4ZLPA

Crystal structure of notch3 negative regulatory region
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
253
structure length
241
Chain Sequence
PRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into Autoregulation of Notch3 from Structural and Functional Studies of Its Negative Regulatory Region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Neurogenic locus notch homolog protein 3
total genus 62
structure length 241
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zlpA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4zlpA01
4ZLPA 5CZXA 3ETOA 2OO4A 5CZVA 3L95X
chains in the Genus database with same CATH superfamily
4AQYC 1PJ6A 4KGKA 3D1QA 3EVMA 3R8YA 1DTQB 1TL7B 1CULA 1NDKA 3C6UA 2ZD1B 2KB2A 3AD8C 5I3PA 4RU2A 1VQKS 2KTQA 1R8CA 3DCAA 2NUHA 2FHJD 4CRJA 1KQGB 3LAMA 1FVSA 3CJ3A 2IAJA 2Z2YB 1X4EA 2OTJS 2E0GA 5KOWA 2GVZB 4QR2A 4MKVA 4DR3F 2AEMA 2QV6A 4W4MA 1JLEA 4ZVOB 3FSIA 3NMRA 4MTNA 1JXVA 2EEYA 2CNKB 3OBIA 1YI2S 1Y11A 2CQGA 2HIYA 4I7FB 1S1TB 2PFDA 4C8LA 4DFPA 1DHMA 4DF4A 2NQPA 2LU2A 1UFLA 4YUDA 1UJ6A 3MEEB 4DV3F 1KS2A 4P73A 3LA0A 1RTIA 1AUSL 2ILYA 2DYJA 1OO0B 2DNHA 2KM8B 4ED6A 2BQ3A 4CYUB 3F73A 1HWKA 4GVBB 3EM1A 4J90A 4PG5A 2AGOA 2UXCJ 1UWAA 3WX4A 3VWSA 1JLAA 2PEBA 1WKJA 2RDDA 4WFZA 1XC9A 4LF7F 4DR7J 2JEIA 2PROA 2VKZG 4JBCA 4N5SA 2RSQA 2IPOB 2OFHX 3SV4A 4OHVA 3RG6A 1L3KA 2EBEA 2HQIA 3NS5A 5L39A 2GA7A 4NA3A 2MJUA 4FF4A 3MR3A 5DQIA 2XG8A 1MU2B 1MMLA 3HD1A 4C3KA 4ZLPA 2VHGA 2IRUA 3C14A 3A9VA 1IR1A 3UW1A 2KH9A 4DV3J 1U48A 4N8OA 4LF8C 2OGUA 2IYGA 2IDEA 2B4VA 2R8KA 1GX5A 5C2CA 1RAHB 3OL7A 3RB0A 3CDBA 4HYKA 1VQ6S 3VAIA 1XNRJ 2OSQA 3MMCB 1TKXB 4DFKA 4GMKA 2IHR1 2BUNA 2R7RA 2HBRB 1FESA 1SJQA 1MROA 4ZLLA 4U8YA 3U27A 2DR7A 3PYEA 4B3SC 2KYXA 4Y2AA 2DK2A 3D0GE 2F7VA 2VBWA 4WE1A 4QYRA 1WI8A 2DO4A 4KQZA 5JVHQ 2QC3A 4DPOA 3UD3P 4KTTA 1QTNB 3DOLB 4Z2XA 3JB9k 4IZ6A 4E2FB 2BDPA 3TOQA 4DV1F 4DR1J 1FJGJ 4EO6A 1X5PA 2CPXA 5HK4A 2R3VA 4RW9A 3EPGA 2D28C 1QM9A 3IM9A 4JP8A 2ZVSA 1O51A 5D15A 3TA1A 1H2UX 3KLEA 2A18A 4BS2A 1OIAA 3PKMA 3MEGB 2RMLA 1KQFB 3KK3A 4BC9A 1F3VA 2RQMA 5D4PA 4JYAJ 1TH5A 4OYXA 3DLPX 3E7XA 1VQLS 2YVSA 4P2XA 1WTFA 2V69A 4IH7A 1M0SA 4ANEA 4DPYA 2MLYA 1VQ8S 4W98A 5IQ6A 4AQYF 3QT6A 4OYAA 2ZKTA 1QE1B 2NUUG 4F0MA 4DV4J 4EYIB 3S8SA 4Q0BB 1NRKA 4P7VA 3FCHA 1YZ7A 4Y2MA 3IS9B 3NBPA 5IQQA 5B7WA 2VQEJ 2DNZA 3HJVA 3T1YF 3K0JA 2D41A 2KZMA 4DV1J 1I51B 5ETRA 2HSEB 1H74A 3UCZP 2XLKA 2MTLA 4DS5A 2PN2A 1SI9A 4X62F 2AW0A 1IKWA 1VK8A 3VGVA 3PIPQ 1TKZA 2FHJA 2LKZA 3AY0A 1FDNA 1HQUA 1Z4UA 4DDFA 5DQGA 2CXEA 5IWAF 3NP5A 4QPXA 1CJTA 4PRFA 3FCWA 1VLAA 1VC5A 3MZIA 3ULHA 2V7BA 2EGTA 3K59A 2ZOGA 4WFAQ 2YCBA 4DR3C 3K89A 3M9OB 4MH4A 2ZH4A 4KH1B 3MCOA 2F63A 3OFHA 2G1DA 2OD6A 9RUBA 3BSNA 4A8MP 4P2SA 1HH2P 3CW8X 1EETA 3TUIC 1R8BA 5ADZA 1DZ5A 1HWUA 2XWXA 3UI3A 1N4LA 2XSJA 1ICEB 1R31A 3PXGa 4C11B 5J1EB 2MY7A 5LSLA 3M6XA 2XCPA 1TK0A 4LR8A 1U1OA 3S01A 3VGSA 2VSQA 3UX3A 4YB5A 1F0XA 3UX2A 1A6LA 1Q95G 2CKWA 3P4UB 4DV5C 3H2VE 5E3CA 4ZVUB 2FJAB 1YZ6A 3PHTA 4B02A 3M32A 3MAAB 3TZZA 1YQHA 4LRDA 2GZOA 3N79A 4FF3A 1CQNA 4N77A 4DJBA 3NS6A 4WK1A 4JI3J 3AXMA 5H9FJ 1VQNS 2IMOA 2VZEA 1S99A 2AWZA 1RHUB 1HI1A 3EGWB 4MKAA 5F8LA 4DR5F 1AFJA 5BUSA 2ZWPA 4IRDA 2OMOA 3VAFA 4DR6C 3ZC4A 1S59A 4ITSA 4A8SA 4AL5A 2CNLB 3M1VA 3QSIA 4K5RA 3HVTA 3I5BA 1SC4B 4J9LA 4OXIA 4M5KA 3EICA 3PCOB 5KG7A 3H4BA 3HHLD 1D9FA 2OI2A 5SUHA 4HHUA 5BR8C 5IT9D 3G8QA 3BSOA 2AQ4A 4Q0BA 4K4YA 1U2FA 4ZP8A 3N6MA 4R5PA 2MKJA 2Z2LA 3BKFA 2NXJA 3K17A 1NBEB 3LO3A 1TKDA 1KRPA 2HYIB 3FK4A 2CFXA 2EFQA 4P6QA 2W2NP 4WP8A 3MD1A 2HHPA 3IC1A 4G1PA 4ZMMA 4PXEA 1N5YA 1TR0A 2W4PA 4WFYA 3R9WA 1MMDA 1CSJA 2DO0A 4FVMA 5FLXY 2F4VF 1U4BA 2KFNA 4XPEA 2WHOA 4CM0A 4I64A 2UXDJ 2N82B 4F4XA 1EP4A 1S9GB 1WC0A 2WAQD 3MCSA 1YIJS 1VRUB 3DOKB 4DCVA 4HEA9 3B78A 3KHLA 1IBLF 3OTEA 1Y00A 1IBCB 2Z57B 2RAQA 2NZ4A 2I9SA 2XHWA 1VS3A 3CJRA 3CJ0A 2QLWA 2P2JA 3U1NA 3HXMA 1YITS 2HS0A 2UUBC 5CYJA 1VHIA 1NH8A 3PYDA 1RSCA 4RZRA 1K44A 1GTEA 2Y1JA 1N36F 8RUCA 1RZMA 3CULA 4ZVFA 3GE9A 3RAXA 3TR3A 2FDNA 4RL1A 5KFYA 4TN2A 2O67A 2HG4A 3NWGA 5KFJA 2ATLA 4PZPA 4JV5C 5KFXA 1WKLA 1SKUB 3WQPA 1M1GA 3L09A 5DZ6A 2IVYA 3NLCA 3OFFA 2XEXA 3BBCA 3IR7B 3VAMA 2XBPA 2IM3A 3GCWP 2CZVC 2LMIA 3M6VA 4NL5A 4TLQA 5A8WB 4BBYA 1MWZA 3IFEA 4IG3A 1PYTA 1VQPS 1V3ZA 2EK6A 2WSEC 2XC9A 4BDPA 2FHOB 1WC1A 3J81Y 1NHKL 4I69A 3JTPA 3KWMA 3THVA 1K1QA 2V68A 4PG8A 2VJVA 2O01C 5CH7B 4WTOB 4DU7A 2B9WA 1ZZNA 3DHVA 1S6QB 5GADU 1P9QC 2CPHA 3JSBA 2DT9A 3Q8SB 1RT3A 1YGYA 3KLHB 1RKIA 3FGVA 3KK3B 1W25A 2ZH5A 2VJUA 3UEBA 5A8KB 5CQGA 2UVWA 3I9V9 3R97A 2O1PA 4WK3A 3H5YA 5J2PA 3L8CA 3KXWA 3AF6A 1RY2A 3KG0A 1Y7PA 2JZ5A 5CZVA 4HLBA 4DLEA 1JLCA 2RKIB 3JTNA 4JV2A 3ILJA 3SQOP 2ALYB 1UVNA 1ZM3A 2P5VA 4KIAA 4ZHRB 1FJGF 4OV1A 5LOQA 3AH6A 4MYUA 4BHQA 3MM9B 2BANB 1FTCA 2E8CA 2DNPA 5CABA 4LFCC 3GB0A 4B3TJ 4ED0A 5AJ3F 3WZ0A 1ZB8A 3OSPA 1BGXT 1HR0F 5AE1A 3KJNB 1EX8A 3NGRA 5KT4A 1SKWA 3NAHA 5T8TA 5EX3A 2DJWA 5H9EK 3KLFA 1M5PC 1WEZA 3TZYA 4X4SA 4OHYA 1R27B 4P75A 4DX5A 2H5EA 4LR7A 1VBKA 1LW0B 3MMAB 4NX9A 4DOZA 2IJRA 5F0UA 2MQNA 3EZ5A 2U1AA 3HFZB 5L1JA 1VQMS 1ROFA 3IGVA 2XB2D 1UZDA 2V50A 2X1BA 2DYAA 4C8NA 1EETB 3UOWA 3CDUA 2ZE2A 1GFWB 3SSQA 3VV2B 1S6PA 3I5AA 3HDSA 1LWFA 2K3KA 2WSCC 2WSFC 3GYXB 2MZRA 4OZJA 2D9OA 2UU9C 3UWTA 1Q8LA 1J2VA 5D0RA 5E5NA 1Q16B 3SV3A 4MIBA 4ANDA 4O44A 3S6EA 1XNQC 5E3AA 4P2FA 3KJQB 2D69A 3ITHB 3M8WA 1NSKL 5KFUA 3TNVA 3VR1A 1KDNA 4YY3F 5KFCA 3T6BA 3LWLA 1YJTA 3SCLE 4MK8A 1TUGB 4ELTA 5KFMA 3Q8YA 3EDRB 4ED2A 4DUYC 4F25A 2F4FA 2OPQB 5HLFB 1FWKA 1XJWB 3D5MA 5D3GB 3RR8A 4JI0J 2NYIA 4KJIA 2LCWA 2P20A 4WP9A 4L2ZA 4X64C 1RTJB 2QZ8A 1PC5A 5BYQA 5J2MB 1VLYA 3OTCA 4JI1F 1T9UA 2V2ZA 4LF1A 1SH0A 2QA2A 5J2PB 4ECRA 4O4RA 3AA9A 3MR5A 4FXDA 1RHMB 2E7XA 2GIFA 2XMUA 3DGPB 5KFKA 2ZHBA 1HW9A 2NPIA 4LSLA 2YNGA 1BD6A 3D28A 3OXLA 3G7SA 5A1IA 4DSIA 1CJVA 2EC0A 2BJ1A 4I2PA 1RA7A 5IV3A 3QIDA 3T9ZA 1RU1A 1U6FA 1NK5A 4OIXA 3S1TA 3RRHA 3N2QA 4CNYA 1ZYQA 1JOSA 5K8MA 2YKNB 4OFZA 2AJ2A 4DV5J 4B3TC 2MZSA 3C6TB 2HZAA 2WBMA 3MUTP 1TVRB 3CW2C 5BUQA 4AUKA 3GJSB 3IO1A 3NY0A 4R25A 5B08A 4K4ZA 4JB8B 4FZVA 5C25A 4TPSB 1ZBTA 3M6UA 2FLPA 2HQFA 5CZXA 1U1LA 2YKAA 2VU5A 1Q53A 3HSJA 1PYOB 3MMBA 3JQJA 1IR2A 1N0UA 5ETNA 2OTLS 4DN9A 3TA2A 3VQTA 3LNOA 4R0MA 4TQRA 4X62C 2MKHA 2QFIA 1NZ8A 3DLEA 3MPWA 4KFBB 4ZPVR 3Q8QB 4DR3J 3EGZA 4EO8A 1V3RA 4JV1A 4YP3A 1TMMA 4JUZA 1HNWJ 3HK2A 3DM2A 1NJYA 4NCGA 4O4GA 2UXCF 2DH7A 2NXNA 2OEMA 3G96A 4FBUA 5A2QY 2JEFA 1TK5A 4LFCF 1UMJA 3JTOA 3KG1A 2JOQA 3QRRA 1CJUB 4CLSA 1H2VZ 2J8SA 4ZJQA 1KEKA 2YWFA 4O3OA 5KG2A 1DFDA 2ZC3A 2ATWA 4KHPC 4B3MF 4TVAB 2F40A 2QVYX 1IBMF 2VQFJ 3WBZA 3QLHB 3Q23A 5HLFA 1APSA 3SIPB 2QMXA 2HNDB 3P96A 4ZPBA 3U7JA 4PG6A 5T8SA 3KLVA 3MAQA 4F4YA 3RB6A 2P9CA 4F67A 3SDEA 1X4HA 1NKBA 1GQEA 1GNKA 3M6WA 1YJNS 4TNOA 2R7XA 2BACA 4RBVA 1AYEA 1OJ4A 1PC4A 4OJHA 3UCUP 4LSLB 2ZITA 4KO0B 1R43A 3BQ1A 3GCXP 5J2NA 2QLBB 1N54B 1ZS6A 3CEDA 4O3NA 1ZM9A 2Z56B 2ATCB 2DGUA 3C15A 4NWBA 3K6RA 1T5HX 4DR1C 2ACMA 2X1FA 2C2MB 3MEDA 5EHHA 2HGNA 2IFXA 4U8VA 3DLLQ 1F2HA 3TJ8A 4KPYA 2BOPA 2LLZA 2M70A 3FVYA 3J7ZT 4JI8J 1HNVA 1NSAA 1RT7B 1M5KC 5GTDA 3P3DA 1UVJA 5KFHA 2J0XA 5E3QA 5D78A 5C2GA 5G0RB 1VQ4S 2XYPB 4ED7A 4NZ0A 2BJOA 1VJQA 4CH7A 3CF5Q 2D1TA 2FZKB 5JVGQ 1FKOB 3IM8A 1T05B 2MJNA 3PW4A 5F3TA 4Q2LA 5LMUF 5BR8J 1VI7A 3MUMP 4OHWA 3VVUA 1WC4A 2DNYA 1PSDA 3NCQA 1U26A 3GIMA 1RYSA 2R8JA 1JLGA 4K4WA 2XMVA 1L3UA 1IWAA 1B7YB 2LP4A 4DR6J 3C14B 3AQPA 4I2QA 2VQEF 2YPZA 4RBUA 4BWMA 5J1PA 3H4DA 5JXSA 4PUIA 2FTRA 2K06A 2F4VC 2Q6BA 1FJEB 1X4GA 4IG0B 4FYXB 4IRCA 1S6OA 5M2RA 3OTOF 4C8YA 1XRBA 4DV2C 1NK6A 3VCDA 1RI7A 1RWNB 2ZBIA 4OZ5A 4DR7C 3HM9A 3N4WA 2VFRA 4PPZA 2K1RA 3HSDA 2BE2B 3BH6B 5ITHA 1ULRA 3RYLA 2F1FA 2KG1A 2M8DB 4OI6A 1NDLA 3BPSP 3QPIA 2GVDB 3UDCA 4F2RA 1T03B 3DLKA 2AIRB 5IV4A 3QJLA 4LF4F 2WVFA 2V63A 5AT1B 3L9ZA 3B4DA 1RTZA 2C3UA 4GC7A 3SQGB 2YBVA 3ZZ0A 2H65B 4X4RA 3RTVA 1N36C 3I0SA 3OXFA 4RNOA 5KG1A 4XTTA 5GAGU 1S1WB 3MWBA 1Q82T 1SV5B 5IM0A 4MH8A 4CZCA 4F26A 3VNSA 3MR7A 3J7YI 3EX7B 1ZPWX 2GIQA 5CAAA 9ATCB 2XY5A 2OPLB 3D54A 2GV1A 4CDIA 4X66J 5KG3A 3RRKA 4CLZA 4F3MA 1EJ7L 5LSOA 2MEWA 1U0HB 3QAEA 4NRTA 4PG4A 4ISBA 2XZDB 3J80Y 3PR4A 2DCUB 4JI0F 3MURP 1AZSA 1XK8A 4ZJLA 1FT8A 2DRBA 2CQ2A 1USPA 4Q8EA 1JJCB 2YWCA 3PY8A 3T1YC 3MR6A 1KSPA 1NSQA 4ZP7A 2J9EA 3PZPA 1JKHA 3IGNA 2VASA 3F0NA 3W9IA 1YBTA 3M2VB 2XMKA 4KHRA 2HHHC 2QL9B 2DXFA 1S4EA 2NSBA 3ETCA 3ZNJ1 1JLBA 4FXWA 3MR2A 4M8LA 3K5NA 4YY3J 1SXLA 3KUEA 1GH8A 1N5SA 3BQ0A 2MYFA 3ZTSA 1KVIA 5LMNJ 3N6LA 4FNHA 1BUXA 2KHCA 4TYBA 2I0XA 2V8VA 2K8GA 2MZ1A 3PR5B 2F4VJ 2VKRA 2HHSA 3CMQA 3Q24A 3ISND 4PWDA 3K5OA 2GMLA 4I56A 1T02A 4DV0F 5J1EA 2CXCA 3DYAB 1HD0A 2XLIA 3FBCA 2YH1A 1RWMB 4HVZA 2RRAA 5F8MA 1JXLA 2Z2MA 1K1SA 2EFNA 4IFYB 3E01A 4GRSA 4RW7A 3HHKA 3OHBA 1RAFB 2LXIA 4DV6J 3H40A 1QAJA 3FSYA 1H6KX 2UXDF 1PU1A 1FRIA 4A8WA 2IY5B 1NEEA 3I0SB 3UPFA 1OPIA 1Y5LB 4KC5A 2CYYA 3DFEA 3HVAA 2PMZD 3KJFB 4IQXA 4OYBA 5IM0B 3V6KA 2HNZB 2DEJA 3PEJA 2ZKUA 1FDDA 1WNEA 4OI3A 2Z51A 3L3CA 3K58A 3KJVB 1SVDA 4F4KA 3C15B 2UVRA 3EGVA 2HBQB 3DC2A 2BRKA 2DIVA 1IR0A 3LGNA 3MEDB 3HZEA 4DEZA 3M8RA 2DXDA 1R0AA 1KVJA 3AF5A 2LQBA 4F3OA 2VA3A 2JL9A 4C0BA 2DCLA 2KZZA 2HFNA 2VQFF 2HBYB 4TY8A 5E0OA 1N5YB 1IUJA 5CD4H 5DGAA 3J7A1 1YRUA 1Y3KA 2HQ3A 5CCLA 1TL3A 4EZ9A 5BSVA 1T7PA 2QTWA 3QGGA 4L76A 3LPEA 3LQVA 4N7TA 3G9CA 1PIEA 2AHOB 3DRXA 4B3OB 3OJUA 1UFWA 1U8SA 2GNKA 3ONQA 2AGQA 4ZPAA 1LOUA 1AFIA 5B0DA 3GJTB 2B4OA 2CPJA 2QA4S 4RM3A 1VCTA 4P9SA 3KHHA 1N56A 4DSLA 3D6HB 4OX9J 4C4WA 1OY6A 1HARA 2JFDA 4WFNQ 4CLLA 4ZN1A 2FJXA 5EGYA 1UEUA 2D74B 3R7SB 4DHVA 3CCTA 5KAKA 5DG9A 4ZVTB 5J2MA 1NKCA 1YRTA 2JVOA 4QWAA 1KQSR 4DSJA 4DR2F 1RTHA 4Y2IA 1R6VA 5IS2A 1MWQA 4K5SA 4JI4F 1XMOC 2FVQA 4NCAA 4OYZA 4AQYJ 4GVBA 2JHEA 4CLKA 1N34J 1XR7A 4MFBB 1T94A 1WI6A 3QFHA 2BVZA 3ET6B 4XDCA 1XMQF 2AYGA 2ZDPA 5KFWA 1FCAA 1WHWA 3DLJA 4BC7A 3PO4A 3OV7A 4HPVA 1VC6A 1E6YB 4A8OA 1WWHA 5HJXA 3I5CA 1KLNA 4DS4A 1EQ0A 1N6QB 1WOPA 1OSDA 1C1CA 2ZUAA 5B0AA 4M5DB 1Y3JA 3CJSA 3QT8A 1WTBA 3HKZD 3SCJE 2B4PA 3AA8A 3G8SA 1RE1B 3EJMA 4HHJA 2BE7D 2UZAA 1H73A 4YFUA 3ETOA 5KT3A 1W2IA 1RTIB 1ACMB 4ZCMA 3ZTOA 1OSCA 3GSDA 3GIIA 1RT5A 3KLIB 1JLCB 2RKIA 2NXCA 4DUZC 2KJWA 4DV0C 4ZHRA 4NLUA 5EWGA 3W9HA 4ES3A 4DUZJ 1USPB 2P2BA 1S5ZA 2V4JB 2VZ9A 2E7WA 4DR1F 2CPEA 2Y1IA 1JIHA 1GK8A 4ZPDA 1NH7A 4C97A 4DPTA 5MAOA 2WTFA 4GO7X 2H51B 2ZBCA 1Y4ZB 3W60A 1EIYB 2WOMB 2H54B 3ZZOA 1ZA1B 4RNHA 1FRHA 1RAAB 2AF6A 3FQKA 2DBBA 3CJ4A 4H54A 3K5MA 4LE5A 2J8AA 4O0NA 2RF2A 4P7TA 5EUHA 5KFAA 2B51A 2R7QA 5IC6B 4ZCLA 3VF0B 5IFMA 1X4AA 1PAUB 4EBEA 2FD2A 1LCIA 4O23A 2H4YB 4ZVQB 3G82A 4QQBA 3F56A 1SCJB 3FQLA 1TKXA 3TX0A 2W4DA 3GJRB 4M63A 4GKKF 1UKKA 4A8KA 2J76E 3T1YJ 2NXUA 2P2MA 5F8HA 2DTJA 1QY7A 1U2RA 2KRBA 2X1GA 2WVCA 5CYMB 1DTTA 3G86A 3WC0A 4FYDA 4ZCIA 2FZCB 3JSYA 1P6TA 1RADB 2WCXA 1HD1A 3WHIA 1X60A 1HIYA 1Q5VA 3MTJA 1VK3A 3VNQA 1W7WA 1L3SA 4A48A 2M0GB 4JV5F 2ADBA 4HI1A 2GAGC 4N47A 5K8NA 4ZPTR 2XHCA 4WFXA 1C1CB 1KHVA 1KFSA 1MDFA 4RMNA 4WU2A 3PKYA 2Z8QA 2XO6A 2HNZA 3IA0A 3Q83A 2I1RA 3HMJG 2VQEC 3W1YC 4I68A 1R89A 2A1BA 4Q8FA 3R9XA 3M30B 2B6AB 4F02A 3TO8A 4QU6A 1V9OA 5HAOA 2PMHA 4LF5J 1V60A 2OJ3A 2VPYB 1QE1A 3NOGA 3DGVA 4PQUB 1V25A 1NJWA 2H1YA 4AL6A 1X5SA 4LF9J 1TAUA 1GPMA 1D8YA 4Y2CA 3ZZTA 4TY8B 1C4CA 1GT8A 3KKFA 1S7IA 4DV2J 2FPHX 2IVMA 2LFVA 3LP1B 1RTDB 4HTJA 4JI7J 3IWNC 4LRAA 2IC3A 2W8KA 3EQ6A 1FJGC 3ICLA 4Y65A 3H25A 2QGFB 2MZJA 1RCXB 7FD1A 4DMZA 4IR1A 1OMSA 1KNZA 3JAMD 2FHKA 4FTFA 4XK8C 1NDPA 2IJNA 1TELA 1M5OC 5AE3A 1RT1B 2JNJA 3QIPA 2B0GA 1FFSB 1UP1A 1FRMA 1WC5A 4OHXA 5KG4A 3CCMS 3ZNUA 4J9MA 5A6PA 2ZH9A 3CCSS 1RWOB 3LPYA 1UEKA 3AHPA 3A8JA 3MOZA 5KFEA 4IRKA 3DOMA 3W65A 4HACB 3F41A 2MQ8A 1GMWD 1OYDA 3AB2B 3GR0A 4NA1A 5HATA 5T7LA 2ZM6J 1UL3A 1B4SA 4X65F 1VMBA 3PYFA 3OSNA 1SQGA 1KOHA 2C2DA 4NLWA 2I2YA 3IBWA 1UW4A 4MFBA 2BXJA 3R9LA 3IEVA 2FVCA 1NSPA 2KDOA 1Y0HA 3FFIA 5E3RA 4DZ6A 3OLAA 1HYSB 3PESA 1BWVA 3I07A 3WIUA 2DIUA 1SL1A 2DGOA 1QVGR 2SXLA 1HR0J 3MDFA 5EWEA 3CO0P 2G0CA 3D1HA 4DFMA 4YY3C 2HVDA 3RW6A 2WONA 2BYCA 3K7RA 3M05A 5GAHI 2HW3A 1WELA 5K8PA 3GONA 3BQ2A 1HNXF 4PQUA 4YHHF 4Q45A 4R5PB 5GAGI 4PYDA 2XNQA 2IM2A 3TDEA 4B3RC 2N7CA 4UQTA 2HIQA 4LR9A 1YJRA 2AZ1A 2I8EA 2PN6A 2M5HA 1CC8A 1CULB 4KPCA 2W2PP 2V4JA 5KFTA 2W25A 3TQEA 1UW9A 4MK9A 2XI3A 4YMEA 3W5YA 3G6XA 1XMQJ 3SSSA 2UU9F 3M8SA 4RLFA 5IFIA 4DR4C 5LCIA 3RRGA 1RT7A 1VRUA 2MMYA 3BN4A 4AD6A 5BURA 2MGZA 5A2QU 4ZP9A 3R7NB 2HHTA 1N88A 3NCRA 1RBLA 2FLLA 3NWRA 2Z58B 3BB5A 2Y8YA 5KEIA 3J81U 3DDIA 2WZ1A 3OXGA 1NK7A 3MD3A 2JC1A 3G82B 1UAWA 2A2DA 2XYGB 3CCRS 3DMJA 4NXMF 2RILA 5AXNA 2ZHAA 2HRTA 4DCTA 1X4CA 2HQDA 3FRYA 5CA5A 5GAHU 1IBKJ 1R0CB 3M8QB 5GVQA 3BO3A 1LWCA 2R8IA 2UUCF 5E2QA 2W9BB 3H2LA 2G13A 7FDRA 4K0BA 2FC8A 3THTA 1FF2A 2NCLA 3GFZA 4P72A 2D7VA 1P1TA 5D77A 3PX6A 2I5JB 2DR5A 5K8FA 5J2QB 1RLDA 4BCAA 4M94A 1YJ7A 2HVEA 2L9WA 3EXCX 2Y3YA 3NGKA 4WXWA 5B0CA 3PFEA 3ILIA 1Z2LA 3H2TA 3QRQA 1MDBA 1UPPA 3AAWB 2AD9A 1C4AA 2OFGX 2YWHA 1GTHA 4KY3A 3FMWA 4ZVHA 1F6TA 1DBDA 1OY8A 3LP0A 2JC0A 1XMQC 1J5OB 2F8HA 3J80D 4CTAB 4FXVA 4DN0A 5BJRA 3PEHA 4X4VA 4LFBJ 2GQCA 2KT2A 3G8TA 1IVZA 2W7AA 3M30A 3US5A 2AEFA 1NK4A 3BR9A 4G1QB 3C16A 2ZHOA 4DR2C 4GO5X 3ETMA 2BV3A 5HBMB 1X0FA 1SV5A 4HI2A 1B0VA 2MKYA 4NE9C 4J9QA 4DV4C 3BPDA 3TP2A 1U1QA 1Q7YT 1T9VA 1SUQB 2YNHB 2OPSB 2A6OA 3N5FA 2D27A 4N76A 5E7OB 4UUWA 1U0SA 3W2VB 4KE5A 3OL8A 1VRTA 4Q7AA 4FF2A 4WCEQ 3TW0A 4DR5J 4GKKC 2A10A 1AZSB 2FLNA 1Q1KA 1O9TA 4C2MA 1GMVA 1T3OA 3QWUA 4RW9B 2ZZMA 4HHHA 1RT4B 1JX4A 2DHMA 2QO3A 3KLEB 5FD1A 2JWNA 3BBBA 4L3KA 4CH0S 5D3GA 5F8GA 1NPKA 2ERRA 1IKVA 5HMZA 4UZCA 1QJHA 2KFYA 1RTJA 3LGMA 1VQYA 4WV3A 1HNXC 3A8IA 3IG1A 3P49B 1NJXA 4LT6A 1LWCB 1RHQB 5IT4A 4GXRA 3CJQA 1AXQA 4HT7A 2DB1A 4OX9C 2QX0A 3CCZA 1RLCL 4DZDA 1FEHA 3BREA 3GILA 2YWKA 1VQ7S 2OAUA 4I2PB 4DV5F 4E0DA 1VRQC 4DR4F 4NI2B 3MI7X 3E51A 1REVA 1NAQA 3FBFA 2C2KB 1KQKA 2VFVA 3ZFVA 3V81A 4LFAF 4H4KA 2CJ9A 4EYHB 3H8YA 4M5JA 3EWGA 1LXJA 2MKCA 1HYSA 4F8RA 2ZBPA 3FUYA 4ILRA 2VA2A 3D67A 2FUG9 5D0HA 1S0VA 3CJEA 5M2PA 1N2FA 4ZLNA 1WF0A 2R2TA 3R1LA 1U47A 3R5BA 1X9SA 1SL0A 1L3TA 4DSKA 1KR4A 2F65A 1M90T 3LOUA 2R7UA 2ZJRQ 2E1PA 4UOGA 2WVEA 4X4UA 2QE5A 3MM7A 1UPMB 1FFGB 3MHYA 3UCGA 4MK7A 4CLPA 2PI4A 3J7AN 3KOAA 5F3ZA 4R1MA 4PUOB 4J9NA 2YNGB 2ZZNA 4EBDA 2XSJB 1KLMA 4OI4A 4C11A 3BSAA 1XMOF 3BM7A 1CEZA 2GX8A 4JI4C 4LF9C 3L7OA 2W8LA 4WZMA 3HPOA 3ZTRA 3C6TA 3DLGB 4XAKA 3TEHB 2Q66A 5K5MA 2RIJA 1S49A 3A3NB 3A4IA 3S7RA 5DETA 2D7SA 4Q2MA 4RW8B 1S77D 1G1XA 2HK3A 4QCLA 1JLQA 2HHQA 3OD2A 1PCAA 4L7IA 3BKTA 4I6AA 4WJBA 1BHNA 5HL7Q 3CE8A 2RU9A 4CIOA 3DLEB 4PPDA 4CO1A 4UOFA 3RBEA 2X51A 3LALA 1X8DA 5D0EA 4LF4J 5DRKA 3MOJB 2VPWB 2KRRA 4LBIA 1TP7A 3TUJC 3DM2B 5AE2A 5I3UB 4JI0C 1C0UB 1UCNA 4OL8A 3M8QA 3J81D 1XR5A 2R7WA 3R3TA 4NLVA 5BSWA 3TWZA 1RUSA 2R2RA 3JSMA 2YNIB 1NM2A 4F36A 2ASJA 1AUDA 1RXOB 5EX0A 5B0FA 4NRUA 2UUAF 2MQOA 2AP6A 3PIOQ 1RAOA 5D4NA 2DISA 4EFAC 2E44A 1HNIA 1QSLA 2JFKA 1U7LA 3EUNA 1B99A 4C8ZA 3BGRA 2LDIA 1YLXA 3W63A 2YQ0A 5LJ5Y 3KMSA 2QA4G 4DSFA 2UVVA 4DQIA 1LWEA 1S9EA 1O6XA 1NZAA 2AV5A 3D1OA 4I1TA 4DCUA 2VG6B 4DL7A 4JI2J 3ET6A 1RAGB 3QT5A 3HO1A 2N4DA 4D3HA 3QBCA 3TYTA 2ZH7A 5KFDA 2YWBA 2YQ1A 4CTAA 2HPUA 1CLFA 3UVJB 5HQMA 4DV7F 2FQQB 1DARA 4K2XA 2DGXA 1FK9A 3A4TA 3CD5A 3QO9B 2ROGA 2FVPA 3UR0A 1RAEB 2YKMB 2OEKA 4X4PA 4IOBA 2PC6A 2R2UA 4K4VA 3I08A 1U02A 2H3EB 2YNHA 4F04B 2GAHC 2EG2A 4M5IA 2XY6A 4K0KF 3QYYA 2WB4A 4P10A 2VBZA 2CJKA 2L41A 3D6FB 1MMNA 3CSKA 4B17A 4U67Q 3TAPA 2HNYB 3UE2A 2P6SA 4LRBA 4QU7A 5BSMA 2WB1D 3K5PA 1TL1A 4U7CA 1U1KA 4JI3F 2CU6A 5F9LA 3NAIA 2DGVA 4CLUA 1JQGA 2ZVIA 1IJFB 3EE3A 3NGDA 3AB4B 1FRXA 5CXTA 1XWLA 3TVZA 4USWA 4ODJA 1J5EJ 1NMEB 4X2BA 1GMWA 2MSSA 2AJ0A 2PO4A 1REGX 2F9DA 4Y34A 1FX2A 3RBDA 1RACB 3BGOP 1S0OA 2VODA 4LFBF 5C24A 4JV5J 2D9PA 4PZVA 4Y3CA 3OL6A 1M6XC 3V2UC 3X1LB 2KO1A 1C0UA 2KL8A 3JQMA 4BSZA 5I3QA 2EFVA 1DQ8A 2NZCA 3TA0A 2JLFA 2HURA 1S1UB 3R2DJ 2XMJA 3KTQA 5H9FK 4Z7CA 3CWJA 1MSWD 3RZAA 4JI5J 1SH2A 4Q5VA 4B9UA 4O3RA 1H0HB 5T41A 3L7PA 1AA1B 1YJ9S 3V81B 4IDKA 4MKYA 3AOAA 3HJFA 1YG0A 2W2QP 4ZN3A 4DV1C 5DG7A 3W2WA 2BE2A 1LWEB 1WJ9A 1RQ0A 3SMZA 4DG9A 4X84A 3Q0AA 3OL9A 4A8YA 1Q8BA 2OKQA 4GS5A 3KDOA 2J7KA 4DG8A 2HMIA 2V8HA 5D8HB 1WKKA 4JI6C 1P27B 1BQMB 3CDWA 5F41A 2G2YA 5I4MA 3GU0A 3KFWX 4LSNB 3QO9A 4I9FA 3S82A 4OZ2A 4FKYA 1MU2A 2EK1A 5HROB 5C42A 4GVLA 1YHQS 4P2MA 1QWIA 2DNNA 2V8DA 2QN6B 1HMVB 4RUCA 1OYEA 2W9CA 2F5GA 4F2SA 3CQ2A 3GV5B 2FYXA 1VGYA 2VONA 4USUA 2E9RX 1P7LA 4Z37A 2R7SA 1UKUA 1TV6B 1X4DA 3CO9A 4MT1A 5BYSA 1S1XA 1T8EA 2OBVA 1Y10A 1TL1B 1GXTA 2XMMA 2YPYA 4LUBA 1NPRA 2P6TA 2ZEJA 1IKYA 3IWLA 4ETZA 4R0EA 2DR8A 2Q3PA 3DLGA 1R7IA 5J1NA 1MN7A 3UR3C 4ZLJA 1JJ2R 1FERA 3PDNA 2DRAA 1F5CA 2QJ3A 2FVSA 3CC7S 4OI1A 2CJAA 1JKHB 4HH1A 2E5JA 5ETOA 4N8NA 2G2ZA 3E01B 4J7CA 4MYTA 5M2UA 1HQ2A 2KKHA 1NJZA 4LF6F 4ECUA 1TAQA 4LFAJ 2HHHF 1UVMA 4L75A 1DLOB 3ILLA 3DLHA 3RBZA 3WX8A 1AROP 4JV0A 4DV7C 1N5QA 2V94A 2GVZA 2QW0X 1S1UA 1HHSA 3I56S 1ZAWA 3CMAS 2HWHA 2GMHA 2ZOMA 1Q5YA 2B8PA 1B0PA 2ZOFA 3I31A 1S76D 2QSWA 4D4IA 1JMTA 1KKGA 1WACA 2W24A 2YKPA 4EEYA 1PKUA 3JS9A 3UFCX 4A8QA 1U49A 3R7BB 1AT1B 4NXNF 3GIRA 3FCEA 4DF8A 2RUSA 2E5IA 2NS1B 4K0KC 3IS9A 2EFPA 3NBPB 1NHUA 4LF9F 1YRXA 2E5LC 1MLAA 3LUYA 5KT2A 4WWSA 4CYUA 2FC9A 3Q89A 5C25B 4ECXA 1O0PA 2WW4A 4Q43A 1YK9A 1ZTWA 2M8HA 4X64F 1WF2A 4OZNA 1NXIA 2MQMA 3QAUA 4USIA 2DNRA 3SFUA 1TL3B 5JJBA 3D66A 3LP2A 1P9YA 4NLDA 4DUYF 1BLUA 2MB0B 4OX9F 3KYLA 5HROA 2R7VA 1T9WA 2QVXX 1U8WA 3CB4A 1FK9B 2UUCJ 2OPPA 4OJ3A 1IQZA 2GJFA 2M3DA 3DRYA 6FD1A 3A26A 2JH3A 2L48A 2WONB 3KDNA 4K59A 4NCGB 4O4GB 1HLWA 4WTYA 1I94J 4X66C 3N01A 1HBNA 2NSCA 2EPIA 4K2JA 4LRCA 4WKRA 4C6AA 1KONA 1Y5NB 2GQQA 3P6YC 4DPWA 4LMZA 4GXQA 2PA8D 4OLPA 3RG2A 3CJKB 1SJ3P 2UUCC 4LFAC 2K3IA 3DRRA 4YB6A 4ELVA 3DAYA 3AJDA 3LAKA 1NKEA 4KH0B 3QLHA 2G9OA 3T1HC 3CTRA 2WK4A 5HI7A 4CO0A 2AJQA 1PO6A 2HRUA 2DPLA 4UUXA 4KV8B 5CD4A 3IPLA 2H48B 3I96A 5DLGA 1I3OB 4EK2A 3M8PB 1IXKA 2E29A 5LSRA 1NK0A 4K0KJ 4E98A 3R5AA 3GP9A 1JXEA 3JAMU 5GAEI 1HR0C 4AXJA 4OV6A 3SFGA 2HFZA 1QAYA 2XY7A 2VF3A 3HVTB 2DR6A 2VFUA 2DXEA 3BS9A 1DQ9A 3DMJB 4ZITA 4B08A 2DKOB 2NR0A 4ZJZA 1Q4RA 2KM8C 3OHAA 3IR6B 2RRBA 4KKOB 4GC6A 3KK1B 5L9NA 4ECZA 1ZZFA 3Q2SC 2KHDA 1ZAXA 3MM8A 4TU8A 5HMWA 3BO4A 3UD4P 3GLJA 5GMKa 3TARA 3OUYA 3BGLA 5EWFA 4G37A 2XWYA 3QGPA 2ASLA 2DRDA 2N3LA 3EPIA 4PQAA 4F7VA 1CJKB 1HFEL 5J2QA 5DQHA 3BZQA 2AX1A 5CYQB 4NLSA 1YJUA 3NCPA 5DO2A 2V4RA 4PWUA 4AFFA 2XS2A 5CHCB 4MMOA 3DDNA 2J6TA 5L1IA 1HQUB 5F0WA 4JI5C 4OJ1A 2GW8A 1HBMA 1TKTB 4ZVGA 1C1BB 2CJBA 1HWJA 2KVQE 4V1Ak 3TVYA 4QYZK 1VQ9S 1HMVA 3FBBA 2W9CB 3BV8A 2GHPA 2YKQA 2XS5A 5K85A 1LKZA 2CAJA 1F1BB 1VQ5S 3UNGC 1N34C 1KWMA 3PYGA 1I1GA 2CQCA 1RT5B 3KLIA 4U96A 4OYPA 4TU9A 3NL0A 3SO4A 3JXOA 3M2RA 3P8BB 3D9BA 3R5JB 5KFGA 3ZO7A 2VG7B 4ZKAA 3SEOA 3GV7B 3TQIA 3HHLB 5KG0A 1RYRA 2DNLA 1K73T 1KTVA 5A1GA 1G3OA 3TEGA 1ZAVA 4JM1A 2E8EA 4KV8A 4DL4A 2IA0A 5AXLA 3OFEA 4UT4A 3IXQA 2MLZA 1NK9A 3PJWA 2XLJA 4DPXA 2BRLA 4RWWA 2QVZX 2JEGA 3W8PA 1S48A 2YWEA 3KUGA 3G6ES 3DLBA 4R8UB 2GJIA 3MPDA 3PG9A 3I6PA 1JLEB 1KHWA 1RT4A 3H20A 5HVFA 4RR5A 3NRBA 5H1SV 3BDPA 1HQEB 1WEXA 5AXKA 4IO9Q 1RJJA 5GMDA 1TFWA 2V9WA 2KT5A 3C19A 5A8KA 2Q1LA 2CQPA 3AOBA 3M1VB 2DHHA 3W64A 2V2VA 2LDYA 3CXCR 3NYRA 3IG1B 1WDTA 3I0RB 3HLUA 2E7GA 1AB8A 3EZUA 3MM8B 5CYMA 3MUVP 1DTTB 1IM6A 2IMWP 3CCQS 2RU3A 5BXIA 2D1SA 5BSTA 1S7HA 1X9WA 1ZOTA 2UXBC 2BANA 2RNEA 1RBOB 5LXYA 4NYOA 1N32C 2BJDA 4LF6J 2JNVA 2QL5B 1O93A 3TAQA 3TRGA 4KHPF 2UU9J 2QLXA 3DU6A 3QMQA 4QWEA 4A8XA 2AU0A 1EQMA 3MCMA 1HNZC 1FXRA 3VAKA 2LU1A 5DS7A 2CPZA 2HVZA 3MTKA 2OPPB 4ED4A 3G4SS 1RCOB 1YSJA 4CO3A 3FBEA 2B6AA 3AXKA 3CC4S 1YVFA 4RW4B 3JYTB 3MMCA 1UVLA 3AD9C 2W4CA 3DHXA 4DL3A 3I32A 1NDCA 2XI2A 2N3OA 2HWTA 2MXYA 1IBMC 3AJ1A 2VG5B 5EDWA 4C8MA 1F9FA 1NPPA 2FJEB 1U1RA 1U24A 4NLXA 1K9MT 3O44A 2KFZA 2L08A 2B9EA 4QR0A 4JI2C 1R6YA 1HW8A 3A3PB 4JI6F 3O6QA 4QWDA 3PW5A 2LQ5A 2AEJA 3CD7A 4WZQA 2I6WA 5IT9U 4G1IA 2F9JA 3QFWA 4IFVA 5FLXD 2V67A 3H5UA 3M8PA 4TLRA 1FHTA 1VIXA 2DHSA 2IAJB 2CQDA 1NCLA 2E5GA 3PJXA 5D0GA 5SZTA 2APOA 5KFZA 1T3NA 1KD1T 1SBRA 4MAKA 5JUMA 2J6SA 2BJ3A 2M5YA 4B9NA 4U6PA 1WSRA 2B4UA 3NNAA 1T0TV 1IBKC 1EB0A 3B82A 3UN2A 4LF6C 4RBTA 1VHFA 3BDEA 4I7FA 2UUWA 1I94F 1S0MA 3C3LA 1ZPVA 1N32J 4NLPA 4DUZF 1PILA 1WC6A 3A25A 1RWUA 2VL1A 4QIGA 3HF5A 4TXSA 5HP1A 5KT6A 4B9TA 3PFOA 5JRHA 2AJFE 4ZVPB 1U45A 2YQ3A 3EXYA 5A6WA 4HDHA 2YNIA 4ICLB 2KI2A 3T41A 1PG5B 2E1RA 2LXUA 2KN4A 2KT3A 2J7WA 3DU5A 4X66F 1XRCA 2RE1A 3GTYX 1TKZB 4CO4A 4C0OC 5BR8F 5DDOC 1RABB 2ABYA 1XNQF 2J7UA 1F2GA 3THPA 4HTIA 3GSIA 4DR6F 1IWGA 5HO4A 2LVWA 1HBMB 1TKTA 3DRPB 3EERA 3IMLA 5KFVA 4RW4A 3W8GA 1NNDA 3RAQA 3IMQJ 3CVKA 3EYZA 1VC0A 3QNWB 1WHXA 3BGFA 3R5GA 4NLYA 2QIFA 4I6WA 4C48A 1V3SA 2KZFA 2YKMA 3DHWC 3N0VA 4FPRA 2O3DA 4NYPA 2XGPA 1MROB 3FEYB 2ZE2B 3HHLA 3DDKA 2V2QA 1RT2B 4OYWA 4NEZA 5AXMA 6FDRA 1TK8A 4HDGA 1QTMA 3M32B 2GHVC 1KOOA 1YX2A 2F8MA 3MAAA 1RT6B 4WIIA 3CCES 1WCJA 3H5SA 4M5GA 2I5JA 2XMTA 4Q44A 5KYVA 2C42A 2LQ8A 1H98A 3NXZA 1DY3A 1Q8IA 1XR6A 1E6YA 2CUYA 1R3NA 2B9YA 1JJHA 2ASDA 3VGTA 4Y6IA 2V5HG 5KFRA 4I4BA 4ERDA 2ONFA 3F44A 5F8NA 3CNQP 1RHKB 3CGIA 3P5BP 1MXBA 1URRA 4ID8A 2OUGA 2OPQA 2QL7B 4C3LA 2KYZA 2CPYA 2VDHA 3T6JA 1GMUA 3PNIA 5IWAC 2HWIA 4BWJA 5KFLA 4NOHA 4K50A 2V34A 4V19X 1FJCA 2DGQA 3SXLA 4RWXA 1KBRA 1V5VA 1UA1A 1MG7A 3I0RA 1SJ1A 5HQLA 3VTIA 2W9AA 1MXAA 4QR1A 2GGPA 2K2PA 2W9BA 2MZQA 4ICLA 2CADA 2GO9A 3GJQB 4LVNP 2ZH1A 1A9NB 4G36A 4IOCQ 1RB0A 4YDXA 1CJVB 3B7WA 3FDSA 4IDKB 1FO1A 2UUBJ 1TMJA 2G0JA 2WVDA 4LIWA 2A6MA 2OELA 2E9TA 3HD2A 3DOKA 2RJZA 5LMNC 2WOMA 3AD7C 4RNNA 4USKA 4DR5C 2JJ4D 2AMCB 4R0JA 2BW2A 3IAS9 4K4TA 4I9GA 1B70B 3M9MB 1KN6A 2MPUA 1NUEA 4DL5A 3C66A 4QJVA 3R5DA 3PW7A 1O92A 3NYQA 3FEXB 4HH0A 4QWBA 2DGSA 3J7Z5 1QUVA 2HHHJ 2EW9A 2PMWA 1VIOA 2FJBB 2EWHA 2N4CA 3ISNC 3MMBB 2HQGA 3C16B 1JLGB 3K8VA 4G1QA 5GADI 1Z2ZA 2RD5C 5HBMA 2BH1X 1FD8A 1PBUA 2PGCA 4DR2J 2C3PA 4EWTA 2KDNA 4XPCA 1RWWB 4Y2KA 2CVIA 2QEXS 3QRPA 4DUTA 1WORA 3H42A 4LBPA 4DU8A 2IJFA 3HHLC 4DQRA 2HKEA 1S9FA 4KHPJ 1XS3A 4DL6A 2OH2A 1VRTB 4IG0A 1F5BA 1XNRF 4LF7C 3RUBL 4ID5B 4KGXB 2GQ2A 3GQCA 2R8HA 2M88A 1Q79A 3OFGA 5I42B 4DR4J 2QSFA 4IQMA 3QQCD 2XULA 5H9UA 1VYAA 3GYGA 4QYZJ 2C2RA 2OHDA 1H2TZ 2E8FA 4X65J 3FNNA 2ZJQQ 4I0WA 4ZOSA 1N33J 4YHHJ 4CI0B 3MM5A 1WDDA 4F50A 2VOOA 2PT7G 1FA0A 3GKUA 8AT1B 3GV8B 1F9EB 4PCQA 4UOHA 3LGHA 4WPAA 3MEKA 2OEJA 3BYPA 2EXUA 2W2MP 2DNQA 3GWCA 5DLFA 2M5OA 1UTAA 4FDFA 1VJWA 4H4MA 5GMEA 1HI8A 3GR1A 4ECYA 4PUOA 1U6ZA 1VDHA 2BKNA 5AJ3J 3C8YA 3HT0A 2NYHA 2HFUA 4O0IA 1LW2B 2FJVA 3CCLS 2AJ4A 1RWKB 2CPIA 3DKDA 3KXDA 4RU9A 3HHNB 4DR7F 5KYTA 2P02A 4RNMA 5LT5A 1UWBA 4QZVB 3MGJA 3TQ1A 2CQ0A 2RS8A 2C28A 2BE9B 4N56A 1O5JA 1FEEA 2OLWA 3MECA 5ETSA 4XDDA 3UDLA 3FZBA 3W5ZA 4RVNA 2B7BB 3ZXWA 2J6UA 1LW0A 3MMAA 4M5HA 2V9KA 4IOAQ 2BABA 3POTA 3ZZZA 1JLQB 1MN9A 1FE0A 5DDPC 4ER8A 3PX0A 2VC1A 3TUPA 4Y00A 3DN9A 2RB7A 3GG1A 3HZGA 2GIRA 3CDAA 3LAXA 1JLBB 2ACYA 4DL0C 1X31C 3ILOA 1KP6A 2DNGA 3DOMB 4DI6A 1P8GA 2C3OA 3TZXA 5IWAJ 3OW2R 1TFYA 5U47A 5LL6d 3NG8A 4I6YA 1P1LA 3QZ7A 2JDJA 3VALA 1XNQJ 1MKYA 2CJYB 1T9YA 3P5TL 4A47A 4JYAC 2CNNB 3CDEA 4MKBA 3KLGA 3SZ2A 1RT6A 3D68A 3PTWA 1MW7A 4OZ1A 4ZK7M 7AT1B 2AYEA 3O3LA 3HULA 1K47A 2HHVA 4JI7C 2A2CA 3OR1B 4XO0A 1YJVA 1WH9A 2K7JA 3ENVA 3V6DA 2V0NA 4RUHA 1CBKA 1S9EB 4PG7A 1R0BG 3E2EA 4ZDNA 3D3CJ 4EI2A 4ENOA 1S6QA 1B3TA 6AT1B 1RT3B 5HQ8A 3LW5C 1VBZA 1QD1A 2DNMA 4ZIVA 1JNRB 1OWXA 2HBZB 3W62A 5KOXA 3J81j 1S6UA 3DGPA 1VFJA 4QBUA 4JI2F 3SQGA 2IM0A 1VR6A 1HPZB 2EFOA 2R4FA 2Q6CA 2VV5A 1BXNA 2UV8G 4NYZA 4DCOB 5E33A 2BKPA 4P71A 4IR7A 2VQFC 3KJVA 3AQOA 1XNRC 1LK7A 1HI0P 2C2ZB 4UTGA 1C0TB 1JNZB 5DZ7A 3QGIA 3PV8A 5BSRA 3LUSA 1D3WA 1LFPA 4LF8J 4DV3C 2IRYA 4KKOA 1YKWA 2HNYA 2ALZA 1NB2A 5IOLA 1TUVA 1U2CA 1E6VA 3HFVA 3IRXB 4ZVEA 3TAMB 5HJYA 4Y0FA 3Q8RB 1U6BA 4U5YD 4DQSA 1HNWC 1H7WA 1OPZA 4C0HA 4M95A 2XMAA 1K0VA 2RQKA 2P8IA 4G6VB 3J80U 2UUAC 2B56A 1HBOB 3MM6B 5HVHA 1WC3A 3MPUB 5DG8A 3G6VA 3H5XA 2MQPA 2ZJPQ 3H59A 4PYAA 2QYCA 2RUGA 2P2QA 4D56A 1CG2A 1W26A 4KSEB 1IJEB 3NS7B 4KB7A 2FIUA 3M2VA 4QPTA 2X1AA 3CUNA 2WRMA 2U2FA 5LMNF 1R8HA 3R2CJ 3JSRA 2B43A 4DX6A 1C1BA 1SC1B 1FDBA 4ZP6A 4F4AA 1VBYA 2XS7A 4TQSA 1DAXA 3A3OB 3I4PA 1H38A 3G87A 2ZZTA 5B0BA 1CJUA 4WU3A 3BR8A 3KLGB 3DXBA 2A3JA 1ML8A 4PEOA 1D0EA 2FZGB 1QSYA 1N5TA 4O3PA 2CQBA 3M2RB 1FWPA 3DNCA 4O44B 5KFPA 3NOCA 2AGPA 2VG7A 4M1KA 1S97A 1SB6A 3CMES 1H7XA 1TQLA 2ZUGA 3DYAA 3CCUS 4IH6A 4PXDA 1UA0A 2QL8A 4NDNA 4YEAA 2WW8A 4NXNJ 5E7QA 1EAYC 2RVJA 3Q8UA 3W7BA 1X5OA 3D0IE 1IBMJ 4FYVB 3DOLA 2ZH3A 1S0NA 2JSXA 3I55S 3NGSA 1SQEA 2C2OB 4LF2A 5G4DA 2CPFA 5KFOA 1BQMA 3T5JA 4C9DA 2X7IA 3GPCA 5A2QD 2GO8A 4X64J 3BGUA 4KO0A 4J9PA 2MM9A 4OMFG 3RGIA 5L1KA 1N5VA 3CJTA 4DX8H 1U1NA 2R7TA 4DUYJ 4H4MB 5KT5A 2KG0A 2CWXA 2D3O1 2OSRA 1DURA 2OPSA 1HNZJ 1JLFB 2E66A 1CC7A 1LW2A 2N7YA 1CS4A 2YTCA 2NCKL 3T19A 3FCCA 2VICA 4JI6J 2ZH8A 1RKJA 1SIZA 4USVA 1TV6A 1X0PA 2RQ4A 3UD5A 3W2VA 2Y4OA 1HNVB 2DVIA 2AT1B 3W2WB 1XN9A 1WHVA 2E5HA 2M9KA 1FTRA 4JOUA 3LWMA 2W7OA 1N33F 5L9XA 2D1CA 4Y28C 5G0RA 2C22A 4UF4A 5B0GA 2G0IA 2KZ0A 2BJ7A 3GZ7A 2OPRB 2JEJA 1ZB9A 3N6NA 5ETPA 1YTYA 4X65C 4U95A 4D4GA 3IBCB 2X3GA 1WHYA 4J9RA 3CW9A 4X4QA 2XQCA 2LEBA 4FPIA 2HHXA 4NMLA 2PEHA 2MQLA 4LSNA 5K9FA 3UQSA 5KG5A 1AMUA 1I94C 4IUFA 1PA4A 3EGNA 1IQTA 3D0HE 3WIVA 4LF7J 4RLEA 4KFBA 3RW7A 3KHGA 1IBKF 4I2QB 1CJTB 3MPYA 1R8PA 2EKYA 1HNZF 2BW7A 3OQ2A 1S12A 3OVSA 3HSGA 1K0RA 4DCSA 2VFTA 1UFKA 1Q81T 1PG3A 2D3OR 1MXCA 4QW8A 4IKAA 4OQJA 1RGVA 1N36J 3N54B 4WBFA 2HHWA 2JMPA 2Z30B 1SJFA 3HX9A 3R44A 2XZTB 3N5BA 2DR9A 1BY9A 2HFVA 4RO0A 3SI8A 2K1RB 4WXOA 2XSFA 3FRZA 5KG6A 4H4KC 4NASA 5DGBA 1FXLA 1T95A 2IYIA 5LM7E 3OJSA 2IVFB 3OVAA 4YQWA 2GVDA 1RG9A 4B3RF 2WBRA 2JX2A 4CLTA 3ADAC 1M5VC 1PJ5A 3BSCA 2D1RA 3L4BC 4YHHC 3CT9A 1U25A 2CA9A 3ZZYA 1Q8KA 1V6HA 3SDEB 4AE5A 4GKJF 3NI2A 2M52A 2EG1A 2DH9A 4IFVB 1FUGA 5LMUC 3PM9A 1N34F 3U02A 2KXFA 3LANA 3K8WA 2B5JA 1S1WA 4KBIA 1U1PA 1F3FA 5HN0A 3M4XA 2BQUA 2J0WA 4USTA 5RUBA 4QIVA 4L73A 3W9JA 3WC2A 3EVOA 4OZ3A 1VLOA 4CP5A 1X4BA 3RBXA 1C0TA 3N28A 4OJGA 5K14A 4YR3A 1MD9A 4KTVA 1Q86T 2CQ4A 1FKPA 2V8GA 4OZLA 1J5EF 1ZETA 4B3RJ 2BJ8A 2DNOA 3CJKA 3UN5A 3VAJA 4KT0C 1KC8T 5E3PA 2ASBA 2CQ3A 3J7YU 4UQGA 2UV8A 1GXLA 4FBTA 2IA6A 3TANA 2BQRA 3C5EA 2HVIA 3W3SA 3I9ZA 2HEKA 4ED8A 1WUUA 4DQQA 4PABA 1RA6A 3QATA 2Q43A 3OR2B 3MPVA 2V2KA 4RPFA 2J9CA 4ES2A 1WSVA 3D2WA 1D9DA 1LEOA 1TL4A 5A19A 4F0KA 1HBNB 2LEAA 3C2PA 1G2EA 2MMAB 3SBMA 4W90B 3O5TB 4KAIA 1J27A 3C46A 4USMA 3DXSX 1IN0A 4USJC 1O8BA 5T7LB 1FRJA 2VC0A 5IC4B 1FXDA 3IP0A 3W5XA 2ZC4A 4NMXA 4A46A 4CLWA 1L2FA 2AZ3A 4NXMC 1VOMA 4FYWB 1X5TA 5HMXA 4L3NA 3EVWA 4IFYA 4RW7B 1WG5A 3FKBA 4QIWD 1M5SA 1YBUA 5L46A 3OUYB 1PAEX 2KU7A 4HR2A 1YBAA 4PKDB 2LXFA 3DLKB 3K57A 2XTJP 1CPZA 3BBFA 1T9XA 5KFFA 4M5MA 4KHMA 2M4MA 2PA3A 3PACA 4DBQA 2L9NA 1QVFR 3TI0A 4K4UA 3HSZA 2D3UA 3DI6A 3D6MB 2PE8A 4KGVB 3KLHA 2W01A 4LF5F 1WOSA 3R6LB 1YWXA 3OLBA 1FFWB 1IKXA 4L74A 3ZTPA 1JLFA 1Y9OA 4HL9A 5HANA 2R9LA 4JI1J 4CH1A 3QJPA 4OX8A 5LXRA 1R0AB 4YR2A 4MIAA 3FC9A 1JB0C 4M5LA 3SYZA 1URNA 2CWKA 2C3YA 3Q86A 5E41A 2B8QA 1WG1A 4ZVRB 2DPIA 2ZDOA 3WDOA 1TTHB 5BSUA 1SQFA 4J91A 3FSXA 2KXNB 3EMTA 5L8RC 5GAEU 4WYWA 1B0TA 2ZH2A 2CJQA 2RHQB 3UN3A 4B3OA 2KXHA 4NLTA 4JI1C 3H98A 4ZPCA 1NO8A 2IC3B 1G4CA 3CIMA 2MQQA 1TL5A 3V4IB 2J5AA 1IBLJ 2HJGA 1UEVA 3CQ3A 2PI5A 1WG4A 3KHRA 3MXHP 3QJJA 1HNWF 1V5IB 2HFSA 1XIQA 2QLJB 1RT1A 3I82A 3QIPB 4ZA1A 3MEGA 4XX2A 1BQXA 5BYRA 1C2PA 5ETTA 3L7UA 5K20B 3NGUA 1HBUA 1KFDA 3KK2A 2VIHA 5A76A 3T3FA 4EZ6A 1IBLC 3Q22A 1PJ7A 2Z0GA 3CCVS 2CG4A 2CZ4A 2HS3A 4OYMA 2PSZA 3GFXA 1ZM4A 3W61A 3CC2S 1FNXH 2ZWOA 3BF4A 2B9XA 3NNCA 3IBFB 1D9AA 5IXUA 1VQSA 2DEIA 2C2EA 4KGZB 1G7CB 2P9GA 3MF5A 4OYOA 3RB3A 4ZS6A 3H7HB 3OTOJ 3HT3A 1U1MA 1NK8A 4NLGA 3ITHA 3NKYA 3TR5A 4PXCA 1Z1ZA 2LECA 1QAXA 2R42A 2VD3A 2X3DA 4J9UE 5CCMA 4OYIA 1N6QA 3W66A 3DI6B 5C42B 3M7VA 2DGWA 3U1MA 2UXBJ 3LP0B 3V6JA 1KKHA 4LRFA 1J5OA 3I4HX 1XQIA 2OIHA 2EKNA 3CCJS 3IEUA 1L3VA 1EARA 2WVBA 3SSRA 2DNKA 3JYTA 1GXUA 2ILZA 1RAIB 4J37A 4RUBA 3VHQA 4NCBA 4JYAF 1FNMA 1S1VB 3M8ZA 1XTZA 2B7CB 4URQU 3R1HA 2HRYA 4B3SJ 2VPZB 1DRZA 2ZM6C 4K7QA 1T5DX 1LQLA 2E9ZA 4EUVA 4J5OA 5DM7Q 2YX7A 2K7KA 2IRXA 3E7WA 2L9DA 2MHEA 2CQHA 3CCWA 4B9MA 3D6TB 3T5HA 3P45B 4IH5A 1RK8A 1PGZA 1EKSA 1TVRA 3A12A 3LTOA 2BJ9A 3PRBA 2PIIA 4NA2A 4RM2A 2YX1A 2Y9HA 1ELOA 2RF2B 1RISA 3OR2A 2R2SA 1NB7A 1JK9B 2Y4NA 1G6BA 2HFOA 2DD8S 2H5IB 2XM3A 4DFJA 1HBUB 5LMUJ 3EZOA 2D1QA 3E8OA 4EATA 1I5OB 3HKWA 1FI4A 4LJMA 4URSA 4LSZB 1JJ4A 4CO5A 3PW0A 4NPOA 2UUAJ 4G3IA 3KG4A 4ED5A 1WF3A 5A8RA 5ETKA 2CVEA 4DXLA 1UZHA 4I67A 5THWA 1RTHB 2GC8A 2RT3A 1MWYA 1DQAA 2H5JB 4TU7A 3H90A 1REVB 2Y1LB 1W2BR 4ELUA 4LF8F 1LXNA 3KNGA 5KFSA 3RJMB 3PRVA 3G2XA 4J9VA 1ZA2B 5F8IA 4UZBA 1HKAA 4X4NA 1FX4A 4FVCA 3V4MA 2ADCA 5HMYA 5KFBA 3Q2TC 1GEHA 2RHSB 4KGMA 3QWPA 4C98A 5L1LA 1P4EC 4PR6A 3GIKA 2RS2A 5KFIA 1B7FA 1SIWB 1EGAA 4PROC 2MKIA 2AX0A 4PXBA 1V26A 2EFGA 2G1HA 1YDLA 4R1LA 4WF9Q 5D6GA 3MM7B 3NPDA 2VBXA 3VZIA 4LQ3A 4NOZA 5DDRC 1S1VA 2D3ZA 2PFFB 3GYNA 5HP1B 2V8PA 2ZNYA 1X9MA 2P2FA 2O5DA 4Z7YA 2DY9A 4L72B 2CIMA 2GFFA 5KFNA 4DQPA 2BBEA 1LWXA 3JAMY 1Q0NA 2VPXB 3RB4A 1T05A 4D3GA 4C8KA 4RUAA 3NGTA 3LP1A 2Z2ZA 2BKOA 4IO1A 1RTDA 2MLXA 4CCHA 1O90A 2M7SA 3ENQA 4YB7A 2HAFA 3OVBA 5A8WA 3A8EA 4EBCA 2VOPA 1EP4B 1S9GA 3A1YG 4IG3B 4LVOP 4DV2F 1XHJA 2WP0C 3OTOC 3NNHA 1PBAA 5KTQA 2CJXB 3MCNA 3FCVA 3R6GB 3V4IA 2ASYA 5DV9A 3AFGA 3I87A 5FJ4A 2R8GA 2HZVA 1HBOA 2FY8A 4YDDB 1XEZA 4NZ6A 1SJRA 4ES1A 2WD9A 3RV2A 4ANCA 4LF4C 4DV6C 1TU0B 4TY9A 1KTQA 4CQ1A 4DG1A 2RDJA 2BM1A 5FLXU 1I6JA 4DLGA 4A8FA 2AYMA 2Y27A 2QMWA 2KJVA 3IN5A 2W7PA 3KK2B 4OI0A 1LV5A 2NREA 1Q78A 2GHWA 2PT0A 1NU4A 4RKUC 4ZVSB 1RT2A 2CPDA 1NYEA 4U9RA 4ATNA 2MKKA 5H9EJ 1FE4A 2L3MA 4ETXA 4JI3C 3ZZPA 3U1LA 3CIZA 3OTBA 2EI5A 1N0VC 2GJ2A 3Q8PB 1JLAB 2ZM6F 1U09A 2CDQA 5F8JA 2CQ1A 4NI2A 1X4FA 1N8RT 1HNIB 4ED3A 1LFWA 2J9DA 4CLYA 5CYQA 4O3QA 3BGRB 4PAAA 3SCKE 3VQSA 2KVIA 2OD4A 4QIEA 4FYYB 4DL2A 2BA9A 4LFCJ 4JI4J 1UJ4A 2HS4A 2OP5A 1XBWA 4F4WA 4NLQA 1Y5IB 2J0SD 2CZ9A 2DH8A 2M2BA 2YH0A 3A8KA 3B4MA 4B3MJ 5K8OA 2E5LJ 3CJ5A 2R7OA 3AJ2A 5IT9Y 2AYAA 1GX6A 3T1HJ 4OYCA 2C3MA 4U7UK 2ROPA 2OMLA 1N52B 2ROEA 2GGPB 2HHUA 4GKJC 1EZZB 3DRSA 5ETVA 5L38A 1XMOJ 3O2EA 2YNFB 3GFYA 4DCJB 3ZZUA 4YR0A 3G6YA 2ZH6A 1PG4A 2W2OP 2OPLA 4F0HA 1CS4B 1S4FA 3K2YA 1XMBA 1BQNA 3ENWA 4FKXA 1U0HA 3K5LA 2EC2A 4O3SA 2P9EA 1L5UA 3PX4A 3E3XA 4N41A 4LBHA 2Y0BB 4ID5A 2DHAA 4MIWA 3PO5A 4PUGA 4IR9A 3NEKA 3KLFB 3M9NB 3HVRA 3VGUA 1FDAA 2OPRA 4F4ZA 3PHEA 2AKWB 3PW2A 3LNVA 2VUGA 5IZHA 2IDLA 2Y0SD 1HHTP 3LGXA 4DG1B 3AODA 2HQCA 4WKYA 3MFHA 3PRDA 3R27A 1DJ0A 1M6XA 3GFHA 1M1HA 2DITA 4ECQA 4F3QA 4ILMA 4OX6A 3CQ1A 2QT7A 2NXEA 4QW9A 1BWEA 1S6PB 3TUZC 3TVKA 3T5LA 4V19J 2JRSA 5I3UA 4S0MA 3B54A 4B3SF 1LWFB 2DY1A 5MLCV 2BR0A 1BA3A 4WIQA 3ZZRA 2XMWA 4U7UD 2G2OA 1WF1A 3HHEA 4GKKJ 5KT7A 5ETLA 2HLTA 2JVRA 2O66A 4EGLA 3T1AA 4D57A 1RP5A 3A9UA 2HLUA 3MECB 5C7PA 1M5HA 4ECSA 3FJ2A 4OHZA 4ED1A 3GG0A 1M1KT 1VISA 4CLFA 3MM5B 2MKSA 2RH3A 5LJ3Y 1QAIA 2J9DE 3UDEA 2QG9B 2HMIB 3TX8A 2LYVA 1RWVB 4UW2A 1UWDA 2BMBA 3POTB 3BYRA 1QUPA 4P74A 4WFBQ 1TUWA 3TJ9A 3IAM9 2QLFB 4J9OA 4ECWA 1FLOA 3DRSB 3UVJA 3UDVA 4X4TA 4FF1A 3PROC 4LFBC 1S10A 1BC6A 2YNFA 1R8AA 3JQKA 3HHDA 4CO2A 3SCIE 1Q7LB 1OQ3A 3O1LA 2POKA 1EKRA 4AL7A 4OX7A 5T14A 2LEPA 2RRNA 2OO4A 4YOEA 1UWBB 5KFQA 1SPBP 2GS8A 2YKNA 3L95X 5F9NA 5DM6Q 1NY8A 1FRLA 2F3JA 4X62J 2MSTA 3FEZA 1VEHA 3ZTQA 3D3BJ 4AYBD 3Q8VA 1HHQA 2MGZB 2XCAA 1NLKL 2YKOA 1J5EC 4C3MA 3VNRA 1UVKA 2Y1RI 3EDQB 2HNDA 1IKVB 4CNZA 1B64A 3LH2S 5ETQA 4LF5C 5D4OA 4ECTA 3TJAA 1DLOA 2LQ9A 3AT1B 2IBKA 4LIRA 2LQJA 3KUHA 2MY8A 5EN1A 2YWGA 3HVWA 2V6AA 1N33C 2BZ2A 4URGA 1ZM2A 4TKTA 4CM2A 3BJYA 4KTQA 3GMGA 5J2NB 4RVOA 4ZJOA 4DCPB 4OZ0A 2FJWA 3D7SB 3MAHA 3BH7B 1H3DA 5DJBA 5FDLB 1D8ZA 2H4WB 3HFKA 1A7GE 4MJKA 4RX6A 1VQOS 1S57A 3FZ2A 2RDIA 2FB0A 3B6BA 2EBGA 3IWXA 4K8RA 3VAGA 4FUTA 3OR1A 2QMUB 4CT8A 3G71S 2B3TB 3V6DB 1OQ6A 3IRXA 3TAMA 1VBXA 5A0YA 2DHXA 1X7VA 2BJEA 2MHNA 4QIFA 4ZPWR 3N9UC 3CD0A 4CT9A 2UVUA 1SC6A 3QGHA 1SC3B 3DRPA 2FGCA 1NJIT 4PHTA 3RU0A 4EMDA 2XNRA 3OTDA 3LP2B 4C8OA 2QFJA 2CG8A 3BN7A 1BMQB 4HT5A 4AT1B 5IT0A 2VB6A 4DSEA 2YWWA 1HPZA 4B3MC 3FMBA 1HWLA 3R5CA 1F9HA 2YX4A 4M5DA 1KLMB 1WOOA 4MTPA 3TUFA 5FIIA 2FY1A 2BX6A 3ISZA 4UY85 1OY9A 3X3UA 4C7QA 4J9KA 1FWLA 1SUQA 1IKXB 2C1EB 1QSSA 1YJWS 2VFSA 2DGTA 1SKRA 1BQNB 2AYBA 4GKJJ 2ZFHA 2QYGA 1E6VB 3DRRB 1ZH5A 4DX7A 2E5LF 4NLOA 4B9SA 1ULTA 1SL2A 2V4QA 4DV7J 1DTQA 1RAJA 1TL7A 3C6UB 2J0QD 2UP1A 2GMJA 2UXBF 4NXNC 2FLOA 3MM6A 1NHVA 4JI8F 1RU2A 2DPJA 3NMAA 1FKOA 3UZ0A 2CQIA 4RLQA 5ETMA 1XRAA 5HVGA 1RDRA 3QZ8A 2IM1A 3GIJA 1T9TA 3QSYB 2NPFA 4DWIA 4PUHA 5DDQC 1RHRB 1LK5A 3ELHA 4WP3A 5B09A 1IB8A 3LF0A 2EVZA 4ALZA 1RHJB 4KYZA 2G4BA 3VVTA 4YB1P 2LA6A 4WYLA 4LREA 2XZWA 3JSMB 4JI8C 2ZBQA 3HI9A 4B9LA 1H72C 4LQ9A 3M2UA 4RW6A 5FDLA 3HP6A 2JLEA 4B9VA 1FJ7A 1OS5A 2MDAA 4K4SA 1N32F 3PJ9A 3V5RA 2VH7A 3MEEA 3T1HF 4DPUA 5C5JA 3MM9A 4ECVA 4NXMJ 4RNFA 1UVIA 4HKQA 4L6V3 3KK1A 1FNOA 1SH3A 3O2IA 3M8YA 5D4LA 2RQCA 5A0YB 2Y8WA 2COLA 4YS2A 3RAMA 1IM4A 3MFIA 2VDIA 1FVQA 4FN5A 1T03A 1KVKA 2UXCC 4W92B 3MMJA 1FD2A 3VZHA 8ATCB 2BEFA 1CJKA 1FRKA 3IRWP 1P4EA 1LNQA 1UJ5A 2FVRA 3CPWR 5B0EA 1JWWA 1D1UA 4KR0B 4X4OA 2A0FB 4KRWA 1T11A 3OPKA 2Z4PA 3VAHA 4NLRA 2VBYA 4J9SA 2BOAA 2HVHA 4FUQA 2CY1A 3QT7A 2JLGA 4OLOA 3T5KA 2CDRB 4L4QA 4H4OA 2QRRA 4FP9A 3BO2A 1S79A 4FS2A 1HNXJ 4WS9A 2XGQA 3O8WA 4B3TF 4PWDB 1S72S 1RWPB 4OI2A 5I42A 1BE4A 1D09B 1LQ9A 1RBAA 2LA4A 2UUTA 2HK2A 5JMNA 4WE1B 2PDAA 4K4XA 1TZ0A 2CNOB 4RW8A 4USHA 4QOTA 2ZD1A 4DV4F 4M5NA 4FS1A 4PWWA 3ENAA 3GPAA 5C24B 1F5AA 1MNEA 1WEYA 3PVXA 1ZTTA 1SKSA 4FNIA 2XR1A 4R8UA 3KMQA 2GCFA 3RR7A 4JI5F 2P2CB 2BM0A 2E7VA 1HQEA 1WD6A 3BKUA 2ZBRA 4IYQA 1RWXB 4YN3B 2PD1A 2HGMA 3D4JA 4CWBA 2H9ZA 3M2UB 4RW6B 1K0TA 2F8EX 2HZCA 1ITPA 2MCQA 2XO7A 1AW0A 3H0PA 2C2NA 1S1TA 5HSPA 2W1BA 1GAOA 5K14B 4HACA 2E1AA 2DHGA 1UETA 2FJDB 3OT9A 5A8RB 4UY8T 3TZWA 4ZCKA 1HL6A 1QM4A 1EHWA 4ILLA 1CQMA 1PYSB 3HCXA 3B8HA 2IIHA 2YY3A 4TYAA 4DV0J 2CRLA 1K8AT 1SJ4P 2E1MC 3H2UB 2YXLA 2UUBF 3V6HA 2VG6A 4QWCA 4AXIA 4ZIWA 3CJ2A 3FFIB 1IKWB 2FGOA 3KNAA 2ZNZA 2FHMA 2I38A 1HWIA 2XYHB 1QDUB 2B5JB 3BEGB 4P52A 4A4JA 4DV6F 1F60B 3UNYA 2NLWA 1XERA 1QLNA 4NEYA 3T9NA 2HGLA 2UXDC 2IBOA 3CJ8A 4H4OB 2Q79A 4NZ7A 3UO0A 2QA1A 4EU0A 3AOCA 1N48A 1S1XB 3PBKA 1A0OB 4JI7F 2MZTA 1FKPB 4UOCA 3CD6S 2E1CA 1IKYB 1HA1A 4E8UA 3IR5B 2AJ1A 1FKAF 1CVJA 2HAIA 2VG5A 4BLGA 3A13A 4RJVA 4XIUA 4G65A
chains in the Genus database with same CATH topology
4AQYC 4KGKA 3D1QA 1DTQB 3C6UA 2ZD1B 2KB2A 4RU2A 5I3PA 1VQKS 2KTQA 1R8CA 3DCAA 2NUHA 2FHJD 1KQGB 3LAMA 1FVSA 3CJ3A 2IAJA 2OTJS 1X4EA 2E0GA 5KOWA 4QR2A 4DR3F 2QV6A 3NMRA 3FSIA 1JLEA 4MTNA 3OBIA 1YI2S 2CQGA 4I7FB 1S1TB 4C8LA 4DFPA 1DHMA 4DF4A 2NQPA 2LU2A 1UFLA 4YUDA 1UJ6A 3MEEB 4DV3F 1KS2A 1RTIA 2ILYA 2DYJA 1OO0B 2DNHA 2KM8B 4ED6A 2BQ3A 3F73A 1HWKA 2AGOA 4PG5A 3WX4A 3VWSA 1JLAA 4WFZA 1XC9A 2JEIA 2PROA 4LF7F 2VKZG 4JBCA 4N5SA 2RSQA 2OFHX 3SV4A 4OHVA 1L3KA 2EBEA 2HQIA 3NS5A 5L39A 2GA7A 4NA3A 2MJUA 4FF4A 3MR3A 5DQIA 2XG8A 1MU2B 1MMLA 4C3KA 4ZLPA 4DV7F 3A9VA 2IRUA 4DCVA 3UW1A 2KH9A 1U48A 4LF8C 4N8OA 2IYGA 2R8KA 2B4VA 1GX5A 3RB0A 3OL7A 3CDBA 4HYKA 1VQ6S 2OSQA 3MMCB 1TKXB 4DFKA 4GMKA 2IHR1 2BUNA 2R7RA 1FESA 1SJQA 1MROA 3U27A 2DR7A 4B3SC 2KYXA 4Y2AA 2DK2A 3D0GE 2F7VA 2VBWA 4WE1A 4QYRA 1WI8A 2DO4A 4KQZA 5JVHQ 4DPOA 3UD3P 4KTTA 3DOLB 4Z2XA 3JB9k 4IZ6A 2BDPA 3TOQA 4DV1F 4EO6A 1X5PA 2CPXA 2D28C 4RW9A 3EPGA 1QM9A 2ZVSA 1O51A 3TA1A 3KLEA 1H2UX 4BS2A 2A18A 1OIAA 3PKMA 3MEGB 2RMLA 1KQFB 3KK3A 4BC9A 2RQMA 5D4PA 3DLPX 3E7XA 1VQLS 2YVSA 1WTFA 1VQ8S 4IH7A 1M0SA 5IQ6A 4AQYF 2ZKTA 1QE1B 2NUUG 4Q0BB 4EYIB 3S8SA 1NRKA 4P7VA 3FCHA 4Y2MA 3IS9B 3NBPA 5IQQA 5B7WA 3K0JA 2DNZA 3T1YF 2KZMA 2D41A 2XLKA 3UCZP 4DS5A 2PN2A 1SI9A 4X62F 2AW0A 1IKWA 1VK8A 3PIPQ 1TKZA 2FHJA 2LKZA 3AY0A 1FDNA 1HQUA 1Z4UA 4DDFA 5DQGA 5IWAF 3NP5A 4QPXA 4PRFA 1VLAA 2V7BA 1VC5A 3MZIA 3ULHA 2YCBA 2EGTA 3K59A 2ZOGA 4WFAQ 4DR3C 3M9OB 4MH4A 2ZH4A 3OFHA 3BSNA 2G1DA 2OD6A 4A8MP 1HH2P 4P2SA 3CW8X 1EETA 3TUIC 1R8BA 5ADZA 1DZ5A 1HWUA 2XWXA 3UI3A 1N4LA 2XSJA 3PXGa 1R31A 4C11B 5J1EB 2XCPA 2MY7A 5LSLA 3M6XA 1TK0A 2VSQA 4PZPA 1U1OA 3S01A 4YB5A 1F0XA 1A6LA 2CKWA 4DV5C 3H2VE 5E3CA 4B02A 2FJAB 3M32A 1YQHA 3N79A 4FF3A 1CQNA 4N77A 4DJBA 3NS6A 4WK1A 1VQNS 5H9FJ 2IMOA 2VZEA 1S99A 2AWZA 1HI1A 3EGWB 4MKAA 5F8LA 4DR5F 1AFJA 5BUSA 4IRDA 2OMOA 3VAFA 4DR6C 3ZC4A 4ITSA 4A8SA 4AL5A 3M1VA 4K5RA 3HVTA 3I5BA 4J9LA 4OXIA 2R8GA 3H4BA 5KG7A 1D9FA 3HHLD 5BR8C 5SUHA 5IT9D 3G8QA 3BSOA 2AQ4A 4Q0BA 4K4YA 1U2FA 4ZP8A 3N6MA 4R5PA 2MKJA 2Z2LA 3LO3A 1TKDA 2HYIB 1KRPA 2CFXA 2EFQA 4P6QA 3MD1A 2HHPA 3IC1A 4G1PA 4ZMMA 4PXEA 1N5YA 1TR0A 2W4PA 4WFYA 3R9WA 1MMDA 1CSJA 2DO0A 4FVMA 5FLXY 2F4VF 1U4BA 2KFNA 4XPEA 2WHOA 4I64A 2N82B 4F4XA 1EP4A 1S9GB 2WAQD 3MCSA 1YIJS 1VRUB 3DOKB 4HEA9 3B78A 3KHLA 1IBLF 3OTEA 1Y00A 2NZ4A 2I9SA 2XHWA 1VS3A 3CJ0A 2P2JA 2QLWA 3U1NA 3HXMA 1YITS 2HS0A 2UUBC 5CYJA 1NH8A 4RZRA 1GTEA 1N36F 4ZVFA 3GE9A 3RAXA 2FDNA 2ATLA 5KFYA 4TN2A 2O67A 2HG4A 3NWGA 5KFJA 4JV5C 5KFXA 3L09A 2IVYA 3NLCA 3OFFA 2XEXA 3IR7B 3VAMA 2XBPA 2IM3A 3M6VA 2CZVC 2LMIA 4TLQA 4NL5A 5A8WB 1VQPS 4BBYA 1MWZA 3IFEA 4IG3A 1V3ZA 2EK6A 2WSEC 2XC9A 4BDPA 2FHOB 3J81Y 4I69A 3JTPA 3KWMA 3THVA 1K1QA 4PG8A 2O01C 5CH7B 2B9WA 1ZZNA 3DHVA 1S6QB 5GADU 1P9QC 2CPHA 3JSBA 2DT9A 3Q8SB 1RT3A 1YGYA 3KLHB 1RKIA 3FGVA 3KK3B 1W25A 2ZH5A 5A8KB 5CQGA 2UVWA 3I9V9 2O1PA 4WK3A 3H5YA 5J2PA 3L8CA 3AF6A 3KG0A 1Y7PA 2JZ5A 5CZVA 4HLBA 4DLEA 2RKIB 1JLCA 3JTNA 4JV2A 1UVNA 4B3MC 1ZM3A 2P5VA 4KIAA 4ZHRB 1FJGF 4OV1A 3AH6A 4MYUA 4BHQA 3MM9B 2BANB 1FTCA 2E8CA 2DNPA 4LFCC 3GB0A 4ED0A 5AJ3F 3WZ0A 1ZB8A 3OSPA 1BGXT 1HR0F 5AE1A 5KT4A 1SKWA 3NAHA 5T8TA 5EX3A 2DJWA 3KLFA 1M5PC 1WEZA 4X4SA 4OHYA 1R27B 2H5EA 1LW0B 3MMAB 4NX9A 4DOZA 3EZ5A 5F0UA 2MQNA 5L1JA 2U1AA 1VQMS 2XB2D 1ROFA 3IGVA 2X1BA 4C8NA 1EETB 3UOWA 3CDUA 2ZE2A 3SSQA 1S6PA 3I5AA 3HDSA 1LWFA 2K3KA 2WSCC 2WSFC 3GYXB 2MZRA 4OZJA 2D9OA 2UU9C 3UWTA 1Q8LA 1J2VA 5E5NA 3SV3A 1Q16B 4MIBA 4O44A 3S6EA 1XNQC 5E3AA 5KFUA 3ITHB 3TNVA 3VR1A 4YY3F 5KFCA 3T6BA 3LWLA 1YJTA 3SCLE 4MK8A 4ELTA 4DUYC 5KFMA 4ED2A 4F25A 2OPQB 5HLFB 5D3GB 3D5MA 3RR8A 2NYIA 4KJIA 2LCWA 2P20A 4L2ZA 4X64C 1RTJB 2QZ8A 1PC5A 5BYQA 5J2MB 1VLYA 3OTCA 4JI1F 1SH0A 2QA2A 5J2PB 4ECRA 4O4RA 3AA9A 3MR5A 4FXDA 2E7XA 5KFKA 2XMUA 2ZHBA 1HW9A 2NPIA 4LSLA 2YNGA 1BD6A 3D28A 3OXLA 3G7SA 5A1IA 4DSIA 2EC0A 4I2PA 1RA7A 3QIDA 3T9ZA 1U6FA 4OIXA 3S1TA 3RRHA 3N2QA 4CNYA 1ZYQA 1JOSA 5K8MA 2YKNB 4OFZA 4B3TC 2MZSA 3C6TB 2WBMA 3MUTP 1TVRB 5BUQA 4AUKA 3IO1A 4R25A 5B08A 4K4ZA 4FZVA 5C25A 4TPSB 1ZBTA 3M6UA 2FLPA 5CZXA 1U1LA 2YKAA 1Q53A 3MMBA 2OTLS 1N0UA 4DN9A 3TA2A 3VQTA 4R0MA 4TQRA 2MKHA 4ZPVR 3EGZA 3DLEA 3MPWA 4KFBB 3Q8QB 4EO8A 1V3RA 4JV1A 4YP3A 4JUZA 3HK2A 3DM2A 1NJYA 4NCGA 4O4GA 2UXCF 2DH7A 3G96A 4FBUA 5A2QY 2JEFA 1TK5A 4LFCF 1UMJA 3JTOA 3KG1A 2JOQA 1H2VZ 1KEKA 1DFDA 5KG2A 2YWFA 4O3OA 2ATWA 4KHPC 2ZC3A 4B3MF 2F40A 2QVYX 1IBMF 3WBZA 3QLHB 3Q23A 5HLFA 1APSA 2QMXA 2HNDB 3P96A 4ZPBA 3U7JA 4PG6A 5T8SA 3KLVA 3MAQA 4F4YA 3RB6A 2P9CA 4F67A 3SDEA 1X4HA 1NKBA 1GQEA 1GNKA 3M6WA 1YJNS 4TNOA 2R7XA 2BACA 4RBVA 4OJHA 1PC4A 3UCUP 4LSLB 2ZITA 4KO0B 1R43A 3BQ1A 5J2NA 1N54B 3CEDA 4O3NA 1ZM9A 2DGUA 4NWBA 1T5HX 4DR1C 2X1FA 3MEDA 5EHHA 2HGNA 2IFXA 4KPYA 2BOPA 2LLZA 2M70A 3FVYA 3J7ZT 1M5KC 1HNVA 5GTDA 1RT7B 3P3DA 5KFHA 2J0XA 5E3QA 5D78A 5G0RB 1VQ4S 4ED7A 4NZ0A 2BJOA 4CH7A 3CF5Q 2D1TA 5JVGQ 1FKOB 2MJNA 3PW4A 5F3TA 4Q2LA 5LMUF 1VI7A 3MUMP 4OHWA 1RYSA 2R8JA 2DNYA 1PSDA 3NCQA 1U26A 3GIMA 1JLGA 4K4WA 2XMVA 1L3UA 3AQPA 4I2QA 2VQEF 4RBUA 4BWMA 5J1PA 3H4DA 5JXSA 2FTRA 2F4VC 2Q6BA 1FJEB 1X4GA 4IG0B 4IRCA 1S6OA 5M2RA 3OTOF 4C8YA 1XRBA 4DV2C 1NK6A 3VCDA 1RI7A 2ZBIA 4DR7C 4OZ5A 3HM9A 3N4WA 2VFRA 4PPZA 2K1RA 2BE2B 5ITHA 1ULRA 3RYLA 2F1FA 2KG1A 2M8DB 4OI6A 3UDCA 3QPIA 4F2RA 1T03B 3DLKA 3QJLA 4LF4F 3B4DA 2C3UA 4GC7A 3RTVA 3SQGB 3ZZ0A 4X4RA 5J2MA 1N36C 3I0SA 3OXFA 4RNOA 5KG1A 5GAGU 1Q82T 1S1WB 3MWBA 1SV5B 5IM0A 4MH8A 4CZCA 4F26A 3VNSA 3J7YI 3EX7B 1ZPWX 2GIQA 2XY5A 2OPLB 3D54A 2GV1A 5KG3A 3RRKA 4F3MA 5LSOA 4ISBA 3QAEA 4NRTA 4PG4A 3J80Y 3PR4A 2DCUB 4JI0F 3MURP 1XK8A 1FT8A 2DRBA 2CQ2A 1USPA 4Q8EA 2YWCA 3PY8A 3T1YC 3MR6A 1KSPA 4ZP7A 2J9EA 3PZPA 1JKHA 3IGNA 2VASA 3M2VB 2XMKA 4KHRA 2HHHC 3ETCA 2NSBA 1JLBA 4FXWA 3MR2A 4M8LA 3K5NA 1SXLA 1GH8A 1N5SA 3BQ0A 2MYFA 1KVIA 3N6LA 4FNHA 2KHCA 4TYBA 2I0XA 2V8VA 2K8GA 2MZ1A 3PR5B 2HHSA 2VKRA 3Q24A 3ISND 4PWDA 3K5OA 2GMLA 4I56A 1T02A 4DV0F 5J1EA 2CXCA 3DYAB 1HD0A 2XLIA 2YH1A 4HVZA 2RRAA 5F8MA 1JXLA 2Z2MA 1K1SA 2EFNA 4IFYB 3E01A 4RW7A 3OHBA 3HHKA 1QAJA 4IOAQ 2LXIA 3IMLA 3H40A 3FSYA 1H6KX 2UXDF 1FRIA 4A8WA 1NEEA 3I0SB 3UPFA 1OPIA 1Y5LB 4KC5A 2CYYA 3DFEA 3HVAA 2PMZ