3AY0A

Crystal structure of methanocaldococcus jannaschii trm5 in complex with adenosine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
335
structure length
320
Chain Sequence
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differentiating analogous tRNA methyltransferases by fragments of the methyl donor.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0883
total genus 89
structure length 320
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ay0A01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 3ay0A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ay0A03
1Q0TA 2PT6A 3SM3A 4E32A 3C3YA 1NBIA 3CBGA 2PJDA 3MAGA 5E1MA 5EGSA 5EZQA 2ZBQA 3QOWA 4PYJA 1RI4A 1G8SA 1EJ0A 4KIFA 3DTNA 4M7RA 5IKMA 1X1DA 3HA7A 4KDRA 4QDKA 4RV9A 4YUZA 2UYQA 2C7PA 4RTSA 4RTJA 2PXAA 1EQAA 1R8XA 3EGEA 3OZSA 4OX9Y 4P58A 4RSRA 1ZGJA 2PKWA 3NJRA 3TLJA 1KPIA 3GWZA 4QTTB 3KQVA 3HCCA 4GC5A 4KVZA 2BR4A 5IH3A 3K6RA 1NW5A 3P2IA 5LR6A 3GRUA 3T7TA 3OZTA 2HNKA 4QDJA 1AQJA 1SUIA 3IYLW 4LG1A 3EVAA 3T7RA 3SSMA 3LBFA 3G2OA 5DRTA 5DT2A 2FK8A 2O05A 4PWYA 5E2BA 3GJYA 3H2BA 3UJAA 5DXAA 1VLMA 5K0GA 3R9XB 2AOTB 3BWYA 3BWCA 3DMHA 3UJDA 1P1BA 4MQ4A 2K4MA 5GIOE 3BT7A 4YUWA 1KIAA 5HOQA 3ER8A 4RTOA 2EJTA 4XUDA 2IIPA 4IV0A 3M6XA 3KQPA 1NKVA 4KIGA 1AF7A 2AOTA 4C06A 4EKGA 3UJ6A 4HG2A 5HIJA 4FS8A 5T6BA 3CJTA 3KPJA 3PLAE 3EGVA 5BXYA 1MJFA 4QVGA 4RTRA 1VIDA 4GOLD 5E9QA 3TFWA 3ERCA 1T43A 4HC4A 2GAFA 2AN3A 4XUEA 1SG9A 2EG5A 2IBTA 3UJ8A 5FQOA 2PX8A 3NVMB 4QTUB 3M33A 1DL5A 1G60A 1JG3A 1EJ6A 2BR5A 3DUWA 3EGIA 3EPPA 3FTDA 2E5WA 3KQQA 3P9NA 3BGIA 2ORED 5G02A 4RTQA 4PGGA 3PFGA 2G72A 2PXXA 2ZWVA 5F2OA 2IBSA 4E31A 5DXJA 5LQJA 2Q41A 3OZRA 1AQIA 1JR4A 2AOXA 3KQOA 3DP7A 3FZGA 3L8DA 2QY6A 1U2ZA 1KR5A 3VC2A 2IPXA 3TQSA 2ZIFA 3OFJA 3KPVA 3TM4A 3UJBA 3GRZA 4POOA 1NBHA 2XYQA 3NMUF 4HSGA 5DSXA 3TM5A 4ZTBA 4Y2HA 1X1CA 3HCBA 2UYCA 3A7EA 2OPBA 3TKYA 4ATNA 3EVDA 4CWAA 2C7OA 3HA3A 3NW9A 1OR8A 1P1CA 4MTLA 3UJ9A 3ELDA 3UA4A 1NT2A 3PX2A 5K0CA 2ZFUA 1NV9A 1WY7A 2PX5A 3FUWA 3G8AA 5T64A 3SVZA 3G5LA 4WVLA 5JUWA 3QV2A 5CCBA 3HVIA 4E2ZA 2NXCA 3M6WA 3C0KA 5DX1A 3DLCA 2G1PA 2WA2A 3RODA 3BGDA 1VP3A 1L3BA 3D2LA 3T0IA 1NV8A 3I53A 2WA1A 2NNWB 3BKXA 2IDKA 2V74B 4X1OA 5LSAA 3A25A 3B5IA 3NVKI 5BW4A 4GEKA 1NW8A 3LBYA 3LCUA 4HRAA 4PYIA 5K09A 5CCXA 3BWMA 3E7PA 3G7UA 3HCAA 5DSTA 1SKMA 2BH2A 3MQ2A 2ZW9A 4EK9A 1FJXA 1HNNA 1JTEA 4CXMA 2GS9A 2H00A 3LDUA 2ZTHA 5GINE 1IXKA 4LWOA 1O9GA 2BM9A 1RI3A 1JSZA 2ADMA 3JWGA 5FTWA 2A14A 5F2KA 5FHRA 3FTCA 4BP3A 4KW7A 1TW2A 3FUUA 3SMQA 5EMJA 2BR3A 2OB1A 3SX0A 2ZZNA 2QE6A 4RYLA 3LKDA 1MHTA 4JXJA 7MHTA 4PGHA 4LWPA 1DUSA 5D1HA 4QPPA 5KS2A 1WXXA 2P3OA 2EJUA 3NWEA 4KRGA 4FSXA 5FCDA 5GM1A 4AZWA 2JHAA 1YZ3A 2CKDA 2XVAA 3CC8A 3EVBA 3R24A 3S68A 4YUXA 5FWAA 3FYCA 3NTVA 5CIYA 3OU6A 2IH2A 2XYRA 1IM8A 3CKKA 3HNRA 3TOSA 5FWDA 1BOOA 1JSXA 5EMMA 4PCAA 1XTPA 1IY9A 3SR4A 1XCJA 4YMHA 3A4TA 3DXZA 3FPGA 4R8SA 3B7PA 3LSTA 1Q0SA 1F38A 3MGGA 3LHDA 2PXCA 2P41A 3IHTA 5E9WA 1YZHA 1RI5A 4Y30A 4H0NA 2PGXA 2JHCA 1L3IA 3U81A 2VDUE 2CL5A 3DLIA 3SSOA 3A26A 1VE3A 3EVFA 3PVCA 3HTXA 3DULA 2ERCA 5CVVA 5E1OA 4GC9A 3TR6A 2AVNA 2NXJA 2IP2A 4DF3A 3RW9A 3OU2A 4GOND 1QAQA 4ER5A 3DXYA 5HIMA 3Q7EA 3MB5A 4V0RA 3KHKA 5T67A 4QQKA 3NWBA 5DM1A 1G55A 1KHHA 4P7KA 4FT2A 4KWCA 4YV0A 1JG4A 4RX1A 5EQJB 3I58A 3PT9A 5BW5A 3EVZA 4RVGA 3MCZA 5K0LA 3HEMA 5K0BA 5LQAA 2VS1A 3EVCA 2B78A 2FRXA 3KPYA 5CVDA 3ER9A 5HZMA 1L3CA 3DXXA 5LQKA 2P7IA 4F84A 2IH4A 1XDZA 5EIFA 5LQRA 4HH4A 1PRYA 1YUBA 3I9FA 2IH5A 4X63A 3REOA 2UZ4A 2NYUA 1P91A 4QVKA 4U7TB 1ZHFA 1ORIA 1I4WA 2O07A 4K6MA 4Z2YA 4F85A 3GCZA 3EMDA 3O31A 5EIWA 5K05A 3SGLA 2PBFA 3FPJA 3KQWA 4R6XA 2O0LA 2EX4A 5KQRA 5EC8A 2OYRA 2YXDA 3P2EA 3TKAA 3G2PA 3LKZA 2O06A 3PS9A 2ZLBA 5D1NA 3HA5A 3X0DA 1JG2A 3LGAA 2PT9A 4XCXA 4P7GA 1D2GA 2OO3A 4RVDA 2ZWAA 5K0EA 3GRYA 4GOOD 3VSEA 2UYOA 1QZZA 5DM4A 5CUQA 5HFJA 1V39A 2ONZA 1YB2A 4E70A 2PLWA 1WZNA 1SUSA 1XDSA 4UOEA 5M5BA 9MHTA 3IEIA 4YUVA 4E2YA 1D2HA 2AOUA 5EEHA 1WXWA 3LPMA 4HTFB 2GB4A 1BC5A 3AXTA 2GA9A 4O29A 1FBNA 3CCFA 5FULA 5E2AA 3P8ZA 5K03A 3JWHA 4C03A 3P2KA 4WXHA 3T7SA 3G5TA 4ER7A 3MTEA 4PCLA 5DTQA 3R0QA 3FPHA 1D2CA 2ZULA 3ELYA 3LDFA 3GRVA 4R6WA 5FA5A 3C6KA 1JQ3A 2YUIA 4PNEA 5CD1A 1ORHA 3AWIA 3HCDA 5E1BA 5ICFA 3DR5A 1RJEA 1FP1D 1X1AA 3FUVA 2IGTA 3FPEA 3GIWA 5H02A 4GQBA 1SQGA 1UIRA 3O4FA 2G8NA 1KPHA 2I7CA 5KVAA 3VC1A 5FADA 3FUXA 2NP7A 1JG1A 3LECA 5EPEA 3NDIA 1I9GA 4L7VA 4CKBA 4DCMA 3KU1A 3KR2A 2ZZKA 2PSSA 3QOXA 3KQMA 1BKYA 1P39A 3FUTA 4C4AA 2NXEA 4P7JA 3OU7A 2XVMA 3BZBA 5MHTA 2ZZMA 4IKPA 1G6Q1 1RJDA 3HVHA 2AN5A 2ZBPA 1KXZA 4HGYA 3LX6A 10MHA 1JQEA 3JWJA 4FP9A 3UBTA 5F2NA 1N7JA 4EQZA 1O54A 2QRVA 3G8BA 3BGVA 1TPYA 3BXOA 3NDJA 3PTAA 2YTZA 2LD4A 1NW7A 2P7HA 4GUAA 3PFHA 1R18A 1KYZA 2YXLA 4E2WA 3PB3A 4PYQA 5DPMA 3UFBA 4BLVA 2VP3A 3THRA 3DMGA 3HM2A 2QRVB 1Z3CA 5BP7A 5DWQA 4KDCA 2YR0A 3B3GA 3DMFA 3KR1A 3TMAA 3E05A 4DCGA 5ICEA 2ZCJA 1TW3A 3HCEA 3P9CA 1FPQA 5CVJA 5EEGA 3CJQA 1SVUA 4A6EA 5FHQA 2YX1A 1R6AA 4CTJA 4R8RA 2JH8A 3I64A 4GF5A 2CMGA 1VL5A 5EZSA 5LQCA 1XXLA 4EVIA 2BZGA 1B42A 5GWXA 3M4XA 4YV1A 4DMGA 5DX8A 4C08A 1QYRA 5JR3A 2HR1A 2AVDA 1O9HA 4IV8A 4RVHA 3P97A 2Z6AA 2PWYA 3BUSA 1F3LA 2XYVA 4DA4A 2EFJA 2WK1A 1G38A 3EVGA 2Y1XA 1QAMA 4OA5A 3DH0A 2PWPA 4F86A 5FA8A 3CGGA 4DKJA 2ESRA 1ZKDA 4PONA 3OE5A 3KQYA 3M70A 3EEYA 3CVOA 2N47A 3ME5A 1VBFA 3GXOA 2BM8A 4PIPA 2JHPA 4X41A 5EVJA 1RJGA 3B3JA 5C1IA 2PV0A 2VZ9A 3HVJA 4PYKA 2V7EA 4AZSA 1AV6A 4PYLA 2F8LA 4ER0A 3OFKA 5DLYA 4E30A 5B1SA 3GRRA 3OCJA 2CWWA 4AX8A 1VP9A 2QM3A 3UWPA 5LQNA 5HIIA 2GPYA 5E9JA 4LECA 3C6MA 2Z6QA 1INLA 1ZQ9A 3PX3A 4FT4A 4XUCA 3SXJA 1M6EX 4OBWA 4DM3A 1EAMA 1Y8CA 3EMBA 5EG5A 4CKEA 3IV6A 2YQZA 1VQ1A 4X60A 3B89A 3F4KA 1R74A 3M6VA 4BLWA 4X61A 1YF3A 3GGDA 2AR0A 1R00A 4U7PB 3ANXA 2JG3A 3DOUA 3THSA 1N7IA 2JH9A 2P1DA 3G2MA 2B2CA 5FQNA 3R6TA 2GLUA 3TPZA 4BP1A 2DPMA 3ID6C 5EKXA 2YVLA 3P71T 2JJQA 3AY0A 4IWNA 4QQNA 2NXNA 1KP9A 2AZTA 3MERA 1M0EA 2VDWA 2P3QA 1XVAA 4FGZA 2NP6A 2ZBRA 3KR0A 3MTIA 5DX0A 2IDJA 5EHIA 1ZG3A 5DTRA 5P8WA 3AXSA 2FHPA 5DRYA 4RTPA 5GOZA 5HILA 3FTEA 2PX4A 3ELUA 4ER6A 2DULA 3E23A 3FPFA 5DM0A 4FZVA 2HMYB 2ZIEA 2FK7A 3KR9A 3C3PA 5EMLA 4C05A 1WG8A 3O7WA 3LCCA 4GOMD 4BLUA 1XCLA 4CTKA 8MHTA 4FR0A 1VPTA 2CMHA 2B9EA 3LL7A 1YFLA 1DCTA 2I6GA 2PVCA 2HV9A 5DM2A 2KW5A 4CKCA 4B17A 2GH1A 4OA8A 3MHTA 5E8JA 2Z6UA 2OB2A 2G71A 4AZTA 1XDUA 3Q87B 4G56A 4QPNA 5EHGA 2ONYA 3GDHA 4RTNA 3CJRA 4PYOA 1L1EA 3R3HA 2AS0A 5ERGB 2OY0A 2XBMA 1HMYA 2FPOA 3G89A 2B3TA 3RIEA 3BKWA 2QYOA 3KPUA 2AN4A 3I5UA 4PYMA 4OQEA 3ELWA 2AOWA 2Y1WA 3E8SA 1R8YA 3HP7A 3WSTA 2P35A 3A7DA 3P9KA 4GBED 5E8RA 4DZRA 4YV2A 4RTMA 3M6UA 5HIKA 1ZGAA 3FRHA 1RI1A 3G88A 5KYGA 5ICGA 4YMGA 2P40A 1G8AA 4ER3A 1JTFA 4OBXA 4R05A 5HEKA 3EVEA 1RI2A 1SQFA 1PJZA 3V8VA 2H11A 3AJDA 3FRIA 2G70A 2I9KA 2ZVJA 5EOVA 5EKUA 1NW3A 2B25A 2FYTA 5DTMA 5C0OE 3UZUA 5KQSA 1FP2A 1NE2A 5K8VA 4ISCA 2OKCA 4MWZA 4EMSA 2OXTA 4C07A 4HGZA 4OQDA 5C9ZA 4PIMA 4MHTA 4A6DA 3ORHA 4AUKA 1X19A 3SSNA 4RWZA 3GO4A 3HCFA 1X1BA 3V97A 2OZVA 2P8JA 1EIZA 1M6YA 4E33A 5E1DA 4P7FA 4M36A 5K0NA 2ZIGA 3TRKA 1UWVA 5FUBA 4M37A 5CM2Z 3UA3A 1KPGA 4DQ0A 3EEOA 1WS6A 1QAOA 2IFTA 5GIPE 2VDVE 4M38A 3MCTA 4PYNA 2UYHA 2YXEA 4AZVA 4EKIA 5K01A 3OPNA 3KQSA 4C04A 2C7RA 4HTFA 3LDGA 1RJFA 2AOUB 3KKZA 4FSDA 3UJCA 5LQUA 3GNLA 2C7QA 3A27A 5CVEA 5GP1A 1H1DA 2FCAA 4RVFA 3VYWA 5K0JA 1N2XA 2R3SA 1UFKA 1XJ5A 2HWKA 3FYDA 2AOVA 2OBFA 1NW6A 1YFJA 2R6ZA 5EMKA 3KPWA 3FTFA 4YUYA 3KQTA 2I62A 3G2QA 3LCVB 3OE4A 2P3LA 4NECA 2O57A 5ICCA 4RTKA 1BHJA 2PY6A 2HTEA 1EG2A 4E2XA 4BY9E 1I1NA 3JWIA 3K0BA 5GM2A 5CVUA 4RTLA 4PINA 2ZSUA 3B3FA 1JQDA 2PX2A 1QANA 3BWBA 1L9KA 4MIKA 3GU3A 3HVKA 5K0FA 2H1RA 3P9IA 5U4XA 4V0QA 3UJ7A 1KYWA
chains in the Genus database with same CATH superfamily
1Q0TA 4H4EA 5BR7A 1DEKA 3ZY6A 3FROA 3FFBA 3TDNA 1LOUA 4R2XA 3SFUA 2R2AA 4P22A 1WXEA 1ZY2A 5HR5A 5JMPA 3ET5A 2RKBA 2WJGA 2CVOA 4J03A 4AO7A 2WPNA 1YLXA 3LANA 1S8AA 1S1TB 5IFKA 4P92A 3ONQA 2E5LC 4L9AA 3FETA 2IC3A 3WC2A 1DX4A 4EPYA 1GMUA 4F4ZA 3P6YC 3HZRA 1EHIA 3GEBA 2Q5EA 2HKEA 2Z98A 4INPA 1ZH8A 3N2LA 1N54B 2H5IB 1M0WA 2CMDA 3L92A 1KOLA 3W64A 2K1RB 3USCS 4ZYXA 4MWOA 3WNBA 2W2VA 2ZPUA 3RTGA 3KPVA 4BQSA 1P4HA 1EE9A 4RQBA 1RM3A 3C5VA 3LK7A 3HHEA 4MUKA 4NQRA 4KGZA 1WY7A 3TQOA 2WA2A 2P4QA 4MQBA 4P31A 1CQJA 3D6JA 5L7WA 4GKBA 4Y2QA 1SIOA 4HRAA 5AK6A 1PJ3A 2BLLA 3BWMA 3ONEA 1FJXA 4N6OA 1CVLA 3UO0A 2I5JA 3RAPR 5DF1A 5JVDB 1TL3A 1BQ4A 2Q4RA 1JSZA 5YASA 2JFNA 4CQMA 1PI3A 4KUGA 1JLGB 2DRAA 4NLXA 2NYVA 4MIWA 1T8RA 3WIEA 3A4TA 4BTEA 1IUPA 3FHTA 3QI2A 1U26A 3X43A 1KFJB 4ZC8A 5K20A 2ZYAA 1GAOA 1NUTA 3BQ1A 5C37A 1CY1A 4O2AB 3TINA 2Z2XA 2QMHA 5CDGA 1W4ZA 2PROA 2QJOA 2F8MA 2JA1A 2UZ4A 2XUOA 2X15A 2P8SA 4B3RC 2BUBA 1GQFA 3DMTA 5GVSA 2BKPA 3R7AA 3NASA 5DDPC 4QU9A 4ZVFA 1OFUA 1RKIA 2E1MC 2QE7A 1WHSA 3KFXA 3BK2A 1U31A 1QVZA 4TQUS 4RH3A 2A0FA 4USIA 3KXIA 1JTVA 3DDSA 3GCWP 2E55A 3D6FB 2HT1A 1PYTA 3A12A 2B7CA 2PK3A 1VQKS 1TA0A 2UYYA 5CX1A 5HG0A 1X3LA 4CKWB 1SQGA 1U3TA 3VALA 1U9YA 3I62A 4FEEA 2G63A 5LN1A 1XALA 1EZ1A 5AM4A 4CPDA 2VDOB 2J6BA 1CIVA 1V5IB 1D0IA 1E63A 3ADOA 4K2XA 1YJVA 1Q19A 4BLOA 3IUJA 3R6WA 3ZTSA 3KYBA 4BMNA 3GLIA 5KFMA 4XFJA 3H8JA 3GUCA 4GF5A 3EGXB 2EIXA 3D2WA 4HDCA 1BHQ1 5DYTA 2GO7A 1BWQA 2LFVA 2QAGB 1H74A 3MOSA 2AJ8A 1HARA 3LP1A 1PR0A 3AERA 3VZHA 3DBLB 3TO5A 5KPJA 1AF4A 2WU1A 2X2EA 4UM5A 3TLGB 5JE8A 3GXOA 4URXR 5EVJA 4O2BA 1VQ5S 3HXPA 2OESA 2J7WA 3CLTD 3MCWA 1EGMB 2JLZA 4US0R 3CJ2A 4Q2LA 2IPLA 2EF0A 1RADA 3MBKA 3A14A 2DNGA 5B6IA 1LU9A 1VSBA 2OGUA 4W5OA 2P6TA 1CUYA 1X8JA 2C9DA 4OXYA 1HW8A 1HW9A 4M46A 3B1XA 4EFAC 3IAEA 4ANFA 1LQ9A 1EX7A 1P9LA 3UT6A 5T14A 3A6JA 5L4NA 1Z1ZA 2AMFA 2H5JA 2XWXA 4G56A 3KDSE 1H6BA 3MYRA 5JS1A 1HMYA 3MR2A 4PR6A 3LC2O 3SPXA 3LO3A 3ZPXA 1TUVA 2CXCA 3AJ8A 1IUOA 1W76A 3FNHA 2D0OB 3UMFA 3T61A 3G87A 4RFVA 2W4PA 3NFRA 2CKWA 5JMTA 4R1OA 5C4MA 1TMKA 5ETVA 1U65A 2J8ZA 1DBWA 5C8ZA 3QFSA 1NU8A 2FQYA 1Q8IA 5FUBA 3QKTA 4DQ0A 1SHJA 4GU5A 2ZDGA 3KLHA 3OPYI 2IJGX 4ARVA 1WUYA 2VOJA 4BZWA 4L95C 3FYHA 2Z3VA 2Y3IA 4BNMA 3S8EA 1N5QA 3E5MA 5CZXA 5CDSA 1ICEB 4A0SA 1FF2A 3FBEA 5A4JA 4JM1A 2IFXA 2QROA 4AJOA 1TQ6A 2PLFA 2WD9A 1YITS 4GMDA 3ULKA 3DZKA 4DFJA 2YNMA 2ZSEA 3OR1A 1PYSB 1CDOA 1OH8A 5I7EA 2X1AA 1S6OA 5D7BA 4CCYA 3MWLA 3V3KA 1T9AA 3ER8A 2ZJ2A 3I9ZA 1HT0A 5C8YF 3EYAA 4L0QA 4LSGA 2H5EA 5EKSA 1TJ3A 3KLIB 5JNVA 1RBAA 3P3DA 1J0CA 2VSNA 1IVNA 5F35A 5LPNA 3DOFA 1KQKA 4NEQA 3A3OA 3Q3JB 1XE3A 3KQQA 5BWOA 4RXUA 1CZNA 2GBCA 1CUVA 3EIXA 2CL6X 4FXOA 4FWBA 2WVDA 2Z2MA 1FK8A 4XLZA 2EFYA 2V9ZA 2GPWA 5D6NA 2IRWA 1X7HA 1H5UA 4NBLA 2UXBB 4BL5A 3P0EA 1I30A 4NPHA 2AIRB 1KY2A 1E0KA 5KHOC 1IYZA 1ZWKA 2NYRA 3VU3A 3HDJA 4OEHA 2PQ2A 4G85A 4DSTA 2FR8C 4IUFA 4H6VA 3TQFA 1F48A 1JE0A 5K1ZA 2IUYA 3FJ1A 1HO3A 4U2KA 3NEYA 1FESA 2P3SA 3BD6A 2V4JB 2QFJA 3SDEA 3FYCA 1I1OA 4PLPA 3WV4A 4JJ4A 4G1QB 3ZVMA 2HHPA 2MM9A 2A2ZA 4HWGA 3TEGA 4ARZA 3TFOA 4ITRC 4C2MA 1CEXA 3O9VA 4DZ6A 3ZHCA 4B3TF 4DCUA 4WY5A 2H4ZA 3KQUA 2MSWA 1GMVA 1GQSA 2BKUA 4BWVA 3V4IB 3M6FA 4U9UA 3KZCA 2QYCA 1XVTA 1Y1TA 4PNZA 5HF9A 4U7GA 1POXA 4LVOP 3PUXA 1VCTA 5EP2A 1EWYA 3EJMA 3CF0A 3TAXA 4FN5A 1LI7A 5KQGA 4MUIA 4NZ9A 3K0SA 1ADGA 1MLAA 2QU8A 2RI0A 1XNQC 4Q44A 3RUFA 3FZBA 1AB8A 2OHDA 1IG0A 3AKDA 3DV2A 4G63A 5E3HA 2JH3A 4OX9F 4CFYA 4WKGA 2INGX 3FD8A 2QZZA 3GJ7A 4G2TA 2DB1A 4MI1A 4ELTA 2NSJA 2XYHB 4U6SA 3R27A 1RQ0A 3JATA 2EFVA 2BXJA 1VSUA 3LZCA 4N7JA 1H2YA 1QRTA 2JJ1D 4H4OA 2H1HA 1ND6A 4HEA1 1DLOB 4V0MA 3MMSA 2BFMA 3OT4A 1E2LA 4FZJA 1T2UA 2BBWA 3MFIA 2VPXA 2KO1A 1IBLJ 2V8PA 3TD6A 5BQ3A 4Z7YA 3C85A 5FLEX 5FWXB 3OIUA 1FL9A 4QDOA 3LQ1A 4DV0B 3K5IA 3JQFC 4CDNA 3OE5A 3ZHRA 4LXYA 3P2JA 7REQA 1QCCA 3KUGA 5TIIA 2AW3A 1EA7A 2C03A 2IHUA 2VSXA 2PWAA 4OH7A 2IV7A 1SA0A 6FDRA 1T8TA 1XZIA 3QELB 3ETOA 3OXGA 4XLTA 5JC1A 3O0DA 5A7GA 1YR6A 1TCVA 1BX1A 3FPAA 1VJCA 2ODAA 2ZBRA 2I6WA 3KR0A 3PJWA 2A9VA 3AXSA 3KX2A 3T95A 3ZV5A 3VHQA 2H7XA 2AF4C 2ZTLA 2GIFA 1ZMTA 4EHAA 2L9DA 1ZVJA 3N6VA 1HQKA 3HL0A 1NPRA 4QIVA 1FEHA 2W7AA 3RAMA 3CLKA 3U3DA 3CDBA 4JI2J 3OC0A 4JI7F 1A5ZA 4G3XA 2UU9F 4JQCA 1H2XA 3TI0A 3FRIA 1XC7A 1F6WA 1L5NA 4PQFA 3WL8A 4DRXB 3C4VA 3VNQA 4USVA 4MRVA 4I1UA 1ZZGA 3I96A 5BURA 3G71S 3I2IA 3JD1A 3QYPA 2NO5A 4N3GA 4JI7B 5HE9A 1TCCA 2SKEA 4Q66C 3OPXA 3MF5A 4E1VA 3T5DA 3BH0A 5JSUA 2HTEA 3CZQA 4E2XA 5CVUA 4BP9A 3G5AA 1IJFA 2VPZB 4BJ5A 3EXHC 4ZYUA 2G09A 2J7UA 1UPUA 4KIFA 3TXXA 2J0SA 1B1CA 4HWTA 4XR9A 3K70D 2O54A 4RNOA 5EVCA 3BVPA 3TLJA 2QPTA 1X0VA 2OFGX 5IJXA 3LF2A 4B3MF 5B7GA 5CB6A 4WXMA 3A10A 2C4HA 7MDHA 2IPAB 4AU1A 4OHPA 4G37A 3EFHA 4QYIA 4M21A 3M3PA 3G59A 2COEA 1N34B 1WUJS 5TS3A 4N7TA 4CLKA 3WYCA 4QVGA 2QTCA 2IBKA 4B9MA 2TMGA 3WGVA 3OVMA 3N2QA 2Q79A 4YNBA 3V7YA 1S48A 2Q41A 3OTWA 2WSSA 1Z4MA 3GRZA 1XQ9A 1UDRA 1ISMA 2ZKLA 3QJ5A 1NVMB 4Q9LA 1YBUA 1EFRD 1OR8A 1P4SA 2C2DA 3C5CA 4EITA 1XRSB 2WF5A 5M34A 2HT6A 4A0HA 2QM7A 3K7EA 3KQKA 4BLRA 3OTGA 3QX7A 2VA8A 2PEYA 5DBHX 3HX9A 4U6PA 5KFIA 2CD9A 3ESBA 2AFHA 3QMVA 4ZVQB 1S1WA 4W9NA 1FNSA 3A6PC 2CYBA 1A69A 3F96A 4JLKA 2DCUB 3KNGA 3QGGA 4WKPA 2C31A 2PSDA 5FCDA 3L7OA 3HO1A 1ECFA 1XKTA 3N8IA 2DKFA 2JVKA 4FKBA 1H3NA 4B08A 2CQGA 3NEPX 4MVYA 4H7IA 2P41A 2Z1MA 2O6HA 5AT1B 4ZI5A 2RQ4A 4JFRA 4NPCA 1GGNA 3VKFA 1PQPA 4QWWA 4DF3A 4R1PA 3FMWA 1EUDB 2QTFA 2PJZA 3FZEA 2Q1XA 5T67A 2X1GA 3U3MA 4CIXA 1V45E 2XMSA 4ECXA 4IDOA 4OIXA 4MMZB 2IL1A 3U6KA 3AILA 3C14C 3CT4A 1EETA 5IAKA 3PRDA 1RBQA 1ZHFA 3MM6B 3PQ6A 3RASA 2UXBF 2EC2A 3DMYA 2OYCA 5CDUA 5AXKA 5BSMA 2CPJA 3DGEC 1QNLA 3PW2A 2VATA 1D0SA 1N1EA 1KMCA 3WBJA 1CETA 3M32A 3UK6A 4B3XA 2J3IA 1C29B 4UTRA 2B7BB 4R0NA 3MMZA 2Q4EA 4MH8A 5ANRB 4RQAA 2IEIA 1U6IA 1ZEMA 3SFTA 4NS4A 4F3RA 2XTNA 1RCXB 3CN9A 2AQ4A 1P6UA 4MW0A 1W7WA 5EIBD 4A1FA 1N4DA 4G1EB 4A2WA 3TA0A 2XVMA 4ZCTA 4RJLA 1PFGA 1UBRS 1T5IA 1TJYA 1T5SA 3QKRA 5ETSA 1FTNA 1WSVA 1HNVA 4I50F 3P4UB 4J7XA 5CFPA 1SJQA 4M1TA 1NBOA 1ULRA 1OLOA 4FF4A 2RK3A 7GPBA 1B42A 2QTNA 2VNSA 4B2LA 2BE2A 4QT4A 5FPYA 3HHNB 4UMDA 3DFZA 1TECE 1PNRA 2GFFA 1M5OC 4KRXA 1VBNA 5IANA 3C87A 4F04B 1IBLF 4RHYA 2ZSKA 3K1AA 3GAMA 3EF1A 4CDMA 4WFNQ 4NNJA 3HDQA 2ES4A 2XW6A 2YS7A 2AP6A 3O4VA 4LFBC 3K0JA 4DLGA 3SC3A 1ZSNA 1DT3A 3FOBA 3PR2B 3ZZ1A 5DX0A 3DL7A 2ZS9A 4QDTA 3G49A 3PFIA 2Z09A 3KCQA 3LUHA 5HILA 3NETA 3U4AA 2BKLA 2FRVA 2WW8A 1YRYE 1Q78A 4M8KA 3N6XA 3V7UA 1EQ2A 4BEJA 1SRRA 2UVWA 4ZOAA 2M6SA 1R43A 1BHO1 3E8SA 1G42A 4S04A 2W9AA 4DSIA 2HM7A 3GFYA 5DG9A 2QI9C 3M4YA 5JANA 4U8VA 4HFJA 5B58T 1TL7A 3QH4A 5E6SA 1N5LA 2PMZD 2ZVSA 1GPBA 2RUGA 1A9QA 5ITZB 2UYHA 3BN3A 3LMKA 3AG6A 2LKCA 2CT8A 4YQZA 2QD4A 1UFKA 5EHNA 4TS3A 2AOVA 2BJDA 5JFOA 1NUPA 3F74A 4N76A 1JT2A 2MZTA 4BLGA 2R68A 2MZSA 1KKLA 1XPRA 1Y9DA 4B7ZA 1ZCBA 2NTNA 1NM5A 1P4EC 2YOFA 4QBKA 1KPIA 3D9QX 2I3AA 5C7PA 1QHEA 2H3EB 1HI9A 1H6KX 5JPDA 2J85A 2QL7B 3DV0B 1JAXA 1DHTA 4HWRA 2IX9A 4O4IF 4C4WA 2VQSA 1JLAA 3LHFA 5LCXA 4I0WA 4B35A 3O8QB 5HM6A 2UU9B 4ICLB 4HDRB 2FPXA 3M7VA 3HJGA 5LBUA 5BXYA 4F4HA 4UOFA 4URSA 3WK7A 1S4QA 1US8B 4F9FA 1H4VB 2G07A 4CLEA 2VG6A 4RIIA 2CLKB 1S6QB 1J9GA 3B1JA 4ZVEA 3NHUA 1K6XA 5A6SA 5KYXB 3GL9A 2PZKA 4L1KA 2XLJA 3EUAA 3L7BA 1J9ZA 2AMLA 4XGKA 1YJRA 2C2OA 2PRSA 3PIRA 5J2UF 3C7TA 1PILA 2GIQA 3KKQA 5C8DA 3JCZA 5E7MA 1M1NB 2ZNZA 5BW4A 2AHRA 5J2MB 1JMYA 1NW8A 3LBHA 3EPJA 1L5HB 3MQ2A 1XCBA 2DNYA 3ICOA 2YX4A 2VJVA 1UWCA 3SHOA 3QNWB 1FRZA 3UAOA 4TS9A 4DR1F 3EWGA 4OYZA 4KXFB 4MTNA 4FHEA 4CF3A 1XEWY 1G4HA 3T9EA 2ZOGA 3K1ZA 4G1PA 3DE0X 1PR4A 4UC0A 4KBIA 4WGGA 3LUDA 1VI2A 2RARA 3COYA 3MT8A 2PGCA 3WHLA 4QYSA 2IYOA 2VDUE 3U7IA 3TR6A 5AIBA 2IP2A 5AOVA 4GOND 1XMOB 1KZ7B 3DV0A 4I1SA 1GTSA 4V0KA 3EEFA 3QWHA 3AUJB 3GUHA 1FYWA 2J9FB 5KT2A 2CXQA 3L0CA 2VXCA 4WYLA 1YUBA 2F6RA 2I54A 1KEEB 3C6BA 3M3DA 2O07A 1EXVA 1V6HA 3EMDA 2EKBA 1CVJA 3NLCA 1KERA 3FSYA 4MV0A 5GTDA 2O06A 2JFDA 4BX3A 3R9KA 4MGIR 4BFXA 1SUBA 4XCXA 2ZYUX 2ODPA 2FOXA 2ID7A 2GWHA 1QVFR 1C4OA 2QF7A 1CRZA 2OE2A 3VSAA 1FBNA 1YBVA 4LRBA 5E2AA 1OPXA 3GV7B 4D9JA 4H7HA 2VKQA 4UU7A 5REQB 1SOUA 4JEIA 4D6XA 1P5ZB 4CTOA 4QXRA 3ZWQA 4CIAA 3HCDA 1D1PA 1JXAA 3VC1A 3KHLA 4BDPA 3KUKA 1X9IA 1CHNA 1RE0A 2CZGA 3QLJA 1OPZA 4FDAA 2X5KO 4L7QA 3C8UA 4R1TA 4CV3A 4KFBA 3VVTA 4MV3A 1E7RA 4Q3DA 1OFIA 5SY9A 1TUIA 4CMHA 4G86A 2V96A 3QSYA 4TMKA 3UAXA 4IJ5A 4TXJA 3GZTB 2RHBA 1QP0A 5L40A 4XX1A 2E5LB 4X4TA 1R0CA 4CV0A 3BJEA 2AWNA 3T6JA 3QE4A 1KY3A 4BKOA 4DLVA 5DYNA 1M66A 2XHEA 4A8SA 1HKAA 1SL0A 3PC8C 4MQUA 3C7DB 3SXJA 4G4SO 4I7FA 1JLLA 4ARIA 2AQ8A 4JUDX 3M6VA 1E92A 2OLWA 2IT1A 5F73A 1RHRB 4NYJR 2CHEA 3F7TA 3G13A 3L93A 2DFNA 3BWDD 1L7BA 4QLOA 3SXUB 3BTOA 4Z37A 2DPLA 2LRHA 3MWEA 3TD9A 1RHUB 1KEVA 4ETNA 4RKUC 3EF3A 2IYNA 1SB8A 2WF7A 2WWYA 2I2XB 1MJHA 1WUUA 3ZD7A 2NVUB 3AXKA 4PNHA 4EA7A 5B3JC 2E6KA 1V6CA 2O5RA 5TQ2A 1E9FA 2C4NA 4WFAQ 5JS6A 1Z7YA 1HRKA 2C4UA 1T0JB 3PKYA 3Q8SB 1RQLA 4DLLA 2DLDA 3LA6A 3NGUA 3DLHA 1RT2A 5JAOA 4UVDA 1SC9A 2QG4A 3IVXA 1G7TA 1XIQA 2A67A 3SSNA 2WFMA 4X94A 1YZVA 4IJWA 2JD0A 3UM9A 1FKOB 1ACMB 5FA6A 3ENAA 4RGBA 2QUHA 2OV4A 5KFQA 1R3NA 4DB2A 2NSDA 2OCLA 4UOZA 3O03A 2FGOA 3C41J 4FXWA 1R4MB 1ABFA 4JC8A 2ZBQA 2HIQA 4FPIA 5IKMA 4LF6C 3U61B 4H6XA 4RSRA 1Z2EA 1QNFA 1D6NA 1Q20A 2XOKD 2I67A 4I6EA 3OZTA 1ZB9A 4OYIA 5BOSB 1ZSYA 4IXWA 4GLLA 5EFOA 4FFWA 1VTKA 2F65A 4QG7A 3H0EA 5HIJA 2CA9A 3CGWA 1G17A 2LBPA 2CVQA 2R96A 4DLRA 1DQZA 3K70C 2V4JA 1J0AA 3DRRA 1N6HA 3T19A 3HHLD 3UFCX 4I4LA 1W0CA 3WJ7A 4XM2A 5KFAA 3L06A 1VHIA 3O3MB 1W0KA 2J48A 3L09A 4EF4A 4PUGA 4TLLB 3FMBA 1LBTA 3C4JA 5K85A 2MQMA 1QO9A 4WXRA 4EG6A 1HDCA 1Q83A 2FG6C 1RCOB 3U7GA 1KSHA 3N4WA 3NWPA 4DA7A 4G81A 1MUUA 2XZDA 4RLHA 4EK9A 4UQLA 4BIMA 5LZ9A 4FGKA 4ZCMA 3DS8A 2I4IA 3EICA 5JNLA 4UEKA 1P1KA 1KQFB 3TEJA 1II9A 4B3SC 1G8JA 1Z6ZA 1X70A 1VC5A 4OHUA 3B52X 4L22A 2OGTA 3C3EA 4NCGB 5JBNA 4WEOA 4K4SA 1Z37A 1DBPA 2HNDA 4KBYA 3VV3A 1GD1O 3PW0A 4J3FA 2IZZA 4M89A 4HVTA 2QMUB 3RW9A 2ZAMA 2C28A 1RBMA 2ZSAA 1ZJ6A 3VAAA 3ESZA 3LUAA 2UXDF 1B0VA 4EYHB 3A6KA 4QSMA 2Z58B 4ZJOA 3NAMA 3NHLA 2GK7A 1WKBA 2JVIA 4K6MA 4YRDA 2X40A 2WE8A 1QOZA 2UUOA 9ABPA 3OTOF 4YRKA 4PGMA 3Q3VA 3GFFA 2W01A 2D7JA 2HI0A 1A6LA 1AUDA 2XI2A 2RK6A 4RL4A 1JU4A 2IKSA 1WMDA 4ZOBA 3MUVP 5BWBA 3ICWA 4DX8H 3STXA 2QW1A 1U7LA 4Z9XA 4K9LA 2APJA 4KC0A 3BDVA 5I3QA 1QVWA 4D4JA 1C0TB 2C1EB 4EUSA 3PJDA 4IPTA 2IRXA 2QV7A 2ANBA 1YJ7A 1EGQA 1NH8A 3GIKA 3KG4A 2VJCA 3I5BA 4WESA 5CG1A 2C9CA 3FDZA 1N0UA 5JZVA 4MYTA 5GONB 1JDJA 2LD4A 2I1VB 2GXSA 1FDDA 4MV5A 1K2VN 4FIZA 3RUAA 2C3UA 1JAZA 3KZXA 4YONB 3FZ2A 3KTOA 1T8YA 1FUGA 4PAQA 3GBPA 2GVDB 1V25A 4S24A 2NO9A 5J1TB 2VN8A 3H4VA 2IOYA 4XB6B 3ABRB 4H7EA 5DTEA 3W6ZA 5E7JA 1S1UA 1BY9A 4QL3A 3E01A 1AKUA 2Q50A 4J7AA 3L43A 5EFZA 3BMXA 1HLDA 4HUQA 3LALA 1SCDA 1VI5A 2C2ZB 5BNWA 3R9LA 5I7HA 5I3CA 2FMXA 2GKGA 2IOHA 4TTAA 4MZXA 5LZ7A 1W5SA 3B54A 2HHJA 3DLTA 2F8TA 4BC9A 2W4IA 4QYRA 3B1FA 4M1MA 3EIUA 2QRMA 3G8QA 3IP3A 2GJIA 2GMLA 2BUNA 1NNLA 2QTTA 4LQLA 2ZK7A 4UQTA 1RWMA 3BEOA 3KSUA 4NFLA 3UEOA 2BISA 2WJYA 1FQJA 3SR0A 2FC9A 2I55A 4WLUA 4H4OB 4Q7AA 5DM7Q 3UZUA 3LYUA 4MVJG 3HP6A 2ASJA 1JQLB 2J9DE 4LUBA 2OXTA 2Y66A 4OQDA 1FDIA 3ORHA 4BNUA 1NZJA 2VYQA 1P7PA 1JWLA 3KJHA 3Q9UA 2V4QA 1WB9A 2YX7A 2H9YA 1KPGA 2HIHA 2ZAOA 4V0OA 1UKYA 4IOAQ 4NESA 5EP3A 1UC8A 1O4VA 2KPOA 5H8WA 3VX3A 3KEOA 2CBXA 3I9V6 4F4JA 2M9MA 2QOEA 3ILJA 1Y5MA 1E8NA 3OBIA 3BJIC 3FTFA 4WCDA 4ZAWA 3LU1A 3RRMA 2J6HA 4CQLA 4JIMA 2FX3A 2M8DB 4ZVRB 4ARAA 3C3YA 1O5OA 4XSGA 4HNAB 3WXMA 3F1KA 1OB2A 5AR1A 3OHPA 5FDLA 3FPBA 5SY6A 1XFDA 2L08A 3N3BC 1IZ9A 4OTZA 2X1HA 3JTPA 1LD3A 4PWYA 1NN5A 4HAXA 3R9XB 3BS9A 2AXPA 4RK7A 3Q8WA 3KHTA 4BNDA 1XLVA 5LIPA 2OFWA 5CU7A 2OT3B 4H4CA 2UXBJ 3GIIA 1RWBA 3VR6D 5C81A 1U8XX 4JL8A 1PLJA 4BNIA 4HDAA 3QIAA 2UUBJ 2W11A 4P3PA 3LBAA 5AHKA 5KKCA 1SUWA 3Q23A 4CQMB 3KB6A 2ORED 2GIRA 4GMKA 1IN0A 2XBPA 5CXXA 4UNSA 4LAFA 5ITSA 1J2RA 2I5JB 5FBVB 1NY5A 4K87A 3QZ8A 3QP9A 3QI7A 1A2BA 3PXDA 5B0FA 3JQPA 4G5HA 4JK3A 3CQ3A 2VNHA 1QV6A 2MY8A 3I53A 1RJWA 2G5GX 4LJ7A 3FUCA 5GMDA 5EJ5A 2NPFA 1UPPA 3X1XA 4YS2A 2XV1A 1RLCL 5D78A 3TW8B 2FSIA 3FTCA 3UMMA 1KOGA 3AHIA 3FUUA 1RHKB 2YZMA 2NCKL 5TVKA 4J1SA 1U2QA 3EZXA 4A16A 2NZCA 4NJMA 4MKYA 721PA 5TMPA 2OPSA 3CA8A 2P0AA 3BX1A 3L6BA 4KPEC 3KKMA 4ICLA 1DMSA 4HDRA 4TMVA 1BRTA 1F38A 2OFFA 4EI8A 1TQLA 1PFWA 3AW9A 5J1EB 2BBOA 1MMFB 4YREA 1G7CB 4AY6A 1LH0A 3QA9A 4CKCB 2V54A 4QVIA 1UC9A 2ZIXB 5LQAA 3UX2A 4UAUA 5KKNB 3FCHA 2WAQD 4JNCA 1NASA 4CMKA 5C2CA 2H52A 2B30A 5SUHA 2XDYA 2O0HA 3PNSA 3VH3A 1RZRD 1Q1KA 4ALNA 4TL7A 3LYHA 2JI6A 3G0DA 3L7UA 2YNGA 1RXIA 1N8RT 1H2HA 1WQ1R 5JFGA 4TGLA 3VYSB 3UHPA 4D26A 4JENA 1M0SA 2GA9A 3RRGA 4BIIA 3IRWP 1ZP6A 1VR6A 3T7AA 3H4IA 3T52A 3VYVA 3CRNA 1PC4A 3GIWA 3FUVA 1QDUA 3O3CA 2E3JA 1XRCA 4K40A 1YS7A 2ZRAA 2ZYVX 2J0VA 1FC0A 3OM1A 1LW0A 4DG1A 4JI2C 2Z5VA 3AVVA 4DMUB 2POQX 2CBGA 3JPYA 3ODGA 4YDHB 3F67A 3EGOA 1X4FA 1D7AA 2OCGA 3W2WB 1M1KT 3ZX5A 4CLTA 3O74A 4D45A 4FFPA 3MK31 3VR5H 1KO1A 2MT9A 4BJ6A 2FE4A 4CNYA 1VQYA 4RU9A 3NGTA 3FYUA 3HKEA 3ENWA 3OETA 2XI3A 2PGAA 3HY3A 4G1CA 3ZZYA 3AHGA 1YKWA 1NNDA 5JSFA 3RH0A 4IBOA 5JOQA 3IB6A 3PR1A 2RONA 1JV2B 2QT9A 2G4VA 3DN9A 4BCDA 2C9BA 1ZM3A 2JPDA 1PX2A 1NHUA 3PV0A 4DPKA 3SCJE 1YNOA 3TX2A 4IO9Q 4GC6A 4MR7A 3EZ6A 1EAMA 3VR2A 2GO8A 3TLAA 3B36A 2HW3A 1DDGA 1JJ2R 3I31A 3CCBA 3Q41A 5JD5A 2EK1A 5MAOA 2ZITA 1ZD2P 4X7BA 3SQNA 4YQFA 5IV4A 3VAGA 5CTAA 5P8WA 3E3LA 2DULA 5E4JA 3ZIAA 2R7OA 1W25A 3WLTA 3Q7SA 5HA5A 5H9EJ 3MOGA 2E5GA 3DDNA 2C95A 4NXMJ 3ZIUA 4O4GA 2XBMA 3L9ZA 4C0HA 1WOSA 1R8YA 2WOJA 4EX6A 4EU0A 3ANNA 4IQ4A 2HHHJ 1SZCA 4QIFA 4CWBA 5GQSA 3HN2A 2YUTA 3IBWA 4QPTA 2D2XA 3CWZA 1GKIA 4WXEA 1K8AT 4RWZA 2OZVA 2Q5OA 2OD9A 3TRKA 2DFDA 5AXBA 3WYEA 3WGJA 3W6UA 4E88A 4XEHA 2WW4A 4ZVSB 1W47A 1XTJA 1GT8A 5CVEA 1PJLA 3FKSA 4M0EA 3ADDA 4WD3A 3PKMA 2R1ZA 5SYMA 4MWBA 3U1LA 4DSFA 1E3EA 4CKYA 1Z2PX 4UU0A 2SCUA 4HWOA 1SIWB 4MVJI 2Q6TA 1VQOS 4DV2J 1CIPA 4LUCA 4JQOA 4QYZJ 2H9ZA 3C7AA 3BWVA 1XTQA 3N6RA 4KVGA 2C7PA 2YL2A 5L95A 3U5ZB 3E53A 2BQ3A 4C76A 4DV1F 3IT0A 2NOAA 3W8GA 2X2OA 5AK3A 5DYWA 3RSCA 2QSZA 1EM6A 4YUWA 4BN4A 1F3OA 1RZVA 3NKYA 3LP2A 4WKYA 4IEEA 3HHLA 1LDEA 4QU5A 3GT0A 1CY0A 5AVJA 3NGMA 2HYIB 2R97A 2XDQA 4K5SA 1B16A 1AZSB 1E2HA 2DCUA 5CNMA 1XU4A 1ISJA 2HHTA 5LCIA 1F3FA 3EZYA 2VA3A 1NXVA 3C70A 3F9IA 5KFWA 1M6XA 4P80A 3H86A 4YR3A 3LY5A 3WIOA 2C42A 1TL3B 3HCBA 4XI9A 4X65F 3ZE9A 2J59A 1ZM2A 2OILA 1XR5A 3C1UA 1W85A 2BN4A 2PX5A 5JUWA 4YRIA 1LS1A 4QYMA 1N1DA 4RKQA 1EKSA 4ESVA 2PR7A 3TRIA 1F9EB 4ZN6A 2UUAB 2EWWA 4X1OA 3K0EA 4C8MA 4MV8A 1SGWA 4CTAB 2J5XA 1MENA 5JSQA 4LMAA 1GCGA 2HQDA 4I6YA 5AW7A 5A1IA 3AVUA 1GPLA 2Y05A 2QL9B 4MPRA 1X7YB 5CB4A 3WGZA 5A9SB 3S1TA 2CKDA 3CE9A 4QDXA 3AM5A 4X64B 4KR6A 1HY3A 3E1SA 3P9SA 1QMPA 4UUMA 3WL4A 2EP7A 2DK2A 4KIAA 3HPQA 1M6NA 3OT5A 4OHVA 4HBGA 1FFBA 1DHRA 5KSYA 3DLIA 3IIIA 5CVVA 2GX6A 5CDFA 4UM9B 2NAPA 3ZJ5A 3OCCA 2VB6A 3NHSA 1NK5A 3FI0A 4BBPA 3FW1A 3CO0S 3T9AA 1F8XA 3DBIA 4HH4A 3EHEA 3POTA 2XQCA 2IIQA 2BT4A 1UM9A 3RYHB 1YZUA 3OCZA 3DE4X 2UYGA 3C8DA 2VTBB 3DGPA 2OMKA 4JXZA 1XDWA 4YDDB 1RM5A 2JCYA 2WVBA 4XZ3A 4UOQA 1TMJA 1FTWA 1Q1GA 4RHEA 1WXWA 3AV0B 1MU2A 1DG1G 2E5FA 4E3ZA 4UZBA 4U8GA 3IP5A 4MINA 2V9WA 3R0QA 4H2DA 1AU9A 3PNIA 1W4LA 5BVHA 1I6MA 3II6X 3DFEA 4CLDA 4RE5A 5K14A 3KSRA 2CWDA 2ZUUA 1HBUB 1Q11A 3UQZA 3NMRA 1BOFA 5IK2D 1TT5B 2QR3A 2JFVA 4PPYA 4G5FA 4DZTA 2E4XA 3LP0B 4ZN3A 3BXOA 4L4SA 3HBFA 3DMPA 4A8JB 3H13A 3VOTA 2VP3A 4V1CA 1NWHA 1W34A 1EFCA 1N2HA 1E9CA 1UQRA 3I2GA 1U3GA 4L2IA 1XXLA 5GWXA 2WJHA 2G80A 2I99A 4L8LA 2PWYA 1PEDA 1QK3A 1Z0UA 1XP5A 2WK1A 2RHHA 4A8HA 3LT2A 4P83A 3C74A 3WC0A 3WNQA 3MGBA 3PEYA 3HR4A 3I01M 3SXPA 2VZ9A 1D4AA 2V7EA 4LSMA 3RREA 3F41A 2HH9A 3LVRE 2FA9A 1TKBA 3U4QA 4NI2A 2PLNA 3LBNA 5A04A 1E0DA 1T05B 4FT4A 5JG7A 3CLSC 3F5FA 2Q99A 2DNRA 2DHSA 3OP1A 4KUHA 2GAIA 3R6TA 4HEHA 2PMCA 3O2QB 2OIHA 1R2QA 2KZMA 2CV1A 2O8BA 2H59A 3M1VB 1GRCA 5DWDA 3C6ZA 3A0RB 5JSHA 3K4QA 4UZCA 1TZ2A 4L3WA 4BC0A 3NTUA 3V7WA 1XRNA 1H2BA 3WRYC 4AZTA 4CZCA 1GXUA 4X85A 1E20A 2CYAA 2Y71A 2AF6A 2QZPA 1NQXA 3LG2A 1K63A 3DDKA 4JBHA 2EARA 3E3MA 4Q05A 3V2HA 1Z07A 1GHTA 4NATA 2Q2WA 3V4LA 6ADHA 1P4AA 4UDYX 4DSJA 2B1GA 3KYCB 2R5NA 2F55A 4MWZA 1M1YE 3A1TA 3P20A 4O2AF 3N6NA 2VP5A 2XA2A 1K7XB 2X4IA 1PS9A 1IB8A 2ZIGA 3PI7A 4QUAA 5BN3B 1A27A 4Q93A 4U2DA 3NH6A 1P2DA 2NAFA 4C43A 2BW0A 1YL6A 4DWIA 2NN3C 1IB6A 2Q7OE 4HDKB 1C2TA 1TFUA 2BJWA 1X86B 2PR2A 3E2EA 3USES 1TFWA 3RJTA 4H08A 3EIOA 2B4TO 1X80A 4HVAA 4BYMA 3EIFA 3P9ZA 1VFJA 4NEGA 1I0LA 5JWHA 4FNGA 1NBEB 2Z2ZA 4CLOA 3BWBA 1JH9A 4KKXB 3C15B 2GNKA 4BGUA 1R9MA 1YA4A 2H1VA 1Z47A 3L8HA 1Z88A 4MHOA 2MSSA 3OOSA 1D8ZA 1KK2A 1FRNA 1RWVB 2GJFA 1U9JA 3T7RA 1LNZA 5AM3A 3L7PA 1CUHA 3LT1A 2CADA 4LJMA 4IV0A 1YRXA 3SBXA 3QRRA 1OAAA 2AGQA 1YTUA 2Q8PA 3VPFA 3JQBC 1P9RA 1MDFA 4CIDA 2XPCA 4OREX 3RFUA 5FOSA 4NZPA 3ZHOA 4WIAA 2J8SA 3ZHUA 3CV3A 2XZTB 3NHKA 1RWNB 5KTMA 2VJDA 5HGJA 4JXKA 3KJFB 3GFZA 3NBYC 3NC4A 5E3JA 2CC2A 3QXHA 4AL5A 4WZAE 5A2GA 2YTCA 3M6WA 1HDZA 1E79D 3QVJA 5CG2A 2H3HA 2YNGB 1CJTB 1HBNB 2DBVO 3AEXA 3L8MA 5KFLA 3E7PA 3AI7A 3BYZA 1BS9A 1SKSA 2FQQB 4HAZA 3GW8A 1UT5A 1M75A 4OXXA 3JAWA 3PCXA 1FF9A 4PG4A 3W9JA 3MAAC 4JI4B 1PP4A 4MW5A 4WNYA 2E29A 3QRPA 2KI2A 1JNYA 1QHNA 2XB9A 4IX1A 1GO2A 1KMHB 1MNAA 1MG5A 2O3DA 4LZJA 4Y0VA 1OAKA 1BOOA 3L79A 2UZ1B 2VUTA 4UUOA 1M2NA 4PR0A 5J1EA 3E9CA 3LHDA 4IJ6A 1KP2A 4DLYA 3ZWAA 3RU9A 1XPUA 5FTKA 4JP8A 5CT6A 1YU6A 1M1YA 3FCXA 3T6KA 3PFWO 4C7VA 1J00A 5JAZA 2ZH4A 1THMA 1ZCJA 3Q7PA 1WHWA 5ES3A 2R7UA 4LEIA 4E4TA 4YJGA 4MA0A 2X0KA 1Q0UA 2RT3A 4P2SA 1OTXA 5THKA 1D1SA 2EL7A 4Q24A 3HMQA 4BMZA 2H0AA 4AP6A 2CN1A 2H07A 2V59A 3PRYA 3DOEA 4NBKA 3KWFA 1PZGA 3QXSA 4Q4DA 1PKUA 1O0SA 3NXZA 3JV7A 4Y98A 3V9PA 1RFGE 5FULA 2AYXA 4I5DA 5EQDA 3L4EA 3UVJA 1RU1A 3G6YA 5A1TA 1G3QA 3GRFA 5L3ZA 2XLKA 3MM9B 3JYOA 3VU9A 1P39A 5EKDA 2WJ6A 2AE1A 2F17A 2ZFHA 3HF5A 2QTHA 10MHA 2IZ0A 3IP7A 5IN5A 3GQBA 3N2KA 2PV7A 1HNXC 1Z6QA 4BHQA 1A5SB 1WOYA 2QG9A 2RHQB 2QTBA 2BFDB 2CLLB 1PAUB 2FSVA 2QFIA 1RT5B 3J80D 3GIMA 5HGXA 3E9EA 4Y0AA 1UODA 4J9SA 3DL4A 1OD6A 3CULA 3UNXA 1U7HA 1RAAB 1GXSB 4BMPB 4A6PA 1YU9A 1YR8A 1J5EJ 5C1PA 2B8PA 1R66A 2PXHA 3EXEA 3HP1A 1JJFA 1E6LA 4Z9AA 5AW0A 3HO6A 2QJTA 1J9EA 1A8IA 1YIAA 3KG1A 1BXRB 5LMUF 1KAGA 1LQUA 5KG6A 3LGSA 2LQBA 2VRWA 3D4OA 4DXAA 2HCRA 1I6WA 5LJIA 4O3OA 2JLYA 4EI7A 5ETPA 1RJJA 2FW6A 1ZNQO 5KJ1A 2NYHA 3HHPA 3D28A 4Q7KA 2FHJD 2D4HA 1SR8A 1SKUA 4UHFA 4QQRA 3NY0A 3RJMA 2OBYA 2QJRA 4ZQGA 3THXB 4JYMA 5DM0A 3ILOA 2HRCA 2IVFA 1YBFA 4K59A 1DC6A 4X93A 1DQRA 1TIPA 1UBUS 5MN4A 2IYLD 1SHTX 1U6JA 4PF1A 4NCXA 4GYJA 4DZZA 4ZZ0A 5AVTA 1N56A 1M8PA 3SFZA 2FWIA 1WEZA 4S1WA 3P19A 3ZVKA 1RACA 3FDJA 5EZYF 5C0OE 3T4XA 2H1YA 3IO1A 5CA1B 5FOQA 5CX1B 1B3RA 3OZFA 3T7DA 3VAFA 1M1ZA 3UKOA 1WU8A 3PNVA 4UZEA 4E33A 5E1DA 3ZC3A 2PRKA 2JDIA 3GGSA 2DUNA 3E01B 3KKZA 2YZ7A 4WSOA 4PPDA 5LYJA 1CUJA 2VRBA 4BS2A 3LPCA 3HKBA 1RBYA 4QWCA 4L6IA 4NECA 1YQWA 2GTHA 1M6VA 2JEZA 4URHA 2ZZTA 1AGNA 1QTQA 1I3OB 1JX4A 5EWLA 4PLZA 3F8SA 1RXYA 2NLOA 5B0AA 4KIJA 4DVGA 5JCJD 3HKZD 4JMPA 2QKYA 3ZDBA 3TSZA 5KFEA 2PJDA 4JYZA 4H1UA 2OM2A 4QDKA 2UYQA 1CUGA 5A9RA 3IL2A 3F7MA 4XPCA 1RBOB 3NKVA 1CJUB 3D1LA 3OLZA 1KYYA 3V8RA 3RIMA 3BWCA 3GLVA 4RIEA 4TTQA 3GJQB 1NJ1A 4XA8A 3UQSA 3B6ZA 2Z30B 5HP4A 2XNCA 1JQ5A 2XTZA 4BX0A 1HL6A 3BD7A 2JX2A 5TF0A 3VX4A 1O94A 2EG5A 4XLLA 4I4IA 1BROA 1PNQA 1YDMA 3M33A 3W5BA 4M1KA 2Q6BA 5JSYA 3IILA 4GZ5A 3JWPA 1IK4A 2GPSA 1J5EF 3RRNA 4Q9NA 4OOFA 3E7XA 1VLLA 4LXQA 3RHSA 1CQJB 2R62A 4AT1A 5D0GA 1AMUA 3DVQX 2LU2A 1XTZA 2VA2A 5KYWB 2W6QA 4X1YA 4JLAA 1BE0A 3OX3A 4IRKA 1OYYA 4K4ZA 4DFMA 1S9HA 4XD7A 1CS0A 1Q7BA 3E7DA 1U8TA 3L9WA 1FVSA 5F2KA 3AL3A 2YHBA 2PZAA 5LP6A 5A2QY 2HSZA 4NAUA 1WHXA 2FW9A 1DUSA 2AV5A 5SYAA 4LGYA 3NYIA 2RHMA 2MQOA 1W88A 4OI6A 2EBFX 1EGAA 1PZNA 2PXCA 4ZZIA 2W22A 3OEEA 4RS3A 2AGOA 5MLCV 3ISVA 5CH5A 3U56A 1QSLA 2H7VA 3EERA 3ZGLA 3GV5B 3A2KA 2ZBVA 1XAGA 2NO4A 3PGVA 1Y4UA 4EGQA 5I47A 5HLFA 1QE5A 1XVIA 3D3WB 1T9XA 4OYMA 2AJLI 5A2QD 1Q1NA 3RS4A 4D92A 2W2TA 3WKAA 2OPSB 1W36B 4NJMB 1DY3A 2V9PA 1T5LA 4PUHA 4ZPAA 4P73A 1TJ4A 2WICA 1D07A 3IAM1 5FRDA 3CJEA 3GEPA 1P0PA 2EKQA 4RNNA 4IFYB 2IYFA 4W9MC 2HADA 1XRBA 4UOEA 3BAZA 2YCLA 3WBBA 1RTJB 4WJKB 1E1KA 3UMRA 3V4SA 1C0UB 4D56A 2ZULA 3ELYA 4DB4A 4OYHA 2GEVA 3W5ZA 2RMLA 3C39A 4Q34A 3NX4A 2R7TA 1LRJA 1JHMA 2XNKA 2GPNA 1Z25A 4RKEA 4MVXA 3U7FB 4QFDA 1UBKS 1F51E 3KU1A 3T3FA 4MQ5A 3D54A 4BFZA 5FWYA 4J0FA 4YUDA 4OHCA 3BE8A 3T3IA 4AS2A 3HVHA 2QRVA 1L5ZA 1V43A 1K0TA 1JHUA 2B34A 3ABOB 4ZHSA 4CM2A 2JVOA 2IYYA 5BSGA 3VISA 4GMHA 4FDFA 4BNFA 3CCLS 4YV1A 2CHGA 3DMNA 1S2GA 2AZDA 4CL3A 5BYJA 1XHJA 2BEJA 1Y9OA 2VF3A 2VT3A 5JZ9A 3N2IA 3QLVC 1KRXA 2IXAA 4G5RA 2V67A 3MDFA 5EINA 5LZ4A 3CNNA 2DXIA 4J0GA 2KDNA 2GASA 1N4LA 5AI4A 1CC7A 4ERDA 5AI8A 2GRUA 1U1MA 5LVAA 4TTRA 4JI7C 4FMCF 2NZXA 5TGDA 3MTIA 1QGYA 4OOEA 1MJGM 3AR9A 1UJCA 4KKOA 2FK7A 3U31A 1UJ4A 4AF6A 2GJSA 1Q91A 4YY3B 1NRXA 3COWA 1UEXC 3R0XA 4Z0HO 3HGTA 1XVVA 1Y8QB 5B4UA 1RTKA 1JVNA 1TLFA 3V8VA 3TLYA 3AB8A 4DN0A 2BFFA 2ZSDA 4CLUA 2OMOA 3W06A 1NY6A 4LVCA 4ZQIA 3WICA 1J99A 4LFAB 3V4ZA 4XIFA 4EBDA 5BSRA 4NOZA 4N18A 2OHIA 1ULTA 1XYGA 2W2OA 4ARCA 1T1GA 5T5QA 2XF8A 1JR3D 4AS3A 5BV0A 1H1DA 1IBCA 2ZBDA 4O4JF 1OIXA 2ZM6F 3OHMA 3S1AB 2AKAB 4EHFA 1QX3A 4DLBA 2HOQA 4BY9E 1AH2A 1T3GA 1O3YA 4O63O 3OLCX 1KF0A 1FRFS 1GN9A 1W5EA 2BY4A 1XERA 3GU3A 1BXRA 1R5OA 2V4UA 5LOVB 2Z2LA 1JKJA 4PWZA 1SHLA 1NJSA 1QAXA 2QLBA 3CH7A 3WIUA 4QXMA 2YVSA 5I3PA 2Y8WA 4AJEA 1P3Y1 1V26A 3LUYA 4JB3A 4BRZA 2V2ZA 2XMCA 3ECAA 3M1LA 5GIOE 4EW6A 3J7YI 4YGYA 4ZQEA 5EIAA 1PAUA 3WL6A 2OYSA 3V48A 2QUAA 3RYCA 5LP6C 3RV4A 4JI2B 5JZOA 4Q4HA 4C7JA 2PKQP 3FDZB 2GR9A 5ITVA 3TSOA 4ETWA 1WR8A 3Q5GA 2C3YA 2FN8A 1L7MA 1JMTA 2ZIFA 4HKTA 3ZHTA 3MQ4A 3K94A 2ZB2A 4Q39A 1CUWA 1JLCB 3JYLA 1KJZA 1WPRA 2OD7A 4B8YA 3FUWA 2FZWA 4F0JA 4CZ2A 3C6YA 4HADA 3GLFA 1WZEA 4B83A 3ADBA 3OLVA 5K09A 5B57C 1H0HB 1JGTA 3FDIA 4HAOA 3CLSD 4XYEA 2SXLA 2GMWA 4FKYA 1I51B 1I10A 2ZUEA 4JFAA 4H6PA 2CJYB 1G9TA 1WXXA 3G8TA 2EJUA 2P3OA 2P6OA 1ODKA 2XVAA 3I6MA 1DBVO 4YJGB 1NPYA 2I2DA 3O1JC 3QUBA 4EPRA 2BF7A 1CZLA 4JU9A 1Q95A 1N0IA 4IFVA 2FGJA 5KTRA 1T7PA 3P4XA 4JI8C 5FI5A 5K8CA 1MOPA 1KI3A 1N2CE 4MVJP 5DGTA 1K8QA 2L42A 1RAIB 3N76A 3EVWA 2JHFA 5L1KA 1VKNA 1E7SA 3IVCA 4NLQA 3V2UC 4TTJA 2MWMA 1A9XB 2ON6A 5K4GA 3FY4A 4KV7A 1Q95G 3JAWB 1U0SY 2WUEA 3L1HA 2A5DA 3KOAA 3G2PA 2Q0XA 1HIYA 5A1GA 3SHQA 3PE4A 4I2NA 1HQDA 1SUDA 1P6QA 2ZVPX 5EX3A 4AL7A 1EUYA 3DM5A 1O77A 2F9FA 1L1RA 2YQ1A 4FD3A 1NVGA 3MTEA 1U0EA 5IEJA 2WOMB 2JKZA 1JHXA 4DSAA 2P2CA 2FR0A 5HUQA 2IS2A 2GESA 1NEEA 3O4FA 1CFJA 1EQ0A 2WD7A 1TYDE 1FE4A 5LMNJ 3H2KA 1O9BA 4XDYA 1WELA 5AIAA 4BFLA 4XJVA 2FPGB 4DQSA 4MLDA 3N0WA 3O8QA 1OV6A 4BNVA 4P93A 5DNCA 3W66A 4I1TA 3ZBTA 1RI7A 2D7SA 2MR5A 3HWSA 4KAXA 3IWXA 5T4BA 4LQDA 3PR4A 3TN7A 2ZH7A 1RAHB 2OV3A 4COOA 1U0NA 4WHMA 5AK0A 2DO4A 4Q3EA 2EI5A 1P8JA 1SIWA 2R2TA 4HNGA 4DUZF 4DR6J 1QF9A 3LUBA 1RLUA 4CM4A 4EQ6B 4R5MA 4F9TA 4OBWA 4LNUA 1W2IA 2VH5R 3HBLA 2DVMA 2PFDA 1WB6A 1R00A 3E9ZA 1EB0A 4QQ8A 2E49A 4HNVA 2X5JO 1MXAA 1M83A 2DPIA 4DUZB 4BAZA 2B2NA 4JBIA 4LRQA 3ELUA 2DHXA 3IIJA 3OCUA 4E5NA 4TWZA 4M8IA 3N5BA 2G06A 3FGOA 4H17A 4FJ2A 3KLGA 3WZMA 5JZBA 3U13A 2YRFA 4IUBS 2WZCA 4IR1A 5J2TB 2CXTA 3NM5A 1P81A 5IC4B 3U19A 3C46A 5ETOA 4BCAA 5KUTA 1RU2A 2WHPB 4H31A 2HNYA 3HYLA 4GBMA 5BSFA 3UDLA 3PRKE 3Q6MA 3ENVA 1HLGA 2R4UA 4J94A 2ASLA 2XHWA 1QHSA 1R8SA 2Z8YA 1WF0A 5KFVA 4NICA 4TTPA 5E6RB 1ZOSA 4A0GA 4PYNA 1IM6A 3KKPA 5LJ5Y 1BDHA 2HRRA 3K5LA 2C7QA 3OMWA 4Q4JA 1XMPA 1L2TA 1IZ8A 4IDPA 4M9UA 5EHQA 1WXGA 4OFXA 4D6YA 4LYFA 3LOUA 1QFXA 4HZGA 2HRDA 4GVXA 3R7BA 1Q6YA 3HB9A 1EJ0A 2ASVA 2OJ3A 3TTSA 1QGUB 1Y1QA 1OC2A 5BSVA 3F46A 2XIJA 3E2IA 5DGAA 3BSSA 3JXEA 1JI3A 4O3QA 3FZNA 1BE6A 4H7FA 4HI2A 4I1IA 1N6QB 3HJRA 1UAYA 3GH3A 3DVSX 4ITVA 3GAAA 4V1CB 3AODA 1DQYA 1U7UA 2ZTSA 3NYWA 3PCOB 4ZGBA 2GVDC 4GOLD 1BW9A 3RARA 3B6BA 3UW3A 1AN0A 1G2EA 3NPMA 3LJKA 1J22A 1USIA 3P9NA 3UJHA 5HK9A 3H2SA 1X74A 3ILVA 2NZ2A 4PAWA 1C1YA 1WSRA 4RA6A 1OT5A 3PEEA 3ZXXA 5FL7A 3K4PA 1N32C 4JI3F 3FJ2A 1N7HA 3ZEIA 1A9SA 4O3NA 2PH7A 2VIIA 4IR9A 1FP4A 2VXOA 1Y4ZA 1P62B 4RABA 5ITWA 4KBFA 1KOFA 4K8RA 1EUQA 4QYTA 2X13A 1ENPA 1IBRA 1XXHE 5LYJF 4HP8A 4RHUA 3QUAA 4H4MB 1K1SA 3ORQA 3SEOA 4EY3A 2IA6A 1KEEA 1J25A 1SURA 3M1IA 5IULC 3GPLA 4CMJA 4FSXA 5GM1A 4UUNA 4PQGA 3CKKA 1Z5OA 3FPGA 1R5JA 5HPYB 1DCMA 5CRIA 3KHHA 1XZMA 1EXWA 1VE3A 4I55F 4YCJA 2MKSA 4I9NA 2O5EA 4HOYA 3RRKA 2HSEA 2WT9A 1S9EA 2DPHA 2DY0A 4MK4A 3NAGA 2ZB7A 1GGJA 2DSTA 4HH1A 3PC7A 2V8HA 1SHZA 5HUHA 5IHXA 3CCSS 5HZMA 3K73O 1VQ8S 4PLHA 5DBFA 1DTSA 2HQFA 4JI6F 1N25A 3WFIA 5AJXA 5AE1A 2W48A 3WQBA 2R00C 3DTTA 4WZZA 4U67Q 3D0IE 1VLZA 1VL2A 2R7KA 4TWRA 2QW8A 2BKEA 2D62A 3GYXB 2Z95A 3A3YA 4UZSA 2PRJA 4GI3A 5E7QA 2HCBA 1H2WA 2C78A 3VF0B 4ER7A 1RQRA 1YMQA 1J1IA 2DKOA 1P1FA 1E2UA 1HDGO 4KHPJ 1KXJA 3Q8KA 1FRKA 4B7XA 1MVNA 4DLWA 2NXUA 3N2GA 4MJLA 1QE1A 2F3PA 4NXNF 1CDZA 1KLMB 4A8OA 5DZ6A 1B93A 5CB0A 3MCVA 4L72B 1X5OA 4NC9A 2RF2A 4JZYA 4F91B 1NUSA 3EM1A 3R9XA 2ZB8A 2PU5A 4MUNA 4AZ3A 3BQ9A 2HZAA 4YWJA 1WF1A 4MPTA 2FH5B 2C3PA 3BSNA 3EG5A 1ID8A 4B74A 1NZ8A 4B4WA 4OL9A 4KQHA 3RU3A 4XE5A 2Y1XA 2PWPA 3K71B 1CQMA 4ZVRA 1M8JA 5LQMA 4FYXB 2J76E 4CQLB 1YAHA 1YS4A 2QLJB 2IU0A 3RGIA 1SL2A 3TLEA 3MRSA 4EARA 1Z6PA 5I9NA 5K51A 4UBIA 3RFFA 3N9UC 2ZJ0A 4ZOQI 1RT4B 5AICA 3NFYA 4KCGA 1Z0AA 3AMVA 2AGVA 1L5LA 2ZUWA 3RC7A 2B2CA 4K2JA 5K8FA 4LPSA 5BQPA 1BFDA 1DUVG 1Q0HA 3ASYA 1FFEA 5ITZA 3PNBA 1DT5A 2VSYA 2XZLA 1N32B 1AKEA 2QENA 3NHRA 1DTWA 1OREA 1X9GA 2GTIA 2P0EA 3AJEA 5KWIA 2BJ1A 3MHTA 4O4LB 1WHTB 3U7QB 1Z2NX 2WWHA 4MDFA 2UXCB 4RTMA 4RF5A 2XQGA 4FEYA 3JAKA 3MEEB 1V1RB 3C7CB 2REQB 2WKQA 4HX5A 5J1PA 3SZRA 3WJ2A 4DV1B 2V9CA 1RRKA 1YOVA 2K7ZA 4J4BA 4LNAA 1PEAA 3OX2A 3E2MA 2Q4OA 1MX3A 2ZRFA 4NA2A 3LQRA 4LQ3A 3O8DA 2AZ3A 4ZCPA 3DRPA 4YJDA 2M70A 2QRRA 3ESRA 2WU8A 2QRHA 1VE9A 4YMUA 4OAPA 2GD2A 3FYDA 2CB0A 2O57A 1UXJA 1KZ4A 1BCRB 1QANA 4DFPA 2Q43A 2IXBA 5FOWA 3W9YA 3ER6A 1U98A 1YB4A 1O97C 1BN7A 2EGUA 4KVAA 3UYLA 3UQYS 4DRYA 4RK0A 3EGEA 4CNBA 4IO1A 5JECA 3GWZA 2V03A 3H1AA 2BKXA 3DLEB 4XQEA 3OMXA 5A4DA 4XK8C 1AQUA 3EK2A 1X2EA 1PG3A 1V3TA 2QSJA 4RHCA 3ITNA 1JS1X 3KLFA 2G6TA 2R47A 4BNTA 2I65A 3F5MA 5FFMA 3LNCA 4K4XA 3U4MA 1OASA 1MORA 4ZP6A 1PQWA 1NR7A 2O4UX 3VWSA 4BNYA 1TAGA 3ZWXA 2CXOA 1CQNA 2DHCA 1BGXT 1D09A 3COZA 1II8A 1FJ2A 3GPBA 4YBRA 3KM0A 4NK4A 1J23A 1C7EA 1SKBA 1C0TA 1Z4JA 2AOXA 4IYJA 3VYUB 4FNAA 3LT5A 4YAIA 2RB5A 1NBHA 5IW8A 3ST7A 1QH8B 2GO1A 4HUTA 1AXGA 1AY0A 4CMEC 4UNIA 3I9KA 1MW8X 5LSLA 4MUAA 5JI3E 2QQEA 5AI5A 4XX0B 3KAJA 2QC3A 3IBTA 4CM4B 3CCTA 2VA9A 4EECA 1XX6A 3E7WA 4H4KC 1VLAA 1VPLA 2LGJA 4RPIA 2IM0A 2GEJA 4HQKA 2ZT6A 3CUEF 2RH9B 7MHTA 5JW6A 3GVIA 4IRMA 3L05A 2XMWA 4KRGA 3OU6A 2UUAJ 2CLOB 3HNRA 1XMOC 1LWCB 3DU6A 3GP5A 4GYYA 2CPIA 4P38A 2Y1OA 4JLJA 2Z2KA 2WONA 2VYNA 2P5SA 4FTWA 2GI4A 1SZPA 4H4KA 4F8JA 3JX9A 2PKEA 4RX1A 5E6UB 4PQAA 3FFAA 3TX0A 5LB2A 3WDOA 1G21E 3AJRA 3DE6X 2HCTA 3C8YA 1Y82A 3HN6A 1EXDA 3G8DA 2XE7A 5DGDA 3BN7A 4IIJB 1BWEA 4LYAA 5EC8A 1ORRA 2BGMA 2I0FA 3EEBA 4OFWA 3H5IA 3LK6A 4TLBA 4MUGA 3ZV3A 2QB5A 4BNKA 1T36B 1CZOA 1PJ5A 5D8DA 3R5FA 1Z7EA 4QBHA 5A8WB 1UBHS 2JJ2D 3BXPA 4PNEA 3TLXA 4ENVA 1PR3A 1OX4B 4A8WA 1YQXA 4YK7A 3KR2A 3TOQA 7ABPA 4M87A 1C0EA 1I6JA 4ZPDA 1P73A 1VIYA 4G0PA 4JD5A 3FCYA 4G1FA 3MBOA 1VBYA 5ICSA 5A76A 2WONB 1OZAA 3JTMA 1O5JA 3QU2A 3TK1A 4C20A 3QX3A 4DCGA 1TUBB 2PGJA 1YQEA 1C8KA 1VE6A 4PSVA 3CUUA 4GWKA 2UDPA 3A1FA 2RH5A 1T25A 2H2FA 5KINB 4KQMA 2FAXA 1SNYA 1ZYUA 4U2FA 2PZMA 5C1DA 1CULB 4LQCA 3VHLB 4LMPA 4GRDA 2YYYA 4HR7A 4N6GA 1AB5A 4X4VA 1U48A 4J9NA 3SQOA 1PZFA 4ND4A 3ILSA 4E30A 4PRYA 4UJ5A 3BL5A 5B1IA 1X7ZB 3L9XA 1NO8A 4ZXFA 1HBJA 3OWHA 2OOKA 3SC2B 1JNRB 4LY9A 4N0QA 2ZH3A 1VCOA 3ZY4A 3IEMA 4M60A 3GUZA 5HWSA 2AZTA 2OWDA 5EJMA 4EZEA 2PVPA 1DBDA 1KN6A 3VGUA 4HGOA 7YASA 2FZGA 2WVGA 3LTEA 4FR0A 1MX5A 3WB9A 4AS1A 4KGXA 3S55A 3PXUA 3OTQA 1DAXA 1MB9A 3RTBA 5JNWA 4GZMA 2B4YA 3PFBA 2Z57A 4D0SA 3P5BA 2GJKA 3L7KA 1ZGAA 3M2RB 1TP7A 3ZYCA 3PTWA 4NU5A 2Q5JA 2QRLA 2R6DA 1I3CA 1ULSA 3TIFA 3DKDA 1FYFA 3KHSA 3AD8C 3CNQS 3EPRA 1KQGA 4NXMC 4LV6A 3ZQUA 1A4UA 1JQJC 2PZLA 1KKUA 4BMYA 2VHTA 1M8KA 4P7FA 4EGFA 1B8UA 1RHRA 1QAOA 3ZHYA 1DQ8A 2XTAA 3NBKA 3H8YA 3BGFA 3UJCA 1NSTA 3DPUA 2WP0C 3PDCA 2ZRCA 3TW0A 1W46A 3ONFA 2I62A 4RAQA 4LI0A 4O2BB 1TZBA 1SVDA 1BXZA 4Q3CA 1GNLA 4M54A 3RR7A 4B32A 1IY0A 4ZI7F 3CC4S 1BJTA 4EYQA 3OJSA 1HNWC 3MGKA 3SM3A 1Q77A 3DTNA 4M7RA 1FQWA 3UOAB 4JP3A 3VZRA 1JYSA 2F1HA 1CJSA 3HVTB 5IM5A 1GPNA 4KHMA 4AQYC 3QU4A 4DR6B 4UBMA 4YPFA 4EEKA 3TGPA 4LFBB 4ALZA 3EPIA 2W2KA 4Y1GA 1R8QA 3RTAA 5DNVA 3SIWA 3ISNC 1DX9A 1O8CA 1XL1A 4I5FA 4F2SA 2GPBA 1JA1A 2Z56A 3ZWVA 1FFAA 4DN9A 5FP0A 5GONA 3KCNA 1PNVA 1YHYA 4NKRA 2P6SA 4LF8C 2VF8A 2OEKA 2NO0A 2YV5A 1E94E 1EUCB 2I66A 4ZKDA 2W7TA 3FNBA 3PNKA 3TI7A 4ZXPA 3I28A 1NYLA 2YV1A 3CSUA 1G7SA 3CD5A 2RRNA 3VOSA 1UW9A 2Z43A 3QF7A 1V9SA 4WCFC 8RUCA 1XCMA 5HQ3B 1R7IA 4QOTA 4IJQA 1WHSB 2L82A 2WHYA 2EXXA 4Y2UA 4GKKJ 1UEJA 4AO6A 1B14A 4CV2A 4DR5F 2Q29A 1HD1A 2B4UA 4HYEA 4BMCA 3ABQB 1SKMA 4QM6A 1YL5A 2YOGA 1GUFA 1PG2A 4HAUA 3K9GA 2Q2VA 5J9FA 3VZQA 1RTHB 2CNWD 1PWXA 2J0QD 4CLRB 2I3GA 2A0XA 2FKAA 4P4UA 3IE1A 1G3OA 2AB0A 4O2AA 5LL6P 5F21A 1AHPA 1DGQA 1WQ3A 4DR5C 4AZ3B 5DJ5A 1FK9B 1AKWA 1DFHA 5KYYB 1NG9A 5BUQA 2L0XA 4OYRA 4W1RA 4ZDWA 4KPCA 1CQPA 4NCGA 3WLIA 1ZBDA 5DM1A 3RRHA 1MEOA 3LIPA 4M5DA 3OFNA 1ML3A 2LXFA 2GZRA 3QVGA 3QIVA 3C3KA 5DULA 2AWOA 3HZOA 4MK8A 1JU9A 1XIVA 4NXNC 1BFUA 3ILLA 1SUPA 3AVTA 4RW4B 1YGYA 1JLBA 2ZBCA 3KFLA 1IMOA 1MAVA 3NL0A 5TMBA 4X1IB 2G04A 1APSA 5H16A 1IHPA 3NV9A 1OU0A 2P4SA 2C2OB 3E9YA 5AW3A 1ZL0A 3CPWR 4YP1A 4ZV4A 2BEUA 5JCPA 1JFLA 4O0NA 3WTCA 1LNSA 3FMPB 2OLJA 4GX2A 3A4VA 5D87A 2IA0A 1A9NB 3DR5A 3AQOA 3ZOZA 4Y9SA 5H02A 3AJ9A 1LSUA 2LR0A 4HYKA 3SJZA 3L0SA 4K5RA 3RUPA 3TVDA 3BZBA 8ATCA 4L5JA 4GPBA 1O95A 1T3SA 3QVMA 3VR3A 1NXTA 4OVKA 2OL4A 1GOTA 2RGRA 1DC4A 4NSNA 4UY8T 1R18A 1GILA 3QHPA 4YJ2F 4FQ7A 5EZ5A 1YIDA 5EGNA 4C6TB 3WMEA 4PO3X 4DV7C 5H4GA 3C7KA 3K15A 1NAIA 4CCYB 2G6BA 2WFAA 1VDMA 4RW9B 3IR6B 5DX8A 4G0XA 3HT0A 1MN9A 2FJUA 3DO8A 2Z6AA 1SC3B 1RXOB 2Q6VA 1DJ0A 2WSEC 1SKYE 4R7ZA 1ZIYA 5KCMA 1ONSA 4K8RB 3O90A 3MILA 1W96A 5KT7A 3PO5A 2OEPA 2XS5A 2GSDA 2YJ5A 4N3NA 4B6SA 1Y8CA 3Q3HA 4J9RA 2IDLA 1XLWA 5HX7A 2LA6A 1X7XA 4MDYA 4Z4CA 3WLEA 1YB1A 1GG8A 2YVLA 2C2BA 4DLTA 1CX9B 1FJGF 3FTNA 2FJPA 2CDAA 2B1QA 4I4TF 4QT0A 2FZKB 2K8GA 4GOMD 4RLEA 1XK7A 1MOQA 1KDOA 1VB5A 1JYEA 5KJCA 1GTHA 2BF4A 2Z8QA 3JTOA 4E5YA 4D3FA 4LCEA 3OFHA 1Y89A 3I1IA 3U2QA 4XCVA 2FPSA 5FORA 2W6ZA 3TVTA 2IU4A 1XZEA 1D9XA 2JIRA 5DASA 1WZ2A 1CJUA 3D2CA 2FSHA 3IS9A 1TXGA 1CVIA 2HZBA 4D98A 2XNSA 1X1QA 4LYYA 3UATA 3V2IA 1JXMA 4B34A 3E81A 5FUVA 4B3SF 4Z7JA 1VKJA 4RPLA 2XZOA 1NW6A 2R6ZA 4X4RA 4QIGA 1H7WA 4P2BA 4L6CA 4C4SA 3PNYA 1O94C 2X9QA 3I8SA 3QXGA 1LFAA 1LPNA 2C00A 1PVDA 3PWTA 5KOHA 3FWZA 1I4TD 3DP9A 2DUMA 3LP1B 3FCOA 3FWNA 2H4JA 5FH9A 3I1FA 4B82A 1XNQB 2RBGA 1XLTC 3PHIA 2O6LA 3MSCA 5L8RC 2PI5A 1S99A 3GJYA 1C3LA 3EGXA 1E59A 3IKMB 3AKCA 3UJDA 2FDCA 4ZEVA 4QSHA 3KQPA 1S0VA 3BFXA 2BKNA 5EWJB 2O3QA 2CQ1A 1K0RA 5JWRA 3CZRA 2VXYA 4B4VA 4PSAA 1QYDA 5IC6A 3M9NB 4N3AA 1GIAA 1USGA 3EPPA 1NQVA 4XGRA 4MQ6A 2M5YA 4JZKA 3IO3A 5CYOA 4N0MA 2HPVA 2NSYA 1KI8A 3ZD8A 5K7SA 3MURP 3KWJA 3GSDA 2FY1A 1S02A 4Y28C 4GI5A 4MTLA 2NU9A 1Z08A 3WK8A 4QQFA 5FLYA 3R7DA 5A06A 5K8MA 4PFSA 3BCUA 3KKKA 5ETKA 4QPZA 4MS4B 3EISA 4WZBE 5AVYA 3BJRA 1NXIA 4O6VA 4PYIA 1VBMA 4ZVKA 5AUPB 1Z5VA 2AKEA 4W5JA 1VHFA 2HU5A 1CC8A 3VM6A 3PZBA 1IR0A 3JQBA 3M8WA 4F2DA 3ANSA 3OAAD 2WVEA 2HBYA 3SCKE 3ZBQA 3EX7B 1GRRA 2NGRA 4WP8A 1ZAWA 3AY6A 3T0GA 2VC0A 6FD1A 3LUSA 1CS4A 1YHZA 3CSSA 4ES2A 5CCMA 1XLTA 4O1MA 1WVMA 3MQFA 1G6OA 2GQ0A 2X19A 1KAHA 3IOMA 3DCAA 4ZHQA 4KNWA 3G85A 4OHKA 4FDVA 5F98A 3MCZA 1T6BY 1Y3AA 4NX2A 4UHBA 3E51A 3KPYA 1KFSA 1A0OA 2G9VA 3I9FA 3RYFA 3SQGB 2GAOA 3C5WP 1EARA 4B9SA 1E3QA 3V00A 3N8GA 1IY1A 2IYAA 4IEFB 2L19A 5IKPA 2I1WA 3AU9A 4EW2A 2IEBA 2HFUA 4HMQA 1UKZA 1KJYA 1YJ8A 1FFGA 2JS7A 2EZ8A 1BXNA 3BL8A 4ZKAA 1GUYA 2C0QA 3HD1A 3QEOA 4F5WA 2QA4G 3FXAA 3L7JA 1UDAA 2PTGA 3JVUA 4RXMA 4I1VA 5FBRB 1FX4A 2PH3A 5C35A 3DXFA 1E2KA 1U8AA 5DCWA 5CA5A 4BKMA 5EPOA 4MROA 3C6UB 3VH1A 4LE2A 1PJRA 3G02A 3PFOA 1JDUA 1H8ED 2YINC 4EQZA 1KYQA 1RBLA 1OLUB 5BWMA 3D1VA 2BGNA 4F4WA 3LM8A 2Y9MB 2IHNA 2ZI4A 4DJBA 3OQPA 2C5GA 4I0WB 1KTIA 3KTAB 4Y2IA 2PRIA 3TOVA 1JLAB 3CSDA 4IINA 2EPIA 5HATA 1NX6A 3M8KA 2UZ1A 5EXTA 5ENVA 3FCWA 3GONA 3IP0A 1AYEA 5AJZA 3M9MB 4GI1A 3CLRC 2W0SA 4XDCA 1L7AA 3NUQA 4FJ0A 2PRYA 4B2IA 3LCJA 2X5XA 3QGMA 4WASA 2YDXA 3O44A 4WV3A 5IJWA 4ECVA 4IIXA 1HA3A 4I9HA 4I14A 3FVWA 3I6QA 4DV4F 3GA7A 2XSJB 3DEJA 3AY0A 2EDAA 1BCSB 4J91A 4IKAA 1R50A 5G0WA 4DR3F 3NGXA 4COKA 3C48A 1IULA 3HC7A 1WW8A 1XQWA 4M9CA 4CT8A 1XN9A 2Y1DA 3MGCA 2J46A 3P4YA 3WQRA 1QU3A 3LL7A 3UEBA 2QNIA 1Y5IA 1AK2A 3SV3A 2VP6A 4NZOA