4U5YD

Crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
115
Chain Sequence
GTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNCGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNTLADPGVVEKLLEEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Acyl-CoA synthetase
publication title Insights into the specificity of lysine acetyltransferases.
pubmed doi rcsb
source organism Streptomyces lividans tk24
total genus 33
structure length 115
sequence length 120
ec nomenclature ec 6.2.1.1: Acetate--CoA ligase.
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4u5yD00
1LCIA 4DG8A 4RVOA 3VNRA 4RMNA 5K8FA 4RVNA 3A9VA 2QVZX 3EQ6A 3FCCA 4D4GA 3DHVA 3RG2A 3NYQA 5KYVA 2QVYX 2P20A 3ETCA 4GS5A 4R0MA 4IZ6A 2Y4NA 3NYRA 5IFIA 3R44A 5DV9A 4R1LA 4RM2A 3CW9A 5JRHA 3VNQA 2VSQA 3B7WA 2Y27A 4WV3A 2P2JA 3E7WA 5BUQA 3DLPX 2D1SA 3CW8X 1ULTA 2VZEA 2D1QA 2P2BA 3G7SA 4GXRA 2Y4OA 4OYCA 2QW0X 3DAYA 3LNVA 4ISBA 5BSRA 4D56A 4GXQA 4RM3A 1MDBA 5BSTA 4EATA 5BSWA 5BSMA 3FCEA 5KEIA 1T5DX 4FUQA 4DG9A 5BURA 2P2FA 3NI2A 3L8CA 4D57A 4RLQA 3IPLA 3A9UA 5BSUA 5GTDA 1AMUA 5E7QA 4R1MA 5K85A 3E7XA 3PBKA 1PG4A 4OXIA 1MDFA 4U5YD 2QVXX 3KXWA 4G37A 3C5EA 1T5HX 2V7BA 5BUSA 4G36A 1PG3A 1BA3A 3LAXA 1YJ7A 4RLFA 2D1RA 2WD9A 2D1TA 4D4IA 2P2MA 1RY2A 5BSVA 5KYTA 2P2QA 4ZJZA 3GPCA 1MD9A 3LGXA 4FUTA 4IR7A 4PZPA 3VNSA
chains in the Genus database with same CATH superfamily
4DG8A 4HPVA 4JI7C 4LFCC 1N36C 4RVNA 1L2FA 1VEHA 4XX2A 3JAMD 1NY8A 1IBLC 1XMQC 4JI4C 1VLAA 4BC9A 1XNRC 2OPLA 2E8EA 2UUCC 4K0KC 2Y4NA 2KZ0A 3R44A 5DV9A 2VQFC 5JRHA 2VSQA 4PUIA 1USPB 2P2JA 1XRBA 2YWBA 3GKUA 2E5LC 5H9UA 2D1SA 3CW8X 4BCAA 5ADZA 5IWAC 2D1QA 5LCIA 2F4VC 2P2BA 4DR2C 3PROC 3GR1A 2QW0X 3DAYA 3LNVA 5BSRA 4D56A 4X62C 4RM3A 2UUAC 1PA4A 4GKKC 4PUHA 2OPLB 4EATA 1FUGA 1QWIA 4PUGA 2YX1A 5BURA 2JNVA 1V26A 4D57A 1WF3A 3S82A 2DPLA 3O2EA 3UEBA 5CZXA 5FLXD 4DR3C 3PESA 1M6XA 5GTDA 3E7XA 1PG4A 4OXIA 3KXWA 5A19A 2PROA 2BH1X 5BUSA 4LFBC 4G36A 1LQLA 2MM9A 1BA3A 2KZFA 4RLFA 2UXDC 2D1TA 4KTTA 5CZVA 2P2MA 5BSVA 2E7GA 2Z51A 1O90A 2P2QA 4ZJZA 4FUTA 2P02A 3A4IA 4PZPA 3VNSA 1WH9A 1LCIA 4JI1C 3VNRA 3UOWA 5K8FA 4D4GA 4JI8C 3EQ6A 1IB8A 4LE5A 1MKYA 3CQ3A 3NYQA 5KYVA 5IT9D 4FTFA 4R0MA 4X65C 1XHJA 3N2QA 3VNQA 4DR1C 1HNZC 4WV3A 3E7WA 2M5HA 2DYJA 3NPDA 3J81D 4X64C 1ULTA 4B3MC 3TDEA 2BJOA 1J5EC 2ONFA 4OYCA 1V60A 4G1IA 3J80D 4JI5C 4K0BA 3R9XA 1ML8A 1T5DX 4FUQA 3NI2A 3I08A 1N33C 3UX3A 4YHHC 4BBYA 1UKKA 2PT7G 1N2FA 1IBMC 1O9TA 4LF9C 5BSUA 3AF5A 4R1MA 3R9WA 3IEVA 3GR0A 2OO4A 2UUBC 4BSZA 4G37A 2KDNA 3ETOA 1FJGC 1XS3A 3LAXA 4JYAC 1O92A 4LF5C 2ZM6C 4JM1A 1P4EA 3LGXA 4GKJC 4RLQA 2UXBC 2QL8A 4DR6C 3L95X 1XNQC 5A2QD 2QVZX 3FCCA 3DHVA 3RG2A 3IEUA 2ATWA 4NDNA 4L7IA 2QVYX 2P20A 4I9GA 4DCSA 4LFAC 4BC7A 3A26A 2D27A 4JV5C 5AE2A 3NYRA 2DHMA 5BR8C 4MH4A 4DV2C 4DR4C 1N32C 2XR1A 4B3SC 2UXCC 4JI3C 5BUQA 1MXCA 3DLPX 2YCBA 2D7VA 5A1IA 2M5OA 5LMUC 1P4EC 4KTVA 1M6XC 1UWDA 4B3TC 3G7SA 5A1GA 2PN2A 1K0RA 4ISBA 4TPSB 1MDBA 5BSTA 3CQ2A 3I07A 3EERA 4B3RC 5BSWA 5BSMA 5KEIA 2E8CA 2P2FA 4PROC 4YY3C 5AE1A 4DR7C 3AF6A 1PU1A 1AMUA 5E7QA 5T8SA 3K6RA 4DV4C 5K85A 2D28C 4DR5C 2CU6A 1GPMA 3IMLA 1XRCA 1ZB9A 1ZB8A 4ZLPA 2V7BA 3CQ1A 1PG3A 5T8TA 4PHTA 1YJ7A 3CJEA 2D1RA 2WD9A 4D4IA 3LUSA 1FLOA 1V25A 1RY2A 2CXCA 5KYTA 4DV0C 3GPCA 4IR7A 3OTOC 4RVOA 1MXBA 4NXNC 4RMNA 4LF7C 2WP0C 1RG9A 3A9VA 1O93A 1EGAA 1I94C 4NOZA 3ETCA 1HR0C 4GS5A 4IZ6A 4KHPC 5IFIA 2AYAA 4JI0C 2ZZMA 4R1LA 1NYEA 4RM2A 3CW9A 2VQEC 1JOSA 3B7WA 2Y27A 5AE3A 3TUFA 4DCVA 3UZ0A 2MMAB 3T1HC 2E0GA 2VZEA 3UX2A 2NCLA 2ZZNA 3LNOA 2E8FA 1WCJA 4LF8C 4DUYC 4JI6C 4DUZC 4GXRA 2Y4OA 3TQIA 3AY0A 3N54B 4LF6C 2ASBA 4L2ZA 4GXQA 4OX9C 1IBKC 3FCEA 4DG9A 1HH2P 3TR3A 3SO4A 4DV5C 1XMOC 3L8CA 1P7LA 1KKGA 5LMNC 1N34C 3IPLA 4DCTA 2EGTA 3RV2A 1MXAA 3T1YC 3PBKA 4MTNA 1MDFA 4U5YD 4JI2C 4DV6C 2QVXX 4LF4C 4I9FA 2OBVA 4NXMC 4AQYC 4DV3C 2UU9C 2HHHC 3C5EA 1T5HX 2YWCA 4DV1C 2MCQA 2HJGA 1USPA 3H2TA 4DCUA 4ODJA 4DV7C 1HNXC 1XRAA 4WS9A 4L4QA 2JMPA 2CY1A 3A25A 1MD9A 1TH5A 4X66C 1QM4A 1HNWC 3A9UA
chains in the Genus database with same CATH topology
4DG8A 4HPVA 4JI7C 4LFCC 1N36C 4RVNA 1L2FA 4XX2A 3JAMD 1IBLC 1XMQC 4JI4C 1VLAA 4BC9A 1XNRC 2OPLA 2E8EA 2UUCC 4K0KC 2Y4NA 3R44A 5DV9A 2VQFC 5JRHA 2VSQA 1USPB 2P2JA 1XRBA 2YWBA 3GKUA 2E5LC 5H9UA 2D1SA 3CW8X 4BCAA 5ADZA 5IWAC 2D1QA 2F4VC 2P2BA 4DR2C 3PROC 3GR1A 2QW0X 3DAYA 3LNVA 5BSRA 4D56A 4X62C 4RM3A 2UUAC 1PA4A 4GKKC 2OPLB 4EATA 1FUGA 1QWIA 5BURA 1V26A 4D57A 1WF3A 3S82A 2DPLA 5CZXA 5FLXD 4DR3C 3PESA 5GTDA 3E7XA 1PG4A 4OXIA 3KXWA 5A19A 2PROA 2BH1X 5BUSA 4LFBC 4G36A 1LQLA 1BA3A 2KZFA 4RLFA 2UXDC 2D1TA 4KTTA 5CZVA 2P2MA 5BSVA 2E7GA 1O90A 2P2QA 4ZJZA 4FUTA 2P02A 3A4IA 4PZPA 3VNSA 1WH9A 1LCIA 4JI1C 3VNRA 3UOWA 5K8FA 4D4GA 4JI8C 3EQ6A 4LE5A 1MKYA 3NYQA 5KYVA 5IT9D 4FTFA 4R0MA 4X65C 3N2QA 3VNQA 4DR1C 1HNZC 4WV3A 3E7WA 2DYJA 3NPDA 3J81D 4X64C 1ULTA 4B3MC 3TDEA 2BJOA 1J5EC 2ONFA 4OYCA 4G1IA 3J80D 4JI5C 4K0BA 3R9XA 1ML8A 1T5DX 4FUQA 3NI2A 3I08A 1N33C 4YHHC 4BBYA 1UKKA 2PT7G 1N2FA 1IBMC 1O9TA 4LF9C 5BSUA 3AF5A 4R1MA 3R9WA 3IEVA 3GR0A 2OO4A 2UUBC 4BSZA 4G37A 3ETOA 1FJGC 3LAXA 4JYAC 1O92A 4LF5C 2ZM6C 4JM1A 3LGXA 4GKJC 4RLQA 2UXBC 2QL8A 4DR6C 3L95X 1XNQC 5A2QD 2QVZX 3FCCA 3DHVA 3RG2A 3IEUA 2ATWA 4NDNA 4L7IA 2QVYX 2P20A 4I9GA 4DCSA 4LFAC 4BC7A 2D27A 4JV5C 5AE2A 3NYRA 5BR8C 4MH4A 4DV2C 4DR4C 1N32C 2XR1A 4B3SC 2UXCC 4JI3C 5BUQA 1MXCA 3DLPX 2YCBA 2D7VA 5A1IA 5LMUC 4KTVA 4B3TC 3G7SA 5A1GA 2PN2A 1K0RA 4ISBA 4TPSB 1MDBA 5BSTA 3I07A 3EERA 4B3RC 5BSWA 5BSMA 5KEIA 2E8CA 2P2FA 4PROC 4YY3C 5AE1A 4DR7C 3AF6A 1AMUA 5E7QA 5T8SA 4DV4C 5K85A 2D28C 4DR5C 1GPMA 3IMLA 1XRCA 1ZB9A 1ZB8A 4ZLPA 2V7BA 1PG3A 5T8TA 4PHTA 1YJ7A 3CJEA 2D1RA 2WD9A 4D4IA 3LUSA 1V25A 1RY2A 2CXCA 5KYTA 4DV0C 3GPCA 4IR7A 3OTOC 4RVOA 1MXBA 4NXNC 4RMNA 4LF7C 2WP0C 1RG9A 3A9VA 1O93A 1EGAA 1I94C 4NOZA 3ETCA 1HR0C 4GS5A 4IZ6A 4KHPC 5IFIA 2AYAA 4JI0C 4R1LA 1NYEA 4RM2A 3CW9A 2VQEC 1JOSA 3B7WA 2Y27A 5AE3A 3TUFA 4DCVA 3UZ0A 3T1HC 2E0GA 2VZEA 2E8FA 4LF8C 4DUYC 4JI6C 4DUZC 4GXRA 2Y4OA 3TQIA 3N54B 4LF6C 2ASBA 4L2ZA 4GXQA 4OX9C 1IBKC 3FCEA 1HH2P 4DG9A 3SO4A 4DV5C 1XMOC 3L8CA 1P7LA 1KKGA 5LMNC 1N34C 3IPLA 4DCTA 2EGTA 3RV2A 1MXAA 3T1YC 3PBKA 4MTNA 1MDFA 4U5YD 4JI2C 4DV6C 2QVXX 4LF4C 4I9FA 2OBVA 4NXMC 4AQYC 4DV3C 2UU9C 2HHHC 3C5EA 1T5HX 2YWCA 4DV1C 2HJGA 1USPA 3H2TA 4DCUA 4ODJA 4DV7C 1HNXC 1XRAA 4WS9A 4L4QA 2JMPA 2CY1A 1MD9A 4X66C 1QM4A 1HNWC 3A9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCI A;  4DG8 A;  4RVO A;  3VNR A;  4RMN A;  5K8F A;  4RVN A;  3A9V A;  2QVZ X;  3EQ6 A;  3FCC A;  4D4G A;  3DHV A;  3RG2 A;  3NYQ A;  5KYV A;  2QVY X;  2P20 A;  3ETC A;  4GS5 A;  4R0M A;  4IZ6 A;  2Y4N A;  3NYR A;  5IFI A;  3R44 A;  5DV9 A;  4R1L A;  4RM2 A;  3CW9 A;  5JRH A;  3VNQ A;  2VSQ A;  3B7W A;  2Y27 A;  4WV3 A;  2P2J A;  3E7W A;  5BUQ A;  3DLP X;  2D1S A;  3CW8 X;  1ULT A;  2VZE A;  2D1Q A;  2P2B A;  3G7S A;  4GXR A;  2Y4O A;  4OYC A;  2QW0 X;  3DAY A;  3LNV A;  4ISB A;  5BSR A;  4D56 A;  4GXQ A;  4RM3 A;  1MDB A;  5BST A;  4EAT A;  5BSW A;  5BSM A;  3FCE A;  5KEI A;  1T5D X;  4FUQ A;  4DG9 A;  5BUR A;  2P2F A;  3NI2 A;  3L8C A;  4D57 A;  4RLQ A;  3IPL A;  3A9U A;  5BSU A;  5GTD A;  1AMU A;  5E7Q A;  4R1M A;  5K85 A;  3E7X A;  3PBK A;  1PG4 A;  4OXI A;  1MDF A;  4U5Y D;  2QVX X;  3KXW A;  4G37 A;  3C5E A;  1T5H X;  2V7B A;  5BUS A;  4G36 A;  1PG3 A;  1BA3 A;  3LAX A;  1YJ7 A;  4RLF A;  2D1R A;  2WD9 A;  2D1T A;  4D4I A;  2P2M A;  1RY2 A;  5BSV A;  5KYT A;  2P2Q A;  4ZJZ A;  3GPC A;  1MD9 A;  3LGX A;  4FUT A;  4IR7 A;  4PZP A;  3VNS A; 
#chains in the Genus database with same CATH topology
 4DG8 A;  4HPV A;  4JI7 C;  4LFC C;  1N36 C;  4RVN A;  1L2F A;  1VEH A;  4XX2 A;  3JAM D;  1NY8 A;  1IBL C;  1XMQ C;  4JI4 C;  1VLA A;  4BC9 A;  1XNR C;  2OPL A;  2E8E A;  2UUC C;  4K0K C;  2Y4N A;  2KZ0 A;  3R44 A;  5DV9 A;  2VQF C;  5JRH A;  2VSQ A;  4PUI A;  1USP B;  2P2J A;  1XRB A;  2YWB A;  3GKU A;  2E5L C;  5H9U A;  2D1S A;  3CW8 X;  4BCA A;  5ADZ A;  5IWA C;  2D1Q A;  5LCI A;  2F4V C;  2P2B A;  4DR2 C;  3PRO C;  3GR1 A;  2QW0 X;  3DAY A;  3LNV A;  5BSR A;  4D56 A;  4X62 C;  4RM3 A;  2UUA C;  1PA4 A;  4GKK C;  4PUH A;  2OPL B;  4EAT A;  1FUG A;  1QWI A;  4PUG A;  2YX1 A;  5BUR A;  2JNV A;  1V26 A;  4D57 A;  1WF3 A;  3S82 A;  2DPL A;  3O2E A;  3UEB A;  5CZX A;  5FLX D;  4DR3 C;  3PES A;  1M6X A;  5GTD A;  3E7X A;  1PG4 A;  4OXI A;  3KXW A;  5A19 A;  2PRO A;  2BH1 X;  5BUS A;  4LFB C;  4G36 A;  1LQL A;  2MM9 A;  1BA3 A;  2KZF A;  4RLF A;  2UXD C;  2D1T A;  4KTT A;  5CZV A;  2P2M A;  5BSV A;  2E7G A;  2Z51 A;  1O90 A;  2P2Q A;  4ZJZ A;  4FUT A;  2P02 A;  3A4I A;  4PZP A;  3VNS A;  1WH9 A;  1LCI A;  4JI1 C;  3VNR A;  3UOW A;  5K8F A;  4D4G A;  4JI8 C;  3EQ6 A;  1IB8 A;  4LE5 A;  1MKY A;  3CQ3 A;  3NYQ A;  5KYV A;  5IT9 D;  4FTF A;  4R0M A;  4X65 C;  1XHJ A;  3N2Q A;  3VNQ A;  4DR1 C;  1HNZ C;  4WV3 A;  3E7W A;  2M5H A;  2DYJ A;  3NPD A;  3J81 D;  4X64 C;  1ULT A;  4B3M C;  3TDE A;  2BJO A;  1J5E C;  2ONF A;  4OYC A;  1V60 A;  4G1I A;  3J80 D;  4JI5 C;  4K0B A;  3R9X A;  1ML8 A;  1T5D X;  4FUQ A;  3NI2 A;  3I08 A;  1N33 C;  3UX3 A;  4YHH C;  4BBY A;  1UKK A;  2PT7 G;  1N2F A;  1IBM C;  1O9T A;  4LF9 C;  5BSU A;  3AF5 A;  4R1M A;  3R9W A;  3IEV A;  3GR0 A;  2OO4 A;  2UUB C;  4BSZ A;  4G37 A;  2KDN A;  3ETO A;  1FJG C;  1XS3 A;  3LAX A;  4JYA C;  1O92 A;  4LF5 C;  2ZM6 C;  4JM1 A;  1P4E A;  3LGX A;  4GKJ C;  4RLQ A;  2UXB C;  2QL8 A;  4DR6 C;  3L95 X;  1XNQ C;  5A2Q D;  2QVZ X;  3FCC A;  3DHV A;  3RG2 A;  3IEU A;  2ATW A;  4NDN A;  4L7I A;  2QVY X;  2P20 A;  4I9G A;  4DCS A;  4LFA C;  4BC7 A;  3A26 A;  2D27 A;  4JV5 C;  5AE2 A;  3NYR A;  2DHM A;  5BR8 C;  4MH4 A;  4DV2 C;  4DR4 C;  1N32 C;  2XR1 A;  4B3S C;  2UXC C;  4JI3 C;  5BUQ A;  1MXC A;  3DLP X;  2YCB A;  2D7V A;  5A1I A;  2M5O A;  5LMU C;  1P4E C;  4KTV A;  1M6X C;  1UWD A;  4B3T C;  3G7S A;  5A1G A;  2PN2 A;  1K0R A;  4ISB A;  4TPS B;  1MDB A;  5BST A;  3CQ2 A;  3I07 A;  3EER A;  4B3R C;  5BSW A;  5BSM A;  5KEI A;  2E8C A;  2P2F A;  4PRO C;  4YY3 C;  5AE1 A;  4DR7 C;  3AF6 A;  1PU1 A;  1AMU A;  5E7Q A;  5T8S A;  3K6R A;  4DV4 C;  5K85 A;  2D28 C;  4DR5 C;  2CU6 A;  1GPM A;  3IML A;  1XRC A;  1ZB9 A;  1ZB8 A;  4ZLP A;  2V7B A;  3CQ1 A;  1PG3 A;  5T8T A;  4PHT A;  1YJ7 A;  3CJE A;  2D1R A;  2WD9 A;  4D4I A;  3LUS A;  1FLO A;  1V25 A;  1RY2 A;  2CXC A;  5KYT A;  4DV0 C;  3GPC A;  4IR7 A;  3OTO C;  4RVO A;  1MXB A;  4NXN C;  4RMN A;  4LF7 C;  2WP0 C;  1RG9 A;  3A9V A;  1O93 A;  1EGA A;  1I94 C;  4NOZ A;  3ETC A;  1HR0 C;  4GS5 A;  4IZ6 A;  4KHP C;  5IFI A;  2AYA A;  4JI0 C;  2ZZM A;  4R1L A;  1NYE A;  4RM2 A;  3CW9 A;  2VQE C;  1JOS A;  3B7W A;  2Y27 A;  5AE3 A;  3TUF A;  4DCV A;  3UZ0 A;  2MMA B;  3T1H C;  2E0G A;  2VZE A;  3UX2 A;  2NCL A;  2ZZN A;  3LNO A;  2E8F A;  1WCJ A;  4LF8 C;  4DUY C;  4JI6 C;  4DUZ C;  4GXR A;  2Y4O A;  3TQI A;  3AY0 A;  3N54 B;  4LF6 C;  2ASB A;  4L2Z A;  4GXQ A;  4OX9 C;  1IBK C;  3FCE A;  4DG9 A;  1HH2 P;  3TR3 A;  3SO4 A;  4DV5 C;  1XMO C;  3L8C A;  1P7L A;  1KKG A;  5LMN C;  1N34 C;  3IPL A;  4DCT A;  2EGT A;  3RV2 A;  1MXA A;  3T1Y C;  3PBK A;  4MTN A;  1MDF A;  4U5Y D;  4JI2 C;  4DV6 C;  2QVX X;  4LF4 C;  4I9F A;  2OBV A;  4NXM C;  4AQY C;  4DV3 C;  2UU9 C;  2HHH C;  3C5E A;  1T5H X;  2YWC A;  4DV1 C;  2MCQ A;  2HJG A;  1USP A;  3H2T A;  4DCU A;  4ODJ A;  4DV7 C;  1HNX C;  1XRA A;  4WS9 A;  4L4Q A;  2JMP A;  2CY1 A;  3A25 A;  1MD9 A;  1TH5 A;  4X66 C;  1QM4 A;  1HNW C;  3A9U A; 
#chains in the Genus database with same CATH homology
 4DG8 A;  4HPV A;  4JI7 C;  4LFC C;  1N36 C;  4RVN A;  1L2F A;  4XX2 A;  3JAM D;  1IBL C;  1XMQ C;  4JI4 C;  1VLA A;  4BC9 A;  1XNR C;  2OPL A;  2E8E A;  2UUC C;  4K0K C;  2Y4N A;  3R44 A;  5DV9 A;  2VQF C;  5JRH A;  2VSQ A;  1USP B;  2P2J A;  1XRB A;  2YWB A;  3GKU A;  2E5L C;  5H9U A;  2D1S A;  3CW8 X;  4BCA A;  5ADZ A;  5IWA C;  2D1Q A;  2F4V C;  2P2B A;  4DR2 C;  3PRO C;  3GR1 A;  2QW0 X;  3DAY A;  3LNV A;  5BSR A;  4D56 A;  4X62 C;  4RM3 A;  2UUA C;  1PA4 A;  4GKK C;  2OPL B;  4EAT A;  1FUG A;  1QWI A;  5BUR A;  1V26 A;  4D57 A;  1WF3 A;  3S82 A;  2DPL A;  5CZX A;  5FLX D;  4DR3 C;  3PES A;  5GTD A;  3E7X A;  1PG4 A;  4OXI A;  3KXW A;  5A19 A;  2PRO A;  2BH1 X;  5BUS A;  4LFB C;  4G36 A;  1LQL A;  1BA3 A;  2KZF A;  4RLF A;  2UXD C;  2D1T A;  4KTT A;  5CZV A;  2P2M A;  5BSV A;  2E7G A;  1O90 A;  2P2Q A;  4ZJZ A;  4FUT A;  2P02 A;  3A4I A;  4PZP A;  3VNS A;  1WH9 A;  1LCI A;  4JI1 C;  3VNR A;  3UOW A;  5K8F A;  4D4G A;  4JI8 C;  3EQ6 A;  4LE5 A;  1MKY A;  3NYQ A;  5KYV A;  5IT9 D;  4FTF A;  4R0M A;  4X65 C;  3N2Q A;  3VNQ A;  4DR1 C;  1HNZ C;  4WV3 A;  3E7W A;  2DYJ A;  3NPD A;  3J81 D;  4X64 C;  1ULT A;  4B3M C;  3TDE A;  2BJO A;  1J5E C;  2ONF A;  4OYC A;  4G1I A;  3J80 D;  4JI5 C;  4K0B A;  3R9X A;  1ML8 A;  1T5D X;  4FUQ A;  3NI2 A;  3I08 A;  1N33 C;  4YHH C;  4BBY A;  1UKK A;  2PT7 G;  1N2F A;  1IBM C;  1O9T A;  4LF9 C;  5BSU A;  3AF5 A;  4R1M A;  3R9W A;  3IEV A;  3GR0 A;  2OO4 A;  2UUB C;  4BSZ A;  4G37 A;  3ETO A;  1FJG C;  3LAX A;  4JYA C;  1O92 A;  4LF5 C;  2ZM6 C;  4JM1 A;  3LGX A;  4GKJ C;  4RLQ A;  2UXB C;  2QL8 A;  4DR6 C;  3L95 X;  1XNQ C;  5A2Q D;  2QVZ X;  3FCC A;  3DHV A;  3RG2 A;  3IEU A;  2ATW A;  4NDN A;  4L7I A;  2QVY X;  2P20 A;  4I9G A;  4DCS A;  4LFA C;  4BC7 A;  2D27 A;  4JV5 C;  5AE2 A;  3NYR A;  5BR8 C;  4MH4 A;  4DV2 C;  4DR4 C;  1N32 C;  2XR1 A;  4B3S C;  2UXC C;  4JI3 C;  5BUQ A;  1MXC A;  3DLP X;  2YCB A;  2D7V A;  5A1I A;  5LMU C;  4KTV A;  4B3T C;  3G7S A;  5A1G A;  2PN2 A;  1K0R A;  4ISB A;  4TPS B;  1MDB A;  5BST A;  3I07 A;  3EER A;  4B3R C;  5BSW A;  5BSM A;  5KEI A;  2E8C A;  2P2F A;  4PRO C;  4YY3 C;  5AE1 A;  4DR7 C;  3AF6 A;  1AMU A;  5E7Q A;  5T8S A;  4DV4 C;  5K85 A;  2D28 C;  4DR5 C;  1GPM A;  3IML A;  1XRC A;  1ZB9 A;  1ZB8 A;  4ZLP A;  2V7B A;  1PG3 A;  5T8T A;  4PHT A;  1YJ7 A;  3CJE A;  2D1R A;  2WD9 A;  4D4I A;  3LUS A;  1V25 A;  1RY2 A;  2CXC A;  5KYT A;  4DV0 C;  3GPC A;  4IR7 A;  3OTO C;  4RVO A;  1MXB A;  4NXN C;  4RMN A;  4LF7 C;  2WP0 C;  1RG9 A;  3A9V A;  1O93 A;  1EGA A;  1I94 C;  4NOZ A;  3ETC A;  1HR0 C;  4GS5 A;  4IZ6 A;  4KHP C;  5IFI A;  2AYA A;  4JI0 C;  4R1L A;  1NYE A;  4RM2 A;  3CW9 A;  2VQE C;  1JOS A;  3B7W A;  2Y27 A;  5AE3 A;  3TUF A;  4DCV A;  3UZ0 A;  3T1H C;  2E0G A;  2VZE A;  2E8F A;  4LF8 C;  4DUY C;  4JI6 C;  4DUZ C;  4GXR A;  2Y4O A;  3TQI A;  3N54 B;  4LF6 C;  2ASB A;  4L2Z A;  4GXQ A;  4OX9 C;  1IBK C;  3FCE A;  1HH2 P;  4DG9 A;  3SO4 A;  4DV5 C;  1XMO C;  3L8C A;  1P7L A;  1KKG A;  5LMN C;  1N34 C;  3IPL A;  4DCT A;  2EGT A;  3RV2 A;  1MXA A;  3T1Y C;  3PBK A;  4MTN A;  1MDF A;  4U5Y D;  4JI2 C;  4DV6 C;  2QVX X;  4LF4 C;  4I9F A;  2OBV A;  4NXM C;  4AQY C;  4DV3 C;  2UU9 C;  2HHH C;  3C5E A;  1T5H X;  2YWC A;  4DV1 C;  2HJG A;  1USP A;  3H2T A;  4DCU A;  4ODJ A;  4DV7 C;  1HNX C;  1XRA A;  4WS9 A;  4L4Q A;  2JMP A;  2CY1 A;  1MD9 A;  4X66 C;  1QM4 A;  1HNW C;  3A9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...