCAA 2KHCA 3KK1B 4NA1A 3U02A 3ZNJ1 3H40A 2CQPA 3NLCA 4JI5F 4F4AA 4B3TF 4L4QA 3F41A 1LWFA 3GE9A 5KFSA 3H8YA 4I6WA 4Y6IA 2CWXA 2EFNA 2RUSA 3LUSA 2DGXA 2NXCA 4QPTA 4I7FB 3TAMB 3VZIA 4PXEA 4K0KF 1HBNA 2Q6CA 3OTOF 1CJUA 1U1LA 3CJKB 1S0NA 2CDQA 3MECB 4I2QB 4TYBA 5D4NA 1FE0A 4DCJB 2WTFA 2RQCA 1C4AA 1IKVA 2OELA 2IM2A 3M6XA 1P6TA 3AODA 3H5SA 1M5PC 3Q2TC 2BKNA 3CWJA 3IRWP 2NQPA 2CQBA 1VC0A 1VR6A 1T3NA 1UFWA 1JLCB 4ODJA 1F1BB 1RA6A 2QLJB 3IAM9 3MD3A 4KKOA 1ZM2A 2B5JB 5AJ3F 5J2QA 1U49A 1RTDA 4LFCJ 1WF3A 4D56A 2DJWA 1OO0B 4DPWA 2KDNA 5H9FJ 1TV6A 2OEKA 3ZZPA 1YZ7A 3QGGA 5HMWA 5D3GB 1X9WA 1JQGA 2E5LC 2V6AA 1NKEA 1TUWA 3A3OB 3K89A 4NYPA 1MXCA 4OJ1A 2RE1A 4TY8A 4B3MJ 1A9NB 1LW2A 2UU9J 2MKJA 2NXEA 1UTAA 4L75A 3T5JA 2GW8A 1IBKJ 4PUOB 3C66A 4DJBA 5J1PA 4X66F 5A2QY 1MD9A 3MAAA 5JMNA 7AT1B 1WHVA 5KFHA 4WIQA 1SKUB 3KK3B 4CLZA 5L9NA 3HO1A 3E51A 1GEHA 4JI3C 1IBLC 2YNHB 2E29A 1TL1A 2F5GA 3OXFA 4OV1A 1L3SA 2FJVA 4DCTA 1JLCA 3N6LA 2PN6A 2ASYA 3UCGA 2CPYA 5GMDA 4DG9A 3VNRA 1XMOJ 2M8DB 2LECA 4DUYC 5KG0A 2MEWA 2CXCA 3HT0A 3ISZA 4LFAF 1DTTA 1R0CB 4DPOA 4R1LA 4DV1C 4DL6A 3CJEA 1VK8A 2KZFA 1K0RA 5KFBA 2AEFA 1F3FA 2L9DA 1GQEA 4W90B 5KG7A 5A6PA 1J2VA 1ELOA 2HGLA 1DQ8A 1H6KX 1OY9A 1T3OA 1TL7B 2ROGA 2RQMA 3JQMA 4K2XA 4CM2A 5AXNA 3M2UB 4ECZA 1R0AA 3GPAA 4JI0J 5FDLB 3M2RA 4K4UA 2F8EX 2C3OA 3HHLB 4UW2A 2HHWA 1RAGB 3QJJA 3IAS9 1REVA 2VZ9A 5IWAJ 1URNA 1HNXF 3IRXA 2V8GA 5IXUA 4RKUC 5HROA 1TV6B 1D8YA 5D3GA 3UWTA 6FDRA 1A7GE 1RTJA 4DR3C 1T02A 5FD1A 2X1GA 2VJUA 4QIFA 1ZAWA 4E98A 2DR5A 2HHUA 2X51A 1RYRA 1AUDA 1HWJA 4O4GA 3MGJA 5SZTA 3GV7B 2G1DA 1KBRA 4DR5C 2C28A 3UVJB 5CCLA 2HFNA 4M5GA 3GIJA 2J6TA 1CJKB 4LF2A 4NA3A 3CIZA 1PJ7A 2V2VA 1NK4A 4HACB 2Q6BA 1TR0A 1DRZA 1ULRA 3LNOA 4I7FA 4NXMF 1VIOA 2AGPA 2P8IA 3GR0A 2HHXA 4OYBA 4FUTA 5KEIA 3AJ1A 4B9MA 3N54B 2MKYA 4X62J 2XY5A 2QW0X 1NM2A 4DS4A 4RR5A 2BANA 3I0RA 3C6TB 4GXQA 3M8RA 2VBYA 4PEOA 4GS5A 4N8OA 4FVCA 1DLOB 5IWAF 3V6DA 3PY8A 2Y4NA 1X4BA 2E44A 3CXCR 1FJGF 1VQMS 3DOLB 3OXGA 3QT8A 3SXLA 2FY8A 1KFDA 1PAUB 4ZN1A 2VPZB 1S4FA 3FJ2A 3KJQB 3IM8A 1JLGB 3MM8A 5AE3A 4Q8FA 1IKYB 1GAOA 3OL6A 2VB6A 4V19J 3I0SA 2XC9A 2KJWA 5KFFA 4DL3A 4DWIA 3D54A 1NSKL 1UW4A 3D6HB 4A8KA 4DV3J 4IFYA 1MKYA 2E7XA 3A9UA 2XZWA 3Q89A 4UOCA 2OIHA 1Q8LA 1RAAB 2RQKA 2YH0A 5KFGA 4ED6A 1S76D 4C98A 5KG2A 3V6KA 3QWPA 4EBCA 4IZ6A 3QRRA 2ZJPQ 5L8RC 1PBAA 4ZPBA 5B0FA 2R7WA 1VQYA 1W2IA 3KLGA 1RT7B 4IG3B 3UDLA 1VOMA 3PHEA 4DG1A 2G4BA 4KBIA 4PZPA 2NXNA 1G4CA 4RWWA 4F7VA 4XIUA 2X3GA 3S6EA 2YPYA 4J9VA 1TQLA 2CU6A 2QJ3A 4FKXA 4JV5J 2B4OA 2RS8A 3FSYA 3I0RB 2V69A 3K8VA 4Q2MA 4Y28C 5HAOA 3BF4A 2ZH4A 2VQFF 2UU9F 4D57A 3GTYX 1JJ2R 1IBKF 1VBKA 1M6XA 4ID8A 2N82B 2ZM6J 2FZCB 3OTCA 3IEVA 3PKMA 1RTIA 1ZZNA 1VIXA 2ASLA 1RLDA 2YWHA 3W66A 3FSXA 2UXBJ 3P6YC 4ZK7M 2AJ1A 1PJ5A 2Z2LA 3BJYA 3DOKB 3S01A 1FO1A 3KLVA 4ECRA 3VVTA 3ILOA 4DV0J 4ED3A 2JWNA 2YQ3A 2D1SA 4JYAC 4DPXA 2GVDB 1WSVA 1U2CA 2NZCA 2DPJA 2DGTA 4LIRA 1IKWB 1FDDA 4OLOA 2KM8C 7FD1A 4WFYA 4O3NA 4J9QA 3TUIC 2JC1A 2HFVA 5JXSA 3SBMA 3V4MA 2FLLA 4JI1J 3IR5B 4K50A 4G1QB 4HTJA 1MSWD 4ZVUB 1QM4A 2JMPA 4H4OB 4GKKF 3BGFA 2CNKB 1NUEA 3DU5A 1C1BA 2G2OA 2LCWA 4LRCA 4F4KA 2CQHA 1LFPA 1HIYA 3M2RB 1TL3B 4KT0C 3FZBA 1D3WA 2D1CA 5D4PA 4JI6J 1RBOB 2MQLA 3GYXB 2CZVC 2J76E 2MZJA 1WEZA 3PJXA 4JP8A 4LVOP 4Q7AA 5BR8J 1LQ9A 1WF0A 3BGRB 3GG0A 3WHIA 3C16A 1YJWS 3CB4A 1FE4A 2PE8A 3K2YA 3DC2A 1B99A 1KKHA 1RTHB 1Y5NB 2ATCB 2QMXA 3DM2B 2PA3A 4H4KA 2QA4G 4DFPA 3FMWA 2O66A 1T9VA 4CLKA 2BXJA 2CPJA 3RAMA 1MDFA 3GILA 2YVSA 1FTRA 3KK2A 3DOKA 3E7XA 1JLBA 5F41A 4RNMA 5A8RB 1OS5A 4WP8A 2PMHA 3VAIA 3HJFA 5IT4A 1KVJA 1S6OA 3VTIA 1CJKA 1RCXB 1LWXA 4IH7A 4ED4A 4MMOA 2GS8A 4X4OA 1EQMA 1YJ7A 1WF2A 1NDKA 4MAKA 4F50A 4DV4C 1MU2B 3DYAB 4JI8F 1XMBA 2F4VC 2ZE2B 4RLQA 1B0VA 2AYEA 3NGSA 1KNZA 4QU6A 1JK9B 4F26A 5KG1A 2AEJA 1UAWA 3ENAA 3QO9B 4OQJA 4RNNA 1TTHB 2QSFA 4WK3A 1PYOB 2GAGC 3SCIE 3RB4A 5DZ6A 3H5UA 3QSYB 4FYDA 3KLIA 1W26A 5FLXU 4IRDA 4OZLA 3M30A 1PGZA 4K4SA 4DR3J 2OD6A 3MPYA 2GC8A 3HI9A 1SC1B 2RVJA 3J7Z5 4A8SA 1J5EJ 2HG4A 4LBPA 2UXDC 4N56A 3PFEA 1IXKA 4WKRA 3DHWC 2HYIB 2ABYA 2F7VA 4A8WA 1DZ5A 3T1HJ 2B9XA 1RAIB 1RSCA 3MMCA 3KUGA 2ILYA 2M52A 1CJVA 2IM3A 1YBAA 1YSJA 3TA2A 4JI0C 1SXLA 2XYHB 1AA1B 3D6MB 4BLGA 3BSOA 1XS3A 4MTNA 2E9RX 4OXIA 1UA1A 2XY6A 4USKA 1Q86T 1NXIA 3D68A 1BC6A 2AP6A 2QVXX 1VRQC 2IJNA 4MH4A 1S6QA 4UOHA 3SCKE 3BDEA 3PTWA 3OV7A 5K8FA 3PKYA 2EGTA 3ET6B 1S59A 1FDAA 4DBQA 3HCXA 2JHEA 2HZVA 2ZD1B 5L1KA 1FDBA 1B4SA 4PG7A 3IM9A 1DY3A 3LALA 4C3LA 3TI0A 3QO9A 1AW0A 2H51B 1RT5B 1CEZA 4X4TA 1UWBA 2RKIA 4FS1A 1U8SA 1G1XA 3WIUA 4M95A 1KS2A 4XDCA 4ED1A 1J5EF 1NSQA 1LK5A 1FD8A 4DV6J 4NLVA 4DLGA 2DK2A 4J7CA 4AE5A 3RU0A 2YNIA 3M8PB 3L8CA 5D4LA 2P2QA 3F73A 4IDKA 3CCWA 2HRYA 3SSRA 5J1EB 2K06A 4TNOA 4DR2F 3D0GE 1QDUB 4WYLA 5EWFA 4DFMA 2CIMA 1R8AA 2J7KA 3JSRA 4GKKJ 3RV2A 2YWKA 1ZPVA 4B3MC 3NGRA 1TKXB 2NREA 1S6UA 4QU7A 3A3NB 2HK3A 2KYZA 5HK4A 5GAEI 5C7PA 1BUXA 4HACA 5J2QB 1VQ4S 1APSA 3NGTA 1F60B 1VRUB 1WG5A 2BV3A 4U95A 5IC6B 4LSLB 3HXMA 4W92B 4DU8A 1Q5VA 4F67A 1ZA2B 1U6FA 1XNQJ 1MXAA 1FLOA 4DF8A 3JSMA 3TJ8A 1HLWA 5MLCV 4B9NA 3P5TL 3KKFA 2HZCA 2R8KA 4B3RF 2JDJA 4CO1A 1LCIA 4R5PA 2QA2A 1N2FA 3MFIA 2R2TA 1S1UA 2BYCA 4R0EA 2GIFA 5D6GA 2IJRA 3HKWA 5CZVA 2HHPA 2C3MA 3DLJA 3EGNA 2LA4A 3MPDA 1RHUB 5ETRA 5DQGA 3MR2A 1JXLA 4IUFA 4DR6J 5IV3A 3W62A 4PQUB 3UZ0A 4AQYC 5IT9Y 3G9CA 1N5YA 2GAHC 1V5VA 3TAPA 1T05A 2IHR1 3I82A 2G2YA 4RO0A 2K1RA 4HHUA 3TAQA 4EUVA 4F0HA 5AXMA 5KT2A 1Q81T 2P9EA 3KMQA 2V8VA 3H5YA 1T11A 1E6VB 1V9OA 1P4EA 2DEJA 2I5JB 1H98A 4X65F 3RB0A 1OIAA 2DH7A 4F2SA 2U1AA 2AKWB 3NNAA 5GADI 4P2SA 1USPA 1K1QA 4LFCF 3T1YF 1R89A 4GO7X 2A18A 4ZHRA 1H3DA 1NPRA 2KT2A 4MIWA 5KG3A 4LF5J 1Y7PA 2JFDA 3PR5B 3MAAB 3TRGA 2IMOA 4PROC 1KKGA 3T6JA 3FEYB 1N33C 2BM0A 4A8QA 3QRPA 4QW9A 4UQGA 3J81Y 1IQTA 2RU9A 2IM1A 2RIJA 4WK1A 2NPFA 5A2QU 3L9ZA 4FF3A 1YQHA 3PFOA 4EBDA 1PC5A 4Y2IA 4NCGB 2A10A 2GHWA 2ZH5A 2HMIA 1QTMA 2WD9A 2E8EA 4C8ZA 4TPSB 1Z2LA 3HT3A 1GMVA 1S9EA 3QT7A 5KFWA 1N34J 4ELVA 2YY3A 3DNCA 3RYLA 2VDIA 2W4DA 2KG0A 2W9BB 3RW7A 2DHSA 2EFPA 4R0JA 3MZIA 2DR8A 4KGVB 5I3UB 1EIYB 4KYZA 2FHJD 2RRBA 2XMWA 2A2DA 1NB7A 3ZTRA 3BQ2A 3GIMA 1S0MA 3FBEA 1B0PA 2DNYA 2PIIA 3HVWA 3PEHA 4YB7A 4DUZJ 1XMQF 3DGVA 2DRAA 3LGNA 3HLUA 2LEAA 2F3JA 1SKRA 4JI6C 2CQDA 4DS5A 1WKKA 4PKDB 3GSIA 2CRLA 4DR4F 3T9NA 2ZNZA 5KFEA 2XS7A 1SC6A 3J80Y 3GV5B 1CJUB 2CJBA 4YDDB 3CUNA 4OX9C 1N36J 4QIWD 5JJBA 3CMES 1R27B 1T95A 3M8QB 3SCLE 5LMNF 3EUNA 3FCEA 2HVEA 2ZITA 3V6DB 4KV8B 2OPSA 1FJCA 4DU7A 1MXBA 4JV1A 3KWMA 3LPYA 4ZLNA 1EHWA 1LWCB 3H2UB 3EVOA 3QT6A 5ETKA 1GTHA 3VQTA 5E41A 4JYAJ 2F1FA 3A4IA 1IWAA 5DDQC 5BUSA 2CZ4A 3JS9A 2K3KA 4P72A 1U1QA 1PG4A 4DR6F 1RWPB 1GMWD 1WG1A 1ZS6A 5AT1B 2HAIA 2XGPA 4FYWB 3GIKA 1FERA 3MHYA 4K0KJ 4TLQA 4L3KA 5T7LB 1G3OA 2M0GB 3MOZA 2YXLA 3PR4A 1EKRA 3P5BP 1FRXA 3CJRA 2XMAA 3RTVA 4I2PA 2MKHA 1IJEB 3CMAS 1N5SA 2D3OR 3DRPB 2J5AA 3E7WA 1QAXA 1IKXA 2B3TB 3LUYA 2D9PA 4UF4A 2BE9B 3SFUA 5KFLA 4IG0B 3OVBA 1O90A 3ETOA 1EGAA 3ITHA 1LXJA 4EO8A 3AD8C 1NJXA 2AT1B 1RJJA 2YKQA 3MM6A 1N32F 3AF6A 2OPRB 5LMUF 2EBEA 2OPLA 4AUKA 4W4MA 3NWRA 5GAHI 2LEBA 5HLFA 5F9LA 5KAKA 1KFSA 4NLDA 4OI2A 1U47A 4OLPA 3T41A 3Q8QB 4FYYB 1R6YA 3GYGA 3I96A 2LEPA 2J0WA 2HEKA 3WC2A 5F8LA 5BSTA 1WTBA 1SJ3P 1S79A 3P3DA 3DAYA 3R44A 2V63A 3FZ2A 4DG1B 2GO8A 2ZBCA 1NDPA 4L6V3 2VBXA 2AMCB 1QJHA 2O5DA 4E2FB 3EVWA 3EERA 1SPBP 3DI6A 4HDHA 4CH7A 2HBYB 2J8AA 2N7CA 2X1AA 2ROEA 2QGFB 3GCWP 2DNGA 4QR0A 3D1QA 5HI7A 2HNYB 3K8WA 4Z7YA 5RUBA 2PFDA 2EW9A 7FDRA 2XLJA 2ZHAA 1HNXJ 2P02A 1CJTB 5D8HB 2A1BA 1I94C 4ZITA 2BOPA 5ETNA 3OFEA 2F9JA 1FDNA 3CE8A 1Y9OA 4K7QA 4NZ7A 4WFNQ 2HHVA 2E7VA 1TKTB 1EKSA 2I8EA 1I5OB 3ZZZA 4UT4A 2AYGA 2VJVA 2UUAJ 4MIBA 1PA4A 2IPOB 2M5YA 3TQEA 1U4BA 2DISA 2DGQA 3B4MA 5HLFB 4I9FA 3AQOA 2BDPA 2N3OA 2DO4A 5D0HA 3M7VA 3ULHA 1RWWB 4ZN3A 2NLWA 3S8SA 2WVCA 1WACA 2R7UA 3C6TA 3OFFA 1SJ1A 2UUWA 5A0YA 4HEA9 1JLFA 4QIVA 4CRJA 5AE2A 4LR9A 1CS4B 2W7AA 3ZTSA 1H7XA 5T8TA 2J0SD 2AJQA 3CEDA 3GIRA 1U1RA 1XMOF 3A8IA 2RDDA 5G0RA 2DHAA 5D0GA 4JI3F 4U5YD 2MZTA 3E3XA 5EGYA 5SUHA 3H20A 2E66A 4KAIA 2PI4A 2CNLB 3MEKA 2VQEJ 4YEAA 2HBZB 2Z58B 3OLAA 2DPLA 2D1RA 2VG6A 4LF6C 1ML8A 1FXDA 4F3MA 4B3SF 2GV1A 3TJAA 5KFOA 4ELTA 2DIUA 4Y2CA 2MMAB 2BEFA 4FTFA 4X64C 2BJ1A 2HIYA 2KVQE 3IO1A 4B08A 2AJFE 1Q79A 3PXGa 3WBZA 3EYZA 3BO3A 1IKYA 3GCXP 2OAUA 1S1WB 5KG5A 2E7WA 3TZWA 2UVWA 3MOJB 2AJ0A 1FFWB 5EWEA 1R0AB 3AB2B 3LP1B 4KO0B 1C4CA 4Y0FA 3BN4A 4CTAB 2B6AA 4NA2A 2LDIA 4IH5A 5J1NA 2QT7A 3G8TA 1TH5A 4JI5J 1L3KA 3Q8PB 1RWKB 1F0XA 4CP5A 1KD1T 3GFZA 4J9NA 4USMA 4LF4C 2J7UA 2RF2B 4ZVRB 3CCTA 4DN9A 2FQQB 4ANDA 3A9VA 3OT9A 3P4UB 1BA3A 1CSJA 2C2NA 2KYXA 4P9SA 2KFZA 2WB4A 1NHKL 2ZC4A 1I94J 2YCBA 4HT7A 4DX8H 5HL7Q 4QCLA 4XTTA 2YX7A 3JAMD 3MD1A 4NL5A 4PYAA 4Z7CA 4KGKA 4PPZA 2AYAA 2XMJA 4OHWA 3OJUA 5CYJA 3PROC 4LRFA 2VUGA 3BH7B 2KHDA 1X4DA 4WWSA 9RUBA 4GKJC 2ALZA 1GMWA 4ES1A 5A8WA 3QJPA 3IG1B 3T3FA 3TZZA 3CC2S 2BJ9A 2C3YA 2ZHOA 4IRCA 1FHTA 2COLA 2OBVA 2RQ4A 4NYZA 4X4NA 4ZVGA 3ISNC 2AYMA 3GB0A 1AXQA 4G1PA 3EGVA 4TY8B 3GJTB 4NXMJ 1KDNA 2DYAA 1UA0A 4B9SA 1N33F 1UWBB 2VA2A 3D7SB 2MGZB 4DQRA 4DDFA 4B9UA 1S7HA 3E01A 5E5NA 2CPDA 1N32J 5A8KB 5F8HA 1R6VA 2RD5C 3DDKA 2JVRA 3JTNA 1XNRF 3ZZOA 1NJYA 1FJ7A 4K0BA 3MAHA 1X4EA 5E33A 2WVEA 2GQ2A 3PW0A 4P10A 4PUGA 5DDPC 3AJDA 3DGPB 3MMBB 1D1UA 1IBMJ 3BEGB 4EFAC 5I42A 4WIIA 4XX2A 2ERRA 1HBOA 4R8UB 1UVMA 5MAOA 1VQ8S 3PRVA 1HFEL 4AYBD 1QLNA 4CO5A 2ZH7A 3FEZA 3MM5B 4DV2C 3QFHA 3UCUP 2ROPA 2XSJB 2ZH1A 3FUYA 2OJ3A 1IBCB 2FGOA 1VYAA 1KVKA 3EDRB 4ZP6A 3D9BA 2WOMB 4DV7F 3PVXA 2FVSA 2IVYA 4DFKA 1J5OA 2BMBA 4DUZF 2UXDJ 1Q95G 2RH3A 5KFYA 2IBKA 5GVQA 4J91A 2VG5B 1S10A 2M5OA 3M6WA 3IP0A 3M32A 1RHJB 3M30B 4LFBC 1HPZA 2Y8YA 4QQBA 4C8LA 4QOTA 1EJ7L 3OUYA 2UUCF 1U48A 1LV5A 1HNZJ 3RBZA 1IVZA 3NPDA 2MY7A 4U9RA 3G4SS 4YMEA 4Y2MA 4CLTA 3THVA 1IM6A 4KC5A 3SQGA 2KM8B 1CC8A 2ZE2A 5BR8F 2DVIA 3BO4A 4EZ9A 3LAXA 4NXNC 3VAGA 1X5TA 3VAKA 3D0IE 4WPAA 1WORA 4B3MF 1K9MT 2EBGA 2KU7A 2EK6A 3WDOA 5GAGU 2HZAA 1HHTP 1TKZB 2KDOA 4OHVA 4ZVFA 5T14A 1XRBA 2KRBA 1OQ3A 1UL3A 1UVKA 3DKDA 1P9QC 3PJWA 4WP3A 1V26A 2DRDA 1JLEA 1AFJA 1E6YA 3A4TA 3JTOA 4DR7C 5AJ3J 2W01A 1L3VA 5DGBA 2NXUA 3ILIA 4RX6A 4RW4B 1HQEA 1FX4A 2YNGA 4ZVOB 4C11B 2BE2A 3UE2A 1RUSA 3ZTQA 4DOZA 4UOGA 4C8OA 3R3TA 1KC8T 3ELHA 3BQ0A 1MN7A 5DG9A 5FJ4A 5IT9U 1XMQC 4I64A 1VFJA 4WFXA 2MHNA 1FWLA 4X4RA 3A3PB 4JI2F 3RG6A 2WONB 1RTHA 1Z1ZA 2NSCA 3PRBA 2ZD1A 3NAHA 3QATA 1UJ5A 1NKBA 5F3TA 1WC1A 3D0HE 2K7JA 2VICA 3CQ3A 3PW5A 3QIPA 3BREA 2BJ7A 3DRXA 3O8WA 2R8HA 1XR5A 2R9LA 2VFRA 4WTOB 4GVLA 3FGVA 1VGYA 4MKBA 5ITHA 3LP2A 3US5A 4R0MA 2KL8A 1HI1A 1WTFA 1X0PA 2BJEA 4LF5C 3R9XA 2C2MB 2AHOB 1PCAA 2KVIA 1KQFB 4ECQA 3MR3A 4N47A 3ENVA 2VC1A 4ZPWR 2GCFA 2OLWA 5GMEA 3MR5A 2GJFA 4DV7J 2UXDF 1NH8A 2H5EA 2B43A 3AXMA 4QZVB 2JSXA 1UWAA 5IC4B 2CY1A 2HRTA 3G7SA 5L1JA 2CFXA 3CCMS 2R42A 5LJ5Y 3DN9A 2D7VA 5DLGA 4IOBA 4X4VA 1RT4B 3H42A 3LANA 2CG8A 1AB8A 1FEEA 3KJFB 3NKYA 2C42A 4DLEA 2OPPB 3PZPA 3NOGA 3D67A 3N6MA 2WONA 4NRUA 2H4YB 2WRMA 2EC2A 3LP0B 2DCLA 2POKA 2RRNA 5IOLA 3L3CA 2VPWB 3CD5A 1MWYA 1O92A 2BKPA 3NXZA 2C2EA 4ECXA 2QVZX 4DCUA 2C2OB 4KE5A 5F8MA 4I69A 4OYWA 4ENOA 3NS5A 1NK5A 1BQMB 1WWHA 4HI1A 3CDEA 4RJVA 3KLHB 2E5LJ 3CCJS 4LF9J 3GQCA 3MUVP 4AL6A 2GGPB 1XJWB 4B9VA 3QLHB 1P1TA 2Z56B 3LWLA 1O5JA 2KZZA 2F4FA 1QVGR 2E5GA 3W2WB 2JEIA 4KTTA 4NWBA 3CJ0A 3GLJA 3R27A 5LL6d 1USPB 3BH6B 2V4JB 3IS9A 3OVAA 4BSZA 3BGRA 3TVKA 3IMLA 3C16B 3TX8A 3AY0A 2ZH3A 4OYPA 2PROA 3KNAA 1FRJA 1FNOA 3PHTA 1H2VZ 2I0XA 2H4WB 1AUSL 4CLLA 1RXOB 2HQGA 2HK2A 3AJ2A 3H59A 4USJC 3Q22A 1RISA 2ZFHA 1ZETA 3CSKA 3R7SB 4RW7A 5E3CA 3EGZA 2FHOB 3FBCA 2NXJA 4NRTA 3GMGA 2V4JA 1TMMA 2LQBA 3IS9B 1O0PA 4N77A 4CWBA 2AX1A 1VHIA 2HQIA 8RUCA 1XR7A 3CCES 2MLXA 4K4WA 3CJ2A 1UMJA 4DQIA 2UVUA 4DUTA 2WK4A 4OX6A 5M2PA 2AGOA 1ZAVA 1WEXA 4ZDNA 2FVPA 4JI8J 2VONA 5DJBA 4DV0C 3JQKA 4Y34A 1SQEA 2GQCA 4RW6B 3ZNUA 4DX6A 4RU9A 5H9FK 2EFQA 9ATCB 1HQEB 2YNGB 3DRYA 4A46A 2WP0C 2DNRA 1FKOA 1JLBB 1WG4A 1GNKA 3EDQB 3SQOP 2XNQA 2XYGB 2PMWA 3HX9A 3WZ0A 3Q2SC 2PI5A 1RBLA 2V7BA 4GXRA 3KLEA 2B4VA 2HBQB 4PXBA 5IQQA 1W2BR 2UXCJ 1OY6A 2IC3A 5BYSA 2N4CA 3DOMB 3PACA 2HQFA 3TWZA 3NY0A 1ZM3A 2Z0GA 3HD1A 4NZ0A 2RAQA 2F8HA 1R8PA 1TL7A 5HBMA 4ZLLA 1SJQA 4GC6A 4L7IA 2BJ3A 1FK9A 4QYRA 2BX6A 4O3QA 4H54A 3WX8A 4Q44A 3W9IA 2DO0A 2HHQA 4AT1B 4GC7A 4O3SA 3QAUA 3SYZA 5J2NA 3HSDA 2CPZA 4F0KA 4GVBA 2VL1A 4KB7A 2GMHA 3JSYA 3OFGA 4M5DB 3G8SA 4C8YA 5BR8C 2ASBA 3NOCA 4BWJA 2EK1A 1D9AA 3F44A 3CJSA 1TL5A 3J7ZT 1VQ9S 4MK8A 2QRRA 2ZDPA 2QLBB 3UOWA 3ZXWA 1HNVA 1DARA 1D09B 1NSPA 1X4CA 2WOMA 2YQ0A 3MI7X 4CQ1A 2CJXB 2W4PA 3BBBA 5H9EK 2IDEA 1JXVA 3NCPA 1D9FA 1Y3KA 4FBUA 1NBEB 4C9DA 5DV9A 3AD7C 4CLUA 1S9FA 1H74A 1DURA 3C15A 4IR1A 3C6UA 2QEXS 4BDPA 3IWNC 1WCJA 2GO9A 2C2RA 3UDVA 2E1MC 4WYWA 3RBEA 1IJFB 3EXCX 1V6HA 3GU0A 1NDCA 2IVMA 4AXJA 1IR0A 1DQ9A 3DLKA 1RI7A 3MDFA 1U45A 4PHTA 1PAEX 4ILRA 2MCQA 1HI0P 4FPIA 4WU3A 5F0UA 2UXBC 4JI4C 2RDJA 3R5BA 3VZHA 3JQJA 1B64A 1SUQB 1QY7A 1HI8A 4ZS6A 3F56A 4WU2A 3MM6B 4DN0A 5E3RA 4YR3A 3R1LA 4JI4J 4JV5F 4BS2A 5T8SA 1YHQS 3JAMY 1WUUA 2P6SA 1KVIA 4CCHA 1IUJA 3PYGA 3P45B 2CZ9A 3V6HA 4JV5C 3D4JA 5KFPA 1VLAA 1H0HB 1N88A 1VEHA 1RDRA 1X4FA 2W2QP 4CM0A 2RMLA 4LF4J 2NPIA 4RLFA 1MROB 1SIWB 3ILLA 1TL4A 4NLOA 5KG6A 2UXBF 1UEUA 3NGUA 3K6RA 3UD3P 4ED2A 2AZ3A 2GJIA 3K7RA 3KDNA 4OYMA 4RW9B 5K8OA 1LKZA 5F8JA 1TVRB 3FK4A 4G3IA 2L9WA 3GONA 1ZPWX 2XMUA 1DHMA 4USWA 5E3PA 5HMXA 5B0DA 1N0UA 2JFKA 2YX1A 2LLZA 2BJ8A 3AOAA 3IXQA 3A8JA 5B0EA 4A8OA 5C2GA 3UCZP 2W4CA 1FRHA 5BYQA 3OHBA 1HNZF 4GKJF 4LFBF 3HVTB 3OL7A 1T9WA 3R5CA 1NAQA 2EFVA 1DAXA 4J9PA 2XGQA 2LVWA 2ACMA 4HI2A 1N5YB 4KV8A 2QL5B 1IN0A 1FEHA 2QSWA 3LOUA 2CADA 3M2UA 1OYEA 3PYDA 4KHRA 2QMWA 5LOQA 2K7KA 2CWKA 4DSLA 2NYHA 1NHVA 3P96A 1XNQF 1EETB 4NMLA 4WV3A 1DTQA 2D9OA 2H5JB 1ZYQA 2CQ4A 2HVDA 2FC9A 3CPWR 3PW4A 4BCAA 5EX0A 1SH0A 4LSNA 4UOFA 2JJ4D 2B8QA 1SBRA 4FS2A 2KFNA 5LMNJ 3B7WA 5BSVA 1RWUA 2UUBJ 1N36F 1M1HA 2QLWA 2JLFA 4CI0B 3MM5A 1X9MA 2Z2ZA 2WSEC 1NDLA 5ETQA 2LXUA 2OFGX 2P6TA 2Y0SD 3MM9B 4PXCA 3W7BA 4K4XA 2XNRA 1PIEA 2KB2A 4CZCA 3I5CA 4QWBA 4MH8A 3OJSA 2G0CA 3NBPB 1GX6A 4DL7A 3CDBA 1QAJA 1FJGJ 1VQ5S 3M8WA 1RHMB 1U09A 2HBRB 1EAYC 2J9DE 4O4GB 2NSBA 4ZJOA 3KLFB 1TFWA 2CQIA 3CT9A 5KFJA 2E1AA 1ROFA 3UI3A 2FZGB 3M9OB 3V81B 2F4VF 5J2PA 2HWIA 3FMBA 1G6BA 2DNHA 2E5LF 4C8KA 4OHZA 2GZOA 2HMIB 2MHEA 2ZBQA 3R5DA 1ZTWA 2BQ3A 4I56A 3G2XA 5KFZA 2WZ1A 4ZKAA 2B51A 1HW8A 2PGCA 4ZVQB 4EZ6A 1MN9A 4OZ5A 2GHPA 1QUPA 2R8JA 4J9OA 4PUOA 3HMJG 4C97A 2AQ4A 2OPRA 5EUHA 2ATLA 4NCAA 4FDFA 4HKQA 5DDRC 4LF6J 2OPLB 1LW2B 1LNQA 4ICLA 3E8OA 1TMJA 3IA0A 3QBCA 1TKDA 3DDIA 1EARA 3ILJA 2B4UA 3H2VE 5CH7B 5BUQA 4WP9A 5GTDA 4YDXA 1UCNA 4HVZA 1UVIA 1P9YA 4CLSA 4ECSA 4PABA 3UDEA 3CCUS 1X5PA 3NRBA 4RLEA 4NLXA 4OL8A 5E7QA 4DV5C 2ASDA 2EEYA 4AQYJ 1UVJA 3MM9A 3QAEA 3N4WA 4C0BA 3DLBA 2V4RA 4RVOA 1FFSB 1FRMA 1Q0NA 1RQ0A 1XQIA 2OPQB 2RILA 3VWSA 3BSNA 1NK7A 2XO7A 3NCQA 3U1LA 1GXTA 4LR8A 2MQOA 3LWMA 5HQ8A 4W98A 3UN5A 3N5FA 4C0HA 5CAAA 1S97A 4P74A 1ZH5A 5C2CA 1J27A 1O93A 3MEDB 3O5TB 4LJMA 2DGOA 3BYRA 1H7WA 3QIPB 2ZUGA 4WE1B 5D77A 4U67Q 3QZ8A 2VKZG 3NG8A 3RB6A 4M94A 1GTEA 1KWMA 1SL2A 1QAYA 2B56A 1X5OA 3J81U 2X1FA 3E01B 3W9HA 1EB0A 2VFSA 2PEBA 2ZVIA 4C7QA 1B7YB 4NMXA 1N0VC 3FKBA 1RWNB 2VG7A 4PG6A 5K14A 4A8XA 5KFQA 5DG8A 2YWWA 2DXFA 4J9LA 4ECYA 1SL1A 4B3SJ 4KJIA 3TA1A 3G6VA 1RWVB 3TARA 3ZZRA 1S0VA 1UFKA 4H4MB 2R7TA 1XMOC 3MEEA 5GAGI 1HBOB 2V9KA 5FLXY 3B6BA 5I4MA 2GVDA 1RWMB 2XHWA 3HFKA 3K57A 4DX7A 1HBMA 2HFOA 4QIEA 4ED7A 2HJGA 5CYQA 4HH1A 1H2TZ 3IC1A 4I2PB 5H1SV 2F65A 2O01C 2HKEA 2ZOMA 4DL4A 1T5HX 2R3VA 4OX7A 1X5SA 2R7QA 4ZPAA 1OPZA 4OYOA 5I3QA 2OPPA 5CD4H 2HS0A 4K8RA 3CGIA 4PQAA 5E0OA 5K5MA 1S1TB 1WELA 3SCJE 3SQGB 2M9KA 1FUGA 4AL7A 5E2QA 5ETOA 4OI6A 5LSRA 4LF7F 2WVFA 3HHNB 1S9GA 2EVZA 4UTGA 4O3OA 4KY3A 4X4SA 3AHPA 3PW2A 3I5BA 2VF3A 5M2RA 4ER8A 4LF5F 2KZMA 5F8NA 1F2HA 2JNVA 3V5RA 2ZH9A 1B3TA 3R1HA 4RPFA 1P8GA 3M32B 2AW0A 3R6GB 1UZHA 2KXFA 4ITSA 4DV0F 2XQCA 1TAQA 2UVRA 4EATA 4Q0BB 3C14B 2JRSA 2G2ZA 2NZ4A 1ZB8A 4I6YA 4HR2A 1HNVB 2BKOA 2YNHA 4PR6A 2ONFA 1AMUA 2CQGA 1ZBTA 3HD2A 4RBVA 4Q45A 1N8RT 1HW9A 5HN0A 4CYUA 2ADCA 4DUZC 3BGUA 2ZM6F 3Q83A 1IB8A 4FXWA 5M2UA 1CULB 1KRPA 1YVFA 1NB2A 2FUG9 4LR7A 4D3GA 3EX7B 4F4XA 3QQCD 2ACYA 2KTQA 2HSEB 5HVHA 1L5UA 4PYDA 3J81D 1VQNS 4EEYA 1NMEB 3D66A 3N6NA 4TN2A 3BKUA 3C14A 4CLFA 4DV2F 1WKJA 5LMUC 4F4ZA 3GSDA 3OXLA 4N41A 2Y4OA 4ZP8A 4WXWA 1N34C 4F02A 4BHQA 1U0SA 1HH2P 2D28C 2BW2A 2VFVA 1JKHB 4DR5F 1URRA 1YZ6A 2ZNYA 3H0PA 1PG3A 2PT7G 3KXWA 2CXEA 3GWCA 1N52B 1M5VC 4QWAA 1F9EB 2HVIA 3M1VA 2IAJA 3BR9A 1M5SA 3Q8VA 1JJHA 1S49A 1Z4UA 1XNRC 3KHGA 3KLGB 1U6ZA 3EM1A 2AJ2A 2DITA 5KTQA 3PBKA 1X4AA 3HHDA 1BQNB 4LFBJ 4RW6A 2QN6B 5HP1B 1FFGB 2OHDA 4M63A 1SIZA 3G82A 5AXKA 3RAQA 4USTA 1SKWA 1SV5A 4DG8A 1WDTA 4ZPTR 2UUCC 2DKOB 2R8GA 1IM4A 1AYEA 3RR8A 3GFXA 2IAJB 2W9CA 3HF5A 2UP1A 1LW0A 2B8PA 1I51B 1M1GA 2PD1A 3O2IA 1WOPA 1AT1B 1VJWA 1X7VA 2MDAA 2ZEJA 1BHNA 3IWXA 5DO2A 4A47A 4JI1C 1JKHA 3QWUA 3CC4S 4B3OB 2QVYX 1KLMB 4DV1F 1S99A 3CNQP 1N33J 3FVYA 4LF8C 3P8BB 2IYIA 1VQPS 1N54B 1YRTA 2X7IA 1RT5A 1S1WA 4OMFG 2EXUA 2A6OA 1L3UA 1RTDB 1WD6A 4X65C 3ZC4A 1Z2ZA 2DTJA 2W9CB 1PO6A 4LUBA 2E8CA 1PJ6A 2WBRA 5A76A 3UQSA 4LF4F 4OZ0A 3PX6A 2WVBA 1IBLF 2E7GA 4C2MA 2XMMA 2KRRA 5DGAA 4KTQA 4NLGA 4RUAA 5JVGQ 2MZRA 1RT1A 4X66C 3W2WA 1XNQC 2CJ9A 2LQ9A 3UDCA 3OLBA 2W2PP 2BQUA 1HR0F 4PWDB 2D69A 2YKPA 3QFWA 4NI2A 2HQDA 2K8GA 3ZZYA 4JI1F 1SI9A 2RDIA 3L7OA 3MEGB 4ILMA 2OTJS 4M1KA 3I07A 3I56S 2GGPA 1Y5IB 3M1VB 1SV5B 1VRUA 2HNZB 1OSCA 1VI7A 1Y0HA 1XN9A 3TX0A 1VC6A 4XO0A 4USUA 3B54A 1BQMA 3KLHA 2VQEF 2MKIA 1NCLA 1QSSA 3J80D 3PO5A 1QSLA 4B3SC 4ETZA 1T9XA 1R31A 2BW7A 2F63A 3D3BJ 1X60A 3DGPA 4OJGA 4YFUA 1K0VA 1P4EC 3KMSA 3KLIB 1Y5LB 1FT8A 2NUHA 4QYZJ 2IY5B 3IMQJ 3CCRS 2MJUA 3CCZA 4ZP9A 4JBCA 1VLYA 2FVQA 3V4IA 4BC7A 2OPSB 3UD5A 2MGZA 1WDDA 3OTOC 4J5OA 4WKYA 3CW9A 2DHHA 5EHHA 5IFMA 5EX3A 3PO4A 4LT6A 2HRUA 1XMQJ 1KLNA 3O6QA 1U1OA 3MUMP 3OPKA 4Q2LA 4O44A 3PIOQ
chains in the Genus database with same CATH topology
3FFIA 2JH3A 3HM9A 1RGVA 2CQ1A 3H5XA 3MMAA 4KGMA 4A8YA 4QW8A 1E6VA 3FSIA 1JNRB 4ZHRB 4IH6A 3I4PA 1O9TA 4DQPA 4AQYF 3MM8B 1S77D 2PMZD 4KSEB 2YWCA 3MM7B 2XLKA 4K4ZA 2HS3A 2WCXA 4ZPDA 4NOZA 3BR8A 4IO1A 1Q82T 1S0OA 3PNIA 5HMZA 2W9BA 2F40A 1SJ4P 4TKTA 2VOOA 4DF4A 3EPGA 4AXIA 1NEEA 4LF6F 1X0FA 2IC3B 1I1GA 1WH9A 2LXFA 4TQRA 3IN5A 1HD0A 5HBMB 1MU2A 3DYAA 4LSLA 2KH9A 4IO9Q 1M5OC 4CNZA 3CULA 1GPMA 1LQLA 2FTRA 3N0VA 5KT7A 2AGQA 1BWEA 1YJTA 4OYCA 4XDDA 1TKXA 1YJ9S 1K73T 4B9LA 4X4PA 5KFMA 2VFTA 1HBMB 3OHAA 3M9NB 4ED0A 3NI2A 2BQRA 1CG2A 2N7YA 4DEZA 3MMJA 5KT6A 1J5EC 1CQNA 2XWXA 3TR5A 3JB9k 3OSPA 1FJEB 4ISBA 3V2UC 3UR0A 5CQGA 5HO4A 1T7PA 3ZZUA 4ILLA 4NPOA 2DGWA 2LYVA 1CPZA 2ATWA 2J9EA 1HMVB 1HL6A 4A8FA 1I94F 1NJZA 4N5SA 2WHOA 5FDLA 2J0XA 2IA0A 4FNHA 1MNEA 1HWLA 4DR6C 1RT3B 1S1XB 2C3UA 4BC9A 3C6UB 3H98A 4PQUA 3N28A 1NK8A 2BBEA 3M8QA 2IRYA 4JI0F 1JX4A 2FJAB 4LQ3A 2V4QA 5KFIA 2OD4A 2AD9A 1U1PA 3CCSS 5LMNC 2LQ5A 3N5BA 3FNNA 1T03A 4X2BA 5CXTA 1U2FA 3MWBA 1FNMA 2JEJA 1IKWA 4TU8A 2IVFB 3AQPA 4C3KA 3DLEB 1T05B 2ZJRQ 1FESA 1C0UA 2HGMA 3NGKA 2PT0A 4ZVHA 4F8RA 1Y4ZB 2LA6A 4MJKA 2FJEB 2W24A 4CT8A 4OJ3A 1XEZA 1S6PA 2HQ3A 4DL2A 2DR7A 5E3QA 2KN4A 3CDUA 4J9SA 2R8IA 2YWEA 4DMZA 5KG4A 1KHVA 3SMZA 3Q8RB 3BZQA 1RT4A 1B7FA 4HL9A 1RKIA 5BURA 2J9DA 2LXIA 4O23A 1C0UB 1U26A 5IT0A 4Y2AA 5KFKA 2FLPA 3ZZ0A 3IFEA 1PILA 3MR6A 4Q0BA 3Q0AA 5F8IA 1VC5A 4KFBA 2VQFC 4KHPF 2JLEA 3TANA 4O3PA 4NZ6A 4JUZA 5KFXA 4EYHB 3C8YA 3G6XA 1FXRA 4UUXA 1HARA 4HT5A 3NS6A 4I4BA 2DGSA 4DSEA 3W2VB 4ED5A 4G6VB 1C1CA 2GX8A 1RP5A 4I1TA 1Q7YT 4M8LA 4C8MA 4D4GA 3KK1A 4DR4C 1JLQB 2P2JA 1SJRA 2ILZA 4R5PB 2RSQA 1DJ0A 2R4FA 1N36C 4ECWA 1N48A 4CH0S 4RNOA 4XAKA 4DL0C 5IS2A 5I3PA 2FIUA 4RWXA 1KTVA 4O0IA 1YGYA 2P5VA 2ZZNA 5T41A 4Y3CA 2XR1A 1X4GA 1NU4A 2DD8S 2GFFA 5K8MA 1ZM9A 4Y2KA 1VBYA 2W8KA 2KKHA 1U24A 1JB0C 3MURP 2HNDB 1VBZA 2M88A 1WHYA 1UJ4A 4OJHA 2WSCC 3CVKA 3RRHA 2XB2D 2F8MA 4HDGA 2IRUA 3M05A 3SDEA 1N5VA 3FEXB 4ECUA 1Q16B 2VH7A 4KFBB 1GT8A 1VQKS 2LQJA 3T9ZA 2CYYA 4DR7F 4HLBA 2JZ5A 5JRHA 4ZCLA 3DMJA 1QWIA 2M4MA 2ZKTA 4KRWA 1KONA 4KHMA 4WFAQ 5DV9A 1KN6A 1SH2A 5C25B 3DRSA 3KLFA 1U1NA 3LAKA 2FGCA 2CQ0A 2BM1A 3IBWA 5C42A 3K0JA 5LXYA 4DR3F 3U1NA 2OMLA 3K5NA 4IQMA 1LK7A 5GAHU 2HLTA 1N4LA 4JV2A 2YWFA 5C24A 3D5MA 2L3MA 2BR0A 5B0BA 2DGUA 1FRIA 2OO4A 2RNEA 2ZH8A 4HYKA 4YHHF 1KQSR 4FZVA 1FJGC 1UJ6A 2XMVA 1LXNA 5IWAC 5CYMB 1VRTB 1U1MA 2HVHA 2W9AA 3KK3A 1O51A 3SV3A 2MPUA 3Q24A 4RW8B 4CIOA 3M8SA 1JXEA 1YRUA 5C24B 1NJIT 3I4HX 3VALA 1ZAXA 2DNZA 3I0SB 1S9GB 1S1UB 3CD7A 4FBTA 1G7CB 2JOQA 2D7SA 2E5HA 3OTDA 2RJZA 3PX4A 1S1TA 1DBDA 4KPYA 1V3ZA 3W2VA 2P2FA 2E5IA 2P2MA 3PIPQ 4ZPCA 3FDSA 4RUHA 4QWCA 1FXLA 3C5EA 4QIGA 2YH1A 2AJ4A 2QIFA 3M2VA 4QR1A 1Y3JA 3H2TA 4UUWA 2DT9A 4RNFA 2XI3A 3M9MB 2HS4A 3GKUA 1WEYA 4WTYA 2EFOA 1YJRA 3UNGC 4DV4F 4DSIA 1NH7A 2P9GA 4I67A 5FLXD 3OR2B 3DRRB 2GQQA 1F9FA 4J9KA 2RB7A 3NMAA 1FKPA 3T6BA 3LH2S 1D8ZA 1JLQA 3DXSX 2HHSA 5KOXA 1P27B 1EETA 4IQXA 4WE1A 1Q7LB 3OUYB 1H2UX 3KG1A 3UPFA 4K0KC 4NCBA 2XWYA 2R7VA 2P2BA 1XWLA 3CDWA 1V3RA 3AAWB 4AFFA 3MCSA 2HHTA 4TYAA 1T03B 3KJVA 1HWIA 2ZKUA 2K3IA 2ZOFA 4FF2A 4PWUA 3U27A 1UVLA 4D3HA 2MQPA 3BM7A 2DR9A 2QYCA 4NX9A 3CIMA 1R7IA 2UUTA 1DTTB 2XBPA 4KR0B 1FA0A 1HNIA 1S72S 3HVAA 3MTKA 4NDNA 2CPFA 1HQUB 2AF6A 4OI3A 4A48A 5B09A 5K8NA 2GA7A 5KT3A 5LSLA 1BQNA 3EZUA 4X64F 2VPXB 4C8NA 5DM7Q 1QVFR 4O44B 5AE1A 4RU2A 2N4DA 3BSAA 4LMZA 4WS9A 3VAJA 4ECTA 2ZH2A 5C25A 5DS7A 1JWWA 2ZC3A 2DNKA 4HH0A 2PDAA 1FVQA 4YB1P 2KZZA 4JI3C 4RVOA 4B17A 2IJFA 4Y00A 3CF5Q 4DL5A 4DL3A 1ZTTA 3IG1A 4RW4A 4C11A 3S7RA 3NWGA 2B9WA 5A2QD 2HFZA 3MEGA 3CC7S 1CQMA 1RT1B 4B3TC 4KKOB 4DCSA 2UUBC 2OMOA 4WXOA 2FB0A 2J9CA 2QFJA 1D9DA 3OSNA 2P9CA 3BO2A 1ZZFA 2RF2A 2W8LA 3DLPX 1FF2A 4PRFA 1K0TA 4DV3F 3GG1A 3J7YI 1RG9A 1F5AA 3NYRA 1TL3A 1RKJA 1RYSA 2DYJA 3MUTP 5I42B 1D0EA 3RW6A 3ETCA 4OI0A 2VFUA 1KTQA 2FJBB 4MIAA 3LP1A 4KO0A 5B7WA 1RT3A 1S1XA 5EDWA 2PA8D 1DLOA 2B9YA 4JYAF 5LSOA 2XG8A 4IKAA 1RT2A 4ZMMA 5GADU 5GAEU 2MXYA 1T8EA 1FKPB 3HZEA 1N5TA 5CYQB 5B08A 4RUCA 5DG7A 1MMNA 1FKAF 3RR7A 1G2EA 4HPVA 1JOSA 1X8DA 2MQNA 5K85A 5CZXA 4PXDA 3OFHA 5H9EJ 3G71S 3IGNA 3RG2A 1RTIB 4O4RA 2MZ1A 3TUZC 3P49B 3B78A 4DV6F 5LT5A 3TUFA 3I6PA 2Y1JA 4EWTA 1N32C 3SZ2A 3HK2A 4WJBA 3LP0A 2E5JA 5B0CA 2HW3A 4PWDA 5HP1A 3RAXA 1S9EB 5KFUA 3EXYA 2J6SA 4GO5X 4LF9C 4HTIA 4HHJA 3IGVA 1VQSA 2FHJA 2CJKA 2GJ2A 1REVB 2GIRA 1NK9A 1O8BA 4CH1A 2MZQA 2UZAA 4NXNF 5KFAA 4ZOSA 2UV8A 1KQGB 2J0QD 3TYTA 2E1CA 2P20A 1JLAA 4YY3F 3EPIA 4MK9A 4B9TA 1MMLA 2BJOA 5A1GA 2D1TA 1Q8IA 1M1KT 5BSMA 1YITS 3L95X 2DH9A 5ADZA 4G36A 4R8UA 1MWZA 3TQIA 4NLTA 2CG4A 2XMTA 1TAUA 3LNVA 2B7BB 2DHXA 1YRXA 5KFVA 4F25A 2E8FA 2ZH6A 2XSJA 1X9SA 1M5HA 3EQ6A 3H4BA 4DV7C 2MY8A 4F3QA 1YWXA 2CKWA 3MMCB 5DDOC 5DQHA 1M90T 3LO3A 2MZSA 2HYIB 1LFWA 3SFGA 4ALZA 4K59A 2QE5A 4WFBQ 1F5BA 2BJDA 2GHVC 3HVRA 1FD2A 1FRLA 4NLSA 1TK5A 3NAIA 1VQNS 1MDBA 4IFVB 4EO6A 3X3UA 1NZAA 3GIIA 3GZ7A 2X1BA 2FHMA 2LMIA 2EI5A 3VR1A 2AWZA 3LGXA 2BE2B 4LIWA 3JSMB 3N01A 3OBIA 1NJWA 2PEHA 4IR9A 2Q79A 3B8HA 4PG4A 1MMDA 2FLNA 1HNXC 2FJDB 1KSPA 3NNCA 1TKZA 2V8DA 2OKQA 3O3LA 5EWGA 5L9XA 4R1LA 1W25A 4DSJA 4UQTA 3CJ5A 2L48A 2V8HA 2C3PA 5BUSA 1JLEB 4DSKA 1NRKA 5D78A 3E2EA 4OFZA 4UY85 3SO4A 2CPEA 2R7XA 2JVOA 2GMLA 1YTYA 2K1RB 5J1EA 3CCQS 1KEKA 4Q43A 1VHFA 3RRKA 3LP2B 5KFNA 4YOEA 2XS2A 1SUQA 2I5JA 4ECVA 3T1YC 4IRKA 3Q8SB 3CJ3A 4NLRA 2B7CB 3UFCX 3TNVA 2R2SA 3UOWA 3HDSA 2YKNB 3BS9A 4URSA 4JV0A 1J5OB 3LF0A 3FRZA 4ES3A 2W25A 4OI1A 5F3ZA 4OZ1A 3SSQA 3MF5A 1UKKA 3I9ZA 1JIHA 2O3DA 3NL0A 3PW7A 3SV4A 3CCLS 4DCVA 2JEGA 1JMTA 4QJVA 1Q8BA 2RS2A 1VMBA 4IG0A 4ID5A 4RW9A 4L72B 3C46A 2Z2MA 2ZVSA 3LGMA 3QYYA 4ZCKA 4B3RC 1XR6A 4Q0BB 3IWLA 2B0GA 1MROA 6FD1A 5J2NB 1V3SA 4YR2A 1CC7A 1P7LA 3R5AA 4NCGA 2OH2A 4NLYA 3PV8A 3KOAA 4RM2A 3M6UA 3JTPA 4XPEA 2UXCF 2D3UA 3B4DA 3GYNA 3FCHA 2HWTA 2DCUB 2ZBIA 2M2BA 1FCAA 3QGHA 5J2MA 5BYRA 2IMWP 2NR0A 2V0NA 5L38A 1HBUB 3ENWA 2IFXA 1YG0A 2PSZA 1M5KC 5F8GA 2XI2A 4F4WA 3IR7B 1F2GA 2WAQD 1EP4B 3EGWB 3ENQA 5C5JA 4A8MP 3MM7A 5BSUA 3VF0B 2G9OA 2Q1LA 3HKZD 4ED8A 2CJAA 3A1YG 4DQQA 3TQ1A 2DB1A 4OHYA 2HNYA 4OZNA 2SXLA 3KHHA 3FQLA 4U7UK 2XEXA 3NBPA 1BQXA 1WF1A 3U7JA 1RT6A 2MSTA 2WB1