4U5YD

Crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
115
Chain Sequence
GTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNCGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNTLADPGVVEKLLEEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acyl-CoA synthetase
publication title Insights into the specificity of lysine acetyltransferases.
pubmed doi rcsb
source organism Streptomyces lividans tk24
molecule tags Ligase
total genus 33
structure length 115
sequence length 120
ec nomenclature ec 6.2.1.1: Acetate--CoA ligase.
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4u5yD00
3GPCA 4RVNA 1ULTA 5E7QA 1YJ7A 4RM3A 4EATA 5JRHA 4FUQA 5BSRA 5KYTA 2VZEA 2VSQA 4IR7A 3CW8X 5BUQA 4FUTA 2WD9A 4G36A 2P2FA 2P2MA 4D57A 4R0MA 4ZJZA 5GTDA 2QVYX 3B7WA 5BUSA 4D4IA 1RY2A 5BURA 5BSWA 2D1QA 4R1MA 2P2QA 4RVOA 1LCIA 2QVXX 3NI2A 4RLQA 4WV3A 4ISBA 3IPLA 4PZPA 2D1RA 3FCEA 4OXIA 1BA3A 3A9VA 3NYQA 4IZ6A 4D56A 2D1SA 1MDBA 3C5EA 3VNQA 3LAXA 3LGXA 2P20A 1AMUA 3EQ6A 3LNVA 3E7XA 3R44A 4R1LA 4D4GA 5KEIA 2QW0X 3KXWA 4GXRA 4GS5A 4U5YD 1T5DX 3G7SA 1PG4A 3DLPX 2Y4OA 5KYVA 3VNSA 5BSTA 3VNRA 5BSVA 2P2BA 4DG9A 3DAYA 2V7BA 3CW9A 2QVZX 1T5HX 5IFIA 5K85A 4GXQA 5DV9A 2Y27A 1MD9A 4OYCA 3DHVA 5BSUA 3FCCA 2Y4NA 1MDFA 3E7WA 2P2JA 3NYRA 5K8FA 3ETCA 3L8CA 5BSMA 4DG8A 4RMNA 3PBKA 4RM2A 3A9UA 4G37A 4RLFA 3RG2A 2D1TA 1PG3A
chains in the Genus database with same CATH superfamily
3UEBA 3TQIA 1XRBA 4AQYC 5CZXA 4EATA 4ZLPA 2E5LC 1NYEA 4GKKC 2VZEA 2M5OA 2Z51A 3UOWA 5BUQA 2WD9A 4OX9C 1N36C 2D27A 4R0MA 4B3TC 1HNWC 4LF6C 3AF6A 4LE5A 1IBMC 2E8CA 1N33C 1RY2A 2YX1A 1NY8A 3H2TA 2OBVA 5BSWA 4ODJA 1XNRC 2MCQA 1LCIA 2YCBA 4ISBA 1XHJA 4PZPA 4BC7A 3A26A 3FCEA 1BA3A 4YY3C 3R9WA 4XX2A 4BBYA 4L7IA 3JAMD 4DV2C 5CZVA 4L2ZA 4L4QA 2JNVA 4JI7C 2D7VA 3IMLA 3NPDA 5KEIA 3KXWA 1HH2P 2HHHC 4GS5A 3G7SA 4NOZA 2ZZNA 5IWAC 1JOSA 5BSTA 1O9TA 2V7BA 3CW9A 3PESA 3TDEA 1T5HX 5A1GA 1I94C 4DR1C 1MD9A 3I08A 4BC9A 2Y4NA 1MDFA 2ATWA 2CU6A 1V25A 3SO4A 4DR6C 1N32C 4B3SC 3R9XA 4K0BA 1N34C 3UX2A 1ML8A 4X65C 4RMNA 4DV5C 3T1HC 4RM2A 3PROC 2OPLB 2D1TA 2JMPA 3GPCA 3AF5A 1O92A 3UZ0A 3K6RA 4LFAC 2QL8A 5BSRA 2MMAB 5LMUC 2VSQA 1WH9A 2NCLA 1XMQC 4JI4C 4PROC 4DV4C 2DPLA 2OPLA 4JI0C 5GTDA 4PUGA 2QVYX 3B7WA 5BUSA 4G1IA 4DCTA 4R1MA 5IT9D 2WP0C 4RVOA 2QVXX 4LF4C 3IPLA 1QM4A 1KKGA 5AE2A 3IEVA 3A9VA 4KHPC 4D56A 2D1SA 2UXBC 1MDBA 1O90A 2KDNA 3LAXA 4DCUA 4MTNA 3EQ6A 2KZ0A 3IEUA 2CXCA 3R44A 4JYAC 3S82A 5T8TA 2QW0X 4GXRA 4DV0C 4LF7C 3LUSA 5LCIA 5ADZA 4I9GA 2Y4OA 3VNSA 1MXCA 5BSVA 4NDNA 2PROA 3DAYA 1MKYA 4X64C 2QVZX 1RG9A 4PHTA 4GXQA 5DV9A 4X66C 2ASBA 3FCCA 1EGAA 3J80D 2XR1A 1XS3A 1P7LA 2PN2A 5AE1A 3GKUA 2P02A 3ETOA 4NXNC 3ETCA 3L8CA 2BH1X 2UXCC 1N2FA 1TH5A 4G37A 1LQLA 5A19A 1PG3A 1ULTA 1O93A 4TPSB 5E7QA 1YJ7A 2UU9C 1XNQC 4RM3A 5JRHA 4DV3C 3CQ2A 3GR0A 1XMOC 1UWDA 1IBLC 1IB8A 4NXMC 2E0GA 4G36A 1HNXC 2UXDC 5A1IA 4DR7C 2P2MA 1WF3A 3UX3A 4ZJZA 3A25A 1HNZC 2VQFC 2OO4A 1MXAA 4D4IA 3CQ1A 4DR2C 2VQEC 1VEHA 4DV7C 5AE3A 5BURA 3OTOC 3J81D 3L95X 2E8FA 4JI5C 1FUGA 1V26A 2D1RA 3RV2A 1M6XA 3NYQA 4IZ6A 3N2QA 1USPB 3C5EA 3VNQA 4LFCC 2P20A 4LF9C 2DYJA 1AMUA 4DR3C 1K0RA 4D4GA 1PG4A 3A4IA 1P4EC 3VNRA 4I9FA 2UUBC 1USPA 4YHHC 2Y27A 3DHVA 3LNOA 2E7GA 5BSUA 1J5EC 1L2FA 4DV6C 1ZB8A 1V60A 1HR0C 1PU1A 2ZM6C 4JI8C 4DUYC 3NYRA 1UKKA 4X62C 4B3RC 1M6XC 4JI6C 4FTFA 2KZFA 4DV1C 4MH4A 3TUFA 3A9UA 4RLFA 3RG2A 3T1YC 4JI1C 4RVNA 2EGTA 1ZB9A 4FUQA 5H9UA 4K0KC 2UUCC 4HPVA 4KTTA 5KYTA 4IR7A 4JI3C 2AYAA 3CW8X 1XRCA 4FUTA 4DR4C 2E8EA 2P2FA 4LF8C 4D57A 2CY1A 1VLAA 1PA4A 4JI2C 4JM1A 2YWCA 4DR5C 2F4VC 3O2EA 2UUAC 2D1QA 5LMNC 2P2QA 3NI2A 1XRAA 4RLQA 4WV3A 1P4EA 4WS9A 1WCJA 2DHMA 5T8SA 4OXIA 4GKJC 3EERA 4BSZA 2HJGA 4B3MC 1FLOA 3LGXA 3LNVA 4DUZC 3E7XA 2PT7G 5BR8C 4R1LA 1QWIA 2M5HA 1FJGC 1IBKC 2ZZMA 4U5YD 1T5DX 3GR1A 1MXBA 5FLXD 4PUIA 2BJOA 3DLPX 3I07A 4KTVA 5KYVA 2P2BA 4DG9A 4LF5C 4JV5C 4LFBC 4BCAA 3TR3A 3AY0A 5IFIA 5K85A 4OYCA 4DCVA 2MM9A 3E7WA 2P2JA 2ONFA 3CJEA 3N54B 5A2QD 5K8FA 2D28C 2YWBA 1GPMA 5BSMA 4DG8A 3PBKA 3CQ3A 4DCSA 4PUHA
chains in the Genus database with same CATH topology
3TQIA 1XRBA 4AQYC 5CZXA 4EATA 4ZLPA 2E5LC 1NYEA 4GKKC 2VZEA 3UOWA 5BUQA 2WD9A 4OX9C 1N36C 2D27A 4R0MA 4B3TC 1HNWC 4LF6C 3AF6A 4LE5A 1IBMC 2E8CA 1N33C 1RY2A 3H2TA 2OBVA 5BSWA 4ODJA 1XNRC 1LCIA 2YCBA 4ISBA 4PZPA 4BC7A 3FCEA 1BA3A 4YY3C 3R9WA 4XX2A 4BBYA 4L7IA 3JAMD 4DV2C 5CZVA 4L2ZA 4L4QA 4JI7C 2D7VA 3IMLA 3NPDA 5KEIA 3KXWA 1HH2P 2HHHC 4GS5A 3G7SA 4NOZA 5IWAC 1JOSA 5BSTA 1O9TA 2V7BA 3CW9A 3PESA 3TDEA 1T5HX 5A1GA 1I94C 4DR1C 1MD9A 3I08A 4BC9A 2Y4NA 1MDFA 2ATWA 1V25A 3SO4A 4DR6C 1N32C 4B3SC 3R9XA 4K0BA 1N34C 1ML8A 4X65C 4RMNA 4DV5C 3T1HC 4RM2A 3PROC 2OPLB 2D1TA 2JMPA 3GPCA 3AF5A 1O92A 3UZ0A 4LFAC 2QL8A 5BSRA 5LMUC 2VSQA 1WH9A 1XMQC 4JI4C 4PROC 4DV4C 2DPLA 2OPLA 4JI0C 5GTDA 2QVYX 3B7WA 5BUSA 4G1IA 4DCTA 4R1MA 5IT9D 2WP0C 4RVOA 2QVXX 4LF4C 3IPLA 1QM4A 1KKGA 5AE2A 3IEVA 3A9VA 4KHPC 4D56A 2D1SA 2UXBC 1MDBA 1O90A 3LAXA 4DCUA 4MTNA 3EQ6A 3IEUA 2CXCA 3R44A 4JYAC 3S82A 5T8TA 2QW0X 4GXRA 4DV0C 4LF7C 3LUSA 5ADZA 4I9GA 2Y4OA 3VNSA 1MXCA 5BSVA 4NDNA 2PROA 3DAYA 1MKYA 4X64C 2QVZX 1RG9A 4PHTA 4GXQA 5DV9A 4X66C 2ASBA 3FCCA 1EGAA 3J80D 2XR1A 1P7LA 2PN2A 5AE1A 3GKUA 2P02A 3ETOA 4NXNC 3ETCA 3L8CA 2BH1X 2UXCC 1N2FA 4G37A 1LQLA 5A19A 1PG3A 1ULTA 1O93A 4TPSB 5E7QA 1YJ7A 2UU9C 1XNQC 4RM3A 5JRHA 4DV3C 3GR0A 1XMOC 1IBLC 4NXMC 2E0GA 4G36A 1HNXC 2UXDC 5A1IA 4DR7C 2P2MA 1WF3A 4ZJZA 1HNZC 2VQFC 2OO4A 1MXAA 4D4IA 4DR2C 2VQEC 4DV7C 5AE3A 5BURA 3OTOC 3J81D 3L95X 2E8FA 4JI5C 1FUGA 1V26A 2D1RA 3RV2A 3NYQA 4IZ6A 3N2QA 1USPB 3C5EA 3VNQA 4LFCC 2P20A 4LF9C 2DYJA 1AMUA 4DR3C 1K0RA 4D4GA 1PG4A 3A4IA 3VNRA 4I9FA 2UUBC 1USPA 4YHHC 2Y27A 3DHVA 2E7GA 5BSUA 1J5EC 1L2FA 4DV6C 1ZB8A 1HR0C 2ZM6C 4JI8C 4DUYC 3NYRA 1UKKA 4X62C 4B3RC 4JI6C 4FTFA 2KZFA 4DV1C 4MH4A 3TUFA 3A9UA 4RLFA 3T1YC 3RG2A 4JI1C 4RVNA 2EGTA 1ZB9A 4FUQA 5H9UA 4K0KC 2UUCC 4HPVA 4KTTA 5KYTA 4IR7A 4JI3C 2AYAA 3CW8X 1XRCA 4FUTA 4DR4C 2E8EA 2P2FA 4LF8C 4D57A 2CY1A 1VLAA 1PA4A 4JI2C 4JM1A 2YWCA 4DR5C 2F4VC 2UUAC 2D1QA 5LMNC 2P2QA 3NI2A 1XRAA 4RLQA 4WV3A 4WS9A 5T8SA 4OXIA 4GKJC 3EERA 4BSZA 2HJGA 4B3MC 3LGXA 3LNVA 4DUZC 3E7XA 2PT7G 5BR8C 4R1LA 1QWIA 1FJGC 1IBKC 4U5YD 1T5DX 3GR1A 1MXBA 5FLXD 2BJOA 3DLPX 3I07A 4KTVA 5KYVA 2P2BA 4DG9A 4LF5C 4JV5C 4LFBC 4BCAA 5IFIA 5K85A 4OYCA 4DCVA 3E7WA 2P2JA 2ONFA 3CJEA 3N54B 5A2QD 5K8FA 2D28C 2YWBA 1GPMA 5BSMA 4DG8A 3PBKA 4DCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPC A;  4RVN A;  1ULT A;  5E7Q A;  1YJ7 A;  4RM3 A;  4EAT A;  5JRH A;  4FUQ A;  5BSR A;  5KYT A;  2VZE A;  2VSQ A;  4IR7 A;  3CW8 X;  5BUQ A;  4FUT A;  2WD9 A;  4G36 A;  2P2F A;  2P2M A;  4D57 A;  4R0M A;  4ZJZ A;  5GTD A;  2QVY X;  3B7W A;  5BUS A;  4D4I A;  1RY2 A;  5BUR A;  5BSW A;  2D1Q A;  4R1M A;  2P2Q A;  4RVO A;  1LCI A;  2QVX X;  3NI2 A;  4RLQ A;  4WV3 A;  4ISB A;  3IPL A;  4PZP A;  2D1R A;  3FCE A;  4OXI A;  1BA3 A;  3A9V A;  3NYQ A;  4IZ6 A;  4D56 A;  2D1S A;  1MDB A;  3C5E A;  3VNQ A;  3LAX A;  3LGX A;  2P20 A;  1AMU A;  3EQ6 A;  3LNV A;  3E7X A;  3R44 A;  4R1L A;  4D4G A;  5KEI A;  2QW0 X;  3KXW A;  4GXR A;  4GS5 A;  4U5Y D;  1T5D X;  3G7S A;  1PG4 A;  3DLP X;  2Y4O A;  5KYV A;  3VNS A;  5BST A;  3VNR A;  5BSV A;  2P2B A;  4DG9 A;  3DAY A;  2V7B A;  3CW9 A;  2QVZ X;  1T5H X;  5IFI A;  5K85 A;  4GXQ A;  5DV9 A;  2Y27 A;  1MD9 A;  4OYC A;  3DHV A;  5BSU A;  3FCC A;  2Y4N A;  1MDF A;  3E7W A;  2P2J A;  3NYR A;  5K8F A;  3ETC A;  3L8C A;  5BSM A;  4DG8 A;  4RMN A;  3PBK A;  4RM2 A;  3A9U A;  4G37 A;  4RLF A;  3RG2 A;  2D1T A;  1PG3 A; 
#chains in the Genus database with same CATH topology
 3UEB A;  3TQI A;  1XRB A;  4AQY C;  5CZX A;  4EAT A;  4ZLP A;  2E5L C;  1NYE A;  4GKK C;  2VZE A;  2M5O A;  2Z51 A;  3UOW A;  5BUQ A;  2WD9 A;  4OX9 C;  1N36 C;  2D27 A;  4R0M A;  4B3T C;  1HNW C;  4LF6 C;  3AF6 A;  4LE5 A;  1IBM C;  2E8C A;  1N33 C;  1RY2 A;  2YX1 A;  1NY8 A;  3H2T A;  2OBV A;  5BSW A;  4ODJ A;  1XNR C;  2MCQ A;  1LCI A;  2YCB A;  4ISB A;  1XHJ A;  4PZP A;  4BC7 A;  3A26 A;  3FCE A;  1BA3 A;  4YY3 C;  3R9W A;  4XX2 A;  4BBY A;  4L7I A;  3JAM D;  4DV2 C;  5CZV A;  4L2Z A;  4L4Q A;  2JNV A;  4JI7 C;  2D7V A;  3IML A;  3NPD A;  5KEI A;  3KXW A;  1HH2 P;  2HHH C;  4GS5 A;  3G7S A;  4NOZ A;  2ZZN A;  5IWA C;  1JOS A;  5BST A;  1O9T A;  2V7B A;  3CW9 A;  3PES A;  3TDE A;  1T5H X;  5A1G A;  1I94 C;  4DR1 C;  1MD9 A;  3I08 A;  4BC9 A;  2Y4N A;  1MDF A;  2ATW A;  2CU6 A;  1V25 A;  3SO4 A;  4DR6 C;  1N32 C;  4B3S C;  3R9X A;  4K0B A;  1N34 C;  3UX2 A;  1ML8 A;  4X65 C;  4RMN A;  4DV5 C;  3T1H C;  4RM2 A;  3PRO C;  2OPL B;  2D1T A;  2JMP A;  3GPC A;  3AF5 A;  1O92 A;  3UZ0 A;  3K6R A;  4LFA C;  2QL8 A;  5BSR A;  2MMA B;  5LMU C;  2VSQ A;  1WH9 A;  2NCL A;  1XMQ C;  4JI4 C;  4PRO C;  4DV4 C;  2DPL A;  2OPL A;  4JI0 C;  5GTD A;  4PUG A;  2QVY X;  3B7W A;  5BUS A;  4G1I A;  4DCT A;  4R1M A;  5IT9 D;  2WP0 C;  4RVO A;  2QVX X;  4LF4 C;  3IPL A;  1QM4 A;  1KKG A;  5AE2 A;  3IEV A;  3A9V A;  4KHP C;  4D56 A;  2D1S A;  2UXB C;  1MDB A;  1O90 A;  2KDN A;  3LAX A;  4DCU A;  4MTN A;  3EQ6 A;  2KZ0 A;  3IEU A;  2CXC A;  3R44 A;  4JYA C;  3S82 A;  5T8T A;  2QW0 X;  4GXR A;  4DV0 C;  4LF7 C;  3LUS A;  5LCI A;  5ADZ A;  4I9G A;  2Y4O A;  3VNS A;  1MXC A;  5BSV A;  4NDN A;  2PRO A;  3DAY A;  1MKY A;  4X64 C;  2QVZ X;  1RG9 A;  4PHT A;  4GXQ A;  5DV9 A;  4X66 C;  2ASB A;  3FCC A;  1EGA A;  3J80 D;  2XR1 A;  1XS3 A;  1P7L A;  2PN2 A;  5AE1 A;  3GKU A;  2P02 A;  3ETO A;  4NXN C;  3ETC A;  3L8C A;  2BH1 X;  2UXC C;  1N2F A;  1TH5 A;  4G37 A;  1LQL A;  5A19 A;  1PG3 A;  1ULT A;  1O93 A;  4TPS B;  5E7Q A;  1YJ7 A;  2UU9 C;  1XNQ C;  4RM3 A;  5JRH A;  4DV3 C;  3CQ2 A;  3GR0 A;  1XMO C;  1UWD A;  1IBL C;  1IB8 A;  4NXM C;  2E0G A;  4G36 A;  1HNX C;  2UXD C;  5A1I A;  4DR7 C;  2P2M A;  1WF3 A;  3UX3 A;  4ZJZ A;  3A25 A;  1HNZ C;  2VQF C;  2OO4 A;  1MXA A;  4D4I A;  3CQ1 A;  4DR2 C;  2VQE C;  1VEH A;  4DV7 C;  5AE3 A;  5BUR A;  3OTO C;  3J81 D;  3L95 X;  2E8F A;  4JI5 C;  1FUG A;  1V26 A;  2D1R A;  3RV2 A;  1M6X A;  3NYQ A;  4IZ6 A;  3N2Q A;  1USP B;  3C5E A;  3VNQ A;  4LFC C;  2P20 A;  4LF9 C;  2DYJ A;  1AMU A;  4DR3 C;  1K0R A;  4D4G A;  1PG4 A;  3A4I A;  1P4E C;  3VNR A;  4I9F A;  2UUB C;  1USP A;  4YHH C;  2Y27 A;  3DHV A;  3LNO A;  2E7G A;  5BSU A;  1J5E C;  1L2F A;  4DV6 C;  1ZB8 A;  1V60 A;  1HR0 C;  1PU1 A;  2ZM6 C;  4JI8 C;  4DUY C;  3NYR A;  1UKK A;  4X62 C;  4B3R C;  1M6X C;  4JI6 C;  4FTF A;  2KZF A;  4DV1 C;  4MH4 A;  3TUF A;  3A9U A;  4RLF A;  3RG2 A;  3T1Y C;  4JI1 C;  4RVN A;  2EGT A;  1ZB9 A;  4FUQ A;  5H9U A;  4K0K C;  2UUC C;  4HPV A;  4KTT A;  5KYT A;  4IR7 A;  4JI3 C;  2AYA A;  3CW8 X;  1XRC A;  4FUT A;  4DR4 C;  2E8E A;  2P2F A;  4LF8 C;  4D57 A;  2CY1 A;  1VLA A;  1PA4 A;  4JI2 C;  4JM1 A;  2YWC A;  4DR5 C;  2F4V C;  3O2E A;  2UUA C;  2D1Q A;  5LMN C;  2P2Q A;  3NI2 A;  1XRA A;  4RLQ A;  4WV3 A;  1P4E A;  4WS9 A;  1WCJ A;  2DHM A;  5T8S A;  4OXI A;  4GKJ C;  3EER A;  4BSZ A;  2HJG A;  4B3M C;  1FLO A;  3LGX A;  3LNV A;  4DUZ C;  3E7X A;  2PT7 G;  5BR8 C;  4R1L A;  1QWI A;  2M5H A;  1FJG C;  1IBK C;  2ZZM A;  4U5Y D;  1T5D X;  3GR1 A;  1MXB A;  5FLX D;  4PUI A;  2BJO A;  3DLP X;  3I07 A;  4KTV A;  5KYV A;  2P2B A;  4DG9 A;  4LF5 C;  4JV5 C;  4LFB C;  4BCA A;  3TR3 A;  3AY0 A;  5IFI A;  5K85 A;  4OYC A;  4DCV A;  2MM9 A;  3E7W A;  2P2J A;  2ONF A;  3CJE A;  3N54 B;  5A2Q D;  5K8F A;  2D28 C;  2YWB A;  1GPM A;  5BSM A;  4DG8 A;  3PBK A;  3CQ3 A;  4DCS A;  4PUH A; 
#chains in the Genus database with same CATH homology
 3TQI A;  1XRB A;  4AQY C;  5CZX A;  4EAT A;  4ZLP A;  2E5L C;  1NYE A;  4GKK C;  2VZE A;  3UOW A;  5BUQ A;  2WD9 A;  4OX9 C;  1N36 C;  2D27 A;  4R0M A;  4B3T C;  1HNW C;  4LF6 C;  3AF6 A;  4LE5 A;  1IBM C;  2E8C A;  1N33 C;  1RY2 A;  3H2T A;  2OBV A;  5BSW A;  4ODJ A;  1XNR C;  1LCI A;  2YCB A;  4ISB A;  4PZP A;  4BC7 A;  3FCE A;  1BA3 A;  4YY3 C;  3R9W A;  4XX2 A;  4BBY A;  4L7I A;  3JAM D;  4DV2 C;  5CZV A;  4L2Z A;  4L4Q A;  4JI7 C;  2D7V A;  3IML A;  3NPD A;  5KEI A;  3KXW A;  1HH2 P;  2HHH C;  4GS5 A;  3G7S A;  4NOZ A;  5IWA C;  1JOS A;  5BST A;  1O9T A;  2V7B A;  3CW9 A;  3PES A;  3TDE A;  1T5H X;  5A1G A;  1I94 C;  4DR1 C;  1MD9 A;  3I08 A;  4BC9 A;  2Y4N A;  1MDF A;  2ATW A;  1V25 A;  3SO4 A;  4DR6 C;  1N32 C;  4B3S C;  3R9X A;  4K0B A;  1N34 C;  1ML8 A;  4X65 C;  4RMN A;  4DV5 C;  3T1H C;  4RM2 A;  3PRO C;  2OPL B;  2D1T A;  2JMP A;  3GPC A;  3AF5 A;  1O92 A;  3UZ0 A;  4LFA C;  2QL8 A;  5BSR A;  5LMU C;  2VSQ A;  1WH9 A;  1XMQ C;  4JI4 C;  4PRO C;  4DV4 C;  2DPL A;  2OPL A;  4JI0 C;  5GTD A;  2QVY X;  3B7W A;  5BUS A;  4G1I A;  4DCT A;  4R1M A;  5IT9 D;  2WP0 C;  4RVO A;  2QVX X;  4LF4 C;  3IPL A;  1QM4 A;  1KKG A;  5AE2 A;  3IEV A;  3A9V A;  4KHP C;  4D56 A;  2D1S A;  2UXB C;  1MDB A;  1O90 A;  3LAX A;  4DCU A;  4MTN A;  3EQ6 A;  3IEU A;  2CXC A;  3R44 A;  4JYA C;  3S82 A;  5T8T A;  2QW0 X;  4GXR A;  4DV0 C;  4LF7 C;  3LUS A;  5ADZ A;  4I9G A;  2Y4O A;  3VNS A;  1MXC A;  5BSV A;  4NDN A;  2PRO A;  3DAY A;  1MKY A;  4X64 C;  2QVZ X;  1RG9 A;  4PHT A;  4GXQ A;  5DV9 A;  4X66 C;  2ASB A;  3FCC A;  1EGA A;  3J80 D;  2XR1 A;  1P7L A;  2PN2 A;  5AE1 A;  3GKU A;  2P02 A;  3ETO A;  4NXN C;  3ETC A;  3L8C A;  2BH1 X;  2UXC C;  1N2F A;  4G37 A;  1LQL A;  5A19 A;  1PG3 A;  1ULT A;  1O93 A;  4TPS B;  5E7Q A;  1YJ7 A;  2UU9 C;  1XNQ C;  4RM3 A;  5JRH A;  4DV3 C;  3GR0 A;  1XMO C;  1IBL C;  4NXM C;  2E0G A;  4G36 A;  1HNX C;  2UXD C;  5A1I A;  4DR7 C;  2P2M A;  1WF3 A;  4ZJZ A;  1HNZ C;  2VQF C;  2OO4 A;  1MXA A;  4D4I A;  4DR2 C;  2VQE C;  4DV7 C;  5AE3 A;  5BUR A;  3OTO C;  3J81 D;  3L95 X;  2E8F A;  4JI5 C;  1FUG A;  1V26 A;  2D1R A;  3RV2 A;  3NYQ A;  4IZ6 A;  3N2Q A;  1USP B;  3C5E A;  3VNQ A;  4LFC C;  2P20 A;  4LF9 C;  2DYJ A;  1AMU A;  4DR3 C;  1K0R A;  4D4G A;  1PG4 A;  3A4I A;  3VNR A;  4I9F A;  2UUB C;  1USP A;  4YHH C;  2Y27 A;  3DHV A;  2E7G A;  5BSU A;  1J5E C;  1L2F A;  4DV6 C;  1ZB8 A;  1HR0 C;  2ZM6 C;  4JI8 C;  4DUY C;  3NYR A;  1UKK A;  4X62 C;  4B3R C;  4JI6 C;  4FTF A;  2KZF A;  4DV1 C;  4MH4 A;  3TUF A;  3A9U A;  4RLF A;  3T1Y C;  3RG2 A;  4JI1 C;  4RVN A;  2EGT A;  1ZB9 A;  4FUQ A;  5H9U A;  4K0K C;  2UUC C;  4HPV A;  4KTT A;  5KYT A;  4IR7 A;  4JI3 C;  2AYA A;  3CW8 X;  1XRC A;  4FUT A;  4DR4 C;  2E8E A;  2P2F A;  4LF8 C;  4D57 A;  2CY1 A;  1VLA A;  1PA4 A;  4JI2 C;  4JM1 A;  2YWC A;  4DR5 C;  2F4V C;  2UUA C;  2D1Q A;  5LMN C;  2P2Q A;  3NI2 A;  1XRA A;  4RLQ A;  4WV3 A;  4WS9 A;  5T8S A;  4OXI A;  4GKJ C;  3EER A;  4BSZ A;  2HJG A;  4B3M C;  3LGX A;  3LNV A;  4DUZ C;  3E7X A;  2PT7 G;  5BR8 C;  4R1L A;  1QWI A;  1FJG C;  1IBK C;  4U5Y D;  1T5D X;  3GR1 A;  1MXB A;  5FLX D;  2BJO A;  3DLP X;  3I07 A;  4KTV A;  5KYV A;  2P2B A;  4DG9 A;  4LF5 C;  4JV5 C;  4LFB C;  4BCA A;  5IFI A;  5K85 A;  4OYC A;  4DCV A;  3E7W A;  2P2J A;  2ONF A;  3CJE A;  3N54 B;  5A2Q D;  5K8F A;  2D28 C;  2YWB A;  1GPM A;  5BSM A;  4DG8 A;  3PBK A;  4DCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...