3AY0A

Crystal structure of methanocaldococcus jannaschii trm5 in complex with adenosine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
335
structure length
320
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0883
publication title Differentiating analogous tRNA methyltransferases by fragments of the methyl donor.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 89
structure length 320
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ay0A01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 3ay0A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ay0A03
3UFBA 2NNWB 1QAQA 4DMGA 2ONZA 2PX4A 5CM2Z 4M37A 5EGSA 4YUWA 4RTJA 5FULA 2IH2A 5T6BA 1IY9A 3Q87B 3G2QA 4V0RA 5CUQA 3HA7A 1ZHFA 3FPGA 5DTMA 3RODA 2PT9A 3M70A 1FPQA 3T0IA 1DCTA 2FYTA 1ZQ9A 3M6UA 1EIZA 2QM3A 4LWPA 4CKEA 3EVGA 4C05A 1FJXA 5EEGA 4AZVA 4EK9A 2P3OA 3NTVA 5DLYA 3AXTA 4DKJA 2OYRA 2NXJA 3EPPA 3O4FA 3ER8A 5F2NA 3PTAA 2EJUA 5EKUA 1V39A 3IHTA 4BLUA 4KVZA 3BGIA 5K09A 2PLWA 2YR0A 1G8SA 2BM8A 1EG2A 1XTPA 1SG9A 1X1AA 2AOXA 3DH0A 4RV9A 2G72A 4RYLA 1G8AA 3G8AA 4X1OA 3M4XA 5E8RA 5C0OE 4DZRA 4YUZA 2C7OA 3KR1A 1NW7A 4RVFA 2HNKA 1FP2A 2YTZA 4OBWA 1P1CA 5KYGA 5F2OA 5MHTA 2DULA 2OBFA 3CGGA 3EVFA 1XDZA 3EMDA 2OB2A 3LKDA 4RTPA 2FK7A 5LR6A 3TPZA 1WXXA 3D2LA 1L9KA 2GPYA 2C7PA 1I9GA 1YZ3A 8MHTA 3LGAA 5FWAA 1JQ3A 2AVNA 3AWIA 2K4MA 4E33A 4E2ZA 4KIGA 1H1DA 3C6MA 3DUWA 3G2MA 1G38A 9MHTA 3GIWA 2FCAA 2PKWA 1KYZA 5K0NA 3A7EA 3BGDA 4C07A 4YV0A 5DX8A 3NVMB 4CTJA 3KPVA 4LWOA 2VZ9A 1M6YA 2ZBPA 2ZIGA 3CC8A 3SSOA 3FPHA 1JG3A 4HRAA 1XCLA 3CJQA 1ORHA 5FCDA 5FWDA 4ER6A 5LQUA 5LQJA 2JJQA 3LDGA 4PONA 3HTXA 2PX5A 3PX2A 1XDSA 2P3LA 1NE2A 2AR0A 3MB5A 3FTDA 1X19A 3EMBA 3R24A 4HC4A 5GIOE 1R8XA 2HV9A 3JWIA 4PYIA 3SXJA 2ZVJA 5DRYA 2GA9A 4HH4A 4EQZA 4YUXA 4PGGA 2O05A 3FUXA 2NXCA 2ZIFA 4RTSA 3KR0A 1WXWA 1RJFA 5EZQA 4WVLA 3EVZA 4RTNA 1XXLA 5ICFA 3V97A 2I6GA 3R3HA 3DLIA 3WSTA 2EG5A 3G88A 2CMGA 4PIMA 3P2EA 4DM3A 3A27A 2B25A 2BZGA 3DXXA 3M33A 4WXHA 5BP7A 3GXOA 4QDKA 4DA4A 2P35A 5DTRA 3T7TA 3BZBA 3IEIA 4RX1A 3TMAA 3OU7A 3FYCA 2OY0A 1KIAA 5E8JA 2F8LA 3OZRA 2PWYA 2C7RA 4FR0A 4GEKA 1UWVA 2AS0A 2ZIEA 3MHTA 3HCEA 4UOEA 2G70A 5C1IA 5EMLA 4R8SA 1SKMA 2GLUA 5DXJA 4MHTA 1SUSA 3C0KA 2PBFA 2ZWVA 5E1OA 4QQNA 2HTEA 5E9WA 4DCGA 4F85A 4YV1A 4F84A 2ZTHA 3HVIA 4PYLA 3THRA 3BT7A 3TKAA 3PB3A 1L3IA 3FUUA 3KQVA 4RVGA 3BGVA 2O57A 3NW9A 1DUSA 5FHRA 4BLVA 4QVKA 4RVHA 5E9JA 1NT2A 5KVAA 2UZ4A 3LSTA 1JTFA 3KR9A 3HNRA 1N7JA 2PGXA 3C3YA 4FT4A 2V74B 1O9HA 2AOVA 3UWPA 3P71T 3BWBA 3R6TA 4GC5A 5DM2A 5E1BA 4DCMA 2AOTA 3M6WA 2OPBA 1XDUA 1F38A 3NWBA 5H02A 2EX4A 3P97A 5FQOA 2JHCA 5BW5A 2LD4A 4JXJA 3OCJA 4HSGA 5DTQA 3UJDA 2ZULA 4R6XA 5EOVA 3A4TA 5EIFA 2G71A 2XVMA 3OZSA 1XVAA 1NW3A 3ANXA 3I64A 5P8WA 2PVCA 3NDIA 1JG4A 2QRVB 1KPHA 3HVKA 3LECA 5K0JA 3EEOA 5GP1A 1YFLA 2AZTA 5T64A 2YXEA 2P1DA 2QYOA 4PNEA 5GM1A 4R8RA 5DSTA 4IWNA 4YUYA 4QPNA 5ICGA 1NV9A 1JG1A 1VE3A 2PY6A 2ZW9A 3HVHA 3P2KA 3TKYA 3QV2A 3LKZA 2VS1A 3VSEA 4CKBA 3CJTA 4QPPA 3FRIA 1RI5A 10MHA 3B3FA 4QVGA 3ELUA 2BR5A 1X1CA 3E8SA 3UA3A 2IIPA 1YUBA 1HNNA 3U81A 1G60A 3DXZA 5GINE 1RJDA 1VLMA 1MJFA 4HG2A 1UIRA 1PJZA 3BKXA 3FTCA 3LDUA 1R00A 5K8VA 5HIMA 5DX1A 3KQMA 5BW4A 5CIYA 4OX9Y 3FTEA 3BWCA 2O06A 5ICCA 3VYWA 2QRVA 3SX0A 2VDUE 5CVJA 3IYLW 3K0BA 2Y1XA 4L7VA 4ER7A 3SMQA 5CCXA 1SVUA 2P3QA 2UYOA 3EGEA 2ZZKA 2ERCA 2IH4A 2GB4A 3GNLA 1NBIA 2QE6A 1EJ0A 1FP1D 4MQ4A 5HIKA 5K05A 2B78A 5CD1A 3JWHA 3MTEA 5FHQA 3UJ6A 1R8YA 4E70A 1M0EA 3P8ZA 4FGZA 1VPTA 3GRYA 2AN5A 3BWMA 1YF3A 3A25A 4RTMA 4R05A 3DMGA 5JUWA 3KKZA 1ZGJA 1RI2A 5ERGB 4V0QA 5LQCA 1KP9A 4Z2YA 1L3BA 2P7IA 2BH2A 4PGHA 3LHDA 1G6Q1 3JWGA 5FA5A 3ERCA 4OA5A 3NDJA 5CCBA 3UJAA 3GGDA 1U2ZA 2WK1A 4QDJA 5CVDA 3C6KA 4U7PB 4IKPA 1NKVA 4KIFA 3MCTA 5K0EA 1KPGA 3DR5A 4LG1A 1NW8A 3GRRA 4YV2A 4P7GA 2P40A 4NECA 3DXYA 5IKMA 4OBXA 4C03A 3KQPA 1F3LA 1JG2A 3I5UA 3A26A 3T7SA 2WA1A 3DMFA 2CMHA 4YMHA 1TW3A 2PX2A 4MIKA 5EQJB 5DM0A 3THSA 4KW7A 1DL5A 2PXAA 3KQSA 3BUSA 4GOMD 2OXTA 2E5WA 2OO3A 3E7PA 4ER0A 3FZGA 2B9EA 2ESRA 3CCFA 1L3CA 3KQQA 3EVEA 1R6AA 2FK8A 2ZBRA 3TFWA 4GQBA 3UBTA 2HWKA 4Y30A 1QZZA 4BP1A 5LQNA 4O29A 2VDWA 2B2CA 3OU2A 4LECA 4C06A 3MQ2A 2ZZNA 1RI1A 2ORED 3BKWA 3PX3A 2IGTA 4P7KA 3A7DA 3SSMA 5CVEA 1RI4A 3VC2A 4GOND 4A6DA 4QTUB 3G5LA 4EKIA 2N47A 5FUBA 2ZZMA 3PS9A 2YVLA 3KPJA 3OU6A 4FP9A 4XUDA 5LSAA 1QYRA 1O9GA 1HMYA 3LCUA 3LCVB 3ER9A 2IBSA 4P7FA 4GC9A 3KPWA 3OE4A 2GAFA 2Q41A 5HZMA 4PYQA 4ZTBA 3FRHA 5C9ZA 2GH1A 4QQKA 1B42A 3LBYA 4DQ0A 3CKKA 4E30A 4X41A 1KYWA 1YZHA 5EKXA 1EQAA 1X1BA 2IDJA 2JH9A 2P41A 4RTRA 2UYCA 5CVVA 4FSDA 3FUTA 2EJTA 3DULA 3G5TA 3G89A 3GU3A 3GWZA 1BOOA 3LL7A 2CWWA 3ID6C 2CKDA 4IV8A 2IDKA 2PSSA 1JTEA 1JQDA 3GRVA 1VL5A 4C4AA 3G7UA 1ORIA 3BXOA 5K0FA 1D2CA 3FPFA 2VDVE 5EZSA 4E32A 3HCDA 5HOQA 1MHTA 2AOWA 4RWZA 1KXZA 2AN4A 2PXXA 3KPUA 2UYQA 3HCAA 3PT9A 5EPEA 1X1DA 4RTOA 3HA3A 3DTNA 3EVBA 3B7PA 4EVIA 5ICEA 2O0LA 5HIJA 3I9FA 2QY6A 5BXYA 4AUKA 3P2IA 3VC1A 4DF3A 3MAGA 3ELDA 3LPMA 3CVOA 5EEHA 3SGLA 4POOA 5E1DA 2AOUB 3UJBA 2XYVA 2ADMA 2GS9A 2VP3A 3LDFA 3X0DA 4P7JA 4RSRA 1AQIA 2FRXA 1NBHA 2YXDA 2I9KA 2Z6AA 1IM8A 3G8BA 3GCZA 2OKCA 3P9NA 4HGYA 1I4WA 5E9QA 5EIWA 3BWYA 5EMKA 5EG5A 1OR8A 1R74A 3FUVA 1Y8CA 4FSXA 2ZCJA 2YQZA 1WS6A 3E23A 3HVJA 2PT6A 1NV8A 2A14A 2ZWAA 4CKCA 5DM4A 3P9CA 2YX1A 2R3SA 1AV6A 2Y1WA 3OFKA 3P9KA 3HM2A 3OFJA 4KDRA 1QAMA 3TM4A 4ATNA 4CTKA 2PX8A 2C7QA 3F4KA 2I7CA 2IP2A 3JWJA 3TM5A 3TOSA 4PINA 5EVJA 3H2BA 1JSZA 2AVDA 3HCBA 2OB1A 5DWQA 3KQWA 4AZSA 4E2XA 2ZSUA 3FPEA 5U4XA 2R6ZA 3B3JA 3M6XA 3SM3A 5EHIA 5HIIA 1JQEA 1RJEA 3DP7A 3PFGA 3TLJA 4E2YA 2AOUA 1EJ6A 2CL5A 2JHAA 4GOLD 1INLA 5E1MA 3TQSA 5DSXA 4AZTA 3LBFA 4AX8A 2NXNA 4AZWA 4ER5A 3T7RA 4MWZA 1KPIA 3NJRA 1VQ1A 3B5IA 1NW6A 4U7TB 2XYQA 3KQOA 2YXLA 3KQYA 3M6VA 5FTWA 4OQEA 1ZGAA 2PXCA 4H0NA 1R18A 2UYHA 2G1PA 2B3TA 5EC8A 4RTQA 5M5BA 1Q0TA 3AY0A 3QOXA 2PV0A 2ONYA 4K6MA 3UJ9A 3O31A 4PYNA 4RTKA 1NW5A 3B89A 1SQGA 3C3PA 3FTFA 3B3GA 2EFJA 4PIPA 3GRZA 2WA2A 2PJDA 2FPOA 3S68A 2NP6A 3RW9A 5K0BA 3V8VA 1Q0SA 1AQJA 2OZVA 2P8JA 5F2KA 5KQRA 1VP3A 7MHTA 1T43A 1VIDA 4PYMA 4E2WA 5DM1A 5IH3A 5K0GA 5JR3A 2H1RA 2PWPA 5K01A 4GBED 3HA5A 2XYRA 3CJRA 1KR5A 3UJ7A 3KPYA 1O54A 4A6EA 5EHGA 2ZFUA 5K0CA 2XVAA 1M6EX 2ZLBA 4Y2HA 1L1EA 4BP3A 3CBGA 4EKGA 2IBTA 2IH5A 3NMUF 1JR4A 2BR4A 1IXKA 1EAMA 5KS2A 1YFJA 1UFKA 1WY7A 1QANA 3ME5A 3OPNA 3AXSA 1ZKDA 3PVCA 4OQDA 5D1HA 3HEMA 3RIEA 4B17A 3GJYA 1QAOA 1P1BA 2NYUA 1JSXA 3EVAA 4C04A 1D2HA 4XUCA 1AF7A 2P7HA 4PYJA 1WZNA 3HCFA 1VP9A 1P39A 3R0QA 2BR3A 4QTTB 1BKYA 3REOA 4IV0A 4PYKA 5HFJA 2V7EA 1VBFA 1RJGA 1XJ5A 1RI3A 3ORHA 4ER3A 3EGVA 1XCJA 2AN3A 1KHHA 2H00A 3E05A 1YB2A 2G8NA 2NXEA 4HTFB 5K03A 5DX0A 5FA8A 4BLWA 3NWEA 4FS8A 3PLAE 1Z3CA 1SUIA 4HGZA 4CWAA 3KQTA 3OZTA 3MTIA 4RVDA 5B1SA 3UA4A 3I53A 2Z6QA 3KR2A 3TR6A 5E2AA 1TPYA 4PCLA 3SVZA 5HEKA 4PCAA 2JHPA 5GOZA 1P91A 3DLCA 4M7RA 1FBNA 4P58A 4X63A 3ELYA 2H11A 3PFHA 4KDCA 4E31A 4F86A 3O7WA 3KHKA 4EMSA 1D2GA 2FHPA 5GM2A 2NP7A 5LQRA 3LCCA 4XUEA 3EGIA 3MCZA 2HMYB 1TW2A 1ZG3A 4G56A 3SSNA 3MERA 3I58A 4YMGA 5DT2A 2JH8A 2HR1A 3Q7EA 2AOTB 3GO4A 5CVUA 5EMJA 5EMMA 4PWYA 5DRTA 4C08A 4GF5A 5KQSA 5GIPE 3FUWA 3GRUA 1BHJA 3GDHA 3QOWA 2O07A 2XBMA 4ISCA 4HTFA 4M36A 4RTLA 3IV6A 5FADA 4GOOD 3LX6A 3HCCA 4X61A 1I1NA 2IFTA 3DOUA 4CXMA 5K0LA 2DPMA 4GUAA 5GWXA 1N7IA 1WG8A 5DPMA 3ELWA 5G02A 3EEYA 3OE5A 2BM9A 3P9IA 4PYOA 4XCXA 3K6RA 3AJDA 5E2BA 2IPXA 4FZVA 1G55A 1BC5A 4KWCA 2JG3A 1SQFA 2I62A 3R9XB 1N2XA 3KU1A 5DXAA 5LQKA 4OA8A 2Z6UA 2KW5A 5HILA 3DMHA 3UJCA 3L8DA 3G2OA 4MTLA 2YUIA 3FPJA 4R6WA 5T67A 5LQAA 4M38A 4X60A 1PRYA 3G2PA 4YUVA 3TRKA 3FYDA 4KRGA 3UZUA 3NVKI 3HP7A 4BY9E 3EVDA 4FT2A 3MGGA 5D1NA 3UJ8A 5FQNA 2ZBQA 3EVCA 3SR4A
chains in the Genus database with same CATH superfamily
4N7TA 4L72B 2R7KA 3EBOA 3P4UA 3QJJA 2TECE 1KMHA 3BYZA 1D09A 4D0LB 2ODAA 2VASA 4QWCA 3RRBA 4MAAA 3F74A 2QWXA 3AA8A 2IEIA 2CL6X 1C2YA 2CLEB 3AP1A 1D2MA 2QTFA 3EPPA 2DCUA 4H77A 5AKYA 4YWHA 5GADl 2JNWA 4QGBA 2FR0A 4E13A 3CTMA 2IM0A 2P91A 3WADA 3N2YA 1W8IA 3GJ0A 4D3GA 4TU7A 3N39C 2CY0A 1J5EC 3MAQA 3RHTA 1NVKA 3UV6A 1XDZA 4I4TA 4M9SA 1PFGA 2G09A 3KOUA 4FFLA 1R0ZA 1V1JA 2Q1UA 3JQAB 3V9AA 1XIQA 3P5SA 1P31A 2VBIA 4YV0A 4X1KA 2CDBA 1XQWA 3C1AA 4ENVA 1XVIA 4UEJA 4LWOA 4CMHA 1LBEA 1VI5A 2HA7A 3GMTA 1EBBA 2DFVA 3GZNB 3MGKA 3TQOA 1KERA 3UYKA 3L1HA 4F04A 4WBSA 3RASA 1NBWB 3I39X 3NMAA 3MBIA 1L4UA 1OYWA 2WHPB 4AD6A 5GJWC 2BFCB 2CLDX 4JOCA 3ZDXB 4PQGA 1BDIA 3AHDA 3C3LA 1VS3A 4MQEA 4IO1A 2PBFA 1GCGA 4P5DA 2GVDA 4DAEA 3RGWS 4LDJA 4C3OB 5C2JB 4CT5A 2I6XA 3OTBA 2VHVA 4ZDNA 4LC1A 3PNYA 3KU4A 1BLUA 4N7RA 1HWUA 4AN4A 1V3UA 2AOTA 2WAQD 4LBYA 3AVXA 3I5BA 4IYJA 1X8XA 5E6SA 4O3OA 1QM9A 1JHXA 1R6UA 4MK4A 4HI2A 3ECCA 4DHVA 1XA0A 1NOIA 4IOLA 3AX6A 3U81A 1A9PA 4NLWA 5PGMA 2M52A 1R00A 2BP7B 3T99A 4CV1A 2JIZA 5JEDA 3QT5A 4PPZA 2IE8A 3O21A 4Q9AA 1E3LA 2XZDA 3ZDZB 3AUJB 4B3MB 2HGSA 4N3CA 4IFIA 3D2WA 3FTNA 4ZPCA 4QUJA 4YB5A 4HSEA 3FPKA 1N6KA 1XQXA 1WA5A 3MMAA 2HSEA 1ZOIA 4M5GA 4NXNB 4WPAA 3MFIA 4OXQA 4EZIA 3LM8A 3QTLA 4ZKAA 4QYTA 3W6ZA 3IIKA 2C1XA 4IDFA 3PHHA 3EYZA 4MS3B 2POCA 3OOJA 3IVMA 4OKNA 5BPHA 1C9NA 1VC0A 1FDRA 3OQOA 2CMDA 2HFSA 4A2QA 3QHAA 3LC1O 2I8LA 3RUEA 4DC1A 2ZVQX 2XY4A 2I2AA 2DLCX 3UT5B 1XMOJ 4WIQA 2NSLA 2JLXA 3J7AC 3IR5B 4GMDA 3T5KA 3MOSA 1P1IA 4IIYA 3RROA 4RTOA 2ZRJA 3AXMA 3KCQA 1M6XA 1PGPA 2YHBA 2DWOA 1FUIA 1Q95G 4O3PA 1VPEA 3EWAA 1J2RA 3H5WA 4CM8A 2DNKA 4R8UB 1GMWD 2IRWA 1PD1A 2ZUDA 1P1TA 3FVYA 3AUYA 4OM8A 1H2EA 5M2RA 5DWQA 1SD2A 2M32A 2FP4B 2R66A 1HORA 2J5RA 3ZD7A 2PZEA 3DXSX 1EJBA 5G4LA 1E6UA 2O8VA 1M6NA 1E6VB 4EQ6B 3SZ2A 3V1TC 5LCXA 4CP5A 2DHGA 4B9AA 5AM0A 4DLVA 2OZVA 1VM6A 1YULA 2JIQA 4C0BA 3VSBA 1YVEI 4NS4A 1Q0PA 3HHLA 3Q0AA 1P5RA 3GWGA 4KRYA 1KK2A 2LU2A 3QM1A 4TZTA 3QE3A 2NG1A 4AWBA 3FB4A 5F78A 3S2YA 3R6WA 1PL6A 4D4IA 2QD4A 1YRAA 3JALA 3SD7A 4YP9A 4BQPA 4B4KA 2YY5A 3WNVA 4NENA 3H40A 4HGZA 4QXOA 1T6ZA 1QG6A 3BS4A 3K9NA 4W1SA 1JEEA 1ENPA 4YDQA 2J6HA 2A33A 3OJOA 2CRLA 1X31C 5T8SA 4LV6A 2BY4A 1WB4A 4N3GA 4UHKA 2XX3A 1OFIA 3K2YA 4P08A 2NSHA 3DAGA 4YDDB 1U4OA 3G2XA 2HTFA 3WVNA 4ANCA 1C1XA 2XB2A 4HLBA 6AT1B 2V69A 5FPTA 3T9EA 3CO0S 1JIKA 1DLJA 4RW7A 3CEHA 4JH0A 2GFQA 4M9XA 1P81A 1YI2S 3Q6MA 5I3UB 4PO8A 3PD0A 4D74A 1MH9A 5JS7A 3C2QA 4ZLLA 5A5EA 4EK9A 3MCNA 3EERA 1FTQA 4LYYA 1XPRA 3VTKA 3QI2A 3FFTA 3MPWA 4L72A 1U1MA 2FE1A 3B8HA 3PZPA 4FDFA 1X1AA 2I5JB 2LV8A 2KG0A 4K3VA 2D41A 4HT7A 1QDLB 1XZPA 3CGGA 4AJOA 3PP8A 5AVTA 5A2QY 2QRZA 4L9RA 1H5QA 3WYNA 1X4DA 1GARA 4JJKA 3TLZA 3PXUA 3H5RA 3CX8A 4DIBA 3OIGA 2EPIA 4Z9FA 3BGSA 4RJIA 3R5SA 2FLKA 3RB0A 3RS5A 3JQAA 3QX3A 5C81A 2YKNB 1E8MA 3H0EA 3Q8PB 3O9ZA 3IB6A 1NQUA 2PO7A 2P9CA 3WL4A 1K1EA 5ADHA 2YHIB 2IL1A 5U9CA 4Y9UA 2QMOA 1Z15A 1G5TA 2H92A 3GZNA 3GX1A 4MHTA 4Y2PA 1N2EA 3BSFA 3OL9A 1Z28A 2WHPA 1II8A 2BFCA 3FTPA 5E7MA 1DDOA 1RTIA 4YA6A 4HQOA 2GEJA 3F46A 1WKBA 4Q16A 2CA9A 3ZDCA 1NURA 3DC7A 3RH0A 3TLMA 4UHEA 3H99A 1QCDA 1G5PA 3MUFA 3SDBA 2YKGA 3OETA 5D77A 1B73A 2IIPA 1M9NA 2AYYA 2HHUA 3HB7A 3J7Z5 4NYOA 4JX8A 1YQ9A 2MU1A 4XSHA 1I7LA 1IAQA 3JYPA 2OAQ1 1U45A 4F3QA 5IBCA 4J0DA 1IBMC 1WCV1 3CDUA 2Q79A 2R4QA 2BP7A 3R27A 3LO3A 2WWIA 3JQJA 2JA2A 4CF4A 3HSDA 1L1RA 4PS0A 2WYWA 3LX4A 3NGRA 3MTAA 2ECQA 2WVCA 1AK2A 3IAS6 3C16B 2HG4A 2ZZMA 2PYDA 3LUJA 1MGPA 1GL9B 3WLNA 2DETA 2VKTA 2QNIA 4NBSA 4V38A 3ONFA 2BMVA 2PUEA 2GM4A 5JSQA 3SEAA 1T05A 4DR3J 3C4VA 4A0QA 4MS3A 2ZM6J 1MEEA 4FLMA 2C54A 2UXBC 4YAGA 3IIEA 4DJEC 4BL5A 2UXCC 4N39A 4GDMA 2EWMA 3TW0A 1VDZA 1CC8A 3QXXA 4QYIB 4HGPA 1VRQC 2V7XA 3IR5A 4OU4A 3U9TA 2AD5A 4GGMX 4OX8A 4ISBA 1VFPA 2Q62A 2V6AA 3Q8RB 4DR7F 3SHTA 4YR7A 2H2AA 3FGVA 2H51B 2OB1A 2QGNA 1FIUA 5CAEA 4XJXA 3PGVA 1T0PA 3VGVA 4X6LA 3KVYA 4IR1A 4R8UA 5DSXA 1E2PA 4AZTA 1YBTA 2RGGA 2LEBA 1I3KA 2PIAA 2WZQA 1GZ6A 2Y9PB 1ESCA 3UG7A 4X84A 3QLTA 1OPXA 5KJFA 5D6GA 4LX0A 4N5MA 2L9DA 4F2PA 4H0NA 3M4JA 1Z83A 3DRPB 2GAOA 4ELVA 3A6HA 3RM3A 2FP4A 3VAAA 2G04A 4MH8A 4QG3A 3T1AA 2HS4A 2L82A 2XM3A 1A9QA 3CZPA 1PZHA 4PZPA 3QH4A 4EQ6A 3KSRA 3KXWA 1ORTA 3QSYA 1XCJA 4G24A 2DFNA 1PWYE 3WWDA 2P4QA 4DL4A 4RJJA 4YXWA 3T3IA 4AYWA 4J9OA 4YP1A 3LP1A 2FVYA 1HPZB 4UTOA 4GQIA 3L05A 2YJNA 2W98A 1YAJA 5JADA 5JV5A 1UJ4A 1N88A 4CV2A 1QAYA 4XCXA 3K6RA 2HK8A 2CVZA 3M5DA 3PW5A 1NKCA 1NLKL 2JCXA 5B30A 5JWOA 3OTOF 1BGWA 2JVRA 3CQ1A 4PXSA 5H80A 3FCSB 3Q5DA 4H7KA 1E1YA 1VHJA 3NPMA 2HZVA 1QV9A 4H4KA 1FE8A 1CNFA 1V6HA 6AT1A 1Z9BA 2XKJE 4PG4A 4QBFA 1KMMA 3PTAA 1M0TA 3E9QA 3OCVA 1Q53A 4PLZA 1ZIXA 3GFYA 1CQMA 1TCBA 3TDMA 3DAHA 5I3UA 3BX1A 3QFFA 3W4IA 2IP4A 3AL0C 1DQZA 4PQUB 2J6SA 5ALZA 1H3NA 2XKBA 5LUAA 3HWX1 5E6RA 1E2IA 4Q12A 3FWYA 2I5JA 2OPRB 4JI7F 2A18A 4PABA 1ZC4A 1HM5A 2YPZA 4LMRA 4CGYA 2JGIA 3KFWX 2ZCUA 2GYUA 3CPJB 1T9HA 3I9JA 4OX9B 2ROEA 5KWEA 3F98A 1DBWA 4R3NA 4AXIA 2ZQYA 1SKAA 1HNZJ 1OH8A 1RJFA 4WFYA 1A7AA 4RC9A 4UPEA 2I2YA 2ASBA 4ZYUA 1TF7A 1W29A 2RILA 3S1TA 3TIVA 2IYOA 2G70A 1JIJA 5KT4A 2ASJA 1YGPA 4F85A 2IS2A 1Z5OA 2YNIB 4F4WA 2GK7A 1YRBA 2E9RX 4X65B 2YHIA 5BVGB 3NGLA 4KYIB 4NH4A 3JD1A 3NGTA 4BMVA 1R0RE 1R64A 1Y3IA 3B53X 2BC9A 4FYXB 5COBA 4EUFA 3VNSA 4G2NA 3BGOS 3RSCA 1MOZA 3C6QA 5CX4A 1QFSA 1SB9A 3VSEA 2FTKE 1TMGE 1QGUA 3QKSA 4RPHA 4B2YA 2PQ0A 1V1MB 4FR2A 5EWEA 2H17A 1GKLA 2LCFA 4PQYA 2C59A 3FVTA 1U4NA 4QDTA 4Z0NA 5CVJA 3IUNA 2Y1XA 3EGXA 5THWA 2OAGA 1Q0ZA 5K3CA 5G1PA 2QIOA 2YX4A 5DO9A 3R3WA 1ABFA 1PEYA 2ZJAA 3ZK9A 3GJXC 2IVMA 2OBLA 3ERCA 3HE3A 1SJRA 4BQRA 2XGQA 1C0LA 3N0XA 4O4HF 3HWRA 3Q1LA 5IKMA 4LK3A 3T7SA 2FSVA 1QGOA 4O3FA 5EP4A 4KJZA 5FPYA 3T8YA 2QFIA 2PUCA 4LVNP 3C70A 2NU9A 1XJWB 3ITEA 5CH5A 3U9SA 4Y2KA 1N7GA 4UNNA 2Q0SA 5IOLA 1TF2A 4M95A 4JMLA 3SCJE 3X44A 3CD6S 1JG6A 1DGQA 4X1IB 3U9LA 1BX1A 4C0QC 3DG9A 3MLAA 3QFHA 2VA9A 4U95A 1X8JA 4YP6A 1BXNA 1R6VA 1U11A 4G0MA 2WTUA 3BR9A 4NCHA 4TNOA 4WNCA 2DITA 3W8NA 3QGIA 2PU5A 5KVQA 2VVTA 2NZUG 1RWBA 4IIDA 2B21A 1GVHA 2IYXA 1U4BA 2R3SA 3P9KA 1OWPA 3JRNA 1F2TB 2HBQB 4H16A 2AZ1A 2R8HA 1L4NA 2CL5A 3EVMA 4N8SA 4TYYA 1NDKA 3F5QA 4E6PA 4MP3A 5K99A 1O95C 5F21A 4I6WA 1NK7A 4Z8XA 3L0ZA 1EK0A 2YRXA 4IQMA 3DLGB 5EC8A 4DWIA 1JF8A 1QG0A 4UVHA 2H51A 2RGUA 5KDDA 2IGBA 3L7BA 3G2NA 2AIRB 3MR3A 4OFXA 1ZEMA 1TC1A 4B73A 1H4QA 1YR2A 2DLNA 5ELLA 1WY7A 3I34X 2AG6A 3DRPA 2NO7A 1RXCA 3LBIA 4PYJA 4WOCA 3HCFA 3SZGA 2ADBA 2DXFA 4X4UA 5IQ6A 5IVKA 2QMWA 1KL7A 3PLAE 1SUIA 3DN9A 2IW3A 1FZTA 2VBWA 3KR2A 4KPYA 1WCWA 2GSWA 4JLSA 1CUVA 4ZPWR 1XV5A 2YY3A 5SYMA 4YCCA 2VYVD 1E9SA 1ZNYA 2HJVA 3DV2A 1HE2A 3BE5A 4RABA 5TV2A 3ZYCA 4RKQA 1B6GA 4BMYA 1JFRA 1XMQB 1U6IA 4DCUA 2XCPA 4B9UA 3KLFB 1V11B 4MV4A 3WLPA 3FYDA 3VGUA 4DLAA 3ESBA 1UBUS 4B33A 1O94D 4JQCA 2YN0A 4C8KA 3TGWA 4WU3A 1PGNA 5DBEX 3EVGA 3N2ZB 1KQFA 4AZVA 5DK4A 1C4CA 3EXG2 3K7EA 1WUYA 2CQPA 1E64A 1IHPA 3GT4A 4CF5A 1GUAA 4J94A 3VSDA 4YMHA 1XR3A 5AWFC 4AG5A 4Y0FA 3Q9UA 4PZLA 2Y6VA 2BRKA 3H8VA 1Q16B 1PIWA 4DADA 3ZBPA 2HHSA 3CIOA 1SUDA 4R1UA 4IRDA 4OAPA 2XYHB 4RWEA 2R2TA 2D06A 1KJYA 3O91A 1WOMA 4ZVUB 1IQ0A 1K92A 4OB7A 3ZCQA 3LPYA 3TRHA 1Z38A 1DQRA 4GAEA 4HP8A 4ABYA 3IAAA 2W8BB 1SHKA 3DLLQ 1R8JA 5FI1B 2XD9A 4DVGA 4MPTA 4GLFA 3OIFA 3GEGA 4PIMA 5IMSA 4D8TA 1SH7A 3BTUA 4NWIA 4LSZB 5EMLA 4C6TB 3LG2A 1RTHB 4YB6A 3M9MB 4RZIA 2QN1A 1LDNA 4XDGA 1DTTB 5ABPA 2ZJ6A 4CTNA 4QVKA 3TGLA 1N34B 4BN4A 1PS9A 4FXOA 2Z1MA 5EWFA 4L4ZA 3P97A 4N47A 3AFIA 5LP6B 2C2MA 1QIDA 1AUXA 4JX9A 4KG7A 3RPEA 2YNIA 1ZM9A 1GX5A 1LK5A 2XA2A 2AEEA 5C1DA 2J5QA 3IR7B 5HVGA 3D54D 5AESA 4XIUA 2WSCC 3W79A 4NJOA 4G1CA 4KTVA 5FYQA 2G82A 2AYGA 3R5AA 1ZITA 5ICCA 2OTJS 1SJ9A 3URKA 1HIYA 1C9DB 2ACYA 2VHGA 4EYSA 1BWEA 4I6AA 3KQNA 1Y8ZA 3KJXA 4JV1A 3C39A 4N5DA 1T9KA 1ADBA 2F2TA 1E6YB 4RXUA 3QIAA 3RUCA 1JXMA 3W5DA 4ZHQF 4TLAA 1ZD1A 3E22B 2P2LA 3GPIA 4H9GA 2P1ZA 5HSPA 3EGNA 2WKWA 2E8FA 4M88A 1NW8A 2GCNA 1XWLA 3JXEA 3WLQA 4ZU6X 4NG5A 1M8KA 4BGUA 4XD2A 1WC0A 3CCWA 2B9YA 4LF6J 4LECA 5IF9A 5J2UB 1VJCA 5FUBA 3LCUA 3V7NA 4BVKA 2W7PA 3F6EX 2CB0A 3VGSA 2X0FA 1RLMA 3N0RA 2C4HA 3FZEA 4M55A 3HHNB 4FW8A 1SHJA 3B48A 2B61A 1LSUA 1HYSB 5C8YB 2PUWA 1NEEA 3P49B 5HROB 4PEVA 1UXGA 4RY8A 4IHAA 2CXSA 2B1JA 1GG2A 3C15B 4P32A 2IHVA 2ZAMA 4UNSA 5ETSA 1JR2A 3T3EA 1OBHA 1P1FA 4ATNA 1WW2A 1FDSA 4Y2XA 1OU4A 5EJ5A 3RADC 5IM0B 2IKSA 4FPRA 3RU2A 3HR8A 3R74A 3V46A 2XO6A 4NPHA 4AECA 3R3VA 1M1KT 2DO4A 2DH9A 3CLTD 4DQKA 5CRIA 2X4IA 1MTOA 5DCLA 3CEDA 5BNZA 3QBDA 4WFNQ 4Q5IA 1F2TA 2HBQA 4B0OA 3M7VA 3OIUA 4RELA 2IF0A 3ZX4A 3USZA 1E63A 3TP2A 5ILQA 5CX1B 1DBPA 1DXOA 3GK3A 2I1WA 4WZ6A 4CHTA 4DV3C 2CHFA 2OECA 3DLGA 4HGRA 2HMUA 1AF7A 3EH1A 2CPEA 1ECLA 3NVAA 4Q1EA 1QJHA 1Y9DA 3O4JA 4DRXB 3JTNA 4OZ5A 4BLWA 1DIAA 4OSPA 4NIMA 3F0NA 5KSZA 1DC7A 2QF7A 2I5PO 1D7AA 4OHZA 2QX8A 1FNDA 3LCCA 1LFPA 5KFWA 1VDMA 4I1SA 4JLMA 3AOAA 2C22A 3VR6A 3TW6A 4CLFA 1GXSB 3NGUA 1I1NA 1J20A 1FDIA 1U0BB 4PZ0A 3OTHA 4JI8F 3MUTP 4ASUA 1E1DA 5IXSA 4UF4A 5D1NA 1HT2E 3RAFC 4BWGA 5TT1A 1VZ2A 1A9TA 4RCYA 1KO1A 4FQ5A 1H6BA 2YNMC 2Q5EA 1RYFA 1V8BA 1N1DA 4DR2C 2GPNA 3OZWA 1GU0A 1Z2CA 1PNTA 1ZCAA 3KLFA 5H9FJ 1JIVA 3L9ZA 3IHTA 4IIJF 3LNTA 4XYEA 2O7RA 3WS7A 3MMZA 2AW0A 2MDTA 2ZI7A 3KR1A 1BHNA 3DRRA 1RCTE 3Q4GA 1U7LA 3UMBA 1VSUA 2H4HA 2Y0PA 3UW3A 1DJLA 3LKDA 3OZCA 3D2LA 2FMHA 5DZSA 2VZLA 1CCWA 1N6NA 3GJ3A 3DYVA 5HKOA 1H3FA 2KRRA 4X7MA 3HY3A 3X1WA 3U7HB 4I7EA 1P1RA 1T9ZA 2CAJA 3G02A 5WRFA 1TM7E 2HQRA 2FW1A 1Q16A 1FU8A 3RFUA 2WVGA 3I45A 4BTEA 1ZA1B 1YZ7A 1R37A 3FF1A 4QUEA 2QP4A 1RHUA 1LQUA 3B1FA 3GMSA 4JI0B 3NWGA 2CMGA 5LXTA 3TMYA 3QLUC 3SBXA 4L51A 3IEVA 4XVCA 1IKXB 1LPPA 2G4BA 2FFRA 1V95A 4GH5A 3E51A 3S82A 1JQ5A 4K9KA 1H2UX 2X1MA 2W8BA 4CNBA 4KXFB 1R5OA 1UBGA 4EI2A 3HVIA 3MJTA 3IG1A 3NWRA 3JAMD 4Q3NA 3DLKB 3VVBA 3H1EA 2XV1A 3UAVA 3QK7A 4I99A 4P3YA 4E5KA 3UZ0A 1WD6A 3N3BC 3DBRB 3ND6A 4C6TA 3ZXIA 1RTHA 5P8WA 3LECA 1DTTA 1E2EA 5DGCA 1NUAA 4QWDA 5K8OA 4PO9A 4V3BA 1Y3DE 2ZDOA 2F8SA 5DGIA 3ES9A 3UCEA 3LYHA 2Y0SD 4EO6A 2BFWA 5F23A 1IMOA 1W5EA 3IP0A 2GMJA 2DCLA 4A2CA 3QUTA 1PIEA 1SBHA 1GFSA 5LP6A 1X0VA 4Q66C 3KQMA 1JXAA 2Z2JA 4X7PA 2X4DA 3NJ8A 3OQVA 4MYHA 1Y81A 4QBTA 3ZHZA 1FLOA 1MJHA 5GONF 5K05A 2FZVA 1VLZA 1DBRA 3ZZMA 2CQIA 2DR2A 3ETCA 4DS4A 2H7YA 1XNRB 5IV4A 3IR7A 3QYPA 1JJ4A 2JVIA 4DV5J 1ISFA 3D3NA 1KJQA 3JD3A 1J8DA 1TXGA 4RKEA 2OPPB 5IZHA 2L0XA 1G2PA 4WJBA 2YOFA 4LFAC 3GFSA 2ATCB 1CJKA 4FBLA 2G9UA 1G64A 1AGRA 2YXBA 3N76A 5JG7A 3NEJA 3O38A 1E6YA 2HWKA 5ETLA 5DP2A 3CW2C 3EIEA 3E5HA 4P98A 4U67Q 4FP9A 2CNNB 2QYGA 1OAKA 4EA8A 3TEMA 4FD2A 4X41A 5J5CA 1X2BA 4Z1MD 3VA7A 5T4EA 5K3DA 1V41E 5BUCA 2M1XA 5FI5A 2PA8D 3TMKA 2VDVE 3E8XA 1TL4A 5J2UA 5A05A 1TK9A 2AN4A 1MO3A 1PZXA 4XPCA 3GJSB 1ACJA 1QIJA 3J7YI 2H1WA 3VSAA 2DXDA 3KLNA 2I9KA 1FDDA 5JO0A 1GFZA 3TRIA 3C7DB 2OCAA 1GTVA 5CB4B 1ZU5A 3IQIX 3IXMA 3TJZA 1HYSA 5C8YA 3GT3A 1QFYA 2VBYA 2MMCA 5ERXA 4UFNA 5KZMB 1ICEB 2W22A 2R6ZA 2W9CB 4BVGA 3TH5A 1CEEA 1JQEA 1FE4A 1AK1A 2BI7A 2X6QA 3FGNA 5F33A 3IX7A 5SICE 1YTYA 4LVOP 1IZ8A 1MVNA 1XTZA 2IA5A 1JLMA 1VE5A 4OJQA 1ND6A 2BEJA 1P74A 5IM0A 4ZO9A 1RSCA 2C5HA 2XITA 5BOSB 3E9NA 1QVVA 5C8ZA 1X7HA 1XMBA 1LF5A 1I14A 4KR6A 2HNZB 3KDSE 2YNGB 1S6OA 3IP7A 1UJNA 2HFUA 1F4VA 3DWGA 3MWGA 2A9PA 2I4TA 2O5RA 3BIXA 3LKVA 3CHYA 2ZB3A 3LLUA 2OP5A 1FDNA 1WSWA 3OR2B 3ZC3A 3EZ2A 3QU2A 5K03A 3CIMA 5LLSA 1Z3CA 2RD2A 4MKBA 2B1IA 5IZCA 1ZR4A 4NU8X 3KG0A 4F7WA 3DR3A 5KOIA 3NR2A 2B0JA 4DLRA 1JDBC 4AJ4A 1N0VC 4G2TA 3RYHB 2BFFB 2BEUB 2FR8C 1GPUA 2IEZA 4DRXA 5ALJA 4CV3A 2V8DA 5HUHA 1F6DA 2XCRB 1K27A 4BJ3A 1G4CA 3QJGA 2V1XA 4X4OA 4L8VA 3GAZA 3EIUA 3FSIA 3EJWA 1Q7YT 3IE1A 3IKTA 2QMQA 1AE1A 5JPCA 3W8EA 3DEKA 1F1BB 3J80D 3AVYA 4WERA 1YJCA 1GXSA 3EGDB 1ORDA 1S3FA 2AZXA 3JYTB 4V0RA 4X4TA 4BP9A 2DPHA 2PZMA 2REXB 3HXPA 2QM3A 1GMWA 1RHQB 4GYYA 1U7DA 2XECA 4BJ5A 1GZSA 1IBMJ 2ZFHA 1SWWA 3DBHB 2IMWP 3F41A 3UG6A 1JFTA 5H8WA 4Q7JB 3G2MA 5MAOA 3KLBA 2CQBA 2JOQA 2IQ5A 2VEDA 3CFYA 1DBIA 3AOCA 4DA7A 3BAFA 1CXZA 5HF6A 3OFFA 1KI3A 3IMKA 4ZN6A 3HC7A 4PONA 1M1ZA 4UHCA 1DPGA 1URPA 2HV9A 2P90A 3I1JA 4C4PA 2NXCA 3B6JA 5JISA 1G3RA 3VKVA 2RU3A 3K9LA 2IDEA 2BOPA 4LV8B 4D98A 5T6MA 3D8TA 1ZTWA 4U7UK 4JR0A 3CCMS 1ZA1A 1SZCA 4LSGA 2EP8A 4QQNA 1DP4A 3QXGA 2J9FB 1LPAB 1EK2A 5MGBA 1U8XX 1Y1PA 3AM5A 3ONDA 3K05A 3LRPA 2AU0A 1WF1A 1KI7A 5KTRA 1FJ2A 4ZQCB 1YBHA 3D0QA 5EESA 1M1GA 1O6XA 2AF6A 1IKXA 4D82A 1Y3BE 4JEUA 1RGVA 4L4UA 2ZYIA 1LSJA 3OESA 4K2AA 2HM7A 5DGDA 4KU4A 5EXSA 2CJXA 4QPNA 2GCOB 2X9LA 3DLKA 1CUXA 2VHQA 2OZEA 4QUIA 4ME6A 2ECFA 4ZVFA 4KP7A 4TKMA 1PKUA 5M3BA 4OX9Y 5CIYA 4B74A 2GAGC 1UMKA 2AG1A 3P5BA 3MPVA 1JSCA 5CCXA 1XF9A 5CB0A 4DHEA 3TEFA 1TL3B 2OJ3A 3EIHA 4G6ZA 5BN1A 3G1WA 2QN7A 4ZICA 4OYAA 3E35A 4H3HB 4PGHA 4XDZA 3GBVA 1UPFA 4HMOA 1KFSA 5D3ZA 1UC4B 2BE9B 3C6KA 1FEEA 2OPSB 4IX1A 2XHCA 3KTDA 1H05A 4EFNA 4ZAVA 2D27A 1I32A 2Q46A 3K2EA 3FPCA 4PRYA 2JKZA 3KSUA 1FYEA 3W1EA 4JLNA 4TGLA 2BKXA 2HPUA 3GFRA 2WJGA 4TUYB 2Q4OA 3WGOA 1MX3A 2D1SA 1FNNA 3A7DA 4MVJD 1RYDA 2VJOA 3ZLVA 5LSAA 2GFFA 3IMGA 4ES3A 2ATCA 2R4FA 3RFXA 4V0OA 5JARA 3L8GA 3ETEA 3OX2A 3KFVA 3I12A 3SJUA 5A8WB 2X1LA 1M8PA 4TYMA 4ZS6A 3GGJA 1L9XA 1J24A 2XRMA 3VR6H 3OZAA 2CNNA 5G0WA 3P4UB 3C41J 2ASLA 4LXGA 2XTJP 4Z7YA 1D09B 1GYRA 3ELDA 2JAWA 3E8OA 3P32A 5LU8A 3W9JA 4CMBA 1U2RA 4AFNA 2DCUB 1L4GA 2LXUA 3HBAA 1KY3A 4JUIA 4P5PA 2KG1A 4P38A 3ONWA 4FF4A 6GPBA 1CEZA 2I1QA 3GJSA 3CQ9A 2VDHA 2W2QA 1I2DA 3AR3A 4F3YA 4E88A 1GEGA 1B16A 4J37A 4UW2A 4PTYA 1OLOA 1XTBA 1RKIA 4RZ3A 3ORYA 1KAQA 3T7IA 4WV3A 1DRJA 4Q3DA 4KVAA 3UJ9A 1TPZA 1DRUA 2W9CA 3IOMA 1HZZA 3S1SA 4YCDA 1GR0A 1MVOA 2VUUA 4K8OA 2NO5A 4K6GA 2AE1A 4UOQA 3I23A 1QAJA 1NJFA 4EKGA 1XCPA 5B6IA 3AXSA 5KX5A 4ECEA 1FX2A 3VPXA 1H93A 5DB4A 5LYJF 2P1RA 1DKQA 1TZJA 2C9DA 2HK2A 2GX8A 5ESXA 1ZUIA 3TDNA 4FS8A 4MQEB 4NYMR 4CWAA 2HHLA 2YNGA 2AV6A 2EC2A 4BIIA 2MJNA 1EFTA 2HCBA 1FUUA 1TVMA 3QF4B 1X9HA 5KSYA 1LJLA 4OQZA 4M8LA 3JVUA 3DC2A 2AOTB 2DHQA 2MKIA 3U61B 5C4MA 4QUHA 2NN3C 2Q8QA 5HJXA 3GF4A 4WBNB 1XNQB 3MUMP 1XEFA 3WAJA 3L7YA 1BE4A 5F51A 4P80A 1NX6A 5E6SB 4MTLA 4WK0B 4A8QA 4O3QA 2BFFA 4UBJA 1TECE 5IAGA 3AR9A 3OD1A 4DF8A 4TYNA 1P75A 4NFHA 3ZKAA 1E1MA 4P53A 1NZ8A 3CRW1 4Z0TA 5JDCC 2N0SA 1H2TZ 2XZDB 1G4UR 1NDLA 1U8AA 3TX6A 3HSJA 2OUGA 4XYLA 3PF9A 1F1BA 2WJWA 1QG2A 1G8SA 3D4IA 1Z0ZA 3JYTA 2HZBA 2HSEB 4ED8A 2RKOA 5C5DA 4RFSB 5MHTA 4J9PA 2D62A 1RHQA 1Q14A 4WFIA 4QREA 4RPCA 2MSKA 2YCLA 8MHTA 5F5NA 2QVLA 1L1FA 2UUAB 1L5KA 4FBTA 2XS7A 3QITA 5K0NA 3BGDA 5DASA 1I30A 5HDBB 3AEYA 4MAMA 4DJ5X 1PKEA 3T1QA 5DQHA 4L3NA 1MQ8B 1I94J 3ESRA 2GA9A 2ZDPA 4YAIA 2MZ1A 1BHQ1 2CV2A 1KZ7B 3TO5A 5B4TA 4GKKC 4I1UA 4Z9AA 1XTJA 4TT3D 4BLPA 1XPUA 3HX9A 1ODJA 1BS1A 1U3UA 1SKMA 5FTLA 3MQ4A 3KXDA 4JROA 4CM8B 5B1HA 3DF9A 3A0RB 4OMFG 5T8KC 1L4YA 4IDQA 2DJIA 3Q41A 2VT7A 2WMNB 3I2HA 4DANA 4DQUA 1K7FB 1HDCA 3ZCPA 1BQ3A 2JGNA 1VL8A 4UQGA 4NFYA 1CR4A 1PJCA 2X5JO 2ZAGA 4F26A 4WD3A 121PA 3PXGa 2C77A 4QFMA 1R9JA 4Q3OA 1CS4B 3ANTA 4ALIA 5KT6A 2B6NA 1RAIB 4HYYA 3HSGA 2AWNA 4MQBA 3P52A 1M1YB 2GO1A 1IQUA 3K0BA 3WLOA 4QXPA 4BVEA 3RUHA 1C2TA 5I9BA 1FHTA 3HHLB 2R68A 1A1SA 2AN5A 3GRKA 4C4YA 2QR3A 2AXEA 1WTAA 3DVSX 5LQCA 2LQ9A 3RREA 2P27A 3PNBA 1XR6A 2XWQA 4TMTA 2DUWA 3LPEA 3E70C 1RYMA 1I0LA 5JYCA 3IRVA 3ER6A 4D56A 4YCSA 3QAEA 2DBQA 1YX2A 1HDRA 1LNZA 3VZSA 1F6BA 3RUBL 3NTXA 1ZWKA 4OSOA 5JBIA 4O29A 5A6VA 4DI6A 4XGIA 1Z62A 5KDOA 2E6UX 4FF2A 4DR3F 3M8RA 4J3JA 2OPSA 4ZJQA 2ZM6F 4GC9A 4O4JA 3DQPA 2AFRA 4AJLA 3ONNA 5CYGA 1Y7HA 4RZHA 3EHDA 1HRKA 5JH7A 1XHJA 5CH8A 1BE0A 1Z0UA 4TUYA 2D3OR 1HYHA 1XRNA 5AVKA 4Z86A 2OWEA 1T2NA 3WYAA 3E4DA 4ZYTA 4XJSA 2HHPA 2B92A 4H60A 2UVQA 3ZZOA 3QWFA 1U2GA 4H7DA 4Y2CA 3MMNA 1PK8A 1W0KD 1EP3B 1G7RA 2VBFA 5E1DA 3A6ZA 4L6CA 1I4WA 3FNBA 1X80A 3FUVA 4HLNA 3OHSX 2WU8A 4P7BA 3MNFA 3D0KA 2DF8A 3W63A 4GRAA 3JS9A 2HL6A 4D9KA 4PU0A 5LM3A 4LQDA 5E33A 4KO0B 3QEBZ 2DECA 4ERDA 3AB4B 2HMAA 3HFVA 3DBOB 1AQUA 2E3JA 3KXLA 5L39A 1PFVA 5JR3A 1RMTA 3NRJA 4AIRA 3GP3A 4HADA 1ZVVA 2WJAA 4ZP8A 3RTBA 3C6XA 1D4ZA 4A8YA 2G88A 1WTCA 5DWVA 2BMDA 2V50A 1DQPA 1CX9B 2C7GA 2QTCA 4TLQA 1QS0B 2NLWA 4WZAE 4V2IA 1YB7A 4C78A 1KH3A 2AWOA 4M1OA 4BMNA 2HRBA 2W11A 3MCAA 1ZD2P 2YNHA 3RJMB 4ND7A 2FJAB 1AY0A 2P2NA 1ZDMA 4B9MA 1II8B 1XD8A 3VAYA 4WLOA 1PL8A 3SSNA 2O5DA 1O6ZA 1RTIB 2VUHB 2CW5A 2IPMA 1W88A 1NNUA 3ED1A 1K3TA 4RKUC 5DTEA 5B3LA 2DO0A 1EKRA 3ADKA 5KT7A 4P1ZA 1S1VB 4M99A 3IWNC 3ELWA 4DBVO 4YH1A 1URNA 2HBZB 5F7OA 3OHMA 1VE1A 3QF4A 2CLIB 2O3DA 3O2QB 4Z49A 4Z7NB 4AS2A 4WBNA 2ZRGA 4CO5A 1MR3F 1SVOA 3H7HB 1T9XA 4NOMA 2VP9A 3D0IE 1ATIA 3RUDA 3I4LA 2NSBA 1REQA 4KVGA 1R15A 3IQGX 3L7DA 4RW0A 4F12A 3BYRA 1U98A 2RHBA 3Q8LA 4WNAA 5C5JA 1LI4A 4UZBA 5LOVF 4JUZA 1JAXA 2JD0A 3EVFA 1JZQA 3TXAA 4USVA 3DDHA 4E4YA 3FHCB 4L9AA 1VMIA 1WUIS 2KE5A 2QZSA 2FJXA 2ZKLA 4PRZA 2V6FA 3TTWA 5JI3E 1TF5A 4A27A 4F2RA 1HNZF 3E8MA 3ZU5A 3VOAA 4C0KA 1NVGA 3GJ7A 4OGKA 4RFSA 3HSKA 2H16A 1MX5A 2JIPA 4ZAWA 5CTAA 3QVTA 4ND6A 4INZA 1RT4A 1ZK0A 1T05B 1R0KA 1OROA 2ZRIA 3KK0A 3OPKA 1Y11A 4ZKEA 3IWLA 3T35A 4QGAA 3GYXB 1W0JA 1HDOA 4REMA 3KXIA 1RT6B 1GMVA 1O0PA 3OTEA 5ITHA 5C35A 2NPFA 4EJ0A 5BMVF 3LX5A 3KC2A 5J43A 3ASYA 4WK1A 3H17A 3AYXB 5H83A 5CNMA 2VQFC 2FEOA 3ET4A 2PGIA 5B2FA 3VKHA 1TM5E 2AWZA 1FA9A 5CAEB 3VZDA 1NSPA 1E9RA 1C0KA 1DKUA 3C3BA 1M76A 4BNHA 2MKSA 4AULA 3QV2A 3OUZA 2IYSA 5K4GA 3VQTA 1JHZA 3K96A 3U3DA 3FVRA 4FVTA 1L7MA 4IDGA 4B8WA 3T4PA 2MM9A 2W4IA 2EGTA 3I62A 2FLOA 3SX0A 2KM1A 1NYRA 3R9KA 5I7EA 5KT3A 1NQAO 2WUGA 1TB4A 2WHYA 2REBA 2XUFA 4FGZA 4EUNA 1CS4A 4CF7A 1OS5A 3NX4A 3O73A 3UR0A 5C25B 1NJSA 1T5BA 2B1RA 4V0QA 1RAIA 2DZDA 1CP2A 1TZ2A 5CVDA 1HI1A 1GGFA 1M1YA 2TS1A 1MJGA 3QSYB 6REQA 1YRUA 1L8LA 3GZ4A 2PI4A 3I04A 5EQJB 2N3OA 2W2OP 5JZSA 1PZFA 5IT9U 2O8EB 1W85A 2XVXA 1RXEA 3TVKA 1RPNA 2DPYA 3M8WA 3LP1B 3VU8A 1G3IA 2DH6A 1J9ZA 1HHQA 2GWHA 3KVVA 2B8PA 2IEGA 1QVZA 2XQFA 4X8MA 1X1EA 2VPWA 2A5LA 1KSFX 5EKXA 2O3JA 3UK2A 5TE9A 3VPCA 4J76A 3EPKA 1TM4E 3F96A 3Q5EA 4UAVA 1FW8A 2PFSA 3INNA 1IZ9A 1ZK4A 1JR3D 2VT6A 1ZGBA 5THQA 4CQ1A 4WCDA 2VAXA 2XMRA 4A0GA 4O4IA 4F2WA 2H1SA 5TQJA 1WHXA 1Z5GA 4D3HA 2IQIA 3QUAA 4Y3UA 3OT1B 2ZH5A 2J31A 2XT0A 3TEJA 3HL0A 1GG5A 4HDOB 4I5DA 4X4SA 2MGZA 3B6MA 3D8SA 1GZVA 2NO1A 1YK0A 1SXLA 2ZI9A 5LQMA 1U8FO 4UXIA 4DV7F 1SBYA 4MGEA 1DDGA 4ES2A 4AX8A 4QG7A 2BH1X 5E6RB 3ST7A 3PDCA 3D54A 5D6OA 2PYIA 4YCNA 2ZUGA 5AIAA 3D6VA 2A9OA 5FPQA 2P69A 4HDHA 3A1VA 1VECA 1QF7A 4B6RA 3Q83A 1CBUA 1Q1GA 4NF2A 5IH3A 1JHUA 5KNLA 5IDVA 4DL2A 3WJ2A 3GMDA 3E2MA 1NM2A 5K0CA 2XVAA 1NCLA 3SQDA 2RQMA 1S9GB 4KO0A 4JI6C 1Z73A 2IBTA 2V7TA 3VGPA 1PEDA 2V8OA 1OMOA 4Q4DA 4BEVA 3DYAB 5ALXA 4X1YA 2V67A 4HZIA 5B0AA 5A2GA 5ALYA 3WMXA 4R51A 1I2AA 5LMUB 4OLHA 2VL1A 1FTSA 4RBNA 1ISPA 1ORWA 4WXEA 1XDWA 1CW2B 5GM2A 1QS0A 4BBJA 3JQMA 5HK9A 4HBGA 5BYBA 3FMOB 2E5GA 2HR1A 2XQCA 4GXTA 1BQEA 4WL0A 3CWJA 3PL1A 5C1OA 3H5OA 2L9WA 4TWRA 1NPYA 1YQHA 4LBWA 3RJMA 4M4SA 2OGZA 5JRDS 2WTMA 3MF5A 4D43A 4JYPA 4WE3A 5KT2A 1QGUB 2AB0A 2Y1LA 3QKSB 4DFJA 5EP3A 1VMDA 3LLSA 1IY2A 5BP7A 4H7EA 5DIFA 2YKPA 2CLFB 2R8ZA 2HU2A 3R3TA 1BD4A 1S1VA 1IXSB 4ED5A 3EGXB 1JKFA 2HBZA 1UA0A 1PZNA 3GR0A 1JDJA 2NXJA 4K81B 1TEVA 2SCUB 1GPAA 5TRTA 5ALVA 3CJ8A 4AY6A 3ECSA 4Z6KA 5KFLA 2G76A 4BPBA 5F3RA 3I5MA 3TR0A 3U6BA 3BD7A 4PPQA 4ZVTB 1NK4A 2ZDGA 2GPYA 4FOPA 2J8AA 2B8TA 4FNAA 4LA4A 1YE5A 4C2AA 2D1RA 3W2FA 2ODQA 2NU9B 5J63A 3NBKA 1GAOA 1FSSA 5GAHU 1CY6A 5JVDB 5AUPB 4HFMA 2I80A 1YCFA 4D7AA 2XAUA 2YWHA 3D8HA 2WAAA 5TX7A 4UY8T 2PYZA 1GTL1 3CF2A 2C4UA 2G2YA 3V97A 2O48X 2AQHA 3COZA 4MT1A 2BRUC 4FGJA 3UB2A 1RSZA 2C7RA 3QEJA 3UMJA 4ECSA 1OC2A 1YDEA 3D2BA 4R1OA 1PNRA 2BI8A 2HEKA 2MOKA 4GUDA 3UT6A 3ISTA 1Q84A 1RT6A 5K8IA 3LXXA 5TJ9A 2W6ZA 1FXWF 5FQOA 4BJHB 3CJ3A 5E6UB 4OY3A 1UT6A 3IUQA 2LGJA 3GW8A 3EA0A 3TUPA 4YO8A 1IN6A 2R8IA 3ZQKA 2WSFC 3K2QA 5AKEA 5HZHA 2VJNA 3RSOA 1C80A 1OYEA 4KQIA 1X5OA 5ALDA 5HWSA 4FYJA 1VQ5S 1ZCBA 4K86A 1MX1A 2J3MA 2RG7A 5HKAA 2AFVA 5BNFA 4IIUA 1RWXA 2ERCA 4L6IA 1FP1D 3A9RA 2PR7A 2VJQA 3MTEA 1M0EA 1AO0A 5ETKA 1ZY2A 1KZ1A 1NAIA 1G2EA 4C5BA 4JJ8A 4LF6F 3DR5A 3AA9A 1F7UA 4DV1C 1JJCB 1JU3A 5FOTA 2Z3VA 2GW8A 1V16A 2WYIA 3GLHE 3NNSA 5KJ6A 4HBZA 5C25A 1XZQA 4CJXA 4IG3B 5AW3A 4CEIB 3K5MA 1FS4A 4A15A 4P7KA 3H9JA 3SSMA 2PLRA 1BRTA 4YGXB 2O3TA 1EUDB 5SZIA 4PG5A 1HMYA 2HWHA 2I6SA 4FC6A 1AURA 1R0BG 2D1CA 2AUMA 3DRSA 1MG0A 1L5ZA 1YMVA 2O8EA 4JJ7A 4KXXA 5FPPA 3B9QA 3IO3A 5EZSA 4UDYX 3MEQA 3CNNA 1NVFA 4E11A 5HQ8A 2DT8A 3HA3A 4IGEA 3DZJA 1WMBA 2YHAA 2KYXA 4IH9A 3KG1A 1KQFB 4JOUA 4HMPA 5G53C 3GG2A 5C1BA 3LUYA 4KQZA 5EKSA 1GDDA 5GADI 1KAGA 2QR2A 1KU6A 3ZHOA 3PC8C 3CC7S 2JVJA 4OXKA 4O2BB 4I64A 1JLBA 5LWHA 4PQEA 5KFEA 1BKDR 3OT1A 2VHUA 2IYFA 2XUHA 3KJIA 3NV9A 2B1QA 2CJPA 4WYWA 4NL4H 1XTRA 4GNKA 3T3PB 3TOVA 1YJVA 1OXTA 1KTIA 3T1YC 3E1SA 2RHOA 3KE9A 4PYNA 4NDNE 3K6SA 2GUGA 4HWTA 1JIUA 2DK2A 2X2FA 1JECA 5FTMA 3CLVA 3KPYA 5A4IS 5JAZA 3LL4A 4KE6A 1XNGA 1QE3A 1R3DA 1FA0A 1UFKA 3ME5A 4MI3A 4F4KA 4D9CA 1IIBA 3CMCO 4D0RA 4QPJC 2FJBB 2XNSA 2M5YA 2YOHA 5BNIA 1WG1A 5H1SV 3T1HJ 3JSMB 2UXDC 1FU7A 2JCBA 1UM8A 1S9GA 1OILA 2CPZA 1YAHA 1ZHHA 4GPBA 4M9ZA 3QX9A 3STVA 3FOFC 3BO2A 1XOIA 3DYAA 4B3TF 2ZE5A 4RL6A 2B35A 1YACA 1Z12A 4CCAA 2C2MB 1LF0A 4OYXA 4ZIWA 1X5PA 2DPMA 4DBQA 2KHCA 4TPKA 2R6FA 4L5BA 4RW8A 2DGTA 2PC6A 3QUBA 4BY9E 1EBFA 3B1KA 3AL3A 2AXPA 3G0DA 5CGQB 5ETMA 5HQTA 4E5DA 3M70A 1CERA 3LY5A 2EW2A 3C43A 3AGPA 4QT0A 3NTVA 1ZN2A 5J4VA 3HR7A 3GYGA 1Q7RA 4BUCA 1IKWB 1RAGB 2WQZA 5E4YA 1PTJC 4O3RA 1EWRA 1Q22A 3A2MA 1Y10A 3J81j 5DG8A 1EG7A 5DEIA 5J59A 1NXPA 2JGEA 1A77A 4UTRA 3T1VA 3CB4A 4FMBB 4LRQA 3GFTA 3HBMA 4ICIA 1ZH0A 5LL6P 1NH7A 1VA5A 2SCUA 3M32B 1JQ3A 2O1SA 1UZHA 4DIOA 4R1NA 3DGEC 3JQFA 1KYZA 4GP7A 2PKQP 1WTBA 1DLIA 1VQ8S 1JWBB 2PH3A 1YR3A 4IX9A 4YFVA 1NW4A 4LTDA 5DWDA 1FRKA 1A8SA 4ZVTA 1TYBE 4DIMA 4L0DA 3CO9A 2O4UX 1UVKA 3JWIA 4OQNA 3P2OA 3MS2A 1WXWA 1RCFA 2FEPA 3R2JA 3JQ9C 4TWAA 5HE9A 5JVDA 4C7BA 5B58T 2WLSA 3HA2A 2DTXA 3VPFA 4U7GA 3VPHA 1YJ9S 1XVUA 3BYPA 2W1BA 2PFGA 1UWAA 3TSYA 5I9NA 4C9BA 2HT1A 1QFZA 4P35A 3AJ2A 4IOCQ 2JC0A 1ZUD1 4ZZ1A 1P2SA 2VSQA 3SEOA 3QBJA 5CH7B 3GLIE 3VRHA 2J9ZB 1E5VA 2RK3A 4Y2GA 4LSNB 4PFKA 4UZFA 4LV5B 2P0AA 1N4LA 2VATA 1V3VA 3GRFA 5E6UA 2Q7OE 1WCIA 3HXOA 4DV5F 1GZ5A 4RL4A 4JB3A 3GNLA 3R5XA 1KH2A 3KZKA 2I8EA 2RF2A 2CPYA 2IS1A 3CUTA 3G82B 4I08A 2RAPA 1I3CA 4AUMA 5P21A 3DMGA 5TB5A 1QKJA 1YHZA 1IHOA 2Z0GA 1Y42X 1Q83A 3W7BA 2HNAA 1JDZA 3RVMA 3L1VA 1NU6A 4OIMA 4UM9D 2CMFA 1XALA 4MGYR 2MSLA 1TTPB 5JSUA 4KH0B 2XRYA 5AW8A 4TKLA 1H2RS 2QQ0A 1EH5A 3FYUC 2QG6A 5B7QA 5D00A 5LD2B 4FBGA 4KRXA 2ZBRA 3UBTA 1DWQA 3ZHQA 1RI1A 2DNQA 5E2IA 4ZGWA 3D3CJ 7MDHA 4B80A 3ER9A 4PX5A 5C7PA 1IBKC 3OLYA 4H4OA 4WFJA 1VQSA 1E4OA 4H1HA 4IG3A 3OJXA 5LZ4A 4TTQA 4ILLA 4CEIA 2VF8A 4C4AA 1UKCA 4OJ1A 4WZQA 1EUDA 4UU7A 1IONA 1DZIA 4DU7A 4Q01A 3KKMA 2V7QD 1IPFA 1MOSA 1LJUA 2VNKA 3VAGA 2Z8QA 2GS9A 2N82B 2C9MA 3ICQB 4NLRA 2FLVA 3EEQA 2YX1A 4J0FA 2X1GA 2XNKA 4FDVA 1TA0A 1L7NA 3DRRB 3ABOB 5TIIA 3FFAA 4ZO4A 5H81A 5C1PA 1DTWB 1W87A 4OP3A 1USUA 4NMHA 3NV7A 4LBHA 3IOYA 3QJPA 1X7GA 4LVCA 1ZFNA 4MV1A 3D6TB 2QVBA 4PGFA 4O2BA 3HU1A 2QRNA 3FTFA 1OASA 3R4CA 2WA2A 3FWZA 4IJ5A 3FH0A 5LCIA 2NO0A 2DY9A 4ANFA 1RHUB 3ITNA 5EHGA 2H54B 4LFBB 4EPVA 2E5LF 3DFUA 4AMGA 3E15A 1YFJA 1TL7C 5LXTB 4HNAB 3FETA 1H1TA 2CPIA 1WNEA 2W9AA 3R0QA 1BKYA 2PMCA 1S1WA 1OYVA 1THZA 2HQGA 4U7UD 4CI0B 4U7HA 2AN3A 3L6EA 3PJDA 3VZQA 3D4JA 1PJQA 3TR6A 1BMFD 2ALYB 3TARA 3IA0A 1BH2A 5EUCA 5KNDD 3IG1B 3LZ6A 2EZ9A 3ZTSA 3G8YA 4MVJA 4R5MA 4DZDA 2BKEA 3G2LA 1UW4A 2B37A 2E4YA 4YYZA 1V48A 4ZXPA 1KHVA 2C7VA 5CA1A 1PU2A 1PJ3A 4YJGB 4TVAB 3DW3X 2Z51A 2L3MA 3QEAZ 3JSMA 1KDRA 3C66A 3UMRA 2DP4E 5D0RA 1Y1SA 2PKQO 4Q21A 3SOZA 1UOOA 1MIHA 4UM7A 2BKLA 1WXQA 1S2NA 2CADA 5MLCV 4JCOA 4ZO6A 2WM2A 2ZJ2A 4Q4AB 1RCOB 1YZVA 3PDHA 2HJGA 4YR2A 1NBEB 2FVRA 5EUMA 4MA0A 5LNK6 1IBMF 3MOIA 2EKYA 5KSWB 5KWIA 5EEGA 5LZ2A 2HRQA 3GXBA 4EHLA 4X93A 2QE7A 3K89A 1COWD 4Z4EA 1ZSYA 3ISND 1KK1A 1LPBB 1H38A 3E9DA 3HPOA 1A5AB 2ISSD 1ZI9A 3H4IA 1CJKB 1IAVA 4EYQA 5K4HA 1K5HA 3AWIA 1IKWA 2LCWA 4DUZB 1RAGA 2QHXA 2JL1A 4R9VA 2IV7A 1RP5A 1R3NA 3FZQA 4CF3A 5KTMA 1MIOB 4FDAA 2VK8A 1NQXA 1SXIA 3E3XA 2F7VA 2FH5B 2BBEA 2YIMA 4CN8A 1R8XA 4DX6A 3SXJA 2GESA 3M32A 3DCNA 4JI4C 2CF5A 1BC6A 1QO0D 3O8DA 4ETMA 2BAGA 2HADA 4MKAA 5F0WA 2COUA 4QEDA 4GD3Q 3D4PA 4AJJA 3C5VA 3QHPA 2CT8A 2SKCA 1FJ7A 4NRUA 3HV0A 2VH7A 3GQCA 2CBXA 4HLQB 4ILRA 2O57A 2WIBA 2UZ4A 2LKDA 3OQ1A 1JTFA 2VPQA 5I4BA 4O1MA 5BSFA 2MHCA 3D1LA 4M5NA 2XYPB 4MEJA 3CCCA 2W83A 3MVEA 2EKDA 4KYVA 1KMNA 2YXEA 4MMOA 2A1TS 5IYZF 2VJDA 1J1ZA 4Q9NA 3QMPA 4CFZA 2YW2A 3UCFA 5HMXA 4FEGA 3E8SA 2WSIA 5TMPA 4FFOA 2J76E 2W9XA 4CM6A 5KFNA 4ER7A 1J5EJ 2IH4A 4ALJA 2P2SA 2CJBA 4LSNA 3I87A 1B00A 1RI2A 1DX6A 2IHZA 2D5CA 1WZUA 1VEHA 4R1TA 3E53A 4UDNA 2Z57A 4AY3A 5KEIA 4GSKA 2C29D 1P4AA 3A4MA 2O3QA 2RE8A 1GPLA 3CIZA 3DMDA 1XJ0A 3B6IA 4EFAC 3CCJS 1X94A 3ZJYA 3G82A 3S8EA 1CY8A 1G4AE 1CLFA 4DQPA 1P2DA 1T6XA 2W2NA 2QUIA 3U13A 1SUCA 2DGDA 2G1KA 3MFQA 1XERA 4GU5A 4EKIA 3HSZA 5K6AC 5A0TA 2HVEA 4GVBB 4KH0A 3E9CA 1N6OA 4DV2C 4B3SB 1EPUA 3B13B 2CWWA 1OV6A 4QDUA 2GETA 3WMGA 1JTEA 3OTIA 4EHFA 3A1UA 5FNVF 4QEZA 5HM8A 3NAIA 2XOEA 2O2ZA 4CKCB 3SC4A 2HS3A 5GAGU 2J33A 2Q28A 1C7EA 3RAXA 1V5GA 3PZRA 1HF3A 1HBNB 1W4RA 1OHHA 2WWYA 2ZSDA 4MIBA 2P2FA 2PBZA 2SKDA 1G8FA 5IM4A 2X5KO 2XIJA 2R4TA 1IWGA 1E7MA 1DIGA 1D6NA 5FR1A 4F4ZA 4PN7A 4K0RA 4MX8A 4AY4A 1WEHA 2ID4A 4ZWNA 3BDEA 3AHIA 4UAGA 3U6KA 4D4GA 4C3LA 2Q4DA 3R5HA 2EWHA 5DHAA 1AKQA 5D86A 1GTZA 1NVTA 4PLGA 5HFAA 4OIXA 1S7IA 4PYMA 1H8HA 1DTWA 2XYRA 2Q8NA 4IV5A 4Y2HA 2IH5A 1MWZA 2CE7A 2QUBA 1D6SA 2P6PA 3FEYB 2B2XA 2H06A 1HE4A 1ULTA 2HB6A 4KQEA 2ASEA 3DM5A 2MB0B 2AX4A 3HMQA 1OW3B 3SFUA 2QK4A 3C8ZA 4LC9A 3MTIA 3R0JA 5CK4A 2AK3A 4OHVA 2H54A 2XLJA 3GV8B 4F86A 8RUCA 2CHQA 4HNAA 4IFVB 2E2WA 3U31A 4Q45A 2VQFJ 1X74A 3BZUA 3LPNA 2J07A 5CA5A 1A72A 5GWXA 2UDPA 3OE1A 2CJXB 3A0UA 3RVRA 4ZZIA 1G291 2CUNA 2EKBA 5DBOA 4G1PA 2DVIA 2M9KA 4P81A 2PH1A 1WOOA 1RQXA 3G2IA 1S2MA 3D3WB 4YJGA 1QSGA 1GSOA 3R40A 4B32A 3WE7A 2ZKUA 4MICA 2ZBIA 2G8LA 4Q37A 4D9GA 2VZ8A 1U3TA 2I33A 1ZO8A 3HULA 4KAAA 2ZOGA 4BLUA 1UK9A 1FVQA 1RPTA 2GM9A 4Q4AA 3D1QA 1NXTA 5ECWA 2IYYA 5IFMA 1NBEA 1IDN1 2QVZX 3K4PA 1IOZA 3NNAA 5EQDA 1WUTA 2FK7A 2ET6A 2C0PA 2P30A 2F9FA 5A8RB 2E7GA 1XD9A 1YQGA 1EI9A 1T24A 3NT5A 1I94F 3CJ2A 5A6WA 1SOWA 1NBME 3LFHA 1OTYA 5SY9A 4ES1A 5JPDA 2FPGA 5HRCA 3C2PA 4DM7A 4C29A 3SSOA 4YREA 4K4TA 4Z4IA 2V2QA 3CA8A 5E3PA 2IODA 3TWOA 4NLVA 4FYIA 1GR1A 3FUXA 3MT7A 3O44A 1SKSA 1R16A 1W5TA 3TQRA 1JIIA 1LVUA 4XDHA 1D03A 3P5BP 1SPXA 1MIOA 1RQ0A 2LQ5A 1YR9A 5KAMA 4F0HA 5E1OA 2ECPA 1O6CA 2JBAB 1DEAA 2BW0A 1VL0A 4OF4A 1QX4A 4BLVA 1N7JA 4P72A 1YIAA 4INOA 1MROB 3AR4A 3WI7A 2E82A 2Y05A 1TM2A 1LWFB 3ISVA 3OLVA 2CFXA 2P1DA 1YIJS 2Z4SA 1P2UA 1MXBA 5C7LO 4DCPA 2GHQA 4XOIA 4LF9F 4BFWA 3I01M 5IDXA 2VG6B 1UWBB 4W5RA 5FFFA 5HIAA 4K6OA 1FNSA 4W4TA 1HLPA 2XYPA 5HIMA 1U3FA 3M8SA 4FKXA 1YSJA 3K3PA 2WAXA 4RLEA 2K3KA 1ZXBA 2GVZB 3AJ1A 2IOFA 5LA6F 2GJSA 3GLTA 2O54A 3UJ6A 1H2WA 1WPXA 2NM0A 3DEFA 1Z7BA 4IJKA 4IXMA 2JLFA 5KX5B 3DCYA 1E0AA 5E2QA 4JI6J 1N32B 3T12A 3RGIA 5LSOA 1K0TA 1I13A 4FCCA 5AUNB 4DSEA 7ADHA 2QUJA 3S29A 3HJUA 3VJRA 1ZMXA 1JU9A 1YZFA 2UZ0A 1R9MA 1YE8A 4LFCC 4C7KA 3R7WB 3Q6NA 2W2QP 3QY0A 1N2CA 5TARA 1G0NA 1SVLA 5HRUA 2VQEC 4JJEA 2A5DA 2A35A 1JDSA 3IDAA 3A9WA 1L7PA 1P6QA 5D0HA 1L4EA 1PDVA 4O2RA 3OKAA 1YZHA 3AVUA 1EQAA 1GTJ1 5L3VA 4F4DA 4MVJH 1FTRA 3U7EB 3D67A 3GWCA 2ZRCA 5CLLA 2UYQA 4UHHA 1P73A 4GVBA 4Q3CA 1E2NA 3U56A 2DYAA 4HS4A 5FBVB 1XEAA 1QWOA 6Q21A 3BWYA 2YV5A 3PSAA 1B41A 2GX6A 2IYQA 4CKCA 1M67A 3KLMX 4AU1A 2A9KA 4EGQA 4Y0AA 4BTVA 3HEAA 1P44A 4JITA 5IJ0B 3GRAA 1DG1G 3DPSA 2XCTB 4B7XA 2QFJA 3KOMA 4X62B 2RDMA 4UE2A 1HBNA 2C28A 5CT8A 4YDXA 3OXGA 3WGGA 3UH0A 1GXLA 3IUPA 3I9V9 1CFJA 2D28C 4EEKA 3A6FA 2XB8A 4HWGA 1DAOA 4UOHA 9ABPA 1GV1A 4XVQA 5ELXA 4ZA1A 1U0RA 1Q0SA 1ST3A 2P8JA 3HS3A 1RP7A 4J4TA 4NBUA 3WLFA 5BYAA 1BVRA 1T6YA 1PJAA 5ARDA 1XDDA 1Z8DA 2AJ2A 2FPWA 2Y99A 3FMVA 3IMQJ 5FBLB 3M9WA 4CTOA 1V8OA 3AMVA 5CYMA 4FQ7A 4Q0BB 1ABEA 1VG8A 3FRZA 4CRWB 2WVEA 5HVHA 3O92A 4H35A 3B9BA 3PUXA 4JXKA 1RRMA 4NOKA 2UXBJ 2B3DA 4EJ2A 3BO3A 4LK2A 4ARVA 2UXCJ 2DR7A 1MMFB 1JP7A 4QFBA 4PM4A 2HIQA 3UZUA 1U0SA 4IFVA 5JSKA 1JR3A 3EVCA 1NDUA 2KXFA 4FPIA 2J9EA 5E4TA 1X60A 1KI2A 3L8HA 4B76A 4OLFA 1HC7A 3OPYB 1Z29A 3JTPA 4MQ5A 3N8DA 4DMMA 2R7AA 1EGAA 3AEUA 3PF8A 4NARA 3IV7A 1Z0DA 2MEWA 2G7MC 3A4IA 4N82A 2BPOA 4DMZA 3D3WA 3LXMA 3GA7A 4IDDA 5TVGA 5J23A 1NBAA 1E2HA 1HT0A 4ZO8A 3QPAA 3M49A 2OLJA 2GFIA 2RHHA 1YZ3A 2EFQA 4TRMA 1FFYA 3C6MA 1VOMA 4XJTA 1T10A 3RS9A 2NCKL 4I1OA 1JFVA 5DMHA 3A4VA 4Z7JA 4O4JB 3P0RA 1YIDA 3EYAA 2WBMA 5F4BA 4I5FA 3RLIA 4BO6A 3HU2A 2YN2A 4R2LA 2HIAA 2PLAA 5A8RA 4WU2A 2HLHA 5JH7B 4OHXA 1CY0A 1HWLA 1XMOF 4M98A 3S4YA 2Z2ZA 4D3XA 4F4HA 4U8HA 3R3HA 4BKQA 4G1BA 4AJ9A 5JMOA 2KHDA 1Y9OA 3BZBA 4RQAA 4LQLA 3RJ9A 3U09A 4OFBA 2DTEA 5ALRA 3QTBA 4GL2A 1E2UA 4KLZA 4XLZA 4G36A 1X80B 3TKAA 3HVAA 1QIKA 1QP0A 1MN9A 5LMNB 5JALA 3CEPB 1NF2A 1BGXT 4DU8A 3EXIB 3TIXB 5KSPA 1QVFR 2RHWA 4NLXA 4FXWA 3NBYC 5IJ9B 3RRJA 1P8AA 4RLSA 1E7SA 3T38A 4RHUA 4DMCA 1Q12A 2JBAA 3M6AA 4Q3BA 4PC7A 3O2IA 4R8RA 1QZUA 3AHHA 3PHLA 3OTGA 3CS3A 4TMYA 3GROA 5FR2A 2QMZA 4DSFA 1X15A 2Q4TA 5T7BA 1TM1E 1MROA 4M94A 4GBJA 1YZGA 4HQLA 1LWFA 3IQWA 1E3DA 2MQOA 3T1YJ 1QOQB 1FVFA 1VB3A 4KBFA 3VUFA 2K7JA 2Q3MA 3M2TA 3GRYA 2BFNA 4WXWA 1JIQA 5EPUA 3FBEA 3DF7A 4UBKA 2J59A 2VG6A 5L38A 1UWBA 4GO5X 5D3QA 4EJSC 2JIRA 1BAPA 4ZC1A 2WB2A 1QYVA 5CXQA 1GYPA 1O87A 2OC4A 2GVZA 1JG2A 4R83A 2YNHB 2GA8A 4TVSA 5TGDA 4HVTA 2FRVA 2CVEA 4E21A 4GOMD 3KJVB 2OR3A 5DN9A 2K2QB 1IXRC 4C06A 4ENOA 1RQPA 2G80A 4M1EA 3LRTA 3ODPA 1UP1A 1RFGE 1W88B 5IDWA 4OYLA 5FV7A 4C30A 2ABYA 1A97A 2QLLA 1FFEA 2YHUA 1QMGA 3K9HA 3R7WA 3V1MA 5JECA 4RTRA 5JZMA 1LGYA 1UOPA 1LH0A 1U65A 5FUVA 1JILA 4D92A 4U3JB 5JCXA 3JASA 5CHEA 2FFJA 4F5YA 2ZYDA 1SUEA 1S7HA 3OPYI 2DJ5A 1HBUB 3CH7A 1REQB 4LXQA 1C3JA 3OKFA 2YXDA 1E92A 4KFBB 4Y2MA 4L74A 1L5UA 3I4PA 2O7SA 1E2LA 2BMFA 3CJKB 1R6TA 4DLKA 4WNAB 3DLAA 4E0DA 3T6JA 4MJLA 2Q1SA 3UKOA 4JA2A 1BEZA 3CTRA 2ZTVA 3BXPA 4IEIA 2VH2A 1AQNA 5FXMA 5ERYA 1EM8B 2AFIA 2A2CA 4FI3F 3I08A 2QAJA 5IJ0A 2R97A 1Z63A 4L5AA 3MD1A 3EG9B 4BB9A 5K8CA 3FMGA 2R00A 5H3HA 2CJQA 3AIOA 2REQB 4GBED 2OE2A 3JQGA 1RT4B 3LUPA 5I7UA 4W5NA 1JYSA 5EDWA 3CBGA 4EELA 2X1FA 1QHHA 3O93A 3AHJA 3ILVA 4UE3S 4HHJA 1BS9A 5HFJA 4NCBA 1KMCA 2WHEA 3ZNUA 4EPRA 3L4SO 4Q1AA 3VR5D 5FWNA 1MB0A 4Y9SA 3NGDA 2VRCD 4Y6PA 4LQ3A 4I50A 1ODSA 4J0QA 2VFSA 5DHSA 2YMLA 3QOWA 3ANNA 2G2OA 4D26A 1AHHA 1S2LA 2FW0A 4NLPA 4Q0BA 4Y9DA 3VR2D 4CYUB 1AVTA 2HHHB 1XXHA 2AGQA 3MGGA 4KZPA 4JP1A 5ARBA 2X3FA 1Y48E 3V6DB 1Z2NX 2LQBA 5K1ZA 5I48A 3OIWA 1SVMA 5FLXU 4PZDA 4Y7DA 4BZZA 1POWA 4G0XA 2BTOA 3K0FB 1TD1A 4MV7A 2EZUA 2NO9A 4AMZA 3NNCA 3B2QA 1I4EB 3EXHC 4BAUA 4MW7A 3OPYA 6REQB 1DZ5A 2DQKA 4YDHB 3I2IA 4RK5A 2BUCA 4AYBD 1G7SA 3K0JA 3QLEA 1IN1A 4FZ3A 1W85B 1JI3A 4K6HA 4JV5B 3GEPA 2HSJA 2BBSA 2NUUG 1VGQA 2PGOA 4Q9HA 5GMOA 2IVZA 3FPHA 2JD1A 3K73O 5FCDA 1U48A 2VPWB 1MEOA 5KYTA 3BD9A 1UKUA 4AQDA 1K8XB 1SL2A 3P2JA 3G6WA 4MR9B 1F5CA 4KQ9A 5F9HA 4LMPA 2ZDHA 4HWKA 1KK3A 1O08A 4UOZA 3NWJA 3ZHTA 2DHAA 2I7VA 3EZOA 4JC4A 1JBEA 3TMAA 3NXZA 2G9NA 3I8OA 3CE8A 2V97A 4CPDA 2BJ3A 4O4IB 5HUJA 3TA1A 1DZ3A 2ZH6A 2O20A 3C0KA 3AVQA 1G6BA 2XCAA 5DNWA 3E58A 2HFOA 1E5XA 1WQ4A 1JVNA 2MGZB 3HNRA 2R8YA 2B8WA 2M9MA 4K5RA 2YWCA 1ZBTA 2ZULA 4CM4A 3CZRA 4EHAA 1LDMA 1RZMA 1XLVA 3C3CA 4D9IA 3EXIA 1IBLB 3R5FA 3R5BA 3ELUA 1SKYB 1KFDA 4YEAA 1MH1A 1NUTA 5IJ9A 2R1UA 2WFZA 3FTEA 3OHBA 4EYKA 3KDOA 5B1IA 4EG6A 1UEJA 2P9BA 3E48A 3R9LA 3K09C 2OOSA 2XDAA 2ZIUB 3ONQA 4E4RA 3B9RA 3U3JA 4ADSG 3V32A 4K28A 1WBBA 1ZNXA 1GM5A 3JWGA 1ORRA 1E0DA 3LUBA 3WOVA 4X1YB 3N5KA 4B79A 3E0QA 5BV1A 2R6AA 2VR1A 3T1OA 4MUEA 2ZE2B 1C8BA 3MXOA 3EX7C 1IBRA 3G2JA 1ZESA 4KBYA 3L6BA 5IEJA 2QI9C 1NUPA 5JCPA 1SRQA 2HD4A 3L0DA 2JRSA 4K6KA 2XPCA 3F0TA 5HNKA 3BB5A 1XGKA 3CVKA 1QD1A 4JLBA 1QLWA 2YQ3A 2ZCVA 3FRHA 3EJ6A 5HGXA 4ALNA 1H2XA 1GY8A 1SKUB 3KJVA 4I55F 4DR1C 4RULA 2N3ZA 4N8NA 1B1CA 2Y1LB 1X7YA 4KHMA 2C57A 2ZKIA 2GRUA 1Q91A 1SCUB 2FPMA 3LOQA 2HYIC 3GU0A 5MDHA 4K0KB 1WW8A 2AJ1A 1E4YA 3T9BA 4MP8A 1FQJA 1ZKMA 1DFDA 2F8TA 2FRXA 3IEPA 2MSSA 3P9NA 4U3JA 5AW1A 3CLRD 3MPYA 3ENVA 2XMAA 2FKNA 4HNTA 1PGOA 1OI7A 2B5WA 3WB1A 4QWWA 4CIXA 4MV5A 2II6A 1GZUA 4RJKA 2NUAB 2XY6A 1HBUA 1SMKA 1TUEA 2GM3A 3TLJA 5BSVA 3KVRA 3R77A 3CXCR 4KFBA 1N1EA 3G96A 3WHKA 4W8GA 3ET5A 3CJKA 1CQXA 2HA5A 5D84A 3MN1A 2V9CA 2RIJA 4DUYC 1XMSA 3GFXA 3BFXA 3QVKA 1GGVA 2OUIA 4X94A 2BZ2A 4WASA 2X4GA 4N01A 5ITSA 4GZ6A 1RJWA 4D42A 3T1HF 2X3GA 1Z08A 4EGJA 1WPGA 1EM8A 4LJ6A 1WACA 2H9AA 3R6GB 4Y0VA 3T5AA 4R69A 3EG9A 1ZYQA 5ES3A 3OJ0A 2G9QA 1B8UA 5L4NA 2REQA 2Q21A 4BKMA 2ICAA 4YDSA 2W00A 2QLWA 2PL1A 2VTDA 3QYFA 5BSKA 4JZYA 4KXUA 1UJ2A 3LA0A 1EYZA 2JAUA 2WM3A 3OQ2A 2QV6A 1M1NB 1YVRA 3MCZA 4NI2B 2J9XB 4Z7QB 1CE8A 2VD3A 2VV5A 3I9NA 3KBBA 2O2GA 2AKYA 3GBPA 2ZAYA 4DLBA