4U5YD

Crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
115
Chain Sequence
GTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNCGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNTLADPGVVEKLLEEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the specificity of lysine acetyltransferases.
pubmed doi rcsb
source organism Streptomyces lividans tk24
molecule tags Ligase
molecule keywords Acyl-CoA synthetase
total genus 33
structure length 115
sequence length 120
ec nomenclature ec 6.2.1.1: Acetate--CoA ligase.
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4u5yD00
2VZEA 5E7QA 5BUQA 1MD9A 5KEIA 2Y4OA 3NI2A 5BSUA 3C5EA 2QVZX 4PZPA 2D1RA 1PG3A 4D56A 5JRHA 2Y27A 3DHVA 3E7WA 4ISBA 5GTDA 2Y4NA 3IPLA 4RLQA 3G7SA 1T5DX 1PG4A 4EATA 1AMUA 3NYQA 4IR7A 3LAXA 2QVXX 3RG2A 4GS5A 2D1TA 1ULTA 2QW0X 2VSQA 3FCEA 5KYTA 4RVNA 5BSMA 3A9UA 3CW8X 5BSRA 4IZ6A 3FCCA 4R1MA 1RY2A 4WV3A 3GPCA 3DAYA 4OYCA 4RLFA 4R1LA 3CW9A 3VNQA 1YJ7A 3E7XA 3PBKA 3LNVA 5K85A 2P2QA 4R0MA 2P2FA 3B7WA 5K8FA 2WD9A 4RM2A 3VNRA 5BSWA 4DG8A 4RM3A 2V7BA 5BSVA 4GXQA 1MDFA 3KXWA 4RVOA 3LGXA 5BURA 4RMNA 3A9VA 5BUSA 4G36A 2P2MA 4OXIA 3NYRA 3ETCA 4U5YD 3EQ6A 4FUTA 5DV9A 4DG9A 2QVYX 5IFIA 4G37A 4GXRA 5KYVA 3L8CA 2D1SA 3VNSA 1BA3A 1T5HX 3R44A 1MDBA 5BSTA 4D4IA 4ZJZA 2P2BA 3DLPX 1LCIA 2D1QA 4D57A 2P20A 4D4GA 2P2JA 4FUQA
chains in the Genus database with same CATH superfamily
5E7QA 1MD9A 4DR5C 2Y4OA 5BSUA 2M5HA 2D27A 1MXAA 4DV0C 2D7VA 1PG3A 4PHTA 3TDEA 4DR4C 2DYJA 1PG4A 2KDNA 5AE1A 3GR0A 3NYQA 2E8CA 4DR2C 3ETOA 1NYEA 1WCJA 4LF7C 1ULTA 2KZ0A 4PUHA 4LFBC 1O90A 4IZ6A 2UXDC 3H2TA 4WV3A 3GPCA 4OYCA 4RLFA 2MM9A 3K6RA 3LUSA 4B3RC 1O9TA 3J80D 4X65C 3E7XA 3TQIA 1N32C 5K85A 1QM4A 4JI6C 4NXNC 2NCLA 4X66C 5T8TA 1XMQC 1RG9A 1V26A 5BSWA 1L2FA 1TH5A 2MCQA 4XX2A 4JI3C 1XNQC 5BSVA 5A1GA 4DV3C 3KXWA 4RVOA 3LGXA 1HNZC 4RMNA 4YY3C 5LCIA 4OXIA 1IBLC 4HPVA 4YHHC 4U5YD 4NXMC 2OO4A 4FUTA 1WH9A 2QVYX 4JI8C 2HHHC 3A25A 2UXBC 3L8CA 2D1SA 4DR3C 4NDNA 1T5HX 3IEUA 5BSTA 2ASBA 1VEHA 4D4IA 1XS3A 3TR3A 2YX1A 1M6XA 2P2BA 1P7LA 4LF8C 2BH1X 3OTOC 4D57A 2P2JA 2PN2A 5KEIA 2JNVA 2PT7G 2QVZX 4PZPA 2DPLA 3PROC 2D1RA 2E7GA 4DCTA 5H9UA 1HNXC 4KHPC 3R9WA 4JI4C 3IPLA 4WS9A 4FTFA 1FJGC 4EATA 4JYAC 4IR7A 2CU6A 4DCSA 3I08A 1N34C 2ONFA 3CQ2A 4GS5A 5A1IA 2CY1A 2QW0X 2VSQA 5KYTA 1JOSA 5AE3A 4RVNA 4I9FA 3UX3A 2D28C 4DV4C 4MH4A 2DHMA 1IBKC 1MKYA 5A19A 1HNWC 5A2QD 2M5OA 3AF5A 2AYAA 4DV7C 2P2FA 4X62C 3B7WA 1ZB9A 3VNRA 4DG8A 4RM3A 2V7BA 2XR1A 4DR6C 1FUGA 2QL8A 3N2QA 4ODJA 1N36C 4BCAA 4B3MC 5BURA 2P2MA 2ZM6C 3EQ6A 4G37A 1NY8A 4JI7C 3R44A 1K0RA 2ZZNA 3IMLA 4DCVA 4ZJZA 1PU1A 3AY0A 4MTNA 2P20A 3R9XA 2BJOA 1P4EC 4KTVA 5BUQA 1ZB8A 4BC7A 3CJEA 4GKJC 4JI1C 2Y27A 3DHVA 3E7WA 4ISBA 2UUCC 5GTDA 2Y4NA 1ML8A 2VQFC 3G7SA 3I07A 1T5DX 4JI0C 3J81D 4BBYA 1N33C 4B3SC 2JMPA 3LAXA 2QVXX 3RG2A 4TPSB 2D1TA 1J5EC 4ZLPA 4I9GA 4OX9C 3A9UA 1XRCA 3CW8X 4L4QA 1P4EA 3FCCA 4R1MA 4X64C 4DV1C 3GR1A 1EGAA 4L2ZA 2E5LC 4R1LA 4AQYC 3CW9A 1M6XC 1YJ7A 4BC9A 3L95X 3PBKA 4LE5A 2F4VC 2VQEC 2P2QA 1I94C 3JAMD 5K8FA 4G1IA 1USPA 4JI5C 4PROC 4PUIA 1MXCA 1GPMA 4DR7C 4GKKC 3IEVA 2ATWA 5LMUC 1IB8A 1MDFA 1HR0C 2ZZMA 1WF3A 3NPDA 4G36A 2OBVA 3NYRA 3ETCA 5CZVA 5DV9A 5IFIA 3EERA 2PROA 4GXRA 3VNSA 4PUGA 1MDBA 4LF9C 2HJGA 2E8EA 3SO4A 3AF6A 2KZFA 2UUBC 1LCIA 4DUZC 4DCUA 2D1QA 5BR8C 3UEBA 1VLAA 2VZEA 4LF6C 3CQ1A 3NI2A 3C5EA 4DV2C 2OPLB 3UZ0A 1KKGA 4D56A 1V25A 3UX2A 5JRHA 4JI2C 4NOZA 1XHJA 4RLQA 5AE2A 2P02A 2EGTA 4K0BA 4DV6C 1AMUA 3TUFA 2UU9C 1PA4A 1HH2P 4LF5C 5IT9D 2MMAB 3S82A 4BSZA 3CQ3A 3FCEA 5BSMA 2YWCA 2E8FA 4JM1A 5ADZA 3T1YC 5BSRA 2UUAC 1XNRC 5T8SA 1RY2A 3PESA 4DR1C 4LF4C 3DAYA 3VNQA 5CZXA 1IBMC 3T1HC 1USPB 5LMNC 3LNVA 2CXCA 3A4IA 4JV5C 1XRBA 3RV2A 4R0MA 1XMOC 1LQLA 3A26A 2WD9A 2YCBA 2E0GA 4RM2A 4B3TC 3GKUA 1O92A 2Z51A 3LNOA 4L7IA 1XRAA 3UOWA 5FLXD 1UKKA 4GXQA 1FLOA 4DUYC 3N54B 5BUSA 3A9VA 4DG9A 1O93A 4LFCC 4K0KC 5KYVA 4LFAC 1BA3A 1MXBA 2YWBA 4DV5C 2UXCC 1V60A 2OPLA 5IWAC 3O2EA 1QWIA 3DLPX 1UWDA 2WP0C 1N2FA 4KTTA 4D4GA 4FUQA
chains in the Genus database with same CATH topology
5E7QA 1MD9A 4DR5C 2Y4OA 5BSUA 2D27A 1MXAA 4DV0C 2D7VA 1PG3A 4PHTA 3TDEA 4DR4C 2DYJA 1PG4A 5AE1A 3GR0A 3NYQA 2E8CA 4DR2C 3ETOA 1NYEA 4LF7C 1ULTA 4LFBC 1O90A 4IZ6A 2UXDC 3H2TA 4WV3A 3GPCA 4OYCA 4RLFA 3LUSA 4B3RC 1O9TA 3J80D 4X65C 3E7XA 3TQIA 1N32C 5K85A 1QM4A 4JI6C 4NXNC 4X66C 5T8TA 1XMQC 1RG9A 1V26A 5BSWA 1L2FA 4JI3C 4XX2A 1XNQC 5BSVA 5A1GA 4DV3C 3KXWA 4RVOA 3LGXA 1HNZC 4RMNA 4YY3C 4OXIA 1IBLC 4HPVA 4YHHC 4U5YD 4NXMC 2OO4A 4FUTA 1WH9A 2QVYX 4JI8C 2HHHC 2UXBC 3L8CA 2D1SA 4DR3C 4NDNA 1T5HX 3IEUA 5BSTA 2ASBA 4D4IA 2P2BA 1P7LA 4LF8C 2BH1X 3OTOC 4D57A 2P2JA 2PN2A 5KEIA 2PT7G 2QVZX 4PZPA 2DPLA 3PROC 2D1RA 2E7GA 4DCTA 5H9UA 1HNXC 4KHPC 3R9WA 4JI4C 3IPLA 4WS9A 4FTFA 1FJGC 4EATA 4JYAC 4IR7A 4DCSA 3I08A 1N34C 2ONFA 4GS5A 5A1IA 2CY1A 2QW0X 2VSQA 5KYTA 1JOSA 5AE3A 4RVNA 4I9FA 2D28C 4DV4C 4MH4A 1IBKC 1MKYA 5A19A 1HNWC 5A2QD 3AF5A 2AYAA 4DV7C 2P2FA 4X62C 3B7WA 1ZB9A 3VNRA 4DG8A 4RM3A 2V7BA 2XR1A 4DR6C 1FUGA 2QL8A 3N2QA 4ODJA 1N36C 4BCAA 4B3MC 5BURA 2P2MA 2ZM6C 3EQ6A 4G37A 4JI7C 3R44A 1K0RA 3IMLA 4DCVA 4ZJZA 4MTNA 2P20A 3R9XA 2BJOA 4KTVA 5BUQA 1ZB8A 4BC7A 3CJEA 4GKJC 4JI1C 2Y27A 3DHVA 3E7WA 4ISBA 2UUCC 5GTDA 2Y4NA 1ML8A 2VQFC 3G7SA 3I07A 1T5DX 4JI0C 3J81D 4BBYA 1N33C 4B3SC 2JMPA 3LAXA 2QVXX 3RG2A 4TPSB 2D1TA 1J5EC 4ZLPA 4I9GA 4OX9C 3A9UA 1XRCA 3CW8X 4L4QA 3FCCA 4R1MA 4X64C 4DV1C 3GR1A 1EGAA 4L2ZA 2E5LC 4R1LA 4AQYC 3CW9A 1YJ7A 4BC9A 3L95X 3PBKA 4LE5A 2F4VC 2VQEC 2P2QA 1I94C 3JAMD 5K8FA 4G1IA 1USPA 4JI5C 4PROC 1MXCA 1GPMA 4DR7C 4GKKC 3IEVA 2ATWA 5LMUC 1MDFA 1HR0C 1WF3A 3NPDA 4G36A 2OBVA 3NYRA 3ETCA 5CZVA 5DV9A 5IFIA 3EERA 2PROA 4GXRA 3VNSA 1MDBA 4LF9C 2HJGA 2E8EA 3SO4A 3AF6A 2KZFA 2UUBC 1LCIA 4DUZC 4DCUA 2D1QA 5BR8C 1VLAA 2VZEA 4LF6C 3NI2A 3C5EA 4DV2C 2OPLB 3UZ0A 1KKGA 4D56A 1V25A 5JRHA 4JI2C 4NOZA 4RLQA 5AE2A 2P02A 2EGTA 4K0BA 4DV6C 1AMUA 3TUFA 2UU9C 1PA4A 1HH2P 4LF5C 5IT9D 3S82A 4BSZA 3FCEA 5BSMA 2YWCA 2E8FA 4JM1A 5ADZA 3T1YC 5BSRA 2UUAC 1XNRC 5T8SA 1RY2A 3PESA 4DR1C 4LF4C 3DAYA 3VNQA 5CZXA 1IBMC 3T1HC 1USPB 5LMNC 3LNVA 2CXCA 3A4IA 4JV5C 1XRBA 3RV2A 4R0MA 1XMOC 1LQLA 2WD9A 2YCBA 2E0GA 4RM2A 4B3TC 3GKUA 1O92A 4L7IA 1XRAA 3UOWA 5FLXD 1UKKA 4GXQA 4DUYC 3N54B 5BUSA 3A9VA 4DG9A 1O93A 4LFCC 4K0KC 5KYVA 4LFAC 1BA3A 1MXBA 2YWBA 4DV5C 2UXCC 2OPLA 5IWAC 1QWIA 3DLPX 2WP0C 1N2FA 4KTTA 4D4GA 4FUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZE A;  5E7Q A;  5BUQ A;  1MD9 A;  5KEI A;  2Y4O A;  3NI2 A;  5BSU A;  3C5E A;  2QVZ X;  4PZP A;  2D1R A;  1PG3 A;  4D56 A;  5JRH A;  2Y27 A;  3DHV A;  3E7W A;  4ISB A;  5GTD A;  2Y4N A;  3IPL A;  4RLQ A;  3G7S A;  1T5D X;  1PG4 A;  4EAT A;  1AMU A;  3NYQ A;  4IR7 A;  3LAX A;  2QVX X;  3RG2 A;  4GS5 A;  2D1T A;  1ULT A;  2QW0 X;  2VSQ A;  3FCE A;  5KYT A;  4RVN A;  5BSM A;  3A9U A;  3CW8 X;  5BSR A;  4IZ6 A;  3FCC A;  4R1M A;  1RY2 A;  4WV3 A;  3GPC A;  3DAY A;  4OYC A;  4RLF A;  4R1L A;  3CW9 A;  3VNQ A;  1YJ7 A;  3E7X A;  3PBK A;  3LNV A;  5K85 A;  2P2Q A;  4R0M A;  2P2F A;  3B7W A;  5K8F A;  2WD9 A;  4RM2 A;  3VNR A;  5BSW A;  4DG8 A;  4RM3 A;  2V7B A;  5BSV A;  4GXQ A;  1MDF A;  3KXW A;  4RVO A;  3LGX A;  5BUR A;  4RMN A;  3A9V A;  5BUS A;  4G36 A;  2P2M A;  4OXI A;  3NYR A;  3ETC A;  4U5Y D;  3EQ6 A;  4FUT A;  5DV9 A;  4DG9 A;  2QVY X;  5IFI A;  4G37 A;  4GXR A;  5KYV A;  3L8C A;  2D1S A;  3VNS A;  1BA3 A;  1T5H X;  3R44 A;  1MDB A;  5BST A;  4D4I A;  4ZJZ A;  2P2B A;  3DLP X;  1LCI A;  2D1Q A;  4D57 A;  2P20 A;  4D4G A;  2P2J A;  4FUQ A; 
#chains in the Genus database with same CATH topology
 5E7Q A;  1MD9 A;  4DR5 C;  2Y4O A;  5BSU A;  2M5H A;  2D27 A;  1MXA A;  4DV0 C;  2D7V A;  1PG3 A;  4PHT A;  3TDE A;  4DR4 C;  2DYJ A;  1PG4 A;  2KDN A;  5AE1 A;  3GR0 A;  3NYQ A;  2E8C A;  4DR2 C;  3ETO A;  1NYE A;  1WCJ A;  4LF7 C;  1ULT A;  2KZ0 A;  4PUH A;  4LFB C;  1O90 A;  4IZ6 A;  2UXD C;  3H2T A;  4WV3 A;  3GPC A;  4OYC A;  4RLF A;  2MM9 A;  3K6R A;  3LUS A;  4B3R C;  1O9T A;  3J80 D;  4X65 C;  3E7X A;  3TQI A;  1N32 C;  5K85 A;  1QM4 A;  4JI6 C;  4NXN C;  2NCL A;  4X66 C;  5T8T A;  1XMQ C;  1RG9 A;  1V26 A;  5BSW A;  1L2F A;  1TH5 A;  2MCQ A;  4XX2 A;  4JI3 C;  1XNQ C;  5BSV A;  5A1G A;  4DV3 C;  3KXW A;  4RVO A;  3LGX A;  1HNZ C;  4RMN A;  4YY3 C;  5LCI A;  4OXI A;  1IBL C;  4HPV A;  4YHH C;  4U5Y D;  4NXM C;  2OO4 A;  4FUT A;  1WH9 A;  2QVY X;  4JI8 C;  2HHH C;  3A25 A;  2UXB C;  3L8C A;  2D1S A;  4DR3 C;  4NDN A;  1T5H X;  3IEU A;  5BST A;  2ASB A;  1VEH A;  4D4I A;  1XS3 A;  3TR3 A;  2YX1 A;  1M6X A;  2P2B A;  1P7L A;  4LF8 C;  2BH1 X;  3OTO C;  4D57 A;  2P2J A;  2PN2 A;  5KEI A;  2JNV A;  2PT7 G;  2QVZ X;  4PZP A;  2DPL A;  3PRO C;  2D1R A;  2E7G A;  4DCT A;  5H9U A;  1HNX C;  4KHP C;  3R9W A;  4JI4 C;  3IPL A;  4WS9 A;  4FTF A;  1FJG C;  4EAT A;  4JYA C;  4IR7 A;  2CU6 A;  4DCS A;  3I08 A;  1N34 C;  2ONF A;  3CQ2 A;  4GS5 A;  5A1I A;  2CY1 A;  2QW0 X;  2VSQ A;  5KYT A;  1JOS A;  5AE3 A;  4RVN A;  4I9F A;  3UX3 A;  2D28 C;  4DV4 C;  4MH4 A;  2DHM A;  1IBK C;  1MKY A;  5A19 A;  1HNW C;  5A2Q D;  2M5O A;  3AF5 A;  2AYA A;  4DV7 C;  2P2F A;  4X62 C;  3B7W A;  1ZB9 A;  3VNR A;  4DG8 A;  4RM3 A;  2V7B A;  2XR1 A;  4DR6 C;  1FUG A;  2QL8 A;  3N2Q A;  4ODJ A;  1N36 C;  4BCA A;  4B3M C;  5BUR A;  2P2M A;  2ZM6 C;  3EQ6 A;  4G37 A;  1NY8 A;  4JI7 C;  3R44 A;  1K0R A;  2ZZN A;  3IML A;  4DCV A;  4ZJZ A;  1PU1 A;  3AY0 A;  4MTN A;  2P20 A;  3R9X A;  2BJO A;  1P4E C;  4KTV A;  5BUQ A;  1ZB8 A;  4BC7 A;  3CJE A;  4GKJ C;  4JI1 C;  2Y27 A;  3DHV A;  3E7W A;  4ISB A;  2UUC C;  5GTD A;  2Y4N A;  1ML8 A;  2VQF C;  3G7S A;  3I07 A;  1T5D X;  4JI0 C;  3J81 D;  4BBY A;  1N33 C;  4B3S C;  2JMP A;  3LAX A;  2QVX X;  3RG2 A;  4TPS B;  2D1T A;  1J5E C;  4ZLP A;  4I9G A;  4OX9 C;  3A9U A;  1XRC A;  3CW8 X;  4L4Q A;  1P4E A;  3FCC A;  4R1M A;  4X64 C;  4DV1 C;  3GR1 A;  1EGA A;  4L2Z A;  2E5L C;  4R1L A;  4AQY C;  3CW9 A;  1M6X C;  1YJ7 A;  4BC9 A;  3L95 X;  3PBK A;  4LE5 A;  2F4V C;  2VQE C;  2P2Q A;  1I94 C;  3JAM D;  5K8F A;  4G1I A;  1USP A;  4JI5 C;  4PRO C;  4PUI A;  1MXC A;  1GPM A;  4DR7 C;  4GKK C;  3IEV A;  2ATW A;  5LMU C;  1IB8 A;  1MDF A;  1HR0 C;  2ZZM A;  1WF3 A;  3NPD A;  4G36 A;  2OBV A;  3NYR A;  3ETC A;  5CZV A;  5DV9 A;  5IFI A;  3EER A;  2PRO A;  4GXR A;  3VNS A;  4PUG A;  1MDB A;  4LF9 C;  2HJG A;  2E8E A;  3SO4 A;  3AF6 A;  2KZF A;  2UUB C;  1LCI A;  4DUZ C;  4DCU A;  2D1Q A;  5BR8 C;  3UEB A;  1VLA A;  2VZE A;  4LF6 C;  3CQ1 A;  3NI2 A;  3C5E A;  4DV2 C;  2OPL B;  3UZ0 A;  1KKG A;  4D56 A;  1V25 A;  3UX2 A;  5JRH A;  4JI2 C;  4NOZ A;  1XHJ A;  4RLQ A;  5AE2 A;  2P02 A;  2EGT A;  4K0B A;  4DV6 C;  1AMU A;  3TUF A;  2UU9 C;  1PA4 A;  1HH2 P;  4LF5 C;  5IT9 D;  2MMA B;  3S82 A;  4BSZ A;  3CQ3 A;  3FCE A;  5BSM A;  2YWC A;  2E8F A;  4JM1 A;  5ADZ A;  3T1Y C;  5BSR A;  2UUA C;  1XNR C;  5T8S A;  1RY2 A;  3PES A;  4DR1 C;  4LF4 C;  3DAY A;  3VNQ A;  5CZX A;  1IBM C;  3T1H C;  1USP B;  5LMN C;  3LNV A;  2CXC A;  3A4I A;  4JV5 C;  1XRB A;  3RV2 A;  4R0M A;  1XMO C;  1LQL A;  3A26 A;  2WD9 A;  2YCB A;  2E0G A;  4RM2 A;  4B3T C;  3GKU A;  1O92 A;  2Z51 A;  3LNO A;  4L7I A;  1XRA A;  3UOW A;  5FLX D;  1UKK A;  4GXQ A;  1FLO A;  4DUY C;  3N54 B;  5BUS A;  3A9V A;  4DG9 A;  1O93 A;  4LFC C;  4K0K C;  5KYV A;  4LFA C;  1BA3 A;  1MXB A;  2YWB A;  4DV5 C;  2UXC C;  1V60 A;  2OPL A;  5IWA C;  3O2E A;  1QWI A;  3DLP X;  1UWD A;  2WP0 C;  1N2F A;  4KTT A;  4D4G A;  4FUQ A; 
#chains in the Genus database with same CATH homology
 5E7Q A;  1MD9 A;  4DR5 C;  2Y4O A;  5BSU A;  2D27 A;  1MXA A;  4DV0 C;  2D7V A;  1PG3 A;  4PHT A;  3TDE A;  4DR4 C;  2DYJ A;  1PG4 A;  5AE1 A;  3GR0 A;  3NYQ A;  2E8C A;  4DR2 C;  3ETO A;  1NYE A;  4LF7 C;  1ULT A;  4LFB C;  1O90 A;  4IZ6 A;  2UXD C;  3H2T A;  4WV3 A;  3GPC A;  4OYC A;  4RLF A;  3LUS A;  4B3R C;  1O9T A;  3J80 D;  4X65 C;  3E7X A;  3TQI A;  1N32 C;  5K85 A;  1QM4 A;  4JI6 C;  4NXN C;  4X66 C;  5T8T A;  1XMQ C;  1RG9 A;  1V26 A;  5BSW A;  1L2F A;  4JI3 C;  4XX2 A;  1XNQ C;  5BSV A;  5A1G A;  4DV3 C;  3KXW A;  4RVO A;  3LGX A;  1HNZ C;  4RMN A;  4YY3 C;  4OXI A;  1IBL C;  4HPV A;  4YHH C;  4U5Y D;  4NXM C;  2OO4 A;  4FUT A;  1WH9 A;  2QVY X;  4JI8 C;  2HHH C;  2UXB C;  3L8C A;  2D1S A;  4DR3 C;  4NDN A;  1T5H X;  3IEU A;  5BST A;  2ASB A;  4D4I A;  2P2B A;  1P7L A;  4LF8 C;  2BH1 X;  3OTO C;  4D57 A;  2P2J A;  2PN2 A;  5KEI A;  2PT7 G;  2QVZ X;  4PZP A;  2DPL A;  3PRO C;  2D1R A;  2E7G A;  4DCT A;  5H9U A;  1HNX C;  4KHP C;  3R9W A;  4JI4 C;  3IPL A;  4WS9 A;  4FTF A;  1FJG C;  4EAT A;  4JYA C;  4IR7 A;  4DCS A;  3I08 A;  1N34 C;  2ONF A;  4GS5 A;  5A1I A;  2CY1 A;  2QW0 X;  2VSQ A;  5KYT A;  1JOS A;  5AE3 A;  4RVN A;  4I9F A;  2D28 C;  4DV4 C;  4MH4 A;  1IBK C;  1MKY A;  5A19 A;  1HNW C;  5A2Q D;  3AF5 A;  2AYA A;  4DV7 C;  2P2F A;  4X62 C;  3B7W A;  1ZB9 A;  3VNR A;  4DG8 A;  4RM3 A;  2V7B A;  2XR1 A;  4DR6 C;  1FUG A;  2QL8 A;  3N2Q A;  4ODJ A;  1N36 C;  4BCA A;  4B3M C;  5BUR A;  2P2M A;  2ZM6 C;  3EQ6 A;  4G37 A;  4JI7 C;  3R44 A;  1K0R A;  3IML A;  4DCV A;  4ZJZ A;  4MTN A;  2P20 A;  3R9X A;  2BJO A;  4KTV A;  5BUQ A;  1ZB8 A;  4BC7 A;  3CJE A;  4GKJ C;  4JI1 C;  2Y27 A;  3DHV A;  3E7W A;  4ISB A;  2UUC C;  5GTD A;  2Y4N A;  1ML8 A;  2VQF C;  3G7S A;  3I07 A;  1T5D X;  4JI0 C;  3J81 D;  4BBY A;  1N33 C;  4B3S C;  2JMP A;  3LAX A;  2QVX X;  3RG2 A;  4TPS B;  2D1T A;  1J5E C;  4ZLP A;  4I9G A;  4OX9 C;  3A9U A;  1XRC A;  3CW8 X;  4L4Q A;  3FCC A;  4R1M A;  4X64 C;  4DV1 C;  3GR1 A;  1EGA A;  4L2Z A;  2E5L C;  4R1L A;  4AQY C;  3CW9 A;  1YJ7 A;  4BC9 A;  3L95 X;  3PBK A;  4LE5 A;  2F4V C;  2VQE C;  2P2Q A;  1I94 C;  3JAM D;  5K8F A;  4G1I A;  1USP A;  4JI5 C;  4PRO C;  1MXC A;  1GPM A;  4DR7 C;  4GKK C;  3IEV A;  2ATW A;  5LMU C;  1MDF A;  1HR0 C;  1WF3 A;  3NPD A;  4G36 A;  2OBV A;  3NYR A;  3ETC A;  5CZV A;  5DV9 A;  5IFI A;  3EER A;  2PRO A;  4GXR A;  3VNS A;  1MDB A;  4LF9 C;  2HJG A;  2E8E A;  3SO4 A;  3AF6 A;  2KZF A;  2UUB C;  1LCI A;  4DUZ C;  4DCU A;  2D1Q A;  5BR8 C;  1VLA A;  2VZE A;  4LF6 C;  3NI2 A;  3C5E A;  4DV2 C;  2OPL B;  3UZ0 A;  1KKG A;  4D56 A;  1V25 A;  5JRH A;  4JI2 C;  4NOZ A;  4RLQ A;  5AE2 A;  2P02 A;  2EGT A;  4K0B A;  4DV6 C;  1AMU A;  3TUF A;  2UU9 C;  1PA4 A;  1HH2 P;  4LF5 C;  5IT9 D;  3S82 A;  4BSZ A;  3FCE A;  5BSM A;  2YWC A;  2E8F A;  4JM1 A;  5ADZ A;  3T1Y C;  5BSR A;  2UUA C;  1XNR C;  5T8S A;  1RY2 A;  3PES A;  4DR1 C;  4LF4 C;  3DAY A;  3VNQ A;  5CZX A;  1IBM C;  3T1H C;  1USP B;  5LMN C;  3LNV A;  2CXC A;  3A4I A;  4JV5 C;  1XRB A;  3RV2 A;  4R0M A;  1XMO C;  1LQL A;  2WD9 A;  2YCB A;  2E0G A;  4RM2 A;  4B3T C;  3GKU A;  1O92 A;  4L7I A;  1XRA A;  3UOW A;  5FLX D;  1UKK A;  4GXQ A;  4DUY C;  3N54 B;  5BUS A;  3A9V A;  4DG9 A;  1O93 A;  4LFC C;  4K0K C;  5KYV A;  4LFA C;  1BA3 A;  1MXB A;  2YWB A;  4DV5 C;  2UXC C;  2OPL A;  5IWA C;  1QWI A;  3DLP X;  2WP0 C;  1N2F A;  4KTT A;  4D4G A;  4FUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...