2ONFA

Crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
GMHVYESDVSWIDDRRTEVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRMGINLKSWNSHVTAELGPSPEKGFKFHRIKIHVKIGVNDEDKEKIPRAMQLAEKYCFISRAIRNNVEEIVDYEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Ta0195
publication title Crystal structure of hypothetical protein (NP_393673.1) from Thermoplasma acidophilum at 1.70 A resolution
rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
total genus 37
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2onfA01
2VQEC 4JI0C 1HR0C 2OPLB 1XMOC 3IEVA 3T1YC 1N32C 4LFCC 3CJEA 1I94C 4DV7C 2ONFA 2JMPA 4DV4C 1HNZC 4KHPC 1HH2P 4DV0C 4LF4C 2ASBA 1MKYA 2UXDC 1J5EC 4JYAC 1USPA 1JOSA 2PN2A 4DCTA 1KKGA 4JI4C 4JI2C 1ZB8A 2E8FA 4LF5C 1VLAA 3R9WA 2UUBC 1N34C 4GKKC 2YCBA 1N36C 2E8CA 2UUAC 4JV5C 2E7GA 2UXCC 1NYEA 1PA4A 4B3SC 4DV6C 2BJOA 2OPLA 1IBKC 4NXMC 4LF6C 2VQFC 2XR1A 2QL8A 1XNQC 4JI6C 4LF8C 4X65C 3AF6A 4DUZC 4B3TC 3LUSA 4DR6C 4JI1C 2DYJA 4LF9C 3JAMD 4GKJC 4DV1C 4K0KC 4B3RC 1L2FA 1WF3A 4DR7C 5LMNC 4DV5C 1ML8A 4LFBC 1ZB9A 2F4VC 4DR1C 3OTOC 2HHHC 4DCVA 4NOZA 4XX2A 5BR8C 4JI8C 4OX9C 2KZFA 4JI7C 4X62C 1N33C 4JI3C 4MH4A 4YY3C 4AQYC 1LQLA 5FLXD 1FJGC 1UKKA 4NXNC 4JI5C 5A2QD 2CY1A 4DUYC 5IWAC 3IEUA 3EERA 4DCUA 1HNXC 1QWIA 2D7VA 5LMUC 1IBMC 2CXCA 1IBLC 2UXBC 1XNRC 2HJGA 4LFAC 2ATWA 4DR3C 3R9XA 1USPB 1XMQC 3J81D 2E5LC 3J80D 2UUCC 2E8EA 1N2FA 4X64C 4DCSA 1K0RA 3I07A 1WH9A 4DR4C 4LF7C 4X66C 2PT7G 4DR2C 1HNWC 3GKUA 3AF5A 4MTNA 4DV3C 4DR5C 5IT9D 4B3MC 4DV2C 4BSZA 2UU9C 2ZM6C 4YHHC 3T1HC 1EGAA 2EGTA
chains in the Genus database with same CATH superfamily
2VQEC 5T8SA 2YWCA 3A26A 1XHJA 4R1MA 1XRAA 2P2JA 1HH2P 4FUTA 2ASBA 3VNQA 1JOSA 4I9GA 2DHMA 1T5DX 3FCCA 3LNVA 3KXWA 3K6RA 3A9UA 2UUBC 5A1IA 4RMNA 2BH1X 1MXCA 1O93A 2UXCC 4R0MA 3GPCA 3EQ6A 4PUHA 4PUGA 2OPLA 2KZ0A 4LF6C 2XR1A 1MDBA 3TQIA 2P2MA 4JI6C 1XRCA 4BC7A 3LUSA 4HPVA 5AE1A 4DV1C 1MD9A 1ML8A 4LFBC 1PG3A 2YX1A 2HHHC 4DCVA 2WD9A 4I9FA 4JI8C 1N33C 1P4EA 1PG4A 4AQYC 1P4EC 1V60A 1LQLA 1FJGC 1UKKA 4G36A 3C5EA 4NXNC 2QVXX 1FUGA 4DG9A 2P2BA 1HNXC 1IBMC 3TDEA 1IBLC 2UXBC 2D1RA 4GXQA 2D1QA 1XS3A 2Y4NA 3TR3A 3J81D 3J80D 2E8EA 4X64C 2DPLA 3B7WA 1K0RA 3PROC 1WH9A 4LF7C 5BUSA 4G37A 4X66C 2PT7G 4DR2C 3GKUA 3AF5A 4MTNA 4DV3C 3A9VA 4GXRA 2UU9C 4RVNA 1EGAA 5KYTA 2EGTA 2OPLB 2D1SA 4ODJA 1I94C 3VNRA 5K85A 4DV7C 2JMPA 5CZXA 4KHPC 2UXDC 3G7SA 1J5EC 4LE5A 4JI4C 2JNVA 1XRBA 3IPLA 4JI2C 1P7LA 2YWBA 1ZB8A 1VLAA 4ZLPA 2YCBA 4PHTA 3CW9A 2UUAC 2E7GA 1GPMA 4B3SC 5K8FA 2BJOA 4GS5A 4KTVA 2QL8A 4R1LA 4IR7A 1BA3A 4X65C 1AMUA 1TH5A 2VSQA 5ADZA 4WV3A 2CU6A 2DYJA 3NYRA 4DR7C 4DV5C 3TUFA 1ZB9A 2F4VC 3AY0A 4BC9A 3OTOC 2D28C 2P2QA 3DHVA 3IMLA 2M5OA 4NOZA 4JI7C 4YY3C 2P20A 1FLOA 5FLXD 3DLPX 2OO4A 3CQ3A 2CY1A 5BSTA 5IWAC 1QWIA 5LMUC 3VNSA 1XNRC 5KYVA 4DR3C 1O92A 1RG9A 5BSRA 2UUCC 3ETCA 1N2FA 1O90A 4OXIA 4DCSA 2PROA 3LAXA 3N54B 5DV9A 3FCEA 2D27A 1HNWC 2KDNA 5IT9D 3SO4A 4DV2C 3L95X 4DG8A 2ZM6C 4FUQA 3T1HC 4IZ6A 3UZ0A 4JI0C 4JM1A 1XMOC 3CJEA 5AE2A 5T8TA 2ONFA 5KEIA 3LGXA 4RVOA 3CQ2A 1HNZC 4D4IA 4DV0C 3R44A 4TPSB 4RM3A 1USPA 4EATA 4RLQA 4DCTA 3A25A 3UEBA 3UX3A 3R9WA 2VZEA 4K0BA 4RM2A 1N36C 3A4IA 4JV5C 1NYEA 4DV6C 1IBKC 4U5YD 4PUIA 2VQFC 4B3TC 1O9TA 4DR6C 4JI1C 5A1GA 4LF9C 4B3RC 3L8CA 1L2FA 1WF3A 5JRHA 5LMNC 2P02A 4D56A 1V26A 4DR1C 5BSMA 5GTDA 3S82A 4OX9C 5BR8C 4PROC 2KZFA 2Y4OA 4X62C 4JI3C 1PU1A 2AYAA 4MH4A 4NDNA 2M5HA 1QM4A 4FTFA 1IB8A 1ULTA 4L2ZA 2E0GA 5A2QD 4ISBA 4DUYC 5A19A 2MM9A 3IEUA 3DAYA 4DCUA 1WCJA 3GR1A 4LFAC 3PESA 5CZVA 3R9XA 1USPB 1XMQC 3ETOA 3RV2A 2D1TA 2MCQA 3UOWA 3I07A 1MXAA 5LCIA 4DR5C 4BSZA 2V7BA 2OBVA 4BCAA 4YHHC 4PZPA 2WP0C 2NCLA 1HR0C 5H9UA 3GR0A 3IEVA 3T1YC 1N32C 3N2QA 4LFCC 3PBKA 4BBYA 1UWDA 5BSWA 4DV4C 1V25A 4ZJZA 4LF4C 1MKYA 4JYAC 2MMAB 2PN2A 5BSUA 1KKGA 3CQ1A 2E8FA 4LF5C 4OYCA 1N34C 4GKKC 2Z51A 2E8CA 5BUQA 3NPDA 1PA4A 4L7IA 4WS9A 4NXMC 1MDFA 1XNQC 4LF8C 1T5HX 4RLFA 1LCIA 3AF6A 4DUZC 2ZZMA 3JAMD 4GKJC 4K0KC 3H2TA 5BURA 3CW8X 4L4QA 3E7XA 3LNOA 3NYQA 3NI2A 4XX2A 5IFIA 1VEHA 4KTTA 4JI5C 5E7QA 3EERA 1YJ7A 2D7VA 1NY8A 1MXBA 4D57A 3O2EA 3UX2A 2CXCA 2HJGA 1M6XA 3RG2A 5BSVA 5AE3A 1M6XC 2ATWA 2P2FA 2QW0X 2E5LC 4G1IA 3I08A 4DR4C 2QVYX 4B3MC 4D4GA 2Y27A 2ZZNA 2QVZX 3E7WA 1RY2A
chains in the Genus database with same CATH topology
2VQEC 5T8SA 2YWCA 4R1MA 1XRAA 2P2JA 1HH2P 4FUTA 2ASBA 3VNQA 1JOSA 4I9GA 1T5DX 3FCCA 3LNVA 3KXWA 3A9UA 2UUBC 5A1IA 4RMNA 2BH1X 1MXCA 1O93A 2UXCC 4R0MA 3GPCA 3EQ6A 2OPLA 4LF6C 2XR1A 1MDBA 3TQIA 2P2MA 4JI6C 1XRCA 4BC7A 3LUSA 4HPVA 5AE1A 4DV1C 1MD9A 1ML8A 4LFBC 1PG3A 2HHHC 4DCVA 2WD9A 4I9FA 4JI8C 1N33C 1PG4A 4AQYC 1LQLA 1FJGC 1UKKA 4G36A 3C5EA 4NXNC 2QVXX 1FUGA 4DG9A 2P2BA 1HNXC 1IBMC 3TDEA 1IBLC 2UXBC 2D1RA 4GXQA 2D1QA 2Y4NA 3J81D 3J80D 2E8EA 4X64C 2DPLA 3B7WA 1K0RA 3PROC 1WH9A 4LF7C 5BUSA 4G37A 4X66C 2PT7G 4DR2C 3GKUA 3AF5A 4MTNA 4DV3C 3A9VA 4GXRA 2UU9C 4RVNA 1EGAA 5KYTA 2EGTA 2OPLB 2D1SA 4ODJA 1I94C 3VNRA 5K85A 4DV7C 2JMPA 5CZXA 4KHPC 2UXDC 3G7SA 1J5EC 4LE5A 4JI4C 1XRBA 3IPLA 4JI2C 1P7LA 2YWBA 1ZB8A 1VLAA 4ZLPA 2YCBA 4PHTA 3CW9A 2UUAC 2E7GA 1GPMA 4B3SC 5K8FA 2BJOA 4GS5A 4KTVA 2QL8A 4R1LA 4IR7A 1BA3A 4X65C 1AMUA 2VSQA 5ADZA 4WV3A 2DYJA 3NYRA 4DR7C 4DV5C 3TUFA 1ZB9A 2F4VC 4BC9A 3OTOC 2D28C 2P2QA 3DHVA 3IMLA 4NOZA 4JI7C 4YY3C 2P20A 5FLXD 3DLPX 2OO4A 5BSTA 2CY1A 5IWAC 1QWIA 5LMUC 3VNSA 1XNRC 5KYVA 4DR3C 1O92A 1RG9A 5BSRA 2UUCC 3ETCA 1N2FA 1O90A 4OXIA 4DCSA 2PROA 3LAXA 3N54B 5DV9A 3FCEA 2D27A 1HNWC 5IT9D 3SO4A 4DV2C 3L95X 4DG8A 2ZM6C 4FUQA 3T1HC 4IZ6A 3UZ0A 4JI0C 4JM1A 1XMOC 3CJEA 5AE2A 5T8TA 2ONFA 5KEIA 3LGXA 4RVOA 1HNZC 4D4IA 4DV0C 3R44A 4TPSB 4RM3A 1USPA 4EATA 4RLQA 4DCTA 3R9WA 2VZEA 4K0BA 4RM2A 1N36C 3A4IA 4JV5C 1NYEA 4DV6C 1IBKC 4U5YD 2VQFC 4B3TC 1O9TA 4DR6C 4JI1C 5A1GA 4LF9C 4B3RC 3L8CA 1L2FA 1WF3A 5JRHA 5LMNC 2P02A 4D56A 1V26A 4DR1C 5BSMA 5GTDA 3S82A 4OX9C 5BR8C 4PROC 2KZFA 2Y4OA 4X62C 4JI3C 4NDNA 2AYAA 4MH4A 1QM4A 4FTFA 1ULTA 4L2ZA 2E0GA 5A2QD 4ISBA 4DUYC 5A19A 3IEUA 3DAYA 4DCUA 3GR1A 4LFAC 3PESA 5CZVA 3R9XA 1USPB 1XMQC 3ETOA 3RV2A 2D1TA 3UOWA 3I07A 1MXAA 4DR5C 4BSZA 2V7BA 2OBVA 4BCAA 4YHHC 4PZPA 2WP0C 1HR0C 5H9UA 3GR0A 3IEVA 3T1YC 1N32C 3N2QA 4LFCC 3PBKA 4BBYA 5BSWA 4DV4C 1V25A 4ZJZA 4LF4C 1MKYA 4JYAC 2PN2A 5BSUA 1KKGA 2E8FA 4LF5C 4OYCA 1N34C 4GKKC 2E8CA 5BUQA 3NPDA 1PA4A 4L7IA 4WS9A 4NXMC 1MDFA 1XNQC 4LF8C 1T5HX 4RLFA 1LCIA 3AF6A 4DUZC 3JAMD 4GKJC 4K0KC 3H2TA 5BURA 3CW8X 4L4QA 3E7XA 3NYQA 3NI2A 4XX2A 5IFIA 4KTTA 4JI5C 5E7QA 3EERA 1YJ7A 2D7VA 1MXBA 4D57A 2CXCA 2HJGA 3RG2A 5BSVA 5AE3A 2ATWA 2P2FA 2QW0X 2E5LC 4G1IA 3I08A 4DR4C 2QVYX 4B3MC 4D4GA 2Y27A 2QVZX 3E7WA 1RY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE C;  4JI0 C;  1HR0 C;  2OPL B;  1XMO C;  3IEV A;  3T1Y C;  1N32 C;  4LFC C;  3CJE A;  1I94 C;  4DV7 C;  2ONF A;  2JMP A;  4DV4 C;  1HNZ C;  4KHP C;  1HH2 P;  4DV0 C;  4LF4 C;  2ASB A;  1MKY A;  2UXD C;  1J5E C;  4JYA C;  1USP A;  1JOS A;  2PN2 A;  4DCT A;  1KKG A;  4JI4 C;  4JI2 C;  1ZB8 A;  2E8F A;  4LF5 C;  1VLA A;  3R9W A;  2UUB C;  1N34 C;  4GKK C;  2YCB A;  1N36 C;  2E8C A;  2UUA C;  4JV5 C;  2E7G A;  2UXC C;  1NYE A;  1PA4 A;  4B3S C;  4DV6 C;  2BJO A;  2OPL A;  1IBK C;  4NXM C;  4LF6 C;  2VQF C;  2XR1 A;  2QL8 A;  1XNQ C;  4JI6 C;  4LF8 C;  4X65 C;  3AF6 A;  4DUZ C;  4B3T C;  3LUS A;  4DR6 C;  4JI1 C;  2DYJ A;  4LF9 C;  3JAM D;  4GKJ C;  4DV1 C;  4K0K C;  4B3R C;  1L2F A;  1WF3 A;  4DR7 C;  5LMN C;  4DV5 C;  1ML8 A;  4LFB C;  1ZB9 A;  2F4V C;  4DR1 C;  3OTO C;  2HHH C;  4DCV A;  4NOZ A;  4XX2 A;  5BR8 C;  4JI8 C;  4OX9 C;  2KZF A;  4JI7 C;  4X62 C;  1N33 C;  4JI3 C;  4MH4 A;  4YY3 C;  4AQY C;  1LQL A;  5FLX D;  1FJG C;  1UKK A;  4NXN C;  4JI5 C;  5A2Q D;  2CY1 A;  4DUY C;  5IWA C;  3IEU A;  3EER A;  4DCU A;  1HNX C;  1QWI A;  2D7V A;  5LMU C;  1IBM C;  2CXC A;  1IBL C;  2UXB C;  1XNR C;  2HJG A;  4LFA C;  2ATW A;  4DR3 C;  3R9X A;  1USP B;  1XMQ C;  3J81 D;  2E5L C;  3J80 D;  2UUC C;  2E8E A;  1N2F A;  4X64 C;  4DCS A;  1K0R A;  3I07 A;  1WH9 A;  4DR4 C;  4LF7 C;  4X66 C;  2PT7 G;  4DR2 C;  1HNW C;  3GKU A;  3AF5 A;  4MTN A;  4DV3 C;  4DR5 C;  5IT9 D;  4B3M C;  4DV2 C;  4BSZ A;  2UU9 C;  2ZM6 C;  4YHH C;  3T1H C;  1EGA A;  2EGT A; 
#chains in the Genus database with same CATH topology
 2VQE C;  5T8S A;  2YWC A;  3A26 A;  1XHJ A;  4R1M A;  1XRA A;  2P2J A;  1HH2 P;  4FUT A;  2ASB A;  3VNQ A;  1JOS A;  4I9G A;  2DHM A;  1T5D X;  3FCC A;  3LNV A;  3KXW A;  3K6R A;  3A9U A;  2UUB C;  5A1I A;  4RMN A;  2BH1 X;  1MXC A;  1O93 A;  2UXC C;  4R0M A;  3GPC A;  3EQ6 A;  4PUH A;  4PUG A;  2OPL A;  2KZ0 A;  4LF6 C;  2XR1 A;  1MDB A;  3TQI A;  2P2M A;  4JI6 C;  1XRC A;  4BC7 A;  3LUS A;  4HPV A;  5AE1 A;  4DV1 C;  1MD9 A;  1ML8 A;  4LFB C;  1PG3 A;  2YX1 A;  2HHH C;  4DCV A;  2WD9 A;  4I9F A;  4JI8 C;  1N33 C;  1P4E A;  1PG4 A;  4AQY C;  1P4E C;  1V60 A;  1LQL A;  1FJG C;  1UKK A;  4G36 A;  3C5E A;  4NXN C;  2QVX X;  1FUG A;  4DG9 A;  2P2B A;  1HNX C;  1IBM C;  3TDE A;  1IBL C;  2UXB C;  2D1R A;  4GXQ A;  2D1Q A;  1XS3 A;  2Y4N A;  3TR3 A;  3J81 D;  3J80 D;  2E8E A;  4X64 C;  2DPL A;  3B7W A;  1K0R A;  3PRO C;  1WH9 A;  4LF7 C;  5BUS A;  4G37 A;  4X66 C;  2PT7 G;  4DR2 C;  3GKU A;  3AF5 A;  4MTN A;  4DV3 C;  3A9V A;  4GXR A;  2UU9 C;  4RVN A;  1EGA A;  5KYT A;  2EGT A;  2OPL B;  2D1S A;  4ODJ A;  1I94 C;  3VNR A;  5K85 A;  4DV7 C;  2JMP A;  5CZX A;  4KHP C;  2UXD C;  3G7S A;  1J5E C;  4LE5 A;  4JI4 C;  2JNV A;  1XRB A;  3IPL A;  4JI2 C;  1P7L A;  2YWB A;  1ZB8 A;  1VLA A;  4ZLP A;  2YCB A;  4PHT A;  3CW9 A;  2UUA C;  2E7G A;  1GPM A;  4B3S C;  5K8F A;  2BJO A;  4GS5 A;  4KTV A;  2QL8 A;  4R1L A;  4IR7 A;  1BA3 A;  4X65 C;  1AMU A;  1TH5 A;  2VSQ A;  5ADZ A;  4WV3 A;  2CU6 A;  2DYJ A;  3NYR A;  4DR7 C;  4DV5 C;  3TUF A;  1ZB9 A;  2F4V C;  3AY0 A;  4BC9 A;  3OTO C;  2D28 C;  2P2Q A;  3DHV A;  3IML A;  2M5O A;  4NOZ A;  4JI7 C;  4YY3 C;  2P20 A;  1FLO A;  5FLX D;  3DLP X;  2OO4 A;  3CQ3 A;  2CY1 A;  5BST A;  5IWA C;  1QWI A;  5LMU C;  3VNS A;  1XNR C;  5KYV A;  4DR3 C;  1O92 A;  1RG9 A;  5BSR A;  2UUC C;  3ETC A;  1N2F A;  1O90 A;  4OXI A;  4DCS A;  2PRO A;  3LAX A;  3N54 B;  5DV9 A;  3FCE A;  2D27 A;  1HNW C;  2KDN A;  5IT9 D;  3SO4 A;  4DV2 C;  3L95 X;  4DG8 A;  2ZM6 C;  4FUQ A;  3T1H C;  4IZ6 A;  3UZ0 A;  4JI0 C;  4JM1 A;  1XMO C;  3CJE A;  5AE2 A;  5T8T A;  2ONF A;  5KEI A;  3LGX A;  4RVO A;  3CQ2 A;  1HNZ C;  4D4I A;  4DV0 C;  3R44 A;  4TPS B;  4RM3 A;  1USP A;  4EAT A;  4RLQ A;  4DCT A;  3A25 A;  3UEB A;  3UX3 A;  3R9W A;  2VZE A;  4K0B A;  4RM2 A;  1N36 C;  3A4I A;  4JV5 C;  1NYE A;  4DV6 C;  1IBK C;  4U5Y D;  4PUI A;  2VQF C;  4B3T C;  1O9T A;  4DR6 C;  4JI1 C;  5A1G A;  4LF9 C;  4B3R C;  3L8C A;  1L2F A;  1WF3 A;  5JRH A;  5LMN C;  2P02 A;  4D56 A;  1V26 A;  4DR1 C;  5BSM A;  5GTD A;  3S82 A;  4OX9 C;  5BR8 C;  4PRO C;  2KZF A;  2Y4O A;  4X62 C;  4JI3 C;  1PU1 A;  2AYA A;  4MH4 A;  4NDN A;  2M5H A;  1QM4 A;  4FTF A;  1IB8 A;  1ULT A;  4L2Z A;  2E0G A;  5A2Q D;  4ISB A;  4DUY C;  5A19 A;  2MM9 A;  3IEU A;  3DAY A;  4DCU A;  1WCJ A;  3GR1 A;  4LFA C;  3PES A;  5CZV A;  3R9X A;  1USP B;  1XMQ C;  3ETO A;  3RV2 A;  2D1T A;  2MCQ A;  3UOW A;  3I07 A;  1MXA A;  5LCI A;  4DR5 C;  4BSZ A;  2V7B A;  2OBV A;  4BCA A;  4YHH C;  4PZP A;  2WP0 C;  2NCL A;  1HR0 C;  5H9U A;  3GR0 A;  3IEV A;  3T1Y C;  1N32 C;  3N2Q A;  4LFC C;  3PBK A;  4BBY A;  1UWD A;  5BSW A;  4DV4 C;  1V25 A;  4ZJZ A;  4LF4 C;  1MKY A;  4JYA C;  2MMA B;  2PN2 A;  5BSU A;  1KKG A;  3CQ1 A;  2E8F A;  4LF5 C;  4OYC A;  1N34 C;  4GKK C;  2Z51 A;  2E8C A;  5BUQ A;  3NPD A;  1PA4 A;  4L7I A;  4WS9 A;  4NXM C;  1MDF A;  1XNQ C;  4LF8 C;  1T5H X;  4RLF A;  1LCI A;  3AF6 A;  4DUZ C;  2ZZM A;  3JAM D;  4GKJ C;  4K0K C;  3H2T A;  5BUR A;  3CW8 X;  4L4Q A;  3E7X A;  3LNO A;  3NYQ A;  3NI2 A;  4XX2 A;  5IFI A;  1VEH A;  4KTT A;  4JI5 C;  5E7Q A;  3EER A;  1YJ7 A;  2D7V A;  1NY8 A;  1MXB A;  4D57 A;  3O2E A;  3UX2 A;  2CXC A;  2HJG A;  1M6X A;  3RG2 A;  5BSV A;  5AE3 A;  1M6X C;  2ATW A;  2P2F A;  2QW0 X;  2E5L C;  4G1I A;  3I08 A;  4DR4 C;  2QVY X;  4B3M C;  4D4G A;  2Y27 A;  2ZZN A;  2QVZ X;  3E7W A;  1RY2 A; 
#chains in the Genus database with same CATH homology
 2VQE C;  5T8S A;  2YWC A;  4R1M A;  1XRA A;  2P2J A;  1HH2 P;  4FUT A;  2ASB A;  3VNQ A;  1JOS A;  4I9G A;  1T5D X;  3FCC A;  3LNV A;  3KXW A;  3A9U A;  2UUB C;  5A1I A;  4RMN A;  2BH1 X;  1MXC A;  1O93 A;  2UXC C;  4R0M A;  3GPC A;  3EQ6 A;  2OPL A;  4LF6 C;  2XR1 A;  1MDB A;  3TQI A;  2P2M A;  4JI6 C;  1XRC A;  4BC7 A;  3LUS A;  4HPV A;  5AE1 A;  4DV1 C;  1MD9 A;  1ML8 A;  4LFB C;  1PG3 A;  2HHH C;  4DCV A;  2WD9 A;  4I9F A;  4JI8 C;  1N33 C;  1PG4 A;  4AQY C;  1LQL A;  1FJG C;  1UKK A;  4G36 A;  3C5E A;  4NXN C;  2QVX X;  1FUG A;  4DG9 A;  2P2B A;  1HNX C;  1IBM C;  3TDE A;  1IBL C;  2UXB C;  2D1R A;  4GXQ A;  2D1Q A;  2Y4N A;  3J81 D;  3J80 D;  2E8E A;  4X64 C;  2DPL A;  3B7W A;  1K0R A;  3PRO C;  1WH9 A;  4LF7 C;  5BUS A;  4G37 A;  4X66 C;  2PT7 G;  4DR2 C;  3GKU A;  3AF5 A;  4MTN A;  4DV3 C;  3A9V A;  4GXR A;  2UU9 C;  4RVN A;  1EGA A;  5KYT A;  2EGT A;  2OPL B;  2D1S A;  4ODJ A;  1I94 C;  3VNR A;  5K85 A;  4DV7 C;  2JMP A;  5CZX A;  4KHP C;  2UXD C;  3G7S A;  1J5E C;  4LE5 A;  4JI4 C;  1XRB A;  3IPL A;  4JI2 C;  1P7L A;  2YWB A;  1ZB8 A;  1VLA A;  4ZLP A;  2YCB A;  4PHT A;  3CW9 A;  2UUA C;  2E7G A;  1GPM A;  4B3S C;  5K8F A;  2BJO A;  4GS5 A;  4KTV A;  2QL8 A;  4R1L A;  4IR7 A;  1BA3 A;  4X65 C;  1AMU A;  2VSQ A;  5ADZ A;  4WV3 A;  2DYJ A;  3NYR A;  4DR7 C;  4DV5 C;  3TUF A;  1ZB9 A;  2F4V C;  4BC9 A;  3OTO C;  2D28 C;  2P2Q A;  3DHV A;  3IML A;  4NOZ A;  4JI7 C;  4YY3 C;  2P20 A;  5FLX D;  3DLP X;  2OO4 A;  5BST A;  2CY1 A;  5IWA C;  1QWI A;  5LMU C;  3VNS A;  1XNR C;  5KYV A;  4DR3 C;  1O92 A;  1RG9 A;  5BSR A;  2UUC C;  3ETC A;  1N2F A;  1O90 A;  4OXI A;  4DCS A;  2PRO A;  3LAX A;  3N54 B;  5DV9 A;  3FCE A;  2D27 A;  1HNW C;  5IT9 D;  3SO4 A;  4DV2 C;  3L95 X;  4DG8 A;  2ZM6 C;  4FUQ A;  3T1H C;  4IZ6 A;  3UZ0 A;  4JI0 C;  4JM1 A;  1XMO C;  3CJE A;  5AE2 A;  5T8T A;  2ONF A;  5KEI A;  3LGX A;  4RVO A;  1HNZ C;  4D4I A;  4DV0 C;  3R44 A;  4TPS B;  4RM3 A;  1USP A;  4EAT A;  4RLQ A;  4DCT A;  3R9W A;  2VZE A;  4K0B A;  4RM2 A;  1N36 C;  3A4I A;  4JV5 C;  1NYE A;  4DV6 C;  1IBK C;  4U5Y D;  2VQF C;  4B3T C;  1O9T A;  4DR6 C;  4JI1 C;  5A1G A;  4LF9 C;  4B3R C;  3L8C A;  1L2F A;  1WF3 A;  5JRH A;  5LMN C;  2P02 A;  4D56 A;  1V26 A;  4DR1 C;  5BSM A;  5GTD A;  3S82 A;  4OX9 C;  5BR8 C;  4PRO C;  2KZF A;  2Y4O A;  4X62 C;  4JI3 C;  4NDN A;  2AYA A;  4MH4 A;  1QM4 A;  4FTF A;  1ULT A;  4L2Z A;  2E0G A;  5A2Q D;  4ISB A;  4DUY C;  5A19 A;  3IEU A;  3DAY A;  4DCU A;  3GR1 A;  4LFA C;  3PES A;  5CZV A;  3R9X A;  1USP B;  1XMQ C;  3ETO A;  3RV2 A;  2D1T A;  3UOW A;  3I07 A;  1MXA A;  4DR5 C;  4BSZ A;  2V7B A;  2OBV A;  4BCA A;  4YHH C;  4PZP A;  2WP0 C;  1HR0 C;  5H9U A;  3GR0 A;  3IEV A;  3T1Y C;  1N32 C;  3N2Q A;  4LFC C;  3PBK A;  4BBY A;  5BSW A;  4DV4 C;  1V25 A;  4ZJZ A;  4LF4 C;  1MKY A;  4JYA C;  2PN2 A;  5BSU A;  1KKG A;  2E8F A;  4LF5 C;  4OYC A;  1N34 C;  4GKK C;  2E8C A;  5BUQ A;  3NPD A;  1PA4 A;  4L7I A;  4WS9 A;  4NXM C;  1MDF A;  1XNQ C;  4LF8 C;  1T5H X;  4RLF A;  1LCI A;  3AF6 A;  4DUZ C;  3JAM D;  4GKJ C;  4K0K C;  3H2T A;  5BUR A;  3CW8 X;  4L4Q A;  3E7X A;  3NYQ A;  3NI2 A;  4XX2 A;  5IFI A;  4KTT A;  4JI5 C;  5E7Q A;  3EER A;  1YJ7 A;  2D7V A;  1MXB A;  4D57 A;  2CXC A;  2HJG A;  3RG2 A;  5BSV A;  5AE3 A;  2ATW A;  2P2F A;  2QW0 X;  2E5L C;  4G1I A;  3I08 A;  4DR4 C;  2QVY X;  4B3M C;  4D4G A;  2Y27 A;  2QVZ X;  3E7W A;  1RY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...