2ONFA

Crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
GMHVYESDVSWIDDRRTEVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRMGINLKSWNSHVTAELGPSPEKGFKFHRIKIHVKIGVNDEDKEKIPRAMQLAEKYCFISRAIRNNVEEIVDYEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_393673.1) from Thermoplasma acidophilum at 1.70 A resolution
rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
molecule keywords Hypothetical protein Ta0195
total genus 37
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2onfA01
2HJGA 2CY1A 4NXMC 2ATWA 4DR6C 4LF4C 4LF7C 4JI0C 4MH4A 2PT7G 4YHHC 3IEUA 4JI5C 5A2QD 2E8EA 4DV7C 4K0KC 2VQFC 1N34C 3T1HC 1HNZC 2UUAC 3AF6A 1ZB8A 1QWIA 1WH9A 4LFCC 4XX2A 1NYEA 3EERA 4DCSA 2JMPA 4B3MC 4LF6C 4MTNA 4DR2C 4DV4C 2DYJA 4B3SC 1N2FA 4DR4C 4DUYC 1J5EC 2XR1A 1FJGC 4DR3C 2E8FA 4DR5C 2ONFA 1ML8A 2UU9C 2UXCC 1UKKA 3J81D 2E8CA 2F4VC 4JI6C 3R9XA 2EGTA 4X62C 1LQLA 1XMOC 4LFBC 1IBLC 4DV1C 3T1YC 2PN2A 1USPB 4X64C 4JI2C 1WF3A 3AF5A 4DCUA 3IEVA 2E7GA 2OPLB 1MKYA 1ZB9A 2YCBA 1IBKC 4JI8C 5LMUC 1N36C 4LFAC 2ASBA 4JI4C 4YY3C 1PA4A 5BR8C 1I94C 4X66C 2UUCC 3CJEA 4JI1C 1JOSA 1VLAA 4DCTA 3R9WA 2BJOA 4DV5C 5LMNC 3JAMD 2OPLA 1XMQC 2E5LC 5IT9D 4B3RC 1XNRC 1HR0C 1HNXC 4JI7C 1HNWC 2ZM6C 3I07A 4KHPC 1N32C 2UXDC 4JI3C 4B3TC 4DR1C 4DCVA 1N33C 1USPA 4GKJC 5FLXD 5IWAC 4DUZC 4DV2C 4JYAC 1XNQC 4AQYC 3OTOC 4GKKC 3GKUA 4JV5C 1EGAA 1L2FA 4DR7C 4LF5C 3J80D 2QL8A 1IBMC 4LF8C 2UUBC 2HHHC 4NOZA 2D7VA 4LF9C 4NXNC 1HH2P 1K0RA 4X65C 1KKGA 4DV6C 3LUSA 2VQEC 4DV3C 4BSZA 4DV0C 4OX9C 2CXCA 2UXBC 2KZFA
chains in the Genus database with same CATH superfamily
4LF4C 4LF7C 4JI0C 3A25A 3GR0A 4YHHC 1UWDA 2KZ0A 1MDFA 1FUGA 3T1HC 1N34C 2UUAC 4TPSB 2MCQA 1NYEA 2P2QA 4LF6C 3FCCA 1MD9A 1P4EA 1MXBA 5BURA 4RM2A 4U5YD 5KYVA 2OBVA 4DR3C 2D27A 2Y4OA 5K85A 2E8CA 3A9UA 4IZ6A 3B7WA 1XMOC 3A9VA 4ISBA 4D4IA 1IBLC 4DV1C 3T1YC 5T8TA 4JI2C 2JNVA 1AMUA 1TH5A 1N36C 3S82A 4LFAC 2ASBA 4RVOA 2V7BA 4PROC 2D1RA 5BR8C 4WS9A 3NPDA 3JAMD 1NY8A 3N2QA 1XNRC 3CQ1A 5AE2A 3I07A 4ZJZA 2WD9A 2QVYX 2P2BA 2UXDC 1V60A 5A1IA 3NI2A 1XRAA 3CQ3A 4DUZC 1XNQC 5BSRA 3OTOC 2YWBA 1LCIA 1PU1A 1IBMC 3G7SA 2DPLA 1O90A 5AE1A 3K6RA 2D7VA 4NXNC 5DV9A 5AE3A 2KDNA 1XS3A 1QM4A 4BCAA 3LUSA 3E7XA 3N54B 3E7WA 2DHMA 2UXBC 2KZFA 4KTVA 3UOWA 4MH4A 3CW8X 2QVZX 4RM3A 5A2QD 2E8EA 3AF6A 2WP0C 1WH9A 1VEHA 4DCSA 4B3MC 4MTNA 2DYJA 1RG9A 4RMNA 4DUYC 1J5EC 2XR1A 2E8FA 4DR5C 2ONFA 1UKKA 3J81D 4FTFA 4PHTA 4JI6C 4RLFA 1BA3A 1LQLA 5A1GA 4LFBC 5E7QA 4G1IA 2PN2A 1USPB 5GTDA 1MXAA 2OPLB 1MKYA 1ZB9A 4RVNA 4LE5A 2OO4A 1IB8A 4JI4C 2BH1X 5K8FA 4X66C 3UZ0A 2YX1A 1JOSA 2CU6A 3R9WA 2BJOA 1XMQC 2MMAB 2P2FA 3TDEA 1HR0C 4JI7C 1HNWC 5A19A 2ZZMA 2QW0X 4DCVA 1N33C 1XHJA 1O92A 4GKJC 3CQ2A 3UX3A 1P4EC 4HPVA 4DV2C 3UX2A 4AQYC 2M5HA 4GKKC 4JV5C 1EGAA 3LAXA 4DR7C 2E0GA 3J80D 2QL8A 2UUBC 3SO4A 4DG9A 3VNSA 2AYAA 3I08A 4L7IA 4X65C 1KKGA 2D1QA 5KEIA 4DV6C 4GXRA 4DV3C 4DV0C 4OX9C 2HJGA 2CY1A 4NXMC 2ATWA 4FUTA 4DR6C 3TQIA 2PT7G 3VNRA 2VSQA 3L8CA 1V26A 4DV7C 4K0KC 2VQFC 1HNZC 1QWIA 1ZB8A 5CZXA 4LFCC 1O9TA 2JMPA 1PG4A 2QVXX 5JRHA 4DV4C 1ULTA 4B3SC 1N2FA 4DR4C 3ETCA 1FJGC 3NYRA 4OXIA 1XRCA 1ML8A 2UU9C 2F4VC 4EATA 4BC7A 3DHVA 2P2MA 2ZZNA 5CZVA 1XRBA 3AF5A 4DCUA 4K0BA 3TUFA 1IBKC 5LMUC 4R0MA 4KTTA 5IFIA 1I94C 2UUCC 1MDBA 3CJEA 1P7LA 4JI1C 4DCTA 3DAYA 4DV5C 5LMNC 3PESA 2E5LC 4D57A 3VNQA 5T8SA 3DLPX 4PZPA 3TR3A 1USPA 2P2JA 2P02A 3A26A 4JYAC 1WCJA 1T5HX 3ETOA 4GXQA 4I9FA 1M6XC 5H9UA 2VZEA 4LF5C 4R1MA 4LF8C 3C5EA 3PROC 3KXWA 4LF9C 1HH2P 4BBYA 2D1TA 1O93A 3FCEA 3GR1A 1K0RA 4WV3A 5BSUA 4JM1A 2VQEC 2Z51A 4BSZA 5KYTA 1V25A 3EQ6A 5BSMA 4I9GA 2CXCA 4D56A 3NYQA 2M5OA 2D1SA 1MXCA 3IEUA 4JI5C 4NDNA 4DG8A 1GPMA 3CW9A 4XX2A 3EERA 4DR2C 3LGXA 5BSWA 2PROA 3IPLA 3RG2A 3A4IA 4BC9A 4G36A 4OYCA 2UXCC 4GS5A 5ADZA 2NCLA 3L95X 5BSVA 3R9XA 2EGTA 4X62C 4X64C 1WF3A 3IEVA 1M6XA 2E7GA 3O2EA 2YCBA 4FUQA 4JI8C 3IMLA 3PBKA 5BUSA 4YY3C 1PA4A 1PG3A 4R1LA 1VLAA 3RV2A 2MM9A 2OPLA 4PUHA 1RY2A 5IT9D 4B3RC 3AY0A 4PUIA 1HNXC 2Y27A 2ZM6C 4G37A 4KHPC 4IR7A 4ODJA 1N32C 4JI3C 4B3TC 4DR1C 2Y4NA 5FLXD 5IWAC 3H2TA 5BSTA 3GKUA 4PUGA 3LNVA 1L2FA 1YJ7A 2HHHC 2D28C 4NOZA 3R44A 4RLQA 3UEBA 3LNOA 4L2ZA 2P20A 4ZLPA 3GPCA 4D4GA 1T5DX 2YWCA 1FLOA 5BUQA 4L4QA 5LCIA
chains in the Genus database with same CATH topology
4LF4C 4LF7C 4JI0C 3GR0A 4YHHC 1N34C 1MDFA 1FUGA 3T1HC 2UUAC 4TPSB 1NYEA 2P2QA 4LF6C 3FCCA 1MD9A 1MXBA 5BURA 4DR3C 4RM2A 4U5YD 2OBVA 5KYVA 2D27A 2Y4OA 5K85A 2E8CA 3A9UA 4IZ6A 3B7WA 1XMOC 3A9VA 4ISBA 4D4IA 1IBLC 4DV1C 3T1YC 5T8TA 4JI2C 1AMUA 1N36C 3S82A 4LFAC 2ASBA 4RVOA 2V7BA 4PROC 2D1RA 5BR8C 4WS9A 3NPDA 3JAMD 3N2QA 1XNRC 5AE2A 3I07A 4ZJZA 2WD9A 2QVYX 2P2BA 2UXDC 5A1IA 3NI2A 1XRAA 4DUZC 1XNQC 5BSRA 3OTOC 2YWBA 1LCIA 1IBMC 3G7SA 2DPLA 1O90A 5AE1A 2D7VA 4NXNC 5DV9A 5AE3A 1QM4A 4BCAA 3LUSA 3E7XA 3N54B 3E7WA 2UXBC 2KZFA 4KTVA 3UOWA 4MH4A 3CW8X 2QVZX 4RM3A 5A2QD 2E8EA 3AF6A 2WP0C 1WH9A 4DCSA 4B3MC 4MTNA 2DYJA 1RG9A 4RMNA 4DUYC 1J5EC 2XR1A 2E8FA 4DR5C 2ONFA 1UKKA 3J81D 4FTFA 4PHTA 4JI6C 4RLFA 1BA3A 1LQLA 5A1GA 4LFBC 5E7QA 4G1IA 2PN2A 1USPB 5GTDA 1MXAA 2OPLB 1MKYA 1ZB9A 4RVNA 4LE5A 2OO4A 4JI4C 2BH1X 5K8FA 4X66C 3UZ0A 1JOSA 3R9WA 2BJOA 1XMQC 2P2FA 3TDEA 1HR0C 4JI7C 1HNWC 5A19A 2QW0X 4DCVA 1N33C 1O92A 4GKJC 4HPVA 4DV2C 4AQYC 4GKKC 4JV5C 1EGAA 3LAXA 4DR7C 2E0GA 3J80D 2QL8A 2UUBC 3SO4A 4DG9A 3VNSA 2AYAA 3I08A 4L7IA 4X65C 1KKGA 2D1QA 5KEIA 4DV6C 4GXRA 4DV3C 4DV0C 4OX9C 2HJGA 2CY1A 4NXMC 2ATWA 4FUTA 4DR6C 3TQIA 2PT7G 3VNRA 2VSQA 3L8CA 1V26A 4DV7C 4K0KC 2VQFC 1HNZC 1QWIA 1ZB8A 5CZXA 4LFCC 1O9TA 2JMPA 1PG4A 2QVXX 5JRHA 4DV4C 1ULTA 4B3SC 1N2FA 4DR4C 3ETCA 1FJGC 3NYRA 4OXIA 1XRCA 1ML8A 2UU9C 2F4VC 4EATA 4BC7A 3DHVA 2P2MA 5CZVA 1XRBA 3AF5A 4DCUA 4K0BA 3TUFA 1IBKC 5LMUC 4R0MA 4KTTA 5IFIA 1I94C 2UUCC 1MDBA 3CJEA 1P7LA 4JI1C 4DCTA 3DAYA 4DV5C 5LMNC 3PESA 2E5LC 4D57A 3VNQA 5T8SA 3DLPX 4PZPA 1USPA 2P2JA 2P02A 4JYAC 1T5HX 3ETOA 4GXQA 4I9FA 5H9UA 2VZEA 4LF5C 4LF8C 4R1MA 3C5EA 3PROC 3KXWA 4LF9C 1HH2P 4BBYA 2D1TA 1O93A 3FCEA 3GR1A 1K0RA 4WV3A 5BSUA 4JM1A 2VQEC 4BSZA 5KYTA 1V25A 3EQ6A 5BSMA 4I9GA 2CXCA 4D56A 3NYQA 2D1SA 1MXCA 3IEUA 4JI5C 4NDNA 4DG8A 1GPMA 3CW9A 4XX2A 3EERA 4DR2C 3LGXA 5BSWA 2PROA 3IPLA 3RG2A 3A4IA 4BC9A 4G36A 4OYCA 2UXCC 4GS5A 5ADZA 3L95X 5BSVA 3R9XA 2EGTA 4X62C 4X64C 1WF3A 3IEVA 2E7GA 2YCBA 4FUQA 4JI8C 3IMLA 3PBKA 5BUSA 4YY3C 1PA4A 1PG3A 4R1LA 1VLAA 3RV2A 2OPLA 1RY2A 5IT9D 4B3RC 1HNXC 2Y27A 2ZM6C 4G37A 4KHPC 4IR7A 4ODJA 1N32C 4JI3C 4B3TC 4DR1C 2Y4NA 5IWAC 5FLXD 3H2TA 5BSTA 3GKUA 3LNVA 1L2FA 1YJ7A 2HHHC 2D28C 4NOZA 3R44A 4RLQA 4L2ZA 2P20A 4ZLPA 3GPCA 4D4GA 1T5DX 2YWCA 5BUQA 4L4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJG A;  2CY1 A;  4NXM C;  2ATW A;  4DR6 C;  4LF4 C;  4LF7 C;  4JI0 C;  4MH4 A;  2PT7 G;  4YHH C;  3IEU A;  4JI5 C;  5A2Q D;  2E8E A;  4DV7 C;  4K0K C;  2VQF C;  1N34 C;  3T1H C;  1HNZ C;  2UUA C;  3AF6 A;  1ZB8 A;  1QWI A;  1WH9 A;  4LFC C;  4XX2 A;  1NYE A;  3EER A;  4DCS A;  2JMP A;  4B3M C;  4LF6 C;  4MTN A;  4DR2 C;  4DV4 C;  2DYJ A;  4B3S C;  1N2F A;  4DR4 C;  4DUY C;  1J5E C;  2XR1 A;  1FJG C;  4DR3 C;  2E8F A;  4DR5 C;  2ONF A;  1ML8 A;  2UU9 C;  2UXC C;  1UKK A;  3J81 D;  2E8C A;  2F4V C;  4JI6 C;  3R9X A;  2EGT A;  4X62 C;  1LQL A;  1XMO C;  4LFB C;  1IBL C;  4DV1 C;  3T1Y C;  2PN2 A;  1USP B;  4X64 C;  4JI2 C;  1WF3 A;  3AF5 A;  4DCU A;  3IEV A;  2E7G A;  2OPL B;  1MKY A;  1ZB9 A;  2YCB A;  1IBK C;  4JI8 C;  5LMU C;  1N36 C;  4LFA C;  2ASB A;  4JI4 C;  4YY3 C;  1PA4 A;  5BR8 C;  1I94 C;  4X66 C;  2UUC C;  3CJE A;  4JI1 C;  1JOS A;  1VLA A;  4DCT A;  3R9W A;  2BJO A;  4DV5 C;  5LMN C;  3JAM D;  2OPL A;  1XMQ C;  2E5L C;  5IT9 D;  4B3R C;  1XNR C;  1HR0 C;  1HNX C;  4JI7 C;  1HNW C;  2ZM6 C;  3I07 A;  4KHP C;  1N32 C;  2UXD C;  4JI3 C;  4B3T C;  4DR1 C;  4DCV A;  1N33 C;  1USP A;  4GKJ C;  5FLX D;  5IWA C;  4DUZ C;  4DV2 C;  4JYA C;  1XNQ C;  4AQY C;  3OTO C;  4GKK C;  3GKU A;  4JV5 C;  1EGA A;  1L2F A;  4DR7 C;  4LF5 C;  3J80 D;  2QL8 A;  1IBM C;  4LF8 C;  2UUB C;  2HHH C;  4NOZ A;  2D7V A;  4LF9 C;  4NXN C;  1HH2 P;  1K0R A;  4X65 C;  1KKG A;  4DV6 C;  3LUS A;  2VQE C;  4DV3 C;  4BSZ A;  4DV0 C;  4OX9 C;  2CXC A;  2UXB C;  2KZF A; 
#chains in the Genus database with same CATH topology
 4LF4 C;  4LF7 C;  4JI0 C;  3A25 A;  3GR0 A;  4YHH C;  1UWD A;  2KZ0 A;  1MDF A;  1FUG A;  3T1H C;  1N34 C;  2UUA C;  4TPS B;  2MCQ A;  1NYE A;  2P2Q A;  4LF6 C;  3FCC A;  1MD9 A;  1P4E A;  1MXB A;  5BUR A;  4RM2 A;  4U5Y D;  5KYV A;  2OBV A;  4DR3 C;  2D27 A;  2Y4O A;  5K85 A;  2E8C A;  3A9U A;  4IZ6 A;  3B7W A;  1XMO C;  3A9V A;  4ISB A;  4D4I A;  1IBL C;  4DV1 C;  3T1Y C;  5T8T A;  4JI2 C;  2JNV A;  1AMU A;  1TH5 A;  1N36 C;  3S82 A;  4LFA C;  2ASB A;  4RVO A;  2V7B A;  4PRO C;  2D1R A;  5BR8 C;  4WS9 A;  3NPD A;  3JAM D;  1NY8 A;  3N2Q A;  1XNR C;  3CQ1 A;  5AE2 A;  3I07 A;  4ZJZ A;  2WD9 A;  2QVY X;  2P2B A;  2UXD C;  1V60 A;  5A1I A;  3NI2 A;  1XRA A;  3CQ3 A;  4DUZ C;  1XNQ C;  5BSR A;  3OTO C;  2YWB A;  1LCI A;  1PU1 A;  1IBM C;  3G7S A;  2DPL A;  1O90 A;  5AE1 A;  3K6R A;  2D7V A;  4NXN C;  5DV9 A;  5AE3 A;  2KDN A;  1XS3 A;  1QM4 A;  4BCA A;  3LUS A;  3E7X A;  3N54 B;  3E7W A;  2DHM A;  2UXB C;  2KZF A;  4KTV A;  3UOW A;  4MH4 A;  3CW8 X;  2QVZ X;  4RM3 A;  5A2Q D;  2E8E A;  3AF6 A;  2WP0 C;  1WH9 A;  1VEH A;  4DCS A;  4B3M C;  4MTN A;  2DYJ A;  1RG9 A;  4RMN A;  4DUY C;  1J5E C;  2XR1 A;  2E8F A;  4DR5 C;  2ONF A;  1UKK A;  3J81 D;  4FTF A;  4PHT A;  4JI6 C;  4RLF A;  1BA3 A;  1LQL A;  5A1G A;  4LFB C;  5E7Q A;  4G1I A;  2PN2 A;  1USP B;  5GTD A;  1MXA A;  2OPL B;  1MKY A;  1ZB9 A;  4RVN A;  4LE5 A;  2OO4 A;  1IB8 A;  4JI4 C;  2BH1 X;  5K8F A;  4X66 C;  3UZ0 A;  2YX1 A;  1JOS A;  2CU6 A;  3R9W A;  2BJO A;  1XMQ C;  2MMA B;  2P2F A;  3TDE A;  1HR0 C;  4JI7 C;  1HNW C;  5A19 A;  2ZZM A;  2QW0 X;  4DCV A;  1N33 C;  1XHJ A;  1O92 A;  4GKJ C;  3CQ2 A;  3UX3 A;  1P4E C;  4HPV A;  4DV2 C;  3UX2 A;  4AQY C;  2M5H A;  4GKK C;  4JV5 C;  1EGA A;  3LAX A;  4DR7 C;  2E0G A;  3J80 D;  2QL8 A;  2UUB C;  3SO4 A;  4DG9 A;  3VNS A;  2AYA A;  3I08 A;  4L7I A;  4X65 C;  1KKG A;  2D1Q A;  5KEI A;  4DV6 C;  4GXR A;  4DV3 C;  4DV0 C;  4OX9 C;  2HJG A;  2CY1 A;  4NXM C;  2ATW A;  4FUT A;  4DR6 C;  3TQI A;  2PT7 G;  3VNR A;  2VSQ A;  3L8C A;  1V26 A;  4DV7 C;  4K0K C;  2VQF C;  1HNZ C;  1QWI A;  1ZB8 A;  5CZX A;  4LFC C;  1O9T A;  2JMP A;  1PG4 A;  2QVX X;  5JRH A;  4DV4 C;  1ULT A;  4B3S C;  1N2F A;  4DR4 C;  3ETC A;  1FJG C;  3NYR A;  4OXI A;  1XRC A;  1ML8 A;  2UU9 C;  2F4V C;  4EAT A;  4BC7 A;  3DHV A;  2P2M A;  2ZZN A;  5CZV A;  1XRB A;  3AF5 A;  4DCU A;  4K0B A;  3TUF A;  1IBK C;  5LMU C;  4R0M A;  4KTT A;  5IFI A;  1I94 C;  2UUC C;  1MDB A;  3CJE A;  1P7L A;  4JI1 C;  4DCT A;  3DAY A;  4DV5 C;  5LMN C;  3PES A;  2E5L C;  4D57 A;  3VNQ A;  5T8S A;  3DLP X;  4PZP A;  3TR3 A;  1USP A;  2P2J A;  2P02 A;  3A26 A;  4JYA C;  1WCJ A;  1T5H X;  3ETO A;  4GXQ A;  4I9F A;  1M6X C;  5H9U A;  2VZE A;  4LF5 C;  4R1M A;  4LF8 C;  3C5E A;  3PRO C;  3KXW A;  4LF9 C;  1HH2 P;  4BBY A;  2D1T A;  1O93 A;  3FCE A;  3GR1 A;  1K0R A;  4WV3 A;  5BSU A;  4JM1 A;  2VQE C;  2Z51 A;  4BSZ A;  5KYT A;  1V25 A;  3EQ6 A;  5BSM A;  4I9G A;  2CXC A;  4D56 A;  3NYQ A;  2M5O A;  2D1S A;  1MXC A;  3IEU A;  4JI5 C;  4NDN A;  4DG8 A;  1GPM A;  3CW9 A;  4XX2 A;  3EER A;  4DR2 C;  3LGX A;  5BSW A;  2PRO A;  3IPL A;  3RG2 A;  3A4I A;  4BC9 A;  4G36 A;  4OYC A;  2UXC C;  4GS5 A;  5ADZ A;  2NCL A;  3L95 X;  5BSV A;  3R9X A;  2EGT A;  4X62 C;  4X64 C;  1WF3 A;  3IEV A;  1M6X A;  2E7G A;  3O2E A;  2YCB A;  4FUQ A;  4JI8 C;  3IML A;  3PBK A;  5BUS A;  4YY3 C;  1PA4 A;  1PG3 A;  4R1L A;  1VLA A;  3RV2 A;  2MM9 A;  2OPL A;  4PUH A;  1RY2 A;  5IT9 D;  4B3R C;  3AY0 A;  4PUI A;  1HNX C;  2Y27 A;  2ZM6 C;  4G37 A;  4KHP C;  4IR7 A;  4ODJ A;  1N32 C;  4JI3 C;  4B3T C;  4DR1 C;  2Y4N A;  5FLX D;  5IWA C;  3H2T A;  5BST A;  3GKU A;  4PUG A;  3LNV A;  1L2F A;  1YJ7 A;  2HHH C;  2D28 C;  4NOZ A;  3R44 A;  4RLQ A;  3UEB A;  3LNO A;  4L2Z A;  2P20 A;  4ZLP A;  3GPC A;  4D4G A;  1T5D X;  2YWC A;  1FLO A;  5BUQ A;  4L4Q A;  5LCI A; 
#chains in the Genus database with same CATH homology
 4LF4 C;  4LF7 C;  4JI0 C;  3GR0 A;  4YHH C;  1N34 C;  1MDF A;  1FUG A;  3T1H C;  2UUA C;  4TPS B;  1NYE A;  2P2Q A;  4LF6 C;  3FCC A;  1MD9 A;  1MXB A;  5BUR A;  4DR3 C;  4RM2 A;  4U5Y D;  2OBV A;  5KYV A;  2D27 A;  2Y4O A;  5K85 A;  2E8C A;  3A9U A;  4IZ6 A;  3B7W A;  1XMO C;  3A9V A;  4ISB A;  4D4I A;  1IBL C;  4DV1 C;  3T1Y C;  5T8T A;  4JI2 C;  1AMU A;  1N36 C;  3S82 A;  4LFA C;  2ASB A;  4RVO A;  2V7B A;  4PRO C;  2D1R A;  5BR8 C;  4WS9 A;  3NPD A;  3JAM D;  3N2Q A;  1XNR C;  5AE2 A;  3I07 A;  4ZJZ A;  2WD9 A;  2QVY X;  2P2B A;  2UXD C;  5A1I A;  3NI2 A;  1XRA A;  4DUZ C;  1XNQ C;  5BSR A;  3OTO C;  2YWB A;  1LCI A;  1IBM C;  3G7S A;  2DPL A;  1O90 A;  5AE1 A;  2D7V A;  4NXN C;  5DV9 A;  5AE3 A;  1QM4 A;  4BCA A;  3LUS A;  3E7X A;  3N54 B;  3E7W A;  2UXB C;  2KZF A;  4KTV A;  3UOW A;  4MH4 A;  3CW8 X;  2QVZ X;  4RM3 A;  5A2Q D;  2E8E A;  3AF6 A;  2WP0 C;  1WH9 A;  4DCS A;  4B3M C;  4MTN A;  2DYJ A;  1RG9 A;  4RMN A;  4DUY C;  1J5E C;  2XR1 A;  2E8F A;  4DR5 C;  2ONF A;  1UKK A;  3J81 D;  4FTF A;  4PHT A;  4JI6 C;  4RLF A;  1BA3 A;  1LQL A;  5A1G A;  4LFB C;  5E7Q A;  4G1I A;  2PN2 A;  1USP B;  5GTD A;  1MXA A;  2OPL B;  1MKY A;  1ZB9 A;  4RVN A;  4LE5 A;  2OO4 A;  4JI4 C;  2BH1 X;  5K8F A;  4X66 C;  3UZ0 A;  1JOS A;  3R9W A;  2BJO A;  1XMQ C;  2P2F A;  3TDE A;  1HR0 C;  4JI7 C;  1HNW C;  5A19 A;  2QW0 X;  4DCV A;  1N33 C;  1O92 A;  4GKJ C;  4HPV A;  4DV2 C;  4AQY C;  4GKK C;  4JV5 C;  1EGA A;  3LAX A;  4DR7 C;  2E0G A;  3J80 D;  2QL8 A;  2UUB C;  3SO4 A;  4DG9 A;  3VNS A;  2AYA A;  3I08 A;  4L7I A;  4X65 C;  1KKG A;  2D1Q A;  5KEI A;  4DV6 C;  4GXR A;  4DV3 C;  4DV0 C;  4OX9 C;  2HJG A;  2CY1 A;  4NXM C;  2ATW A;  4FUT A;  4DR6 C;  3TQI A;  2PT7 G;  3VNR A;  2VSQ A;  3L8C A;  1V26 A;  4DV7 C;  4K0K C;  2VQF C;  1HNZ C;  1QWI A;  1ZB8 A;  5CZX A;  4LFC C;  1O9T A;  2JMP A;  1PG4 A;  2QVX X;  5JRH A;  4DV4 C;  1ULT A;  4B3S C;  1N2F A;  4DR4 C;  3ETC A;  1FJG C;  3NYR A;  4OXI A;  1XRC A;  1ML8 A;  2UU9 C;  2F4V C;  4EAT A;  4BC7 A;  3DHV A;  2P2M A;  5CZV A;  1XRB A;  3AF5 A;  4DCU A;  4K0B A;  3TUF A;  1IBK C;  5LMU C;  4R0M A;  4KTT A;  5IFI A;  1I94 C;  2UUC C;  1MDB A;  3CJE A;  1P7L A;  4JI1 C;  4DCT A;  3DAY A;  4DV5 C;  5LMN C;  3PES A;  2E5L C;  4D57 A;  3VNQ A;  5T8S A;  3DLP X;  4PZP A;  1USP A;  2P2J A;  2P02 A;  4JYA C;  1T5H X;  3ETO A;  4GXQ A;  4I9F A;  5H9U A;  2VZE A;  4LF5 C;  4LF8 C;  4R1M A;  3C5E A;  3PRO C;  3KXW A;  4LF9 C;  1HH2 P;  4BBY A;  2D1T A;  1O93 A;  3FCE A;  3GR1 A;  1K0R A;  4WV3 A;  5BSU A;  4JM1 A;  2VQE C;  4BSZ A;  5KYT A;  1V25 A;  3EQ6 A;  5BSM A;  4I9G A;  2CXC A;  4D56 A;  3NYQ A;  2D1S A;  1MXC A;  3IEU A;  4JI5 C;  4NDN A;  4DG8 A;  1GPM A;  3CW9 A;  4XX2 A;  3EER A;  4DR2 C;  3LGX A;  5BSW A;  2PRO A;  3IPL A;  3RG2 A;  3A4I A;  4BC9 A;  4G36 A;  4OYC A;  2UXC C;  4GS5 A;  5ADZ A;  3L95 X;  5BSV A;  3R9X A;  2EGT A;  4X62 C;  4X64 C;  1WF3 A;  3IEV A;  2E7G A;  2YCB A;  4FUQ A;  4JI8 C;  3IML A;  3PBK A;  5BUS A;  4YY3 C;  1PA4 A;  1PG3 A;  4R1L A;  1VLA A;  3RV2 A;  2OPL A;  1RY2 A;  5IT9 D;  4B3R C;  1HNX C;  2Y27 A;  2ZM6 C;  4G37 A;  4KHP C;  4IR7 A;  4ODJ A;  1N32 C;  4JI3 C;  4B3T C;  4DR1 C;  2Y4N A;  5IWA C;  5FLX D;  3H2T A;  5BST A;  3GKU A;  3LNV A;  1L2F A;  1YJ7 A;  2HHH C;  2D28 C;  4NOZ A;  3R44 A;  4RLQ A;  4L2Z A;  2P20 A;  4ZLP A;  3GPC A;  4D4G A;  1T5D X;  2YWC A;  5BUQ A;  4L4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...