3UZ0A

Crystal structure of spoiiiah and spoiiq complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
114
structure length
114
Chain Sequence
DLFTTYRLDLEDARSKEREELNAIVSSDDATAKEKSEAYDKMTALSEVEGTEKQLETLIKTQGYEDALVNAEGDKINITVKSDKHSKSKATAIIDLVAKEIKTMKDVAVTFEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the basal components of a bacterial transporter.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords Stage III sporulation protein AH
total genus 44
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.270 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3uz0A00
3UZ0A 3TUFA
chains in the Genus database with same CATH superfamily
3CW8X 4WV3A 1FJGC 4DR7C 1XNRC 4PUGA 1XS3A 3FCCA 1RG9A 4I9FA 4PROC 1V60A 4JM1A 4L7IA 1MD9A 1VEHA 4BBYA 4D4GA 5IFIA 4YY3C 2JMPA 4JI2C 2P2JA 4LF5C 3VNRA 4LFAC 4GXQA 1N33C 4JYAC 1MDBA 3IPLA 4BCAA 5BSTA 3OTOC 4RVOA 2QL8A 2ZZNA 3GR0A 5BUSA 3I07A 2E8FA 1I94C 1FLOA 2ZZMA 2QVYX 3JAMD 5CZXA 3L95X 4G36A 4DUYC 2QVZX 2MCQA 3E7WA 3CQ1A 4DR5C 2VZEA 4DUZC 5IWAC 1M6XA 4DV6C 4AQYC 4GXRA 1XHJA 4LF8C 2D1RA 1PG3A 2P2BA 3TQIA 4RVNA 4XX2A 4RM3A 1USPA 5BR8C 1TH5A 2Y4NA 3N2QA 3RG2A 3EQ6A 4ZLPA 1UKKA 4DV1C 4FUQA 3UX2A 3NPDA 3NYRA 4BSZA 1FUGA 4R1MA 4PHTA 5BSVA 5KYVA 1AMUA 1PU1A 4KTTA 4NXMC 3A4IA 5AE3A 3UZ0A 4BC9A 4JI6C 3L8CA 1XRAA 4U5YD 4X64C 3SO4A 4LF6C 4D57A 1KKGA 4X65C 5A1IA 2E0GA 4L2ZA 2UXBC 4RLFA 2CXCA 2UXCC 2XR1A 1MXAA 5CZVA 4ISBA 5BSWA 3IMLA 2PT7G 3TUFA 4LF9C 5BSRA 1IBLC 3UX3A 1ULTA 1MKYA 4DCVA 4DV3C 3GKUA 4DV4C 4DR4C 4B3RC 1LQLA 4OX9C 4RM2A 2AYAA 2YX1A 4EATA 1VLAA 3VNQA 1P4EA 3CQ3A 4B3TC 3T1YC 3H2TA 5H9UA 1MXCA 1T5DX 4LFCC 4DV0C 1RY2A 3I08A 5BUQA 1V25A 2ZM6C 3KXWA 2F4VC 2M5HA 3NYQA 4G1IA 4KTVA 5AE1A 1XNQC 1WH9A 2Z51A 5K8FA 1J5EC 2HJGA 2DPLA 2VSQA 4DG8A 3E7XA 4DV5C 2YWBA 2BH1X 1PA4A 2KZFA 2E8CA 5E7QA 3RV2A 2UXDC 4KHPC 3PESA 2YWCA 2P02A 2OPLA 1WF3A 3LNVA 5BSMA 2PROA 2E7GA 1MXBA 1ZB9A 1ZB8A 4DV7C 4JI4C 4LF4C 4RLQA 2EGTA 2ONFA 4G37A 1K0RA 2UUBC 4GKJC 3FCEA 4NOZA 2P2MA 5A1GA 1XMQC 2KZ0A 1PG4A 3C5EA 1UWDA 3UEBA 5K85A 3GR1A 4JI3C 2ATWA 2E5LC 4GKKC 3UOWA 1XRCA 3NI2A 2OPLB 2Y4OA 3GPCA 1HNZC 1ML8A 1T5HX 3B7WA 2V7BA 4DCSA 2D1SA 1BA3A 4ODJA 1LCIA 4IR7A 1EGAA 3A9VA 3N54B 5T8TA 2QVXX 4OYCA 4DCTA 1YJ7A 4WS9A 5AE2A 3R9XA 1N34C 4JV5C 2UUAC 4IZ6A 4D4IA 3EERA 3CW9A 4R0MA 3TDEA 1V26A 5KYTA 3LUSA 5JRHA 1XMOC 2D27A 3DHVA 2UUCC 3ETOA 2NCLA 2VQFC 4DV2C 3T1HC 2P2FA 3CQ2A 5GTDA 1HH2P 2DYJA 4RMNA 1NYEA 2D1TA 3R9WA 4JI5C 3A9UA 1HR0C 4X66C 1QWIA 2DHMA 3AY0A 2CU6A 2D7VA 2P2QA 4JI7C 4NDNA 1QM4A 1IBMC 4K0KC 4DR2C 3TR3A 1P7LA 1MDFA 5DV9A 4R1LA 4JI1C 3A26A 3PBKA 5LMUC 4DR3C 2WP0C 2BJOA 4OXIA 3PROC 4LF7C 3J81D 1IBKC 4D56A 1USPB 4ZJZA 4YHHC 1GPMA 1N36C 4DG9A 5KEIA 4DR1C 2M5OA 3AF6A 4NXNC 2UU9C 1NY8A 1WCJA 4FUTA 3IEVA 5BSUA 3S82A 2MMAB 4X62C 4LE5A 4DCUA 1L2FA 1HNWC 5LCIA 2YCBA 1O90A 2D1QA 2QW0X 2CY1A 2Y27A 3LNOA 5ADZA 3CJEA 3ETCA 4MH4A 2OO4A 2JNVA 1HNXC 1N32C 3AF5A 2WD9A 3IEUA 1IB8A 3G7SA 1O93A 4L4QA 5A2QD 5IT9D 1JOSA 1O92A 3J80D 3K6RA 4GS5A 1O9TA 4HPVA 4PUIA 4MTNA 5BURA 4TPSB 3R44A 2OBVA 2HHHC 3O2EA 5FLXD 5LMNC 5A19A 4I9GA 2P20A 2D28C 2VQEC 4BC7A 1M6XC 4PZPA 1XRBA 5T8SA 3LAXA 4DR6C 3LGXA 3A25A 4LFBC 2MM9A 2KDNA 3DAYA 4JI0C 4PUHA 1N2FA 4JI8C 2ASBA 4FTFA 4B3SC 1P4EC 2PN2A 3DLPX 4B3MC 2E8EA 4K0BA 3VNSA
chains in the Genus database with same CATH topology
3CW8X 4WV3A 1FJGC 4DR7C 1XNRC 3FCCA 1RG9A 4I9FA 4PROC 4JM1A 4L7IA 1MD9A 4BBYA 4D4GA 5IFIA 4YY3C 2JMPA 4JI2C 2P2JA 4LF5C 3VNRA 4LFAC 4GXQA 1N33C 4JYAC 1MDBA 3IPLA 4BCAA 5BSTA 3OTOC 4RVOA 2QL8A 3GR0A 5BUSA 3I07A 2E8FA 1I94C 2QVYX 3JAMD 5CZXA 3L95X 4G36A 4DUYC 2QVZX 3E7WA 4DR5C 2VZEA 4DUZC 5IWAC 4DV6C 4AQYC 4GXRA 4LF8C 2D1RA 1PG3A 2P2BA 3TQIA 4RVNA 4XX2A 4RM3A 1USPA 5BR8C 2Y4NA 3N2QA 3RG2A 3EQ6A 4ZLPA 1UKKA 4DV1C 4FUQA 3NPDA 3NYRA 4BSZA 1FUGA 4R1MA 4PHTA 5BSVA 5KYVA 1AMUA 4KTTA 4NXMC 3A4IA 5AE3A 3UZ0A 4BC9A 4JI6C 3L8CA 1XRAA 4U5YD 4X64C 3SO4A 4LF6C 4D57A 1KKGA 4X65C 5A1IA 2E0GA 4L2ZA 2UXBC 4RLFA 2CXCA 2UXCC 2XR1A 1MXAA 5CZVA 4ISBA 5BSWA 3IMLA 2PT7G 3TUFA 4LF9C 5BSRA 1IBLC 1ULTA 1MKYA 4DCVA 4DV3C 3GKUA 4DV4C 4DR4C 4B3RC 1LQLA 4OX9C 4RM2A 2AYAA 4EATA 1VLAA 3VNQA 4B3TC 3T1YC 3H2TA 5H9UA 1MXCA 1T5DX 4LFCC 4DV0C 1RY2A 3I08A 5BUQA 1V25A 2ZM6C 3KXWA 2F4VC 3NYQA 4G1IA 4KTVA 5AE1A 1XNQC 1WH9A 5K8FA 1J5EC 2HJGA 2DPLA 2VSQA 4DG8A 3E7XA 4DV5C 2YWBA 2BH1X 1PA4A 2KZFA 2E8CA 5E7QA 3RV2A 2UXDC 4KHPC 3PESA 2YWCA 2P02A 2OPLA 1WF3A 3LNVA 5BSMA 2PROA 2E7GA 1MXBA 1ZB9A 1ZB8A 4DV7C 4JI4C 4LF4C 4RLQA 2EGTA 2ONFA 4G37A 1K0RA 2UUBC 4GKJC 3FCEA 4NOZA 2P2MA 5A1GA 1XMQC 1PG4A 3C5EA 5K85A 3GR1A 4JI3C 2ATWA 2E5LC 4GKKC 3UOWA 1XRCA 3NI2A 2OPLB 2Y4OA 3GPCA 1HNZC 1ML8A 1T5HX 3B7WA 2V7BA 4DCSA 2D1SA 1BA3A 4ODJA 1LCIA 4IR7A 1EGAA 3A9VA 3N54B 5T8TA 2QVXX 4OYCA 4DCTA 1YJ7A 4WS9A 5AE2A 3R9XA 1N34C 4JV5C 2UUAC 4IZ6A 4D4IA 3EERA 3CW9A 4R0MA 3TDEA 1V26A 5KYTA 3LUSA 5JRHA 1XMOC 2D27A 3DHVA 2UUCC 3ETOA 2VQFC 4DV2C 3T1HC 2P2FA 5GTDA 1HH2P 2DYJA 4RMNA 1NYEA 2D1TA 3R9WA 4JI5C 3A9UA 1HR0C 4X66C 1QWIA 2D7VA 2P2QA 4JI7C 4NDNA 1QM4A 1IBMC 4K0KC 4DR2C 1P7LA 1MDFA 5DV9A 4R1LA 4JI1C 3PBKA 5LMUC 4DR3C 2WP0C 2BJOA 4OXIA 3PROC 4LF7C 3J81D 1IBKC 4D56A 1USPB 4ZJZA 4YHHC 1GPMA 1N36C 4DG9A 5KEIA 4DR1C 4NXNC 3AF6A 2UU9C 4FUTA 3IEVA 5BSUA 3S82A 4X62C 4LE5A 4DCUA 1L2FA 1HNWC 2YCBA 1O90A 2D1QA 2QW0X 2CY1A 2Y27A 5ADZA 3CJEA 3ETCA 4MH4A 2OO4A 1HNXC 1N32C 3AF5A 2WD9A 3IEUA 5IT9D 3G7SA 1O93A 4L4QA 5A2QD 1JOSA 1O92A 3J80D 4GS5A 1O9TA 4HPVA 4MTNA 5BURA 4TPSB 3R44A 2OBVA 2HHHC 5LMNC 5A19A 5FLXD 4I9GA 2P20A 2D28C 2VQEC 4BC7A 4PZPA 1XRBA 5T8SA 3LAXA 4DR6C 3LGXA 4LFBC 3DAYA 4JI0C 1N2FA 4JI8C 2ASBA 4FTFA 4B3SC 2PN2A 3DLPX 4B3MC 2E8EA 4K0BA 3VNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UZ0 A;  3TUF A; 
#chains in the Genus database with same CATH topology
 3CW8 X;  4WV3 A;  1FJG C;  4DR7 C;  1XNR C;  4PUG A;  1XS3 A;  3FCC A;  1RG9 A;  4I9F A;  4PRO C;  1V60 A;  4JM1 A;  4L7I A;  1MD9 A;  1VEH A;  4BBY A;  4D4G A;  5IFI A;  4YY3 C;  2JMP A;  4JI2 C;  2P2J A;  4LF5 C;  3VNR A;  4LFA C;  4GXQ A;  1N33 C;  4JYA C;  1MDB A;  3IPL A;  4BCA A;  5BST A;  3OTO C;  4RVO A;  2QL8 A;  2ZZN A;  3GR0 A;  5BUS A;  3I07 A;  2E8F A;  1I94 C;  1FLO A;  2ZZM A;  2QVY X;  3JAM D;  5CZX A;  3L95 X;  4G36 A;  4DUY C;  2QVZ X;  2MCQ A;  3E7W A;  3CQ1 A;  4DR5 C;  2VZE A;  4DUZ C;  5IWA C;  1M6X A;  4DV6 C;  4AQY C;  4GXR A;  1XHJ A;  4LF8 C;  2D1R A;  1PG3 A;  2P2B A;  3TQI A;  4RVN A;  4XX2 A;  4RM3 A;  1USP A;  5BR8 C;  1TH5 A;  2Y4N A;  3N2Q A;  3RG2 A;  3EQ6 A;  4ZLP A;  1UKK A;  4DV1 C;  4FUQ A;  3UX2 A;  3NPD A;  3NYR A;  4BSZ A;  1FUG A;  4R1M A;  4PHT A;  5BSV A;  5KYV A;  1AMU A;  1PU1 A;  4KTT A;  4NXM C;  3A4I A;  5AE3 A;  3UZ0 A;  4BC9 A;  4JI6 C;  3L8C A;  1XRA A;  4U5Y D;  4X64 C;  3SO4 A;  4LF6 C;  4D57 A;  1KKG A;  4X65 C;  5A1I A;  2E0G A;  4L2Z A;  2UXB C;  4RLF A;  2CXC A;  2UXC C;  2XR1 A;  1MXA A;  5CZV A;  4ISB A;  5BSW A;  3IML A;  2PT7 G;  3TUF A;  4LF9 C;  5BSR A;  1IBL C;  3UX3 A;  1ULT A;  1MKY A;  4DCV A;  4DV3 C;  3GKU A;  4DV4 C;  4DR4 C;  4B3R C;  1LQL A;  4OX9 C;  4RM2 A;  2AYA A;  2YX1 A;  4EAT A;  1VLA A;  3VNQ A;  1P4E A;  3CQ3 A;  4B3T C;  3T1Y C;  3H2T A;  5H9U A;  1MXC A;  1T5D X;  4LFC C;  4DV0 C;  1RY2 A;  3I08 A;  5BUQ A;  1V25 A;  2ZM6 C;  3KXW A;  2F4V C;  2M5H A;  3NYQ A;  4G1I A;  4KTV A;  5AE1 A;  1XNQ C;  1WH9 A;  2Z51 A;  5K8F A;  1J5E C;  2HJG A;  2DPL A;  2VSQ A;  4DG8 A;  3E7X A;  4DV5 C;  2YWB A;  2BH1 X;  1PA4 A;  2KZF A;  2E8C A;  5E7Q A;  3RV2 A;  2UXD C;  4KHP C;  3PES A;  2YWC A;  2P02 A;  2OPL A;  1WF3 A;  3LNV A;  5BSM A;  2PRO A;  2E7G A;  1MXB A;  1ZB9 A;  1ZB8 A;  4DV7 C;  4JI4 C;  4LF4 C;  4RLQ A;  2EGT A;  2ONF A;  4G37 A;  1K0R A;  2UUB C;  4GKJ C;  3FCE A;  4NOZ A;  2P2M A;  5A1G A;  1XMQ C;  2KZ0 A;  1PG4 A;  3C5E A;  1UWD A;  3UEB A;  5K85 A;  3GR1 A;  4JI3 C;  2ATW A;  2E5L C;  4GKK C;  3UOW A;  1XRC A;  3NI2 A;  2OPL B;  2Y4O A;  3GPC A;  1HNZ C;  1ML8 A;  1T5H X;  3B7W A;  2V7B A;  4DCS A;  2D1S A;  1BA3 A;  4ODJ A;  1LCI A;  4IR7 A;  1EGA A;  3A9V A;  3N54 B;  5T8T A;  2QVX X;  4OYC A;  4DCT A;  1YJ7 A;  4WS9 A;  5AE2 A;  3R9X A;  1N34 C;  4JV5 C;  2UUA C;  4IZ6 A;  4D4I A;  3EER A;  3CW9 A;  4R0M A;  3TDE A;  1V26 A;  5KYT A;  3LUS A;  5JRH A;  1XMO C;  2D27 A;  3DHV A;  2UUC C;  3ETO A;  2NCL A;  2VQF C;  4DV2 C;  3T1H C;  2P2F A;  3CQ2 A;  5GTD A;  1HH2 P;  2DYJ A;  4RMN A;  1NYE A;  2D1T A;  3R9W A;  4JI5 C;  3A9U A;  1HR0 C;  4X66 C;  1QWI A;  2DHM A;  3AY0 A;  2CU6 A;  2D7V A;  2P2Q A;  4JI7 C;  4NDN A;  1QM4 A;  1IBM C;  4K0K C;  4DR2 C;  3TR3 A;  1P7L A;  1MDF A;  5DV9 A;  4R1L A;  4JI1 C;  3A26 A;  3PBK A;  5LMU C;  4DR3 C;  2WP0 C;  2BJO A;  4OXI A;  3PRO C;  4LF7 C;  3J81 D;  1IBK C;  4D56 A;  1USP B;  4ZJZ A;  4YHH C;  1GPM A;  1N36 C;  4DG9 A;  5KEI A;  4DR1 C;  2M5O A;  3AF6 A;  4NXN C;  2UU9 C;  1NY8 A;  1WCJ A;  4FUT A;  3IEV A;  5BSU A;  3S82 A;  2MMA B;  4X62 C;  4LE5 A;  4DCU A;  1L2F A;  1HNW C;  5LCI A;  2YCB A;  1O90 A;  2D1Q A;  2QW0 X;  2CY1 A;  2Y27 A;  3LNO A;  5ADZ A;  3CJE A;  3ETC A;  4MH4 A;  2OO4 A;  2JNV A;  1HNX C;  1N32 C;  3AF5 A;  2WD9 A;  3IEU A;  1IB8 A;  3G7S A;  1O93 A;  4L4Q A;  5A2Q D;  5IT9 D;  1JOS A;  1O92 A;  3J80 D;  3K6R A;  4GS5 A;  1O9T A;  4HPV A;  4PUI A;  4MTN A;  5BUR A;  4TPS B;  3R44 A;  2OBV A;  2HHH C;  3O2E A;  5FLX D;  5LMN C;  5A19 A;  4I9G A;  2P20 A;  2D28 C;  2VQE C;  4BC7 A;  1M6X C;  4PZP A;  1XRB A;  5T8S A;  3LAX A;  4DR6 C;  3LGX A;  3A25 A;  4LFB C;  2MM9 A;  2KDN A;  3DAY A;  4JI0 C;  4PUH A;  1N2F A;  4JI8 C;  2ASB A;  4FTF A;  4B3S C;  1P4E C;  2PN2 A;  3DLP X;  4B3M C;  2E8E A;  4K0B A;  3VNS A; 
#chains in the Genus database with same CATH homology
 3CW8 X;  4WV3 A;  1FJG C;  4DR7 C;  1XNR C;  3FCC A;  1RG9 A;  4I9F A;  4PRO C;  4JM1 A;  4L7I A;  1MD9 A;  4BBY A;  4D4G A;  5IFI A;  4YY3 C;  2JMP A;  4JI2 C;  2P2J A;  4LF5 C;  3VNR A;  4LFA C;  4GXQ A;  1N33 C;  4JYA C;  1MDB A;  3IPL A;  4BCA A;  5BST A;  3OTO C;  4RVO A;  2QL8 A;  3GR0 A;  5BUS A;  3I07 A;  2E8F A;  1I94 C;  2QVY X;  3JAM D;  5CZX A;  3L95 X;  4G36 A;  4DUY C;  2QVZ X;  3E7W A;  4DR5 C;  2VZE A;  4DUZ C;  5IWA C;  4DV6 C;  4AQY C;  4GXR A;  4LF8 C;  2D1R A;  1PG3 A;  2P2B A;  3TQI A;  4RVN A;  4XX2 A;  4RM3 A;  1USP A;  5BR8 C;  2Y4N A;  3N2Q A;  3RG2 A;  3EQ6 A;  4ZLP A;  1UKK A;  4DV1 C;  4FUQ A;  3NPD A;  3NYR A;  4BSZ A;  1FUG A;  4R1M A;  4PHT A;  5BSV A;  5KYV A;  1AMU A;  4KTT A;  4NXM C;  3A4I A;  5AE3 A;  3UZ0 A;  4BC9 A;  4JI6 C;  3L8C A;  1XRA A;  4U5Y D;  4X64 C;  3SO4 A;  4LF6 C;  4D57 A;  1KKG A;  4X65 C;  5A1I A;  2E0G A;  4L2Z A;  2UXB C;  4RLF A;  2CXC A;  2UXC C;  2XR1 A;  1MXA A;  5CZV A;  4ISB A;  5BSW A;  3IML A;  2PT7 G;  3TUF A;  4LF9 C;  5BSR A;  1IBL C;  1ULT A;  1MKY A;  4DCV A;  4DV3 C;  3GKU A;  4DV4 C;  4DR4 C;  4B3R C;  1LQL A;  4OX9 C;  4RM2 A;  2AYA A;  4EAT A;  1VLA A;  3VNQ A;  4B3T C;  3T1Y C;  3H2T A;  5H9U A;  1MXC A;  1T5D X;  4LFC C;  4DV0 C;  1RY2 A;  3I08 A;  5BUQ A;  1V25 A;  2ZM6 C;  3KXW A;  2F4V C;  3NYQ A;  4G1I A;  4KTV A;  5AE1 A;  1XNQ C;  1WH9 A;  5K8F A;  1J5E C;  2HJG A;  2DPL A;  2VSQ A;  4DG8 A;  3E7X A;  4DV5 C;  2YWB A;  2BH1 X;  1PA4 A;  2KZF A;  2E8C A;  5E7Q A;  3RV2 A;  2UXD C;  4KHP C;  3PES A;  2YWC A;  2P02 A;  2OPL A;  1WF3 A;  3LNV A;  5BSM A;  2PRO A;  2E7G A;  1MXB A;  1ZB9 A;  1ZB8 A;  4DV7 C;  4JI4 C;  4LF4 C;  4RLQ A;  2EGT A;  2ONF A;  4G37 A;  1K0R A;  2UUB C;  4GKJ C;  3FCE A;  4NOZ A;  2P2M A;  5A1G A;  1XMQ C;  1PG4 A;  3C5E A;  5K85 A;  3GR1 A;  4JI3 C;  2ATW A;  2E5L C;  4GKK C;  3UOW A;  1XRC A;  3NI2 A;  2OPL B;  2Y4O A;  3GPC A;  1HNZ C;  1ML8 A;  1T5H X;  3B7W A;  2V7B A;  4DCS A;  2D1S A;  1BA3 A;  4ODJ A;  1LCI A;  4IR7 A;  1EGA A;  3A9V A;  3N54 B;  5T8T A;  2QVX X;  4OYC A;  4DCT A;  1YJ7 A;  4WS9 A;  5AE2 A;  3R9X A;  1N34 C;  4JV5 C;  2UUA C;  4IZ6 A;  4D4I A;  3EER A;  3CW9 A;  4R0M A;  3TDE A;  1V26 A;  5KYT A;  3LUS A;  5JRH A;  1XMO C;  2D27 A;  3DHV A;  2UUC C;  3ETO A;  2VQF C;  4DV2 C;  3T1H C;  2P2F A;  5GTD A;  1HH2 P;  2DYJ A;  4RMN A;  1NYE A;  2D1T A;  3R9W A;  4JI5 C;  3A9U A;  1HR0 C;  4X66 C;  1QWI A;  2D7V A;  2P2Q A;  4JI7 C;  4NDN A;  1QM4 A;  1IBM C;  4K0K C;  4DR2 C;  1P7L A;  1MDF A;  5DV9 A;  4R1L A;  4JI1 C;  3PBK A;  5LMU C;  4DR3 C;  2WP0 C;  2BJO A;  4OXI A;  3PRO C;  4LF7 C;  3J81 D;  1IBK C;  4D56 A;  1USP B;  4ZJZ A;  4YHH C;  1GPM A;  1N36 C;  4DG9 A;  5KEI A;  4DR1 C;  4NXN C;  3AF6 A;  2UU9 C;  4FUT A;  3IEV A;  5BSU A;  3S82 A;  4X62 C;  4LE5 A;  4DCU A;  1L2F A;  1HNW C;  2YCB A;  1O90 A;  2D1Q A;  2QW0 X;  2CY1 A;  2Y27 A;  5ADZ A;  3CJE A;  3ETC A;  4MH4 A;  2OO4 A;  1HNX C;  1N32 C;  3AF5 A;  2WD9 A;  3IEU A;  5IT9 D;  3G7S A;  1O93 A;  4L4Q A;  5A2Q D;  1JOS A;  1O92 A;  3J80 D;  4GS5 A;  1O9T A;  4HPV A;  4MTN A;  5BUR A;  4TPS B;  3R44 A;  2OBV A;  2HHH C;  5LMN C;  5A19 A;  5FLX D;  4I9G A;  2P20 A;  2D28 C;  2VQE C;  4BC7 A;  4PZP A;  1XRB A;  5T8S A;  3LAX A;  4DR6 C;  3LGX A;  4LFB C;  3DAY A;  4JI0 C;  1N2F A;  4JI8 C;  2ASB A;  4FTF A;  4B3S C;  2PN2 A;  3DLP X;  4B3M C;  2E8E A;  4K0B A;  3VNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...