3AY0A

Crystal structure of methanocaldococcus jannaschii trm5 in complex with adenosine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
335
structure length
320
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differentiating analogous tRNA methyltransferases by fragments of the methyl donor.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0883
total genus 89
structure length 320
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ay0A01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 3ay0A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ay0A03
5E2AA 3OCJA 1XDUA 2GAFA 1P1CA 4FS8A 4QQNA 5DLYA 3TR6A 4BP1A 2R6ZA 5EEGA 1ZKDA 1HMYA 2VZ9A 2Z6QA 2AOTA 3EVDA 1X1BA 4QPNA 5FA8A 5JUWA 3G8BA 3CGGA 1KIAA 3G88A 3EGVA 2BH2A 1WXWA 4E70A 2ZCJA 3OU6A 3PS9A 3DH0A 4RVHA 5K0JA 4C4AA 3PLAE 1M0EA 2AOVA 1ZQ9A 3R6TA 1SQGA 5FHQA 3GGDA 3BUSA 3HA3A 4U7PB 5EIFA 4BLUA 4RTQA 5M5BA 1QAOA 2XBMA 7MHTA 3LCCA 4GC9A 3UA4A 3HCDA 3LDFA 2XYRA 1TW3A 1ORHA 3O4FA 4LWOA 3KPWA 2ZSUA 5DPMA 5DTRA 2FPOA 3SM3A 3P9NA 2IDKA 3UJBA 1QYRA 2AN3A 3EEOA 1ORIA 5LQJA 5T64A 3SVZA 3M6VA 3LKDA 2AOTB 2PLWA 1FPQA 1SUIA 4U7TB 5F2KA 4KVZA 3M6XA 4RTPA 4CTKA 5HZMA 3FRIA 1L3BA 5LQKA 1F3LA 3B5IA 3KKZA 4RVGA 5GM2A 2AOUA 3KQMA 5K05A 1DCTA 2BZGA 4OA5A 3SSOA 4RTNA 1N2XA 3KQYA 2ADMA 1AF7A 3G89A 4HGZA 3HA5A 5EMKA 3C3YA 5BW4A 4FZVA 3FPGA 2YXLA 5GP1A 3UJ8A 2OKCA 3PT9A 5ERGB 3LHDA 2JH8A 2PWPA 3MQ2A 4C08A 3KQVA 5K01A 2NXEA 3EVFA 3ORHA 4Z2YA 5E8JA 1NV8A 3LBYA 2I6GA 2C7RA 1VE3A 1O54A 4HTFB 5D1HA 3SGLA 4PYMA 2FK8A 5EMLA 3SSMA 3G5LA 1SG9A 3THSA 4PWYA 4B17A 2PXXA 2F8LA 3PFGA 4EKIA 5DRYA 3FTEA 3NTVA 1P39A 1WG8A 4RV9A 2I7CA 2PV0A 3IV6A 5E9QA 1XCJA 3GRUA 1B42A 3SMQA 3TKAA 2EX4A 4RTOA 1RI5A 1YF3A 2JH9A 5EC8A 1V39A 2Q41A 4O29A 3T7RA 2PWYA 3KU1A 1O9GA 3DXZA 5JR3A 5K09A 4KDRA 5EQJB 1XTPA 5DM0A 4EKGA 4C07A 2ESRA 1RJFA 2OB2A 2O57A 3DMHA 5K0LA 3UJAA 3UA3A 4DA4A 2C7PA 1N7IA 2IH4A 1PJZA 3ELDA 1T43A 1X1CA 2ZW9A 1G60A 4E31A 1SUSA 1JSZA 3S68A 2QM3A 2AS0A 3DMFA 4PYLA 5E1DA 3MERA 1JG3A 4YUWA 3A7EA 3P2EA 1X1DA 1JG1A 4HGYA 4X1OA 2DULA 5CUQA 2NXJA 2UYCA 4E2YA 5HIKA 3EVEA 3PVCA 2PXCA 4HH4A 3EVZA 4YMGA 5E1MA 2P7HA 4F85A 1NW7A 1VP3A 5LQRA 3CKKA 1YZ3A 5LSAA 3CCFA 5K0EA 1L9KA 2AOUB 4L7VA 3DOUA 3TPZA 2QRVA 4CKBA 4RTRA 2WA1A 2V74B 1YUBA 1FP1D 2PSSA 3LSTA 5EG5A 5C9ZA 5ICEA 2ZIGA 4RTSA 5P8WA 4DKJA 3PX2A 4LECA 2H00A 3NW9A 2FHPA 2O0LA 1Q0TA 2XVMA 4Y2HA 5EHIA 4DZRA 5KQRA 4WXHA 3BT7A 3P2KA 4FT4A 5FTWA 4MIKA 2ZIEA 4BP3A 4C06A 4RTJA 3EMBA 3H2BA 2JG3A 5DRTA 3TM4A 2ZVJA 1EJ6A 3FTDA 4MWZA 2BR4A 2GB4A 4PYOA 5FWDA 2PBFA 3VC2A 4OQDA 5CD1A 3GO4A 1IY9A 2VS1A 3O7WA 3KQWA 2I62A 4ZTBA 5B1SA 3TMAA 1XDZA 1JQ3A 1XVAA 2B2CA 2ZLBA 5K0CA 3OE5A 4KIGA 3RW9A 4FP9A 3I58A 4X61A 5FA5A 1XJ5A 3FUUA 1QAQA 3OFKA 1WZNA 5HFJA 3SXJA 1NBHA 3NJRA 3UJ9A 3O31A 5FHRA 2ZIFA 4LG1A 4P7GA 5HOQA 3BKXA 5FCDA 2YUIA 4PYNA 2PT9A 3E05A 2BR3A 3LECA 2ORED 4ISCA 2OBFA 4F84A 3KPVA 4A6EA 4GEKA 2IPXA 2YXEA 2WA2A 2JHCA 3FYCA 4P7JA 3ELWA 3M33A 4GOOD 4RTMA 2UZ4A 1I4WA 5CM2Z 5EPEA 2OZVA 4Y30A 4PYJA 2AVDA 5FUBA 3E8SA 4ER6A 3DTNA 2ZBQA 3FPEA 1P1BA 2CMHA 3B3GA 1PRYA 1I9GA 4RWZA 3D2LA 3MTEA 4YUXA 2AN4A 4GOMD 4GQBA 1X1AA 4KW7A 1KYWA 1NW3A 4ER3A 1KHHA 4HG2A 4E2XA 1G38A 4GOND 4A6DA 3QV2A 5CCBA 4GOLD 4POOA 3HNRA 5BP7A 4P58A 4PYKA 5EHGA 2ZULA 4V0QA 2IFTA 2IBTA 3CJQA 5FQNA 2CL5A 1KR5A 2H1RA 3LPMA 4IWNA 5ICGA 2FYTA 3TOSA 3I53A 4HC4A 4HSGA 4RYLA 1RJGA 2PX5A 4IV0A 5KQSA 4EQZA 3HTXA 3G2OA 1XXLA 2VDVE 2ERCA 2PJDA 5ICFA 2PGXA 2O05A 1NKVA 1Y8CA 2YTZA 2OY0A 5C0OE 3RIEA 3TLJA 3VYWA 4G56A 5LR6A 5GINE 2HTEA 3UBTA 1EQAA 3BWYA 3DULA 4RVDA 1QANA 4QTUB 5EVJA 3TFWA 4F86A 1X19A 1N7JA 3EMDA 2P35A 3G7UA 3LGAA 4GUAA 1JG2A 2HV9A 1EG2A 2NP7A 2UYQA 4YUZA 4E2ZA 2I9KA 3M6UA 3GWZA 4WVLA 3C3PA 1Z3CA 3DUWA 4OX9Y 5CVUA 2ZBRA 3EVGA 2ZWVA 3RODA 3P8ZA 3A25A 1JQEA 4R6WA 1JQDA 5E2BA 3HCFA 1VIDA 4HTFA 4X41A 4BY9E 2XVAA 2OO3A 1R74A 5DX0A 3GXOA 3X0DA 2IDJA 1AQIA 4XCXA 1NW6A 1VL5A 3IHTA 3G2PA 4EVIA 5HILA 4X60A 2VDWA 3UZUA 1R00A 3HVKA 4HRAA 3AJDA 2P40A 3BGDA 3DLIA 3GRYA 4OBXA 3ME5A 1MJFA 2N47A 3UWPA 3MCZA 2NNWB 3ER9A 4QPPA 1ZHFA 2H11A 2Z6UA 3FRHA 2B9EA 5K0GA 4V0RA 3OPNA 1BOOA 3DR5A 2BR5A 1TPYA 2YVLA 3THRA 2AVNA 5E9JA 3C6KA 2C7QA 3EVBA 1RI2A 3EPPA 3BXOA 4QVKA 3BWMA 5DXAA 5K8VA 4FT2A 5K0FA 2UYOA 3NDJA 5FWAA 3PB3A 2ZZKA 2OB1A 4QTTB 1I1NA 4EK9A 2P41A 3PTAA 1D2HA 1L1EA 4YMHA 1WY7A 3FPFA 2O07A 2FCAA 5DTMA 1AV6A 3SX0A 1F38A 4XUCA 3AY0A 3DXXA 2OPBA 2AZTA 3MTIA 3GRVA 1RI3A 5HIMA 4EMSA 2FK7A 1R18A 3REOA 1H1DA 5U4XA 4AZSA 2Z6AA 3BWBA 3P9KA 1FJXA 3AWIA 3B3JA 3CBGA 5EZSA 3GRRA 4H0NA 3JWIA 3TRKA 1KPGA 2ZFUA 2P3LA 4QQKA 5KS2A 3R0QA 5KYGA 3DLCA 3E23A 4K6MA 3HCAA 3LX6A 3OFJA 5FADA 2VP3A 2LD4A 4RTKA 1G6Q1 4P7KA 1BC5A 3NWBA 4ER0A 1KPHA 1NBIA 2XYQA 2K4MA 3KPYA 2G70A 1YFJA 4CWAA 1L3CA 1MHTA 3NWEA 3TM5A 2JHPA 3BGIA 3EGIA 2HWKA 5DWQA 2HNKA 4C04A 5CVJA 1NW5A 3IEIA 3MB5A 4MTLA 2B78A 2FRXA 3FPJA 3B7PA 5E8RA 1EAMA 8MHTA 1DL5A 3FYDA 1R6AA 5K0NA 3HA7A 4E30A 1YZHA 4YUYA 1KPIA 5EOVA 3T0IA 5IKMA 2YX1A 4AZWA 5ICCA 1UIRA 5CCXA 4KIFA 2ZWAA 3CC8A 3LCUA 9MHTA 1HNNA 3MCTA 3NVMB 4CKCA 4E2WA 3IYLW 3EVCA 1YFLA 3L8DA 1VP9A 2GA9A 1RI4A 4AZVA 5EEHA 1SKMA 3AXTA 4DM3A 2IGTA 4OQEA 4DMGA 3KR9A 3B89A 1QZZA 1EIZA 2PY6A 1RJDA 2PVCA 3FUWA 1G8AA 3QOWA 1DUSA 1YB2A 3GDHA 3U81A 1IXKA 1R8XA 4CTJA 2HR1A 3C0KA 1ZGJA 2BM9A 2PXAA 3KR2A 5EKUA 3R9XB 3CJRA 3FTCA 4R05A 3CJTA 2EG5A 3A7DA 3HCCA 4PYIA 3SR4A 3EVAA 1G8SA 3GCZA 3K6RA 3LCVB 2PX4A 4RTLA 1BKYA 1JTFA 3HCEA 3OZRA 1RJEA 3I64A 4M36A 3I9FA 2IP2A 3QOXA 5GIPE 1L3IA 2NXNA 2GS9A 3HCBA 4MHTA 4YUVA 3Q87B 4X63A 2GH1A 2ONYA 2AR0A 3FZGA 4R8SA 4PNEA 3GRZA 5FULA 3GIWA 5DX8A 2AN5A 3EEYA 3UJ6A 3JWJA 1UWVA 4PONA 5CVEA 10MHA 5H02A 1QAMA 2QRVB 2ZZNA 5DXJA 2JHAA 1JR4A 3JWGA 3KQPA 5DTQA 1SVUA 3HVIA 1TW2A 3LL7A 3OU7A 4QDJA 3FUVA 4M7RA 4R8RA 5CVDA 1KYZA 2GLUA 3LKZA 3UJDA 2C7OA 2AOXA 4JXJA 3HP7A 5C1IA 1AQJA 1NT2A 2NYUA 2PX2A 2ZTHA 2NXCA 4M37A 5LQAA 4PINA 3KPUA 3KQTA 3MGGA 3P2IA 2DPMA 3HM2A 4BLWA 4OBWA 2ZZMA 1G55A 2E5WA 5EZQA 3DP7A 3R3HA 2CKDA 2EJUA 3T7TA 1NV9A 3UJ7A 2ZBPA 3VC1A 5CVVA 2ONZA 4PGGA 5EMJA 4CKEA 5E1BA 4GBED 2BM8A 3ERCA 1RI1A 3FTFA 3G2MA 1JTEA 5K0BA 2HMYB 3G8AA 3ER8A 3DMGA 1ZGAA 4ER7A 5K03A 1VBFA 4BLVA 4YV1A 4E33A 3OZSA 2CWWA 5GM1A 3WSTA 2UYHA 4OA8A 4DQ0A 3TQSA 2A14A 2P8JA 1NE2A 4QDKA 3FUTA 3LBFA 5D1NA 3OZTA 3NMUF 1KP9A 4DF3A 4PIMA 2P3OA 4AX8A 4PCAA 4AUKA 4CXMA 4E32A 3FPHA 1JG4A 3FUXA 3M70A 5DT2A 1JSXA 2QE6A 5DM1A 3TKYA 3PFHA 2G72A 5DSTA 5BXYA 1D2GA 3P97A 2PKWA 1U2ZA 3ELUA 1VPTA 3EGEA 3GNLA 4DCGA 5G02A 3KR1A 5E1OA 5GOZA 1M6YA 2Y1XA 2Y1WA 1D2CA 3AXSA 3MAGA 4FR0A 5CIYA 5E9WA 4UOEA 4FGZA 3M4XA 2YR0A 4KDCA 5DM2A 2P1DA 3F4KA 1IM8A 1NW8A 2PT6A 5HIJA 2WK1A 2OYRA 4ER5A 3LDUA 3T7SA 3G5TA 5T67A 2AOWA 5EMMA 5LQUA 5KVAA 4RX1A 5T6BA 5BW5A 4RSRA 4IKPA 5F2NA 1WXXA 3B3FA 2G1PA 1FP2A 3CVOA 3KQQA 3KQSA 4RVFA 3LDGA 3V97A 2IH5A 3M6WA 3BWCA 2JJQA 4R6XA 3SSNA 2IIPA 4M38A 4ATNA 3ELYA 3GU3A 3ID6C 4MQ4A 5HEKA 2P3QA 4XUDA 3HVHA 3OE4A 3JWHA 4PGHA 1EJ0A 3BZBA 4GC5A 4KWCA 3P9CA 3GJYA 1Q0SA 2V7EA 2QYOA 2YQZA 2EJTA 3HVJA 3Q7EA 4AZTA 5LQNA 1FBNA 2CMGA 2R3SA 4YV0A 2EFJA 2IH2A 5DM4A 5EGSA 3G2QA 5FQOA 1XDSA 1INLA 1R8YA 2QY6A 2IBSA 2B3TA 3MHTA 3KPJA 3A26A 5GWXA 5LQCA 5MHTA 4QVGA 4IV8A 1SQFA 2GPYA 1OR8A 2G71A 3KHKA 3DXYA 3P71T 5HIIA 4PCLA 3HEMA 4C05A 5DX1A 5IH3A 3KQOA 4P7FA 5GIOE 3BGVA 4PYQA 3V8VA 1BHJA 1VLMA 3NVKI 1WS6A 4PIPA 1ZG3A 3UFBA 3E7PA 2XYVA 4NECA 2KW5A 3NDIA 2YXDA 3R24A 2NP6A 4YV2A 5EKXA 3ANXA 2P7IA 1UFKA 2B25A 4FSDA 5EIWA 3I5UA 2VDUE 3KR0A 1XCLA 2OXTA 2PX8A 3UJCA 4DCMA 1O9HA 5DSXA 1KXZA 4XUEA 1M6EX 4KRGA 3C6MA 1VQ1A 3VSEA 3OU2A 5F2OA 2O06A 4GF5A 3K0BA 1P91A 4FSXA 4LWPA 4C03A 2G8NA 3A4TA 3A27A 3P9IA 3PX3A 3BKWA
chains in the Genus database with same CATH superfamily
1PGOA 3VGVA 3MHYA 4BP1A 3GFZA 1SUQB 2ZS8A 5B30A 4GSYA 5KMGB 2JVJA 3LC2O 1KI6B 1HDYA 4I3HA 3TAQA 4YAFA 4KAFA 2R6HA 3WDSA 3GD7A 1J6UA 4MQBA 4L5CA 2XO6A 2PGAA 2V50A 2PGLA 2HMUA 2OCIA 1AUXA 3C3YA 3PDIB 3TJ8A 1T9DA 1ES9A 3OJ0A 1C1CB 1YAHA 3H1BA 3N6XA 4AXIA 2Y92A 4HTFB 3GLIE 2DIUA 3H83A 1NTRA 1RQ0A 1GSOA 1RAAA 4I1UA 3JQGB 1PNOA 2QN8A 3RIMA 4HDHA 5BWNA 5F7OA 4RBVA 4D42A 1MENA 5DM0A 1LLCA 4FUQA 5BWCA 1QIMA 3COPA 2DYAA 4FTWA 2E5HA 5GAEI 2QM3A 2IY7A 2QDKA 3CIFA 4LV8B 5KT4A 3VVUA 4JKIA 3WFIA 1RYZA 1EJ2A 1IKWA 3G0CA 1W46A 2OM6A 2MSCB 4LYJA 1VQMS 1O97C 2AQHA 3TQQA 2A2DA 3KK1A 2NACA 2OESA 4Y0FA 3G9QA 3DMPA 3D3NA 4TXSA 5C3MA 3CF2A 2NZ4A 2E1MC 1XVAA 4U7FA 2P2NA 1KKGA 1Z29A 3OLQA 2KRRA 2ZIFA 1BE6A 1ND6A 2BR3A 2ZTMA 5KTYA 5DW0A 2ZH9A 3GIJA 1SZPA 4K9QA 4L16A 4KX3A 5LMNB 1JRLA 3FRJA 2QVYX 2JL1A 2Q1XA 5HDBB 1HETA 3D2LA 1IU9A 2OSBA 3CRMA 4RV4A 2VP5A 2J9GA 3H1GA 2FE4A 1KETA 1PD1A 3BE5A 1DBSA 4MPJA 3SYRA 5FOTA 1JHRA 3KO8A 1YCDA 4EYKA 3HXTA 3UMYA 4O3FA 4D8UA 3QK7A 2E4AA 4LHVA 4ME6A 1SH0A 2B30A 2OWDA 1H4QA 1YL6A 4OI3A 3TZHA 3K5WA 3UPTA 2JFYA 1MMFB 2BFCB 2LV8A 3QVTA 3O6VA 4KHZA 1E6VB 1ACMA 1L4KA 3EVGA 3PUHA 4CMIA 3A25A 3IQDB 1OZGA 2OVFA 3E9CA 4WZAE 4JI0C 1E0JA 2XCPA 4YR0A 4M98A 1N1EA 2XYGB 4FFLA 5K45A 2H11A 1CYDA 3IT3A 4G0MA 5DNWA 4U2FA 4J0KA 1GPMA 3OF3A 3ZHBA 3AF2A 4D3GA 5CPBA 1T2EA 1TMJA 1AZSB 1CDEA 4BTEA 4MGHA 5ER9A 1P80A 4OX8A 5LZ4A 5F41A 1FDSA 2AJCA 3O2EA 2J5KA 4OZ5A 1XA4A 3W2VB 2G7MC 5AH0A 2XZDA 4GXQA 3E1GA 2H2HA 4TLRA 4BRWA 1KSPA 1NVMB 2YWGA 3Q5DA 5F5NA 3D0GE 2I8EA 1WTBA 3VNUA 1HT3A 2KX7A 3QYJA 3U7GA 1UIRA 1ZL0A 5DQIA 2DFKB 3GIMA 4W9RA 5HQ8A 3KLEA 3HUUA 2B4YA 2JZOA 2W6MA 1O89A 3AKEA 1WH9A 2J9ZB 4OQEA 5COAA 1U48A 1E7SA 4G5FA 3E0XA 2QLFA 2IYPA 2OD6A 1LPNA 4JV2A 1XE3A 4Q7JB 4MIYA 4CF5A 1YRTA 4GC7A 2VHJA 1SIZA 3B53X 4ID5B 1FFGA 1ZPDA 4OYAA 1S59A 3INTA 3CDAA 4A8YA 2IC3B 1C1DB 3G9TA 2QLBB 1W5EA 5IABA 5LT5A 3UWMA 1DLIA 2D3OR 1SVLA 4RH1A 2ZSEA 2E2WA 3FEZA 2DNQA 1C14A 4PGGA 1FFXB 5IWAC 5KNBH 2RBEA 3A2LA 3RR2A 3WG9A 5IN5A 1OGJA 4IH6A 1CG2A 4JK3A 2ZPUA 3NMUF 1EX8A 2R8IA 2AX0A 5DM1A 4ELTA 2HWTA 4RZ2A 4RSHA 4NBUA 1VQSA 1RKVA 3PIOQ 1Z5PA 3AODA 1ST3A 4EG5A 1KC8T 5IDQA 2BMVA 3KOAA 1RADA 3VR3A 4MYSA 3UG7A 3PG5A 5LA6B 1G0OA 1MQSA 1TL7C 4JDPA 1DRJA 1G1MA 3AU8A 3BWCA 4QPXA 4F3QA 1DRWA 3KSRA 4FZ5A 3E01B 3ZH2A 1W5FA 3JPWA 1TO6A 4CKWA 4BO0A 2EAUA 1J1ZA 2G8LA 4QBKA 3BV8A 3TARA 3QTTA 1TRKA 4RBUA 2XOKA 4NECA 2V67A 2IVYA 1ZQ1A 3QZUA 4YI5A 3EVTA 1U0TA 4UE3S 4EQ6A 3G8CA 3QEAZ 1DJ0A 3LANA 4GZLA 1XWFA 3TOVA 1QP0A 1FVHA 2NN3C 4NAVA 3LXMA 4ENRA 2X2OA 1DY3A 5JMWA 3DDWA 3V8NA 4ISBA 4COKA 1ESDA 3GJ3A 4ECTA 3VKHA 2GZDA 1Z73A 4MR7B 2RGNC 4I1SA 3UJBA 4F91B 1UJ6A 4PZZA 1VI2A 3AUAA 4ALNA 1Z22A 5E3CA 2VKZG 1EK2A 2MYPA 4MV9A 1NRXA 3DM5A 1N2SA 2I99A 4E7PA 2CY0A 2ZT6A 3ZHQA 3EGDB 1RTZA 1WW3A 5EWGA 2ZH4A 1GMWA 5EMKA 4A8MP 4GKBA 1PFQA 2ODEA 4FFSA 4Y9TA 5B1YA 3HR7A 1NULA 1WXDA 4ZIRB 5TMBA 3ZNQA 3CE8A 1HNVA 3GH1A 1KFJB 3INNA 2OPRA 4R2XA 3WVNA 4M9ZA 3WYBA 1EP4A 1SB9A 3DQQA 4BO2A 4ENOA 1YITS 4AYTA 4RFSB 3EGZA 2W25A 1KTVA 1X1CA 1G60A 2H3EB 1CYEA 2HBRB 2FHJD 1IN5A 1UVKA 4RE5A 5KQLA 4MO9A 2CYBA 4OL0A 1DE0A 4N1AA 3T4EA 5JH7B 1A82A 3WX8A 4Q1FA 1M2FA 3RBAA 4PXAA 3DAHA 1XMVA 2LQ5A 3OEWA 2EFYA 4O1MA 3UB2A 1REQB 2RGEA 4ANFA 1E9CA 4V0LA 1DPGA 1U1EA 1M33A 3VHLB 2BFDB 1NFRA 3H2TA 3GRCA 1DHMA 5F4ZA 4XYBA 3HDGA 4NRDA 2MZJA 1PRYA 2J9DE 4QYSA 1UBUS 1E18A 1X1AA 2Q6OA 4C7JA 5IK2A 3ZGZA 2V7VA 3BFXA 3RRFA 4XVRA 3A36A 2I55A 2HCRA 4J4TA 2I6XA 5D3GA 3T61A 2G04A 1M2OA 3PXEA 4EMTA 2GNKA 1YRQA 4Q7KA 1QR2A 1CZLA 5B5SA 2RK3A 2XJ9A 3T3FA 4R8UB 5AJUA 1I33A 4HWSA 4P32A 4B4UA 3P26A 3CF5Q 3PA6A 3SKVA 2CPYA 3K5HA 4BIMA 4O5AA 3CR8A 3HGQA 3NOOA 2HHVA 3TOCA 2TMKA 4ZAXA 2IJRA 1E2KA 1K4MA 2VATA 3K0AB 1JBEA 1JMYA 1DTWB 1TUEA 2CVZA 4MVYA 2COLA 1VJQA 3LX5A 1NOKA 4DQUA 1CEYA 4YJHA 3LYLA 4X4SA 5JDCC 2JIRA 4QDXA 3OQBA 3OOHA 1U0EA 4NXMF 1FDRA 2W4IA 3EIUA 3ZEAA 2X76A 2ZNZA 5NLLA 4RNNA 2FLNA 2B4PA 5BSEA 4JH0A 2AYEA 1J21A 3MMBB 3GUZA 1X5OA 5JTUA 5AE1A 1NN0A 2GK6A 2V9PA 4QQKA 4C3KA 4F0HA 2OMKA 2Q6CA 2BRKA 4F5DA 4QPTA 3PW7A 4DLLA 3QWUA 4IIGA 3JQ7A 3NOGA 1K3UB 2DVMA 1PDOA 1VECA 3R1LA 1DLJA 3HFVA 4ES2A 4B4VA 2DJIA 1T9KA 1F2GA 1TO1E 2GASA 2O7RA 4IDNA 5LDGA 4OHYA 1WCXA 2QTCA 3Q7TA 3RVPA 2F3PA 1IQZA 3ISJA 2IQ5A 4A82A 4A8WA 2J46A 3MS7A 3C0KA 1VRUB 2VO1A 3RSZA 1LBEA 1L4GA 1BKYA 2AE2A 4PBRA 3CU5A 5DGBA 3GLGE 2VIHA 4TLDA 3ETHA 4L22A 3KEOA 3RSOA 3LA8A 4F8YA 1QG4A 2EG9A 3IEMA 2D7JA 4WSOA 3KOYA 5CFNA 2WJVA 3G0HA 4OMFG 2P2LA 1MROB 2CLOB 4CIOA 2KLHA 3RS9A 4RPJA 4V3CA 2ZJOA 1P5FA 3G2MA 2OPLB 2AHOA 2OLWA 2YZMA 1T1SA 1U5AA 4NMHA 2JLWA 4EG0A 5FI3A 1KGDA 4PX3A 5IYZB 1K8AT 1MTOA 3M70A 4H3HB 3ENNA 2C4WA 4YMIA 1M5PC 2OV8A 1GNRA 1PZHA 3E2MA 1E6LA 4Y2SA 4X62B 1NF2A 3T7SA 4D56A 1KA9H 4JVMA 4CMAA 4JNCA 2ZJ6A 2JDIA 1SUQA 5ALXA 2CWKA 3EVMA 5EWMA 2AJFE 2B7BB 1KVUA 1X5PA 1N2CA 1YZGA 4WERA 2CLSA 5HEKA 1W1WA 3C8ZA 4Z7NB 3ZZ0A 1A8HA 2VT3A 4QGAA 3RT9A 1Q1QA 1FBNA 4MNTA 2NYHA 2A1UB 3ESDA 5SY4A 3BF7A 3AZQA 3LRTA 1JIUA 3A9TA 1AA6A 5EE1A 1IIBA 3C97A 3MF4A 4M8SA 5EIWA 1TV6A 1XCLA 1WDDA 4RR5A 5CFMA 3EY9A 4A6PA 2AFIA 2K3IA 1W87A 4QM6A 4B4WA 4YACA 1PE0A 2VICA 2Z6QA 4GMKA 1RAAB 3EGVA 1SM4A 3U3ZA 2JCYA 3KK3A 3V81B 1YZTA 5DBIA 4OHRA 2I2FA 2DNNA 3SYZA 4GPD1 3V1NA 2WB4A 1A77A 4Q9DA 2O3RA 3MTJA 4A2WA 3F2VA 4ZI7B 1H98A 4PTLA 3L0IB 3COYA 5B1EA 1EX9A 2EQBA 3D2AA 1MG5A 3DWEX 2KS6A 1R37A 3G13A 4Y67A 5LZ9A 2Q9BA 4F9TA 1T05B 4PLHA 5I7WA 1V3RA 3ZZUA 4I50A 2W2OP 1O94C 3R6GA 1HMVA 3AEUA 3C3JA 1AKMA 3IUNA 3QSYA 1Y8AA 5I9TA 4M5LA 5HLFB 3QIVA 1VYVA 4DA4A 3DDCA 4F3YA 2OXCA 3VOTA 4LA4A 1E3SA 2R7XA 1YS4A 5CB4F 3K1YA 2VJBA 3G5UA 3GEGA 4CEJB 3QGPA 3LW8A 3TQ1A 4PKDB 1KI9A 1KQGA 2NYVA 4WXHA 3WHIA 3TTWA 4BEVA 4QYMA 2KJQA 2VJPA 5A4JA 3PV8A 1QK5A 1T5LA 3L3CA 2XXJA 3N3AC 1S1CA 3S99A 5AHRA 2FFQA 1ULHA 2G1JA 3QGIA 2YHSA 4HVCA 1E77A 3PFWO 3OM0A 5A4AA 5HMYA 1US8A 2V7WA 1I1HA 2WSLA 1GLNA 4CM3A 1KU6A 3IOCA 3R5HA 4KQKA 4H4MA 2Y71A 4IDEA 4QG7A 2DPGA 3JPYA 4C4SA 4JV5C 2HFKA 2GJIA 1TGVA 2O5RA 3ZQ4A 4YP9A 3QSIA 2JARA 521PA 1FUKA 1XZHA 4X44A 2ZKUA 3NKFA 4KE5A 2AB0A 3J7TA 1K4YA 1SC4A 1JTVA 5AVTA 4LSGA 4NV1A 3OQHA 1BKSB 4QICA 4BL5A 4B3TB 5C32A 3CCUS 1QANA 1PJRA 5GAGU 2D00A 1G17A 2CEAA 2P5YA 3D28A 4NU6A 3MXTA 4RKYA 3EW7A 4D3DA 3ESXA 4MO2A 4OXQA 1N92A 3B54A 4W1SA 2HW3A 4CE6A 3LUYA 5A8RA 1UK6A 5FD8A 1K9SA 2C9YA 4N8DA 3STWA 1OXUA 2EGGA 1N2GA 5BXIA 3SDSA 2BRUA 4EFMA 3X1ZA 3R44A 1I1NA 1SOMA 4BAUA 3MPDA 4TS1A 3TF5A 3FFWA 1GR1A 5TNXA 4PICA 1EVJA 3GRRA 3V9AA 1HR0J 2HU5A 3L4BA 4DLUA 2OPSA 4RY2A 2V63A 3A0UA 3TDNA 1Y6FA 4C04A 2DFLA 3BB3A 3QVGB 2IZ1A 5ALYA 1XRLA 1SKRA 4IXWA 5DDPC 3Q3IA 1RKQA 1S7CA 2XWXA 1D5CA 4A27A 2NTNA 4ND3A 4IHJF 5DKFA 4ZREA 1RAEA 4F5EA 2CPXA 1LX7A 1KS2A 3I83A 5M7EA 5HZGA 1WY5A 1M5RA 2BYCA 4NXMJ 1YJWS 2VCYA 1NZJA 2IHBA 2VBIA 1I3CA 4NG5A 4DCPA 4LW8A 1GEHA 3DEJA 1KK1A 4PXYA 4XX1A 1FJEB 1XZJA 3DJYA 1CQPA 1QF7A 2E7GA 3IKLA 5CR9A 1NX9A 3RV3A 3M8YA 1I7SB 3R40A 2QRGA 1ZZNA 4FBGA 3DCJA 3GZJA 1FXWA 4CKEA 1OI4A 1XLTA 2MMYA 1V96A 1X7ZB 3F9IA 3FUTA 2VPQA 3QO9A 4U7DA 3B1KA 2O2YA 2Z8YM 3G5AA 3DLEA 3TKYA 4GLJA 1B6RA 1D4AA 1O96B 5JQWA 4MWEA 2J7WA 1GU7A 4HGPA 2QZZA 5J1PA 3NPMA 2JGIA 4IYJA 3RFCA 2H65A 4HMOA 3AF0A 1Z2EA 2AG8A 1J8DA 3T12A 4NPAA 1PL8A 3FDJA 3EPKA 3JWHA 3OHSX 5A6VA 5E4TA 2FJEB 3IE1A 4HL9A 4FHZA 2M88A 1SU7A 4P36A 5KREA 1UXJA 1Z37A 3FCCA 1JKFA 2GF9A 4UW9A 4JI7J 3BXFA 3NS7A 1CS4B 3A1UA 4ZARA 4H3VA 1H8HA 5L1LA 1ZHHA 1JI3A 2O66A 4LGCA 3I2KA 4TT3D 3ETOA 5FL7A 2VTVA 3A27A 4B9EA 3OXFA 3TR6A 3KOWA 4B82A 1SUFA 1C7ZA 2CZCA 2IP4A 3GLVA 2M3DA 3QU9A 1SL1A 3GU0A 2F63A 2AKWB 5L9XA 3EQZA 1WDWB 2RF2A 2ONCA 2GN6A 4O0IA 2BGRA 4BNLA 1DELA 2HA7A 3GV8B 1PQWA 1XMQF 3R5FA 1FPQA 1SCNE 5LKAA 3QWBA 5A0FA 2Y0BB 2EDCA 1HNZC 4PWDB 4P3XA 2J07A 4TWJA 4UM7A 2CYCA 2C2NA 4K2HA 3C3BA 4OPMA 3SBOA 4W5OA 1DXOA 5A05A 4KEAA 2P6MA 1ODFA 4B4OA 3WWOA 2XMMA 4HWGA 4Z0TA 5LYYA 2IUEA 2ESRA 3P0EA 2ZRJA 1M7HA 3BGLA 3CVXA 4FE4A 4P0PB 1PVDA 1YQEA 4KC5A 1AK1A 2BMAA 3TXYA 1FP4A 1YJ9S 4KLAA 4FYWA 3GMGA 5ED0A 1Y9EA 1RUSA 3X1DA 4XEHA 3K0CC 4RKWA 3R3WA 3Q83A 5JRZA 4DC1A 2OD9A 3FLEA 1HDZA 5E6UA 2VRCA 1DAGA 1V48A 2DMRA 3U39A 4A0QA 1QAXA 3P0FA 3IUPA 1KZYC 2IY5B 1DX4A 2VODA 1U8FO 5D3MA 2FZKB 4XWKA 3JB9k 1WC4A 3R5AA 1UKCA 2I6SA 3RWBA 1MMLA 3V8RA 1QE0A 1NQVA 1FUIA 1RXWA 2CKMA 2H1SA 2C2RA 3ONDA 4V0QA 2IPOB 1YJ7A 4HC4A 4RYLA 4ON9A 1NQXA 5L53A 16PKA 1UK9A 1EDEA 1VLOA 2GJ8A 3P2OA 1EWTA 1KBQA 1F5AA 4ZITA 5KFLA 2PR7A 3MSCA 4OYBA 1QRDA 1VIDA 2G2OA 2VAXA 3GLKA 3AILA 1U49A 1Y9JA 3QLHA 4UDYX 1HWYA 4RA6B 5HRAA 1MFPA 2JEZA 2GRUA 3PIIA 2AF3C 4DN0A 4B44A 1CR0A 1TRHA 2YX4A 3DI6B 1MB2A 3K58A 4WN3A 1XQIA 2X1HA 5A4KA 1QBGA 1BDMA 4I1YA 4WY2A 2ATWA 5IC6B 5HTOA 1Y7TA 1N9GB 4BPRA 3T1YF 1M73E 2FQWA 2AA3A 2QG6A 2JHPA 4JP2A 2PRSA 4IDBA 4RJTA 2E89A 5AUOB 2KYRA 2MR5A 1W7AA 3VOAA 1JA9A 5J4KA 4ND6A 4ZHQA 3H5TA 2ZB3A 2ZCUA 1PFWA 3CT9A 5K8UA 1HMVB 3QOFA 3QLUA 4KZPA 2W9CA 4YCAA 4KPCA 3BK1A 1R0YA 3DMTA 1I10A 1R5BA 4DMKA 4G5YA 4B0PA 1CULB 3OM8A 1YRBA 4OJMX 3P2JA 5JXSA 3R9XB 4TRMA 4CLEA 3ONQA 1Y81A 4QX6A 2ZT7A 4LQLA 1KI3A 3BGFA 1S0OA 3V33A 2P2QA 1JXAA 5DX8A 3EEYA 3TX2A 1KDOA 1Y1RA 1YCGA 3O94A 4MCAA 4HLUA 1XQWA 5KWVA 4B3SJ 4OHXA 2FJDB 3X44A 3P2IA 3I5YA 4A5OA 2VONA 3T7TA 4OH1A 4K50A 2YBVA 4M7OA 3W2EA 3QUQA 1O8BA 4F06A 1G8GA 3RB6A 1EQUA 2IXAA 1KZGB 4WU3A 1HWKA 5IEJA 3U4QA 5CYFA 2UVRA 4WDQA 3MFHA 3S8YA 3FEYB 1AKRA 2IPAB 3P97A 2VF5X 5CH8A 3MM7A 4HJRA 3SAJA 4NATA 4RNFA 2PUAA 4C6RA 4PCUA 1RHQA 3SZGA 3LQRA 2FEAA 2Q5LA 3IBTA 1HTWA 4L4YA 3ZV3A 3NGUA 1XIQA 3GU3A 3NS5A 2W0MA 3ETLA 4BVHA 1EIWA 4PXCA 2Q8QA 2QYCA 4QXPA 2D1TA 3BS9A 1LC3A 2F00A 2QSUA 2QL5A 1KQFB 4TKTA 1NJWA 4WK2B 1CLUA 4RF3A 1NI3A 3OESA 4ZO7A 4IIVA 4YCDA 2OCBA 2C92A 2PS9A 3PKZA 2WYWA 4JJZA 3U7RA 5JXIA 1ZGBA 4CI0B 3ZWVA 2WSFC 2R4TA 4MT1A 2EZ4A 1SUBA 4JDUA 3FYHA 1GUFA 2YNGB 1R1DA 1ORVA 1E59A 1VL0A 2VSFA 3R6GB 2PMFA 4DV1F 2JEJA 3R9IA 1N6OA 1RYBA 1UJ4A 3D7RA 2FW1A 2HJ9A 2P5UA 2MJUA 3CCQS 1T5TA 1ZSVA 3B4DA 1ZJYA 4FFBB 1P5RA 5LJLA 3NX4A 2WU8A 4FYPA 3HRIA 1E3IA 3G9UA 5EUQB 1QYVA 3A9CA 1S5ZA 4UD6A 2WVHA 1FD8A 3LPNA 4PLYA 4LZPA 1ZRNA 1NVGA 5F2EA 2PL3A 4AF8A 2L0XA 1JLQA 5JJCA 1HE2A 2WIAA 3LY5A 4RV9A 1NG1A 3SJUA 1RI5A 3UMGA 3T7RA 5KFNA 3DMHA 4ZCPA 2OEPA 2LXUA 1TMOA 2GBPA 3TK1A 1E3JA 1J8YF 4ZP9A 3K9QO 2HNYB 3GGGA 3KVRA 2DULA 4JCCA 2EC0A 3DAFA 3KE8A 4CFYA 5JBIA 2B8NA 2FQXA 1L1FA 2WJAA 2R00C 3G1TA 1EVLA 3U27A 1CQJA 1VRCA 3FQKA 3ZU4A 4E1BA 2QJ3A 2UZ3A 4PQYA 4DXDA 4YXWA 3VI4B 3ND9A 1DAOA 1SC4B 3ENWA 2EFDB 2E5JA 3G7SA 2RHQB 5ENVA 3EIQA 1X7WA 2JAUA 3BKXA 2JLQA 5TVGA 3HLTA 3CR3C 4UEWA 3L9XA 3FYCA 2WKSA 3HR4A 4FIZA 2BQUA 4LKOA 1USWA 3K96A 4I56A 1SZDA 4ED6A 2E44A 1ZRSA 3I9ZA 3V34A 1V5WA 5JI2E 3HE3A 3H3FA 4NQZA 5T5QA 3EGNA 3EFHA 3W6ZA 2B43A 5F52A 4XSHA 2APOA 3IPLA 3FW1A 3VKVA 3W04A 3T6JA 2NV6A 1X9GA 1O58A 3DBLA 4QOEA 3VAJA 3GCWA 4LBYA 5LBIA 3HYCA 4ECUA 4PLZA 4BY9E 1R74A 3VR5A 2YKNA 2WWIA 3KXWA 4A8KA 3WY9A 3SNHA 2ZAYA 4LFCC 1IBSA 1OHHD 4DSZA 3M2UA 2DBQA 5K0GA 4LJSA 2AQ4A 3GYBA 5B1DA 3BDEA 4IG4A 2XPCA 3HJGA 3VZRA 3RFUA 4U7HA 5DHUA 3DWFA 3AVUA 3WYNA 2QQ0A 4JSYA 1I6KA 4PZDA 2D1RA 2H9AA 2PTHA 3F46A 2BELA 1QWIA 1FWPA 1ENZA 2XUZA 1LWNA 5LQMA 3Q6NA 4FHDA 2JEFA 3B6BA 3EUWA 3MB5A 1PWHA 4O4HA 4J16C 1MFZA 4DVJA 1YBUA 4DSJA 5AUQA 1LRKA 5B4VA 1RGVA 1IJBA 3D2WA 3EAFA 2PE8A 1MU0A 2FKNA 3AERB 5IC4B 1G5TA 1IXKA 1QG6A 1OA1A 2CD7A 3GR0A 3KK0A 4FI3C 2FWPA 1B8UA 4KBFA 5JYEA 4R5PA 4NE7A 3P0IA 1ITPA 4C3MA 4YRNA 2O2GA 3OZAA 3QOXA 1OYYA 4DDKA 2CG4A 3JQ7B 2NVOA 5GADU 4DV2B 1D2AA 2CYYA 3DDSA 4RW9A 4YJ2A 2ATEA 3HP7A 4AROA 2YVAA 4GBMA 4KQ6A 1TJPB 1UQRA 2IIVA 3LE8A 3MEEB 4LSZA 1QRTA 5AHOA 2QMYA 1VK8A 4L2IA 2IYLD 4L7IA 1RWKA 1RCUA 3O03A 3P9SA 2VPZB 3HDVA 3NCQA 1J9GA 1FKAF 5JADA 3L40A 3VU8A 1BX1A 5FUWA 5BSGA 1JQBA 2HK7A 1EX6A 2CMDA 1DUIA 5AJ3F 5GADl 4TXJA 3VOSA 4ZHSA 5KSWB 2O20A 4Y2AA 2GCNA 1RAHB 4KBGA 3GDWA 3Q11A 2OSVA 3I6YA 4E4YA 5HI7A 2GIFA 3QKIA 3CRZA 3P9CA 5F8JA 1A72A 3STTA 1TU0A 4W8OA 5L4LA 2QVCA 3QH4A 3W8PA 2AWZA 1TVRA 2I4IA 4FLEA 4UFPA 2RCNA 1BH6A 4R0JA 5KFGA 4IRUB 1LI7A 1JEYB 2OBYA 1QP4A 2R6ZA 5D2CA 5J2QA 3EZ7A 4F2DA 1KIAA 2GGSA 3DCAA 4CTAB 2AOVA 4WEOA 3TL3A 1QAOA 3LDFA 5EXEA 4EY7A 2FPOA 4Q0MA 5CAAA 4RW7B 1LSUA 2FPMA 3GCXP 3C16C 3R0XA 5IAOA 1PR2A 3E9RA 4FE7A 4QWEA 3VR3D 5TVKA 3AJ8A 3I2FA 5HBMA 1NVWQ 2WYVA 2GNPA 4URZR 1S49A 2Q5FA 4LJRA 1H69A 1UVJA 1JWLA 1HGXA 1DT3A 3C7KA 2GD1O 4J9QA 4M6WB 4RW8A 2VPWB 4V02A 1E0AA 2YZ2A 3L8MA 5THKA 3FOCA 5K4HA 3L6UA 2JNJA 4IOLA 2JK0A 3NGTA 4AY4A 3PNKA 3D6TB 2DUJA 3CPHA 4N5IX 2I22A 4DY6A 1H2XA 2Y3IA 3NC4A 1ZCZA 3M83A 1OV6A 4ILKA 3CV3A 4ZEXA 3TQOA 3FSJX 4PPQA 4XB1A 4C06A 4MYDA 3KL2A 1K98A 2Y8EA 3HUTA 3QX3A 1TZBA 4LVOA 4EY5A 4R68A 2X15A 1XNRB 1RT6B 2HQCA 1WVGA 3GY0A 5HF6A 4ZQBA 3VVCA 3FBBA 2BEVB 2NSJA 3J80Y 3VTZA 1S6PB 2D1YA 1R6DA 1KBOA 4B3MJ 4X4OA 5EHZA 3OJFA 4WKGA 1F8UA 4PWWA 4DNOA 2DR9A 2A1TR 4DUZJ 5CB4B 4F0KA 2GWHA 3B6ZA 3TJRA 1KHHA 4R5HA 1L9XA 4W6ZA 4FF2A 1TQ2A 4JENA 1CJTC 5AUPB 3AG6A 4GP7A 1NK9A 2HSGA 3HYLA 5HANA 5KQSA 3UB3A 3I9MA 1ZK3A 5GINE 1U2DA 2PD4A 4ZHQF 1N7JA 3GLTA 5CNJA 2TS1A 4MWBA 5E2IA 1AJEA 5BR8J 1FJGJ 4ALLA 2X0FA 2GD2A 3C1UA 2G1DA 4JMPA 2R3VA 4DANA 3DTVD 4FR5A 1UOOA 2CE2X 2C9ZA 4LX0A 1O03A 2F9FA 4YRPA 1UVIA 1H85A 3DVSX 3WA7A 3NAGA 5C5CA 2HCJB 3NIGB 4DUZC 2MSNA 2RIPA 1IVNA 1Y5IA 4TLCA 1RPTA 3FNGA 4MYCA 2REBA 3DLKB 2GMHA 4B7CA 3L6CA 4K2XA 4P80A 2A5FA 3TTTA 3KHHA 3LO5A 1STOA 1R8PA 1MORA 2F9MA 3RR8A 3S4YA 1XMJA 5FDLA 2VRBA 821PA 5CIWA 2PT7G 2L17A 1GZ4A 3DVAB 4JBGA 4QD3A 4B73A 4YOEA 4ETIA 5FADA 3LX6A 3DDKA 1IWPB 3NWBA 3EEBA 3ENKA 3WLMA 2G70A 3SF8B 1WEYA 5FKJA 1SELA 1Q77A 4ZN6A 3QJLA 1UVNA 2PUCA 2DXEA 4GZ3A 3UV7A 1E79D 1XYVA 2WZBA 2W2KA 3B6IA 4OGKA 4PFJA 1DTQA 9MHTA 4EW1A 4AAYA 2AMFA 3SYTA 2OBVA 5IZCC 3R27A 3WDOA 3H04A 1I7NA 2H9YA 3BA1A 1V8DA 1KY5A 4HNHA 4V0MA 2WSEC 2H48B 4F56A 2EG5A 4DTCA 2JD2A 2XY7A 3KXDA 5L38A 5DT9A 1WPGA 3C1AA 2POCA 3HU2A 1CY7A 5DXJA 1YJXA 4CQMB 2DHRA 3PVSA 5A3VA 3ZBQA 4NASA 2GLUA 5IP5A 4K7JA 5ITVA 4QODA 3MWDB 1WUKS 4R1OA 4LS3A 3AUJB 1KZHA 3ESZA 3ODPA 4ZYWA 2GXUA 3JVUA 1Y3JA 2R6R1 2QJTA 3KJIA 2I1VB 4REOA 3H5WA 1MROA 4LXGA 2J6TA 5SZKB 5BXYA 1NWCA 1XN9A 4DCUA 3D3KA 2XMKA 3MJVA 2UVDA 2GK7A 1JAYA 5ALJA 4RANA 3B9PA 3FKSA 3A4MA 3ZLUA 3ZYCA 4DBLC 3ANSA 5IWAJ 3DE6X 5EFZA 1IKVB 2YWRA 1TEZA 4FGSA 3FKBA 2DUNA 5JDCA 4CLWA 4AI6A 2QE7A 4YRDA 2AU0A 1SIWA 3GEBA 2FCRA 3ER6A 1FX1A 2QSJA 2KVIA 4R7GA 3ZV6A 4NLPA 5A5FA 3EIXA 4CKCB 3GHHA 3P3DA 5KNLA 1VL2A 2W4MA 2J76E 3MINB 1L1RA 4F04A 1FRLA 3QPDA 3PLRA 3RBDA 1R15A 2H65B 3ETGA 4Q7QA 2B9VA 4ARUA 1LJUA 1ZKDA 4KZKA 3VYUB 4IGAA 3L9ZA 2I8LA 3R6TA 4TQAA 3S2YA 4GBJA 4MVJF 4ZYLA 4ZVUB 2AFRA 2PZBA 3FWYA 4E46A 3N07A 3LCCA 3HCDA 4RD3A 4RHEA 5T7BA 4ETMA 5FX2A 1N7HA 1F4VA 2OP0A 4KVZA 1KY3A 4KQ2A 2V45A 1UC9A 3SIPA 8GPBA 2P02A 2VQEB 4DCOB 5T57A 3FPKA 3KQVA 1KP2A 1VGQA 4FYKA 3SV4A 4DLYA 3SKYA 4NMXA 2JAXA 2WOMA 3WMEA 4FDUA 4F4AA 2QYSA 3ISVA 3A2NA 1FDAA 4P38A 4RDIA 3WMXA 4R25A 2BGGA 2HTFA 1PJQA 3L8EA 1Y9AA 4BNWA 1BVRA 1NBMD 1PJ2A 3FMBA 3FN4A 3FHTA 1OS5A 3MMJA 1LTQA 1Q0TA 1H9CA 4HHEA 2AQ8A 4MA0A 1HNIA 4NEHB 5CLFA 3MM5B 2P2MA 5K0TA 1SXGA 3PL5A 2I2DA 1XK7A 5C46F 2P75A 5IZ4A 2YIMA 2LXNA 2J0XA 4LF9J 4QYXA 3NJRA 1J0CA 5LIRA 3SYNA 3K7RA 4HDKB 4RENA 2NUHA 2Q3DA 4E0DA 2YJZA 3LV8A 4TS3A 5AKHA 5ITHA 3NBZC 2RH8A 4IQFA 3WBZA 4LF1A 2PWBA 2VOOA 2QAGC 5TT0A 2BJHA 2YJGA 1Z68A 4OIMA 4YLGA 5LL6P 4DV0J 1RK8A 2R8OA 3FWZA 1VEHA 4D99A 4DV7J 5REQB 5JZMA 1N2EA 4M1MA 2FHSA 4FNAA 4AQDA 2OP1A 4PZAA 1XC9A 3II6X 4ZVEA 1L3VA 2HOQA 5K8CA 4O3NA 4ZO8A 5EJ2A 2H1IA 1C3VA 5K20A 5EMHA 3EDCA 4G0WA 1T6NA 4DV0F 1BS1A 4H4OB 5BRNA 2F67A 4X7RA 2DPXA 3J80U 4J9RA 4AKGA 1YZYA 1XRNA 3BMNB 1P9WA 4KPYA 3WOHA 4A48A 3H2GA 2HPAA 4G86A 4D4IA 2J8SA 3LH2S 3FJ1A 1Q1BA 7ABPA 1YRUA 1W4RA 5K8LA 2FVXA 3OZWA 1OPXA 4LR8A 2NSYA 4ER0A 4FKYA 3U4GA 1RMQA 1MD9A 2QOEA 1VLHA 2HNKA 4EKNB 2ZWPA 3TBFA 4KMSA 1UM8A 4YUYA 1TL7B 4NYMQ 4L4SA 2Q8PA 1D9DA 4MCIA 3FMFA 4DPLA 3TXAA 4N65A 3GSDA 4QECA 1I3LA 4MQUA 3HQ4O 3N2QA 4X6LA 2GCFA 3MD3A 1DBPA 1OZHA 4OM8A 3OZRA 3M4ZA 3DNCA 3GONA 1BGVA 3DXFA 1W2BR 5TGTA 2XQFA 1MW7A 4QT4A 3BN3A 5DO2A 3LTEA 4R3WA 1P0CA 2PT7A 4XGRA 3OT5A 1W4LA 3U3OA 1N0UA 3VC1A 2P0YA 1H0SA 3ZDAA 3INRA 1CZHA 2Y1JA 4PX2A 1RHJB 5HE8A 3QLHB 3IRUA 2VJNA 3W9IA 3TX8A 1J0BA 4WVFA 3N8DA 4I1OA 1VMAA 2HU2A 5KZMB 3BFJA 4NABA 2JHFA 4LUCA 3GG2A 2VUIB 4BLPA 4D9EA 5IQ6A 4Y3CA 1FKOA 1RHKB 3SXPA 2PT6A 4EABA 1H3FA 2QPTA 1ND5A 3JZIA 4DUGD 5KO2A 1O95D 4BWJA 3KMSA 4O4JA 3FPLA 3PNYA 2UZ1A 5M04A 4YV0A 4DBVO 1JDZA 2CJKA 3B3QA 3PD1A 4IAOA 2GPYA 3NOCA 2FZCB 1LPOA 2AFHE 4HPJB 4M1SA 1IDN1 1GRRA 1VQ8S 5DWVA 3LYUA 5C7LO 2VSNA 3L1HA 4FVTA 3IO3A 4ZZ3A 2G5CA 5HN0A 1MO2A 3E3XA 1R0KA 3GLQA 2J9RA 4AKTA 4USJC 1C41A 2PBRA 2OV4A 3QGHA 2BUCA 1FCJA 3VKUA 1SVSA 1NBAA 5EXTA 3L06A 4J75A 1PHRA 5EUBA 3W2WB 3EQ6A 3RS7A 3Q8UA 1G8MA 5CDTA 2A0KA 5FPSA 4LZAA 2KZFA 4S0ZA 3KK2B 2IV3A 1YNOA 1IQTA 5CH3A 5JNLA 2JX2A 3A6DA 4NH4A 4HO1X 5TDHA 3NV9A 3SC2B 4RAQA 4CMCA 3O92A 3MCUA 2XNQA 8ADHA 2B4TO 1JLFB 2MSWA 4JI8F 3LBYA 2TRSB 4ANCA 1CUSA 1JECA 4TRNA 2ODTX 4WOBA 3A6PC 2CAJA 4I7FB 1U8CB 5EI5A 1DAXA 5JEEA 1H6KX 1S6PA 3W5YA 1SXLA 1D1PA 4ZDKA 2X7XA 4WXMA 4MS3B 4A0HA 2HWXA 5G0RA 3PZRA 4KLCA 1WOMA 5KFTA 2IZ5A 2OGTA 1DJLA 2V8PA 1XEZA 5AUNB 1EETB 1YAJA 1LWFB 3GELA 3LWZA 2E9ZA 4E14A 2WICA 4M0DA 4RTSA 3GW8A 3GDOA 4WTYA 3JQQA 3PX2A 3PCOB 4P1ZA 1MO5A 2Q2OA 1GILA 1N1DA 4EITA 1QFJA 5T7LB 4EO4A 3VO2A 1JE0A 3GO4A 2RHHA 4DI6A 2VC1A 1EWKA 3OQ1A 4FYWB 3GWCA 2G0AA 4F4KA 4JITA 3IH5A 4RQUA 2HIYA 1Z5NA 4E13A 4V0SA 3KLNA 1DAMA 1RBMA 2KI5A 4C9BA 4M0MA 3NANA 3LQ2A 3MGBA 4TYYA 1OOEA 3LXXA 1XRAA 1KYWA 5BR1A 1GFWB 4Z4IA 3L4SO 3JYLA 2K7FA 3RPEA 2UP1A 2ZULA 3ZWQA 4PSVA 2E0GA 3GBVA 1TZJA 3IAXA 1PIWA 1SBYA 4MW7A 4QJVA 1B0PA 1XQYA 3KXPA 3JR3A 4OLBA 3Q8MA 2Y2VA 3HTXA 2Q6LA 2XLJA 5B6PA 2PGXA 5IVKA 2YWFA 1Z82A 3UMMA 3EDYA 3NM4A 4G1BA 1DEHA 3OKPA 1G6BA 3EG5A 2HN9A 2FR1A 5CVUA 1TMGE 1RKBA 4KGMA 4IDHA 3X0DA 2PSEA 3L7AA 3OOEA 1UFRA 5KFOA 3ME5A 5CT5A 3FPSA 4I2QA 4XARA 4QU8A 3EUEA 2W2KB 4G01B 4PLFA 2YVLA 4EHAA 1ZJWA 2FJBB 4NESA 1BQMA 2HO5A 3A32A 3ODGA 4TUYF 2O07A 4ZDWA 1FU4A 1BO6A 2C3UA 4JJKA 1E3QA 2G0JA 3VJKA 5IVHA 1KVSA 1U2GC 5LZ7A 1TL3B 3SI8A 1NP3A 3QJYA 3PO4A 3HP4A 2VDPB 4HAZA 1FTNA 1K92A 1SHTX 3S7RA 2NSCA 5LYJB 5BVHB 3P9QA 2F8MA 4YNBA 1EHIA 3MUMP 1QGYA 2O5CA 5KQPA 2I3BA 1FZQA 2DO4A 3NVMB 3VAHA 1N52B 1IVSA 2CZGA 3KLIA 3ZNPA 4QOTA 2ILZA 1QDUA 1E6WA 4NJMA 2DSTA 4QEKA 4HH0A 1CUAA 4CTJA 2FHJA 1B0VA 3I6PA 2PXAA 1LGYA 5ALGA 1VLAA 4G0QA 2XI2A 4DJJA 3JAMY 3KZVA 2Q0QA 3AVVA 4BGDA 3RAEC 2ZSAA 1BDIA 4HDGA 1XS3A 5FNVB 3I9OA 3ZE2B 1TCVA 4KYTA 4M5IA 1QONA 3A31A 4QDJA 4C7QA 2X5XA 1D4FA 1BLUA 1T03B 4TU9A 4TTVA 5DIFA 3MB8A 1ECPA 3W78A 5EZQA 3SOPA 3CVWA 3W8FA 1AU9A 4L0MA 4JXZA 4AD8A 1V26A 1ZMTA 1IJEB 5EZYB 5LSRA 4Q9JA 1G5RA 3SI7A 5A4DA 5I7OA 2W7PA 1K6MA 3GA0A 3IR7A 5A7GA 1JPNA 2HLDA 1K6XA 4HPXB 1FFAA 1NWHA 4YQEA 4ZT3A 5TX7A 2XDAA 1NSKL 2C4NA 2IODA 3LK6A 4E3WA 5A3RA 2VYND 2IK8A 2WHPB 3C5VA 4EYIB 3WL8A 3KJNA 4MW0A 3KJHA 5CZVA 5DV9A 2QRHA 3IUBA 3CJ0A 1K8QA 2L9DA 1OI3A 5KT5A 5JAHA 1A4UA 2EFJA 4XPZA 2QZ4A 1NSYA 3MMSA 5DM7Q 5FJIA 7FD1A 5LSLA 5E6RB 3HEMA 4RWEA 5KFXA 4P7FA 2X9QA 5TPZD 3DD5A 1KSGA 3VDMA 2ZITA 4EPTA 4M5DB 1G3MA 3ZLJA 2RH3A 4TTIA 3H05A 2PZEA 5KC8A 2F3SA 3KNGA 2D6FA 4HAXA 5AOCA 1DWQA 1VKZA 1RBQA 4S1TA 4Z9YA 2I80A 3EUAA 4DLAA 5JUWA 3QG1A 3CGGA 4I1IA 1G41A 1A7KA 3CF4G 2W7TA 1WZEA 3BREA 2Q1SA 2HK9A 1XZGA 2A9JA 3N05A 3D9QX 1TU0B 1QYRA 2VPIA 1D9XA 4LY3A 3N87A 5IKEA 4US1R 4CM2A 2CHGA 4G0NA 4NL5A 1Y3AA 1W85B 2O7QA 2OGZA 1QHYA 1BWSA 3IGNA 1OQ3A 3H4IA 3ORHA 4HTAA 1FCAA 2J9EA 1U1FA 5CPFA 4PWYA 2LMIA 4P7BA 5D85A 5A8KA 2O0KA 1C9DB 1RI7A 3IDQA 4CUZA 3KWJA 1NONA 3FVVA 1RJFA 2QSYA 3UA3A 5AKKA 1VDZA 1JSZA 2HS0A 1T4BA 2MEWA 1ORDA 1FUUA 4NDZA 1T9GS 1SBQA 4QEDA 3HWRA 3K15A 1S1VB 4NEYA 3N75A 1J5EC 3BAZA 2R79A 3WB2A 1A1VA 3P2KA 3S2UA 4QOSA 4ED8A 4ZVLA 2X2PA 3ENVA 2ZB2A 1HPZA 1QGAA 2QT9A 1GAQA 1KSJA 5CYMA 3MELA 4PEVA 3MK31 1IUOA 1XRSB 1GGKA 1NHVA 1K0TA 5JO0A 5BW8A 5EAIA 3RTAA 1W93A 2O7NA 3T1AA 3HCPA 4DJ5X 2X1MA 3FM9A 4M0CA 4Y0NA 2IFTA 3RJTA 1JLSA 1N2FA 4BQPA 1RJGA 1GCOA 4C5BA 5TIIA 4WAUA 4TL6A 1QLWA 4K9DA 2EP5A 3JAMD 3X1WA 1H4SA 5AW9A 4MYTA 3L82B 2BEWA 3DW1X 3VH2A 3N2LA 3HHLC 1WG1A 3FNHA 1V8BA 2CXCA 2FYXA 2FUKA 2JLEA 3UWOA 3BYRA 1WOOA 3HKCB 1S89A 2DISA 2BFBB 2FMKA 3UZUA 3VSBA 3VR6H 2IKQA 1ZHFA 4LXTA 3FOFC 4U7UD 3T5HA 2VR1A 1MX1A 4A92A 2YJ4A 1YR9A 3Q22A 3E7XA 2ZAOA 5FWYA 1VQKS 5KFWA 1PUIA 1F38A 3K20A 4QLAA 5SYMA 2GRAA 3GPAA 2DECA 4M0PA 3OTIA 1QOZA 3ETDA 4M95A 2YQ4A 2AWNA 5C8YA 4TYBA 4LYGA 4Y7DA 2ZJPQ 3WGKA 2PA3A 2MKCA 1I7QB 5IWAF 4CZCA 4PCVA 3KYCB 4HDNB 1S1WB 3MM8A 4LYYA 2HU8A 1VRTB 1SOUA 3PL1A 3QATA 3FZBA 2R00A 4KWHA 3CC8A 4L75A 2GPTA 3EDMA 4OKNA 2REOA 1KFSA 3FFTA 5FT9A 2PJUA 2RKBA 2G83A 2QMHA 2R2RA 5FUVA 2LBPA 1MQ8B 4BASA 3KALA 4MKHA 4GICA 2VQ6A 3HLKA 1JA1A 2CXPA 1E89A 2BKNA 3N8IA 1IMJA 4FM9A 3HYNA 1G8KA 1XTRA 2G9QA 1URRA 4CKZA 2EBGA 3BKUA 1ULAA 3AFOA 4I4LA 4BLWA 3U6BA 5C4GB 3ZY3A 4KMOA 3LT2A 1X1SA 1KQ3A 3TAMB 1C0LA 3J7YU 2DWPA 2VRWA 3MTGA 4L8YA 4ECYA 1PSZA 2QRLA 2R85A 3DL0A 2RHSB 1JBKA 1VJ1A 1A9TA 2FEXA 1C2PA 1VCHA 2VHQA 3E1SA 3L1UA 4KTVA 4ARAA 1WBJB 4IFYB 4IDDA 2Y1WA 1H2FA 2CJBA 5GPBA 1S2NA 4XM2A 3A1FA 4MINA 3M3DA 1XTSA 1NX6A 1YXMA 2C07A 4C21A 5CGQB 1FE0A 4X65J 4ZO6A 5KCZA 4KR2A 2Q07A 3AAWB 3RC3A 5A0VA 4YO8A 2YUTA 2QVLA 4KGKA 2QVZX 2PNFA 4LZWA 2G71A 4BMPB 2IY9A 3HFKA 4BWMA 4GGPA 3Q8VA 2IEZA 2ZUBA 4XSGA 3GZNB 1Z36A 3QTLA 1O5TA 4EB0A 1PR0A 4UBMA 4TY8B 3WGHA 2K1RB 3K6JA 5F2OA 1GN9A 1B6SA 4LWPA 3LOUA 3OL8A 4M9XA 3LYAA 4ABTA 5FOWA 1KOJA 2A4KA 4QQNA 1OU4A 2GJ4A 3GYXB 3MM4A 1B74A 2RDDA 3OECA 2DRAA 5G53C 2DGXA 3LH5A 3SMZA 1L4HA 4L5BA 1I5RA 5RUBA 1KQNA 4GYWA 4F8EA 4ZJOA 2JAOA 1K2WA 4WOPA 2EPIA 5B58T 4D6YA 3IPRA 2W0SA 4JCOA 4CM9A 1U3TA 1AY0A 1G21B 4URUR 3GCXA 4WV3A 1UEUA 1X4AA 1GDDA 2YDXA 1PG3A 2V4MA 1LFWA 1TMKA 3E8OA 4N3NA 3T5BA 1JQKA 2VYQA 4ZLJA 3GB0A 1FW6A 4KNVA 4YREA 4Z8XA 2AG6A 1QUPA 1NQOA 3D4BA 5TQ0A 2POKA 3CDBA 1H72C 5F78A 4RKEA 1DQYA 3F47A 4UM8B 4RK6A 4MRMA 3QHAA 3FCEA 2VXOA 3PXGa 2Q46A 1WEHA 4DC9A 1Y10A 4QHYA 1SXQA 3TVKA 4Y6IA 3C6TB 4QPCA 1LBSA 2FSVC 5F5LA 3HSYA 4LZZA 5ALHA 4BN5A 4OXXA 4DZRA 4I6JA 1DCMA 2BCEA 4G5RA 3P20A 1ATZA 2NU7A 3AT1B 1DBVO 5JAMA 2O2HA 2C9DA 3QW4B 1Q0NA 4DMZA 3UO0A 2OBFA 1TYBE 2VDLB 3SR0A 2YXEA 3MFIA 4B83A 2J3DA 4FW8A 3TZEA 4EPVA 2FFJA 1X7YA 1E66A 1IB6A 3FPEA 3RVMA 3FDZB 2ZD1B 2BISA 3X1KA 4HVAA 2DUMA 4CT8A 4XLLA 1QGUA 3J80D 3T7AA 5ECGC 1YKGA 4L9SA 3NAIA 1UEXC 5DU2A 7REQB 5AICA 1Z17A 1E7YA 2HHTA 3W5VA 3L1JA 2OQRA 2DH9A 1VJGA 5CFZA 1SCAA 2F40A 4D9CA 3DUWA 1TL3A 2FG5A 3USZA 3MJ4A 2VG5B 4P31A 4WNAB 2HMSA 3HFGA 4NZMA 2VOPA 4IGEA 3VH4A 1PYSB 2CADA 5MFZA 2N47A 2E85A 3KIPA 2WOMB 3PU6A 3M2PA 1ZW1A 1UL3A 1SI9A 1DAEA 2H57A 4EJ0A 1HD1A 4B9NA 2RHRA 4NS1A 2ZXFA 2DC1A 4BV8A 3LG2A 4CTMA 1O5OA 1E3WB 3ZHUA 4TLBA 2C9MA 5EHHA 3B48A 4Z1OA 2DHHA 3B1ZA 5HNKA 5ADVA 1E2DA 2EBHX 5G4KA 4JI3C 1LDMA 1WHSB 3K53A 4YTEA 5D15A 3S2GA 4CWAA 5KTNA 2VASA 5BNTA 4BUZA 1BX0A 3EZ9A 2BJWA 4C0AC 4DMHA 4D9IA 1ZNZA 2MZRA 3IRWP 5A0YA 3L7UA 4L72A 3EXHA 3H1FA 2GOYA 1JDPA 1VCMA 2VG7A 3DONA 1SKWA 3N5CA 5CEFA 1GPJA 3IV7A 1PQYA 4JZKA 3H2IA 1RT9A 1XP5A 2VBGA 2H85A 2JLSA 2WHXA 2PQMA 2ZWIA 4N5HX 5D7NA 3UHJA 5J4VA 2FPHX 2QW8A 2XGQA 1KZ4A 3EIOA 1KDYA 1T11A 4PNEA 1TA9A 4RM3A 3AR8A 5CK5A 5AP9A 1KI8A 4LJ6A 2V7PA 1R8BA 1Y9DA 3GPBA 3DRSA 1PZMA 4R8RA 2YN0A 2F3JA 3HHPA 4YAUA 3DOLB 1J5OB 2WM3A 4AKEA 2CKDA 3QLVA 3UJ7A 3NHJA 5DM70 1TT5A 3A6HA 4E6PA 3MPVA 1OY9A 3O8BA 4Y2XA 3SJCA 4DKXA 2QMUA 3BBPA 1QAIA 3W8NA 5CG1A 3P2YA 4B7AA 3TEHB 3NAZA 3TGLA 1SH2A 1TVEA 4NLTA 1PA4A 4CCWA 2BHNA 2CNDA 1TK5A 2W8BB 2A3NA 4ENTA 2FTRA 1EB8A 4XPEA 3HEAA 5CFLA 2O1EA 4AN0A 1SQ5A 2XOKD 3QF4A 2ZDOA 3UMJA 1U1MA 1FDUA 4Q4CA 1BCRB 3NTLA 3BDIA 1N8RT 1KZ7B 4HKQA 1T8YA 1XDSA 4C4ZA 4ILLA 4DLNA 2Q99A 2GI4A 3TZXA 5GIOE 1NNDA 2MSLA 2ZYTX 1E62A 4MMXB 1N9ZA 8ATCA 2VPXA 3UJCA 3BULA 2OC4A 3ZWOA 1GTZA 1Y11A 2ZK7A 3AF3A 3AJRA 5K2MA 3NALA 4ICLA 3AUXA 5IJ9B 1GQOA 4P33A 5IZCA 4XX2A 4XGQA 4UMDA 5AI6A 3PX6A 3ILLA 1HQUB 5CH7B 1Z0IA 2NO4A 1QQTA 4IR7A 2KSQA 3FTQA 4DLVA 5SZHB 2ZYAA 4ESHA 3SVZA 4KBIA 1NVVR 4U95A 2FGOA 2JAWA 3KELA 1WHXA 4ZOCA 2MYUA 2F1KA 2PN2A 5AR1A 3AR7A 1FDVA 1YMUA 3F4BA 3TCNA 4JSRA 1MN7A 2BMJA 1QTMA 3PT9A 4AXBA 2P5TB 1PQ4A 4R2LA 5KG0A 1R0ZA 4H2DA 1SUAA 1U02A 3H5UA 2O9JA 2K5UA 2WSSD 5HRUA 1ZGCA 3RWMB 3LXUX 1PGZA 3BPSA 2FJXA 2IH4A 1NXVA 1VMKA 3WRXA 4HWOA 1ZONA 2DFPA 4Q9KA 1Q79A 2CQ0A 3FDFA 2GZSA 5E1MA 1OV4A 1OIVA 3OFND 2XODA 3T9BA 2P9BA 2VA2A 3HXOA 4X71A 2R1TB 2SCUA 2DXDA 2YL2A 2DTXA 2VH2A 3V80A 4YFYA 2XT9A 3HVAA 4KAAA 3B9QA 4WLUA 1H5NA 3LKBA 2WTEA 4ALIA 3WADA 1WZNA 3CLKA 5LDDC 4CN8A 4D3HA 3I6BA 4OP3A 2QZPA 5CJPA 4A0GA 2XGJA 3E3OA 5HKLA 2A9PA 5GADI 2ZOMA 2IPLA 1S4EA 1L6IA 3CMES 4DFDA 6FD1A 3PEFA 1XCOA 2V69A 4UXIA 4ZZ0A 1JYFA 2HGZA 4WINA 1JDBC 3EAGA 2EDAA 2PXHA 3OHAA 4ECAA 1QIGA 4QQBA 3MEDB 1GEGA 6GPBA 5K1ZA 5AQ1A 2YNMD 4UXHA 2JNWA 3IAS1 2HQ3A 4UE6A 1PTKA 2WAMA 2PGJA 3Q8XB 3CCLS 4NU0A 2XUDA 2YTZA 5C0OE 2YICA 5CDHA 3CCES 1W36D 2GAGC 1WNTA 5D0GA 2C96A 1ZLYA 2RDJA 1XNRJ 4EHIA 2MJNA 3QKSB 1D7AA 2C2BA 3JAMU 4PG4A 2FVRA 2ZP1A 2C4KA 1FNNA 4AO6A 4H6XA 5JS1A 5IYZA 5LZ2A 3G2NA 4DL6A 2C2YA 2P11A 1R3UA 3SIRA 3W7BA 4OL8A 3RQSA 3JQMA 3BXZA 3BXEA 1J09A 3OO1A 4QU0A 4E5SA 1DRZA 1LWFA 1LRLA 2B8JA 1Z0ZA 2EYUA 3HGTA 4H4OA 3B3JA 4NOHA 2ZM6J 3OTOB 3BMNA 4IHJB 2JMPA 1CJVC 1U2TA 2IU3A 5BUCA 1WELA 2NS1B 4C7VA 2K4MA 4BJ5A 3BGIA 2WPDA 4INJA 4UMFA 3TH5A 2ATVA 3E8MA 3LNVA 1YZNA 1YU6A 2NOAA 4DXHA 4QU6A 1HNXF 2IYFA 2XADA 4BTVA 3PWSA 4BLOA 1CUUA 1RXCA 2PEZA 2B8WA 3RC7A 3IE2A 3UDVA 3AX6A 1T6XA 3A3YA 3BH0A 3I87A 4FOPA 2BM9A 1H6AA 3EC2A 2OAGA 3N4WA 4JB3A 5DB4A 1N57A 4NBKA 4RD4A 4FB5A 4MH4A 4QR1A 1S76D 4RHYA 3PBKA 1CQZA 5JNWA 3HP6A 1UF9A 3SYMA 1YDWA 3K0KA 1EQMA 4B7UA 4JJGA 3FUVA 4R3UC 1ISMA 5K8FA 4MQFB 2GM4A 5KNCA 1LDNA 2LW7A 1PN3A 2IYZA 3ECSA 2PKQO 3I92A 5AW0A 2CFSA 1ZAYA 2H29A 1O0CA 1X9MA 4QSHA 1MAAA 1ZAXA 4ER7A 3UTCA 1Q7BA 4QDKA 3EJWA 4NULA 2E82A 1RMYA 3QE4A 3VHQA 3IT2A 3RU2A 3TRIA 1CJVB 3EH1A 1X7VA 2Y1XA 5DE3A 3H7HB 5JSZA 2P1DA 4WK6A 2DLCX 1YO6A 1TM5E 1IMOA 4AL7A 2A67A 3PW2A 2GAOA 2RT3A 5JY6A 3SSNA 4KR7A 1HO3A 1G18A 2QY9A 2GGPA 1Y8QA 1QGOA 4Z9XA 4MQLA 1X80A 3TR5A 2ZSHA 1WXIA 2QDXA 5JC1A 2ACMA 2V6IA 4L9AA 2Z30B 1OPIA 8AT1A 2F59A 3DT9A 3IMLA 4FOLA 4HH3C 4JYBA 1W88A 4Q4LA 1XL0A 2YTCA 2QTRA 1SB6A 2HFZA 5DDIP 4YJKA 3KJQB 3EWNA 4HVZA 3I0MA 4WLNA 4C4AA 3Q1LA 3DXBA 2OEJA 3K30A 4U9UA 4UHBA 4BUJA 2YPYA 1EVYA 1YR8A 1E1RA 2MSEB 2B5VA 4NLVA 2GZ3A 2D3ZA 3WGUA 3B4MA 1XR7A 4CTKA 4J1TA 5BV2P 2HNAA 3HZGA 2W11A 3ORQA 3JV7A 5HJXA 2C7GA 3OJEA 3W7AA 1K5HA 4UW2A 1ZXBA 1ZK0A 1S4MA 1P77A 3Q1KA 1X7ZA 2RKIA 4F67A 3W9YA 2X14A 2BEFA 1SKYB 5FPYA 5IVPA 2ZM6C 4NSNA 3W6OA 2R6GA 3FCHA 5JD3A 1AC5A 4KQFA 4F4UA 1NW4A 3BIXA 5JQGA 4MAAA 3QW2A 2HY7A 2WIDA 5EXPA 5EWEA 1XAIA 3KTAB 4J1QA 4UOQA 2XYHB 1N25A 2VQFB 5JAQA 4M4SA 3A6KA 5IWCA 2DR5A 1OLOA 1QG2A 2VDOB 3V6MA 1PX0A 4JV0A 2ISCA 3MILA 2YWJA 1A9QA 1SCJA 4FYIA 5CB0A 3I32A 4Z1MD 4YFUA 3E7FA 3CUUA 5AOBA 4AP9A 4NMMA 4YRTA 5E6RA 4Q4HB 4TLLB 3HB0A 1IN4A 2OAEA 1QAQA 1XMPA 3IXQA 3W4KA 3ZKAA 2JD0A 3N01A 1J2TA 4I3FA 3RR7A 3ANTA 3PENA 5D3ZA 2QM8A 4AT1B 1JNRB 2JLYA 1SCUA 4KWIA 1EB0A 4YUXA 3OZUA 4GVPA 4DCCA 1NW3A 2BFAA 1F9EA 2AUMA 2IUUA 3RB8A 2Q4EA 1L7OA 1REQA 1TXGA 3CJQA 2XA1A 5KFBA 4XJXA 2UXBC 4I81A 2VP0A 3ZO7A 2KXHA 4WXYB 1V7ZA 4CIYA 3D6NB 3ORYA 3AJ9A 4WK3A 3UGJA 3QNWA 2OT3B 3NHPA 4P53A 4WFKA 5KTTA 5T3YA 2Z8XA 2CUYA 4JLKA 1Z8FA 4B81A 3JSXA 4PZPA 2C4HA 4E5NA 3UK0A 4JEUA 3IHTA 4X60A 2VDWA 1NKTA 4HRAA 1WF0A 2HCFA 4QPPA 2H2WA 2LQ8A 1SL2A 2Z9CA 1XF9A 1M75A 2H4YA 4ZGWA 3KJZA 5GAHI 3KKEA 4QFBA 3WLJA 3C14A 1T8RA 4WFIA 1GTJ1 2R8XA 4C88A 3OPXA 4BFXA 4BHQA 1UWAA 2YOFA 4QXQA 4LBIA 3NL0A 1Y6GA 3GP5A 1NLFA 1VHFA 3TRKA 4L1KA 1LWEB 2HSWA 2MINB 3HYTA 4CMGA 1KEKA 5FLXD 2A0FB 2UUCC 1RT4A 4FGJA 3AUTA 4Q9AA 1CJTB 3QFTA 2DGQA 2FR8C 4JHXA 3QKRA 2QXTA 4AMYA 3R5BA 2YKGA 4TM8A 4LMRA 3AG5A 5BVHA 3OTOJ 2HKEA 3GDHA 2OGWA 3IBYA 1FX2A 1P0FA 1V8PA 3TBKA 3P27A 4WLEA 5IJXA 2HR1A 2PYIA 5TPWB 3KTFA 5F8LA 3PGVA 4O3PA 5AKJA 3UUWA 2IUYA 5BWOA 1XZPA 1I30A 3ESRA 3K2EA 2P6OA 4EM6A 3KLIB 4RFLA 3BO2A 4CDGA 4G4IA 5JC8A 2ZC4A 4NJMB 4AURA 1QJHA 3NEAA 3WWPA 1NK8A 3D8BA 1HEIA 4WXOA 4C6HA 3AIIA 1KYZA 1W29A 1IY0A 4F3TA 1O6CA 3VPBA 1FHTA 2BC9A 3HNOA 4V39A 5F5XA 2MLXA 1AGXA 3PFFA 3SHTA 4BFVA 1YJBA 2QGZA 4P2GA 4YPVA 3O6QA 4OTZA 1CJKC 4H7EA 5ALZA 1E1NA 3UQZA 5AM1A 2XQJA 4NBSA 3F7MA 4DX5A 3CCMS 2AOWA 2RH5A 3EZYA 2FLPA 2X8AA 3H5LA 1YLXA 2OFWA 1KQKA 2AWOA 4ZCQA 4R7TA 1MXCA 1U47A 2RHWA 5DLFA 5EXXA 3ACDA 5U9CA 3CNBA 4MA4A 3HFSA 3L41A 5GWXA 3A26A 3VZCA 4LKRA 1X7HA 3DBHB 121PA 2DITA 1RT1A 3GNTA 4KU4A 1C7IA 1LDEA 2BTEA 3PUKA 1U9JA 1H7WA 3C7DB 1BXZA 3D9BA 2H5JA 3LW7A 1VLYA 2WUDA 4GAEA 3TYTA 4XB6B 1FC0A 3RU0A 5LMNC 5EUCA 1UINA 4NXNJ 2EFEB 2CF6A 4BC7A 2G9VA 2B7BA 4AJEA 2AV5A 2BH2A 4DV4C 2IU4A 1YJ8A 3PGKA 2UDPA 3GGCA 1H2BA 3H9CA 3JAMA 4DR2B 1KONA 3NZEA 3DKRA 3LP0A 1WM1A 3SM3A 4M7PA 3K0JA 3T5AA 1GL3A 1HBOB 1T95A 3DRPA 4L5YA 4YONB 3GZNA 3RC1A 4F60A 2C2WA 3HA5A 1G6KA 3HP1A 3RVQA 1JXQA 3IDFA 4B2PA 3SGLA 4PYMA 5A8WB 1WXEA 3R3UA 4K8RB 3K6KA 4JVSB 3UDLA 4RTOA 2WVDA 4F3CA 4QUJA 1IY1A 3F74A 1WP9A 3DFMA 2J3MA 4JI4F 2XRMA 3QVSA 4EFNA 4K26A 1C3LA 1E5VA 3UV6A 1U45A 4JBYA 3F56A 1XD9A 3M9NB 2AOUB 2OYCA 2VG6B 2E5LF 4RZRA 4FWTA 3GT3A 3ETMA 4GHWA 4MI6A 2I1QA 2YN4A 2UVVA 2IKSA 1Q1GA 2CE7A 4JV5J 2D4HA 3I8XA 4HNVA 2GAIA 2VS1A 5KC9A 2IM1A 2B4AA 3DAOA 4FP9A 1MIOB 5IRCD 1Y7IA 4G8CA 2GCGA 3AVXA 4QZVB 2JFGA 4Q3CA 3NBMA 4DJAA 1RWNA 4YR3A 4Y1EA 1D8ZA 1FLOA 5FUBA 4F4FA 1IWGA 5GMKa 1HFJA 1N5RA 1FRNA 2BMBA 1SBTA 5EP1A 2JHGA 1ILWA 1X7DA 4JNKA 2GJFA 4B6JA 1RT7A 1T9WA 3MT9A 4EQZA 3QIPB 3IV9A 1BFKA 5K8OA 3IFEA 2CJAA 3BE8A 1LK0A 3HB4X 2IE8A 2P2SA 1EG2A 2FHMA 1GQEA 4E2ZA 3GP3A 3H8VA 1VJDA 5FBLB 3P8BB 4BAGA 3ZGOA 1NURA 3QJJA 1RJ9A 1GDHA 3JZAA 4MH0R 3BJIC 2XWSA 2GD6A 1W34A 1YOBA 4URHA 1N0HA 1XI2A 4KH1A 4USIA 3U7IA 4K9OA 1KRWA 1G7CB 3FYUA 2HIQA 3AUKA 3DOJA 5LU8A 4KHMA 4BFZA 4PRKA 1S9GA 1KK2A 1Y6ZA 4M1ZA 5BMVB 4D0GA 2QUZA 5CQGA 2VWGA 1XIVA 3O73A 1KTIA 3OWOA 1N5MA 2X0JA 2RMKA 3DWGA 3CPWR 4PNHA 5IM5A 5KPJA 2WVGA 2FUCA 3EIHA 4LF4C 3EASA 2R7VA 1CULC 3TW4A 3V7NA 1WMBA 3DGFC 2UU9C 2O2DA 4IO0A 2IYIA 3VNRA 1RT3A 5CX1A 3ZWAA 2QEXS 4MGEA 2QX7A 2CNWA 1KJJA 1LI5A 2I4RA 2QAGB 1DO8A 3L0CA 2LEPA 3WYEA 1EKSA 3HYRA 4D4GA 2PRIA 1YB2A 1GT91 1IUNA 3HJUA 1EDZA 3WTCA 4RY0A 4RQAA 1NKSA 1PW7A 5DIZA 4JA2A 3RAQA 2P9YA 3BXPA 1TO2E 4O4JF 5KYXB 3KG2A 5C8VA 4X63A 3PHBE 4D74A 4WN9A 2FUG9 5A6SB 2I2AA 3HKZD 2I67A 3SBXA 1KJYA 4CU5A 4M37A 3P45A 3K31A 2LWIA 3IUQA 3R3HA 5JFGA 2BONA 3UMVA 4H4KA 1GR0A 2LP4Y 2AMVA 3AOGA 2V5HG 3RW7A 5B58C 1MGOA 2PMBA 4AT1A 1T02A 2XC9A 4DA7A 3JD1A 4RIIA 3BH7B 4LF4B 3EISA 3QYYA 2C3MA 3G82C 1YB7A 2Y1LA 1T2AA 1XTBA 5FBRB 1QIJA 5IFIA 4TSFD 3RABA 4AUEA 3DRSB 4NOKA 4AJHA 5G4KB 1NN5A 1UIMA 2BRUC 4R6XA 3KT3A 1TQDA 1LVUA 4F93B 1WDMA 1EJ0A 2BKEA 1I7LA 5LQNA 2PIAA 2XMDA 1OWXA 4ED9A 3D4JA 4UE2A 5FQOA 1NRWA 3KD3A 1L8QA 5KFCA 3BGVA 3V8VA 3T9AA 4D46A 4ID8A 1AQNA 2XKJE 3TAPA 5HTKA 4DPOA 1AVTA 2I34A 1TDJA 4XUEA 3U4AA 2PR2A 4DRYA 1N2HA 5LJ5Y 4UFOA 1GY8A 2WIFA 3M81A 1SQSA 3PNLA 4JJ4A 3M6LA 2FGJA 421PA 3KU4A 3K09A 5K3SA 2QENA 1EXWA 2G9OA 2IDKA 4EW6A 3EPRA 3MT8A 1O95A 4M6WA 3G79A 3ZWWA 4P4SB 4FD2A 2CPZA 4ZVSB 4YV7A 2AJDA 4G09A 3DR3A 4JI1B 3SSOA 5JUMA 4RTNA 2L69A 3IUMA 1SU6A 5GP1A 2XQGA 4IFVA 5ELLA 2D1QA 2HHPA 3PD0A 1F5SA 3G23A 5FBZA 3KLFB 1JB9A 2IWRA 3EWSA 2IEDA 1ISRA 2V9KA 4UDOA 5B0FA 1ZB8A 2HJVA 4K0KC 1CWUA 5DGCA 4R84A 3ND8A 1T43A 4ENUA 3I0SA 2XMRA 3T1HJ 4KP7A 2HBYA 4PPGA 1XZLA 5D5HA 2R86A 3QQCD 4CNZA 3ZVLA 2H54B 2FSPA 3MQFA 1QJ4A 4RPKA 1ZYQA 2L19A 5AXCA 3AK4A 3H6GA 1E94E 1QZXA 1AB5A 1JEAA 3N39C 4CPDA 4IJVA 1GITA 1DQ9A 4O4HB 1MDFA 3G85A 1XHLA 2FN4A 2VFUA 5C34B 4G23A 2WJZB 3OL9A 3KPVA 2PZJA 3ULHA 2V3WA 1KWKA 4B02A 3IVAA 3Q5EA 2UV8G 4CM1A 5THWA 4UAVA 2C42A 3IM8A 4KO8A 1AHHA 3AYXB 4ETNA 3H5SA 4H1HA 4NYOA 2BUAA 3B8HA 4UVHA 3OVMA 2WF9A 2ZQ5A 2HURA 4G97A 3F49S 4PLWA 5E7QA 5D87A 1GNQA 1W94A 2PJRA 3GLGB 4K4WA 4WGGA 5AJXA 3E2PA 1CLFA 4KK4A 1N48A 2WF8A 4NXMB 4R9SA 13PKA 4U9RA 4YJ2B 4QHTA 1M5KC 1DBQA 4B9MA 1Y1LA 3MEEA 4LSZB 3F6YA 1D9ZA 3ZE8A 4ENQA 1Q1AA 2O8DB 7REQA 4OBXA 4CO0A 4E09A 2FWJA 3GCGA 1WZIA 3W0LB 1BYIA 3HXQA 2G4BA 1XT6A 4AQYB 2LEAA 3IPCA 5LL6d 1G8FA 1E2EA 4EK9A 1BXRB 5HWSA 2D1FA 1EUDB 2XBPA 3MR5A 1JLEA 2XCUA 4ER8A 2BMDA 2IHKA 4NDAA 2BAGA 3P4UB 4A3SA 1HBOA 2GO8A 3CISA 4TVOA 7AT1B 1N5SA 5ETJA 3BSYA 3NWEA 4YWJA 1KE1A 3K70C 5CJJA 4USWA 3JSRA 4G36A 4UU1A 3HV2A 5LXRA 1ZS9A 3JD3A 1VCOA 1TQ8A 2GHPA 2VQEF 5HKOA 2DD8S 4JYPA 5AVZA 1SKMA 1JIQA 4DMGA 4TL7A 1P8AA 4LZNA 1G8AA 1DUSA 2RHLA 4NENB 3DLJA 3D4IA 5LXTF 2KFYA 4O3OA 4UPVA 2AX4A 4GMFA 1USPB 3J7AN 2WI8A 1LQTA 4PO3X 1URNA 4ZS6A 3IEKA 1VPWA 1WU7A 5KHLB 3FZGA 2Y66A 1A96A 3MGCA 4JFAA 3EC7A 1GL6A 1GPUA 4YRSA 2HPVA 1YQQA 4MAKA 1U7UA 3OMXA 2AJ0A 2NXCA 2D2VA 1JB0C 621PA