4U5YD

Crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
115
Chain Sequence
b'GTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNCGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNTLADPGVVEKLLEEKQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acyl-CoA synthetase
publication title Insights into the specificity of lysine acetyltransferases.
pubmed doi rcsb
source organism Streptomyces lividans tk24
molecule tags Ligase
total genus 33
structure length 115
sequence length 120
ec nomenclature ec 6.2.1.1: Acetate--CoA ligase.
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4u5yD00
4R1LA 5BSMA 5E7QA 1BA3A 2P2QA 5KEIA 3LAXA 3A9UA 3FCEA 3LNVA 3PBKA 2P20A 2Y4OA 3IPLA 2VZEA 4U5YD 2D1SA 3NI2A 4IZ6A 4PZPA 4G37A 3GPCA 4RM2A 4R1MA 3RG2A 4DG9A 5BSTA 3DAYA 4GXQA 5DV9A 3EQ6A 1MDFA 5BSUA 3VNRA 4D4GA 3C5EA 4D57A 5BURA 5IFIA 5BUSA 3G7SA 4DG8A 4RLFA 1RY2A 2QVYX 2P2MA 3NYQA 4GXRA 3R44A 4D4IA 3B7WA 4RMNA 1YJ7A 3E7XA 4GS5A 4OYCA 2QVZX 2WD9A 5BSWA 1MD9A 1PG3A 3VNQA 4D56A 2P2BA 1T5DX 3VNSA 4ZJZA 3L8CA 4ISBA 5BSRA 5BSVA 1ULTA 4RVNA 3CW8X 2QVXX 4WV3A 4IR7A 5BUQA 2P2FA 4RM3A 3LGXA 2VSQA 3DLPX 1T5HX 4R0MA 3DHVA 5KYTA 3ETCA 1PG4A 4OXIA 3CW9A 3KXWA 1AMUA 4G36A 2QW0X 2D1RA 4EATA 2Y27A 2P2JA 2D1TA 2V7BA 5JRHA 1MDBA 4FUQA 2Y4NA 5K85A 4RVOA 4RLQA 2D1QA 3A9VA 3FCCA 5K8FA 3E7WA 1LCIA 5GTDA 5KYVA 3NYRA 4FUTA
chains in the Genus database with same CATH superfamily
2YCBA 4DUZC 1HNZC 1N2FA 3PESA 4DR1C 2OPLA 4DCTA 1UKKA 3IPLA 1VLAA 3L95X 4U5YD 5LCIA 5A19A 5T8TA 4DUYC 4K0BA 4I9GA 4PZPA 1EGAA 3SO4A 2UXDC 1XS3A 4PUIA 2UXCC 3UEBA 5BR8C 3J80D 4ZLPA 4DV5C 2EGTA 5IT9D 4GXRA 3B7WA 4RMNA 3E7XA 2WD9A 4DV0C 2D28C 1O93A 1PG3A 2P2BA 2MMAB 2PROA 4DV2C 5FLXD 5AE3A 3IMLA 4DCVA 3CW8X 2D27A 1O9TA 4NDNA 1T5HX 4BC9A 5KYTA 4BC7A 1L2FA 3ETCA 4PUHA 4OXIA 1AMUA 1XRBA 2OO4A 4I9FA 4WS9A 1FJGC 2P2JA 2V7BA 1V26A 5K85A 1ZB9A 1XMOC 5K8FA 1LCIA 2JNVA 1P7LA 5KYVA 4FUTA 5E7QA 3NPDA 4KTTA 1BA3A 3LNVA 4LE5A 2E8CA 3PBKA 2Y4OA 3R9WA 2VZEA 2D1SA 4RM2A 4R1MA 5H9UA 3RG2A 3A26A 4GKKC 3DAYA 2VQEC 4DR4C 4DR2C 3N2QA 5AE2A 1MDFA 3VNRA 1QM4A 2P02A 1KKGA 5IFIA 3J81D 4B3RC 5BUSA 2CY1A 3IEVA 4RLFA 5T8SA 1TH5A 4D4IA 2UUAC 2KDNA 4OX9C 4JV5C 4LF6C 4DV7C 1V60A 3VNQA 1N33C 4ZJZA 3L8CA 4NOZA 4MH4A 5BSVA 3GKUA 4DR3C 4LF4C 5CZVA 4KTVA 3JAMD 4YY3C 5GTDA 1RG9A 5ADZA 4R0MA 1XHJA 4X64C 3GR0A 2KZFA 5LMNC 1PG4A 4BBYA 4LFAC 3ETOA 4G36A 1IBKC 4LF9C 3CQ3A 2BH1X 2Y27A 2DPLA 2Z51A 2D1TA 5JRHA 2DYJA 4FUQA 4GKJC 4YHHC 2E7GA 3I08A 3TR3A 5A1IA 2D1QA 3FCCA 4PUGA 4DCUA 2DHMA 2QL8A 4R1LA 3CQ2A 5BSMA 1HR0C 2NCLA 3EERA 5KEIA 3LAXA 1WH9A 3A9UA 2P20A 1IBLC 4LF8C 2CU6A 3T1HC 2YWBA 2UXBC 3NI2A 4DV4C 4IZ6A 4JI3C 4B3MC 4G37A 4L4QA 4B3SC 5BSTA 4X62C 4LF7C 4GXQA 1P4EC 3EQ6A 1XNRC 2D7VA 4FTFA 5BSUA 3T1YC 2KZ0A 1V25A 4D4GA 4LFCC 3C5EA 3RV2A 4D57A 1ML8A 1HH2P 2UU9C 3IEUA 1XNQC 3O2EA 2ZZMA 1JOSA 3UX3A 4DG8A 1RY2A 4BSZA 1NY8A 2QVYX 5IWAC 4JI8C 4AQYC 1USPB 1WCJA 1YJ7A 2M5OA 1NYEA 4LF5C 4JI1C 3CQ1A 2QVZX 5BSWA 4JI5C 4DV6C 1MD9A 4DR6C 1N36C 1T5DX 3VNSA 1M6XC 4ISBA 5BSRA 1ULTA 4RVNA 4TPSB 2E8EA 2ASBA 1K0RA 1MXBA 4RM3A 3LGXA 4PROC 3DLPX 3UZ0A 1FUGA 4DV1C 2MM9A 2WP0C 1MKYA 3I07A 4DCSA 2YWCA 2E5LC 4BCAA 1N34C 1USPA 2QW0X 2D1RA 4EATA 1I94C 3A25A 3S82A 5LMUC 1MDBA 4JI6C 4JI2C 4RVOA 2F4VC 2E0GA 2YX1A 2BJOA 1IBMC 2ONFA 4JYAC 4JI4C 4XX2A 1QWIA 2P2QA 4DR5C 3FCEA 4DV3C 2ATWA 1ZB8A 1XRCA 1WF3A 4JI7C 2HHHC 2OBVA 3GPCA 1PU1A 4NXMC 4DG9A 3H2TA 2PN2A 1XRAA 1UWDA 1VEHA 5DV9A 3OTOC 3R9XA 4K0KC 2M5HA 5A2QD 3K6RA 4ODJA 5BURA 1O90A 2AYAA 4DR7C 2JMPA 3CJEA 1XMQC 4NXNC 2MCQA 1LQLA 3G7SA 2PT7G 1P4EA 2ZZNA 1IB8A 1GPMA 1PA4A 2P2MA 3NYQA 3LNOA 3R44A 5AE1A 3AF5A 2XR1A 3LUSA 4GS5A 4OYCA 3N54B 4JM1A 4D56A 2CXCA 4HPVA 4LFBC 5CZXA 3AY0A 2QVXX 4WV3A 4IR7A 4KHPC 1FLOA 3PROC 5BUQA 2UUBC 2P2FA 2VSQA 1HNWC 4X66C 3DHVA 4G1IA 1M6XA 1N32C 2OPLB 4B3TC 2E8FA 4PHTA 1J5EC 3CW9A 3KXWA 3TUFA 1O92A 2ZM6C 3GR1A 4L2ZA 3TDEA 1MXAA 2VQFC 4X65C 4L7IA 2UUCC 3UOWA 2Y4NA 3A4IA 5A1GA 1MXCA 4MTNA 3UX2A 4RLQA 1HNXC 3A9VA 3E7WA 2HJGA 3AF6A 3TQIA 4JI0C 3NYRA
chains in the Genus database with same CATH topology
2YCBA 4DUZC 1HNZC 1N2FA 3PESA 4DR1C 2OPLA 4DCTA 1UKKA 3IPLA 1VLAA 3L95X 4U5YD 5A19A 5T8TA 4DUYC 4K0BA 4I9GA 4PZPA 1EGAA 3SO4A 2UXDC 2UXCC 5BR8C 3J80D 4ZLPA 4DV5C 2EGTA 5IT9D 4GXRA 3B7WA 4RMNA 3E7XA 2WD9A 4DV0C 2D28C 1O93A 1PG3A 2P2BA 2PROA 4DV2C 5FLXD 5AE3A 3IMLA 4DCVA 3CW8X 2D27A 1O9TA 4NDNA 1T5HX 4BC9A 5KYTA 4BC7A 1L2FA 3ETCA 4OXIA 1AMUA 1XRBA 2OO4A 4I9FA 4WS9A 1FJGC 2P2JA 2V7BA 1V26A 5K85A 1ZB9A 1XMOC 5K8FA 1LCIA 1P7LA 5KYVA 4FUTA 5E7QA 3NPDA 4KTTA 1BA3A 3LNVA 4LE5A 2E8CA 3PBKA 2Y4OA 3R9WA 2VZEA 2D1SA 4RM2A 4R1MA 5H9UA 3RG2A 4GKKC 3DAYA 2VQEC 4DR4C 4DR2C 3N2QA 5AE2A 1MDFA 3VNRA 1QM4A 2P02A 1KKGA 5IFIA 3J81D 4B3RC 5BUSA 2CY1A 3IEVA 4RLFA 5T8SA 4D4IA 2UUAC 4OX9C 4JV5C 4LF6C 4DV7C 3VNQA 1N33C 4ZJZA 3L8CA 4NOZA 4MH4A 5BSVA 3GKUA 4DR3C 4LF4C 5CZVA 4KTVA 3JAMD 4YY3C 1RG9A 5ADZA 4R0MA 4X64C 3GR0A 2KZFA 5LMNC 1PG4A 4BBYA 4LFAC 3ETOA 4G36A 1IBKC 4LF9C 2BH1X 2Y27A 2DPLA 2D1TA 5JRHA 2DYJA 4FUQA 4GKJC 4YHHC 2E7GA 3I08A 5A1IA 2D1QA 3FCCA 4DCUA 2QL8A 4R1LA 5BSMA 1HR0C 3EERA 5KEIA 3LAXA 1WH9A 3A9UA 2P20A 1IBLC 4LF8C 3T1HC 2YWBA 2UXBC 3NI2A 4DV4C 4IZ6A 4JI3C 4B3MC 4G37A 4L4QA 4B3SC 5BSTA 4X62C 4LF7C 4GXQA 3EQ6A 1XNRC 2D7VA 4FTFA 5BSUA 3T1YC 1V25A 4D4GA 4LFCC 3C5EA 3RV2A 4D57A 1ML8A 1HH2P 2UU9C 3IEUA 1XNQC 1JOSA 4DG8A 1RY2A 4BSZA 2QVYX 5IWAC 4JI8C 4AQYC 1USPB 1YJ7A 4LF5C 1NYEA 4JI1C 2QVZX 5BSWA 4JI5C 4DV6C 1MD9A 4DR6C 1N36C 1T5DX 3VNSA 4ISBA 5BSRA 1ULTA 4RVNA 4TPSB 2E8EA 2ASBA 1K0RA 1MXBA 4RM3A 3LGXA 4PROC 3DLPX 3UZ0A 1FUGA 4DV1C 2WP0C 1MKYA 3I07A 4DCSA 2YWCA 2E5LC 4BCAA 1N34C 1USPA 2QW0X 2D1RA 4EATA 1I94C 3S82A 5LMUC 1MDBA 4JI6C 4JI2C 4RVOA 2F4VC 2E0GA 2BJOA 1IBMC 2ONFA 4JYAC 4JI4C 4XX2A 1QWIA 2P2QA 4DR5C 3FCEA 4DV3C 2ATWA 1ZB8A 1XRCA 1WF3A 4JI7C 2HHHC 2OBVA 3GPCA 4NXMC 4DG9A 3H2TA 2PN2A 1XRAA 5DV9A 3OTOC 3R9XA 4K0KC 5A2QD 3TQIA 4ODJA 5BURA 1O90A 2AYAA 4DR7C 2JMPA 3CJEA 1XMQC 4NXNC 1LQLA 3G7SA 2PT7G 1GPMA 1PA4A 2P2MA 3NYQA 3R44A 5AE1A 3AF5A 2XR1A 3LUSA 4GS5A 4OYCA 3N54B 4JM1A 4D56A 2CXCA 4HPVA 4LFBC 5CZXA 2QVXX 4WV3A 4IR7A 4KHPC 3PROC 5BUQA 2UUBC 2P2FA 2VSQA 1HNWC 4X66C 3DHVA 4G1IA 1N32C 2OPLB 4B3TC 2E8FA 4PHTA 1J5EC 3CW9A 3KXWA 3TUFA 1O92A 2ZM6C 3GR1A 4L2ZA 3TDEA 1MXAA 2VQFC 4X65C 4L7IA 2UUCC 3UOWA 2Y4NA 3A4IA 5A1GA 1MXCA 4MTNA 4RLQA 1HNXC 3A9VA 3E7WA 2HJGA 3AF6A 5GTDA 4JI0C 3NYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1L A;  5BSM A;  5E7Q A;  1BA3 A;  2P2Q A;  5KEI A;  3LAX A;  3A9U A;  3FCE A;  3LNV A;  3PBK A;  2P20 A;  2Y4O A;  3IPL A;  2VZE A;  4U5Y D;  2D1S A;  3NI2 A;  4IZ6 A;  4PZP A;  4G37 A;  3GPC A;  4RM2 A;  4R1M A;  3RG2 A;  4DG9 A;  5BST A;  3DAY A;  4GXQ A;  5DV9 A;  3EQ6 A;  1MDF A;  5BSU A;  3VNR A;  4D4G A;  3C5E A;  4D57 A;  5BUR A;  5IFI A;  5BUS A;  3G7S A;  4DG8 A;  4RLF A;  1RY2 A;  2QVY X;  2P2M A;  3NYQ A;  4GXR A;  3R44 A;  4D4I A;  3B7W A;  4RMN A;  1YJ7 A;  3E7X A;  4GS5 A;  4OYC A;  2QVZ X;  2WD9 A;  5BSW A;  1MD9 A;  1PG3 A;  3VNQ A;  4D56 A;  2P2B A;  1T5D X;  3VNS A;  4ZJZ A;  3L8C A;  4ISB A;  5BSR A;  5BSV A;  1ULT A;  4RVN A;  3CW8 X;  2QVX X;  4WV3 A;  4IR7 A;  5BUQ A;  2P2F A;  4RM3 A;  3LGX A;  2VSQ A;  3DLP X;  1T5H X;  4R0M A;  3DHV A;  5KYT A;  3ETC A;  1PG4 A;  4OXI A;  3CW9 A;  3KXW A;  1AMU A;  4G36 A;  2QW0 X;  2D1R A;  4EAT A;  2Y27 A;  2P2J A;  2D1T A;  2V7B A;  5JRH A;  1MDB A;  4FUQ A;  2Y4N A;  5K85 A;  4RVO A;  4RLQ A;  2D1Q A;  3A9V A;  3FCC A;  5K8F A;  3E7W A;  1LCI A;  5GTD A;  5KYV A;  3NYR A;  4FUT A; 
#chains in the Genus database with same CATH topology
 2YCB A;  4DUZ C;  1HNZ C;  1N2F A;  3PES A;  4DR1 C;  2OPL A;  4DCT A;  1UKK A;  3IPL A;  1VLA A;  3L95 X;  4U5Y D;  5LCI A;  5A19 A;  5T8T A;  4DUY C;  4K0B A;  4I9G A;  4PZP A;  1EGA A;  3SO4 A;  2UXD C;  1XS3 A;  4PUI A;  2UXC C;  3UEB A;  5BR8 C;  3J80 D;  4ZLP A;  4DV5 C;  2EGT A;  5IT9 D;  4GXR A;  3B7W A;  4RMN A;  3E7X A;  2WD9 A;  4DV0 C;  2D28 C;  1O93 A;  1PG3 A;  2P2B A;  2MMA B;  2PRO A;  4DV2 C;  5FLX D;  5AE3 A;  3IML A;  4DCV A;  3CW8 X;  2D27 A;  1O9T A;  4NDN A;  1T5H X;  4BC9 A;  5KYT A;  4BC7 A;  1L2F A;  3ETC A;  4PUH A;  4OXI A;  1AMU A;  1XRB A;  2OO4 A;  4I9F A;  4WS9 A;  1FJG C;  2P2J A;  2V7B A;  1V26 A;  5K85 A;  1ZB9 A;  1XMO C;  5K8F A;  1LCI A;  2JNV A;  1P7L A;  5KYV A;  4FUT A;  5E7Q A;  3NPD A;  4KTT A;  1BA3 A;  3LNV A;  4LE5 A;  2E8C A;  3PBK A;  2Y4O A;  3R9W A;  2VZE A;  2D1S A;  4RM2 A;  4R1M A;  5H9U A;  3RG2 A;  3A26 A;  4GKK C;  3DAY A;  2VQE C;  4DR4 C;  4DR2 C;  3N2Q A;  5AE2 A;  1MDF A;  3VNR A;  1QM4 A;  2P02 A;  1KKG A;  5IFI A;  3J81 D;  4B3R C;  5BUS A;  2CY1 A;  3IEV A;  4RLF A;  5T8S A;  1TH5 A;  4D4I A;  2UUA C;  2KDN A;  4OX9 C;  4JV5 C;  4LF6 C;  4DV7 C;  1V60 A;  3VNQ A;  1N33 C;  4ZJZ A;  3L8C A;  4NOZ A;  4MH4 A;  5BSV A;  3GKU A;  4DR3 C;  4LF4 C;  5CZV A;  4KTV A;  3JAM D;  4YY3 C;  5GTD A;  1RG9 A;  5ADZ A;  4R0M A;  1XHJ A;  4X64 C;  3GR0 A;  2KZF A;  5LMN C;  1PG4 A;  4BBY A;  4LFA C;  3ETO A;  4G36 A;  1IBK C;  4LF9 C;  3CQ3 A;  2BH1 X;  2Y27 A;  2DPL A;  2Z51 A;  2D1T A;  5JRH A;  2DYJ A;  4FUQ A;  4GKJ C;  4YHH C;  2E7G A;  3I08 A;  3TR3 A;  5A1I A;  2D1Q A;  3FCC A;  4PUG A;  4DCU A;  2DHM A;  2QL8 A;  4R1L A;  3CQ2 A;  5BSM A;  1HR0 C;  2NCL A;  3EER A;  5KEI A;  3LAX A;  1WH9 A;  3A9U A;  2P20 A;  1IBL C;  4LF8 C;  2CU6 A;  3T1H C;  2YWB A;  2UXB C;  3NI2 A;  4DV4 C;  4IZ6 A;  4JI3 C;  4B3M C;  4G37 A;  4L4Q A;  4B3S C;  5BST A;  4X62 C;  4LF7 C;  4GXQ A;  1P4E C;  3EQ6 A;  1XNR C;  2D7V A;  4FTF A;  5BSU A;  3T1Y C;  2KZ0 A;  1V25 A;  4D4G A;  4LFC C;  3C5E A;  3RV2 A;  4D57 A;  1ML8 A;  1HH2 P;  2UU9 C;  3IEU A;  1XNQ C;  3O2E A;  2ZZM A;  1JOS A;  3UX3 A;  4DG8 A;  1RY2 A;  4BSZ A;  1NY8 A;  2QVY X;  5IWA C;  4JI8 C;  4AQY C;  1USP B;  1WCJ A;  1YJ7 A;  2M5O A;  1NYE A;  4LF5 C;  4JI1 C;  3CQ1 A;  2QVZ X;  5BSW A;  4JI5 C;  4DV6 C;  1MD9 A;  4DR6 C;  1N36 C;  1T5D X;  3VNS A;  1M6X C;  4ISB A;  5BSR A;  1ULT A;  4RVN A;  4TPS B;  2E8E A;  2ASB A;  1K0R A;  1MXB A;  4RM3 A;  3LGX A;  4PRO C;  3DLP X;  3UZ0 A;  1FUG A;  4DV1 C;  2MM9 A;  2WP0 C;  1MKY A;  3I07 A;  4DCS A;  2YWC A;  2E5L C;  4BCA A;  1N34 C;  1USP A;  2QW0 X;  2D1R A;  4EAT A;  1I94 C;  3A25 A;  3S82 A;  5LMU C;  1MDB A;  4JI6 C;  4JI2 C;  4RVO A;  2F4V C;  2E0G A;  2YX1 A;  2BJO A;  1IBM C;  2ONF A;  4JYA C;  4JI4 C;  4XX2 A;  1QWI A;  2P2Q A;  4DR5 C;  3FCE A;  4DV3 C;  2ATW A;  1ZB8 A;  1XRC A;  1WF3 A;  4JI7 C;  2HHH C;  2OBV A;  3GPC A;  1PU1 A;  4NXM C;  4DG9 A;  3H2T A;  2PN2 A;  1XRA A;  1UWD A;  1VEH A;  5DV9 A;  3OTO C;  3R9X A;  4K0K C;  2M5H A;  5A2Q D;  3K6R A;  4ODJ A;  5BUR A;  1O90 A;  2AYA A;  4DR7 C;  2JMP A;  3CJE A;  1XMQ C;  4NXN C;  2MCQ A;  1LQL A;  3G7S A;  2PT7 G;  1P4E A;  2ZZN A;  1IB8 A;  1GPM A;  1PA4 A;  2P2M A;  3NYQ A;  3LNO A;  3R44 A;  5AE1 A;  3AF5 A;  2XR1 A;  3LUS A;  4GS5 A;  4OYC A;  3N54 B;  4JM1 A;  4D56 A;  2CXC A;  4HPV A;  4LFB C;  5CZX A;  3AY0 A;  2QVX X;  4WV3 A;  4IR7 A;  4KHP C;  1FLO A;  3PRO C;  5BUQ A;  2UUB C;  2P2F A;  2VSQ A;  1HNW C;  4X66 C;  3DHV A;  4G1I A;  1M6X A;  1N32 C;  2OPL B;  4B3T C;  2E8F A;  4PHT A;  1J5E C;  3CW9 A;  3KXW A;  3TUF A;  1O92 A;  2ZM6 C;  3GR1 A;  4L2Z A;  3TDE A;  1MXA A;  2VQF C;  4X65 C;  4L7I A;  2UUC C;  3UOW A;  2Y4N A;  3A4I A;  5A1G A;  1MXC A;  4MTN A;  3UX2 A;  4RLQ A;  1HNX C;  3A9V A;  3E7W A;  2HJG A;  3AF6 A;  3TQI A;  4JI0 C;  3NYR A; 
#chains in the Genus database with same CATH homology
 2YCB A;  4DUZ C;  1HNZ C;  1N2F A;  3PES A;  4DR1 C;  2OPL A;  4DCT A;  1UKK A;  3IPL A;  1VLA A;  3L95 X;  4U5Y D;  5A19 A;  5T8T A;  4DUY C;  4K0B A;  4I9G A;  4PZP A;  1EGA A;  3SO4 A;  2UXD C;  2UXC C;  5BR8 C;  3J80 D;  4ZLP A;  4DV5 C;  2EGT A;  5IT9 D;  4GXR A;  3B7W A;  4RMN A;  3E7X A;  2WD9 A;  4DV0 C;  2D28 C;  1O93 A;  1PG3 A;  2P2B A;  2PRO A;  4DV2 C;  5FLX D;  5AE3 A;  3IML A;  4DCV A;  3CW8 X;  2D27 A;  1O9T A;  4NDN A;  1T5H X;  4BC9 A;  5KYT A;  4BC7 A;  1L2F A;  3ETC A;  4OXI A;  1AMU A;  1XRB A;  2OO4 A;  4I9F A;  4WS9 A;  1FJG C;  2P2J A;  2V7B A;  1V26 A;  5K85 A;  1ZB9 A;  1XMO C;  5K8F A;  1LCI A;  1P7L A;  5KYV A;  4FUT A;  5E7Q A;  3NPD A;  4KTT A;  1BA3 A;  3LNV A;  4LE5 A;  2E8C A;  3PBK A;  2Y4O A;  3R9W A;  2VZE A;  2D1S A;  4RM2 A;  4R1M A;  5H9U A;  3RG2 A;  4GKK C;  3DAY A;  2VQE C;  4DR4 C;  4DR2 C;  3N2Q A;  5AE2 A;  1MDF A;  3VNR A;  1QM4 A;  2P02 A;  1KKG A;  5IFI A;  3J81 D;  4B3R C;  5BUS A;  2CY1 A;  3IEV A;  4RLF A;  5T8S A;  4D4I A;  2UUA C;  4OX9 C;  4JV5 C;  4LF6 C;  4DV7 C;  3VNQ A;  1N33 C;  4ZJZ A;  3L8C A;  4NOZ A;  4MH4 A;  5BSV A;  3GKU A;  4DR3 C;  4LF4 C;  5CZV A;  4KTV A;  3JAM D;  4YY3 C;  1RG9 A;  5ADZ A;  4R0M A;  4X64 C;  3GR0 A;  2KZF A;  5LMN C;  1PG4 A;  4BBY A;  4LFA C;  3ETO A;  4G36 A;  1IBK C;  4LF9 C;  2BH1 X;  2Y27 A;  2DPL A;  2D1T A;  5JRH A;  2DYJ A;  4FUQ A;  4GKJ C;  4YHH C;  2E7G A;  3I08 A;  5A1I A;  2D1Q A;  3FCC A;  4DCU A;  2QL8 A;  4R1L A;  5BSM A;  1HR0 C;  3EER A;  5KEI A;  3LAX A;  1WH9 A;  3A9U A;  2P20 A;  1IBL C;  4LF8 C;  3T1H C;  2YWB A;  2UXB C;  3NI2 A;  4DV4 C;  4IZ6 A;  4JI3 C;  4B3M C;  4G37 A;  4L4Q A;  4B3S C;  5BST A;  4X62 C;  4LF7 C;  4GXQ A;  3EQ6 A;  1XNR C;  2D7V A;  4FTF A;  5BSU A;  3T1Y C;  1V25 A;  4D4G A;  4LFC C;  3C5E A;  3RV2 A;  4D57 A;  1ML8 A;  1HH2 P;  2UU9 C;  3IEU A;  1XNQ C;  1JOS A;  4DG8 A;  1RY2 A;  4BSZ A;  2QVY X;  5IWA C;  4JI8 C;  4AQY C;  1USP B;  1YJ7 A;  4LF5 C;  1NYE A;  4JI1 C;  2QVZ X;  5BSW A;  4JI5 C;  4DV6 C;  1MD9 A;  4DR6 C;  1N36 C;  1T5D X;  3VNS A;  4ISB A;  5BSR A;  1ULT A;  4RVN A;  4TPS B;  2E8E A;  2ASB A;  1K0R A;  1MXB A;  4RM3 A;  3LGX A;  4PRO C;  3DLP X;  3UZ0 A;  1FUG A;  4DV1 C;  2WP0 C;  1MKY A;  3I07 A;  4DCS A;  2YWC A;  2E5L C;  4BCA A;  1N34 C;  1USP A;  2QW0 X;  2D1R A;  4EAT A;  1I94 C;  3S82 A;  5LMU C;  1MDB A;  4JI6 C;  4JI2 C;  4RVO A;  2F4V C;  2E0G A;  2BJO A;  1IBM C;  2ONF A;  4JYA C;  4JI4 C;  4XX2 A;  1QWI A;  2P2Q A;  4DR5 C;  3FCE A;  4DV3 C;  2ATW A;  1ZB8 A;  1XRC A;  1WF3 A;  4JI7 C;  2HHH C;  2OBV A;  3GPC A;  4NXM C;  4DG9 A;  3H2T A;  2PN2 A;  1XRA A;  5DV9 A;  3OTO C;  3R9X A;  4K0K C;  5A2Q D;  3TQI A;  4ODJ A;  5BUR A;  1O90 A;  2AYA A;  4DR7 C;  2JMP A;  3CJE A;  1XMQ C;  4NXN C;  1LQL A;  3G7S A;  2PT7 G;  1GPM A;  1PA4 A;  2P2M A;  3NYQ A;  3R44 A;  5AE1 A;  3AF5 A;  2XR1 A;  3LUS A;  4GS5 A;  4OYC A;  3N54 B;  4JM1 A;  4D56 A;  2CXC A;  4HPV A;  4LFB C;  5CZX A;  2QVX X;  4WV3 A;  4IR7 A;  4KHP C;  3PRO C;  5BUQ A;  2UUB C;  2P2F A;  2VSQ A;  1HNW C;  4X66 C;  3DHV A;  4G1I A;  1N32 C;  2OPL B;  4B3T C;  2E8F A;  4PHT A;  1J5E C;  3CW9 A;  3KXW A;  3TUF A;  1O92 A;  2ZM6 C;  3GR1 A;  4L2Z A;  3TDE A;  1MXA A;  2VQF C;  4X65 C;  4L7I A;  2UUC C;  3UOW A;  2Y4N A;  3A4I A;  5A1G A;  1MXC A;  4MTN A;  4RLQ A;  1HNX C;  3A9V A;  3E7W A;  2HJG A;  3AF6 A;  5GTD A;  4JI0 C;  3NYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...