4U5YD

Crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
115
Chain Sequence
GTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNCGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNTLADPGVVEKLLEEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the specificity of lysine acetyltransferases.
pubmed doi rcsb
source organism Streptomyces lividans tk24
molecule tags Ligase
molecule keywords Acyl-CoA synthetase
total genus 33
structure length 115
sequence length 120
ec nomenclature ec 6.2.1.1: Acetate--CoA ligase.
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4u5yD00
3CW9A 2Y4NA 4R0MA 4U5YD 3NI2A 2QVYX 3G7SA 2P2MA 4RM2A 3A9VA 4D4GA 5BURA 4OYCA 3L8CA 1PG3A 3KXWA 2V7BA 5BUQA 2WD9A 4D56A 4WV3A 3FCCA 1T5DX 4RMNA 5BSWA 4GXQA 4PZPA 4DG9A 3LAXA 3LGXA 3VNQA 4RVOA 2QVZX 1LCIA 5KYVA 2VZEA 3B7WA 4ISBA 5IFIA 5BSMA 4RM3A 3A9UA 3IPLA 5E7QA 4EATA 4GS5A 2D1SA 4D4IA 1PG4A 4ZJZA 2P20A 1MD9A 4RLFA 4OXIA 5GTDA 1MDBA 1T5HX 5JRHA 4G36A 3EQ6A 3E7XA 3LNVA 5KYTA 5K8FA 3E7WA 3DLPX 4D57A 1RY2A 4GXRA 2P2BA 5DV9A 2P2FA 1ULTA 4FUQA 4G37A 5BSUA 3ETCA 5BSVA 5KEIA 4IR7A 3NYQA 1YJ7A 2D1QA 4FUTA 4RVNA 2P2QA 2D1TA 4R1MA 2QVXX 4DG8A 2QW0X 4RLQA 3VNSA 3RG2A 3VNRA 2D1RA 5BUSA 2Y27A 3DHVA 3DAYA 3GPCA 3CW8X 1MDFA 3PBKA 3FCEA 5BSRA 3NYRA 4R1LA 5K85A 3C5EA 1AMUA 2VSQA 2Y4OA 2P2JA 1BA3A 3R44A 5BSTA 4IZ6A
chains in the Genus database with same CATH superfamily
1P4EC 4KTVA 2QL8A 3H2TA 5H9UA 4JYAC 1PU1A 3NI2A 2QVYX 3G7SA 2P2MA 1N34C 4MTNA 5A1GA 5BUQA 1K0RA 2PT7G 1XRCA 4WV3A 4GKKC 4DV4C 5BSWA 4PZPA 2YWCA 3LAXA 3VNQA 1USPA 4RVOA 2VZEA 3B7WA 4L2ZA 2M5HA 2ZM6C 4RM3A 4BC9A 3IPLA 2HHHC 4EATA 3J81D 4PHTA 3UX3A 4B3SC 4LFAC 3I07A 3RV2A 4OXIA 2D28C 3IMLA 4K0BA 3E7XA 3ETOA 5KYTA 3DLPX 2ONFA 4D57A 2VQEC 4LF5C 2NCLA 3K6RA 1UKKA 4X65C 1N33C 3UZ0A 1LQLA 5T8TA 2M5OA 5DV9A 4PUHA 5BSUA 1HR0C 5KEIA 5T8SA 4LFBC 1ZB8A 3IEUA 4PUIA 2KZ0A 2D1QA 4JM1A 4FUTA 4DUZC 1UWDA 2QVXX 2E7GA 4JI3C 5BUSA 3CQ1A 2Z51A 1FUGA 3CW8X 2UUAC 3AF6A 3PBKA 1O92A 5BSRA 5A2QD 4DCSA 2P2JA 1BA3A 1MXBA 3T1YC 1FLOA 3CW9A 4BCAA 2OBVA 4DR3C 1QWIA 4DR2C 4LF7C 2OPLB 5A19A 1ML8A 3TDEA 4DUYC 3A9VA 4DV0C 4OYCA 1WCJA 5LCIA 3L8CA 1XNQC 4BBYA 3KXWA 2V7BA 1J5EC 1FJGC 4DR6C 4RMNA 5ADZA 2HJGA 3LGXA 4LF4C 4KTTA 4B3MC 5AE2A 1PA4A 3EERA 1NYEA 3A9UA 5IT9D 4DR7C 3CQ3A 2BH1X 1PG4A 2KZFA 1MD9A 1N32C 2ATWA 1XMOC 1T5HX 1P4EA 3L95X 2D7VA 2UXDC 2ZZMA 1P7LA 1IBKC 2DHMA 4DV5C 2XR1A 4LF6C 2P2FA 1ULTA 1M6XA 4FUQA 1HNZC 4LE5A 4NOZA 3ETCA 2MCQA 3AY0A 2CXCA 4NXNC 1QM4A 3VNSA 4I9GA 2E0GA 4DV6C 1XHJA 4LF9C 4B3TC 1V26A 1WF3A 3FCEA 4BC7A 5K85A 5AE1A 1IBLC 4L4QA 3R9WA 3TUFA 4JI0C 4JI7C 1O9TA 5FLXD 2AYAA 5BSTA 3T1HC 1XRBA 4R0MA 1MKYA 4DV1C 1EGAA 4YHHC 4DR5C 4DCUA 4DCTA 4RM2A 4JI8C 4D4GA 2ASBA 1PG3A 2D27A 2E8EA 4FTFA 2UU9C 4JV5C 3GR0A 4ZLPA 3A25A 4LFCC 4GXQA 5LMNC 2E8CA 1LCIA 1XMQC 4DCVA 4ISBA 1V25A 5LMUC 2OO4A 5IFIA 3AF5A 1XS3A 1HNWC 1USPB 4GS5A 4WS9A 1VEHA 1O90A 4D4IA 2E8FA 3UX2A 1N2FA 5CZXA 1MDBA 3LUSA 3UOWA 4BSZA 2UUBC 3EQ6A 3LNVA 5K8FA 3E7WA 1NY8A 4L7IA 1RY2A 1VLAA 3LNOA 3IEVA 2OPLA 2MM9A 2P2BA 4DV7C 2PROA 5BSVA 4HPVA 3NYQA 4RVNA 2P2QA 4R1MA 4LF8C 3PESA 4DG8A 4JI6C 4RLQA 3VNRA 2D1RA 2UUCC 2UXCC 1ZB9A 2Y27A 3DHVA 3GPCA 4XX2A 1HNXC 4X62C 3GKUA 4NDNA 3C5EA 3I08A 2P02A 4GKJC 3OTOC 1TH5A 4AQYC 2YWBA 2F4VC 5JRHA 3R44A 4IZ6A 4G1IA 2JMPA 2Y4NA 4I9FA 2ZZNA 3NPDA 4U5YD 4DV3C 4K0KC 4PROC 2WP0C 4TPSB 3A4IA 3S82A 2BJOA 5BURA 1JOSA 4X66C 2DPLA 3R9XA 3O2EA 3TQIA 2WD9A 4D56A 1XNRC 2UXBC 3FCCA 1T5DX 1M6XC 5CZVA 3N2QA 4DG9A 2QVZX 5KYVA 1RG9A 2CY1A 4OX9C 4MH4A 2VQFC 5AE3A 4JI2C 5BSMA 4X64C 5E7QA 3N54B 2CU6A 2D1SA 4DV2C 4ODJA 4ZJZA 4KHPC 2P20A 4PUGA 1L2FA 3CQ2A 5BR8C 4RLFA 3UEBA 5GTDA 1GPMA 1N36C 1V60A 1MXCA 1WH9A 3A26A 4NXMC 1O93A 4G36A 2DYJA 4YY3C 1IBMC 2EGTA 3CJEA 1XRAA 5A1IA 4JI1C 2YX1A 3J80D 4GXRA 2E5LC 4DR4C 3TR3A 1HH2P 2PN2A 4G37A 4B3RC 2YCBA 4IR7A 2MMAB 2KDNA 1IB8A 1YJ7A 3GR1A 2D1TA 3PROC 2QW0X 3RG2A 5IWAC 4JI4C 3DAYA 3JAMD 1MDFA 3NYRA 4R1LA 1AMUA 1KKGA 1MXAA 2VSQA 4DR1C 3SO4A 1I94C 2Y4OA 2JNVA 4JI5C
chains in the Genus database with same CATH topology
4KTVA 2QL8A 3H2TA 5H9UA 4JYAC 3NI2A 2QVYX 3G7SA 2P2MA 1N34C 4MTNA 5A1GA 5BUQA 1K0RA 2PT7G 1XRCA 4WV3A 4GKKC 4DV4C 5BSWA 4PZPA 2YWCA 3LAXA 3VNQA 1USPA 4RVOA 2VZEA 3B7WA 4L2ZA 2ZM6C 4RM3A 4BC9A 3IPLA 2HHHC 4EATA 3J81D 4PHTA 4B3SC 4LFAC 3I07A 3RV2A 4OXIA 2D28C 3IMLA 4K0BA 3E7XA 3ETOA 5KYTA 3DLPX 2ONFA 4D57A 2VQEC 4LF5C 1UKKA 4X65C 1N33C 3UZ0A 1LQLA 5T8TA 5DV9A 5BSUA 1HR0C 5KEIA 5T8SA 4LFBC 1ZB8A 3IEUA 2D1QA 4JM1A 4FUTA 4DUZC 2QVXX 2E7GA 4JI3C 5BUSA 1FUGA 3CW8X 2UUAC 3AF6A 3PBKA 1O92A 5BSRA 5A2QD 4DCSA 2P2JA 1BA3A 1MXBA 3T1YC 3CW9A 4BCAA 2OBVA 4DR3C 1QWIA 4DR2C 4LF7C 2OPLB 5A19A 1ML8A 3TDEA 4DUYC 3A9VA 4DV0C 4OYCA 3L8CA 1XNQC 4BBYA 3KXWA 2V7BA 1J5EC 1FJGC 4DR6C 4RMNA 5ADZA 2HJGA 3LGXA 4LF4C 4KTTA 4B3MC 5AE2A 1PA4A 3EERA 1NYEA 3A9UA 5IT9D 4DR7C 2BH1X 1PG4A 2KZFA 1MD9A 1N32C 2ATWA 1XMOC 1T5HX 3L95X 2D7VA 2UXDC 1P7LA 1IBKC 4DV5C 2XR1A 4LF6C 2P2FA 1ULTA 1HNZC 4FUQA 4LE5A 4NOZA 3ETCA 2CXCA 4NXNC 1QM4A 3VNSA 4I9GA 2E0GA 4DV6C 4LF9C 4B3TC 1V26A 1WF3A 3FCEA 4BC7A 5K85A 5AE1A 1IBLC 4L4QA 3R9WA 3TUFA 4JI0C 4JI7C 1O9TA 5FLXD 2AYAA 3T1HC 5BSTA 1XRBA 4R0MA 1MKYA 4DV1C 1EGAA 4YHHC 4DR5C 4DCUA 4DCTA 4RM2A 4JI8C 4D4GA 2ASBA 1PG3A 2D27A 2E8EA 4FTFA 2UU9C 4JV5C 3GR0A 4ZLPA 4LFCC 4GXQA 5LMNC 2E8CA 1LCIA 1XMQC 4DCVA 4ISBA 1V25A 5LMUC 2OO4A 5IFIA 3AF5A 1HNWC 1USPB 4GS5A 4WS9A 1O90A 4D4IA 2E8FA 1N2FA 5CZXA 1MDBA 3LUSA 3UOWA 4BSZA 2UUBC 3EQ6A 3LNVA 5K8FA 3E7WA 4L7IA 1RY2A 1VLAA 3IEVA 2OPLA 2P2BA 4DV7C 2PROA 5BSVA 4HPVA 3NYQA 4RVNA 2P2QA 4R1MA 4LF8C 3PESA 4DG8A 4JI6C 4RLQA 3VNRA 2D1RA 2UUCC 2UXCC 1ZB9A 2Y27A 3DHVA 3GPCA 4XX2A 1HNXC 4X62C 3GKUA 4NDNA 3C5EA 3I08A 2P02A 4GKJC 3OTOC 4AQYC 2YWBA 2F4VC 5JRHA 3R44A 4IZ6A 4G1IA 2JMPA 2Y4NA 4I9FA 3NPDA 4U5YD 4DV3C 4K0KC 4PROC 2WP0C 4TPSB 3A4IA 3S82A 2BJOA 5BURA 1JOSA 4X66C 2DPLA 3R9XA 3TQIA 2WD9A 4D56A 1XNRC 2UXBC 3FCCA 1T5DX 5CZVA 3N2QA 4DG9A 2QVZX 5KYVA 1RG9A 2CY1A 4OX9C 4MH4A 2VQFC 5AE3A 4JI2C 5BSMA 4X64C 5E7QA 3N54B 2D1SA 4DV2C 4ODJA 4ZJZA 4KHPC 2P20A 1L2FA 5BR8C 4RLFA 5GTDA 1GPMA 1N36C 1MXCA 1WH9A 4NXMC 1O93A 4G36A 2DYJA 4YY3C 1IBMC 2EGTA 3CJEA 1XRAA 5A1IA 4JI1C 3J80D 4GXRA 2E5LC 4DR4C 1HH2P 2PN2A 4G37A 4B3RC 2YCBA 4IR7A 1YJ7A 3GR1A 2D1TA 3PROC 2QW0X 3RG2A 5IWAC 4JI4C 3DAYA 3JAMD 1MDFA 3NYRA 4R1LA 1AMUA 1KKGA 1MXAA 2VSQA 4DR1C 3SO4A 1I94C 2Y4OA 4JI5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CW9 A;  2Y4N A;  4R0M A;  4U5Y D;  3NI2 A;  2QVY X;  3G7S A;  2P2M A;  4RM2 A;  3A9V A;  4D4G A;  5BUR A;  4OYC A;  3L8C A;  1PG3 A;  3KXW A;  2V7B A;  5BUQ A;  2WD9 A;  4D56 A;  4WV3 A;  3FCC A;  1T5D X;  4RMN A;  5BSW A;  4GXQ A;  4PZP A;  4DG9 A;  3LAX A;  3LGX A;  3VNQ A;  4RVO A;  2QVZ X;  1LCI A;  5KYV A;  2VZE A;  3B7W A;  4ISB A;  5IFI A;  5BSM A;  4RM3 A;  3A9U A;  3IPL A;  5E7Q A;  4EAT A;  4GS5 A;  2D1S A;  4D4I A;  1PG4 A;  4ZJZ A;  2P20 A;  1MD9 A;  4RLF A;  4OXI A;  5GTD A;  1MDB A;  1T5H X;  5JRH A;  4G36 A;  3EQ6 A;  3E7X A;  3LNV A;  5KYT A;  5K8F A;  3E7W A;  3DLP X;  4D57 A;  1RY2 A;  4GXR A;  2P2B A;  5DV9 A;  2P2F A;  1ULT A;  4FUQ A;  4G37 A;  5BSU A;  3ETC A;  5BSV A;  5KEI A;  4IR7 A;  3NYQ A;  1YJ7 A;  2D1Q A;  4FUT A;  4RVN A;  2P2Q A;  2D1T A;  4R1M A;  2QVX X;  4DG8 A;  2QW0 X;  4RLQ A;  3VNS A;  3RG2 A;  3VNR A;  2D1R A;  5BUS A;  2Y27 A;  3DHV A;  3DAY A;  3GPC A;  3CW8 X;  1MDF A;  3PBK A;  3FCE A;  5BSR A;  3NYR A;  4R1L A;  5K85 A;  3C5E A;  1AMU A;  2VSQ A;  2Y4O A;  2P2J A;  1BA3 A;  3R44 A;  5BST A;  4IZ6 A; 
#chains in the Genus database with same CATH topology
 1P4E C;  4KTV A;  2QL8 A;  3H2T A;  5H9U A;  4JYA C;  1PU1 A;  3NI2 A;  2QVY X;  3G7S A;  2P2M A;  1N34 C;  4MTN A;  5A1G A;  5BUQ A;  1K0R A;  2PT7 G;  1XRC A;  4WV3 A;  4GKK C;  4DV4 C;  5BSW A;  4PZP A;  2YWC A;  3LAX A;  3VNQ A;  1USP A;  4RVO A;  2VZE A;  3B7W A;  4L2Z A;  2M5H A;  2ZM6 C;  4RM3 A;  4BC9 A;  3IPL A;  2HHH C;  4EAT A;  3J81 D;  4PHT A;  3UX3 A;  4B3S C;  4LFA C;  3I07 A;  3RV2 A;  4OXI A;  2D28 C;  3IML A;  4K0B A;  3E7X A;  3ETO A;  5KYT A;  3DLP X;  2ONF A;  4D57 A;  2VQE C;  4LF5 C;  2NCL A;  3K6R A;  1UKK A;  4X65 C;  1N33 C;  3UZ0 A;  1LQL A;  5T8T A;  2M5O A;  5DV9 A;  4PUH A;  5BSU A;  1HR0 C;  5KEI A;  5T8S A;  4LFB C;  1ZB8 A;  3IEU A;  4PUI A;  2KZ0 A;  2D1Q A;  4JM1 A;  4FUT A;  4DUZ C;  1UWD A;  2QVX X;  2E7G A;  4JI3 C;  5BUS A;  3CQ1 A;  2Z51 A;  1FUG A;  3CW8 X;  2UUA C;  3AF6 A;  3PBK A;  1O92 A;  5BSR A;  5A2Q D;  4DCS A;  2P2J A;  1BA3 A;  1MXB A;  3T1Y C;  1FLO A;  3CW9 A;  4BCA A;  2OBV A;  4DR3 C;  1QWI A;  4DR2 C;  4LF7 C;  2OPL B;  5A19 A;  1ML8 A;  3TDE A;  4DUY C;  3A9V A;  4DV0 C;  4OYC A;  1WCJ A;  5LCI A;  3L8C A;  1XNQ C;  4BBY A;  3KXW A;  2V7B A;  1J5E C;  1FJG C;  4DR6 C;  4RMN A;  5ADZ A;  2HJG A;  3LGX A;  4LF4 C;  4KTT A;  4B3M C;  5AE2 A;  1PA4 A;  3EER A;  1NYE A;  3A9U A;  5IT9 D;  4DR7 C;  3CQ3 A;  2BH1 X;  1PG4 A;  2KZF A;  1MD9 A;  1N32 C;  2ATW A;  1XMO C;  1T5H X;  1P4E A;  3L95 X;  2D7V A;  2UXD C;  2ZZM A;  1P7L A;  1IBK C;  2DHM A;  4DV5 C;  2XR1 A;  4LF6 C;  2P2F A;  1ULT A;  1M6X A;  4FUQ A;  1HNZ C;  4LE5 A;  4NOZ A;  3ETC A;  2MCQ A;  3AY0 A;  2CXC A;  4NXN C;  1QM4 A;  3VNS A;  4I9G A;  2E0G A;  4DV6 C;  1XHJ A;  4LF9 C;  4B3T C;  1V26 A;  1WF3 A;  3FCE A;  4BC7 A;  5K85 A;  5AE1 A;  1IBL C;  4L4Q A;  3R9W A;  3TUF A;  4JI0 C;  4JI7 C;  1O9T A;  5FLX D;  2AYA A;  5BST A;  3T1H C;  1XRB A;  4R0M A;  1MKY A;  4DV1 C;  1EGA A;  4YHH C;  4DR5 C;  4DCU A;  4DCT A;  4RM2 A;  4JI8 C;  4D4G A;  2ASB A;  1PG3 A;  2D27 A;  2E8E A;  4FTF A;  2UU9 C;  4JV5 C;  3GR0 A;  4ZLP A;  3A25 A;  4LFC C;  4GXQ A;  5LMN C;  2E8C A;  1LCI A;  1XMQ C;  4DCV A;  4ISB A;  1V25 A;  5LMU C;  2OO4 A;  5IFI A;  3AF5 A;  1XS3 A;  1HNW C;  1USP B;  4GS5 A;  4WS9 A;  1VEH A;  1O90 A;  4D4I A;  2E8F A;  3UX2 A;  1N2F A;  5CZX A;  1MDB A;  3LUS A;  3UOW A;  4BSZ A;  2UUB C;  3EQ6 A;  3LNV A;  5K8F A;  3E7W A;  1NY8 A;  4L7I A;  1RY2 A;  1VLA A;  3LNO A;  3IEV A;  2OPL A;  2MM9 A;  2P2B A;  4DV7 C;  2PRO A;  5BSV A;  4HPV A;  3NYQ A;  4RVN A;  2P2Q A;  4R1M A;  4LF8 C;  3PES A;  4DG8 A;  4JI6 C;  4RLQ A;  3VNR A;  2D1R A;  2UUC C;  2UXC C;  1ZB9 A;  2Y27 A;  3DHV A;  3GPC A;  4XX2 A;  1HNX C;  4X62 C;  3GKU A;  4NDN A;  3C5E A;  3I08 A;  2P02 A;  4GKJ C;  3OTO C;  1TH5 A;  4AQY C;  2YWB A;  2F4V C;  5JRH A;  3R44 A;  4IZ6 A;  4G1I A;  2JMP A;  2Y4N A;  4I9F A;  2ZZN A;  3NPD A;  4U5Y D;  4DV3 C;  4K0K C;  4PRO C;  2WP0 C;  4TPS B;  3A4I A;  3S82 A;  2BJO A;  5BUR A;  1JOS A;  4X66 C;  2DPL A;  3R9X A;  3O2E A;  3TQI A;  2WD9 A;  4D56 A;  1XNR C;  2UXB C;  3FCC A;  1T5D X;  1M6X C;  5CZV A;  3N2Q A;  4DG9 A;  2QVZ X;  5KYV A;  1RG9 A;  2CY1 A;  4OX9 C;  4MH4 A;  2VQF C;  5AE3 A;  4JI2 C;  5BSM A;  4X64 C;  5E7Q A;  3N54 B;  2CU6 A;  2D1S A;  4DV2 C;  4ODJ A;  4ZJZ A;  4KHP C;  2P20 A;  4PUG A;  1L2F A;  3CQ2 A;  5BR8 C;  4RLF A;  3UEB A;  5GTD A;  1GPM A;  1N36 C;  1V60 A;  1MXC A;  1WH9 A;  3A26 A;  4NXM C;  1O93 A;  4G36 A;  2DYJ A;  4YY3 C;  1IBM C;  2EGT A;  3CJE A;  1XRA A;  5A1I A;  4JI1 C;  2YX1 A;  3J80 D;  4GXR A;  2E5L C;  4DR4 C;  3TR3 A;  1HH2 P;  2PN2 A;  4G37 A;  4B3R C;  2YCB A;  4IR7 A;  2MMA B;  2KDN A;  1IB8 A;  1YJ7 A;  3GR1 A;  2D1T A;  3PRO C;  2QW0 X;  3RG2 A;  5IWA C;  4JI4 C;  3DAY A;  3JAM D;  1MDF A;  3NYR A;  4R1L A;  1AMU A;  1KKG A;  1MXA A;  2VSQ A;  4DR1 C;  3SO4 A;  1I94 C;  2Y4O A;  2JNV A;  4JI5 C; 
#chains in the Genus database with same CATH homology
 4KTV A;  2QL8 A;  3H2T A;  5H9U A;  4JYA C;  3NI2 A;  2QVY X;  3G7S A;  2P2M A;  1N34 C;  4MTN A;  5A1G A;  5BUQ A;  1K0R A;  2PT7 G;  1XRC A;  4WV3 A;  4GKK C;  4DV4 C;  5BSW A;  4PZP A;  2YWC A;  3LAX A;  3VNQ A;  1USP A;  4RVO A;  2VZE A;  3B7W A;  4L2Z A;  2ZM6 C;  4RM3 A;  4BC9 A;  3IPL A;  2HHH C;  4EAT A;  3J81 D;  4PHT A;  4B3S C;  4LFA C;  3I07 A;  3RV2 A;  4OXI A;  2D28 C;  3IML A;  4K0B A;  3E7X A;  3ETO A;  5KYT A;  3DLP X;  2ONF A;  4D57 A;  2VQE C;  4LF5 C;  1UKK A;  4X65 C;  1N33 C;  3UZ0 A;  1LQL A;  5T8T A;  5DV9 A;  5BSU A;  1HR0 C;  5KEI A;  5T8S A;  4LFB C;  1ZB8 A;  3IEU A;  2D1Q A;  4JM1 A;  4FUT A;  4DUZ C;  2QVX X;  2E7G A;  4JI3 C;  5BUS A;  1FUG A;  3CW8 X;  2UUA C;  3AF6 A;  3PBK A;  1O92 A;  5BSR A;  5A2Q D;  4DCS A;  2P2J A;  1BA3 A;  1MXB A;  3T1Y C;  3CW9 A;  4BCA A;  2OBV A;  4DR3 C;  1QWI A;  4DR2 C;  4LF7 C;  2OPL B;  5A19 A;  1ML8 A;  3TDE A;  4DUY C;  3A9V A;  4DV0 C;  4OYC A;  3L8C A;  1XNQ C;  4BBY A;  3KXW A;  2V7B A;  1J5E C;  1FJG C;  4DR6 C;  4RMN A;  5ADZ A;  2HJG A;  3LGX A;  4LF4 C;  4KTT A;  4B3M C;  5AE2 A;  1PA4 A;  3EER A;  1NYE A;  3A9U A;  5IT9 D;  4DR7 C;  2BH1 X;  1PG4 A;  2KZF A;  1MD9 A;  1N32 C;  2ATW A;  1XMO C;  1T5H X;  3L95 X;  2D7V A;  2UXD C;  1P7L A;  1IBK C;  4DV5 C;  2XR1 A;  4LF6 C;  2P2F A;  1ULT A;  1HNZ C;  4FUQ A;  4LE5 A;  4NOZ A;  3ETC A;  2CXC A;  4NXN C;  1QM4 A;  3VNS A;  4I9G A;  2E0G A;  4DV6 C;  4LF9 C;  4B3T C;  1V26 A;  1WF3 A;  3FCE A;  4BC7 A;  5K85 A;  5AE1 A;  1IBL C;  4L4Q A;  3R9W A;  3TUF A;  4JI0 C;  4JI7 C;  1O9T A;  5FLX D;  2AYA A;  3T1H C;  5BST A;  1XRB A;  4R0M A;  1MKY A;  4DV1 C;  1EGA A;  4YHH C;  4DR5 C;  4DCU A;  4DCT A;  4RM2 A;  4JI8 C;  4D4G A;  2ASB A;  1PG3 A;  2D27 A;  2E8E A;  4FTF A;  2UU9 C;  4JV5 C;  3GR0 A;  4ZLP A;  4LFC C;  4GXQ A;  5LMN C;  2E8C A;  1LCI A;  1XMQ C;  4DCV A;  4ISB A;  1V25 A;  5LMU C;  2OO4 A;  5IFI A;  3AF5 A;  1HNW C;  1USP B;  4GS5 A;  4WS9 A;  1O90 A;  4D4I A;  2E8F A;  1N2F A;  5CZX A;  1MDB A;  3LUS A;  3UOW A;  4BSZ A;  2UUB C;  3EQ6 A;  3LNV A;  5K8F A;  3E7W A;  4L7I A;  1RY2 A;  1VLA A;  3IEV A;  2OPL A;  2P2B A;  4DV7 C;  2PRO A;  5BSV A;  4HPV A;  3NYQ A;  4RVN A;  2P2Q A;  4R1M A;  4LF8 C;  3PES A;  4DG8 A;  4JI6 C;  4RLQ A;  3VNR A;  2D1R A;  2UUC C;  2UXC C;  1ZB9 A;  2Y27 A;  3DHV A;  3GPC A;  4XX2 A;  1HNX C;  4X62 C;  3GKU A;  4NDN A;  3C5E A;  3I08 A;  2P02 A;  4GKJ C;  3OTO C;  4AQY C;  2YWB A;  2F4V C;  5JRH A;  3R44 A;  4IZ6 A;  4G1I A;  2JMP A;  2Y4N A;  4I9F A;  3NPD A;  4U5Y D;  4DV3 C;  4K0K C;  4PRO C;  2WP0 C;  4TPS B;  3A4I A;  3S82 A;  2BJO A;  5BUR A;  1JOS A;  4X66 C;  2DPL A;  3R9X A;  3TQI A;  2WD9 A;  4D56 A;  1XNR C;  2UXB C;  3FCC A;  1T5D X;  5CZV A;  3N2Q A;  4DG9 A;  2QVZ X;  5KYV A;  1RG9 A;  2CY1 A;  4OX9 C;  4MH4 A;  2VQF C;  5AE3 A;  4JI2 C;  5BSM A;  4X64 C;  5E7Q A;  3N54 B;  2D1S A;  4DV2 C;  4ODJ A;  4ZJZ A;  4KHP C;  2P20 A;  1L2F A;  5BR8 C;  4RLF A;  5GTD A;  1GPM A;  1N36 C;  1MXC A;  1WH9 A;  4NXM C;  1O93 A;  4G36 A;  2DYJ A;  4YY3 C;  1IBM C;  2EGT A;  3CJE A;  1XRA A;  5A1I A;  4JI1 C;  3J80 D;  4GXR A;  2E5L C;  4DR4 C;  1HH2 P;  2PN2 A;  4G37 A;  4B3R C;  2YCB A;  4IR7 A;  1YJ7 A;  3GR1 A;  2D1T A;  3PRO C;  2QW0 X;  3RG2 A;  5IWA C;  4JI4 C;  3DAY A;  3JAM D;  1MDF A;  3NYR A;  4R1L A;  1AMU A;  1KKG A;  1MXA A;  2VSQ A;  4DR1 C;  3SO4 A;  1I94 C;  2Y4O A;  4JI5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...