4ZLPA

Crystal structure of notch3 negative regulatory region
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
253
structure length
241
Chain Sequence
PRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurogenic locus notch homolog protein 3
publication title Insights into Autoregulation of Notch3 from Structural and Functional Studies of Its Negative Regulatory Region.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 62
structure length 241
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zlpA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4zlpA01
5CZVA 3ETOA 5CZXA 3L95X 2OO4A 4ZLPA
chains in the Genus database with same CATH superfamily
3Q83A 4LBPA 5KFHA 1D9FA 3IP0A 4DCJB 2VV5A 2LEAA 4MK9A 1S9EA 2KO1A 4ODJA 2GJ2A 3TVYA 2FDNA 4ISBA 1R31A 1GXTA 2C3YA 2BH1X 2VONA 3K5MA 2CKWA 3SSRA 1EHWA 2AJFE 1HWKA 1GTEA 1NJIT 4L76A 2KZFA 1D1UA 3LF0A 4DR5J 2RD5C 1IBMF 1WUUA 1L3KA 1A9NB 5HP1A 2I1RA 5F0UA 1J27A 4RBUA 5HK4A 1S6UA 1I94F 3OTBA 2V9KA 2V69A 4C11B 1PG3A 1QSLA 3SCKE 3CD0A 3R1LA 1N48A 4OLOA 4A8KA 4KYZA 2B7BB 3M6WA 3MOZA 1VQ7S 4MMOA 4EZ9A 4KHPF 3KJFB 1VQSA 3M2UB 3C15A 3WIVA 1RT3A 4I6WA 1VQ5S 4FF4A 1Y00A 3GIRA 3VGUA 2CQCA 3G6VA 2WHOA 4PG6A 5B7WA 1NKCA 2B8PA 5IOLA 4DQIA 1J2VA 1X4FA 1REVB 3POTA 2NSBA 2A0FB 2UXBJ 4FTFA 3CJ4A 4ZLJA 3OUYA 1FKOB 2ZM6C 1R27B 4ZPDA 5DG8A 1QTNB 3IGNA 1RKJA 1PG4A 5E33A 4PXBA 1Q95G 1VRUB 3E01A 1NBEB 1ELOA 2DVIA 1HWUA 1YHQS 2XI2A 3SFUA 3H98A 4G37A 3F73A 3EQ6A 4TU7A 1JLAA 1J5EC 1M90T 4PXCA 2P20A 2HBRB 1VLOA 4ED2A 2HHQA 5GTDA 3NWGA 4QWDA 2C22A 3RRKA 4DL4A 1WHWA 2DNQA 2HG4A 4S0MA 1NK7A 4K8RA 6FDRA 2VB6A 1FI4A 1FJEB 2M9KA 4DG1A 4LQ9A 1QY7A 3IRXA 4ANCA 4Q43A 2ZDPA 3CT9A 1OQ6A 4L75A 1IUJA 1RT6B 4N41A 3BQ1A 1LOUA 3R5GA 5KFLA 4X4RA 3SV4A 4WZMA 2IY5B 4LF6C 3SCIE 2OJ3A 1IJEB 1L5UA 4PR6A 2EFGA 2HHPA 2E5IA 2K1RB 1JMTA 1HNZC 3TJAA 2AKWB 2VU5A 4FXWA 3EYZA 1SUQB 4Q8EA 1NXIA 2FHOB 3QJLA 3I9V9 4C0OC 1FRMA 3DM2B 3CDUA 2R7OA 2E5LJ 4IR9A 2PROA 2OPSB 2NXJA 1WHVA 2C3UA 3THVA 2CVEA 1RKIA 1BHNA 3HFKA 2EGTA 4OV1A 3FBBA 3HHLD 2I5JA 4K7QA 2YKOA 3HSGA 1XC9A 4CI0B 2VJUA 3QQCD 5M2RA 2F4VF 1GX6A 4KPYA 2BE9B 3HHLA 2EVZA 1G6BA 2IFXA 3FNNA 2MKJA 3SDEA 3U1MA 4ANDA 1EETA 1S1TA 3SQOP 2G0CA 3CCZA 1X9MA 4L6V3 3SZ2A 1MG7A 1CJVA 4TU8A 4WJBA 2ZHAA 4Q0BA 1I94C 2LXUA 5BUSA 2H48B 4F50A 1RWKB 5ETLA 4UQTA 3G7SA 3DRRA 5FD1A 2HMIB 2PFDA 3FMBA 4DN0A 2ZUAA 5T8SA 4GKJC 4Y0FA 1GMVA 4KHPC 2W01A 5HO4A 4KGMA 2DPIA 1KLMA 3KLHB 2UUBJ 4B3RC 4DPYA 2CJKA 2B4OA 5E3QA 4ZPBA 5F0WA 1CC7A 3I5AA 3C6TB 5LMNF 4B3MJ 4YQWA 3M8YA 3I0RB 2OPLB 4L2ZA 3TEGA 3G8QA 2JC0A 2CPJA 2OPQB 1E6VB 1KVJA 2LCWA 2YVSA 3W5YA 3KMSA 1HNIB 4EWTA 4M5KA 5A1IA 1TUWA 4WS9A 1NM2A 1UWBB 3MM5A 3GV7B 3HDSA 2Z2LA 2V8DA 4DV7F 4DXLA 3KHLA 3QGIA 4G36A 1MLAA 2WOMA 3A26A 3PNIA 2QX0A 4EBEA 1U48A 3VV2B 3H8YA 2GVDB 4O3OA 4RPFA 2KU7A 3R7NB 1BQXA 2LQJA 2V2ZA 2UUCJ 3NNHA 2LQ8A 2DRDA 2CDRB 2FB0A 3KNAA 4UOFA 4GKKF 1RT5B 4JB8B 2NR0A 2F9JA 1DY3A 3QSYB 3CCUS 4A8MP 4YHHC 2VA3A 2XULA 2L3MA 5J2PA 1AUDA 5C24A 2C2EA 1S72S 2LFVA 1ZPVA 2ZOMA 3TAPA 1S6PB 3IS9A 4PZPA 3J81Y 4KR0B 4H54A 2PT0A 4IG3B 3GSIA 4ZN1A 2PN2A 2R8GA 2IC3B 4ZVEA 4UQGA 2CG8A 3CXCR 2JMPA 2OKQA 4PG7A 4DX6A 1DARA 2ZBIA 2XO7A 2GMJA 2KJVA 4UZBA 5SUHA 2P8IA 4DR6F 4NLRA 2P5VA 4OL8A 1PBAA 1D3WA 3M9MB 4G1IA 5A8WB 2F9DA 2BR0A 2BA9A 5CH7B 4L3KA 4YY3C 2FPHX 4EK2A 5J2MB 1S77D 4PYAA 2JLGA 4F4YA 2ZM6J 2CQ1A 1UEUA 3DLEA 2HZVA 2QFIA 1X31C 1U1NA 3E3XA 5KFDA 1RK8A 1HPZB 3MHYA 1M1HA 2W4CA 2R8HA 5KFKA 4UOCA 2QT7A 2VG6A 4XK8C 5LMNC 4R0MA 2G4BA 2MSTA 1HR0F 1J5EJ 1SJ1A 5BSWA 4V19X 3KLVA 3DLKA 2MLXA 3OL6A 2DR7A 2QLFB 2YH0A 4YB7A 4ID5A 2E8CA 2YX1A 5BYQA 1K8AT 1TV6B 4UOHA 5HI7A 5C2CA 5KFCA 1B3TA 2DH8A 2HVDA 1N32C 3EGZA 4BHQA 3CCMS 2YNHB 3GMGA 3O2EA 3H0PA 4ZIVA 1TL4A 4DG8A 4LF6J 1AFJA 3ELHA 2R2UA 2VPXB 5A1GA 3UOWA 1HNZJ 2PEHA 5E3CA 1YBAA 4K4VA 4XPCA 3TZWA 2KVQE 3EGWB 4M5JA 3PROC 4IQMA 1IWGA 2J7KA 3G8SA 4GKKC 4DV2F 4IRKA 2RF2B 1BA3A 2XC9A 2V9WA 3PRVA 2M8HA 4RNOA 1T3NA 4ED4A 1SC1B 2LQ5A 3TANA 3OJUA 2ILZA 3J7YI 4JOUA 3CVKA 3CW9A 4IH7A 1IN0A 2ZZMA 1RTZA 2DY1A 2MHNA 2PEBA 4P73A 4MH4A 3BR9A 1X0FA 5G0RA 2NZ4A 2HK3A 1VRQC 1LW2A 1UEVA 1I94J 4Z7YA 2DHAA 1NJZA 2AGPA 1MKYA 3FSYA 1CULB 1VI7A 2HBZB 4KTQA 4GKJJ 5KG0A 4X66F 3SO4A 2HNYB 1U2RA 3AY0A 3ZZTA 4KHPJ 3GFXA 4B3RJ 3BV8A 4F25A 4KTVA 3ZTRA 1LWCA 3MEDA 3FJ2A 2RU3A 2BRLA 3PESA 4U67Q 4RLQA 2QZ8A 2BXJA 1G2EA 4KH1B 3SCJE 3GE9A 1SI9A 2CPZA 4O23A 3N6NA 2Y0SD 3FRYA 3A3OB 1MDFA 1WKLA 2DNHA 5M2PA 3OTOF 2HVHA 4LF2A 2OMLA 3R2CJ 4MKVA 4KFBB 3ZTQA 4WIQA 3R2DJ 5ETSA 4EBDA 2VZ9A 3BH7B 3AJ1A 1HR0C 5KFWA 1FWPA 2NSCA 3W65A 5CZVA 1FNXH 4WU3A 1H7WA 1Q53A 1SQFA 4JI8J 4NLGA 2D27A 4OHZA 1C0TB 4P74A 3TZXA 3SQGB 5F8LA 1W2IA 3TNVA 2CIMA 2D9PA 4KB7A 2XS7A 4MIWA 3MMBA 2HZAA 3W9JA 5KT4A 1YJRA 2B6AA 1IM6A 2IJRA 2CZ9A 4H4MA 2YNGB 3C14A 4YHHJ 3OSPA 4WP8A 4NE9C 3T6BA 3HD2A 4DLEA 1VQYA 1WG5A 2ZKTA 3ZZRA 2DK2A 4HLBA 2BKOA 1LWFA 5HVGA 3RBXA 2ZE2A 4RUAA 2AW0A 1RACB 3BREA 1C4CA 2RQKA 3FBEA 2JNVA 3QZ8A 4U7UK 4LIRA 1U26A 1X4HA 4DL0C 1WEYA 1RHKB 3VZHA 3R5JB 3OVSA 3Q22A 1IKWA 2NPFA 4G6VB 3UZ0A 1DURA 1SV5A 5KAKA 2IA6A 1RT2B 4QWAA 4JYAF 1HA1A 2Y1JA 2HNDA 4DR7F 4DU7A 2GGPB 4Q2LA 4JI6C 1FRIA 3KHHA 3J7A1 2VG5B 3R9WA 1WH9A 2Q79A 1EP4A 1TVRB 1OYDA 3AJ2A 4X4PA 4F26A 2HAIA 1S1UB 4YY3J 4EBCA 3KLGA 1S1XA 4DL6A 1NJYA 1S1WB 1WNEA 2XO6A 5C7PA 2N7CA 4ZP9A 3HHKA 1KHWA 2X7IA 2WSFC 5KG2A 3MD3A 2FGOA 4IQXA 3A8JA 2C28A 3NLCA 1WI6A 2DNGA 3TI0A 3MFIA 4IDKA 3EGVA 1ZAVA 4NA3A 3KNGA 2UVUA 1RTDB 4D4IA 5LMNJ 3LNVA 3M32B 1RAIB 3A12A 3RV2A 2RHSB 4DCUA 1RTJA 2VQFF 2HS4A 1VQ6S 4AQYC 2CXEA 2DGWA 3ZC4A 3OTOC 5IWAC 1NB7A 1NPPA 4ECUA 4LF5F 2GMLA 4RNMA 1RA6A 1N32J 5LSRA 3K17A 3QRRA 4ED6A 4QPXA 1T7PA 3VQTA 1NSAA 3D4JA 4FN5A 3CCWA 4WP3A 1NKBA 4ANEA 4CZCA 2FVPA 2IYGA 1S99A 3NGTA 4DL7A 3LOUA 5F9NA 3MM6B 4WK3A 1ZOTA 4L72B 4YDXA 5KOWA 2DIUA 4DL2A 4FUQA 2CZ4A 4M95A 5DRKA 4MKYA 1DZ5A 5FLXY 3R44A 3KXDA 2ZH9A 4WU2A 1HHQA 4K0BA 1TFWA 1RAEB 3CQ1A 1RU1A 3H90A 3KK2B 4GKKJ 1GMUA 4OHYA 5I3QA 1KRPA 5E2QA 3FSXA 3D1HA 4USWA 2WSEC 4QIEA 5AXNA 2EPIA 5FLXD 3M8PB 3X3UA 4R8UB 2EBGA 3VAFA 2N82B 4MTNA 2MZJA 5AT1B 3M4XA 1LNQA 2G0IA 2Q66A 4QYRA 4C0BA 5IT0A 1LK7A 1LWEA 3KMQA 5ETNA 1E6YA 2DYJA 1Y3KA 3MTKA 5IQ6A 1CBKA 3I0SA 5HMZA 4J9OA 2YWGA 3RB6A 5B0AA 2XR1A 1HIYA 3UN2A 2BW2A 1WACA 3CCSS 3LUYA 3T41A 4QU6A 2Y4OA 3HSDA 1B0PA 2YWWA 4IRDA 4IOBA 3V81B 2KT2A 1MROA 5D0RA 5H9FK 3UN5A 3J7ZT 9RUBA 4F4XA 1JLCA 4OLPA 2E9TA 5D3GB 3AD9C 3H2TA 3KK1B 3I9ZA 3UDEA 2E7WA 2YY3A 3DRSB 1O90A 1F2HA 2JX2A 4WF9Q 1FXLA 4PROC 5I3PA 1VIXA 1UPMB 3D7SB 3RR7A 3OJSA 3CJ2A 2HZCA 4K2JA 2UU9F 3QAEA 4MKBA 1R3NA 5KFUA 5HQMA 1SJ4P 4ERDA 3RBZA 1D8YA 4B3OA 2CQGA 3VTIA 4FZVA 4FYWB 4YOEA 1UA1A 1HR0J 4CLPA 3M8WA 3WQPA 5C25B 4USUA 2ZBRA 2W24A 2Z2ZA 3CPWR 1SL0A 5KFBA 2CQDA 2MLZA 4RNHA 4F67A 1BWVA 4A8QA 1UL3A 1YRTA 2LEBA 1ZBTA 5D77A 3K0JA 2EWHA 5IS2A 3W5ZA 4EGLA 1CG2A 3DN9A 2H9ZA 5JXSA 2XMMA 1PA4A 2XB2D 3TQIA 3DOLA 3R9XA 3TR5A 2J76E 2LU1A 3GSDA 2ZDOA 4LF4J 3EPGA 3IG1A 1T9WA 5DO2A 3KJQB 3CO0P 2RKIA 1DQ8A 4FF1A 4QIGA 1R0AB 4DOZA 2GQ2A 3UE2A 1T9XA 4X4OA 5CYMA 3M8SA 3L4BC 4USKA 3QLHB 3ISND 4DV3F 2AYAA 2XS5A 1T3OA 3G6YA 1OY9A 1RI7A 1IB8A 2LQBA 4IFYB 1HHTP 2XLJA 1O0PA 3GTYX 2MYFA 4YUDA 3RRGA 2CRLA 2Y9HA 1Q8LA 3BQ2A 1F3VA 3HZEA 4JI6J 2QW0X 1UETA 4DV6F 3NL0A 3DKDA 5BXIA 1N36F 1F5AA 5D0EA 2R7UA 1WOOA 1HYSA 2R7QA 4CNZA 2QL5B 2MZ1A 4X4TA 2Z0GA 2YNIA 5A8RA 4JI1J 4NYZA 1A7GE 2XS2A 2HPUA 3VQSA 4F2SA 1HNWF 2H5EA 4A8WA 3OL7A 3W5XA 2E66A 3V4IB 4DSEA 4P7TA 1CJTB 3VR1A 3C8YA 2GC8A 5HANA 5CCLA 1H38A 5KFGA 5C2GA 1QJHA 2OTJS 2BJ9A 5DJBA 5H9FJ 2ZD1A 5I4MA 2HQIA 1Z4UA 4CLFA 1CJUB 3SI8A 4AQYJ 4HVZA 3OFHA 5BJRA 3O5TB 4YB5A 3OTOJ 2UU9C 1R8PA 5IWAJ 3PX6A 2B5JA 3NOCA 2HBQB 1A6LA 3AHPA 2HHHF 2AV5A 5CAAA 4DV5C 5FJ4A 4U7CA 4WXWA 4UUWA 4I9FA 4X64F 4KKOB 1M6XC 2W9BB 3FMWA 4GO7X 4N76A 2JEGA 4A8FA 2XG8A 4DR1F 2JHEA 2QGFB 3G82A 4FXVA 3OR2B 2SXLA 2A6MA 4OZJA 4LFCF 1CC8A 1NK8A 3OHAA 5G4DA 1JWWA 1URNA 5L46A 1VLAA 2F65A 2W2MP 3DU6A 2PMZD 1L3VA 1CEZA 3A9VA 3D3CJ 1YKWA 5IQQA 1RHJB 1AYEA 2J9EA 3E7XA 1XERA 4NLTA 3LPYA 1EARA 4RL1A 2W2QP 1SIWB 2HWTA 1HARA 4QIFA 2DR5A 2YKQA 3I82A 4LT6A 3FSIA 3M6VA 3ENWA 2QG9B 1ROFA 4RUBA 4DV3C 3BBBA 5CYQB 9ATCB 2OGUA 1Q8BA 5E3AA 3V6KA 1N34F 3BJYA 3KHGA 3B82A 2NYIA 2VF3A 1NJXA 5GAHU 4B9VA 4GO5X 4CRJA 3HF5A 3I08A 4DR2C 1H2TZ 5CCMA 4B3SC 1VDHA 4NXMF 1TL3B 4DV6C 1G4CA 1VC6A 2DNLA 3OXLA 3BGRB 1HHSA 2ASJA 3AQOA 1BGXT 5E41A 3PYEA 2BX6A 2NQPA 1AXQA 3G6XA 3SBMA 2AMCB 1YK9A 4CQ1A 1PGZA 4HT5A 3HM9A 4TKTA 3LAKA 1X60A 3BGLA 3M1VB 1YSJA 3KFWX 3CC2S 3VAKA 2PA8D 1VFJA 2MY7A 2CWXA 2VFUA 3H2UB 2RUGA 2UXCF 2EG2A 2A10A 3GCXP 1K0TA 3BO3A 3L9ZA 5D4OA 2B4PA 1REGX 3MPUB 1WF1A 2VFTA 2V7BA 2OPRB 1RCOB 2GA7A 2J6UA 1B64A 4OX9C 3KDOA 3M8QB 1QUVA 2HS3A 1MN9A 5F8IA 3QO9A 3QNWB 1UEKA 3W8PA 1WKJA 5HQ8A 2JEJA 4NRTA 3W2WB 2GO8A 2BW7A 4DR1C 1SPBP 4CO2A 2BE7D 3EPIA 2XYPB 2PD1A 1WSVA 5F8GA 3TA0A 3DC2A 5CQGA 2ZITA 3UWTA 1R7IA 3MFHA 4B08A 4KGZB 3OQ2A 3A13A 4RO0A 3BGFA 1WD6A 3Q8VA 3NBPA 3T5HA 3MMJA 1QE1B 1JLEA 5HATA 1SKWA 3PXGa 3CDWA 3BZQA 2QVYX 2YTCA 4I0WA 5E3PA 2JFDA 1DLOA 4TU9A 3HKWA 1M1GA 3B54A 5CHCB 4DL5A 1J5OA 2HGLA 3PJWA 1T5HX 2C1EB 2CNLB 1O92A 1DTQA 4OQJA 4DPOA 1JNRB 3HD1A 4ZJQA 4ZCIA 1T03A 3BH6B 4NCGA 3AH6A 4NLDA 2NPIA 1FEEA 3IM8A 3HK2A 1RWMB 3SIPB 4PG4A 4KHRA 1D9DA 1IBLC 2RQMA 1TFYA 1U0HA 3W2VB 1XBWA 2MJNA 3TUJC 3TQ1A 4I68A 2F3JA 1N34C 4HT7A 4DV0F 4RNFA 4HL9A 1K44A 1SH0A 2GHWA 1QLNA 4A48A 3MR3A 3MEEB 1IQZA 3OSNA 1IR0A 2QL9B 4OI6A 4IR1A 5GMKa 2Y0BB 1ZM4A 5SZTA 3H2VE 2VFSA 4PUOB 3I4HX 2IM3A 1S9EB 4OYWA 4NXMC 1Y10A 3QBCA 3QAUA 1KQSR 4QIWD 3MAAB 3HFVA 4C3LA 1Q86T 4A8OA 5HVHA 1ZTWA 3PIPQ 5F9LA 3W63A 2FJBB 2OMOA 4P52A 1YDLA 4USTA 3BSOA 4EI2A 3W60A 1NK6A 3P49B 2UU9J 1N5YA 2J0QD 4M94A 4JI7F 3GP9A 1V9OA 3TVKA 4NZ6A 1FNMA 2HHWA 4EUVA 2XYHB 4DV5J 2OPPB 5D15A 1RADB 1U02A 4NCAA 1ZYQA 4X65F 1K73T 4KV8A 2R3VA 3JSYA 2UXCC 2EFNA 2GQQA 2DNRA 3MM7A 1W25A 4IR7A 2XBPA 4FS2A 1RT1A 3H25A 5DGBA 2DGOA 4EEYA 1SCJB 5FLXU 3TUIC 2DEJA 2HNZA 1O51A 3K5OA 4CLSA 3POTB 4G1QB 3V6HA 3JTOA 4O3PA 5K8MA 4C8YA 4QIVA 5EGYA 5EHHA 2OBVA 4F7VA 1SJQA 5LT5A 4MKAA 1LW0B 3S01A 4PPDA 4B9NA 1RT7A 2GAGC 4OZ0A 4AFFA 2E5GA 4UY85 1FKPA 4O3NA 1FJCA 4M5LA 4DR4C 5HSPA 1NYEA 4Y34A 4NLQA 3QWUA 3FBFA 4FS1A 3N28A 4N8NA 3QT6A 3N0VA 1S0NA 4X4NA 4JI0F 3SCLE 3AFGA 1OY6A 1IKVA 1OWXA 4I2QB 5EN1A 3ITHB 2CJXB 2H3EB 3IRXB 2ROGA 4LRAA 1VJWA 2KXFA 2BMBA 2KZMA 1HQEB 1Q8IA 4H4OA 3HVWA 2DTJA 4DR2J 4Y6IA 3PY8A 5HMWA 4B3SJ 2AJ2A 3A3NB 4MYTA 1GQEA 2MSSA 1KBRA 2ZVSA 2P9EA 3D6TB 2LVWA 5A8KA 3DLGB 3M7VA 4M5IA 3LGXA 3RR8A 3S6EA 3PFEA 3OLBA 3IWXA 3MMCA 5DLFA 4DPUA 4FF3A 1WELA 3EJMA 2WBMA 3A8EA 4H4KC 3L7OA 1C2PA 3O1LA 3NGRA 1VK8A 4BLGA 3MM8A 1WG1A 4NRUA 5D4LA 2LKZA 4EU0A 3CUNA 2EW9A 3GLJA 4ZVUB 3A25A 1YI2S 2J6TA 2EFQA 4XDDA 3PG9A 4Q45A 4OYPA 2GHVC 5L39A 3THPA 1UW9A 3DHXA 2WD9A 1CQMA 4ZJZA 2E0GA 1OPZA 1YITS 1RCXB 4L3NA 1V25A 2DHHA 4YS2A 4FYVB 3TARA 4OX9J 4PWWA 4I1TA 1S1VA 5HBMA 1WF0A 5L1LA 2WAQD 2UXDF 1X4BA 2XMTA 3WX4A 3IAM9 2DNNA 4DR1J 4IRCA 5H9EK 1Q16B 4FBTA 3DAYA 2P9CA 4GVLA 2C2NA 3KLIB 3UVJB 1RWUA 3CMQA 3EVMA 3EDRB 2D1CA 4OX8A 4EYIB 3Q2TC 4MK8A 4ETZA 4I7FA 2D3O1 4GVBA 1Q5YA 5E5NA 2G13A 1M0SA 2AT1B 1HNVB 2LDIA 3DOKA 2VBYA 2QC3A 5A6WA 4J37A 2K3KA 4HTJA 2XQCA 5A19A 3Q8YA 2DNMA 1SC4B 5KFVA 3D6MB 4ZJOA 5GVQA 1VJQA 1AZSB 4OI3A 4USVA 4DFJA 4NXNF 3LTOA 3AA9A 2YKNA 1X0PA 1IBLJ 1QUPA 3BGOP 1KR4A 3C16A 5IM0A 2PIIA 4LVOP 1N34J 2GVZA 4ZCKA 2KVIA 4FNHA 4NPOA 4ZVSB 1MWYA 2HWIA 4OZ3A 4CWBA 5ETVA 2KJWA 1EQ0A 3GG0A 2AP6A 4HI2A 4OV6A 2QTWA 5BSMA 3NMRA 3KG0A 4D3GA 1RT4A 4LSNB 2AYMA 4NLXA 2IMWP 2UUAF 4DUYF 5KOXA 3RYLA 3UI3A 3TO8A 4XIUA 4OYBA 4PWUA 1AFIA 2A6OA 3G6ES 2PMWA 5HROB 2W7AA 3PW4A 5KT3A 1TU0B 3GIKA 1SH2A 2N3OA 1MW7A 1NJWA 2DCUB 1WC6A 3TX0A 3ZZYA 5AXLA 2V6AA 4C11A 2UXCJ 2EFPA 1EKRA 3DYAA 1TKXA 3TZYA 1TL5A 3SSSA 3A4TA 2NZCA 1OPIA 1XNQJ 3M2UA 1VIOA 2YKMA 2J5AA 1M5HA 4B3TJ 2CZVC 2GS8A 1WOPA 4O4GA 4RBVA 2LDYA 2UXDC 1T9UA 2QE5A 1REVA 1NCLA 2LLZA 1YRXA 2WTFA 1TK8A 3QT8A 5ETRA 2FLNA 4ED3A 5BSVA 4CO3A 3TAMB 2DO4A 2GAHC 4DR4J 3WBZA 4B9LA 4I9GA 1VRUA 2RSQA 5H9EJ 1FX4A 4ICLB 2VFVA 2PO4A 3DLKB 4WTYA 3QFWA 2POKA 3E2EA 4ID5B 1Y4ZB 3SXLA 4ZPVR 1ZM2A 1T94A 3AXKA 1S6QB 2OEMA 2FHKA 2UVWA 3OXFA 1O93A 3WC0A 4DUTA 3A1YG 5D8HB 1PYSB 2EEYA 4CLWA 4DFMA 2MZQA 1QAYA 2CQHA 4DCVA 2ZOFA 5AJ3F 4AE5A 2FGCA 3HJVA 3N9UC 1SL2A 4NCBA 3IMQJ 3T1YC 2HKEA 1WJ9A 3G4SS 2E1PA 1WSRA 5L38A 2VDIA 5D4NA 4ECXA 3OTEA 2FY8A 1U1QA 3ZZZA 4TQRA 3ZZPA 3H20A 4PWDA 2K1RA 3LP1B 4NLUA 1XR5A 3VAMA 1SUQA 1VISA 3DRYA 5KFOA 2JEFA 4W98A 2OIHA 1SQEA 3DM2A 4CO4A 4UZCA 4LBHA 5AE2A 2QYGA 3TRGA 5K14A 3PW7A 2DBBA 3MR7A 4DV4C 2QA1A 4CTAB 2CNOB 2AX0A 4ZVQB 4MH8A 2NXUA 4CM0A 4GXRA 4AXIA 3OXGA 5B0CA 4DCSA 1RHUB 1S48A 3NS6A 3NG8A 1SC6A 2HMIA 5F8MA 4C7QA 1V6HA 1NDPA 1LWCB 1N56A 2B4UA 2ATLA 1HBNB 3MDFA 3OFGA 2QL8A 4DU8A 2QLBB 2N3LA 3A3PB 3CDEA 2APOA 3GV8B 2MGZB 2JOQA 3C6TA 8AT1B 2HGMA 1ZAXA 3KJVB 2ZBQA 3I0RA 3QGGA 3SFGA 1XR6A 2OPLA 4ED1A 1VYAA 3BKUA 2LA4A 5JVGQ 3G87A 2JH3A 2J9DE 2W7OA 4J9MA 2OPQA 1E6VA 1SVDA 1KQFB 3DLHA 3C6UB 1XNRC 1RQ0A 1UVLA 3FGVA 1HNIA 3GWCA 2DYAA 2FZKB 2V4JB 2IBKA 1PKUA 1MWQA 3UDLA 3S8SA 1KONA 2MTLA 2MKKA 4LF8F 1QM9A 2JC1A 3R97A 2ZBPA 3LUSA 3CC4S 2AYEA 2VD3A 4ZVHA 4KO0B 4NZ0A 2GVDA 2L41A 2XY6A 2AYGA 2XY7A 2JFKA 3DGPB 3DOMA 1YJTA 1X9SA 3VZIA 1QSSA 1TP7A 4H4MB 3GR0A 4DEZA 3D6HB 1RT5A 3M30B 2IVFB 2WONB 3DDIA 4WYWA 3CCJS 1TH5A 4DQQA 4NX9A 3ONQA 4J91A 2CQ4A 1SB6A 3D66A 4WCEQ 2GV1A 3VHQA 2FLPA 2P2CB 2AGQA 2I0XA 2MCQA 3L3CA 5LJ3Y 1S6PA 1PAEX 1N5TA 1U45A 5DG9A 1P8GA 1H0HB 2DXFA 1S0MA 4IG3A 3D9BA 3VAIA 1WC0A 1QWIA 3KK3A 2IC3A 3IR6B 2HQCA 2BE2A 3FEXB 2C2ZB 1FWKA 3CF5Q 2C42A 1HD0A 2QIFA 4QW9A 4C4WA 2ZH8A 1S0OA 3GQCA 3CD7A 4ENOA 1VQ9S 2E1MC 1FDDA 3D28A 4FP9A 1ULTA 3T1HC 1FVSA 1F1BB 2ZWPA 2VG7B 4QOTA 1FJGC 4RW7B 4AL7A 5A8WA 5DDOC 4DZ6A 3CGIA 2D1QA 4U8YA 4CYUB 3PBKA 1RLDA 3DMJB 2N4CA 2CAJA 2COLA 2DR8A 3LO3A 4QWEA 2E5HA 2NYHA 1F60B 2FJVA 3W9IA 4FYDA 4YMEA 2WSCC 4ZOSA 2BJ1A 3U27A 3UR0A 3AAWB 5B0FA 1RAHB 5A0YB 1F0XA 3MEGB 1HPZA 2MQ8A 1U6FA 3NNAA 2KH9A 4USHA 1B7YB 1RTJB 3ISNC 1LKZA 4J90A 4R25A 2QV6A 4OZNA 2FJXA 5FDLB 4EFAC 2MKCA 2HBYB 2XMJA 3FQKA 2XHCA 3ENAA 3ENQA 1IWAA 3ZFVA 3D5MA 2VICA 3BPSP 1I5OB 4O3QA 4HHHA 3N79A 2WVDA 1T9TA 1TV6A 1S7HA 5KFMA 4JV5C 4WFAQ 4RW4B 5B0GA 2YNHA 2MDAA 4CNYA 2H4YB 3VNQA 3NKYA 5F3TA 1F2GA 2R7RA 1T02A 3T1YJ 4CT8A 3X1LB 2CU6A 3PO4A 4LF8C 4ETXA 1D9AA 3ULHA 1CLFA 3TR3A 1H6KX 3HLUA 1S79A 1ZM3A 1YGYA 2MEWA 4ELUA 4HPVA 5K5MA 4YR2A 1CPZA 5J1NA 1N0UA 2PMHA 3GV5B 5T8TA 3T3FA 4FBUA 4LFAF 2ZVIA 4ECWA 2YPYA 2YBVA 3PHTA 5GAHI 2ZKUA 5KG1A 1X5SA 1R8CA 5LMUF 2RF2A 4AUKA 5HN0A 4DCTA 3C66A 3K6RA 3TZZA 3PR4A 2Y8WA 1KLNA 1N54B 3KLFB 5HVFA 4DV4J 3VGTA 4ES2A 3BB5A 2V2KA 1C1BA 5DQIA 4NEYA 1DAXA 2ZJQQ 4X2BA 2MMAB 4JV0A 2A2CA 2HFNA 3DRPB 1VRTB 3NI2A 2RU9A 4X4VA 1DFDA 5EWEA 2BBEA 4WPAA 4BC9A 1CULA 2VFRA 4DFPA 2CJ9A 5KG3A 4BS2A 3N6LA 2V94A 2DNKA 2DH9A 4J9UE 2Q1LA 2HNYA 1JLCB 2QMXA 4X4UA 2V8PA 2V4RA 3R7SB 1UFLA 4C48A 1X5PA 3KKFA 5CZXA 3EVOA 4F4ZA 4B9UA 3RAMA 1GXLA 1KOOA 4WK1A 1NZ8A 3MTJA 1FRJA 2HHXA 3R5AA 2NXNA 3IWLA 4F3OA 3L95X 4OI4A 2K06A 1YBTA 1NNDA 2Q6CA 3MECB 1P6TA 2FZCB 2CPFA 2IAJB 4F2RA 3I56S 1U09A 2P02A 4IUFA 1U49A 2R8JA 1XNRJ 2IYIA 2E7XA 1TUGB 1BQMA 1IKXA 4BWJA 4JV2A 1UFKA 2BANB 2QVZX 3UPFA 4TQSA 1H72C 4KFBA 1TKTB 2DPLA 2ASYA 2MJUA 1U1OA 4A8SA 3FUYA 4C8ZA 4JI5J 2PA3A 5K8OA 2HLTA 4L4QA 2NREA 5LM7E 4HKQA 2R8IA 3KHRA 3EWGA 3DXSX 2B56A 3M2RB 3PJXA 2XLKA 4J9QA 2G2OA 2E1AA 4LFBF 3T5LA 1C0TA 2QJ3A 3SQGA 4ZJLA 5GAGI 1WDDA 1ZA1B 3FFIB 2HQ3A 1K0VA 3G8TA 1W2BR 4NLOA 2YNGA 2W9CB 4CH1A 3MCNA 3IBCB 3CSKA 1IR1A 4NWBA 1QSYA 3DNCA 4LFAC 2VH7A 2EKYA 2AGOA 1ZH5A 4USIA 2DNOA 3WIUA 3PYFA 2KTQA 1PILA 1I51B 5J1EB 3NP5A 4WE1A 4USMA 3J7AN 3RU0A 3I4PA 3JQJA 1PO6A 3OLAA 1FE4A 2AZ1A 4LRDA 4NL5A 5KFIA 1RT2A 5KFAA 5F8HA 3T1HJ 1P9QC 3ETOA 3QRQA 4DI6A 3N6MA 3Q89A 2DD8S 1FJGJ 3BBFA 2GGPA 2CJQA 1HYSB 5IT9D 3D1OA 2MHEA 3KTQA 5F3ZA 2VG5A 1IBMC 2V4QA 4IKAA 3TUZC 1TVRA 3JB9k 1S1UA 1YJ7A 3GJQB 1R0BG 3D68A 3J80D 4ZN3A 2DO0A 2HHVA 5K8NA 2VPYB 2KZ0A 1RHRB 2OHDA 1WG4A 1HNXJ 1U1LA 5DM6Q 3LP2B 5DZ7A 5EDWA 2ZEJA 4C8KA 1XMQF 4PUHA 4PPZA 3HT0A 3LQVA 4CDIA 4Z2XA 1RTDA 2DEIA 3H2LA 4CLLA 2XLIA 1QVGR 3M32A 2B4VA 2PE8A 2XMWA 2GW8A 1JLBA 2B5JB 4TPSB 3V6JA 2E29A 4PXEA 4WIIA 1PSDA 2IRUA 1WCJA 4DCPB 3FKBA 2C2MB 2OI2A 8ATCB 1HBMB 3AB2B 2OFHX 3CC7S 4B9TA 1C1CB 1D0EA 4L74A 1YIJS 4JV5J 3VAHA 2YWHA 1K0RA 1BD6A 3B4DA 3H4DA 1TELA 4P2FA 4L7IA 3DRXA 3H7HB 3ZNJ1 1QD1A 4IFVA 3EXCX 5B0EA 1Y11A 4P2XA 4ZVRB 5BYSA 2B43A 4U7UD 3MM6A 4IYQA 3A4IA 1NUEA 2M4MA 3K5NA 3TJ9A 2FC9A 2G2ZA 2AX1A 2E8EA 5EWFA 4MTPA 2ZNYA 5DS7A 3MD1A 5L9NA 4FUTA 2F63A 4DR3F 4P6QA 3VWSA 2KT3A 3GR1A 3IXQA 3KK2A 2Z2YB 4CO5A 1USPB 3DI6B 2LQ9A 2KN4A 1HBUB 2JZ5A 3AOCA 5T7LB 2NXCA 5C5JA 4DS5A 3CDBA 3M8PA 4R8UA 4K4TA 4RW8B 2WB4A 3WZ0A 2ZUGA 3AA8A 2K3IA 2XMAA 2CVIA 4C0HA 1Q7YT 4YDDB 1I6JA 1B7FA 5IV4A 4DSFA 3M9OB 2X1FA 3R7BB 4NI2A 2XCPA 2HIYA 5DG7A 1TR0A 4O44B 2MQPA 3AF5A 2PDAA 2VJVA 2GFFA 5A2QD 5BR8F 2B7CB 4OJ1A 4K50A 3BO4A 4IH6A 6AT1B 2FUG9 1N8RT 3JXOA 2O01C 2YQ1A 2Y3YA 2V34A 3PDNA 3V6DA 1NK4A 3Q23A 3TJ8A 1YJWS 2E44A 2F4VC 4BDPA 4CLTA 1ZZNA 2HHUA 3MAHA 3VF0B 1B70B 4LE5A 3PM9A 4M5DA 3TUPA 2E7GA 1S12A 1KQKA 4V19J 5D3GA 4NA2A 3KK1A 2Y8YA 2XNRA 3KLEB 2D74B 3JQKA 4DWIA 3E7WA 2CJAA 3IEUA 4DR5F 2CQBA 3E8OA 2LA6A 2AWZA 2R7TA 3Q8SB 1XMQC 4FVMA 3BDPA 4ZPCA 2ZHOA 3IA0A 4NLSA 2AEMA 2V2QA 1N0VC 3SV3A 4DHVA 5C25A 2OP5A 1MU2B 2B3TB 1S0VA 5KG4A 4EMDA 2EC0A 4PXDA 2EC2A 1VOMA 3OL8A 3N01A 3BEGB 5CD4H 3QO9B 3Q8PB 4OZLA 3MCMA 3HFZB 3BSCA 4YP3A 1RBOB 3RBDA 2D1SA 2ZH4A 2OFGX 2UXBF 4QR2A 1YVFA 2VQEF 4LF9F 5THWA 1FCAA 2UUTA 4ELVA 2JEIA 4LRFA 1GNKA 4DV7C 3NBPB 4URGA 4OJHA 4XX2A 5KYTA 4HACB 1YJ9S 5T41A 1ZAWA 3AOBA 2W8KA 2UUWA 1TUVA 3OVBA 4LFAJ 1L3TA 1DLOB 1H2VZ 4JM1A 4CH7A 2MY8A 2I8EA 1Y3JA 1S6OA 1HQUA 4QR0A 3QLHA 1DTQB 2IMOA 1DHMA 2L9WA 5J2QB 1GT8A 2CQ2A 4MFBB 1IBKF 4RR5A 2ZH3A 3PX4A 2FHMA 1JXVA 4IFYA 5ETPA 4K4YA 1VHFA 3DDNA 4NCGB 1R0CB 2B9EA 3VVUA 3T1AA 2IDEA 3D2WA 2LXFA 2AZ3A 2C2KB 2DRAA 3K5PA 3PR5B 1HH2P 3OR1B 3FK4A 3O8WA 2YNFB 3R8YA 2D69A 2DNYA 2KM8C 4O3RA 3EM1A 1IBMJ 3HMJG 1IXKA 3CCQS 2IJFA 3LGNA 2QO3A 5BR8C 3R5CA 4QJVA 4LBIA 3RB4A 1PBUA 1MWZA 3LP0A 1TKZB 2E5LF 3EXYA 2IPOB 3FEZA 2J8AA 1HQ2A 2D3ZA 3CCRS 4DR6C 4OFZA 1SJ3P 1CJTA 1JKHB 1KC8T 3CTRA 2QEXS 1PJ6A 1Q1KA 2RT3A 2RIJA 4RLFA 4JI3F 5BSTA 1TMJA 4OJGA 1CJUA 3R5DA 5HJYA 2NUUG 2VUGA 1U6BA 4J9VA 3NCRA 3OD2A 2NXEA 2QVXX 2BQ3A 1AMUA 2I9SA 3P4UB 3GILA 4KKOA 1YZ7A 2XWYA 3JSRA 2P6SA 1Q5VA 2BKNA 4FPRA 3P8BB 3PVXA 3HVAA 2UUBF 1VQ4S 2G0JA 3OR2A 3DHVA 1WEXA 5E7OB 4M5MA 4TLRA 4YB1P 4B3MF 1N5QA 1V3RA 1RABB 1TAQA 4I4BA 5DDQC 1SIZA 3UNYA 4DPTA 3CDAA 2VQEC 4LF9C 4C98A 2BACA 2Z58B 4NYOA 5IC4B 1RUSA 1IKYA 2J9CA 3R3TA 2V0NA 5DM7Q 1CJKB 3I55S 3FC9A 2XGQA 1NHVA 2ZFHA 4J9NA 1Y9OA 2WVEA 4X4SA 3KUEA 2Z51A 4ZLPA 2IBOA 4PG8A 5EX0A 3OT9A 2W2OP 5U47A 1G3OA 1URRA 3IMLA 5LXRA 4H4OB 3I5CA 4OZ2A 3NS7B 4DV2C 5CYQA 2CY1A 1IBKC 5HLFA 2NUHA 2UUCF 3TA2A 3FCWA 3Q8UA 1SH3A 5KFZA 2CXCA 2K7KA 2F4VJ 1QAJA 4EO8A 4DLGA 1KNZA 4QPTA 2XTJP 4JV1A 4PG5A 1TL3A 4IG0B 3M8RA 4I2PB 1M5PC 1FUGA 4OYMA 1QTMA 4WKYA 1JK9B 1VQPS 1JOSA 3UD3P 3HO1A 1MNEA 1P27B 4PYDA 4NOZA 2BJ8A 1AT1B 1P9YA 3UX2A 2E5LC 4XPEA 4X66C 3UD4P 3IN5A 3ET6B 3MF5A 1XMQJ 3MXHP 3KXWA 3GFZA 1TQLA 1FF2A 1DBDA 2ZH2A 5HMYA 1VC0A 4JI3C 1SC3B 1BQNA 2Y1LB 3PV8A 2QYCA 5HBMB 1CS4B 1X7VA 4HI1A 2MPUA 2OPRA 4F04B 1Z2LA 1LK5A 1L3SA 4FNIA 3J7Z5 2GQCA 1MSWD 3M8QA 5I3UB 5LCIA 1M5OC 3V5RA 2KM8B 1KTVA 3JYTB 4KIAA 2Z57B 2MKHA 2ZM6F 4KGVB 3RJMB 4DX7A 1YLXA 3IM9A 3MMAB 3QSIA 2WVFA 3W2WA 1Q79A 1SJRA 4DV7J 3RRHA 4DSKA 5EUHA 5CA5A 5KFFA 3JAMY 1I1GA 4V1Ak 1YJNS 2JRSA 3AT1B 4WP9A 5I42B 3O44A 2ATWA 3D6FB 1Q8KA 1RBLA 4URSA 3OHBA 4KC5A 5GADU 2CQIA 1XRAA 5J2NB 4DX5A 4DFKA 1N6QB 2DISA 4IO9Q 3JAMD 1O8BA 1MXCA 1TL1B 2QFJA 1K1QA 5IT9U 1TZ0A 1RAAB 2EKNA 1NHKL 3KUHA 4HDHA 4LMZA 5K20B 2R7SA 1RWPB 4RU9A 1KKGA 3QIPB 3J80U 3R6GB 5D0GA 2JJ4D 5LL6d 1KHVA 1ZA2B 2VBXA 4ZCMA 3HZGA 1XWLA 2GVZB 4LF6F 1RAFB 4C9DA 1AB8A 4WFBQ 1M6XA 3PKYA 3W2VA 5BR8J 2Y4NA 3N5BA 1HNZF 4LRBA 2ALYB 3ILLA 3MEEA 2FYXA 3PHEA 4R5PB 3GYXB 4J5OA 1RT4B 4DR6J 1FESA 3LGHA 3M9NB 4PUOA 4JYAC 1XTZA 1OMSA 2OO4A 4DR7C 4FPIA 1FNOA 3DXBA 3FVYA 1HBOB 5A6PA 2Z2MA 2QLJB 4F4AA 2NCLA 3MAAA 2M88A 3BKFA 4DV1F 2Z56B 2ATCB 3QRPA 1KEKA 1RYSA 1P7LA 1VHIA 1UAWA 1WC3A 2JL9A 1T05B 1KDNA 3JSMB 3THTA 2HURA 3Q0AA 1S97A 2FJEB 1WF2A 2Y1RI 1NH8A 4UF4A 3EGNA 4C8LA 2OPPA 4KGKA 1U0SA 4K59A 4A47A 4Y65A 3DYAB 1TKXB 1KVKA 4GKJF 4N8OA 3I5BA 4CLUA 2XM3A 2RS8A 3I07A 2YKMB 4B3RF 1U1PA 4A8XA 4J9RA 4O4GB 2VQFC 3GZ7A 1UVIA 3W64A 3LANA 3GIJA 2O5DA 2DGVA 2F40A 3K89A 2P2FA 3VAGA 4G1QA 4JP8A 4LF5C 4ZLLA 3ZTOA 2VQEJ 3Q24A 4LF9J 1DTTB 2IVMA 1ML8A 3CJKB 3RW6A 1B0TA 1LW0A 4F3MA 3P6YC 5F8NA 2BJEA 2GNKA 1FT8A 4WTOB 5A2QU 1CSJA 1XS3A 2WZ1A 1C4AA 4N56A 4C3KA 3ETMA 2QMWA 5KFSA 4KSEB 4OX7A 4D4GA 2J0WA 4ZDNA 3HVTB 2R4FA 2CUYA 1EB0A 3WC2A 3L09A 3ZNUA 2V67A 3GPAA 1TKDA 4DV2J 3EDQB 4I2QA 4OYOA 1IBKJ 2XSJB 4JI8F 3ITHA 3ZO7A 1N88A 2WVBA 2NS1B 4LSZB 2G9OA 1HQEA 4B9SA 1T11A 1V26A 4F36A 2GCFA 4ILMA 2FJAB 2XWXA 2AHOB 1I3OB 1OS5A 4YHHF 2BEFA 1R8HA 3DLGA 5EX3A 2O67A 2M8DB 1M1KT 4DSLA 5IT4A 4PWDB 1T95A 3M2VB 3TW0A 3MUVP 3CJ5A 1FFSB 2RHQB 5AXKA 2AIRB 2HRUA 4LJMA 1NK9A 1IJFB 1WWHA 4X66J 2KYXA 1Y5LB 5AXMA 1R6YA 2GJFA 2GX8A 1XJWB 1FK9B 2HFOA 5K8PA 2KRRA 2VC0A 5K14B 3MR6A 4IOAQ 4DV1C 4QW8A 3B78A 4HDGA 4JI3J 1NHUA 2FC8A 1GX5A 2VOOA 1FFWB 2RRBA 3GCWP 2OD4A 2KHDA 4QU7A 2CYYA 3H5XA 1XEZA 2ONFA 1WHXA 5L1JA 3PO5A 3K7RA 1UFWA 2R2TA 3IFEA 4RW6B 2OAUA 4CO1A 4YY3F 2E1RA 4LF7F 2IM2A 3CJ0A 4WV3A 5KFRA 3DU5A 2J8SA 1TL7B 4P75A 4D56A 3R5BA 2HK2A 3CEDA 3L7PA 4ZVGA 1T0TV 3C46A 4A8YA 3D3BJ 4KH0B 2EFVA 3KLIA 3OPKA 1XHJA 2RS2A 3UVJA 2AJ0A 4P2MA 2HFZA 4USJC 4QQBA 1RTIA 1PAUB 4J9KA 2BQRA 2XHWA 1WOSA 3TOQA 1JJ2R 3M6UA 1BUXA 1HI1A 5BUQA 2V8HA 1UW4A 3GG1A 2QMUB 4WKRA 1S9FA 1HNVA 5DETA 2BJDA 4NMLA 1N32F 2CG4A 2G1DA 3ZZ0A 1X9WA 4ELTA 4E8UA 1JB0C 1BE4A 1HMVA 5GAEU 2OUGA 1AZSA 1NSPA 1RAOA 1S59A 1FFGB 2PN6A 2BDPA 2VA2A 2K7JA 3NGKA 3DOMB 4E2FB 4JI8C 4OYXA 3JSBA 3L8CA 3OL9A 3K58A 1RG9A 4BWMA 3T6JA 1AROP 2YWCA 2OEJA 2N7YA 4RKUC 4JYAJ 1VS3A 3QZ7A 1LEOA 2PFFB 4DR7J 3CB4A 2ASLA 5C42B 4LSNA 4J9LA 1N36C 1YRUA 4PQAA 1NPKA 4LSLB 2BABA 4M5GA 3CJEA 4FVCA 3OW2R 3NXZA 5HROA 3KK3B 4NLWA 1YX2A 1VCTA 1HNWC 1UP1A 4I6AA 1JLFB 3R9LA 2BE2B 1EZZB 2YKPA 2LYVA 3D0GE 1BC6A 3J81D 2KYZA 2ASDA 3MM9B 2BKPA 8RUCA 2H65B 3VNRA 1VQNS 2X3GA 3NGUA 2HAFA 4DZDA 1W7WA 3VALA 2VQFJ 4RW9B 2ROPA 1C0UB 1RDRA 2MKYA 3KJNB 4ALZA 4XDCA 4HTIA 1RWXB 4TY8B 1S9GA 2HHHC 4LF5J 3N54B 2OD6A 4LF7C 2UZAA 2IRXA 2RE1A 2ZJRQ 4PHTA 4NLPA 4X64C 2C3OA 3QT5A 1RTHA 2DJWA 1JLQB 4QR1A 1X5TA 2CADA 4H4KA 3TAMA 1X8DA 1KSPA 4LFCC 4LUBA 1NZAA 1N4LA 4ICLA 4LREA 1TK5A 4LQ3A 3LW5C 5KFNA 1UVKA 3G96A 2O3DA 4OIXA 4R0JA 4X62F 4ECYA 3DHWC 1S6QA 3NWRA 1ZZFA 3HHLC 1GAOA 4U9RA 2HYIB 1N52B 2HVEA 4DQPA 4G65A 5GAGU 1FDAA 3RW7A 4Q8FA 3PZPA 1BWEA 4PABA 4LF4F 4DF4A 2D1RA 3FZBA 3OFFA 2KB2A 2MLYA 3UCZP 1Q81T 1S49A 2P2BA 4K0KF 3B4MA 5E3RA 2DHGA 4K5RA 2HGNA 2HIQA 3LP1A 4QYZK 1RSCA 4C97A 4LR8A 4KY3A 3GB0A 4NOHA 2UV8G 4O4RA 3PKMA 4JI2F 4DV1J 1EQMA 1VBYA 1KFSA 4PQUA 1UZDA 1C1BB 2XZWA 4Q7AA 5JVHQ 2RH3A 3P3DA 4JI6F 4U96A 3G71S 3RAXA 3PACA 5KT2A 2DY9A 4CTAA 2VL1A 5HP1B 3K2YA 3QMQA 3MAQA 3CULA 1HWLA 3LAMA 2H1YA 4K4ZA 2XEXA 3MZIA 3HSZA 2IVYA 3UX3A 4JI1F 2Q43A 1P1TA 1UKUA 1M5KC 4ZLNA 4R1LA 4P9SA 3JAMU 2IJNA 1V3ZA 4Q44A 5JUMA 4AL6A 2VIHA 3C15B 4M1KA 1RT3B 4RJVA 3QFHA 1HBNA 5J1PA 2YXLA 1WC1A 3HVRA 2WP0C 5T14A 3W62A 2M5OA 2MGZA 4C8NA 3HHEA 3AJDA 4FYYB 2HQGA 4AQYF 4ZKAA 3KJVA 4LVNP 2BV3A 2WBRA 1KWMA 5IWAF 3OUYB 2KXNB 2XYGB 1BQMB 1IKXB 5HMXA 3E01B 2KG0A 3C6UA 1X4EA 1TAUA 3IEVA 4BCAA 4OX6A 3M05A 1FTRA 3OBIA 3FBCA 4X84A 2V4JA 1JLAB 1KQGB 4K4SA 5M2UA 1R89A 3D0HE 3TVZA 2MKSA 1F9EB 2VOPA 1HWJA 4X62C 4DV3J 1U8WA 1ZPWX 1V5IB 3HJFA 5KFQA 5K8FA 2EI5A 3MPYA 4KO0A 4DG1B 2BJ3A 2P6TA 3DGPA 3MPWA 2N4DA 2MM9A 2IA0A 2VODA 5CABA 4R0EA 2LXIA 3IO1A 4RNNA 3ILIA 2EG1A 2AQ4A 4LF4C 3AXMA 3CNQP 3M30A 4DV6J 3BPDA 2WONA 1H73A 3BS9A 1N36J 2HEKA 2CJBA 1XRBA 4K0KC 2LU2A 2XZTB 4ZVPB 4DV0C 2BUNA 1D8ZA 4HR2A 1KS2A 4MYUA 4TXSA 3AD7C 2X1AA 4W90B 2FVQA 4YR0A 5ETKA 1HNWJ 1H7XA 4FKYA 3NY0A 3O6QA 1BLUA 2ADBA 1QVFR 4RMNA 4WE1B 3K57A 4ECRA 4QYZJ 4JI2C 3TA1A 1EX8A 5KFJA 2I5JB 4JUZA 1WEZA 1XK8A 2ZNZA 4DN9A 3CD6S 2H5JB 1RHMB 3HHLB 1UCNA 4N77A 2FJDB 1S76D 3SDEB 1XR7A 3T9NA 1EETB 1S1TB 3EICA 2KHCA 4JI7C 4ZHRA 2J6SA 3CE8A 2VG7A 1CJVB 1XMOF 2HHHJ 3FQLA 3WHIA 4Q0BB 3TWZA 3DLBA 3GJSB 4LF7J 4RW7A 3NNCA 2JLEA 2MQNA 3DRRB 4JI1C 4CYUA 3DMJA 4P71A 2MQQA 2R42A 4WFXA 3MURP 4TY9A 4X64J 2VSQA 4X65C 2ZC4A 2DGQA 2HQDA 1NK5A 1NEEA 2DHXA 2GHPA 4GS5A 5D6GA 1VQLS 4K2XA 1KLMB 3A9UA 5ITHA 2FLLA 3MCSA 2RDDA 4QWBA 2BM0A 4LFCJ 2M70A 2ABYA 5IV3A 5A0YA 1FRKA 2KFNA 1DRZA 3MEGA 1JLBB 1JLGA 1AW0A 2CPYA 2CQPA 3UQSA 5L9XA 5B08A 2HQFA 1RJJA 1FEHA 4UW2A 2QA4S 3MUMP 4Q5VA 3TAQA 1QAXA 4ECZA 3WDOA 5FDLA 1PIEA 1IBCB 1NK0A 4Y00A 3BKTA 2J7UA 2D28C 2DGSA 2EBEA 2R2SA 2W8LA 3ISZA 5K85A 4KAIA 2ERRA 2UP1A 3MM5B 2E5JA 4IH5A 3P5TL 4IFVB 2AF6A 4RW4A 2BRKA 2WOMB 1JNZB 3DLPX 3CQ2A 2U1AA 2RNEA 4JI0C 5BSUA 4Q2MA 5ETTA 4ZVTB 2OTLS 1GTHA 2RAQA 1VQ8S 3PJ9A 1JJHA 1DJ0A 4NASA 3BF4A 1PYOB 2BOAA 4J9PA 1GEHA 2JSXA 2AD9A 4KGXB 3QATA 1V60A 2ZC3A 4NXMJ 1TK0A 4CIOA 3AF6A 2DITA 2WB1D 4DJBA 5J2PB 1M5SA 2AJQA 3CQ3A 5C24B 2HS0A 1FRLA 4NI2B 3KLFA 4CCHA 1Q78A 3IS9B 2H51B 4ZMMA 2QSWA 3UDCA 2MB0B 4PRFA 4WFZA 2YX7A 2ZOGA 2R7WA 2D3UA 3DRPA 1O5JA 1VRTA 2W25A 1VEHA 3IPLA 1NDLA 3ADAC 3V6DB 2AJ4A 3BSAA 2F8HA 2FHJD 1KVIA 4U5YD 2I6WA 1K47A 4U8VA 4M5DB 4B17A 2DHSA 5KT5A 4J9SA 4ED0A 3O3LA 2FHJA 2J7WA 3V4MA 2DNPA 3LAXA 4DL3A 3S1TA 2YWEA 1XMOC 4DUZF 3IR7B 2RVJA 2G1HA 3DLLQ 2JVRA 3EERA 2B9XA 4FXDA 3VGVA 1H98A 3DLEB 2K2PA 1Z2ZA 2DXEA 4Y3CA 2G2YA 1QAIA 3T5JA 3LALA 4DV5F 3MECA 1OYEA 1LXJA 4HH1A 2IAJA 4DS4A 4O3SA 2OSRA 5KG6A 3FEYB 1FKOA 4ED8A 2HVZA 1WC4A 4RWWA 4WYLA 2VG6B 4AXJA 3IRWP 3BN7A 2BANA 3TQEA 1DQAA 2YX4A 1NO8A 1UKKA 1IR2A 1TKTA 7FD1A 4TVAB 4M8LA 2IM1A 1KD1T 5IFIA 2FJWA 4X62J 5GADI 1R6VA 1NLKL 3GIMA 4RLEA 4I69A 4XTTA 2HWHA 3BM7A 1K9MT 4WZQA 3TDEA 1SJFA 3US5A 2FVSA 3M2RA 4YN3B 4ED5A 1R8BA 2E7VA 2D9OA 1HKAA 1HL6A 4M5HA 3NPDA 4NXNC 3RAQA 3KYLA 3ZZOA 3FFIA 1T9VA 3C2PA 2BQUA 3LPEA 3MR2A 2KRBA 1RT6A 3IWNC 4K0KJ 3IR5B 3J81U 1N5SA 2F7VA 4RBTA 4AD6A 2W9CA 1EKSA 4DV0J 1P4EA 1UWAA 3GJTB 3A8KA 2H5IB 1HQUB 1VK3A 4E0DA 2AJ1A 3N2QA 2W2NP 2JNJA 3L7UA 3HCXA 2YQ3A 4TN2A 1M5VC 1RYRA 1VBXA 1EGAA 1UMJA 4QZVB 2W4PA 4KE5A 2DCLA 2F8MA 1VR6A 3CMAS 3H40A 4JI2J 1B4SA 2BVZA 4RUHA 2OPSA 4IOCQ 4AL5A 5J1EA 1W26A 4DR2F 2FY1A 2UUAC 4DUYC 1RGVA 3QJJA 4B3SF 1UWDA 5IXUA 3F44A 3ICLA 5BYRA 1Y5NB 4ZITA 3CJRA 5G0RB 3ZZUA 3CCVS 4G1PA 3DDKA 2W9AA 4JI7J 4TLQA 1LW2B 3N5FA 1PJ5A 4ITSA 2V2VA 3G2XA 4HYKA 3OV7A 1SKUB 3LP0B 4X65J 5MLCV 1GK8A 1HFEL 4U6PA 2IHR1 1XN9A 3BSNA 4LF1A 1GH8A 3UFCX 1MXBA 5FIIA 1SBRA 2ZH5A 3R6LB 3MEDB 2UVRA 3QIDA 3LP2A 5KFPA 2YQ0A 2V5HG 1OSCA 2B9WA 3KLHA 4K5SA 4DUZC 2VASA 3Q8QB 2VPZB 3C19A 1JIHA 3BR8A 3SMZA 3JTNA 5ADZA 3PTWA 3PX0A 3BYPA 2H54B 1U25A 2XGPA 1U2FA 1OQ3A 4OX9F 1HBMA 4XO0A 1U1RA 3UDVA 1C1CA 1GMWD 4RZRA 2V68A 2RQ4A 3D67A 3PW0A 3FDSA 4F4WA 1S7IA 4CM2A 1GMWA 2Q3PA 2OLWA 1JX4A 4F0MA 1UWBA 2LMIA 3EVWA 4ATNA 4Y28C 3UW1A 4JI0J 3NGSA 3K8VA 2L08A 3CW8X 1SKSA 3MEKA 4ES3A 1T8EA 4ED7A 2PSZA 3F0NA 1MMNA 4LRCA 4CP5A 4UTGA 2PI5A 1YQHA 4GC6A 3J81j 1X4CA 3GONA 2ZH6A 4PZVA 1OO0B 2W1BA 3QJPA 3JTPA 1BY9A 3MMBB 2HFVA 4OZ5A 3EZ5A 5ETQA 1IKYB 2B6AB 4LR7A 1SKRA 3LNOA 3DLJA 1F6TA 3M6XA 4ZPTR 1USPA 4GC7A 3DI6A 3C14B 1HBUA 4DBQA 5T7LA 2RB7A 1N2FA 1LQLA 1LWFB 4RW8A 2GIQA 4PEOA 2HJGA 2ZE2B 3LA0A 3RBEA 1IBLF 2CFXA 3NRBA 3I31A 1FA0A 4MIBA 1N5VA 2CNNB 2UV8A 2DHMA 2OSQA 4O44A 2CPHA 2VHGA 5HLFB 2NLWA 4F3QA 7FDRA 1IKWB 4RX6A 1SV5B 3ILOA 3CO9A 3OTCA 1ACMB 3CJ3A 4WBFA 1GFWB 2A1BA 2XMUA 2HNDB 3NYQA 1WTBA 2X1BA 1U4BA 1YZ6A 2HHTA 2YWKA 3BDEA 2DGUA 3F41A 1R8AA 1XMOJ 3PCOB 3V2UC 1EP4B 2CJYB 1HW9A 1YTYA 3CCLS 2Q6BA 2RRAA 5MAOA 1VBZA 3KLGB 1S1XB 1VBKA 2R8KA 2LEPA 4IO1A 2UXDJ 1F3FA 2W7PA 1UJ6A 4RWXA 3KLEA 4FYXB 2EK1A 4B9MA 3I32A 4Y2KA 1FRHA 3D1QA 4OJ3A 5ETOA 3I87A 4LIWA 5J2MA 3G86A 1XQIA 4GMKA 3KWMA 4IDKB 3BBCA 1UZHA 3BN4A 4NMXA 1AA1B 2FZGB 3KG1A 4CLZA 3I6PA 3W66A 4JBCA 1BQNB 3HSJA 1MU2A 3Q2SC 1XNQF 4ZS6A 3MR5A 1RU2A 4N5SA 2I38A 4OZ1A 3PRDA 1FLOA 4B3TF 3H5YA 5KG5A 1S4FA 3PRBA 3I96A 1Q0NA 1ICEB 1U8SA 2RILA 3D54A 3UCGA 3BO2A 1ZB8A 4PCQA 4CH0S 1OY8A 4NXNJ 3RG6A 1RY2A 2YKAA 5GAEI 4TNOA 3RG2A 2C2OB 4RVOA 4DR4F 1BXNA 4UOGA 1F9FA 1RBAA 1PC4A 5GMDA 4HACA 3SYZA 2U2FA 1S10A 4K4UA 4W92B 3ZTPA 4F4KA 2CPEA 2KFZA 5CD4A 4HH0A 3S82A 4K4XA 4Y2MA 3FZ2A 1VC5A 1LCIA 4KHMA 3EZUA 4Y2CA 5J2QA 2F8EX 4MJKA 4DMZA 1JJ4A 1FHTA 4MFBA 2UUAJ 4DUYJ 3MWBA 2D7SA 2C2DA 1FO1A 2ZZTA 4RU2A 2J9DA 4OYIA 3FCVA 1LWEB 1Q4RA 2KG1A 1E6YB 4PAAA 4JI4F 5DLGA 3I0SB 2ZJPQ 3OR1A 2XZDB 2YNFA 2MZTA 2B0GA 2Z4PA 2D1TA 2X51A 1YG0A 2RMLA 4I67A 2OELA 3CJTA 1MD9A 4UT4A 2PT7G 3NMAA 3MUTP 2V50A 2AU0A 1VQOS 3NCQA 3CJSA 2Y1IA 1TKZA 4DF8A 3GPCA 2MZSA 1MROB 4ILRA 5GMEA 4Z7CA 2JDJA 2F1FA 4OMFG 5DDRC 3C3LA 4DUZJ 3N4WA 1JKHA 2WW4A 2F5GA 5DV9A 2DT9A 2YWFA 4QWCA 1CQNA 5KYVA 1U7LA 4DDFA 2X3DA 2ZH1A 5F8JA 3OVAA 5H9UA 4IZ6A 1JXLA 3UEBA 1WC5A 3PFOA 4ES1A 3PW5A 4B3OB 2HFSA 2QA2A 1PU1A 4NZ7A 4Y2IA 1JXEA 3HP6A 4EATA 5B0DA 5F41A 3PIOQ 3QGPA 3OFEA 1WKKA 1LFPA 4ZP8A 3PEHA 1X4AA 5DZ6A 3U02A 5AE1A 4RM3A 1KKHA 1GPMA 4B02A 3HPOA 2ZH7A 4U95A 1XNQC 5AE3A 3T9ZA 4KJIA 5CXTA 3BGUA 4MK7A 4QBUA 4DX8H 1PC5A 4B3TC 3T19A 3PYDA 1QM4A 2M5YA 2QSFA 1PJ7A 3ILJA 2GZOA 5AJ3J 3DOLB 4CLKA 4TYBA 5LJ5Y 5DQHA 2VKRA 4P10A 4I56A 2E9RX 3IG1B 1IM4A 1WHYA 2FIUA 2XNQA 5ETMA 1CJKA 1ZS6A 4F02A 1A0OB 5KT7A 3KDNA 2RKIB 2KZZA 4LR9A 2OH2A 4P2SA 2XMVA 1ZB9A 1KTQA 1F5BA 1PYTA 6FD1A 5DQGA 4DSJA 5CYMB 2BOPA 1N33F 4ZPWR 2CDQA 4OYAA 4C3MA 1UVNA 3W3SA 4KRWA 2GO9A 1JJCB 2FVCA 1QDUB 2DIVA 5LMUC 1NRKA 1RB0A 3A8IA 2M0GB 4Z37A 5IT9Y 1FWLA 4M5NA 4OI1A 2M52A 5KFTA 3E51A 4YB6A 2KXHA 3TEHB 1T5DX 4K4WA 4A4JA 3HXMA 4P7VA 2JLFA 3MOJB 2IIHA 3EZOA 2GMHA 4JI4C 4DCOB 4EYHB 4DPXA 4X4QA 4IG0A 3J80Y 2UVVA 1NMEB 4I2PA 3W61A 3G9CA 2WK4A 3CCTA 2YNIB 1LQ9A 5A8RB 2WW8A 1GXUA 3K5LA 2B8QA 4KPCA 3K59A 2RDIA 4EO6A 1NPRA 3HX9A 2VBWA 1S1WA 3PYGA 1VLYA 3ET6A 3P45B 3IGVA 1MMDA 5JRHA 2HVIA 3VGSA 3LWMA 2ZD1B 3H42A 5KT6A 3RZAA 3ENVA 2KDNA 2IM0A 1NH7A 3D0IE 1HWIA 2ZWOA 4L73A 3CWJA 3FRZA 2XY5A 4UY8T 4NA1A 4N7TA 1CS4A 4AT1B 1FD2A 2BJOA 2QN6B 4WWSA 2AEFA 5L1IA 1MMLA 2FLOA 1ZETA 2F4FA 2YH1A 3CW2C 5I3UA 4C8MA 3CCES 3JYTA 3G82B 5D0HA 1IQTA 4ZCLA 2DB1A 3IC1A 3MMAA 2MQLA 3UD5A 4FF2A 2KL8A 4LF8J 4ZIWA 4NYPA 1RTIB 1NU4A 3QT7A 2JVOA 2X1GA 5KTQA 1Y5IB 2AYBA 2FQQB 1V3SA 5I42A 3C5EA 1B99A 1YWXA 1NY8A 1H74A 3IBFB 2VC1A 4ZVOB 2RRNA 5J2NA 4LFBC 1X4GA 1N6QA 4YFUA 3HULA 1TL1A 1TTHB 3JS9A 5K9FA 1X5OA 3KG4A 1HMVB 2BM1A 1F9HA 4OI2A 3UR3C 4BSZA 1Z1ZA 4YR3A 3QIPA 3ZTSA 5A2QY 3HKZD 3CIZA 3B6BA 1SQGA 2QLWA 3T1YF 1N33C 1NKEA 4F8RA 4FKXA 2KFYA 2PGCA 2Y27A 2RJZA 1O9TA 1RISA 2QA4G 2A2DA 4O0NA 1ULRA 1S57A 3HT3A 2DR6A 4EZ6A 3ETCA 1L3UA 3R27A 2JWNA 3QPIA 2C3PA 1UPPA 5L8RC 3DFEA 1FTCA 5D78A 1EJ7L 2I2YA 3GYGA 1FD8A 2VDHA 5H1SV 4R5PA 3TP2A 3EUNA 2ROEA 1LWXA 1WDTA 2FVRA 3J7YU 2PI4A 2MKIA 4BC7A 5HQLA 3V81A 1HBOA 2P2JA 4FDFA 2R9LA 3GJRB 1F5CA 1VGYA 3AQPA 4N47A 5JJBA 3GFHA 4DV4F 2R2RA 4ILLA 3MGJA 4KT0C 1Y7PA 5D4PA 1FERA 3DRSA 1OIAA 1T05A 3JSMA 2J0XA 3H5UA 1HI0P 3NOGA 2CWKA 2DNZA 2ASBA 4HHUA 4WFNQ 2DRBA 1WI8A 1FX2A 4ZPAA 3K8WA 4OHXA 2EXUA 2LECA 5RUBA 1KN6A 3RGIA 1RP5A 2CQ3A 5DDPC 3NGDA 4NLYA 1FVQA 4I64A 4A46A 1UTAA 4OYZA 3NEKA 2KT5A 2AEJA 4YEAA 5E7QA 3QYYA 3SSQA 2W2PP 1VQMS 3CJ8A 1R43A 1S9GB 3LH2S 4OHVA 3GIIA 1UVJA 2ACMA 2V63A 3TX8A 1CVJA 4URQU 1H2UX 1WF3A 3MCOA 3HHDA 1MN7A 2FD2A 5CYJA 1RTHB 2O1PA 3SEOA 4AYBD 2P2QA 1U1MA 3JQMA 4GXQA 3H4BA 4ID8A 2RUSA 1DTTA 2ACYA 3CJKA 5LOQA 4W4MA 1ZTTA 7AT1B 4P72A 1XNRF 4DQSA 4WXOA 4QCLA 1U6ZA 5A76A 1JLEB 2QRRA 1WORA 3PW2A 5B09A 1FXDA 3P96A 4JI5F 1NSKL 1XIQA 3HVTA 3GFYA 2XSFA 3RTVA 2WRMA 1Y0HA 4OHWA 1FDBA 1R0AA 4MAKA 4DR3C 1J5OB 2DGXA 5LMUJ 4DG9A 2XSJA 5L1KA 5JMNA 2C3MA 1U2CA 2DR9A 1T03B 2FTRA 3KUGA 5HL7Q 3AOAA 4E98A 2XI3A 2D7VA 1XRCA 3TUFA 3CD5A 1U24A 1NAQA 4JI4J 2P9GA 1RLCL 2RQCA 2DKOB 4DQRA 1LFWA 1U0HB 3Q86A 1JQGA 1FXRA 1RAGB 2KKHA 1FRXA 3R1HA 3U1LA 2HSEB 3NCPA 3BQ0A 2GJIA 3M2VA 2M3DA 2YCBA 4ZP6A 2YPZA 2NCKL 1KP6A 4KTTA 5E0OA 1UJ5A 5IC6B 1APSA 2PC6A 5KFYA 4MT1A 1EAYC 5KG7A 1LV5A 2CPIA 3EX7B 1HW8A 2DH7A 3MPVA 3NAHA 1FK9A 2KDOA 4PQUB 3S7RA 3V4IA 2MQMA 4ZA1A 1RE1B 1RWVB 3VCDA 1YBUA 1NDKA 1FKAF 2BJ7A 1H3DA 3T1HF 1Q82T 1N5YB 3GKUA 1FJGF 2CNKB 3TYTA 3UN3A 1D09B 4RVNA 3AB4B 3VAJA 1KOHA 4DR5C 1S4EA 1PCAA 4RW6A 1PG5B 3BYRA 4KV8B 1X4DA 1NB2A 2LP4A 3MM7B 3U7JA 2HW3A 1TL7A 2HFUA 3RB0A 3CIMA 2W9BA 1HNXF 2EK6A 1RT1B 1DQ9A 1FDNA 2ADCA 4ECSA 2HNZB 4BBYA 4HEA9 4RUCA 4UUXA 3OTDA 4M63A 2B51A 1VQKS 1RZMA 2R7XA 4LFBJ 3IAS9 1WTFA 1UVMA 4OYCA 1MDBA 2D3OR 1RT7B 2UXBC 1U47A 1RA7A 3UO0A 1BMQB 2MXYA 1FKPB 1FJ7A 3LWLA 2OEKA 5DGAA 1V5VA 1U1KA 1OSDA 1MXAA 4JV5F 4RM2A 2DPJA 2KI2A 1B0VA 1P1LA 1RWNB 3HHNB 3GYNA 1VMBA 2E8FA 2D41A 4JI5C 1N33J 3NYRA 2L9DA 3CMES 2HRTA 2K8GA 1IKVB 3KOAA 4GRSA 2Z8QA 4J7CA 1SL1A 1T9YA 3RUBL 4O0IA 3M8ZA 3MI7X 4ZP7A 3GU0A 4NEZA 1ITPA 5KEIA 1UA0A 1AUSL 3AODA 2B9YA 3Q8RB 1XMBA 1Q7LB 3HI9A 4I6YA 2A18A 2HLUA 5HJXA 3FCCA 2GIRA 3W7BA 1LXNA 4NDNA 4D57A 1G1XA 5A8KB 2QL7B 2E1CA 5B0BA 3EE3A 3UCUP 5C42A 3MMCB 5LXYA 2XCAA 1HD1A 5EWGA 3QGHA 4KQZA 1RAJA 4OI0A 4NLVA 4PKDB 2M5HA 3BGRA 2DXDA 3QWPA 2VZEA 3MM8B 4LSLA 2VKZG 3DGVA 2C2RA 3VNSA 3NS5A 2CPXA 4ER8A 3NAIA 2M7SA 2CQ0A 2IDLA 1FE0A 2XMKA 1JLFA 2Z30B 1KFDA 2R7VA 2GIFA 2L48A 3M1VA 3LGMA 1RWWB 1ZM9A 1YJVA 2A3JA 2DGTA 2IRYA 3EMTA 1O6XA 3MM9A 2V8VA 3WX8A 4ZHRB 2MQOA 2MMYA 4CO0A 3PEJA 2CPDA 2W4DA 1HLWA 1NSQA 4RW9A 1S1VB 2L9NA 1C0UA 1YJUA 1IVZA 4TY8A 1EIYB 1OJ4A 4ZVFA 1P4EC 4DSIA 3CJQA 2E9ZA 2QLXA 3DCAA 3B7WA 5KFXA 1HNXC 3W8GA 5IFMA 1JLQA 3F56A 4R1MA 3UNGC 1L2FA 1JLGB 2ZBCA 2UUBC 1RWOB 5IZHA 4C6AA 5KFEA 2ZZNA 3B8HA 3ZXWA 4MIAA 2HHSA 1G7CB 5BSRA 4XAKA 1UJ4A 2ZHBA 4I7FB 2O66A 4GVBB 4B3MC 2EFOA 4F0KA 1QE1A 3W9HA 1J5EF 4G3IA 3FCEA 2P2MA 4C8OA 4DR3J 4CLYA 3DOKB 5LSLA 4ECVA 4HHJA 2YWBA 5LSOA 2CA9A 1TMMA 2BYCA 2BZ2A 4KBIA 2WVCA 4WFYA 4F0HA 4CT9A 3AD8C 1RXOB 2MZRA 4ECTA 3P5BP 4Y2AA 2RDJA 2M2BA 5BURA 2VPWB 2YKNB 1SXLA 4D3HA 3O2IA 1K1SA 3W1YC 2VBZA 2V8GA 3C16B 5IM0B 1RHQB 4PUGA 3MPDA 4DPWA 5HAOA 2ALZA 3U1NA 4PUIA 1HI8A 1NDCA 4ZK7M 1S5ZA 2J0SD 3T5KA 3H5SA 4OXIA 4ECQA 2HRYA 2WCXA 4C2MA 3FCHA 2ILYA 2UUCC 3IBWA 4TYAA 3VVTA 2H4WB 3RB3A 3H59A
chains in the Genus database with same CATH topology
4TU9A 4B17A 2DHSA 3HKWA 5KT5A 4J9SA 4ED0A 1VOMA 3O3LA 2FHJA 5CHCB 3OL8A 4DL5A 2J7WA 1J5OA 2HGLA 5KFHA 1D9FA 3V4MA 3PJWA 1T5HX 3N01A 2DNPA 2VV5A 3BEGB 2LEAA 4MK9A 1S9EA 4DL3A 3S1TA 2YWEA 3LAXA 5CD4H 1XMOC 2KO1A 4ODJA 3QO9B 2GJ2A 4DUZF 3Q8PB 4OZLA 3IR7B 2RVJA 3TVYA 1O92A 2FDNA 1DTQA 3DLLQ 2JVRA 4ISBA 4OQJA 1R31A 1GXTA 2C3YA 4DPOA 3BSCA 2BH1X 2VONA 3EERA 4YP3A 3K5MA 2B9XA 1JNRB 4FXDA 3RBDA 2CKWA 4DR6C 2D1SA 2ZH4A 4ZCIA 1T03A 2OFGX 3SSRA 2AJFE 4QR2A 2UXBF 1YVFA 1H98A 2VQEF 4LF9F 3DLEB 2K2PA 4NCGA 1HWKA 5THWA 3AH6A 1Z2ZA 1FCAA 4Y3CA 4NLDA 2NPIA 1GTEA 2UUTA 1QAIA 1FEEA 1NJIT 3HK2A 3T5JA 3LALA 4DV5F 4ELVA 2JEIA 1GNKA 3MECA 2KZFA 1LXJA 4HH1A 4PG4A 2IAJA 4KHRA 4DS4A 1D1UA 3LF0A 1D9DA 2RD5C 1IBMF 3NBPB 2OSRA 4DV7C 1IBLC 2RQMA 1TFYA 4URGA 1L3KA 1A9NB 3W2VB 1XBWA 5HP1A 2I1RA 2MJNA 5F0UA 5KG6A 3TUJC 3TQ1A 4OJHA 4XX2A 3FEYB 5KYTA 1FKOA 4I68A 2F3JA 4RBUA 4ED8A 1S6UA 1N34C 2HVZA 4HT7A 4RWWA 4WYLA 2VG6B 3OTBA 4AXJA 4RNFA 4HL9A 5T41A 4DV0F 1I94F 1SH0A 2V9KA 3IRWP 1ZAWA 3BN7A 4C11B 2GHWA 1PG3A 2BANA 2W8KA 1QSLA 3SCKE 2UUWA 3CD0A 4A48A 3R1LA 1QLNA 3MR3A 1N48A 3MEEB 1IQZA 3OSNA 1DQAA 2YX4A 1NO8A 1TUVA 4OLOA 3OVBA 1UKKA 1IR0A 4A8KA 1L3TA 1DLOB 1H2VZ 1TKTA 4OI6A 4CH7A 2MY8A 7FD1A 5GMKa 4IR1A 4JM1A 4M8LA 2B7BB 3M6WA 3MOZA 2IM1A 1VQ7S 4MMOA 1ZM4A 1KD1T 2I8EA 5SZTA 2FJWA 4EZ9A 4KHPF 3H2VE 5GADI 2VFSA 1VQSA 1Y3JA 1S6OA 3M2UB 3I4HX 2IM3A 4PUOB 1S9EB 1HQUA 4NXMC 1RT3A 4I6WA 4QR0A 3GIMA 4RLEA 1VQ5S 4I69A 4FF4A 3QLHA 1DTQB 1Y00A 3QAUA 1KQSR 2HWHA 4QIWD 2IMOA 3BM7A 1K9MT 1DHMA 2L9WA 5J2QB 1GT8A 2CQ2A 2CQCA 4WZQA 4MFBB 1IBKF 3TDEA 2ZH3A 3PX4A 3G6VA 2FHMA 2WHOA 4C3LA 4IFYA 1Q86T 4PG6A 4A8OA 1SJFA 5B7WA 1NKCA 3US5A 4K4YA 1VHFA 3DDNA 2FVSA 1ZTWA 3PIPQ 4NCGB 4DQIA 1J2VA 3M2RA 5F9LA 1X4FA 4ED5A 2FJBB 2OMOA 1R8BA 1REVB 3POTA 3T1AA 3D2WA 2D9OA 2NSBA 2LXFA 1HL6A 3BSOA 1NK6A 2DRAA 3P49B 3K5PA 3PR5B 4FTFA 1N5YA 2J0QD 4M94A 4JI7F 1HH2P 3OR1B 3CJ4A 1V9OA 3RAQA 3NPDA 3TVKA 4NXNC 4NZ6A 1FNMA 3O8WA 1FKOB 3OUYA 2YNFB 3KYLA 2HHWA 1R27B 2ZM6C 3ZZOA 4EUVA 3FFIA 4ZPDA 5DG8A 2DNYA 2KM8C 4O3RA 3IGNA 3C2PA 2OPPB 1RKJA 2BQUA 1PG4A 5E33A 3MR2A 4PXBA 2KRBA 3HMJG 1RT6A 1IXKA 1VRUB 3E01A 3CCQS 2IJFA 3IWNC 3LGNA 3IR5B 4NCAA 1ZYQA 2QO3A 1N5SA 1ELOA 4X65F 5BR8C 1K73T 3R5CA 2F7VA 4RBTA 2W9CA 2DVIA 4QJVA 1HWUA 1YHQS 4KV8A 2XI2A 3RB4A 3JSYA 2UXCC 3SFUA 3H98A 4G37A 2EFNA 1HQUB 3F73A 1VK3A 3EQ6A 2GQQA 2DNRA 3MM7A 4TU7A 1JLAA 1MWZA 1W25A 2AJ1A 3LP0A 4E0DA 3N2QA 1J5EC 1M90T 1TKZB 4PXCA 2E5LF 2P20A 4IR7A 3EXYA 2XBPA 3FEZA 2J8AA 4FS2A 2HHQA 2YQ3A 4TN2A 4ED2A 1M5VC 1RYRA 1RT1A 2D3ZA 3CCRS 1UMJA 3H25A 4OFZA 4QZVB 1VBXA 1EGAA 3NWGA 5DGBA 2W4PA 5GTDA 4QWDA 2DGOA 4KE5A 4EEYA 2DCLA 2F8MA 3CMAS 3TUIC 2C22A 3RRKA 3H40A 1SJ3P 1JKHB 1KC8T 2BVZA 2HNZA 4DL4A 1O51A 3K5OA 1WHWA 3CTRA 4RUHA 2OPSA 4IOCQ 2QEXS 4AL5A 2DNQA 2HG4A 1Q1KA 3POTB 2RT3A 4G1QB 5J1EA 1NK7A 4DR2F 6FDRA 2RIJA 2FY1A 2UUAC 2VB6A 3V6HA 1FJEB 4DUYC 3JTOA 4O3PA 1RGVA 3QJJA 4B3SF 2M9KA 4DG1A 4RLFA 4LQ9A 5IXUA 1QY7A 3IRXA 5K8MA 4JI3F 4C8YA 4QIVA 5BSTA 3F44A 3ICLA 5EGYA 5BYRA 4Q43A 1Y5NB 2ZDPA 3CT9A 5EHHA 4OJGA 2OBVA 3R5DA 1SJQA 5LT5A 5G0RB 1OQ6A 4MKAA 1IUJA 3ZZUA 3CCVS 1LW0B 4G1PA 1RT6B 3DDKA 3S01A 2W9AA 4PPDA 2NUUG 4TLQA 2VUGA 4B9NA 4N41A 1RT7A 1LW2B 1U6BA 3BQ1A 1LOUA 5KFLA 4X4RA 4OZ0A 3N5FA 4AFFA 3NCRA 3SV4A 2E5GA 4WZMA 4UY85 1FKPA 4LF6C 4ITSA 3SCIE 4O3NA 2OJ3A 1FJCA 1IJEB 1L5UA 4HYKA 4DR4C 3OV7A 4PR6A 2QVXX 2BQ3A 1AMUA 2I9SA 1NYEA 3LP0B 2EFGA 4Y34A 5MLCV 2HHPA 2E5IA 4NLQA 3QWUA 2K1RB 3GILA 1JMTA 1HNZC 1HFEL 4U6PA 4KKOA 2IHR1 1XN9A 3BSNA 4FS1A 1GH8A 2XWYA 3JSRA 2P6SA 3N28A 4N8NA 3UFCX 1MXBA 4FPRA 4FXWA 3N0VA 3EYZA 1SUQB 5FIIA 3PVXA 4Q8EA 1SBRA 2ZH5A 2FHOB 1S0NA 3HVAA 3QJLA 3I9V9 4C0OC 1FRMA 4X4NA 3DM2B 3CDUA 2R7OA 4JI0F 3SCLE 1VQ4S 2UUBF 4IR9A 2PROA 2OPSB 1IKVA 3MEDB 3OR2A 2UVRA 1OWXA 1WHVA 4I2QB 3QIDA 3LP2A 5KFPA 2C3UA 3THVA 2CVEA 2V5HG 3DHVA 1WEXA 5EN1A 1RKIA 1OSCA 2B9WA 3HFKA 5E7OB 3ITHB 2EGTA 4TLRA 4YB1P 3KLHA 4K5SA 4DUZC 4OV1A 3IRXB 2ROGA 1N5QA 4B3MF 1VJWA 2KXFA 2KZMA 1V3RA 3HHLD 2VASA 1HQEB 1Q8IA 4H4OA 2I5JA 3Q8QB 2YKOA 1TAQA 3HVWA 2DTJA 4I4BA 2VPZB 1XC9A 5DDQC 4Y6IA 1JIHA 1SIZA 3PY8A 4CI0B 3BR8A 3SMZA 5M2RA 2F4VF 5HMWA 1GX6A 3CDAA 4KPYA 3JTNA 5ADZA 2VQEC 4MYTA 4LF9C 1GQEA 2MSSA 3PX0A 3HHLA 4C98A 2EVZA 1U25A 2BACA 1G6BA 2IFXA 2ZVSA 2XGPA 1U2FA 4NYOA 3FNNA 2MKJA 3SDEA 3U1MA 2P9EA 1OQ3A 4OX9F 2LVWA 1EETA 1HBMA 1S1TA 5A8KA 1IKYA 3DLGB 4XO0A 1U1RA 2J9CA 3R3TA 2G0CA 2V0NA 3CCZA 4L6V3 5DM7Q 1X9MA 3LGXA 3SZ2A 3RR8A 3S6EA 1C1CA 3PFEA 3OLBA 4TU8A 4WJBA 3I55S 3IWXA 3MMCA 2ZHAA 4Q0BA 1I94C 2LXUA 5BUSA 2XGQA 4F50A 5DLFA 1NHVA 2ZFHA 4UQTA 4RZRA 4J9NA 1WELA 4FF3A 2WBMA 2RQ4A 1Y9OA 3A8EA 4H4KC 3G7SA 3DRRA 5FD1A 2HMIB 3L7OA 3PW0A 3FDSA 3FMBA 4DN0A 4F4WA 4X4SA 1C2PA 3O1LA 1VK8A 2Q3PA 3MM8A 1WG1A 5T8SA 4GKJC 4NRUA 2OLWA 4ZLPA 4Y0FA 5D4LA 2IBOA 1JX4A 1UWBA 2LMIA 4PG8A 4KHPC 5EX0A 2LKZA 4KGMA 4Y28C 4ATNA 5HO4A 2DPIA 4EU0A 1KLMA 3KLHB 5U47A 3UW1A 3CUNA 2EW9A 4B3RC 1G3OA 1URRA 3IMLA 3K8VA 2B4OA 2L08A 5LXRA 5E3QA 4ZPBA 5F0WA 1SKSA 2CJKA 3CW8X 4H4OB 1CC7A 3I5CA 4DV2C 5CYQA 2CY1A 3MEKA 1YI2S 4ES3A 1T8EA 3I5AA 4ED7A 1IBKC 2PSZA 2J6TA 1MMNA 2EFQA 3C6TB 4XDDA 4Q45A 5LMNF 2GHVC 5L39A 3THPA 2PI5A 1YQHA 3DHXA 2NUHA 4YQWA 5HLFA 3TA2A 2UUCF 4GC6A 2WD9A 1X4CA 3I0RB 1SH3A 5KFZA 1CQMA 2K7KA 2ZH6A 2CXCA 2OPLB 4ZJZA 4L2ZA 1OO0B 3JTPA 3QJPA 1BY9A 3MMBB 4OZ5A 1OPZA 3EZ5A 4EO8A 4DLGA 1QAJA 2E0GA 1IKYB 2B6AB 1SKRA 1YITS 4QPTA 1KNZA 3DLJA 3M6XA 4JV1A 3G8QA 4L3NA 4PG5A 4ZPTR 1TL3A 2JC0A 2CPJA 1V25A 1USPA 4GC7A 3DI6A 4IG0B 3M8RA 2OPQB 1E6VB 1KVJA 4I2PB 1HBUA 3TARA 2LCWA 2YVSA 1M5PC 4I1TA 1S1VA 4DBQA 5HBMA 5T7LA 1WF0A 3KMSA 1HNIB 2RB7A 4EWTA 5L1LA 1FUGA 2WAQD 2UXDF 1QTMA 1N2FA 5A1IA 1X4BA 4WKYA 4WS9A 2XMTA 3WX4A 1LQLA 1LWFB 4RW8A 3IAM9 1UWBB 2GIQA 3MM5A 1JK9B 2HJGA 3GV7B 2ZE2B 3HDSA 1VQPS 1JOSA 2DNNA 3UD3P 3HO1A 1MNEA 3RBEA 1P27B 2Z2LA 4NOZA 2V8DA 1IBLF 2CFXA 4DV7F 4IRCA 1Q16B 2E5LC 3KHLA 3QGIA 3NRBA 4G36A 4XPEA 4FBTA 3DAYA 4X66C 2WOMA 2P9CA 3UD4P 3I31A 3IN5A 1FA0A 4MIBA 3KLIB 1N5VA 3MF5A 1RWUA 3PNIA 2D1CA 2UV8A 3MXHP 4EBEA 1U48A 2OSQA 4O44A 2CPHA 5HLFB 3KXWA 2NLWA 4OX8A 4EYIB 4F3QA 7FDRA 3GFZA 3H8YA 4O3OA 3Q2TC 4MK8A 1TQLA