3AY0A

Crystal structure of methanocaldococcus jannaschii trm5 in complex with adenosine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
335
structure length
320
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0883
publication title Differentiating analogous tRNA methyltransferases by fragments of the methyl donor.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 89
structure length 320
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ay0A01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 3ay0A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ay0A03
1JSXA 3FYCA 3P9NA 1XDZA 2WK1A 5HILA 2G8NA 2AVDA 1SG9A 3CC8A 2WA1A 4DKJA 2JHPA 3FPGA 5FULA 4K6MA 4EMSA 3ERCA 4HTFA 4GQBA 5DWQA 1RI3A 1EJ0A 4QVGA 1WXXA 3KR1A 5E9QA 4AZWA 4ER7A 3LBYA 2FRXA 9MHTA 3EGEA 1YUBA 3KPVA 2GH1A 4V0RA 4Z2YA 5U4XA 5C0OE 2CKDA 4E32A 2IH5A 1D2GA 3EEYA 3GRYA 3HCDA 1NW8A 4QQKA 5KQRA 4HG2A 2PXXA 3UJBA 3FZGA 2O06A 3FPFA 3FUVA 3KQYA 5T6BA 3VC1A 4E2YA 1QAQA 3DOUA 1FP1D 3NW9A 2EJTA 2PBFA 4PYLA 5FHQA 5BP7A 5LQUA 2NP7A 3EVCA 3LKZA 4PYKA 5CCXA 1BHJA 5DRYA 1NV9A 4PGHA 2AOTA 3NJRA 1INLA 2VZ9A 4QVKA 2QM3A 5ICFA 2ONZA 2FYTA 4RTMA 4PIMA 5C1IA 3DR5A 4E2WA 2PX8A 3OE4A 5K01A 3EVAA 2YXLA 3A26A 3AJDA 3R3HA 1WZNA 4PWYA 3EGVA 2ZLBA 4GEKA 2O0LA 1X1AA 4JXJA 1XTPA 5GIOE 3B3FA 4POOA 2NP6A 3TQSA 3CBGA 4AZSA 3IV6A 1KYZA 5EMMA 3PLAE 3VC2A 1RI4A 5HEKA 3P2KA 1RJGA 2P3LA 3SVZA 5GM2A 3K6RA 2IIPA 2AN5A 2PGXA 3I5UA 4AUKA 1XDSA 3HCFA 4BLUA 3I53A 2QE6A 3DLIA 5DLYA 3DP7A 3LKDA 5K0LA 4PCLA 1P91A 2PXAA 3FTCA 1ZKDA 3P2IA 4OBXA 1EIZA 3EMDA 5FQNA 3MERA 5DPMA 4C08A 4GOND 1EJ6A 1NW7A 2PT9A 4CTKA 2DPMA 5EZSA 3FPHA 1JG4A 4QDKA 5CVVA 3KU1A 3Q7EA 3FTFA 3BXOA 1L3CA 4YMHA 4C4AA 4F86A 5DRTA 3FTEA 2NXCA 3OZTA 5EMJA 3TKYA 3DXZA 4GF5A 4HC4A 1P39A 1HMYA 3RW9A 3DLCA 3EVGA 1TW3A 4LWPA 2AN4A 3FPJA 1KPHA 3NWBA 4GOMD 3GO4A 4BP3A 4DQ0A 5KS2A 4YUYA 1P1BA 2PWPA 5E9WA 5BW5A 3REOA 2ZVJA 2JHAA 1D2CA 4FT4A 1P1CA 2C7RA 4RVFA 3THSA 3B3GA 4RTNA 3DULA 3RODA 3UJCA 3I9FA 1X19A 5DXAA 3D2LA 3C3PA 1XJ5A 2CMHA 3IEIA 5E9JA 2HNKA 3O4FA 4AZVA 3PTAA 2I6GA 3P8ZA 1WXWA 3BUSA 4KIFA 1IXKA 3IHTA 3KKZA 5LQRA 4CKBA 5EVJA 1YZ3A 2OBFA 2ZCJA 3OFJA 4P7KA 3UJ9A 3C6MA 1KIAA 1RI1A 2BR5A 5EKUA 3EVZA 3FYDA 1XXLA 1YB2A 3G2MA 3ID6C 3PB3A 1OR8A 1SQFA 5F2KA 4GC9A 3TKAA 2UYHA 1FPQA 2YXEA 3IYLW 4ATNA 3BKXA 3OPNA 1FBNA 3LDFA 2JH9A 4IKPA 5E2BA 4KW7A 1IY9A 3P9IA 3VSEA 3T7SA 2V74B 2Z6UA 2H11A 1XDUA 5EHIA 2OB2A 2JJQA 2NXJA 2C7QA 2OZVA 3HCBA 3G88A 2AOXA 5K0GA 1M6YA 3M6VA 3UWPA 3GDHA 4FSDA 3P9KA 4IV8A 3UJ8A 2AOVA 3MCTA 2VDUE 5K0FA 4XCXA 3BZBA 1FJXA 4EQZA 2F8LA 2ZTHA 3PX3A 2ADMA 1JG3A 3JWGA 2PT6A 2BM9A 1AF7A 3CJRA 3AXSA 2B3TA 3P71T 2AR0A 2UYOA 4DCGA 5HZMA 5LQKA 1I4WA 5E1BA 4QPPA 5D1NA 2FCAA 5FWDA 5K05A 4GOLD 3HCEA 4HSGA 4YUZA 5E8JA 1KR5A 3HVHA 4HGYA 2B25A 2AN3A 4RV9A 3UJDA 1XVAA 5EG5A 3E8SA 1VIDA 5HIMA 3HCAA 5CVEA 3TR6A 5BW4A 4M7RA 2FPOA 4NECA 2GB4A 2ZBQA 3LSTA 4GOOD 2JG3A 7MHTA 2P7IA 2WA2A 3FUWA 1N7JA 4KVZA 3T7RA 4BLVA 3HVJA 2IH2A 1R8YA 2P35A 5K0EA 3UA4A 5ICEA 3UA3A 4AZTA 3EVDA 3NMUF 3KQMA 4DCMA 4ER3A 2NYUA 4M38A 4FR0A 1G38A 3H2BA 2BM8A 4R05A 4B17A 4ER0A 4MTLA 5DTMA 5F2OA 4RTOA 1H1DA 4PYNA 4FS8A 2XYRA 4HTFB 2IFTA 3R24A 1NW5A 3ANXA 3EVFA 4A6EA 5CVDA 2HR1A 2HMYB 2PVCA 2ZFUA 3OU7A 2AZTA 3KR0A 4X41A 1B42A 2LD4A 2Y1XA 1JSZA 3CKKA 4PYIA 3A27A 4HGZA 4WVLA 5EEGA 3I64A 3VYWA 4KWCA 1JQ3A 3E05A 3F4KA 3HA5A 3WSTA 5DX8A 1G55A 3O31A 3G2QA 3MGGA 1KPIA 5LSAA 3TPZA 3GRVA 4F85A 4R6WA 3SXJA 2Q41A 2VS1A 5CD1A 2XYQA 4KDRA 3EEOA 3A7DA 2BH2A 4RVDA 3KQOA 3THRA 3KQPA 2OY0A 3B5IA 3M6WA 1NW6A 4E70A 4YUXA 2GAFA 4PCAA 1KXZA 1UFKA 2O07A 3AXTA 2ZSUA 3DXXA 2OO3A 4FT2A 4ISCA 3B7PA 2GPYA 3SMQA 3DMFA 1V39A 1ZHFA 2ZW9A 4OBWA 1I1NA 1D2HA 2VDVE 2BR4A 4P7GA 1M0EA 1NV8A 2ZWVA 5DSXA 2ZBRA 2B2CA 3BWMA 1XCJA 3SSMA 2PSSA 5D1HA 4RTQA 4XUCA 4QTUB 1JTFA 1X1CA 2ONYA 4IWNA 3SSNA 2IDKA 4HH4A 1AQJA 1L3IA 3ER8A 1G6Q1 3GRUA 3B3JA 3Q87B 3HTXA 3MTIA 3MTEA 3BGIA 3DMGA 1O9HA 2ORED 2PY6A 1O54A 5CUQA 3SR4A 1G8AA 4YV0A 2I7CA 3ELYA 4M36A 1VP3A 2ERCA 3R0QA 3FUTA 4CKEA 1SKMA 3ORHA 4RWZA 3ELWA 1ZGJA 3MCZA 4E2ZA 5C9ZA 3CCFA 3LECA 3BGDA 4LECA 3G7UA 3AY0A 3LL7A 1VE3A 1EG2A 2BZGA 3LGAA 2NXNA 3C3YA 3FUXA 1DL5A 4FZVA 4YUVA 3TRKA 3KPJA 2ZZMA 4PYMA 4R6XA 2P7HA 4P7FA 1BKYA 2UYCA 1BC5A 3U81A 4YUWA 1L1EA 1ORHA 2PXCA 3G2PA 4KIGA 3GIWA 8MHTA 2ZWAA 2IPXA 5DM4A 5DX1A 5HIJA 5GINE 3G89A 1WY7A 2NXEA 4HRAA 3BWBA 2B78A 4ZTBA 1YFJA 3SGLA 1PJZA 2VP3A 3CVOA 4QQNA 1Z3CA 1VL5A 3G8AA 4LG1A 4RVGA 2JH8A 3M6UA 4L7VA 1NKVA 2P40A 5E2AA 2C7PA 1YFLA 1AV6A 2Z6QA 3DH0A 3LHDA 2QRVB 1N7IA 3EGIA 4BY9E 3SX0A 3PVCA 4U7TB 3MQ2A 4C05A 2ZIEA 4FSXA 5KVAA 2B9EA 5GOZA 2AOWA 2IBTA 5DT2A 2R6ZA 3LX6A 3UJAA 2P1DA 1Y8CA 5KYGA 1R6AA 4DZRA 3QV2A 3LDGA 3NTVA 3OU6A 2PKWA 2PV0A 4X61A 4CTJA 1NBHA 4CKCA 3AWIA 3E23A 4EKIA 4PNEA 2I9KA 3UBTA 3FTDA 1SUSA 5E8RA 1Q0TA 2AOUA 4C04A 4PYQA 1AQIA 2P3OA 5LR6A 5HOQA 4M37A 3BT7A 3L8DA 1M6EX 1R18A 5EZQA 3M6XA 2O57A 2GA9A 3BGVA 1KPGA 4R8RA 3P97A 1VQ1A 3GGDA 3M4XA 3O7WA 5FA5A 5F2NA 2HTEA 1MJFA 3NVMB 1F38A 4OA5A 3EPPA 4C03A 5T64A 3GRZA 1RJDA 3BWCA 2KW5A 5EPEA 1YF3A 2UYQA 4E31A 2HV9A 1NBIA 3BWYA 3M70A 4LWOA 1U2ZA 3OFKA 2QY6A 2OXTA 5BXYA 4RTKA 5K09A 1TPYA 4U7PB 5DXJA 3G2OA 4CWAA 4R8SA 4YMGA 3G5LA 3ME5A 5CVJA 3MHTA 2ZBPA 2K4MA 2ZIFA 5H02A 1F3LA 1ZG3A 2FHPA 1PRYA 2I62A 3FPEA 5DM0A 5ERGB 3HM2A 2Y1WA 5FA8A 5B1SA 1IM8A 1JG1A 2QYOA 3KR2A 2PWYA 4GC5A 5G02A 1G60A 3C0KA 5EQJB 4KRGA 3TM5A 3HVKA 3A25A 5LQNA 3X0DA 4QTTB 4YV1A 3KPUA 5EGSA 5EEHA 5ICGA 1QZZA 3PX2A 2IDJA 3TLJA 2PX5A 4X60A 2CWWA 2CL5A 3CJQA 4MIKA 1JG2A 2YX1A 3KQSA 2C7OA 1R74A 1NT2A 2E5WA 1EQAA 1QAOA 3A4TA 3TFWA 3GRRA 2AVNA 5DTQA 3DTNA 4P58A 3LPMA 4IV0A 5M5BA 5GWXA 5E1MA 5EIWA 4FGZA 1T43A 5EMLA 3LCVB 2YQZA 5IKMA 3K0BA 3MB5A 3NDJA 4QPNA 4PYJA 2FK7A 5CCBA 1RI5A 2YVLA 3CGGA 4QDJA 3UZUA 3V8VA 3FRIA 5EIFA 3KPYA 2AOTB 3HEMA 2EX4A 3LDUA 3SM3A 4E30A 4EK9A 4EKGA 4C06A 4OA8A 2IGTA 3DUWA 4GUAA 2GLUA 2YTZA 3UJ6A 5GM1A 1WS6A 2ZIGA 5HFJA 1DUSA 3LCUA 3I58A 4DM3A 4DA4A 5FWAA 4DF3A 4H0NA 2PX4A 1JQDA 5FHRA 3ER9A 4OQDA 5JUWA 2G72A 3P9CA 4WXHA 3FUUA 3T0IA 1JR4A 4P7JA 5LQCA 4G56A 3OE5A 4MWZA 4RTLA 4OX9Y 2XYVA 2CMGA 4RTPA 3HCCA 1XCLA 4E33A 2XBMA 4X1OA 4CXMA 1X1BA 2P8JA 5CM2Z 3PS9A 1ZGAA 4GBED 3KQQA 2G70A 2HWKA 2YR0A 5DM1A 3S68A 5DSTA 3GJYA 3OZRA 3UFBA 1SQGA 4ER5A 1QANA 5K8VA 1RJFA 5CIYA 4RTJA 2XVAA 3A7EA 3EVEA 2EJUA 2OPBA 3PFHA 5EMKA 2YXDA 4YV2A 2YUIA 3G5TA 3NDIA 3SSOA 1QAMA 5HIIA 2R3SA 3TMAA 1R8XA 5LQJA 4V0QA 2O05A 5FTWA 1UWVA 4RYLA 3V97A 2VDWA 1L9KA 1EAMA 2EG5A 2OB1A 1NE2A 3KPWA 5DTRA 4AX8A 2BR3A 1N2XA 1X1DA 5EC8A 2AS0A 5EHGA 5EKXA 5FCDA 4Y2HA 2H00A 1KHHA 3HNRA 4O29A 5CVUA 4RTRA 3KR9A 3GWZA 3T7TA 3JWIA 2NNWB 1VP9A 2G71A 1VBFA 4F84A 3NVKI 4PIPA 5T67A 5K0NA 3PT9A 3EMBA 4XUDA 4ER6A 1TW2A 3UJ7A 3JWJA 3KQTA 1RJEA 2IP2A 1WG8A 1G8SA 1NW3A 2PLWA 1SUIA 2A14A 2PX2A 3QOWA 5LQAA 3R9XB 2OKCA 3DXYA 3R6TA 3HP7A 1Q0SA 5HIKA 2FK8A 3GNLA 2N47A 3P2EA 2P3QA 5K0CA 2IBSA 1R00A 3NWEA 4PONA 4RVHA 2ZULA 4DMGA 1KP9A 3OZSA 3DMHA 5K0JA 5FQOA 5EOVA 5E1OA 4BP1A 1QYRA 2QRVA 2XVMA 3GXOA 3RIEA 3TM4A 3ELDA 4UOEA 5K0BA 5FUBA 3C6KA 3OCJA 3HA3A 1ORIA 3EVBA 3HA7A 1FP2A 5JR3A 2G1PA 2JHCA 2Z6AA 1JTEA 3FRHA 3JWHA 1UIRA 3KQWA 3MAGA 4RTSA 4MHTA 4FP9A 3KHKA 1KYWA 3M33A 2IH4A 3E7PA 3QOXA 3ELUA 5GP1A 4EVIA 2ZZKA 4PINA 5IH3A 2OYRA 1YZHA 3TOSA 3GU3A 4XUEA 3LCCA 2H1RA 4RX1A 4Y30A 3KQVA 5ICCA 1MHTA 5K03A 2GS9A 2PJDA 4MQ4A 1O9GA 3BKWA 1VPTA 2P41A 3B89A 5GIPE 1SVUA 4PYOA 3CJTA 3PFGA 4RSRA 10MHA 5E1DA 2V7EA 1DCTA 1L3BA 3GCZA 1BOOA 5DX0A 4PGGA 4A6DA 2UZ4A 2DULA 4X63A 5FADA 3G8BA 2AOUB 4E2XA 1ZQ9A 3OU2A 1JQEA 2ZZNA 2EFJA 2ESRA 5KQSA 5DM2A 1VLMA 5P8WA 5MHTA 1I9GA 4C07A 3LBFA 3HVIA 1HNNA 4KDCA 4BLWA 1RI2A 4OQEA
chains in the Genus database with same CATH superfamily
1ZYQA 4RJTA 1C9NA 1C30B 1CU1A 1YJ5A 3L7LA 4E32A 4BO0A 5IKXA 1Q2XA 1E18A 2OPQA 3MTJA 5C24A 2ZUWA 3NMAA 4O3NA 4WLOA 3PW0A 3D0OA 4PGHA 4D46A 3E35A 3BN3A 4RTMA 3VNUA 3DN9A 3EVAA 2C9MA 4J3FA 4BXOB 1IBMJ 1J2RA 3QKSA 2V69A 2C1ZA 3KNZA 1CNMA 3OTEA 4BNIA 2AKAB 4XVRA 1T4CA 1YJWS 2IOHA 3NKYA 3LBHA 2YVKA 1D03A 4TSFA 3OEWA 4Z9BA 1JG4A 821PA 1SXIA 2ZIXA 3NLLA 4RK4A 1UMDA 1KOLA 5TMEA 5F8MA 3DV9A 2AG0A 4LF9B 3A05A 3D6JA 2MLZA 4KXQA 5IVPA 4N39A 1WHSB 1O96B 4FX5A 3MPOA 2XGMA 2XCTB 2R96A 3RKUA 1DDOA 5L4NA 4RMJA 3KDNA 5D87A 5JY1A 1JT2A 4UM5A 4XB1A 2QA2A 3UAYA 1UT8A 2X5KO 3ZWCA 1S4EA 4FB5A 1S2MA 1RWQA 3MS2A 4NDAA 2Q50A 4IIUA 1M5UA 1E89A 4G25A 6NULA 4ZAXA 3R5FA 3PWKA 3J81Y 4LYGA 2H1LA 2AW0A 1K7SN 3FBEA 3GLFB 5KB3A 1HPZB 5HUQA 5AM5A 3ITEA 4HMPA 1FVQA 3A1EA 3FUWA 3KSUA 5CXXA 1APBA 3I6PA 4F11A 3Q83A 1Z0SA 2HQIA 4J1SA 1HNXJ 5IF9A 4JMPA 2EYQA 1TB4A 4US1R 2REBA 4TMXA 2QUBA 1EBBA 3PJDA 3I64A 1OROA 3IMCA 5KG7A 3H2SA 4IFYB 5CTJA 3BRCA 2P6NA 5EHHA 2WB2A 1FKPA 2JK0A 3AB4B 4LOAA 3PWSA 1KS9A 3T1HJ 1W581 5JI2E 4DJAA 4EFMA 3R3TA 4TMYA 1N0HA 1FDBA 3A1VA 4I55A 1G6Q1 2A4MA 2D2VA 4W1QA 2N3OA 1U6ZA 4E2ZA 2VUIB 4EY8A 5BOSA 3OR2B 4DL4A 4MKVA 3IH5A 2LR0A 2AG6A 3ANYB 4IIJB 3TRKA 3BMQB 2OEJA 3JATB 2LXFA 1WB6A 1VMAA 4EEZA 4FYPA 3BRWA 2RAUA 1TRHA 3W5HA 4ZTBA 1BH6A 5G1PA 2HGMA 4EYEA 4BX2A 2Y67A 4MKXA 4EY6A 4UNNA 4H59A 1IB6A 4DPKA 4X61A 2DISA 1QJ4A 4KAAA 3O75A 4ADSG 3GPLA 1CP2A 1E9DA 3KOZA 2D3O1 3V6MA 5F8IA 2P75A 1SCDA 3PQ3A 5ECYA 4B3DA 5CM8B 3BXZA 4JI4J 4E08A 2XNSA 2HQSA 2KI5A 2W4QA 1RKUA 4PHTA 3A25A 4INOA 1H5NA 3I5BA 5DW3A 1U2TA 2FPRA 1XNRC 5T4HA 1KO8A 2HSEA 4PZCA 4PQEA 1E9AA 4C2AA 1JLAB 4JB8A 4WOBA 4R2KA 4BFYA 3B6EA 1PZGA 1VQNS 3M30B 3IA0A 1ZB8A 5AIAA 3V4VB 2FOXA 2UVWA 1JQDA 5JUWA 1ML8A 3I82A 1HQCA 3OFVA 2I54A 1U6IA 1L2TA 3DDSA 5LNK1 4OMCA 3Q1KA 3WXMA 1P8JA 1AG9A 4MUKA 3GLIA 3WXBA 4CKZA 2NU9A 3R1HA 1CPZA 1DG3A 1VKJA 1Q74A 2PJUA 4LVNP 5HAOA 3WWEA 2VKTA 5K6AC 2PZAA 4GPTA 1UWBA 1VC2A 3QUSA 1S6PA 4DUTA 3A31A 4EPWA 3HCRA 4WZBE 2GZRA 3IS9A 1I33A 1HARA 3PYGA 3L7CA 3QE3A 1JW9B 4RXMA 3DNPA 3QA9A 3QLEA 3UMGA 1RLUA 3NWEA 3ZUPA 2XNDD 1IKWA 3ZNQA 1E4EA 2H5JA 2O66A 2WSYB 1ZN8A 1S96A 5G1OA 2RJNA 2Z6AA 3TO8A 5J2TA 1PKUA 1KJJA 4Y30A 4HI1A 5FLXU 1U9IA 4TXNA 4DV6C 5GADI 3H5LA 3UFXB 3VA7A 3EPRA 2KMLA 3LUAA 1I3MA 2R85A 2PL5A 3TI0A 1US8A 3ILVA 1UW9A 1H23A 1MOPA 1UMCB 3HQ4O 1P1JA 3CG0A 4Y8VA 2H85A 2NVUB 3IQHX 2ZRFA 4NQZA 4YCJA 4FFRA 4H3KB 3ETCA 3T9ZA 2VRCA 1D2GA 4RY8A 3PLRA 3AZQA 4PAOA 1QX4A 4HHJA 4DR7F 5FD8A 3SS9X 3GT0A 3K6SA 1MROB 5A1GA 5C52B 2VKZG 1PEDA 2HEIA 2A5DA 2HSZA 3ORRA 1PWYE 2QHXA 3LCJA 5H0IA 1W4RA 1FDTA 3KT6A 1W0KA 5BR8C 1ZAXA 4O3PA 1E3TA 1Z35A 3CIOA 1HNWB 2UDPA 3J7YU 1Y3IA 1MIOA 4DSAA 3C2PA 1EXVA 3A0UA 3LUKA 1CBKA 2NTNA 1N2IA 3I9FA 4UQPA 1OI2A 4QQBA 4HCJA 4U02A 4US2R 1JIHA 4XOUA 1M1XB 4JYPA 1LPMA 1IN1A 2QVXX 4TN5A 1JE0A 1EETB 3DDNA 3HI9A 2KBEA 1GPJA 5CZXA 5LMUC 3QO9A 3KUXA 1SD5A 4JI2F 4UCFA 4X64J 1HEIA 4G2NA 3RVLA 4G0UA 4IX9A 3R41A 3ZDAA 4CMBA 1MRNA 4FCWA 5NLLA 3CH6A 1VKRA 2XGQA 4F2PA 4ZK2A 3W9IA 3OT4A 2RB4A 4IF6A 3QTBA 4XDDA 2VUHB 1SD1A 1EWTA 2CL6X 3W5AA 4H3SA 1ZKMA 3W6UA 1XHLA 4ID8A 4F4WA 3PPVA 1E3DA 3KJQB 1OTYA 2P91A 4QL3A 3LRTA 2C4KA 4CF3A 1A97A 2XCRB 4BFVA 3IEKA 5IT0A 1E1CB 4KFBA 2EI5A 4MS3B 4Z99A 5LU9A 1L5VA 4KQ6A 1AK1A 2ZHAA 4WNYA 3TCXB 3KU4A 3AVUA 2ZWVA 2KM1A 1F5NA 3CJ5A 4LFCB 3I61A 3PACA 3SSNA 2HAEA 1EUCA 4X93A 3WNCA 4I66A 4JI3J 1W73A 3UBMA 3ICEA 1J5EB 4QG3A 3C5CA 5JAHA 4MUFA 1GRQA 1T9BA 4O2BA 1ZGJA 2VG6A 3MCZA 1KL7A 3L92A 2FY1A 4IVNA 5E0OA 4LECA 5AT1A 3LL7A 1U3GA 3S55A 4BN0A 2V9ZA 4G2TA 4MW7A 1DIGA 1LDNA 7FDRA 3LP1B 3FOCA 1QDUB 1T5DX 2R68A 2M1XA 4LT6A 1X7DA 3JVDA 4TSFD 4ZP1A 5CEEA 3O4HA 1PLLA 3ZBTA 3CPEA 3BD7A 4NAHA 1GGMA 1J1ZA 3C97A 4JI7F 2Z4PA 2A0KA 2ZUGA 2ATXA 5DNYB 4NLGA 1UINA 4F04B 1V11A 2MSTA 4XWOA 1AKRA 5A03A 1PL8A 3DGFC 4LSGA 4W5OA 3SS7X 4XK8C 4YMGA 1FDSA 1NJ5A 2I62A 4V19X 4NK4A 1T9XA 1TAUA 4N49A 4PTYA 5HQMA 1RKBA 3GLFE 3CUWA 3T1YB 1PJLA 1NMXA 3HV0A 3HXQA 4USUA 1I4LD 2BACA 3ND9A 3I6BA 4ZVRB 5JJ5A 2E5WA 3RIYA 2V7GA 4PN3A 3ILLA 5G40A 2CSUA 3KEQA 2KJWA 4TLCA 3KEOA 2K5UA 2GRAA 1CULA 2PX4A 1GARA 4C7QA 3DC2A 2WE8A 3B20A 4K2JA 1NF8A 5HUJA 3VR3D 1AK2A 3EGZA 4XCQA 4FLEA 5JAIA 3TX8A 1YR8A 4N40A 1ZPDA 5EJ5A 4WK3A 3QH4A 4NEZA 4Z51A 2C8JA 1NE7A 4CIXA 4LSLB 1PGJA 2VAMA 4YFUA 3D9BA 2V5AA 5IFIA 4GGOA 2M5OA 4TLAA 5J63A 2ODTX 3O47A 2MYTA 1TZBA 2AE2A 4NLQA 3OZSA 1AKWA 1W19A 2BFAA 1VBXA 3KFVA 5ED0A 1NOJA 1ZVJA 3NCRA 4M0CA 4OQPA 1SBQA 2J0QA 1GJRA 4BX9A 3N6VA 3AWDA 5E1DA 4QJ3A 3KCQA 2N82B 2ZUTA 4KHPJ 2KE5A 4EZEA 1UOEA 3GFXA 4EBBA 3BRWD 3KP1A 1KEZA 1KEVA 4G89A 4J0HA 3RD5A 2OLWA 2W0MA 4YJFB 1NSTA 4IDDA 4JCOA 3DOEA 5IJ0A 3BQ2A 4NOJA 3ZGOA 4HL6A 4PPQA 4PYLA 1TZKA 5I9BA 3ANNA 4MAKA 2R7MA 4MIYA 4QVKA 1Q20A 1OZ0A 4D3YA 2V2QA 2FFJA 5IPFA 3AJDA 4HLBA 4FF3A 5EJ9A 1JLEB 2M4MA 2E1MC 2FWRA 3VSAA 3GL9A 3OLYA 1WKVA 3SVZA 3KWLA 3K6RA 2XMQA 2VP4A 1UZHA 1F1JA 1TU3A 4BLSA 3DP7A 1KDRA 5HXAA 1VQPS 3N3AC 4E4TA 3CMMA 1DC7A 2L69A 4OLBA 3N4WA 2VC2B 4QU0A 3ZXWA 4XYMA 2AN4A 3WFIA 4W9RA 5LSRA 5EJ2A 3HH8A 1U9IC 2D1YA 4M3NA 5JVDB 1FSZA 2LPMA 1B73A 3H5RA 3CVXA 2EFQA 3LPYA 3PF8A 2A86A 1F6BA 1YRBA 2Z51A 1N4AA 4S2EA 2IWHA 3DD5A 1WXQA 3KLHA 5KX5F 4RKQA 4ETNA 2X9QA 3LY9A 4Q00A 4QZVA 2R8ZA 3B12A 1Z4LA 1GUBA 4BUZA 3AZOA 2GFHA 2ONFA 2AB0A 2RHSB 1E2EA 2QXYA 1F7UA 1ECFA 1KR5A 4HGYA 5LIRA 1RT7B 2W6OA 2ZSEA 3RC2A 5HLFA 3HCAA 4OU5A 3A12A 3JQAB 1XMOC 1NJZA 2FUG6 1D7AA 1DCKA 4UUWA 1K6JA 4EO8A 3A3PA 3NAIA 4DMKA 3DEYX 4WE1A 3OQHA 1S1WB 3T15A 3G13A 1E77A 4AT1A 3NOQA 3PNPA 1ZL2A 1U0EA 3K0FA 2QP9X 2IEDA 3AEQA 2G8LA 4JI1B 4KQXA 1C3EA 2VDRB 1OT5A 4G86A 5DBGA 3TW4A 3G0DA 4JU8A 6AT1A 2I2AA 1WB5A 3THYB 2VRCD 4M1TA 2H1YA 3UKDA 4UEJA 3MTAA 3C5WP 4CLRA 4X54A 1YJVA 1ONPA 2CDQA 2W70A 1RKIA 2MKIA 1FWKA 2SNIE 2LZ0A 1PJ7A 5K3CA 2WD9A 4WOKA 1L7PA 1W0KD 1SL2A 1H1LB 1FERA 3UAWA 5B57C 3NNNA 5KYWB 5LP1A 4KP7A 1PIWA 5M3BA 3PD7A 4JK3A 1V5EA 3CPHA 2RH5A 3FTQA 4X20A 3S1AB 1LU9A 2NSBA 1E7YA 4P08A 2QY6A 1SC1A 2WZDA 2J3IA 1NMEA 5JYEA 3E5MA 2Q6LA 2IHJA 4YDQA 1JFRA 1RTHA 1TTHA 5TPZD 4BASA 5ETRA 2IM3A 5TLSA 3QZ8A 2PGLA 2PX5A 5LB4A 1LBHA 3PKZA 3EG9A 3PQCA 4LIPD 2PZJA 3IAS6 2QGNA 3T9DA 4GVLA 3LPMA 4DR2F 4KQ9A 3PIRA 1NDPA 3ZU6A 4C8NA 5IVKA 2OI2A 3EFOB 2H4XA 2JZOA 4PU0A 2KO1A 2GMHA 4G36A 1AKEA 5HBMB 4JV0A 4CL2A 4FQ8A 3RAPR 1TK2A 4W98A 3DT9A 4BLOA 1LFDB 3M89A 2A9PA 4DLEA 1D9XA 3RLIA 1IM4A 4L6CA 4GBJA 5AKGA 1C7EA 1WHTA 1K68A 2BSXA 3NH9A 4OAOA 3LXXA 1AXEA 3K8YA 2X2EA 2G71A 4DR5J 2VBWA 2NSJA 1BCSA 4JH0A 3OVMA 2FOIA 1YVFA 4WKGA 5ADVA 4DRYA 2IJNA 4UHHA 3KOUA 2J6TA 1WSVA 4KYUA 4Q1CA 4LRBA 1KFKB 3QSGA 2QT0A 3CZRA 1GCOA 4N82A 2B4OA 4DMCA 1Z5UA 2PS1A 3QMMA 3TSWA 3S1LA 1RXUA 1BKSB 4K8RA 1JAZA 2C22A 4H1VA 3TRGA 7FD1A 3EK2A 5BRAA 2OVBA 3REQB 1H85A 3OF2A 1JHZA 3PFKA 2IM0A 2Y4NA 4ZVOB 2AI2A 1H65A 1CULC 3JAMY 3NRBA 2J45A 4Y2IA 1WOMA 5D85A 4ANEA 3CM0A 2UUCC 3Q7PA 1R5JA 2DAPA 1YT5A 3AB2B 3OI7A 3P27A 3JQEA 1UC4B 2DWOA 3AW8A 3LKZA 3GRAA 5ELMA 3OLXA 1PTKA 3DNCA 16PKA 2SKEA 2XAAA 2HF7A 1K08A 4P52A 1XWLA 3NIWA 4ZCRA 3DRRB 3C48A 4YCCA 3DM2B 5KTRA 4MKFA 3BD6A 3LKDA 2C8VA 2C3OA 2BVZA 1ZWKA 3FKJA 3U7EB 6REQB 1PJSA 4ECRA 2Q29A 2I2YA 4XYGA 5YASA 5IANA 5L9NA 1P1BA 3PUYA 2YC2C 3EYWA 1H2XA 2X77A 3M3HA 1MTOA 1GFIA 2Y76A 4ZIWA 1EQUA 4YT4A 2RUSA 4GSLA 3QMVA 4H3VA 2BCGY 2X0JA 1KNZA 3V6DB 1Y9ZA 4FC7A 1UKZA 1C1BA 2VK1A 3EGDA 3KUUA 2WJAA 4OLHA 4A7PA 1UQRA 2WKQA 5KFYA 2XBPA 4ED4A 2WUFA 3LH5A 3CXRA 2RHTA 1EA5A 1QIIA 3RTCA 3CF2A 3ZV3A 4RUKA 4A92A 4Y98A 3KOYA 1MH1A 2B25A 2I6WA 2FWAA 4MW2A 1TR0A 2OO4A 4B83A 2V4ZA 2ONJA 1XEXB 4MLDA 1K6XA 1CQIB 4ZFNA 2QAGB 1AJEA 4B3MJ 1A7AA 4DA0A 3SDEB 2GGPB 3WHPA 4FOSA 5MFZA 3C24A 4K9NA 2X9LA 4QNNA 1J8FA 3OC6A 1AS2A 3QWHA 4X41A 2CW5A 2J0QD 4Q9NA 4ZI7A 2G9OA 1UR5A 2JC1A 1QY7A 2MB0B 4C97A 1XN9A 2OY0A 4PX9A 2GPYA 2QLWA 1I4OA 4JR0A 3M8SA 2M1ZA 4XWYA 2AR9A 3ZWNA 3BL6A 1AUDA 4QU5A 4KTQA 1JDBC 4CM3A 3KSBC 3ACDA 3OWXA 1I3NA 3ELYA 3WIUA 2HDWA 3RF7A 1E60A 5JSYA 1PT5A 3CZ4A 1AOXA 4H7JA 2W6MA 1WPQA 1UBSB 1ONSA 4FI3C 2B1JA 4CYUA 1J0BA 1EZZA 3GN2A 3BXHA 3TJZA 2HQFA 2J7KA 4QJIA 2VSOA 3B1ZA 1ZWLA 4LVCA 4H7IA 4DV1J 1C4KA 1KQGB 4R9VA 2X9GA 4N3AA 3N5BA 2ZM6F 4UTZA 3QV2A 5FTNA 1LS1A 4C4ZA 2EKDA 1RT2A 1U48A 5BUSA 2IODA 4YAOA 4E5UA 1G291 4LMZA 3HR4A 3NR2A 2QT7A 2RU9A 4UNRA 3NJ4A 3GQCA 1BROA 4XD7A 2VHTA 1FQKA 4S04A 3HDJA 2YWFA 1FOEB 2XSJB 1GG8A 3KB8A 2G1JA 2FMIA 3F8WA 2NW6A 1A27A 4D57A 1HI0P 3TJMA 4HBZA 3N6MA 4FGZA 1W9MA 2O3SA 1PK7A 3W90A 1H4TA 3NDJA 5HS4A 4NMLA 2V50A 2IY8A 2IGTA 1HOTA 3E9EA 2GLUA 4ZYXA 3K70C 1JR4A 2V94A 4OX9Y 2EP7A 3K8VA 1EU1A 2H8KA 3W66A 3T3MB 5GJBA 3MTGA 4OF4A 4OJNA 3OPQA 2DRDA 4ZYTA 1T3OA 3TMAA 2DFTA 3VISA 4D9JA 2W2KA 1L3TA 1RMYA 1DDIA 4WFKA 2EW8A 2P4HX 3LT4A 2CYBA 2ZH1A 1JLQB 1C3OB 1RJ9A 3E4CA 4GX2A 1HR0J 3JSAA 5AK6A 1T6XA 4NNOA 3N8IA 3HGMA 1XAIA 2SICE 3FWYA 1FMFA 4XAKA 1X80B 4G4IA 1WVGA 5K3BA 2ALYB 2AJ2A 4P9NA 3JR7A 4I1RA 4KMOA 3V4OA 2L19A 1KDYA 2R86A 5KNDH 5I7OA 2V7VA 1SU7A 1KKLA 4C2MA 3CWJA 2DXEA 2GO7A 5CYOA 4MEAA 3WGJA 3K70D 2AJTA 1F2GA 4EPVA 2CLIB 1G4AE 5A0FA 1TJ5A 2JFBA 4HWGA 5IDXA 5FOQA 2HYIB 1G5HA 4BEVA 1IJEB 3MURP 3FYCA 4LX8A 5BSFA 3OOHA 1LDMA 3I52A 3TI9A 1FNMA 3VPDA 4C8OA 2D0IA 2XE7A 5LDGA 2I2DA 4KKOB 4AJOA 4L3NA 2JMPA 3IPYA 3IBCB 3ZVRA 5EESA 5EQTA 2P65A 5K9ZA 1PKEA 1X4AA 4CO1A 1RWWA 4UDYX 3SS8A 5JJIA 3AEKA 2FYTA 2BYCA 1V3QE 3QXJA 4EOGA 2M70A 1GNVA 2EIXA 5SZHB 3MBKA 4XM0A 2IPAB 4FNOA 3IV6A 4RX6A 4M9CA 1ETHA 4CCWA 1H7XA 4GKJF 2GOYA 2AFIA 4O1HA 5T8SA 3W9BA 3M0EA 3TAUA 3HFZB 2W2OP 3V8QA 4BWMA 4L5CA 1DAEA 4NSNA 1RIFA 4DY6A 4ZJQA 4L4XA 1DPGA 3RREA 2HX1A 3MAAB 2JFOA 3R7BB 4OZ5A 1N9KA 3KJGA 3GG9A 3WJ1A 3CWCA 3AIKA 3DPUA 2XRYA 2ZYAA 3GJRA 3C16A 3K9HA 1XERA 2BFWA 1UZMA 3OFJA 1BMDA 3NJ8A 4P34A 2YJNA 1KJIA 5DGAA 2Q6IA 3HU1A 1RPNA 4KQZA 1CZKA 5B2EA 3TZQA 4QICA 5CCDA 4TTVA 2HA6A 2GA7A 1N8KA 3H7IA 4US0R 1H3DA 1GG2A 1DUIA 3H3FA 2YWXA 4AQYJ 2OORA 3KLPX 1P5HA 1K75A 5CEJA 4CCHA 4QDTA 1QYVA 3OTQA 1HYSB 4PAMA 1A9QA 1HWKA 2Q07A 2E4AA 2GHVC 3FGNA 2C78A 3MMZA 2FPPB 2ODBA 4PLCA 3MM9A 2X19A 2PSJA 1RHMA 1VBZA 4IYQA 5CCMA 2HMYB 4WFXA 1Z2LA 3AG5A 1LK5A 4ETMA 3G9ZA 4JWTA 4DSEA 1BQMB 4GX5A 4C14A 3HUUA 2DCMA 1IXYA 1VC6A 2PBRA 1YRWA 2WSCC 2NAPA 2J4DA 3MCAA 4J0JA 4B3TB 3OLQA 4ZVHA 1K73T 2B4QA 2J9DA 4D43A 2X7IA 2B7BB 1Q5VA 1CHNA 3GBPA 3SX2A 3HTXA 1R8SA 4WKYA 1ICEB 4GRDA 4NMXB 3D1OA 3F6EX 2IXFA 2VF3A 1XO1A 1HW9A 5THWA 2YV5A 3OKAA 4WFYA 2EZ9A 2RU3A 3IFEA 2NXWA 1N33F 3Q15C 3IBFA 3VU0A 1EP3B 1VLZA 5EKDA 4PZLA 3Q0EA 3P45B 4R3NA 1TV6B 3RC1A 1TT5B 3DE5X 3SGLA 4UVEA 3TZXA 2O8FB 4H1TA 4WNAA 5EJFA 2DPIA 3A0RB 4HZGA 4ZVKA 1QH1B 5KJ6A 1L4MA 3UJAA 1OZFA 4DR7C 2Z8YA 4TTTS 2C8KA 1XE3A 4CLUA 1JNRB 2FSGA 3INTA 3AM3A 1A4XA 2JLWA 3SYTA 3H87A 4R9RA 4HN4B 2XQCA 4RTKA 4J9OA 2QPAA 4CCAA 4TL9A 3I9OA 3I5CA 1N6QB 4D3GA 2WONA 2VNIA 4HATA 4PPYA 4FMCB 4A8SA 1JV2B 2V6FA 4D5GA 4XYBA 2XA2A 3ZU3A 1DJQA 4G67A 2CWWA 2YX1A 2OBYA 1YQ9A 3CDWA 2HJHA 3S0JA 2YVLA 4TQUS 5EZYB 2BY4A 4BQIA 1U28A 2XGJA 3I62A 3DBOB 1FDAA 3QKRA 1QE3A 1YJAA 4BS2A 2CUZA 4M9UA 2RDMA 1LGYA 8AT1B 2EF1A 2E87A 1E62A 4RTJA 4E5MA 1PJCA 4JI2C 2R2UA 3IM8A 4L8GA 1MAUA 1DQYA 3K7RA 4ARCA 4P3YA 2V5VA 4JSYA 3CNOA 4RFVA 4BNFA 4FDFA 2WEKA 2YOFA 4ES6A 3W5CA 5KMGB 2PLRA 5BV7A 1HSOA 3DU6A 3D3BJ 4A9AA 4N4AA 5J1EB 4X71A 3CLRC 3PITA 1D0SA 3AFOA 4UMEA 4MR9A 3HVAA 1M74A 2QLJA 3WMFA 3VR6H 3MEGA 2NGRA 4KSCA 4EMBA 1UEUA 3SXLA 1IY8A 3N2GA 4ZCSA 4C7JA 2M8HA 4QEZA 4G09A 4F1WA 1TEHA 3N6LA 5F3ZA 2W24A 2XODA 3V2GA 4ILKA 5TJHA 3PJRA 1CQJB 3LP2B 4P75A 2F3RA 3FLAA 4JEIA 1SXGA 1JIQA 4MMOA 2XCOA 3C98A 2IXEA 4DV2B 3EIFA 2IZ0A 3BJEA 2AN1A 1KK2A 4E2FA 4W5TA 2GPJA 5KSWB 3WIDA 1X7XA 4DN9A 1OLUA 2AMLA 5AJVB 4K5QA 1EDDA 4TOIA 1DOZA 3TB4A 4DPOA 5KWSA 4DRXB 1MLDA 3UW3A 1XR5A 4FBTA 2I65A 1IOWA 3AI2A 4XD7D 1DTWA 2IHVA 1RWVB 2CXCA 2FQXA 2P9BA 1RU3A 2H1OA 4JI7C 1UBHS 2H52A 4H16A 1J5EF 1GL3A 5EWEA 2J41A 2EVWX 1LB1B 4OL0A 2BW7A 1RBQA 3OTIA 3OA2A 4RPIA 1K8QA 1G41A 3MWEA 1C0KA 3KSRA 4CKBA 3NBPB 4LBYA 4UAUA 1L5HB 2R7OA 2JLSA 3C15C 3ROTA 2QTFA 3CVWA 2Y1DA 1EGHA 3ZNUA 4E11A 1HEYA 2HK6A 3IX7A 2AMYA 2IYTA 4F4XA 1C8BA 2EWVA 3UK0A 1YZVA 4Q4DA 2JAUA 2IL1A 3QBDA 3SC6A 5CH7B 1VDMA 3B38A 2BM9A 1ZD9A 3HZOA 5IUKC 3WAJA 4D99A 1UKCA 1MZPA 4FM9A 1OA1A 2HLHA 2R6GA 2J6IA 3CH5A 4QIFA 2AQIA 1JPUA 1V3SA 2ISQA 4GMFA 3T7RA 4EAQA 3AJ2A 3RFXA 2QIOA 2O8EA 3LQRA 5DYWA 4B17A 1YDFA 3T1YF 4FS8A 3JYHA 4RIIA 5IP5A 4ZAZA 4YP5A 3JARA 4EB3A 4ERNA 5CD1A 2B4AA 3GEHA 4M8IA 3RVRA 1GTJ1 3KT3A 4GMXA 4CQMA 4YK7A 3T5HA 3C16C 3OJLA 5D1HA 1M9NA 5IWAC 2O2GA 4OLFA 1KRXA 4PS0A 2AEEA 2HURA 3G9TA 1AQJA 2O0JA 4ZOCA 2MSKA 2CPIA 3G9UA 3V1UA 4JLPA 1KLNA 1HYBA 1TKCA 2C2DA 2XH8A 3O90A 4QPDA 4J9LA 1ZBTA 2V8PA 2OCYC 1Z4MA 3COPA 1XZNA 3D2CA 2VH7A 4K4YA 1AKQA 2PT7G 1IY2A 2DGSA 4W5QA 4MKZA 1PYOA 4LF7C 1GRNA 4GICA 4R2IA 1JXLA 4OQLA 1DO8A 2P40A 3B4MA 4UY85 2W37A 3V4FA 3WGLA 1B6GA 4D9KA 2IBTA 5M7EA 1PNOA 1GPDG 4N8NA 4I4TB 3PHEA 1Y8CA 2N42A 1RTIB 1AX9A 1W46A 4KO2S 4QJVA 1JAHA 3MWDB 2IITA 2HBYA 4E03A 4D02A 5FA5A 4Y2PA 3GP9A 1U2ZA 1URPA 4ZYYA 5KJFA 2O7VA 4QWWA 5JRDS 2J0XA 5CLFA 4KBYA 1D7OA 4KRGA 1TTQB 1W25A 1CLFA 3CZMA 1GADO 2MKHA 1CY6A 2YBEA 4G5HA 3OY2A 3M8YA 4G6ZA 4EFAC 3I2GA 2XJ4A 4PNZA 3MM7B 1KHWA 1Z9BA 2KTQA 4GAEA 5LJ3Y 4FYVB 4FC6A 4G8DA 3VGSA 1U9JA 1K1SA 3TDMA 1LXCA 4CFYA 1MPXA 2WSLA 2ZROA 1A9YA 2XMAA 3O4IA 4KR0A 3LPLA 3ANTA 2FHKA 4XTRA 4FFBB 2G7ZA 1Q3KA 1XEFA 2FVPA 1I6LA 4NENB 3T9BA 3DKVA 4ANDA 2QG6A 3ZGVA 1OFTA 2OXIA 1JSLA 1W49A 1VP9A 1M76A 4IH9A 2IC3B 5L53A 3GNSA 2ZBDA 2H7VA 3A9RA 4XKJA 1IE3A 4R5MA 1T0TV 3MECA 2ZULA 1S77D 2ZTVA 1CDEA 4OZ0A 2W2NA 1VHTA 1ZJJA 2Q21A 1E6YB 4OX9B 1KK1A 4KR2A 3G59A 1EUZA 3H9CA 4CI9A 5D8HB 1E6KA 4D4LA 1U1MA 3KQVA 2R25B 2AFVA 4KXMA 3W65A 1ZZEA 4JBXA 2A1IA 3T1VA 3GEDA 2RKBA 2CXHA 3UGQA 5KWEA 2BFOA 1U28C 2RGBA 4RQUA 4JUAA 1HO3A 2P6PA 4MULA 1C2TA 1JFSA 1Y5IB 4OFBA 1CDDA 3KR1A 3TQTA 2AE1A 4JGBA 3PUJA 3V7YA 1L1RA 4DQKA 2KRRA 1C0UA 1R9MA 1YDEA 5LP6B 1AKYA 4D98A 2QM3A 3BGWA 1HQEB 1YJUA 4KTTA 3HKCA 1E1LA 3JQ7A 4IIYA 4TRRA 2BLLA 5C25B 5HMXA 4IH4A 4NZ7A 4JI1F 4G5SA 3HPRA 3FCOA 4FN4A 4MYDA 3K9GA 3L8YA 5CVVA 4FUQA 1XMPA 4H7DA 4O23A 3RSLA 5G4LA 5GY7A 3EVGA 4LWPA 3RW9A 3FPKA 2E7WA 3WNQA 2JWNA 4A6PA 4RVFA 4V1Ak 2PFKA 1IULA 4WSOA 1LWCB 5CK4A 3H4TA 1Z82A 5EXEA 2AJ1A 1Y3JA 1NX9A 4AIIA 4A10A 1HDXA 5JW6A 2BL4A 1NLZA 4FVCA 3UMMA 1ISIA 4IO9Q 5BSGA 4N7BA 1WWKA 3T1NA 3FYDA 1XV5A 1OAAA 2FFRA 4LF1A 1NXPA 5JD6A 2IIHA 4TSRA 3K1JA 1G21B 4JVMA 2WG0A 2WP8J 4AYTA 2B5JA 4ENQA 4ID9A 1KF0A 2AN3A 3OJCA 2J5BA 3D3EA 5GONF 2Y0BB 3DS8A 4XGNA 3LSTA 5B12A 3EGOA 4BQFA 4BNYA 4AO6A 2NM0A 4IQ8A 3K2QA 3EEQA 5DTMA 3FSRA 1W7WA 4RF4A 1I7DA 4UHDA 1S59A 2BJDA 2IA0A 4CLOA 2OILA 3POTB 4UTNA 1PX2A 2WAMA 5IT9A 2FKAA 1SJQA 1SVWA 3U7JA 3OTBA 5ETNA 1MO6A 3UK6A 4M0UA 2QN6B 4YUXA 2BKEA 2DTDA 1P5ZB 1T0IA 4FT2A 1J8VA 2Y9HA 1R6UA 2VDVE 4KFUA 1VXOA 2D4AA 1PHPA 4CE6A 2RDJA 2Q7DA 4O1MA 4KX3A 4MDEA 3SEQA 3WA7A 2UXCB 2H48A 1SRRA 5EP4A 1KEKA 1KFCB 3TOQA 2H17A 3WSVA 1QIFA 1B1AA 2B0JA 3I9V6 1T4DA 4B3SJ 5JNUA 4UREA 3PGKA 3PEUA 4BZXA 3G8SA 2HMTA 8MHTA 3K4QA 1SA0B 3R09A 4KPYA 1RYDA 3TG8A 1J6UA 1OWOA 4L7IA 5L1KA 3RYHB 2QG9A 2AC7A 3PV0A 1HX7A 1QAYA 2ZIEA 1H1TA 5HPYB 1NPKA 3WC0A 2FW7A 2D2FA 3JS9A 2YHIB 2JGAA 5K45A 2FR8A 4OVKA 1CUCA 4NHEA 2V9PA 2H1VA 3TAHA 4WBNA 3A8IA 1R8BA 3HXMA 4R8RA 2WG2A 3AODA 5C53B 1NBIA 4OYWA 4JI5C 4LX0A 2Z0MA 5CVJA 5ERGB 2JZNA 1SJ1A 2BF7A 2B7CA 4M1OA 1WZCA 4EMUA 4LDNA 2NCLA 2CHQA 1S89A 4ZVQB 2G4CA 4N3NA 2HQCA 1HMVB 2EX4A 4YR3A 2JGIA 4LN1A 4ICLA 1G8GA 2ASVA 1JLFB 3QYFA 5KFCA 4QFMA 2OYCA 4KWTA 1Q1GA 1FFXB 2F8HA 4FTFA 4RTPA 3PC3A 2CDBA 1Q7TA 1U8ZA 2JC3A 3P94A 4KO1S 1IEXA 2HWKA 4M55A 1H72C 3ZTQA 5K8VA 3CF6R 4CH0S 4KLZA 4WXWA 2RFLA 3AUAA 5D0GA 1GLVA 3CE9A 1AHNA 1YQHA 1NE2A 1R0RE 2YOGA 2EVZA 4TTAA 2WTBA 1OJ7A 2BFPA 2PIDA 5I6DA 3MMAB 5I42B 1TW2A 3KRTA 3HVUA 1NXQA 1PGOA 2G9ZA 5BSKA 4CQMD 5LLTA 1RXOB 3UGKA 1M75A 3GP5A 5KDOA 5K7SA 1MO3A 2FHSA 2W43A 2PRYA 3IVAA 1VE5A 1XCGB 3PT5A 3MTDA 4CWBA 4OQXA 4TZKA 1N5OX 1JS1X 2ZUCA 4Q8EA 1ICIA 4F91B 4LYJA 5DW0A 4D9GA 4ZPCA 1IIRA 5HJ5A 4V2IA 4RO0A 4D6XA 1DSSG 2ZYRA 5D00A 2RRAA 3FY4A 2HWXA 2HPAA 5JISA 1W47A 4Q3BA 2VPQA 1ADBA 2GX8A 1UK7A 3EVWA 5KFSA 1ZQ9A 2D5AA 1DC8A 3JU3A 2V8HA 4WK2B 3VMMA 1KAOA 5ICMA 4NIMA 1CR4A 3GLSA 5DN6A 4CO2A 5EGNA 1JQ5A 1IONA 5DWQA 3QITA 1U94A 4X8MA 3TJAA 4FLMA 3O4RA 3PZRA 4NLPA 2ON6A 4B9AA 1FJGJ 1A7GE 4P2FA 2IHYA 4EGFA 3MZ0A 3UGJA 2O48X 1R8JA 2VDKB 1QGYA 4EK2A 2JNVA 3D6VA 2ROQA 3LLMA 1H3FA 2AZMA 2QZ8A 3DCJA 3GHYA 1U0HB 3FAZA 4EJSB 2VJMB 4KMRA 1PUIA 3N53A 4TGLA 4WN3A 2PT9A 5ALXA 1FKOB 3DHNA 1CFZA 2MJNA 2LA4A 3WK5A 4YMHA 5E2QA 1SXLA 2FZKA 1N2BA 3SJZA 2NUBA 3L6RA 2KFYA 3EXG1 1A1VA 3HD2A 2YNIB 2F9LA 1LPNA 4N8DA 2SCUB 5TQ0A 1IAQA 2DR0A 2CXOA 3PR4A 2A6PA 1QQAA 4WMLA 2WQ7A 3AF3A 1NJ1A 4NXNJ 4D5EA 4I64A 3KLEB 4I1PA 2H2GA 1Q83A 4GP7A 5JRJA 1JG3A 3UE2A 1U2DA 1IZYA 5D1NA 3DE3X 3FNHA 2FX2A 3IS3A 3D2WA 5CB4F 2BUBA 3P9QA 3UWTA 2D7JA 5IXUA 2JCGA 4V0NA 3HO1A 3U1NA 2CZVC 1U3WA 3D8TA 4N56A 3DFIA 5TQ2B 4CM0A 3LKBA 4ALLA 3W4IA 4TM7A 5IWAJ 1CB7A 1E3LA 4HGNA 4L2ZA 2Z4TA 3E58A 3MEEB 5JZMA 1FUGA 3G0HA 2VI5A 4FYYB 1IPEA 3QRWA 2NO5A 2OSBA 3KLVA 1L3VA 3GLUA 3E05A 2D06A 2W2PP 3CDBA 4KLCA 1B8UA 2BBOA 3O31A 3VSBA 3EEOA 4O4JB 3RCBA 2WOMA 1IJFA 3NRCA 2P2FA 3GPBA 4IG4A 1PR3A 1Z39A 2P2SA 2ZW9A 4RVSA 3TX0A 1WUUA 2DB1A 1QGAA 3OJWA 3KBBA 4LF7J 4UPVA 2V3VA 3HBFA 4F8EA 5FOVA 3F7TA 2BFFB 2IU6A 2RSLA 1FSPA 2Z3VA 1S2NA 2I76A 1J33A 3FMWA 1AXRA 5I7EA 3RLFA 1DMSA 4MR8A 2NUAB 3BEOA 3FZQA 4O3MA 4AZ3A 2P7HA 3KJFA 2HWUA 1UW4A 2GVZB 5ADUS 3NYRA 2WF9A 1FTRA 4HHUA 2UVPA 3LHDA 1Z6QA 5FD1A 3BMCB 1SOAA 2IU3A 5D3MB 3AP1A 1EFHA 4FZ5A 4ZODA 3TPCA 2WHYA 1T1SA 1LNSA 3J7AC 2LLZA 4OJ1A 1R18A 4DA7A 2FDRA 4MAFA 1QNLA 1X0VA 3BV8A 2NV2B 5A6VA 4GKJC 2UYQA 1G21E 3ZZ0A 1Y33E 1JXQA 2IIVA 1F3LA 3GFQA 1YQXA 5LBTA 3FK4A 5A8KB 4HX9A 2P4EA 2P6OA 5KNDA 4ES3A 2CIMA 1HC7A 3PDIB 3T3GA 2R1VB 3E5RA 2B8PA 4LK3A 1RI5A 2GPNA 5AI4A 1IC6A 4FHEA 2AOTB 4Z4CA 1B3RA 3CNQS 3UJ6A 1N5YA 5FAKA 5DGBA 4WJZA 2CY0A 1QO9A 4PGFA 3VR1A 1RWKB 3MWFA 3GEEA 1DC4A 4G63A 5E4FA 3KVVA 3TH5A 3USZA 1MG5A 4CJXA 3PS9A 4PABA 1ZGAA 4CLLA 3KQQA 1XR7A 5HKBA 4TVBA 1BE8A 4DCUA 1TKRA 2VAWA 1SIZA 4B47A 3OUZA 3M8PB 4Q9JA 3MTBA 2DFKB 3JYNA 4Q2LA 5DI3B 4Y2HA 5ARDA 1GTEA 5EHNA 3DV0B 5IT9D 2FR8C 4OK5A 3NPDA 5DOVA 5EFOA 1PG0A 5H9EJ 3MFQA 1MQSA 2JGLA 3QUAA 4Q0MA 4CUKA 1UKYA 1OCEA 4BKPA 4DMGA 5H81A 3RT1A 3DKRA 4OKSA 4B81A 2DHEA 5EMHA 1N4LA 2ZI7A 1NDUA 2NVBA 1RT9A 2QVBA 3FBTA 1UA0A 3RZAA 5LYJB 4X4VA 2J4CA 4FNHA 2JRLA 4PINA 5LQSA 2OHDA 4CMAA 4DMFA 5F3DA 4L7QA 1ZICA 4BB9A 2M5YA 2UZ4A 1N0VC 4ZO4A 2MXYA 1X7HA 1JQEA 2RHGB 4PUGA 2XQIA 1HNIB 4M9QA 3KO8A 3RJMA 2JJ2A 4FMDB 1XDZA 2DR8A 2G8NA 4EHNA 4HUQB 4Z4QA 4FYDA 3P52A 3RS0A 4TY8B 3EMVA 5I8PA 3P5BA 5IAAA 4PRKA 1N33C 2P11A 4OZLA 2FVRA 4CG3A 5F76A 1BHJA 3FGOA 1AF4A 1NYLA 2GN1A 1EWKA 1CVIA 2N46A 4JJFA 5KYTA 2F3QA 5DGHA 6ABPA 2O0LA 3NHKA 2DUJA 2P6UA 3IOMA 4JYBA 4HVLA 1YE5A 2HK3A 1RY2A 1PJBA 1T95A 1MTZA 4B3TF 5HROB 1MAHA 2JGJA 1H9AA 3O1LA 3KFWX 4CTKA 4WI1A 1VSTA 2H4HA 4AXJA 3T7DA 3KZCA 1P8GA 2WSBA 2GESA 3K9BA 2ZJRQ 3NVDA 1YK1A 1PO7A 2QTNA 2D27A 4AD6A 3L06A 2DNOA 2IXTA 4RTNA 2HNBA 3AHDA 5AQEA 3IERA 2IGBA 4XIUA 3ETLA 4WZZA 2HM7A 2F3SA 4BHTA 4IG0A 1J56A 3DDUA 3BUSA 3UD4P 2IHKA 4D6YA 2GN0A 1D5WA 5I3CA 3PC2A 1Z5ZA 1JFFB 2Q3EA 3LALA 5DDQC 3NS6A 2YS7A 3TTSA 3WLEA 3GH3A 1SQ0A 7REQA 1WUIS 2H11A 1C0PA 4KSBA 4NH0A 2AOXA 2VYQA 3FNFA 4PSUA 1KP3A 2B9WA 4IXDA 1LW6E 1AHHA 4LFBJ 3T06B 5IJXA 3SQGB 4JQYA 1HDCA 2ZKIA 2CGEA 2A9FA 3TW8A 4IS2A 4MICA 5FPSA 4KGVA 3D0RA 3HHLA 4UVHA 3CJSA 4U7HA 3R5TA 4E07A 2E7XA 1I13A 2XCAA 3NYWA 4KWHA 2KLHA 1TFRA 4LWZA 4PWDA 4HGZA 5FBQB 4NBKA 4CLSA 4OOFA 4QAJA 3NGXA 2HCFA 1Y1PA 3UJHA 5FPPA 3ZWWA 3B5IA 4JI6B 1P2BA 1XHFA 2O7NA 4NY1A 5DV9A 4P84A 1HLWA 5DN6D 4EM6A 1VMEA 1CY0A 1GFZA 5BJRA 4X6UA 3WP1B 3RPEA 4MP6A 2UZ3A 2FJBB 1V95A 2FW9A 3CCUS 3UMYA 4R1PA 3KVRA 3SQNA 2PGOA 5CHYA 4EZ9A 2BGIA 2PUHA 1U2DC 1S49A 1BLUA 1JEJA 1M2NA 1NI4A 3BB1A 2I6TA 3OTOB 3TVYA 4JI5J 4QHTA 2XCUA 4BNGA 4YRSA 1RYEA 3NBFA 1PJ2A 4MCHA 2HSWA 4U2CA 1ODLA 2ZRCA 2P2GA 4L8LA 2FPIA 5HK9A 2JIDA 2CYAA 2Y1GA 1RT6A 1DPFA 3JQFA 3QLHB 3ROEA 2AF3C 2GRJA 4JXKA 5B3KA 3L1KA 4YC7A 4EI9A 5C1DA 5EHZA 3ICVA 1UPBA 4X95A 2VQEF 1ZVKA 4YN3B 3EZ7A 1KR4A 3VR6A 3TLGB 4QGAA 4Y1FA 1JZTA 1OQAA 2H5IB 2LMIA 2JA2A 1NK9A 1J8MF 3COWA 3DR3A 1RQPA 3DHXA 2CFOA 4OSOA 4Z7YA 1CQXA 1W44A 4H4CA 1NBOA 3UCEA 4B7CA 1P7VA 1ZSNA 1WHXA 5KYVA 4BBPA 2HRZA 4LR7A 1QIGA 1HFWA 1UKVY 1JIIA 2QYSA 1EP1B 1XD9A 2ZNYA 1A50B 1ULUA 4NABA 1K0VA 2FSIA 4F72A 4Y1GA 2R66A 4U6NA 5CIYA 2G1DA 2X1GA 3DBRA 2IZ5A 2E5LF 1HI9A 4EMDA 3PXEA 2AT1A 5ILGA 4I99A 4WDQA 4FYWB 3RASA 5T7LB 3DW3X 1ZNZA 2BR3A 3SKYA 4WADA 3T52A 1R0CB 4DA8A 3VV2B 2AYAA 4JIMA 1KP2A 5HMLA 1RJEA 1Q0TA 2PX2A 3WGTA 1NATA 2OPHA 1UOOA 2OKCA 2Y6UA 4LTNA 4DNQA 2LXUA 2LP4Y 1XK6A 3CUVA 5IM0B 4DG1A 5JR3A 4LXHA 2IW1A 1NW9B 1W34A 3KHKA 5HJYA 3D4LA 1N7HA 2NLOA 4H1WA 4RX1A 1R64A 1TKDA 3B9BA 4NLSA 3I0SA 3PX0A 1UBEA 2VP9A 5A3VA 3NT4A 2C9CA 1R31A 3GCZA 1SAYA 5L7YA 2WUWE 4AG6A 1QKKA 1EVYA 4NMMA 1HNNA 1D6NA 1ZFNA 2DH5A 2QJFA 4KGZB 1DXQA 3RHSA 3NOGA 3B9RA 2JHPA 1E9SA 4J6EA 3PNMA 4AZWA 4NDNA 2A0XA 3EA4A 1G4CA 4ZAGA 2ATEA 3R5JA 3A1NA 3QKWA 5JADA 2KM8C 4D0LB 2I3ZA 4YMLA 2YKAA 1K88A 2O8BB 1TL7A 3EGWA 2VWHA 3G5UA 2O6LA 4TS3A 3FCWA 4N0EA 3NONA 2ZEJA 4Q18A 3I04M 1EWYA 5CW2A 5LDDC 3QPVA 1X5OA 4LXYA 3HJUA 3CCTA 1EFDN 4IXNA 2JLBA 3WGMA 4K0KB 3ZR4B 1LFAA 5KNDD 3DAFA 3O8RA 5IVHA 3EXIA 1QG4A 3AONB 2PJZA 3VZIA 4H3HB 3A9VA 1G1XA 2WTNA 3KLIB 4EJ6A 3OM9A 1H38A 3CGIA 1SBYA 1HE8B 4BGVA 2C98A 2JLGA 3K20A 4N5MA 4IJ5A 5K8FA 3PC4A 1WD6A 1FESA 4AJNA 3AA9A 2UVRA 4XDGA 1SHJA 5JANA 4TWIA 1SKRA 2BUNA 2Q9CA 3KV3O 5I7AA 4GMKA 4FSDA 2QTCA 1BDMA 3R0ZA 1XNRJ 3AXSA 1T9AA 4ZO7A 5JALA 4UU0A 1VJRA 3N59A 5C46F 2ZRJA 3UJDA 4ZK7M 1USWA 2EF0A 1K0TA 4GOOD 3BFVA 3L0DA 2F6RA 5L51A 5ES4B 3L0CA 4MI1A 5LOQA 4WESB 4AKIA 1SUQB 4WEQA 4AC9A 3R5AA 2GK6A 2XYRA 1QF6A 1TZMA 2BFBB 3GIDA 2WAQD 1E1QA 2HR1A 3UHJA 2IV3A 3HULA 4HVTA 2JJMA 1ETUA 2WQ6A 2ACWA 1T03B 2JHFA 2Z3ZA 1L5YA 4LNUB 2JIRA 4YX9A 1CNFA 4RA6A 1PR5A 4B09A 3W5DA 2E0IA 2JJ2D 1WNTA 2Q4RA 4QTUB 1HL7A 2C2MA 3DD1A 3CNBA 4OOEA 3H7HB 2F8MA 3LPCA 1A2BA 3C3DA 4K4TA 3NO4A 4JNCA 1KVRA 1ZRNA 3BGFA 3R6DA 2DT9A 1P45A 2VBGA 4H08A 3QWIA 3TIXB 5ALTA 2AMJA 3ROKA 3RRGA 1WJ9A 5C8YF 4Z7CA 3T9NA 4DV6J 3AINA 2VQFB 4ZLNA 3DM5A 3ETNA 5A5EA 4I50B 1T1JA 4TQSA 1G3UA 3K1ZA 2BJ9A 3AKYA 5AXNA 2PKYX 4URSA 3HHLC 1EFCA 4OX9F 2GWRA 1MOQA 3W2HA 4NU6A 5CB4A 5DSZA 4S1WA 4EFDA 4AFFA 3C41J 5KKAA 3BYRA 2FJDB 2GCNA 2B6HA 4LAFA 3L49A 4A47A 2AR7A 3M32B 4NATA 4FZ3A 3GJSA 4FHDA 4UARA 5FDLB 3IODA 1GXLA 3G2OA 3KTAB 4WFBQ 4E3WA 3FPEA 1RT1A 2I0FA 1ST2A 4X84A 4OQZA 1DJ0A 2ALZA 1DXOA 3SXUB 4X2BA 3IVGA 1M2EA 4BU1A 5BR8J 1XDWA 4MJ7A 1FXLA 2GBLA 3CPJB 2Q8NA 5SZJA 1FLOA 1OH5A 3MB5A 4WIIA 3KAKA 2XLIA 1SULA 4WLEA 3PE4A 3JB9k 3L6CA 3LDUA 4Y6QA 1MPTA 1LPSA 1BTOA 4RXUA 2FJWA 1U3UA 5DP2A 3HSYA 4Q2MA 4DS5A 1M5HA 2O7RA 2NLWA 4ZMBA 3QVVA 1PZFA 5BURA 2G9NA 4UTPA 1NULA 1U4OA 3HHLD 4C0AC 3O8WA 4JJZA 1YRLA 4F8JA 1QK5A 5GAHI 3NP9A 3A2NA 4FR5A 1M6HA 2F40A 3L82B 3DLHA 4MFBA 3ACBA 4TKVA 4XE5A 5LMUJ 1GXUA 3PZBA 5THQA 3JQFC 3UJ3X 4A0HA 3DHWC 3PTLA 1Q0SA 5FR1A 4JZKA 2QPTA 3MF4A 3W5ZA 5JLJA 2GO9A 4KH0B 3LA6A 3EAFA 5H83A 2XVMA 1XTTA 3LWLA 1XP5A 1HL6A 4RETA 4J5OA 4K05A 2D74B 1K44A 2QUJA 2VSFA 4EBDA 2FPHX 4EHJA 1BHSA 3NBYC 3HSSA 4OV1A 1RWUA 1J0XO 1BOOA 1X8XA 3EZYA 3GJ4A 2NYIA 5B58T 3FVYA 1M5RA 3LQ4A 3NPAA 2HREA 3HSKA 5FOUA 4NXMB 4TMWA 4DDHA 4CLKA 1GR0A 2V4JA 2AQHA 5EIHA 4C2UA 3DMYA 3IGVA 2RB5A 2PX0A 3TQIA 3GIMA 1GILA 1JSRA 4E5PA 3SKXA 1DIHA 3RFFA 4LC1A 4YWHA 1JLCA 4J9SA 4MIAA 1JKMA 4OQMA 1EBFA 3TQSA 3ILSA 3X1DA 1DKRA 2DR7A 3HS3A 1TXGA 2AN5A 3UANA 1W29A 2MQMA 5C7PA 2O54A 1JKIA 3VR6D 1VJGA 2UXCF 2GBFA 2YKMA 3FPHA 3AHEA 1SUFA 3U4IA 1OZAA 4NPHA 5G3YA 1KY4A 4HC4A 1QFSA 4YB8A 4DMUB 3FFIB 2EATA 3MVEA 2I5JB 5KYNA 3HFKA 2H57A 4BFTA 1Z8HA 3D7KA 1RI1A 2YH2A 3THOA 3GLVA 1YQTA 3NYIA 4UM9B 3U9LA 4RLQA 4JUDX 2H4WB 5D0EA 1RHQB 1GITA 4RKUC 2KZFA 1WM1A 2ERRA 2EIHA 4FGJA 3FSJX 4FCCA 3DM9B 3BMOA 1FVOA 4DOMA 2FJUA 1GNQA 3KKFA 1ZOOA 4CF6A 2BEWB 4BNDA 5KOWA 4DCGA 4GPAA 4IR7A 4B6FA 5BVGA 4LGYA 5ETKA 1T10A 4U7UK 1QHHB 1TL7C 3H25A 2J48A 2YV3A 1IY1A 3E9MA 5E3AA 1YCDA 3HVJA 4OYBA 3QT6A 4F92B 2FP3A 3K16A 2HF2A 1FXDA 2G25A 3AUSA 4ZVVA 2E9RX 3D6HB 4IJKA 3WGNA 2Q43A 4URHA 1XAJA 3D7SA 2F1OA 3L7OA 1SWWA 5I7WA 1JQ3A 1AGXA 5JNWA 3ISZA 4HAUA 4QOJA 2EFOA 2C4HA 4F85A 2QTRA 1SR8A 1BDIA 1SPBS 3BBLA 2V8GA 1ODKA 2ZJFA 1UP6A 2PKCA 1ES9A 4UUXA 2Z8QA 4G97A 5J40A 1EG7A 5BYSA 2NZJA 3PRKE 2FF5A 1LCIA 4QUJA 4ZJYA 2CXTA 2W6IA 2QV7A 3U2QA 3B6MA 4U2FA 2YXNA 2B6AB 1X9HA 5GMOA 3DRPA 1JSCA 2AUTA 3QF4B 4LF9F 1RCOB 4GKKB 5MHTA 1ZSVA 1HLGA 3E22B 3G8QA 1CC1S 4EG5A 1BYIA 3EDMA 1YMUA 4WL0A 1D1UA 5EHQA 2XXAB 4FINA 4ND6A 1A69A 3R6WA 2DIUA 3DP9A 4RW7A 5L9XA 2Y77A 5KYGA 4IIVA 4HNAB 1TF5A 4FW8A 2I6UA 3HO8A 3QYYA 4CM2A 2DMRA 1UJ4A 4I5DA 4TTJA 3TW0A 4V0ME 3DDIA 4C0HA 4L72B 2CPZA 3HU3A 4MWOA 5L3QB 2CHGA 4F4FA 4KN9S 5CM9C 5TXGA 3DLPX 4TKUA 2DNQA 3T7KA 2WUEA 1K5DA 4URVR 4OLJA 3LW8A 2OZLB 5JASA 2FVSA 3C15A 1CE8A 1V16B 5A76A 4DCTA 1ZH5A 2EZUA 1UKUA 1S0OA 2VBFA 3KPUA 4TM8A 3NIBA 3PX2A 3TFQA 1CLUA 3VFDA 1Q1NA 1JR6A 1NVUQ 3ZH9B 2C7OA 2IEYA 1ZPWX 4N76A 3GV0A 5B09A 4QSMA 3TL6A 1FLVA 3KOMA 5JSUA 4AJLA 5T41A 1Q19A 2D3OR 1T9HA 2X4IA 1NH8A 1F4PA 3PKMA 1M1GA 2M32A 1K66A 1U1OA 4LYAA 3M2PA 1VSVA 4I36A 3ZNJ1 2WAYA 1QP7A 2J6HA 3ZO7A 4QM7A 3C45A 4LXQA 1RAIB 3DEAA 1E1QD 5IWCA 2XY5A 621PA 4UULA 1H2EA 3VTFA 4DWJA 4Q7QA 3HWX1 1FFHA 4DSLA 5JTUA 2COKA 3HDSA 2PMZD 4KH1A 1GD1O 1DO0A 2Q2QA 1IUJA 1AB6A 5KG5A 2J6SA 4OP3A 3AUTA 4IIJF 3F5FA 5E4TA 4FNIA 5F8JA 3WFZA 2ZOGA 1RC0A 3VI4B 3HA3A 1UBGA 1XMOJ 5C1OA 3K1AA 3MF5A 1RFLA 2JEYA 3D2BA 1NJ6A 2CEKA 4HLDA 3DFUA 4EHDA 2GBLC 1IK6A 10MHA 1E1KA 5DX0A 2O8DB 3SZ3A 4DC0A 2XRZA 2H0RA 1TO1E 3MT8A 4F4ZA 4QGGA 1HE5A 3GUCA 4LQ4A 3FCAA 3EPLA 1ZM3A 4P3XA 1AURA 1IHUA 4AUEA 1L2FA 1TFUA 1JQJC 2ZBUA 1A7JA 1PS8A 4I68A 5I48A 1S6OA 4J0GA 3B78A 1ECBA 5HQ3B 3FMPB 3S70A 1E2KA 1MXHA 3F7OA 2Q9BA 2ZJ7A 2CNLA 1ZAVA 5IVDA 3WHKA 5C2CA 1S2LA 5IABA 1QYXA 2A1BA 1OXSC 1JG7A 1K7EB 1MXAA 3BREA 1EJ6A 3DE4X 1U0FA 2J9FA 3GY0A 4NL5A 5DHQA 3WBZA 3D3CJ 5DASA 3I28A 1H2HA 3T5MA 2XVYA 3U1VA 3JXOA 1AN9A 5KSYA 3OA0A 2RRNA 3GLQA 4UBOA 1OBVA 1N2ZA 1W36C 5L4LA 1XCOA 2HL6A 3AQ4A 5KX5A 1BJTA 2PSEA 3DMNA 3QF7A 5IUJC 1ZQ1A 3A6ZA 3EVZA 4CMKA 1SXPA 3G2MA 1R8CA 3THVA 1Q12A 3PCTA 2YXEA 3UVEA 4Y1RB 1F2TB 1XNGA 2WINI 3I09A 3AFGA 1R0BA 2ZUFA 3IKVA 2DXDA 4BFCA 3M4NA 2QGZA 3AY7A 3GGOA 3LV8A 1R50A 2QX6A 5BQOA 5H82A 2XYGA 1UT5A 1JWWA 1F60A 5KFTA 2O1EA 3BXGA 3PX3A 3F41A 4C89A 5AE2A 2C7VA 3UWSA 3DKPA 1I4WA 2BGLA 2HQRA 4DL6A 1RC1A 2XUAA 1GQQA 5B6PA 3F3KA 2RC5A 4I1TA 5KVSA 4JV5B 1UXJA 2QZJA 2RI0A 4I8DA 5FNVB 2JVKA 3SV3A 4AULA 2ZJ5A 4J2HA 3T6BA 4OXIA 3JYTB 4DCJA 4LDRA 3THPA 4TT8A 1P7PA 4PQRA 3LH2S 1XCBA 4B1FA 2PA0A 4M1YA 2JIBA 4HF7A 2RI1A 3V80A 1W36D 1Y4ZA 3OURA 5L4SA 5CYMA 3QU5A 1RT3A 4E70A 1PNRA 1MVLA 2DG2A 2ENUA 4HI2A 5KYUB 1HETA 1M6WA 1MSWD 2G9QA 4RW4A 2WKPA 2ZG6A 3OHBA 3ROPA 4R0EA 2B1IA 2FEMA 1FS5A 1RWNA 1T5TA 4HH4A 2UUAB 2XVXA 2NTEA 4PV7A 1JLBB 1N5KA 1V3RA 3TCNA 3MTIA 5AK4A 1DKPA 3RGIA 2A0FA 3UB4A 5F1OA 4H7FA 1IIBA 1KMHA 1HNWF 4MHSA 3QU4A 3V6JA 1A2OA 3CW8X 3ZJTA 4DSNA 2F64A 1EHIA 4HX2A 1ZA2B 2HT1A 1U6KA 2EHJA 2IPXA 2WAOA 4DADA 1SEVA 2PFSA 4RPCA 5ER9A 3AT1B 4NE7A 5CLIA 1YO6A 5B0FA 2A1TS 1KKHA 1Y7HA 2CWXA 4IDGA 3K73O 3EQZA 3CUYA 1N8SA 3Q23A 2CHEA 3HJTA 5LYJF 1T6NA 2GYYA 3UPDA 2BANB 1RPTA 4UVDA 5E8RA 2F1HA 2UUCJ 4C04A 2R7XA 1IB8A 4MA4A 1H3NA 2EG9A 2O5CA 3ITHB 4W5JA 5CX1B 1U02A 3I5MA 1Y48E 2BX6A 3OFKA 2O2SA 4WW0A 1VE9A 2GBPA 1QGOA 3WGIA 2X9VA 3VNBA 4EJFA 1QV6A 3R7WA 3ZDQA 1J5OB 1ZUHA 4JD5A 2QYOA 4LVUA 1KSFX 1TIPA 3HVKA 4UOGA 2QL7A 1IPFA 3AVYA 1H0SA 3TZYA 1TUBA 4R2WA 2PSDA 1IVNA 5C3UA 5I51A 4JDPA 3X1LB 1QAIA 1M6XA 1EX6A 3ZQ6A 1NHWA 2QO3A 1RE1A 4QT4A 4N3CA 3OQJA 1U0BB 2IUFA 3H8WA 1PTJA 3U7IA 4MRRA 3A6LA 2DLNA 2ISSD 5JFGA 3U7QB 1V2HE 3UWDA 3OOJA 3CLRD 3VOTA 4L85A 3ZIAA 5DSTA 3M6FA 3LWZA 1X4FA 3TBKA 3PFHA 1BW9A 4HDRB 4IG3B 2PZBA 4YV2A 5C8YA 3FHTA 5JSZB 3AETA 3RUPA 4LFCF 3ZZPA 5MN6A 2VJAA 2VDWA 3NG1A 4BO6A 1J20A 1KSJA 2ATCA 3GZ4A 2Q9AA 1HBNB 4WP3A 1W4CA 2CFSA 4LDZA 3CIMA 2BOPA 2Y27A 3MMXA 1P3Y1 3WLAA 3NVKI 4AO8A 4DUYB 2QTTA 3AQIA 2D28C 2IK8A 1T3NA 3RBEA 1GG9A 3T7JA 4DN0A 1GU7A 3TM4A 5C80A 2Z2IA 1ZCJA 5FUBA 3C6KA 3OCJA 2RBEA 4QAQA 2FPSA 3FRHA 3MD1A 5TF0A 1C7ZA 2O7QA 2W6ID 3CMCO 3Q3CA 4KJIA 2OENG 3WQRA 4OQFA 3TOSA 3D8UA 2AEMA 2R2RA 2WIFA 2E4YA 4AMYA 4ECTA 2HK7A 1DX6A 2HRQA 1VCIA 3Q3IA 4FDVA 4UNQA 3OQIB 2B99A 4G5FA 1IFXA 4MQ5A 4G1MB 4HT7A 2VSNA 5A5FA 3RNLA 2XMZA 5G0VA 4C11A 2A2DA 1FQWA 1OH6A 1ENZA 3E9CA 3UK1A 4V0RA 2WM2A 4F38A 1NTOA 1Y8AA 5BNWA 3NBXX 3HKEB 4HFNA 3REGA 4MVJI 2O06A 4CEHA 4USKA 4V0LA 2ZTSA 3R5BA 1GAJA 3LAKA 5K8IA 4NX2A 1NU6A 1B8VA 1LLFA 3ZXUB 1HHTP 4JAVC 4POOA 4WZBA 1RJGA 3IHKA 1LLDA 3O82A 2P2NA 3DL7A 3FZYA 1QM5A 1WR8A 1JJ2R 5KU7A 1TMJA 5CYQA 2M3DA 2AV6A 1T6ZA 5AJYA 4DSOA 2HZBA 3JYQA 2D8MA 2Q6CA 2YY5A 3FAKA 4NJOA 2YJ5A 3DTYA 4LREA 2WCXA 4HH0A 4G23A 3E9YA 5KDDA 1FJ2A 1CJUB 3WDMA 3G2LA 4YJGA 1O3YA 2J09A 2VQEC 2WJWA 5CDGA 4R81A 5JNTA 3KG2A 1S1VA 5CRIA 2JGNA 3OT1B 2DUMA 1WBBA 3GI1A 1SQFA 4ML3A 1HT2E 4B9VA 1CJCA 2JATA 2J30A 2JH9A 3EPIA 4Y9DA 5SZKB 4ALNA 2YNGB 3I9JA 3RVDA 3O3CA 2AHOB 3CJRA 1VPLA 3L4KA 3I92A 1E4VA 2PH1A 4R9NA 2AGVA 2P7IA 2E5LC 4UOHA 5F5NA 3CVUA 2B20A 4MP8A 2W01A 5B4VA 5B4UA 2JLRA 3CSSA 4AXXA 3DLKB 3LOPA 4WTOA 3NNCA 1RTZA 2PVCA 4U8GA 2VZEA 4R7GA 1OJ4A 4BQQA 3UJNA 1K86A 3O9ZA 4F6RB 4RVDA 4ZHQB 2PPLA 3QEAZ 1OV6A 5D4LA 3MA0A 5I3PA 2F67A 4KI0A 1VK3A 3L7BA 1KARA 4AS3A 1U7ZA 2QM8A 4ZN6A 2PC6A 3SYZA 2PLNA 3AD8C 1O6FA 2F62A 5B1HA 2IIBA 1PR6A 1T9UA 4P5PA 2ASJA 4BUCA 4KQEA 3BO2A 4W8HA 1RT4B 5TSDA 1UWKA 1RHJA 1VJCA 2LKDA 3HFRA 5TS2A 1J07A 3FCXA 1B7GO 4DJDC 3B1JA 1Y89A 4F1KA 3TZLA 3WK6A 3H2LA 2XLJA 5JVDF 4HQLA 1KS2A 3SU8A 1YL5A 3SY8A 4RVGA 4TROA 2UXDB 1RDRA 2ZH7A 3ISNC 3T95A 4II2A 1J2TA 1NBHA 1QH8A 3FCVA 1DC3A 1FBTA 1V4BA 2MSWA 2PCLA 5TC4A 1KFBB 1C30A 1P2SA 2DRAA 2Y1WA 2GX6A 2Y3YA 3SNHA 5EEHA 3NETA 1SH0A 4CLDA 3QUBA 1APSA 1VRTB 5EIEA 1PG2A 4WS9A 4D74A 1UCNA 5CLLA 1QAOA 2FB0A 1PQUA 4BXOA 2ZYWX 1OQ3A 3K0BA 4H7PA 4EK9A 2J31A 2JF0A 4M87A 4WZMA 1CRLA 4WN9B 5FHRA 5CFZA 2KFZA 1PQ4A 4NBLA 3DG9A 3H86A 4Y9SA 2R3VA 4LNAA 3FETA 3W8EA 3SIWA 3ISND 2XVAA 4EYHB 1RKQA 2Z08A 4BFZA 2CLOB 3HJBA 5C8ZA 1I3LA 4HDNB 1WHSA 1O96A 4C98A 2WE7A 4RYLA 2NG1A 5J59A 5EERA 1FSFA 2IJGX 3GWZA 2W11A 1J06A 4MCJA 1E2HA 2HFVA 5DHAA 3UATA 3Q6IA 3CO0S 3AD9C 5F0WA 2W5UA 1Q16B 1MVOA 4Z9XA 4X4OA 2DNKA 4BP1A 4LPSA 2DWUA 2IHBA 1V9OA 3EZLA 5A62A 4DR2C 2VKQA 1YKSA 2X7XA 1C9DB 4CV1A 3GLFA 1FFSB 1HPZA 2NU7B 3B89A 3IAHA 4WK1A 5AW8A 3MJSA 1M6XC 5JMPA 5FBHA 3BZUA 3H90A 1Z34A 3BPDA 1VLVA 3T6KA 4FGWA 2EK1A 5KQSA 3SFUA 1VLMA 4NMWA 1W5FA 4LY6A 1LJ8A 2Z6VA 4ZHSA 1VEHA 3I1JA 1PTJC 1Z83A 1RAEA 3IDZA 3H42B 1XMXA 1ANKA 4K6MA 4KUEA 3I2HA 3HT3A 3CR3C 3QSYB 3BILA 4YYEA 2H59A 3KPVA 3RAEC 1D0EA 1R0KA 4A23A 1SB8A 1X8LA 4JNKA 1MAWA 2CXNA 4IFYA 2E8CA 1GMUA 1XKLA 1AS0A 4X9XA 3QG1A 5JBNA 4BWFB 1TLFA 2R7SA 3U44A 2AV5A 1SWVA 3K94A 5CIWA 2BOAA 2H4YB 1UAWA 1QVAA 1RYFA 4CLPA 3ZWVA 4DQUA 1WORA 3KZMA 4BNXA 2FPGB 3QYAA 4KSYA 3VAMA 1MXFA 4XWTA 5EXTA 4GWLA 2W90A 2VK8A 4YAIA 1V8FA 2RONA 5AKZA 2NXCA 1U47A 1P80A 1ISGA 1SXJB 3AEUA 1FRJA 1TW3A 1Z5NA 2QPLA 1KPHA 3R23A 3GT3A 1VMDA 1MDFA 1U2SA 3X43A 4DR7J 1OBOA 4GQIA 1AB8A 4J43A 2ROGA 2YZMA 5EJ7A 3ONNA 4PAQA 3AF6A 3AX6A 1W2WB 1DKMA 2QW8A 2VQFF 3UJ9A 1ZAYA 1F9FA 5EKUA 3QVUA 3ZIAD 1HG0A 4X0EA 4F6LA 4OJ3A 2ZOMA 1KORA 1ZRMA 3S5UA 3RQSA 5LLSA 3PCOB 4OX8A 1FFBA 3KHGA 2CFIA 2FCAA 3DNFA 5BV8A 2C1XA 4ZVFA 4M7RA 4WXRA 3G82B 1NZAA 2W2NP 3VO1A 5EQDA 1RK8A 2ET6A 3U13A 2Y0SD 1PL6A 1JLAA 5F51A 1QRDA 2HJGA 2G0NA 3OCCA 1PO6A 1Z2AA 2OUIA 3NS7A 1QTNB 3C6UB 1Y7LA 3M30A 2A9VA 4PYIA 2OELA 4IGFA 4JI2J 4AECA 3GYBA 5LB2A 3R3XA 5DX8A 4F96A 4PSDA 5BUZA 4CLFA 1RCUA 3B52X 3WGGA 1IBLB 3U7GA 3FYSA 1IBKB 4BP9A 1X4EA 5IVIA 1JWAB 3OM1A 4O2RA 1JYSA 2NZCA 1XQVA 1L4LA 1MWQA 3ED5A 3RYCB 4B9UA 4H4MB 2KDNA 1U1NA 4I19A 1JJ7A 4EABA 1D6MA 1RXVA 2YIDA 4USTA 3EF0A 3LTNC 2XMMA 3GB9A 2ZIAA 3HB0A 2RF2B 1KH3A 4I7EA 4MW1A 3C3YA 5TR9A 2ONCA 2HFZA 3PG9A 4S12A 5D5PA 4LJ6A 1W87A 2VF5X 2GBCA 2A35A 4I3GA 5K3OA 3SXPA 1U98A 4QUAA 3EAQA 3BG5A 4YQFA 4RPLA 2Q79A 4WCDA 1U7WA 4JBHA 5L1JA 4X7MA 1PR4A 5TF4A 3WJ2A 4DCNA 1NDQA 3UO8B 5IZ4A 1ADJA 2Z4RA 3DOKA 1F8GA 1DTQB 2RJ3A 1FNDA 1UMCA 4DOZA 3TIIA 3DYVA 1ILWA 3EF1A 3LQVA 1GG5A 4R1UA 1H4QA 4G5OA 2NVUA 1TLLA 4NBRA 5KTKA 2OSVA 2CWKA 2WIJA 4NXMF 4TYNA 1M1NA 4IYRA 3T5AA 1DRZA 3FHJA 2EW9A 4NAVA 1YCHA 1S79A 4OV6A 1FRMA 4N7TA 3K17A 2JFPA 4P58A 2GN8A 4K2HA 4PQAA 4JI7J 3SZOA 1ZRSA 1TKZB 2G4BA 1G0NA 2OPLB 4HMOA 4DF3A 2JGFA 3SYKA 1GKUB 4UXHA 2ZB7A 4KMMA 1A5ZA 4PRYA 2OV8A 3AM1A 1WC0A 3CJ2A 3OSPA 2EERA 4PC3A 3BPSA 3I9LA 3MIZA 1SCJB 2A78A 2FLVA 2ZM6C 4XFJA 4YRZA 4ZCKA