3UZ0A

Crystal structure of spoiiiah and spoiiq complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
114
structure length
114
Chain Sequence
DLFTTYRLDLEDARSKEREELNAIVSSDDATAKEKSEAYDKMTALSEVEGTEKQLETLIKTQGYEDALVNAEGDKINITVKSDKHSKSKATAIIDLVAKEIKTMKDVAVTFEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Stage III sporulation protein AH
publication title Structure of the basal components of a bacterial transporter.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 44
structure length 114
sequence length 114
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.270 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3uz0A00
3UZ0A 3TUFA
chains in the Genus database with same CATH superfamily
4ZLPA 4GXRA 2YCBA 3G7SA 4DV5C 2UUBC 2CU6A 3GR1A 1JOSA 2P2MA 1VEHA 2BJOA 4LFBC 2VSQA 3A9VA 2Y4NA 4KHPC 2DYJA 2QL8A 4ODJA 4BCAA 4DV6C 2KZFA 4PUIA 1BA3A 3TDEA 3R9XA 3LGXA 1MDFA 3R9WA 4DV0C 1USPB 3H2TA 3I08A 4L7IA 4OYCA 4PZPA 2P2BA 4LF7C 1XRAA 5LMNC 1XMQC 1USPA 3CQ1A 1XRCA 1MDBA 1L2FA 2D28C 4JM1A 2Y4OA 1PG4A 4KTTA 4BC7A 2UXBC 4WV3A 3IPLA 1N36C 3PROC 4B3MC 2JNVA 1P7LA 4DR7C 1XRBA 2PN2A 1UWDA 3L8CA 4PUHA 3TUFA 4B3TC 1WF3A 1MXAA 1O9TA 4HPVA 4DCUA 2ZM6C 2OPLB 3SO4A 3J80D 1IBLC 1K0RA 3J81D 2OO4A 4L4QA 3CW9A 5BSRA 4K0BA 2QVXX 4YHHC 3LAXA 4GXQA 2OPLA 3DAYA 3UOWA 2MMAB 3GR0A 4JI4C 1O90A 4I9FA 2DHMA 2D1RA 1XNRC 4JI7C 4ISBA 4LF6C 5BSUA 4LFCC 5CZVA 1V25A 4R1LA 3L95X 1YJ7A 4X66C 5FLXD 1GPMA 2UXDC 3A25A 2D1QA 5H9UA 4R0MA 4R1MA 4YY3C 1XHJA 4LF8C 2Y27A 5A2QD 5BURA 4GKKC 1FUGA 1HNWC 4I9GA 4DG8A 4DCVA 2DPLA 2JMPA 5AE1A 1XS3A 4LF4C 4DR6C 2QVYX 3VNQA 3OTOC 5IWAC 2WD9A 3NYRA 4BSZA 4JI5C 3PBKA 3T1HC 2V7BA 1AMUA 4DCSA 3A26A 2P2QA 4PHTA 4B3SC 4WS9A 4G36A 2MCQA 4DR1C 2CXCA 4D4GA 3B7WA 1LQLA 4RVNA 1IBMC 5KYTA 1XMOC 2D27A 4FTFA 5T8TA 4JI0C 4NXMC 2HHHC 4X64C 2P02A 3CQ3A 5LMUC 4FUTA 3EQ6A 2ZZNA 4EATA 5IFIA 1I94C 1O93A 4TPSB 2YX1A 3NI2A 2F4VC 2YWCA 2VZEA 5GTDA 3KXWA 2ASBA 4LF5C 3AF6A 3E7XA 4JI3C 4JV5C 4ZJZA 5A1GA 5KYVA 1MD9A 2UUCC 4BBYA 2Z51A 3AY0A 4DR3C 2AYAA 3VNSA 3C5EA 3S82A 1HNXC 1P4EA 1NY8A 3R44A 4B3RC 5AE3A 1PU1A 3K6RA 4RVOA 4DUYC 1FJGC 2ONFA 1PA4A 2NCLA 5BSMA 2PT7G 1N34C 3IEUA 4XX2A 2M5OA 1NYEA 3CW8X 4LE5A 4LF9C 2QW0X 1T5DX 5BSWA 4LFAC 4MH4A 3EERA 4DR5C 2XR1A 5AE2A 4DCTA 3LNVA 4RM3A 1TH5A 3ETOA 1XNQC 1HH2P 2D7VA 3E7WA 4DG9A 4RLQA 1ZB8A 4GKJC 2P20A 1RY2A 3RV2A 1N2FA 4X65C 5A1IA 2ZZMA 1VLAA 1UKKA 4FUQA 2BH1X 3FCCA 4DV1C 4G1IA 4KTVA 2D1SA 4D4IA 3LUSA 4PROC 4X62C 4PUGA 3DLPX 3A4IA 1KKGA 5LCIA 4IR7A 3VNRA 2E8CA 3FCEA 3LNOA 3UX3A 1M6XC 5CZXA 2MM9A 2VQFC 3GKUA 5IT9D 1ZB9A 2E8FA 2UUAC 1RG9A 1ML8A 4GS5A 4DR4C 5T8SA 4G37A 1O92A 3A9UA 4JI6C 1HR0C 4NXNC 5K85A 1EGAA 4DV3C 1FLOA 1QWIA 4MTNA 3IEVA 3DHVA 3UX2A 2E0GA 5A19A 2KZ0A 2WP0C 1P4EC 1V26A 1ULTA 3N54B 4NOZA 1M6XA 5ADZA 3GPCA 4JI8C 2D1TA 2UU9C 4IZ6A 3TR3A 3NYQA 1PG3A 1IBKC 4JYAC 2E8EA 2YWBA 2QVZX 3UEBA 1WCJA 4JI1C 1J5EC 1QM4A 3IMLA 4OX9C 2M5HA 2EGTA 4OXIA 1T5HX 2P2JA 3CQ2A 5DV9A 5K8FA 3TQIA 3AF5A 1V60A 4BC9A 4JI2C 5BR8C 1MXBA 4D56A 4DUZC 4NDNA 1N32C 2VQEC 1LCIA 2ATWA 4DV2C 1N33C 4DV7C 5JRHA 4DR2C 5E7QA 2UXCC 2CY1A 3RG2A 3NPDA 1HNZC 2OBVA 4U5YD 3CJEA 4RMNA 2P2FA 4K0KC 3T1YC 4L2ZA 1WH9A 5BSVA 2PROA 4RLFA 2E5LC 3O2EA 1IB8A 1MXCA 5BUSA 4DV4C 1MKYA 3JAMD 3N2QA 5BUQA 3PESA 5KEIA 2E7GA 3UZ0A 4AQYC 3ETCA 3I07A 2HJGA 4RM2A 2KDNA 5BSTA 4D57A
chains in the Genus database with same CATH topology
4ZLPA 4GXRA 2YCBA 3G7SA 4DV5C 2UUBC 3GR1A 1JOSA 2P2MA 2BJOA 4LFBC 2VSQA 3A9VA 2Y4NA 4KHPC 2DYJA 2QL8A 4ODJA 4BCAA 4DV6C 2KZFA 1BA3A 3TDEA 3R9XA 3LGXA 1MDFA 3R9WA 4DV0C 1USPB 3H2TA 3I08A 4L7IA 4OYCA 4PZPA 2P2BA 4LF7C 1XRAA 5LMNC 1XMQC 1USPA 1XRCA 1MDBA 1L2FA 2D28C 4JM1A 2Y4OA 1PG4A 4KTTA 4BC7A 2UXBC 4WV3A 3IPLA 1N36C 3PROC 4B3MC 1P7LA 4DR7C 1XRBA 2PN2A 3L8CA 4B3TC 3TUFA 1WF3A 1MXAA 1O9TA 4HPVA 4DCUA 2ZM6C 2OPLB 3SO4A 3J80D 1IBLC 1K0RA 3J81D 2OO4A 4L4QA 3CW9A 5BSRA 4K0BA 2QVXX 4YHHC 3LAXA 4GXQA 2OPLA 3DAYA 3UOWA 3GR0A 4JI4C 1O90A 4I9FA 2D1RA 1XNRC 4JI7C 4ISBA 4LF6C 5BSUA 4LFCC 5CZVA 1V25A 4R1LA 3L95X 1YJ7A 4X66C 5FLXD 1GPMA 2UXDC 2D1QA 5H9UA 4R0MA 4R1MA 4YY3C 4LF8C 2Y27A 5A2QD 5BURA 4GKKC 1FUGA 1HNWC 4I9GA 4DG8A 4DCVA 2DPLA 2JMPA 5AE1A 4LF4C 4DR6C 2QVYX 3VNQA 3OTOC 5IWAC 2WD9A 3NYRA 4BSZA 4JI5C 3PBKA 3T1HC 2V7BA 1AMUA 4DCSA 2P2QA 4PHTA 4B3SC 4WS9A 4G36A 4DR1C 2CXCA 4D4GA 3B7WA 1LQLA 4RVNA 1IBMC 1XMOC 5KYTA 2D27A 4FTFA 5T8TA 4JI0C 4NXMC 2HHHC 4X64C 2P02A 5LMUC 4FUTA 3EQ6A 4EATA 5IFIA 1I94C 1O93A 4TPSB 3NI2A 2F4VC 2YWCA 2VZEA 5GTDA 3KXWA 2ASBA 4LF5C 3AF6A 3E7XA 4JI3C 4JV5C 4ZJZA 5A1GA 5KYVA 1MD9A 2UUCC 4BBYA 4DR3C 2AYAA 3VNSA 3C5EA 3S82A 1HNXC 3R44A 4B3RC 5AE3A 4RVOA 4DUYC 1FJGC 2ONFA 1PA4A 5BSMA 2PT7G 1N34C 3IEUA 4XX2A 1NYEA 3CW8X 4LE5A 4LF9C 2QW0X 1T5DX 5BSWA 4LFAC 4MH4A 3EERA 4DR5C 2XR1A 5AE2A 4DCTA 3LNVA 4RM3A 3ETOA 1XNQC 1HH2P 2D7VA 3E7WA 4DG9A 4RLQA 1ZB8A 4GKJC 2P20A 1RY2A 3RV2A 1N2FA 4X65C 5A1IA 1VLAA 1UKKA 4FUQA 2BH1X 3FCCA 4DV1C 4G1IA 4KTVA 2D1SA 4D4IA 3LUSA 4PROC 4X62C 3DLPX 3A4IA 1KKGA 4IR7A 3VNRA 2E8CA 3FCEA 5CZXA 2VQFC 5IT9D 3GKUA 1ZB9A 2E8FA 2UUAC 1RG9A 1ML8A 4GS5A 4DR4C 5T8SA 4G37A 1O92A 3A9UA 4JI6C 1HR0C 4NXNC 5K85A 1EGAA 4DV3C 1QWIA 4MTNA 3IEVA 3DHVA 2E0GA 5A19A 2WP0C 1V26A 1ULTA 3N54B 4NOZA 5ADZA 3GPCA 4JI8C 2D1TA 2UU9C 4IZ6A 3NYQA 1PG3A 1IBKC 4JYAC 2E8EA 2YWBA 2QVZX 4JI1C 1J5EC 1QM4A 3IMLA 4OX9C 2EGTA 4OXIA 1T5HX 2P2JA 5DV9A 5K8FA 3TQIA 3AF5A 4BC9A 4JI2C 5BR8C 1MXBA 4D56A 4DUZC 4NDNA 1N32C 2VQEC 1LCIA 2ATWA 4DV2C 1N33C 4DV7C 5JRHA 4DR2C 5E7QA 2UXCC 2CY1A 3RG2A 3NPDA 1HNZC 2OBVA 4U5YD 3CJEA 4RMNA 2P2FA 4K0KC 3T1YC 4L2ZA 1WH9A 5BSVA 2PROA 4RLFA 2E5LC 1MXCA 5BUSA 4DV4C 1MKYA 3JAMD 3N2QA 5BUQA 3PESA 5KEIA 2E7GA 3UZ0A 4AQYC 3ETCA 3I07A 2HJGA 4RM2A 5BSTA 4D57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UZ0 A;  3TUF A; 
#chains in the Genus database with same CATH topology
 4ZLP A;  4GXR A;  2YCB A;  3G7S A;  4DV5 C;  2UUB C;  2CU6 A;  3GR1 A;  1JOS A;  2P2M A;  1VEH A;  2BJO A;  4LFB C;  2VSQ A;  3A9V A;  2Y4N A;  4KHP C;  2DYJ A;  2QL8 A;  4ODJ A;  4BCA A;  4DV6 C;  2KZF A;  4PUI A;  1BA3 A;  3TDE A;  3R9X A;  3LGX A;  1MDF A;  3R9W A;  4DV0 C;  1USP B;  3H2T A;  3I08 A;  4L7I A;  4OYC A;  4PZP A;  2P2B A;  4LF7 C;  1XRA A;  5LMN C;  1XMQ C;  1USP A;  3CQ1 A;  1XRC A;  1MDB A;  1L2F A;  2D28 C;  4JM1 A;  2Y4O A;  1PG4 A;  4KTT A;  4BC7 A;  2UXB C;  4WV3 A;  3IPL A;  1N36 C;  3PRO C;  4B3M C;  2JNV A;  1P7L A;  4DR7 C;  1XRB A;  2PN2 A;  1UWD A;  3L8C A;  4PUH A;  3TUF A;  4B3T C;  1WF3 A;  1MXA A;  1O9T A;  4HPV A;  4DCU A;  2ZM6 C;  2OPL B;  3SO4 A;  3J80 D;  1IBL C;  1K0R A;  3J81 D;  2OO4 A;  4L4Q A;  3CW9 A;  5BSR A;  4K0B A;  2QVX X;  4YHH C;  3LAX A;  4GXQ A;  2OPL A;  3DAY A;  3UOW A;  2MMA B;  3GR0 A;  4JI4 C;  1O90 A;  4I9F A;  2DHM A;  2D1R A;  1XNR C;  4JI7 C;  4ISB A;  4LF6 C;  5BSU A;  4LFC C;  5CZV A;  1V25 A;  4R1L A;  3L95 X;  1YJ7 A;  4X66 C;  5FLX D;  1GPM A;  2UXD C;  3A25 A;  2D1Q A;  5H9U A;  4R0M A;  4R1M A;  4YY3 C;  1XHJ A;  4LF8 C;  2Y27 A;  5A2Q D;  5BUR A;  4GKK C;  1FUG A;  1HNW C;  4I9G A;  4DG8 A;  4DCV A;  2DPL A;  2JMP A;  5AE1 A;  1XS3 A;  4LF4 C;  4DR6 C;  2QVY X;  3VNQ A;  3OTO C;  5IWA C;  2WD9 A;  3NYR A;  4BSZ A;  4JI5 C;  3PBK A;  3T1H C;  2V7B A;  1AMU A;  4DCS A;  3A26 A;  2P2Q A;  4PHT A;  4B3S C;  4WS9 A;  4G36 A;  2MCQ A;  4DR1 C;  2CXC A;  4D4G A;  3B7W A;  1LQL A;  4RVN A;  1IBM C;  5KYT A;  1XMO C;  2D27 A;  4FTF A;  5T8T A;  4JI0 C;  4NXM C;  2HHH C;  4X64 C;  2P02 A;  3CQ3 A;  5LMU C;  4FUT A;  3EQ6 A;  2ZZN A;  4EAT A;  5IFI A;  1I94 C;  1O93 A;  4TPS B;  2YX1 A;  3NI2 A;  2F4V C;  2YWC A;  2VZE A;  5GTD A;  3KXW A;  2ASB A;  4LF5 C;  3AF6 A;  3E7X A;  4JI3 C;  4JV5 C;  4ZJZ A;  5A1G A;  5KYV A;  1MD9 A;  2UUC C;  4BBY A;  2Z51 A;  3AY0 A;  4DR3 C;  2AYA A;  3VNS A;  3C5E A;  3S82 A;  1HNX C;  1P4E A;  1NY8 A;  3R44 A;  4B3R C;  5AE3 A;  1PU1 A;  3K6R A;  4RVO A;  4DUY C;  1FJG C;  2ONF A;  1PA4 A;  2NCL A;  5BSM A;  2PT7 G;  1N34 C;  3IEU A;  4XX2 A;  2M5O A;  1NYE A;  3CW8 X;  4LE5 A;  4LF9 C;  2QW0 X;  1T5D X;  5BSW A;  4LFA C;  4MH4 A;  3EER A;  4DR5 C;  2XR1 A;  5AE2 A;  4DCT A;  3LNV A;  4RM3 A;  1TH5 A;  3ETO A;  1XNQ C;  1HH2 P;  2D7V A;  3E7W A;  4DG9 A;  4RLQ A;  1ZB8 A;  4GKJ C;  2P20 A;  1RY2 A;  3RV2 A;  1N2F A;  4X65 C;  5A1I A;  2ZZM A;  1VLA A;  1UKK A;  4FUQ A;  2BH1 X;  3FCC A;  4DV1 C;  4G1I A;  4KTV A;  2D1S A;  4D4I A;  3LUS A;  4PRO C;  4X62 C;  4PUG A;  3DLP X;  3A4I A;  1KKG A;  5LCI A;  4IR7 A;  3VNR A;  2E8C A;  3FCE A;  3LNO A;  3UX3 A;  1M6X C;  5CZX A;  2MM9 A;  2VQF C;  3GKU A;  5IT9 D;  1ZB9 A;  2E8F A;  2UUA C;  1RG9 A;  1ML8 A;  4GS5 A;  4DR4 C;  5T8S A;  4G37 A;  1O92 A;  3A9U A;  4JI6 C;  1HR0 C;  4NXN C;  5K85 A;  1EGA A;  4DV3 C;  1FLO A;  1QWI A;  4MTN A;  3IEV A;  3DHV A;  3UX2 A;  2E0G A;  5A19 A;  2KZ0 A;  2WP0 C;  1P4E C;  1V26 A;  1ULT A;  3N54 B;  4NOZ A;  1M6X A;  5ADZ A;  3GPC A;  4JI8 C;  2D1T A;  2UU9 C;  4IZ6 A;  3TR3 A;  3NYQ A;  1PG3 A;  1IBK C;  4JYA C;  2E8E A;  2YWB A;  2QVZ X;  3UEB A;  1WCJ A;  4JI1 C;  1J5E C;  1QM4 A;  3IML A;  4OX9 C;  2M5H A;  2EGT A;  4OXI A;  1T5H X;  2P2J A;  3CQ2 A;  5DV9 A;  5K8F A;  3TQI A;  3AF5 A;  1V60 A;  4BC9 A;  4JI2 C;  5BR8 C;  1MXB A;  4D56 A;  4DUZ C;  4NDN A;  1N32 C;  2VQE C;  1LCI A;  2ATW A;  4DV2 C;  1N33 C;  4DV7 C;  5JRH A;  4DR2 C;  5E7Q A;  2UXC C;  2CY1 A;  3RG2 A;  3NPD A;  1HNZ C;  2OBV A;  4U5Y D;  3CJE A;  4RMN A;  2P2F A;  4K0K C;  3T1Y C;  4L2Z A;  1WH9 A;  5BSV A;  2PRO A;  4RLF A;  2E5L C;  3O2E A;  1IB8 A;  1MXC A;  5BUS A;  4DV4 C;  1MKY A;  3JAM D;  3N2Q A;  5BUQ A;  3PES A;  5KEI A;  2E7G A;  3UZ0 A;  4AQY C;  3ETC A;  3I07 A;  2HJG A;  4RM2 A;  2KDN A;  5BST A;  4D57 A; 
#chains in the Genus database with same CATH homology
 4ZLP A;  4GXR A;  2YCB A;  3G7S A;  4DV5 C;  2UUB C;  3GR1 A;  1JOS A;  2P2M A;  2BJO A;  4LFB C;  2VSQ A;  3A9V A;  2Y4N A;  4KHP C;  2DYJ A;  2QL8 A;  4ODJ A;  4BCA A;  4DV6 C;  2KZF A;  1BA3 A;  3TDE A;  3R9X A;  3LGX A;  1MDF A;  3R9W A;  4DV0 C;  1USP B;  3H2T A;  3I08 A;  4L7I A;  4OYC A;  4PZP A;  2P2B A;  4LF7 C;  1XRA A;  5LMN C;  1XMQ C;  1USP A;  1XRC A;  1MDB A;  1L2F A;  2D28 C;  4JM1 A;  2Y4O A;  1PG4 A;  4KTT A;  4BC7 A;  2UXB C;  4WV3 A;  3IPL A;  1N36 C;  3PRO C;  4B3M C;  1P7L A;  4DR7 C;  1XRB A;  2PN2 A;  3L8C A;  4B3T C;  3TUF A;  1WF3 A;  1MXA A;  1O9T A;  4HPV A;  4DCU A;  2ZM6 C;  2OPL B;  3SO4 A;  3J80 D;  1IBL C;  1K0R A;  3J81 D;  2OO4 A;  4L4Q A;  3CW9 A;  5BSR A;  4K0B A;  2QVX X;  4YHH C;  3LAX A;  4GXQ A;  2OPL A;  3DAY A;  3UOW A;  3GR0 A;  4JI4 C;  1O90 A;  4I9F A;  2D1R A;  1XNR C;  4JI7 C;  4ISB A;  4LF6 C;  5BSU A;  4LFC C;  5CZV A;  1V25 A;  4R1L A;  3L95 X;  1YJ7 A;  4X66 C;  5FLX D;  1GPM A;  2UXD C;  2D1Q A;  5H9U A;  4R0M A;  4R1M A;  4YY3 C;  4LF8 C;  2Y27 A;  5A2Q D;  5BUR A;  4GKK C;  1FUG A;  1HNW C;  4I9G A;  4DG8 A;  4DCV A;  2DPL A;  2JMP A;  5AE1 A;  4LF4 C;  4DR6 C;  2QVY X;  3VNQ A;  3OTO C;  5IWA C;  2WD9 A;  3NYR A;  4BSZ A;  4JI5 C;  3PBK A;  3T1H C;  2V7B A;  1AMU A;  4DCS A;  2P2Q A;  4PHT A;  4B3S C;  4WS9 A;  4G36 A;  4DR1 C;  2CXC A;  4D4G A;  3B7W A;  1LQL A;  4RVN A;  1IBM C;  1XMO C;  5KYT A;  2D27 A;  4FTF A;  5T8T A;  4JI0 C;  4NXM C;  2HHH C;  4X64 C;  2P02 A;  5LMU C;  4FUT A;  3EQ6 A;  4EAT A;  5IFI A;  1I94 C;  1O93 A;  4TPS B;  3NI2 A;  2F4V C;  2YWC A;  2VZE A;  5GTD A;  3KXW A;  2ASB A;  4LF5 C;  3AF6 A;  3E7X A;  4JI3 C;  4JV5 C;  4ZJZ A;  5A1G A;  5KYV A;  1MD9 A;  2UUC C;  4BBY A;  4DR3 C;  2AYA A;  3VNS A;  3C5E A;  3S82 A;  1HNX C;  3R44 A;  4B3R C;  5AE3 A;  4RVO A;  4DUY C;  1FJG C;  2ONF A;  1PA4 A;  5BSM A;  2PT7 G;  1N34 C;  3IEU A;  4XX2 A;  1NYE A;  3CW8 X;  4LE5 A;  4LF9 C;  2QW0 X;  1T5D X;  5BSW A;  4LFA C;  4MH4 A;  3EER A;  4DR5 C;  2XR1 A;  5AE2 A;  4DCT A;  3LNV A;  4RM3 A;  3ETO A;  1XNQ C;  1HH2 P;  2D7V A;  3E7W A;  4DG9 A;  4RLQ A;  1ZB8 A;  4GKJ C;  2P20 A;  1RY2 A;  3RV2 A;  1N2F A;  4X65 C;  5A1I A;  1VLA A;  1UKK A;  4FUQ A;  2BH1 X;  3FCC A;  4DV1 C;  4G1I A;  4KTV A;  2D1S A;  4D4I A;  3LUS A;  4PRO C;  4X62 C;  3DLP X;  3A4I A;  1KKG A;  4IR7 A;  3VNR A;  2E8C A;  3FCE A;  5CZX A;  2VQF C;  5IT9 D;  3GKU A;  1ZB9 A;  2E8F A;  2UUA C;  1RG9 A;  1ML8 A;  4GS5 A;  4DR4 C;  5T8S A;  4G37 A;  1O92 A;  3A9U A;  4JI6 C;  1HR0 C;  4NXN C;  5K85 A;  1EGA A;  4DV3 C;  1QWI A;  4MTN A;  3IEV A;  3DHV A;  2E0G A;  5A19 A;  2WP0 C;  1V26 A;  1ULT A;  3N54 B;  4NOZ A;  5ADZ A;  3GPC A;  4JI8 C;  2D1T A;  2UU9 C;  4IZ6 A;  3NYQ A;  1PG3 A;  1IBK C;  4JYA C;  2E8E A;  2YWB A;  2QVZ X;  4JI1 C;  1J5E C;  1QM4 A;  3IML A;  4OX9 C;  2EGT A;  4OXI A;  1T5H X;  2P2J A;  5DV9 A;  5K8F A;  3TQI A;  3AF5 A;  4BC9 A;  4JI2 C;  5BR8 C;  1MXB A;  4D56 A;  4DUZ C;  4NDN A;  1N32 C;  2VQE C;  1LCI A;  2ATW A;  4DV2 C;  1N33 C;  4DV7 C;  5JRH A;  4DR2 C;  5E7Q A;  2UXC C;  2CY1 A;  3RG2 A;  3NPD A;  1HNZ C;  2OBV A;  4U5Y D;  3CJE A;  4RMN A;  2P2F A;  4K0K C;  3T1Y C;  4L2Z A;  1WH9 A;  5BSV A;  2PRO A;  4RLF A;  2E5L C;  1MXC A;  5BUS A;  4DV4 C;  1MKY A;  3JAM D;  3N2Q A;  5BUQ A;  3PES A;  5KEI A;  2E7G A;  3UZ0 A;  4AQY C;  3ETC A;  3I07 A;  2HJG A;  4RM2 A;  5BST A;  4D57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...