2ONFA

Crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
GMHVYESDVSWIDDRRTEVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRMGINLKSWNSHVTAELGPSPEKGFKFHRIKIHVKIGVNDEDKEKIPRAMQLAEKYCFISRAIRNNVEEIVDYEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_393673.1) from Thermoplasma acidophilum at 1.70 A resolution
rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
molecule keywords Hypothetical protein Ta0195
total genus 37
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2onfA01
1ML8A 1L2FA 2UUAC 4LFCC 2UXCC 2JMPA 1USPA 4MH4A 1XMQC 1VLAA 1UKKA 2UU9C 4DV5C 2ASBA 1IBMC 4DR1C 4DR5C 2UXBC 4BSZA 1EGAA 2DYJA 4DV2C 1USPB 4YHHC 4DV3C 2OPLA 4X64C 2VQFC 4JI8C 2KZFA 4DCVA 1JOSA 1N2FA 2CY1A 1J5EC 3I07A 4DUYC 4JI3C 4JV5C 1HH2P 1N33C 2PT7G 4YY3C 2UUBC 4K0KC 1N32C 3IEUA 3T1HC 2CXCA 4B3MC 1KKGA 1K0RA 2UXDC 4B3SC 4AQYC 4LF9C 1IBKC 1FJGC 1LQLA 4JI0C 2UUCC 2D7VA 4LF4C 4MTNA 4GKJC 1N36C 2E7GA 4DCTA 4DR7C 4B3RC 2ONFA 1NYEA 3T1YC 2HJGA 4JI7C 2YCBA 4DR3C 4NXMC 3IEVA 2E5LC 3R9XA 3R9WA 1WH9A 4LFAC 5IWAC 1IBLC 2OPLB 4X65C 4X62C 3J80D 2VQEC 2PN2A 5A2QD 5LMUC 1MKYA 4JI4C 1XNQC 1HR0C 3AF5A 4XX2A 4DR4C 4JI1C 2HHHC 4DV4C 4LF6C 4DUZC 2QL8A 4LF7C 4NOZA 5LMNC 4DCSA 4DV1C 2ZM6C 3GKUA 3LUSA 4DV7C 4DV6C 4DR2C 4LFBC 1XNRC 1HNXC 4OX9C 1HNZC 5BR8C 4LF5C 4JI2C 4JI6C 1PA4A 1N34C 1ZB8A 1XMOC 5IT9D 2XR1A 2E8CA 1ZB9A 1I94C 1HNWC 3J81D 2EGTA 4GKKC 2ATWA 1QWIA 3OTOC 4DR6C 3CJEA 3EERA 4DCUA 3JAMD 2E8EA 4JYAC 4KHPC 4X66C 4B3TC 2F4VC 1WF3A 4NXNC 3AF6A 5FLXD 2BJOA 4DV0C 4LF8C 2E8FA 4JI5C
chains in the Genus database with same CATH superfamily
5DV9A 4PZPA 2UXCC 4D4IA 5AE1A 5JRHA 1XMQC 3CW9A 4RM3A 2ASBA 3CW8X 1LCIA 4DR1C 2JNVA 4BSZA 1EGAA 2MCQA 5CZXA 4R0MA 1USPB 4DV3C 3DAYA 4ZJZA 1N2FA 4RLFA 1J5EC 3I07A 4JI3C 1TH5A 1HH2P 1P4EC 2CXCA 2QVZX 5K8FA 1MDBA 1K0RA 1V25A 2UXDC 4B3SC 3A4IA 4LE5A 1LQLA 1MXAA 2UUCC 4GKJC 2E7GA 3CQ3A 3S82A 3T1YC 2HJGA 4NXMC 2E5LC 4KTVA 2OPLB 5BSTA 4X62C 3J80D 2VQEC 1O92A 1M6XC 4RLQA 1MKYA 2KZ0A 3C5EA 2MM9A 3ETOA 3K6RA 1T5HX 2VSQA 4DV4C 5BURA 3AY0A 4LF7C 2P20A 4D4GA 2BH1X 2YWCA 2V7BA 2ZZNA 4DCSA 1MXCA 5T8TA 4HPVA 3UX2A 4DV7C 4DV6C 4OX9C 2OBVA 4R1LA 3PROC 2P2JA 2Z51A 3G7SA 3UZ0A 3GR0A 1HNWC 2ATWA 1PU1A 4DR6C 3EERA 4KHPC 1MXBA 1WF3A 3LGXA 4NXNC 5A1GA 3TR3A 4LF8C 4JI5C 2P02A 4IZ6A 4NDNA 3ETCA 1USPA 4MH4A 1BA3A 4FTFA 1VLAA 1UKKA 4D56A 5A1IA 4RM2A 4DR5C 2QW0X 2OPLA 2AYAA 4X64C 4JI8C 4DCVA 4DUYC 1N33C 4D57A 4YY3C 4ZLPA 2D1SA 3TDEA 2D28C 2Y27A 1KKGA 5IFIA 4FUQA 3GPCA 1FJGC 2D7VA 3A9VA 1N36C 4DCTA 4DR7C 2WP0C 1IB8A 2ONFA 1NYEA 4JI7C 2YCBA 3NI2A 2DPLA 2QVXX 1IBLC 3A25A 4OYCA 4L4QA 4KTTA 5LCIA 1YJ7A 4TPSB 4PROC 3CQ2A 5A2QD 5LMUC 1MD9A 5KYVA 1V26A 1O9TA 4DUZC 1M6XA 4ODJA 5LMNC 5BSMA 2YWBA 3GKUA 3VNRA 5K85A 4LFBC 1HNXC 3PBKA 1HNZC 3A26A 4WV3A 3GR1A 5GTDA 4G36A 4JI2C 4JI6C 1N34C 4IR7A 1ZB8A 3VNSA 2P2FA 1I94C 4GKKC 3OTOC 3CJEA 3NYRA 1XHJA 4DCUA 3JAMD 4GXQA 2QVYX 4JYAC 4X66C 3AF6A 3IMLA 2BJOA 1ZB9A 2E0GA 1P4EA 5KEIA 2UUAC 4LFCC 3I08A 2JMPA 4PUGA 4G1IA 5CZVA 5BSUA 2UU9C 4DG8A 4DV5C 5BSVA 1IBMC 5H9UA 3R44A 4U5YD 1T5DX 4YHHC 1XS3A 3SO4A 2KZFA 2Y4OA 2Y4NA 2CY1A 2PT7G 3EQ6A 2UUBC 4K0KC 3IEUA 5E7QA 3FCCA 1NY8A 1FUGA 3N54B 3VNQA 3A9UA 1VEHA 4B3RC 1PG4A 5T8SA 3UOWA 4DR3C 3IEVA 2P2MA 1RG9A 3R9XA 4R1MA 4BC9A 5IWAC 3DHVA 4X65C 3UEBA 4GS5A 4EATA 2YX1A 4K0BA 4JI4C 5BSWA 3AF5A 3RV2A 4XX2A 4ISBA 2HHHC 5BUQA 3NPDA 2NCLA 2D1QA 3E7XA 3O2EA 5BSRA 4BCAA 4DV1C 4I9FA 3LNVA 2OO4A 1RY2A 1O90A 3B7WA 3L8CA 4L2ZA 1XNRC 5BR8C 3PESA 4LF5C 4JM1A 4PUIA 1O93A 1PA4A 1XMOC 3TQIA 2E8CA 5KYTA 2EGTA 2E8EA 2KDNA 4B3TC 3UX3A 4DV0C 2E8FA 1ML8A 1L2FA 4WS9A 2VZEA 3E7WA 2MMAB 4L7IA 2UXBC 2P2QA 2DYJA 4DV2C 2D1TA 4G37A 2VQFC 1JOSA 3IPLA 4JV5C 1N32C 3T1HC 4B3MC 4FUTA 4AQYC 4LF9C 1IBKC 3LNOA 3LAXA 4LF4C 4JI0C 1FLOA 4MTNA 2ZZMA 2P2BA 2M5HA 3KXWA 1UWDA 4PUHA 3CQ1A 4GXRA 2D1RA 3R9WA 5A19A 1WH9A 1GPMA 2PROA 1ULTA 2M5OA 4LFAC 5AE3A 2CU6A 2PN2A 5BUSA 1XNQC 3TUFA 1HR0C 3N2QA 4DR4C 4JI1C 1XRBA 4LF6C 2QL8A 1WCJA 5AE2A 4NOZA 1XRCA 4OXIA 2ZM6C 3LUSA 4DR2C 2WD9A 3FCEA 4BBYA 3DLPX 5ADZA 1QM4A 3L95X 1XRAA 3NYQA 2D27A 1V60A 3RG2A 5IT9D 2XR1A 1AMUA 1MDFA 1P7LA 3J81D 3H2TA 4I9GA 1QWIA 4RVNA 2DHMA 2F4VC 4BC7A 1PG3A 4PHTA 5FLXD 4RVOA 4RMNA 4DG9A
chains in the Genus database with same CATH topology
5DV9A 4PZPA 2UXCC 4D4IA 5AE1A 5JRHA 1XMQC 3CW9A 4RM3A 2ASBA 3CW8X 1LCIA 4DR1C 4BSZA 1EGAA 5CZXA 4R0MA 1USPB 4DV3C 3DAYA 4ZJZA 1N2FA 4RLFA 1J5EC 3I07A 4JI3C 1HH2P 2CXCA 2QVZX 5K8FA 1MDBA 1K0RA 1V25A 2UXDC 4B3SC 3A4IA 4LE5A 1LQLA 1MXAA 2UUCC 4GKJC 2E7GA 3S82A 3T1YC 2HJGA 4NXMC 2E5LC 4KTVA 2OPLB 5BSTA 4X62C 3J80D 2VQEC 1O92A 4RLQA 1MKYA 3C5EA 3ETOA 1T5HX 2VSQA 4DV4C 5BURA 4LF7C 2P20A 4D4GA 2BH1X 2YWCA 2V7BA 4DCSA 1MXCA 5T8TA 4HPVA 4DV7C 4DV6C 4OX9C 2OBVA 4R1LA 3PROC 2P2JA 3G7SA 3UZ0A 3GR0A 1HNWC 2ATWA 4DR6C 3EERA 4KHPC 1MXBA 1WF3A 3LGXA 4NXNC 5A1GA 4LF8C 4JI5C 2P02A 4IZ6A 4NDNA 3ETCA 1USPA 4MH4A 1BA3A 4FTFA 1VLAA 1UKKA 4D56A 5A1IA 4RM2A 4DR5C 2QW0X 2OPLA 2AYAA 4X64C 4JI8C 4DCVA 4DUYC 1N33C 4D57A 4YY3C 4ZLPA 2D1SA 3TDEA 2D28C 2Y27A 1KKGA 5IFIA 4FUQA 3GPCA 1FJGC 2D7VA 3A9VA 1N36C 4DCTA 4DR7C 2WP0C 2ONFA 1NYEA 4JI7C 2YCBA 3NI2A 2DPLA 2QVXX 1IBLC 4OYCA 4L4QA 4KTTA 1YJ7A 4TPSB 4PROC 5A2QD 5LMUC 1MD9A 5KYVA 1V26A 1O9TA 4DUZC 4ODJA 5LMNC 5BSMA 2YWBA 3GKUA 3VNRA 5K85A 4LFBC 1HNXC 3PBKA 1HNZC 4WV3A 3GR1A 5GTDA 4G36A 4JI2C 4JI6C 1N34C 4IR7A 1ZB8A 3VNSA 2P2FA 1I94C 4GKKC 3OTOC 3CJEA 3NYRA 4DCUA 3JAMD 4GXQA 2QVYX 4JYAC 4X66C 3AF6A 3IMLA 2BJOA 1ZB9A 2E0GA 5KEIA 2UUAC 4LFCC 3I08A 2JMPA 4G1IA 5CZVA 5BSUA 2UU9C 4DG8A 4DV5C 5BSVA 1IBMC 5H9UA 3R44A 4U5YD 1T5DX 4YHHC 3SO4A 2KZFA 2Y4OA 2Y4NA 2CY1A 2PT7G 3EQ6A 2UUBC 4K0KC 3IEUA 5E7QA 3FCCA 1FUGA 3N54B 3VNQA 3A9UA 4B3RC 1PG4A 5T8SA 3UOWA 4DR3C 3IEVA 2P2MA 1RG9A 3R9XA 4R1MA 4BC9A 5IWAC 3DHVA 4X65C 4GS5A 4EATA 4K0BA 4JI4C 5BSWA 3AF5A 3RV2A 4XX2A 4ISBA 2HHHC 5BUQA 3NPDA 2D1QA 3E7XA 5BSRA 4BCAA 4DV1C 4I9FA 3LNVA 2OO4A 1RY2A 1O90A 3B7WA 3L8CA 4L2ZA 1XNRC 5BR8C 3PESA 4LF5C 4JM1A 1O93A 1PA4A 1XMOC 3TQIA 2E8CA 5KYTA 2EGTA 2E8EA 4B3TC 4DV0C 2E8FA 1ML8A 1L2FA 4WS9A 2VZEA 3E7WA 4L7IA 2UXBC 2P2QA 2DYJA 4DV2C 2D1TA 4G37A 2VQFC 1JOSA 3IPLA 4JV5C 1N32C 3T1HC 4B3MC 4FUTA 4AQYC 4LF9C 1IBKC 3LAXA 4LF4C 4JI0C 4MTNA 2P2BA 3KXWA 4GXRA 2D1RA 3R9WA 5A19A 1WH9A 1GPMA 2PROA 1ULTA 4LFAC 5AE3A 2PN2A 5BUSA 1XNQC 3TUFA 1HR0C 3N2QA 4DR4C 4JI1C 1XRBA 4LF6C 2QL8A 5AE2A 4NOZA 1XRCA 4OXIA 2ZM6C 3LUSA 4DR2C 2WD9A 3FCEA 4BBYA 3DLPX 5ADZA 1QM4A 3L95X 1XRAA 3NYQA 2D27A 3RG2A 5IT9D 2XR1A 1AMUA 1MDFA 1P7LA 3J81D 3H2TA 4I9GA 1QWIA 4RVNA 2F4VC 4BC7A 1PG3A 4PHTA 5FLXD 4RVOA 4RMNA 4DG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  1L2F A;  2UUA C;  4LFC C;  2UXC C;  2JMP A;  1USP A;  4MH4 A;  1XMQ C;  1VLA A;  1UKK A;  2UU9 C;  4DV5 C;  2ASB A;  1IBM C;  4DR1 C;  4DR5 C;  2UXB C;  4BSZ A;  1EGA A;  2DYJ A;  4DV2 C;  1USP B;  4YHH C;  4DV3 C;  2OPL A;  4X64 C;  2VQF C;  4JI8 C;  2KZF A;  4DCV A;  1JOS A;  1N2F A;  2CY1 A;  1J5E C;  3I07 A;  4DUY C;  4JI3 C;  4JV5 C;  1HH2 P;  1N33 C;  2PT7 G;  4YY3 C;  2UUB C;  4K0K C;  1N32 C;  3IEU A;  3T1H C;  2CXC A;  4B3M C;  1KKG A;  1K0R A;  2UXD C;  4B3S C;  4AQY C;  4LF9 C;  1IBK C;  1FJG C;  1LQL A;  4JI0 C;  2UUC C;  2D7V A;  4LF4 C;  4MTN A;  4GKJ C;  1N36 C;  2E7G A;  4DCT A;  4DR7 C;  4B3R C;  2ONF A;  1NYE A;  3T1Y C;  2HJG A;  4JI7 C;  2YCB A;  4DR3 C;  4NXM C;  3IEV A;  2E5L C;  3R9X A;  3R9W A;  1WH9 A;  4LFA C;  5IWA C;  1IBL C;  2OPL B;  4X65 C;  4X62 C;  3J80 D;  2VQE C;  2PN2 A;  5A2Q D;  5LMU C;  1MKY A;  4JI4 C;  1XNQ C;  1HR0 C;  3AF5 A;  4XX2 A;  4DR4 C;  4JI1 C;  2HHH C;  4DV4 C;  4LF6 C;  4DUZ C;  2QL8 A;  4LF7 C;  4NOZ A;  5LMN C;  4DCS A;  4DV1 C;  2ZM6 C;  3GKU A;  3LUS A;  4DV7 C;  4DV6 C;  4DR2 C;  4LFB C;  1XNR C;  1HNX C;  4OX9 C;  1HNZ C;  5BR8 C;  4LF5 C;  4JI2 C;  4JI6 C;  1PA4 A;  1N34 C;  1ZB8 A;  1XMO C;  5IT9 D;  2XR1 A;  2E8C A;  1ZB9 A;  1I94 C;  1HNW C;  3J81 D;  2EGT A;  4GKK C;  2ATW A;  1QWI A;  3OTO C;  4DR6 C;  3CJE A;  3EER A;  4DCU A;  3JAM D;  2E8E A;  4JYA C;  4KHP C;  4X66 C;  4B3T C;  2F4V C;  1WF3 A;  4NXN C;  3AF6 A;  5FLX D;  2BJO A;  4DV0 C;  4LF8 C;  2E8F A;  4JI5 C; 
#chains in the Genus database with same CATH topology
 5DV9 A;  4PZP A;  2UXC C;  4D4I A;  5AE1 A;  5JRH A;  1XMQ C;  3CW9 A;  4RM3 A;  2ASB A;  3CW8 X;  1LCI A;  4DR1 C;  2JNV A;  4BSZ A;  1EGA A;  2MCQ A;  5CZX A;  4R0M A;  1USP B;  4DV3 C;  3DAY A;  4ZJZ A;  1N2F A;  4RLF A;  1J5E C;  3I07 A;  4JI3 C;  1TH5 A;  1HH2 P;  1P4E C;  2CXC A;  2QVZ X;  5K8F A;  1MDB A;  1K0R A;  1V25 A;  2UXD C;  4B3S C;  3A4I A;  4LE5 A;  1LQL A;  1MXA A;  2UUC C;  4GKJ C;  2E7G A;  3CQ3 A;  3S82 A;  3T1Y C;  2HJG A;  4NXM C;  2E5L C;  4KTV A;  2OPL B;  5BST A;  4X62 C;  3J80 D;  2VQE C;  1O92 A;  1M6X C;  4RLQ A;  1MKY A;  2KZ0 A;  3C5E A;  2MM9 A;  3ETO A;  3K6R A;  1T5H X;  2VSQ A;  4DV4 C;  5BUR A;  3AY0 A;  4LF7 C;  2P20 A;  4D4G A;  2BH1 X;  2YWC A;  2V7B A;  2ZZN A;  4DCS A;  1MXC A;  5T8T A;  4HPV A;  3UX2 A;  4DV7 C;  4DV6 C;  4OX9 C;  2OBV A;  4R1L A;  3PRO C;  2P2J A;  2Z51 A;  3G7S A;  3UZ0 A;  3GR0 A;  1HNW C;  2ATW A;  1PU1 A;  4DR6 C;  3EER A;  4KHP C;  1MXB A;  1WF3 A;  3LGX A;  4NXN C;  5A1G A;  3TR3 A;  4LF8 C;  4JI5 C;  2P02 A;  4IZ6 A;  4NDN A;  3ETC A;  1USP A;  4MH4 A;  1BA3 A;  4FTF A;  1VLA A;  1UKK A;  4D56 A;  5A1I A;  4RM2 A;  4DR5 C;  2QW0 X;  2OPL A;  2AYA A;  4X64 C;  4JI8 C;  4DCV A;  4DUY C;  1N33 C;  4D57 A;  4YY3 C;  4ZLP A;  2D1S A;  3TDE A;  2D28 C;  2Y27 A;  1KKG A;  5IFI A;  4FUQ A;  3GPC A;  1FJG C;  2D7V A;  3A9V A;  1N36 C;  4DCT A;  4DR7 C;  2WP0 C;  1IB8 A;  2ONF A;  1NYE A;  4JI7 C;  2YCB A;  3NI2 A;  2DPL A;  2QVX X;  1IBL C;  3A25 A;  4OYC A;  4L4Q A;  4KTT A;  5LCI A;  1YJ7 A;  4TPS B;  4PRO C;  3CQ2 A;  5A2Q D;  5LMU C;  1MD9 A;  5KYV A;  1V26 A;  1O9T A;  4DUZ C;  1M6X A;  4ODJ A;  5LMN C;  5BSM A;  2YWB A;  3GKU A;  3VNR A;  5K85 A;  4LFB C;  1HNX C;  3PBK A;  1HNZ C;  3A26 A;  4WV3 A;  3GR1 A;  5GTD A;  4G36 A;  4JI2 C;  4JI6 C;  1N34 C;  4IR7 A;  1ZB8 A;  3VNS A;  2P2F A;  1I94 C;  4GKK C;  3OTO C;  3CJE A;  3NYR A;  1XHJ A;  4DCU A;  3JAM D;  4GXQ A;  2QVY X;  4JYA C;  4X66 C;  3AF6 A;  3IML A;  2BJO A;  1ZB9 A;  2E0G A;  1P4E A;  5KEI A;  2UUA C;  4LFC C;  3I08 A;  2JMP A;  4PUG A;  4G1I A;  5CZV A;  5BSU A;  2UU9 C;  4DG8 A;  4DV5 C;  5BSV A;  1IBM C;  5H9U A;  3R44 A;  4U5Y D;  1T5D X;  4YHH C;  1XS3 A;  3SO4 A;  2KZF A;  2Y4O A;  2Y4N A;  2CY1 A;  2PT7 G;  3EQ6 A;  2UUB C;  4K0K C;  3IEU A;  5E7Q A;  3FCC A;  1NY8 A;  1FUG A;  3N54 B;  3VNQ A;  3A9U A;  1VEH A;  4B3R C;  1PG4 A;  5T8S A;  3UOW A;  4DR3 C;  3IEV A;  2P2M A;  1RG9 A;  3R9X A;  4R1M A;  4BC9 A;  5IWA C;  3DHV A;  4X65 C;  3UEB A;  4GS5 A;  4EAT A;  2YX1 A;  4K0B A;  4JI4 C;  5BSW A;  3AF5 A;  3RV2 A;  4XX2 A;  4ISB A;  2HHH C;  5BUQ A;  3NPD A;  2NCL A;  2D1Q A;  3E7X A;  3O2E A;  5BSR A;  4BCA A;  4DV1 C;  4I9F A;  3LNV A;  2OO4 A;  1RY2 A;  1O90 A;  3B7W A;  3L8C A;  4L2Z A;  1XNR C;  5BR8 C;  3PES A;  4LF5 C;  4JM1 A;  4PUI A;  1O93 A;  1PA4 A;  1XMO C;  3TQI A;  2E8C A;  5KYT A;  2EGT A;  2E8E A;  2KDN A;  4B3T C;  3UX3 A;  4DV0 C;  2E8F A;  1ML8 A;  1L2F A;  4WS9 A;  2VZE A;  3E7W A;  2MMA B;  4L7I A;  2UXB C;  2P2Q A;  2DYJ A;  4DV2 C;  2D1T A;  4G37 A;  2VQF C;  1JOS A;  3IPL A;  4JV5 C;  1N32 C;  3T1H C;  4B3M C;  4FUT A;  4AQY C;  4LF9 C;  1IBK C;  3LNO A;  3LAX A;  4LF4 C;  4JI0 C;  1FLO A;  4MTN A;  2ZZM A;  2P2B A;  2M5H A;  3KXW A;  1UWD A;  4PUH A;  3CQ1 A;  4GXR A;  2D1R A;  3R9W A;  5A19 A;  1WH9 A;  1GPM A;  2PRO A;  1ULT A;  2M5O A;  4LFA C;  5AE3 A;  2CU6 A;  2PN2 A;  5BUS A;  1XNQ C;  3TUF A;  1HR0 C;  3N2Q A;  4DR4 C;  4JI1 C;  1XRB A;  4LF6 C;  2QL8 A;  1WCJ A;  5AE2 A;  4NOZ A;  1XRC A;  4OXI A;  2ZM6 C;  3LUS A;  4DR2 C;  2WD9 A;  3FCE A;  4BBY A;  3DLP X;  5ADZ A;  1QM4 A;  3L95 X;  1XRA A;  3NYQ A;  2D27 A;  1V60 A;  3RG2 A;  5IT9 D;  2XR1 A;  1AMU A;  1MDF A;  1P7L A;  3J81 D;  3H2T A;  4I9G A;  1QWI A;  4RVN A;  2DHM A;  2F4V C;  4BC7 A;  1PG3 A;  4PHT A;  5FLX D;  4RVO A;  4RMN A;  4DG9 A; 
#chains in the Genus database with same CATH homology
 5DV9 A;  4PZP A;  2UXC C;  4D4I A;  5AE1 A;  5JRH A;  1XMQ C;  3CW9 A;  4RM3 A;  2ASB A;  3CW8 X;  1LCI A;  4DR1 C;  4BSZ A;  1EGA A;  5CZX A;  4R0M A;  1USP B;  4DV3 C;  3DAY A;  4ZJZ A;  1N2F A;  4RLF A;  1J5E C;  3I07 A;  4JI3 C;  1HH2 P;  2CXC A;  2QVZ X;  5K8F A;  1MDB A;  1K0R A;  1V25 A;  2UXD C;  4B3S C;  3A4I A;  4LE5 A;  1LQL A;  1MXA A;  2UUC C;  4GKJ C;  2E7G A;  3S82 A;  3T1Y C;  2HJG A;  4NXM C;  2E5L C;  4KTV A;  2OPL B;  5BST A;  4X62 C;  3J80 D;  2VQE C;  1O92 A;  4RLQ A;  1MKY A;  3C5E A;  3ETO A;  1T5H X;  2VSQ A;  4DV4 C;  5BUR A;  4LF7 C;  2P20 A;  4D4G A;  2BH1 X;  2YWC A;  2V7B A;  4DCS A;  1MXC A;  5T8T A;  4HPV A;  4DV7 C;  4DV6 C;  4OX9 C;  2OBV A;  4R1L A;  3PRO C;  2P2J A;  3G7S A;  3UZ0 A;  3GR0 A;  1HNW C;  2ATW A;  4DR6 C;  3EER A;  4KHP C;  1MXB A;  1WF3 A;  3LGX A;  4NXN C;  5A1G A;  4LF8 C;  4JI5 C;  2P02 A;  4IZ6 A;  4NDN A;  3ETC A;  1USP A;  4MH4 A;  1BA3 A;  4FTF A;  1VLA A;  1UKK A;  4D56 A;  5A1I A;  4RM2 A;  4DR5 C;  2QW0 X;  2OPL A;  2AYA A;  4X64 C;  4JI8 C;  4DCV A;  4DUY C;  1N33 C;  4D57 A;  4YY3 C;  4ZLP A;  2D1S A;  3TDE A;  2D28 C;  2Y27 A;  1KKG A;  5IFI A;  4FUQ A;  3GPC A;  1FJG C;  2D7V A;  3A9V A;  1N36 C;  4DCT A;  4DR7 C;  2WP0 C;  2ONF A;  1NYE A;  4JI7 C;  2YCB A;  3NI2 A;  2DPL A;  2QVX X;  1IBL C;  4OYC A;  4L4Q A;  4KTT A;  1YJ7 A;  4TPS B;  4PRO C;  5A2Q D;  5LMU C;  1MD9 A;  5KYV A;  1V26 A;  1O9T A;  4DUZ C;  4ODJ A;  5LMN C;  5BSM A;  2YWB A;  3GKU A;  3VNR A;  5K85 A;  4LFB C;  1HNX C;  3PBK A;  1HNZ C;  4WV3 A;  3GR1 A;  5GTD A;  4G36 A;  4JI2 C;  4JI6 C;  1N34 C;  4IR7 A;  1ZB8 A;  3VNS A;  2P2F A;  1I94 C;  4GKK C;  3OTO C;  3CJE A;  3NYR A;  4DCU A;  3JAM D;  4GXQ A;  2QVY X;  4JYA C;  4X66 C;  3AF6 A;  3IML A;  2BJO A;  1ZB9 A;  2E0G A;  5KEI A;  2UUA C;  4LFC C;  3I08 A;  2JMP A;  4G1I A;  5CZV A;  5BSU A;  2UU9 C;  4DG8 A;  4DV5 C;  5BSV A;  1IBM C;  5H9U A;  3R44 A;  4U5Y D;  1T5D X;  4YHH C;  3SO4 A;  2KZF A;  2Y4O A;  2Y4N A;  2CY1 A;  2PT7 G;  3EQ6 A;  2UUB C;  4K0K C;  3IEU A;  5E7Q A;  3FCC A;  1FUG A;  3N54 B;  3VNQ A;  3A9U A;  4B3R C;  1PG4 A;  5T8S A;  3UOW A;  4DR3 C;  3IEV A;  2P2M A;  1RG9 A;  3R9X A;  4R1M A;  4BC9 A;  5IWA C;  3DHV A;  4X65 C;  4GS5 A;  4EAT A;  4K0B A;  4JI4 C;  5BSW A;  3AF5 A;  3RV2 A;  4XX2 A;  4ISB A;  2HHH C;  5BUQ A;  3NPD A;  2D1Q A;  3E7X A;  5BSR A;  4BCA A;  4DV1 C;  4I9F A;  3LNV A;  2OO4 A;  1RY2 A;  1O90 A;  3B7W A;  3L8C A;  4L2Z A;  1XNR C;  5BR8 C;  3PES A;  4LF5 C;  4JM1 A;  1O93 A;  1PA4 A;  1XMO C;  3TQI A;  2E8C A;  5KYT A;  2EGT A;  2E8E A;  4B3T C;  4DV0 C;  2E8F A;  1ML8 A;  1L2F A;  4WS9 A;  2VZE A;  3E7W A;  4L7I A;  2UXB C;  2P2Q A;  2DYJ A;  4DV2 C;  2D1T A;  4G37 A;  2VQF C;  1JOS A;  3IPL A;  4JV5 C;  1N32 C;  3T1H C;  4B3M C;  4FUT A;  4AQY C;  4LF9 C;  1IBK C;  3LAX A;  4LF4 C;  4JI0 C;  4MTN A;  2P2B A;  3KXW A;  4GXR A;  2D1R A;  3R9W A;  5A19 A;  1WH9 A;  1GPM A;  2PRO A;  1ULT A;  4LFA C;  5AE3 A;  2PN2 A;  5BUS A;  1XNQ C;  3TUF A;  1HR0 C;  3N2Q A;  4DR4 C;  4JI1 C;  1XRB A;  4LF6 C;  2QL8 A;  5AE2 A;  4NOZ A;  1XRC A;  4OXI A;  2ZM6 C;  3LUS A;  4DR2 C;  2WD9 A;  3FCE A;  4BBY A;  3DLP X;  5ADZ A;  1QM4 A;  3L95 X;  1XRA A;  3NYQ A;  2D27 A;  3RG2 A;  5IT9 D;  2XR1 A;  1AMU A;  1MDF A;  1P7L A;  3J81 D;  3H2T A;  4I9G A;  1QWI A;  4RVN A;  2F4V C;  4BC7 A;  1PG3 A;  4PHT A;  5FLX D;  4RVO A;  4RMN A;  4DG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...