2ONFA

Crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
b'GMHVYESDVSWIDDRRTEVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRMGINLKSWNSHVTAELGPSPEKGFKFHRIKIHVKIGVNDEDKEKIPRAMQLAEKYCFISRAIRNNVEEIVDYEFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Ta0195
publication title Crystal structure of hypothetical protein (NP_393673.1) from Thermoplasma acidophilum at 1.70 A resolution
rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
total genus 37
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2onfA01
1LQLA 4DR4C 2CY1A 4DV0C 4AQYC 4LFCC 2UUCC 1HNXC 1JOSA 2F4VC 1IBMC 4JV5C 4DV3C 4DR5C 2D7VA 4JI3C 4X65C 4DV4C 2E8FA 4NXNC 4DCTA 4DCVA 4DCSA 1HH2P 1XMOC 2BJOA 3T1HC 1ML8A 1K0RA 4DV7C 2E5LC 1USPB 1N2FA 4LF9C 4LF8C 2JMPA 4DR7C 4DV6C 4B3MC 1QWIA 2HJGA 4B3TC 2HHHC 1J5EC 2ATWA 4X62C 4B3SC 5A2QD 2OPLB 4LF5C 1USPA 3AF6A 4OX9C 3EERA 3J81D 1UKKA 3JAMD 1ZB8A 2VQFC 1PA4A 5IT9D 2KZFA 2CXCA 4DR2C 2PN2A 2E8EA 1IBLC 2UXBC 4XX2A 2QL8A 2ASBA 3AF5A 4LF4C 4JI0C 2OPLA 2UU9C 4DV2C 4JI1C 4B3RC 5LMUC 2ONFA 1HR0C 3IEVA 1IBKC 5FLXD 4DUZC 4JI8C 2DYJA 1N36C 1XNQC 1EGAA 4JI7C 2UXDC 3GKUA 1HNZC 4LFBC 4MTNA 4GKJC 4JI5C 3R9WA 3R9XA 3J80D 3IEUA 4DUYC 5BR8C 4NOZA 2XR1A 1N33C 4GKKC 3OTOC 1HNWC 4LF7C 1WH9A 1ZB9A 1XNRC 5IWAC 2VQEC 1L2FA 2UXCC 4DV5C 4DV1C 4X66C 2PT7G 4JI4C 4LFAC 4JI2C 4DR6C 2E8CA 2UUAC 1MKYA 4KHPC 4DCUA 3T1YC 2EGTA 4JI6C 4YHHC 4BSZA 4NXMC 4K0KC 4LF6C 2ZM6C 1FJGC 3I07A 4DR3C 2UUBC 1N32C 1WF3A 1VLAA 1I94C 1XMQC 3LUSA 1N34C 4JYAC 3CJEA 2YCBA 4X64C 2E7GA 4MH4A 4YY3C 1NYEA 5LMNC 4DR1C 1KKGA
chains in the Genus database with same CATH superfamily
5AE2A 2CY1A 2M5HA 4TPSB 2F4VC 2PROA 4JV5C 3IMLA 5AE1A 4FUQA 4DR5C 2D7VA 4X65C 3IPLA 4DV4C 1XRAA 4I9FA 1XMOC 1HH2P 1MXBA 4DV7C 1N2FA 5ADZA 2HJGA 2D1TA 3KXWA 5DV9A 4B3SC 4LF5C 1USPA 3AF6A 2AYAA 2OBVA 2Y4OA 3J81D 1UKKA 4DR2C 2E8EA 2ASBA 3LNVA 3EQ6A 4DV2C 3NYQA 1NY8A 1YJ7A 4JI1C 3LGXA 2P2FA 4ZLPA 2YX1A 1IBKC 4IR7A 4G1IA 4DUZC 4JI8C 2DYJA 5K85A 3L8CA 4JI5C 3I08A 3VNSA 3J80D 4NOZA 4DG9A 4GKKC 3CW9A 5LCIA 4GS5A 4DG8A 4R0MA 3CQ2A 4X66C 2VZEA 1P4EC 4LFAC 2E8CA 4KHPC 2V7BA 5BUQA 4DCUA 4JI6C 4K0KC 1BA3A 4RM2A 3ETOA 3I07A 4DR3C 3C5EA 3RV2A 1XMQC 1N34C 3B7WA 2D1RA 3CJEA 1V25A 4LE5A 3E7XA 4ISBA 4MH4A 4YY3C 1NYEA 3A9UA 3DAYA 4DV0C 4LFCC 4AQYC 1HNXC 5BSRA 1JOSA 2DPLA 2MM9A 2YWCA 5KYTA 4DCSA 3L95X 1K0RA 2QVXX 2E5LC 5T8SA 5BSUA 3VNQA 4LF8C 4DR7C 2M5OA 2MMAB 5BSVA 5KYVA 1MXAA 1MDFA 1IB8A 3GPCA 1TH5A 1PU1A 5A2QD 2P2BA 2MCQA 3TDEA 4OX9C 3EERA 1PA4A 4G37A 3UX3A 3S82A 2UXBC 5AE3A 3CW8X 3H2TA 1V60A 4JI0C 2OPLA 5BSTA 1M6XA 4B3RC 4BC7A 4WV3A 3G7SA 4OXIA 1FUGA 1P4EA 4PZPA 1FLOA 4IZ6A 1N36C 4ZJZA 4PROC 1XNQC 1XHJA 5IFIA 4NDNA 5BSMA 4MTNA 3LNOA 3DLPX 4GKJC 3R9XA 3IEUA 4RM3A 1XRBA 4R1MA 4HPVA 3TUFA 4LF7C 3ETCA 2KDNA 3E7WA 1XNRC 2VQEC 1L2FA 4DV5C 4PHTA 4JI4C 5GTDA 5K8FA 2NCLA 1V26A 2D28C 4D4GA 4LF6C 2ZM6C 5CZVA 3A26A 1FJGC 2WP0C 2UUBC 3A4IA 2P2JA 3A25A 4X64C 4U5YD 3LAXA 1M6XC 2Z51A 5LMNC 4DR1C 2D27A 1O9TA 3GR0A 2Y27A 2E8FA 4DCTA 4DCVA 2BJOA 3T1HC 2CU6A 1USPB 3K6RA 4RVNA 5KEIA 1QWIA 1VEHA 1P7LA 1J5EC 5BSWA 3PESA 4RVOA 2ATWA 4X62C 3NYRA 3JAMD 1ZB8A 5A1IA 1T5DX 2CXCA 4GXQA 4L7IA 4G36A 2QL8A 2JNVA 5BUSA 2Y4NA 3AF5A 4LF4C 4BC9A 1XRCA 5BURA 5LMUC 4L2ZA 5CZXA 2ONFA 1HR0C 3IEVA 4R1LA 5FLXD 4EATA 2DHMA 2P20A 3PROC 3GR1A 1AMUA 2UXDC 3GKUA 4LFBC 1GPMA 2D1QA 3CQ1A 5T8TA 3RG2A 4DUYC 5BR8C 1MD9A 2QVZX 1HNWC 2VSQA 1PG3A 3PBKA 3FCEA 2WD9A 4FTFA 4KTVA 4FUTA 3TR3A 5A19A 2PT7G 4D4IA 4WS9A 4JI2C 2UUAC 3UZ0A 2QW0X 4YHHC 4K0BA 3A9VA 3R44A 4RLQA 1WF3A 1VLAA 4L4QA 1ULTA 4JYAC 2QVYX 4PUHA 2E7GA 4PUIA 5A1GA 2ZZNA 1O90A 1LQLA 4DR4C 4BCAA 2UUCC 1RY2A 4KTTA 1IBMC 4DV3C 4JI3C 3AY0A 4NXNC 2ZZMA 2E0GA 1QM4A 1ML8A 4ODJA 4LF9C 2JMPA 3DHVA 4DV6C 4B3MC 4B3TC 4D56A 2HHHC 4D57A 2OPLB 2VQFC 5IT9D 1WCJA 2KZFA 2P02A 2PN2A 1IBLC 4XX2A 3CQ3A 2BH1X 3N2QA 4I9GA 2UU9C 3UX2A 4GXRA 4RLFA 2D1SA 1O92A 3O2EA 3NI2A 3TQIA 3SO4A 1EGAA 4JI7C 1O93A 3UOWA 2OO4A 4BBYA 1HNZC 1RG9A 3R9WA 4RMNA 3UEBA 3N54B 1PG4A 2YWBA 2XR1A 1N33C 5H9UA 3OTOC 1WH9A 1ZB9A 5IWAC 4OYCA 5E7QA 1LCIA 2UXCC 4DV1C 1UWDA 1T5HX 2P2MA 4DR6C 1MKYA 5JRHA 2KZ0A 3T1YC 2EGTA 4BSZA 4NXMC 3VNRA 4JM1A 4PUGA 1N32C 1I94C 3LUSA 2YCBA 3NPDA 2P2QA 3FCCA 1MXCA 1MDBA 1XS3A 1KKGA
chains in the Genus database with same CATH topology
5AE2A 2CY1A 4TPSB 2F4VC 2PROA 4JV5C 3IMLA 5AE1A 4FUQA 4DR5C 2D7VA 4X65C 3IPLA 4DV4C 1XRAA 4I9FA 1XMOC 1HH2P 1MXBA 4DV7C 1N2FA 5ADZA 2HJGA 2D1TA 3KXWA 5DV9A 4B3SC 4LF5C 1USPA 3AF6A 2AYAA 2OBVA 2Y4OA 3J81D 1UKKA 4DR2C 2E8EA 2ASBA 3LNVA 3EQ6A 4DV2C 3NYQA 1YJ7A 4JI1C 3LGXA 2P2FA 4ZLPA 1IBKC 4IR7A 4G1IA 4DUZC 4JI8C 2DYJA 5K85A 3L8CA 4JI5C 3I08A 3VNSA 3J80D 4NOZA 4DG9A 4GKKC 3CW9A 4GS5A 4DG8A 4R0MA 4X66C 2VZEA 4LFAC 2E8CA 4KHPC 2V7BA 5BUQA 4DCUA 4JI6C 4K0KC 1BA3A 4RM2A 3ETOA 3I07A 4DR3C 3C5EA 3RV2A 1XMQC 1N34C 3B7WA 2D1RA 3CJEA 1V25A 4LE5A 3E7XA 4ISBA 4MH4A 4YY3C 1NYEA 3A9UA 3DAYA 4DV0C 4LFCC 4AQYC 1HNXC 5BSRA 1JOSA 2DPLA 2YWCA 5KYTA 4DCSA 3L95X 1K0RA 2QVXX 2E5LC 5T8SA 5BSUA 3VNQA 4LF8C 4DR7C 5BSVA 5KYVA 1MXAA 1MDFA 3GPCA 5A2QD 2P2BA 3TDEA 4OX9C 3EERA 1PA4A 4G37A 3S82A 2UXBC 5AE3A 3CW8X 3H2TA 4JI0C 2OPLA 5BSTA 4B3RC 4BC7A 4WV3A 3G7SA 4OXIA 1FUGA 4PZPA 4IZ6A 1N36C 4ZJZA 4PROC 1XNQC 5IFIA 4NDNA 5BSMA 4MTNA 3DLPX 4GKJC 3R9XA 3IEUA 4RM3A 1XRBA 4R1MA 4HPVA 3TUFA 4LF7C 3ETCA 3E7WA 1XNRC 2VQEC 1L2FA 4DV5C 4PHTA 4JI4C 5GTDA 5K8FA 1V26A 2D28C 4D4GA 4LF6C 2ZM6C 5CZVA 1FJGC 2WP0C 2UUBC 3A4IA 2P2JA 4X64C 4U5YD 3LAXA 5LMNC 4DR1C 2D27A 1O9TA 3GR0A 2Y27A 2E8FA 4DCTA 4DCVA 2BJOA 3T1HC 1USPB 4RVNA 5KEIA 1QWIA 1P7LA 1J5EC 5BSWA 3PESA 4RVOA 2ATWA 4X62C 3NYRA 3JAMD 1ZB8A 5A1IA 1T5DX 2CXCA 4GXQA 4L7IA 4G36A 2QL8A 5BUSA 2Y4NA 3AF5A 4LF4C 4BC9A 1XRCA 5BURA 5LMUC 4L2ZA 5CZXA 2ONFA 1HR0C 3IEVA 4R1LA 5FLXD 4EATA 2P20A 3PROC 3GR1A 1AMUA 2UXDC 3GKUA 4LFBC 1GPMA 2D1QA 5T8TA 3RG2A 4DUYC 5BR8C 1MD9A 2QVZX 1HNWC 2VSQA 1PG3A 3PBKA 3FCEA 2WD9A 4FTFA 4KTVA 4FUTA 5A19A 2PT7G 4D4IA 4WS9A 4JI2C 2UUAC 3UZ0A 2QW0X 4YHHC 4K0BA 3A9VA 3R44A 4RLQA 1WF3A 1VLAA 4L4QA 1ULTA 4JYAC 2QVYX 2E7GA 5A1GA 1O90A 1LQLA 4DR4C 4BCAA 2UUCC 1RY2A 4KTTA 1IBMC 4DV3C 4JI3C 4NXNC 2E0GA 1QM4A 1ML8A 4ODJA 4LF9C 2JMPA 3DHVA 4DV6C 4B3MC 4B3TC 4D56A 2HHHC 4D57A 2OPLB 2VQFC 5IT9D 2KZFA 2P02A 2PN2A 1IBLC 4XX2A 2BH1X 3N2QA 4I9GA 2UU9C 4GXRA 4RLFA 2D1SA 1O92A 3NI2A 3TQIA 3SO4A 1EGAA 4JI7C 1O93A 3UOWA 2OO4A 4BBYA 1HNZC 1RG9A 3R9WA 4RMNA 3N54B 1PG4A 2YWBA 2XR1A 1N33C 5H9UA 3OTOC 1WH9A 1ZB9A 5IWAC 4OYCA 5E7QA 1LCIA 2UXCC 4DV1C 1T5HX 2P2MA 4DR6C 1MKYA 5JRHA 3T1YC 2EGTA 4BSZA 4NXMC 3VNRA 4JM1A 1N32C 1I94C 3LUSA 2YCBA 3NPDA 2P2QA 3FCCA 1MXCA 1MDBA 1KKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQL A;  4DR4 C;  2CY1 A;  4DV0 C;  4AQY C;  4LFC C;  2UUC C;  1HNX C;  1JOS A;  2F4V C;  1IBM C;  4JV5 C;  4DV3 C;  4DR5 C;  2D7V A;  4JI3 C;  4X65 C;  4DV4 C;  2E8F A;  4NXN C;  4DCT A;  4DCV A;  4DCS A;  1HH2 P;  1XMO C;  2BJO A;  3T1H C;  1ML8 A;  1K0R A;  4DV7 C;  2E5L C;  1USP B;  1N2F A;  4LF9 C;  4LF8 C;  2JMP A;  4DR7 C;  4DV6 C;  4B3M C;  1QWI A;  2HJG A;  4B3T C;  2HHH C;  1J5E C;  2ATW A;  4X62 C;  4B3S C;  5A2Q D;  2OPL B;  4LF5 C;  1USP A;  3AF6 A;  4OX9 C;  3EER A;  3J81 D;  1UKK A;  3JAM D;  1ZB8 A;  2VQF C;  1PA4 A;  5IT9 D;  2KZF A;  2CXC A;  4DR2 C;  2PN2 A;  2E8E A;  1IBL C;  2UXB C;  4XX2 A;  2QL8 A;  2ASB A;  3AF5 A;  4LF4 C;  4JI0 C;  2OPL A;  2UU9 C;  4DV2 C;  4JI1 C;  4B3R C;  5LMU C;  2ONF A;  1HR0 C;  3IEV A;  1IBK C;  5FLX D;  4DUZ C;  4JI8 C;  2DYJ A;  1N36 C;  1XNQ C;  1EGA A;  4JI7 C;  2UXD C;  3GKU A;  1HNZ C;  4LFB C;  4MTN A;  4GKJ C;  4JI5 C;  3R9W A;  3R9X A;  3J80 D;  3IEU A;  4DUY C;  5BR8 C;  4NOZ A;  2XR1 A;  1N33 C;  4GKK C;  3OTO C;  1HNW C;  4LF7 C;  1WH9 A;  1ZB9 A;  1XNR C;  5IWA C;  2VQE C;  1L2F A;  2UXC C;  4DV5 C;  4DV1 C;  4X66 C;  2PT7 G;  4JI4 C;  4LFA C;  4JI2 C;  4DR6 C;  2E8C A;  2UUA C;  1MKY A;  4KHP C;  4DCU A;  3T1Y C;  2EGT A;  4JI6 C;  4YHH C;  4BSZ A;  4NXM C;  4K0K C;  4LF6 C;  2ZM6 C;  1FJG C;  3I07 A;  4DR3 C;  2UUB C;  1N32 C;  1WF3 A;  1VLA A;  1I94 C;  1XMQ C;  3LUS A;  1N34 C;  4JYA C;  3CJE A;  2YCB A;  4X64 C;  2E7G A;  4MH4 A;  4YY3 C;  1NYE A;  5LMN C;  4DR1 C;  1KKG A; 
#chains in the Genus database with same CATH topology
 5AE2 A;  2CY1 A;  2M5H A;  4TPS B;  2F4V C;  2PRO A;  4JV5 C;  3IML A;  5AE1 A;  4FUQ A;  4DR5 C;  2D7V A;  4X65 C;  3IPL A;  4DV4 C;  1XRA A;  4I9F A;  1XMO C;  1HH2 P;  1MXB A;  4DV7 C;  1N2F A;  5ADZ A;  2HJG A;  2D1T A;  3KXW A;  5DV9 A;  4B3S C;  4LF5 C;  1USP A;  3AF6 A;  2AYA A;  2OBV A;  2Y4O A;  3J81 D;  1UKK A;  4DR2 C;  2E8E A;  2ASB A;  3LNV A;  3EQ6 A;  4DV2 C;  3NYQ A;  1NY8 A;  1YJ7 A;  4JI1 C;  3LGX A;  2P2F A;  4ZLP A;  2YX1 A;  1IBK C;  4IR7 A;  4G1I A;  4DUZ C;  4JI8 C;  2DYJ A;  5K85 A;  3L8C A;  4JI5 C;  3I08 A;  3VNS A;  3J80 D;  4NOZ A;  4DG9 A;  4GKK C;  3CW9 A;  5LCI A;  4GS5 A;  4DG8 A;  4R0M A;  3CQ2 A;  4X66 C;  2VZE A;  1P4E C;  4LFA C;  2E8C A;  4KHP C;  2V7B A;  5BUQ A;  4DCU A;  4JI6 C;  4K0K C;  1BA3 A;  4RM2 A;  3ETO A;  3I07 A;  4DR3 C;  3C5E A;  3RV2 A;  1XMQ C;  1N34 C;  3B7W A;  2D1R A;  3CJE A;  1V25 A;  4LE5 A;  3E7X A;  4ISB A;  4MH4 A;  4YY3 C;  1NYE A;  3A9U A;  3DAY A;  4DV0 C;  4LFC C;  4AQY C;  1HNX C;  5BSR A;  1JOS A;  2DPL A;  2MM9 A;  2YWC A;  5KYT A;  4DCS A;  3L95 X;  1K0R A;  2QVX X;  2E5L C;  5T8S A;  5BSU A;  3VNQ A;  4LF8 C;  4DR7 C;  2M5O A;  2MMA B;  5BSV A;  5KYV A;  1MXA A;  1MDF A;  1IB8 A;  3GPC A;  1TH5 A;  1PU1 A;  5A2Q D;  2P2B A;  2MCQ A;  3TDE A;  4OX9 C;  3EER A;  1PA4 A;  4G37 A;  3UX3 A;  3S82 A;  2UXB C;  5AE3 A;  3CW8 X;  3H2T A;  1V60 A;  4JI0 C;  2OPL A;  5BST A;  1M6X A;  4B3R C;  4BC7 A;  4WV3 A;  3G7S A;  4OXI A;  1FUG A;  1P4E A;  4PZP A;  1FLO A;  4IZ6 A;  1N36 C;  4ZJZ A;  4PRO C;  1XNQ C;  1XHJ A;  5IFI A;  4NDN A;  5BSM A;  4MTN A;  3LNO A;  3DLP X;  4GKJ C;  3R9X A;  3IEU A;  4RM3 A;  1XRB A;  4R1M A;  4HPV A;  3TUF A;  4LF7 C;  3ETC A;  2KDN A;  3E7W A;  1XNR C;  2VQE C;  1L2F A;  4DV5 C;  4PHT A;  4JI4 C;  5GTD A;  5K8F A;  2NCL A;  1V26 A;  2D28 C;  4D4G A;  4LF6 C;  2ZM6 C;  5CZV A;  3A26 A;  1FJG C;  2WP0 C;  2UUB C;  3A4I A;  2P2J A;  3A25 A;  4X64 C;  4U5Y D;  3LAX A;  1M6X C;  2Z51 A;  5LMN C;  4DR1 C;  2D27 A;  1O9T A;  3GR0 A;  2Y27 A;  2E8F A;  4DCT A;  4DCV A;  2BJO A;  3T1H C;  2CU6 A;  1USP B;  3K6R A;  4RVN A;  5KEI A;  1QWI A;  1VEH A;  1P7L A;  1J5E C;  5BSW A;  3PES A;  4RVO A;  2ATW A;  4X62 C;  3NYR A;  3JAM D;  1ZB8 A;  5A1I A;  1T5D X;  2CXC A;  4GXQ A;  4L7I A;  4G36 A;  2QL8 A;  2JNV A;  5BUS A;  2Y4N A;  3AF5 A;  4LF4 C;  4BC9 A;  1XRC A;  5BUR A;  5LMU C;  4L2Z A;  5CZX A;  2ONF A;  1HR0 C;  3IEV A;  4R1L A;  5FLX D;  4EAT A;  2DHM A;  2P20 A;  3PRO C;  3GR1 A;  1AMU A;  2UXD C;  3GKU A;  4LFB C;  1GPM A;  2D1Q A;  3CQ1 A;  5T8T A;  3RG2 A;  4DUY C;  5BR8 C;  1MD9 A;  2QVZ X;  1HNW C;  2VSQ A;  1PG3 A;  3PBK A;  3FCE A;  2WD9 A;  4FTF A;  4KTV A;  4FUT A;  3TR3 A;  5A19 A;  2PT7 G;  4D4I A;  4WS9 A;  4JI2 C;  2UUA C;  3UZ0 A;  2QW0 X;  4YHH C;  4K0B A;  3A9V A;  3R44 A;  4RLQ A;  1WF3 A;  1VLA A;  4L4Q A;  1ULT A;  4JYA C;  2QVY X;  4PUH A;  2E7G A;  4PUI A;  5A1G A;  2ZZN A;  1O90 A;  1LQL A;  4DR4 C;  4BCA A;  2UUC C;  1RY2 A;  4KTT A;  1IBM C;  4DV3 C;  4JI3 C;  3AY0 A;  4NXN C;  2ZZM A;  2E0G A;  1QM4 A;  1ML8 A;  4ODJ A;  4LF9 C;  2JMP A;  3DHV A;  4DV6 C;  4B3M C;  4B3T C;  4D56 A;  2HHH C;  4D57 A;  2OPL B;  2VQF C;  5IT9 D;  1WCJ A;  2KZF A;  2P02 A;  2PN2 A;  1IBL C;  4XX2 A;  3CQ3 A;  2BH1 X;  3N2Q A;  4I9G A;  2UU9 C;  3UX2 A;  4GXR A;  4RLF A;  2D1S A;  1O92 A;  3O2E A;  3NI2 A;  3TQI A;  3SO4 A;  1EGA A;  4JI7 C;  1O93 A;  3UOW A;  2OO4 A;  4BBY A;  1HNZ C;  1RG9 A;  3R9W A;  4RMN A;  3UEB A;  3N54 B;  1PG4 A;  2YWB A;  2XR1 A;  1N33 C;  5H9U A;  3OTO C;  1WH9 A;  1ZB9 A;  5IWA C;  4OYC A;  5E7Q A;  1LCI A;  2UXC C;  4DV1 C;  1UWD A;  1T5H X;  2P2M A;  4DR6 C;  1MKY A;  5JRH A;  2KZ0 A;  3T1Y C;  2EGT A;  4BSZ A;  4NXM C;  3VNR A;  4JM1 A;  4PUG A;  1N32 C;  1I94 C;  3LUS A;  2YCB A;  3NPD A;  2P2Q A;  3FCC A;  1MXC A;  1MDB A;  1XS3 A;  1KKG A; 
#chains in the Genus database with same CATH homology
 5AE2 A;  2CY1 A;  4TPS B;  2F4V C;  2PRO A;  4JV5 C;  3IML A;  5AE1 A;  4FUQ A;  4DR5 C;  2D7V A;  4X65 C;  3IPL A;  4DV4 C;  1XRA A;  4I9F A;  1XMO C;  1HH2 P;  1MXB A;  4DV7 C;  1N2F A;  5ADZ A;  2HJG A;  2D1T A;  3KXW A;  5DV9 A;  4B3S C;  4LF5 C;  1USP A;  3AF6 A;  2AYA A;  2OBV A;  2Y4O A;  3J81 D;  1UKK A;  4DR2 C;  2E8E A;  2ASB A;  3LNV A;  3EQ6 A;  4DV2 C;  3NYQ A;  1YJ7 A;  4JI1 C;  3LGX A;  2P2F A;  4ZLP A;  1IBK C;  4IR7 A;  4G1I A;  4DUZ C;  4JI8 C;  2DYJ A;  5K85 A;  3L8C A;  4JI5 C;  3I08 A;  3VNS A;  3J80 D;  4NOZ A;  4DG9 A;  4GKK C;  3CW9 A;  4GS5 A;  4DG8 A;  4R0M A;  4X66 C;  2VZE A;  4LFA C;  2E8C A;  4KHP C;  2V7B A;  5BUQ A;  4DCU A;  4JI6 C;  4K0K C;  1BA3 A;  4RM2 A;  3ETO A;  3I07 A;  4DR3 C;  3C5E A;  3RV2 A;  1XMQ C;  1N34 C;  3B7W A;  2D1R A;  3CJE A;  1V25 A;  4LE5 A;  3E7X A;  4ISB A;  4MH4 A;  4YY3 C;  1NYE A;  3A9U A;  3DAY A;  4DV0 C;  4LFC C;  4AQY C;  1HNX C;  5BSR A;  1JOS A;  2DPL A;  2YWC A;  5KYT A;  4DCS A;  3L95 X;  1K0R A;  2QVX X;  2E5L C;  5T8S A;  5BSU A;  3VNQ A;  4LF8 C;  4DR7 C;  5BSV A;  5KYV A;  1MXA A;  1MDF A;  3GPC A;  5A2Q D;  2P2B A;  3TDE A;  4OX9 C;  3EER A;  1PA4 A;  4G37 A;  3S82 A;  2UXB C;  5AE3 A;  3CW8 X;  3H2T A;  4JI0 C;  2OPL A;  5BST A;  4B3R C;  4BC7 A;  4WV3 A;  3G7S A;  4OXI A;  1FUG A;  4PZP A;  4IZ6 A;  1N36 C;  4ZJZ A;  4PRO C;  1XNQ C;  5IFI A;  4NDN A;  5BSM A;  4MTN A;  3DLP X;  4GKJ C;  3R9X A;  3IEU A;  4RM3 A;  1XRB A;  4R1M A;  4HPV A;  3TUF A;  4LF7 C;  3ETC A;  3E7W A;  1XNR C;  2VQE C;  1L2F A;  4DV5 C;  4PHT A;  4JI4 C;  5GTD A;  5K8F A;  1V26 A;  2D28 C;  4D4G A;  4LF6 C;  2ZM6 C;  5CZV A;  1FJG C;  2WP0 C;  2UUB C;  3A4I A;  2P2J A;  4X64 C;  4U5Y D;  3LAX A;  5LMN C;  4DR1 C;  2D27 A;  1O9T A;  3GR0 A;  2Y27 A;  2E8F A;  4DCT A;  4DCV A;  2BJO A;  3T1H C;  1USP B;  4RVN A;  5KEI A;  1QWI A;  1P7L A;  1J5E C;  5BSW A;  3PES A;  4RVO A;  2ATW A;  4X62 C;  3NYR A;  3JAM D;  1ZB8 A;  5A1I A;  1T5D X;  2CXC A;  4GXQ A;  4L7I A;  4G36 A;  2QL8 A;  5BUS A;  2Y4N A;  3AF5 A;  4LF4 C;  4BC9 A;  1XRC A;  5BUR A;  5LMU C;  4L2Z A;  5CZX A;  2ONF A;  1HR0 C;  3IEV A;  4R1L A;  5FLX D;  4EAT A;  2P20 A;  3PRO C;  3GR1 A;  1AMU A;  2UXD C;  3GKU A;  4LFB C;  1GPM A;  2D1Q A;  5T8T A;  3RG2 A;  4DUY C;  5BR8 C;  1MD9 A;  2QVZ X;  1HNW C;  2VSQ A;  1PG3 A;  3PBK A;  3FCE A;  2WD9 A;  4FTF A;  4KTV A;  4FUT A;  5A19 A;  2PT7 G;  4D4I A;  4WS9 A;  4JI2 C;  2UUA C;  3UZ0 A;  2QW0 X;  4YHH C;  4K0B A;  3A9V A;  3R44 A;  4RLQ A;  1WF3 A;  1VLA A;  4L4Q A;  1ULT A;  4JYA C;  2QVY X;  2E7G A;  5A1G A;  1O90 A;  1LQL A;  4DR4 C;  4BCA A;  2UUC C;  1RY2 A;  4KTT A;  1IBM C;  4DV3 C;  4JI3 C;  4NXN C;  2E0G A;  1QM4 A;  1ML8 A;  4ODJ A;  4LF9 C;  2JMP A;  3DHV A;  4DV6 C;  4B3M C;  4B3T C;  4D56 A;  2HHH C;  4D57 A;  2OPL B;  2VQF C;  5IT9 D;  2KZF A;  2P02 A;  2PN2 A;  1IBL C;  4XX2 A;  2BH1 X;  3N2Q A;  4I9G A;  2UU9 C;  4GXR A;  4RLF A;  2D1S A;  1O92 A;  3NI2 A;  3TQI A;  3SO4 A;  1EGA A;  4JI7 C;  1O93 A;  3UOW A;  2OO4 A;  4BBY A;  1HNZ C;  1RG9 A;  3R9W A;  4RMN A;  3N54 B;  1PG4 A;  2YWB A;  2XR1 A;  1N33 C;  5H9U A;  3OTO C;  1WH9 A;  1ZB9 A;  5IWA C;  4OYC A;  5E7Q A;  1LCI A;  2UXC C;  4DV1 C;  1T5H X;  2P2M A;  4DR6 C;  1MKY A;  5JRH A;  3T1Y C;  2EGT A;  4BSZ A;  4NXM C;  3VNR A;  4JM1 A;  1N32 C;  1I94 C;  3LUS A;  2YCB A;  3NPD A;  2P2Q A;  3FCC A;  1MXC A;  1MDB A;  1KKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...