2ZZNA

The complex structure of atrm5 and trnacys
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
336
structure length
336
Chain Sequence
b'MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0883
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
total genus 81
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zznA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zznA03
5ICEA 3LHDA 3M6WA 5FA5A 4MQ4A 2OO3A 5ERGB 4BP1A 5T64A 5LSAA 2PT9A 5K0GA 4KIGA 3FPGA 2AS0A 2VDVE 2UYOA 3A27A 5EZQA 5FULA 4HGYA 2QRVB 3HVHA 1KPGA 7MHTA 3BGVA 5EMLA 4DKJA 1NE2A 3JWIA 4XUDA 2PJDA 2P35A 4BP3A 1XJ5A 5GIOE 4BY9E 2ZBPA 3WSTA 1NBHA 1FP2A 3E8SA 4X63A 2EX4A 5EHIA 3EVDA 3BGDA 3KPYA 4A6DA 3U81A 4FSXA 3SX0A 3HVJA 5K0FA 1X1CA 4CTKA 2IBSA 2P41A 1RI3A 3DP7A 2O0LA 2ZSUA 3NW9A 3P97A 2G70A 4EK9A 1NV9A 3GJYA 3PVCA 4GOLD 5FQNA 8MHTA 3V8VA 2EFJA 2YXEA 3AWIA 2PWYA 3BKXA 3CKKA 3P9KA 5CVEA 5KS2A 3TMAA 3EVCA 4F86A 3FPEA 3LBYA 4RVGA 1FPQA 3R3HA 4RTOA 4RTNA 3P9NA 2B2CA 5KQRA 2ONYA 3NDJA 3PX3A 2YXLA 3CJTA 4PYMA 3JWGA 2GB4A 1WZNA 2YR0A 3HCFA 1D2CA 2V74B 3QV2A 3CBGA 5EMMA 2I7CA 1O9HA 4RTPA 5CVUA 1G55A 3M6UA 1INLA 3KHKA 5K0CA 5G02A 3TR6A 2ZW9A 5EOVA 5GINE 3FYDA 3THRA 3NWBA 5CCBA 3I64A 3OE5A 3SVZA 1VP3A 1EAMA 4GC5A 4XUCA 5FWDA 4PYIA 5E1BA 4DCGA 4EQZA 5HIKA 1L9KA 3VSEA 3EEOA 1JSXA 4RVDA 1YZHA 2AVNA 1M0EA 4RV9A 3DUWA 3PB3A 2P40A 2C7RA 2FPOA 4PGHA 3Q87B 1WY7A 2NXCA 3G2OA 4R6XA 4AUKA 3EGEA 5CD1A 4YUVA 3HCDA 3B89A 4V0QA 3A4TA 1KR5A 2IDKA 3TM5A 1JG2A 1XDUA 3E05A 3OZSA 4U7TB 1YFJA 2BR3A 2PX2A 1JG4A 1AQIA 1T43A 2P8JA 2XYQA 2WA2A 3SSNA 3BT7A 3LL7A 5KYGA 3BUSA 3ELUA 2YX1A 2IH5A 3KPJA 2VP3A 3IHTA 1NW8A 3UJ8A 3HP7A 3VYWA 3M70A 3O7WA 3R24A 2PVCA 3EGIA 5DRTA 4P7GA 3UA4A 5DM4A 4PNEA 4DM3A 5K03A 2KW5A 5EIFA 3GNLA 3I9FA 2JH8A 2ZBQA 4PYOA 5DLYA 2O05A 4YMGA 1R8XA 3GRUA 4R8RA 5E8RA 2H11A 4GOMD 3X0DA 4EKGA 2ESRA 3AY0A 3FUWA 2CKDA 4HGZA 5EG5A 2AOUB 5DSTA 5LQCA 2UYCA 2Y1WA 3LKDA 3ME5A 5LQRA 4X61A 3LDFA 4GUAA 5EMKA 3ELWA 4FSDA 4DF3A 1EQAA 2G8NA 3I5UA 4GOND 4XCXA 4HH4A 3A25A 3BWCA 1KPHA 4RTLA 1JQDA 3G5TA 4PIPA 3FUTA 3OU6A 4DCMA 3EVFA 4POOA 4QVGA 3OE4A 4E70A 3FUUA 3DLCA 5IKMA 3G2QA 3OU7A 2LD4A 4OQEA 2ZIGA 4R05A 5CVJA 3BGIA 3GRRA 3KKZA 1N7JA 5GP1A 3P8ZA 5K0LA 3THSA 3MQ2A 5EZSA 1ZGJA 3CGGA 3DTNA 4AZTA 4E30A 5JUWA 3LSTA 2UZ4A 5EVJA 2ZTHA 1JQ3A 2EJTA 3M6XA 3R6TA 1PRYA 4KWCA 4M7RA 5C1IA 5CCXA 1DCTA 2NXEA 5MHTA 2IBTA 2YXDA 2AN5A 2O57A 3LCVB 3GIWA 4OQDA 4E2YA 1SUIA 3GRVA 3LBFA 4H0NA 4PCAA 5FHQA 3TKAA 3TLJA 3UJBA 5KQSA 4RTRA 2UYHA 1YF3A 1WG8A 4GEKA 4HSGA 2OY0A 2ZBRA 4LWOA 3IEIA 4X1OA 1Y8CA 2PT6A 3P2KA 4UOEA 4YUZA 2NNWB 3DH0A 1VBFA 1VPTA 1EJ0A 3FRHA 2PBFA 3DXXA 5FTWA 4YMHA 1KXZA 2IH4A 1DUSA 2HWKA 3L8DA 4RVHA 1VE3A 5HIIA 3UJ6A 3DXZA 1SKMA 3NMUF 2P3LA 3TM4A 4MWZA 4HG2A 1D2HA 2OPBA 4GOOD 1RI2A 4IKPA 2IGTA 4L7VA 4QPPA 4XUEA 4E2WA 2NP7A 1KIAA 1KPIA 3EVAA 3LCCA 1I4WA 3NVKI 1X19A 3EGVA 3EVZA 1D2GA 3MAGA 5DWQA 4AX8A 5ICGA 2ADMA 3JWJA 3EVEA 1AF7A 1R6AA 2AOWA 3A26A 1XVAA 4HTFB 4OBWA 5E2BA 5F2OA 4DMGA 2JHCA 2P3QA 2E5WA 3A7EA 5HFJA 3KQVA 5T67A 3HCEA 1HMYA 2I6GA 5GM1A 2QY6A 1P1CA 5EHGA 5GOZA 5H02A 2Y1XA 5ICFA 3E23A 5LQAA 1WS6A 1Q0SA 2BM8A 2Z6UA 1L3BA 2B25A 4QQNA 5FA8A 2B3TA 5FQOA 5LQJA 4RVFA 1YFLA 2ZZMA 2AN3A 3DXYA 3FPJA 2HNKA 3FYCA 3RW9A 2YTZA 3OFKA 2AVDA 2UYQA 3A7DA 4LG1A 4JXJA 3SXJA 4PONA 4OX9Y 5LR6A 5GWXA 3C0KA 1M6YA 3KQYA 2R3SA 1VP9A 1RJFA 3NTVA 3T7TA 3UFBA 1NW5A 1FP1D 4CKEA 5EGSA 1U2ZA 1I1NA 3BWMA 3C3YA 4EKIA 3VC2A 5FHRA 2XBMA 1RI1A 1VLMA 3P2IA 4C03A 4CWAA 4CKCA 1FBNA 3UJCA 4NECA 1XDSA 2V7EA 5DM2A 5EIWA 1YB2A 2PLWA 4PIMA 4LECA 4RTSA 2C7QA 1JR4A 2P1DA 4HC4A 3G88A 2JHAA 5HZMA 2PY6A 2QRVA 2FYTA 3AXSA 1AQJA 3UJ9A 4ISCA 1VIDA 3O31A 3PFGA 2Q41A 3G7UA 1NW3A 4FT2A 3ER9A 3MTIA 2HR1A 4C07A 3TRKA 2PKWA 4RYLA 1N2XA 4OA8A 4KVZA 2QM3A 3TFWA 2DULA 4FT4A 4WVLA 4ATNA 2N47A 5U4XA 3TPZA 5ICCA 3G5LA 1JG3A 3FPHA 1G8AA 4KDRA 3C6MA 1TW3A 2PGXA 1BOOA 3ANXA 2VZ9A 3BXOA 3EEYA 4YUXA 3AXTA 3HTXA 3NDIA 3G2MA 1XXLA 3HA5A 3Q7EA 5EC8A 3HVIA 1M6EX 5FADA 3HA7A 1R18A 2GPYA 1VL5A 3OZRA 4BLVA 3LKZA 4Y2HA 1JQEA 4ER3A 2AOVA 3ELDA 5E2AA 4CKBA 1RI4A 2BR5A 1ZGAA 3LPMA 4ER5A 4R8SA 2ZLBA 2NXNA 3ER8A 3MGGA 1SQGA 5K0NA 4DZRA 3PTAA 3HVKA 4FP9A 1QYRA 1X1AA 5D1HA 2ORED 2WA1A 2Z6QA 4X41A 4F84A 3GCZA 1XTPA 3HEMA 3D2LA 4YV1A 3GRYA 3PFHA 5DRYA 5K0BA 3DULA 2AOTB 3ELYA 1BHJA 3ID6C 4M37A 5DM1A 2ZCJA 2CMHA 5DXJA 2ZIEA 3ORHA 5DM0A 2BZGA 1O54A 1SUSA 2PWPA 4C04A 3HM2A 3QOXA 1KP9A 4PYQA 4E2ZA 1Z3CA 3O4FA 2ZVJA 2FK7A 4GC9A 1O9GA 1QAQA 4AZWA 3NVMB 4QPNA 3UWPA 5E1MA 3HCAA 3SSOA 1NV8A 3KQSA 5E9QA 4AZSA 3UBTA 1JTEA 3EPPA 5EEHA 5BP7A 4YUWA 1B42A 3G8AA 4E31A 5HOQA 3F4KA 2QE6A 2XYRA 2B78A 5HIJA 5DXAA 4YUYA 1UIRA 2HTEA 2OXTA 2GS9A 5CIYA 2C7PA 4V0RA 2R6ZA 3MB5A 3E7PA 3EVGA 4OA5A 4P7FA 1AV6A 4PINA 3TOSA 4QDJA 2IPXA 3SSMA 3LDGA 3B3GA 3KQTA 3CCFA 1NBIA 3R9XB 2AZTA 5EKXA 2AOUA 1VQ1A 5GIPE 4FR0A 2GLUA 2JHPA 3SR4A 4QDKA 2IH2A 1P91A 3H2BA 3P2EA 1SQFA 2XYVA 3KR9A 1EG2A 4P7KA 1IY9A 3GGDA 3K0BA 3CC8A 3GU3A 1UWVA 4FS8A 4GBED 9MHTA 2PX5A 2BH2A 4YV2A 2ZWAA 1WXWA 4ER0A 3KR1A 1KYZA 3MHTA 1RJGA 1H1DA 2ZFUA 3VC1A 3DLIA 3HA3A 2H1RA 5FCDA 1DL5A 3FTCA 4GF5A 4U7PB 3B5IA 2CL5A 3MCTA 5F2NA 2NXJA 1I9GA 2JG3A 4KIFA 5CVVA 2JJQA 3GO4A 4R6WA 2PXCA 2VDWA 4GQBA 2ERCA 1ZQ9A 4FGZA 5CM2Z 2GH1A 2NYUA 3B3JA 2EJUA 1NKVA 3M6VA 5B1SA 2GA9A 2VDUE 4PCLA 5CUQA 3DMFA 5EKUA 4C06A 4DQ0A 3PLAE 1G6Q1 3HCBA 3T7RA 2AN4A 4E33A 2YVLA 5E1DA 5K05A 3NWEA 2VS1A 1G8SA 5EMJA 5KVAA 4QTUB 5K09A 2BM9A 3BWYA 3R0QA 5DTMA 1SG9A 2OB2A 3T7SA 3UJ7A 4C4AA 3FZGA 5P8WA 4BLWA 3MTEA 2HMYB 3B7PA 1ZHFA 3PX2A 3IV6A 5CVDA 1WXXA 3IYLW 1QZZA 5IH3A 3HNRA 1SVUA 4QTTB 3MCZA 3DR5A 4ER6A 3KQPA 4KDCA 4PWYA 4C08A 5JR3A 4B17A 4CXMA 5HILA 3SGLA 3KR2A 1IM8A 3V97A 4P7JA 4HTFA 3G8BA 5DPMA 3NJRA 1P39A 3G89A 1XDZA 4RWZA 1UFKA 3LECA 4PYJA 4RTMA 3TKYA 1F3LA 2GAFA 2IIPA 4WXHA 2PXXA 4RX1A 1FJXA 1NT2A 1F38A 3RIEA 4F85A 2O07A 2DPMA 3REOA 4MIKA 3KQMA 3OCJA 1TPYA 3S68A 3I53A 1ZG3A 5HEKA 1X1DA 2FK8A 3T0IA 1JSZA 4KW7A 2ZZNA 1TW2A 3OZTA 1Q0TA 1X1BA 1YZ3A 3FRIA 2QYOA 3FTEA 2G71A 3KU1A 4M38A 3SM3A 3GWZA 5K01A 3BWBA 4DA4A 1QAOA 4RSRA 2PX4A 1P1BA 2OB1A 3P71T 2PV0A 3OFJA 5DT2A 5C9ZA 3OPNA 1ORIA 2I62A 4CTJA 3EMDA 2I9KA 4MHTA 2A14A 1N7IA 4K6MA 1OR8A 2YQZA 3KPUA 1R00A 4YV0A 4EVIA 3FTFA 3EVBA 1ZKDA 2PXAA 1RJDA 3C6KA 3CJRA 3RODA 3M33A 3GXOA 1R8YA 1BKYA 3BZBA 4RTKA 2OZVA 5DSXA 3GRZA 5GM2A 5DX0A 3FUXA 5T6BA 1KHHA 3KQOA 1JTFA 2C7OA 2AR0A 4IV8A 1L3CA 2G72A 3KQQA 4M36A 4PYLA 2JH9A 5K8VA 3FUVA 2B9EA 2OKCA 5DTQA 4AZVA 3MERA 5EQJB 2Z6AA 10MHA 5E1OA 5DX1A 2XVAA 5E9JA 5FWAA 2H00A 3LDUA 2FRXA 1NW6A 1JG1A 3OU2A 3KQWA 3CJQA 2EG5A 2ZIFA 1RJEA 1QANA 4QVKA 5K0JA 1QAMA 2OBFA 3P9IA 3B3FA 3QOWA 2CWWA 2P7IA 5EPEA 4ZTBA 4E2XA 2XVMA 5LQUA 1YUBA 5LQKA 3BKWA 1G60A 1XCJA 2YUIA 1MJFA 2ONZA 2IFTA 3PS9A 4Z2YA 5E8JA 1XCLA 2CMGA 4ER7A 4MTLA 5M5BA 4G56A 2PSSA 5HIMA 2P7HA 4PGGA 1R74A 3LX6A 4IWNA 5BW4A 1PJZA 1RI5A 2FHPA 3UZUA 5BW5A 2IP2A 3CVOA 3JWHA 3LGAA 5E9WA 3SMQA 3DOUA 2BR4A 2O06A 2WK1A 2ZWVA 3KPVA 2AOTA 4HRAA 4IV0A 4RTQA 4RTJA 3KR0A 1L3IA 3UJDA 1ORHA 1NW7A 3DMGA 4A6EA 1IXKA 4EMSA 2K4MA 3C3PA 3P9CA 5C0OE 2OYRA 2P3OA 5FUBA 4OBXA 3AJDA 2PX8A 1G38A 2NP6A 1HNNA 3HCCA 1MHTA 3M4XA 4PYKA 4C05A 4LWPA 3DMHA 2FCAA 4BLUA 3K6RA 3I58A 1L1EA 2ZZKA 1KYWA 4E32A 3TQSA 4P58A 4FZVA 4QQKA 1V39A 4O29A 3FTDA 2AOXA 2HV9A 3G2PA 5K0EA 2F8LA 3LCUA 5DX8A 5F2KA 1BC5A 5EEGA 5BXYA 2ZULA 4KRGA 5LQNA 4Y30A 3UJAA 3EMBA 3ERCA 3FPFA 5D1NA 1EJ6A 1EIZA 2IDJA 3PT9A 3KPWA 4X60A 4PYNA 5DTRA 3UA3A 3GDHA 2G1PA
chains in the Genus database with same CATH superfamily
5JZ9A 2CJFA 4WCDA 2RKOA 4LYYA 3MOSA 1RQ7A 4NLLA 4EA9A 2NTYC 1PU1A 5EXXA 1XZLA 5DZ6A 3OD1A 3GVHA 5CA0F 3ZZZA 5HQ3B 1HYSB 3PQ6A 3FM9A 4MH8A 1KFKB 4GOLD 1TZJA 3Q8LA 1RT6B 3QVWA 2DBBA 3CW2A 2BUNA 4M98A 5HCNA 3HY6A 1XP8A 3EPJA 4R2IA 3WTCA 3AM4A 4F12A 1E2FA 3GBSA 4GPEA 2GNAA 4XYEA 1C3OB 1V7CA 2QUAA 3OICA 2PUCA 2R0QC 2G5GX 3TYXA 3C70A 1SULA 1AMNA 1EUDB 3DPSA 5COBA 2DUNA 1YV9A 4EW2A 4RJVA 1NWHA 3QEBZ 3O8WA 4F2GA 1KR5A 3KOXA 5B1HA 3SE0A 3Q5EA 4MW5A 3W2WA 4CR8A 2R5WA 2R4UA 3SCKE 4D9BA 1F9EA 1L4LA 3JPWA 1F6BA 3LP0A 3TRDA 1X8LA 2XRMA 3BL6A 4H7KA 3AL0C 3KE9A 3VPCA 3S7ZA 1V11A 4G0XA 4JDPA 1OJ7A 2G2YA 4TRJA 4R05A 4OHFA 4Y6QA 2ID8A 3QG5A 4B74A 4FKMA 2B7CA 1D2AA 1W6RA 5IT5A 4BO0A 4E5SA 2JCXA 1Y3FE 4AYBD 4B9AA 1SZPA 1T9GS 3FRHA 2PBFA 3FR8A 2ON6A 3ISTA 2QG9A 2ACWA 3ZI7A 4IWXA 3OCCA 3PLNA 4MI9A 4ID8A 4E21A 4TZ0A 4OGLA 5G0SA 5LOVB 1QVAA 1IUJA 1U1FA 1ZN9A 3JARB 4A27A 5ARBA 1KZHA 4U7UD 1P75A 3WX4A 5EUMA 3C3MA 1ZD8A 3KG2A 4ZYZA 3CV3A 3M1IA 5D87A 4LG1A 3BHNA 2BN4A 3KKOA 2XRZA 3OOWA 3FDJA 5ESWA 1QAJA 2R6DA 4WN3A 2PH1A 2LCWA 5JG7A 3ND6A 3FSRA 2FSFA 3DDWA 3BXFA 2BBSA 3NHMA 1F5SA 5T8TA 1Z5GA 5ED4A 3CNLA 1FVQA 2WDPA 4KDRA 4H4OA 4JI1B 2NXWA 3PW2A 1R18A 3MI7X 2JK0A 1M5OC 2VJUA 4PSDA 3BFXA 1P9YA 4X4QA 2L18A 1IXZA 1R5NA 4WT7A 1ZYQA 4W5RA 3RRXA 3RVJA 2D13A 2WSCC 2C8JA 1E9BA 2HS0A 2QS9A 1SPBS 2HYDA 3TUJC 3DV2A 2GPTA 3UAYA 3SKVA 3CUKA 2J3DA 3MECA 1ZICA 1AMOA 4V0RA 3OEWA 4DV1F 3IBFA 1PR5A 3USCS 2C2NA 1MC8A 1VFPA 3T3MB 2H08A 2WG2A 1WC0A 4UJ5A 4P7KA 4OAPA 4BLPA 4DSZA 4LF1A 1DY3A 4EGJA 2UUWA 2REQB 4WEQA 3HCRA 2D2FA 1N6RA 4ALLA 2NSDA 3VR4A 1PGNA 1SVNA 2ZRKA 4MHOA 2B6AB 4D3HA 3E5NA 4OX6A 2EDAA 2CG4A 4JOSA 2WU1A 2YQ0A 1RLJA 1JNYA 4YHHB 3NJ4A 1K68A 3PVZA 2JF0A 4UOZA 1W47A 1M7GA 3SHQA 1MEJA 2C2RA 3EWGA 1K8XB 2VUTA 3IC1A 1IM8A 1C3VA 2DGTA 3D3BJ 3VA7A 2YWDA 1I6WA 3DAYA 4NE9C 4F85A 2DKFA 3DM2A 4TPSB 3BWVA 2XJ4A 4J9KA 4RKYA 2FQQA 1GYPA 3KJQA 3VAKA 3PQCA 4UHJA 4QRDA 4E13A 4ISBA 1W88A 3HL4A 1I2MA 4BV8A 4AYWA 5IANA 1ZMXA 1W1UA 3MJVA 3QKSB 2VHUA 1QAYA 4WLUA 5KJCA 1TEHA 1XQIA 1L3CA 3A6LA 5DTQA 2X13A 1UZHA 5BORA 5EJ2A 4FNHA 2FQYA 3OZIA 2HWHA 3HMQA 2PKCA 2C54A 3OPKA 4IOJA 1KP3A 3ZV5A 3FQKA 4CF6A 4J1TC 1XZ8A 4A6XA 4NFLA 5FAXA 2DEIA 1Z2EA 4L07A 1H2AS 1SOVA 4URHA 3HKEA 3PUKA 4U7FA 3GFXA 4JGGA 3JALB 3ZE7A 5C80A 2Q6OA 1XDDA 3M4XA 3C6UA 2CNKB 4NBUA 1UPPA 2F3RA 3QELA 2A6OA 4NMWA 3UMMA 2F63A 2HQFA 5F8NA 3MFYA 1SKQA 3LRPA 2DNRA 3T3PB 4XDHA 3ZJUA 2ZE2A 4LMAA 1IQUA 2DSNA 4PLPA 3LXRA 1P0QA 3QIVA 1T8EA 3L6RA 1J6UA 3OLAA 2NQ8A 2I7DA 1WMSA 3K72B 3QVJA 3K32A 1IBMC 1X9MA 3HEAA 1E63A 1SKRA 3MJHA 3AONB 3FXAA 3HB0A 3VTAA 2BANB 4P4UA 3LF2A 2ZG6A 1H2VZ 3F6RA 1IZ7A 2QVZX 1RNLA 5BR4A 4IDAA 2WF5A 2WFAA 2KJWA 2UZIR 4RCVA 4Z99A 2IIVA 5HL7Q 4PF1A 3DUWA 1H8ED 2HMAA 4KZKA 3PEWA 2CQ4A 3JQKA 4BVJA 4TKVA 4MCHA 1T3OA 4L72B 5BRNA 1QIKA 3D3NA 1EJBA 4O44B 4IDHA 3KYCB 1RADB 4YJ2F 2C3UA 1XP5A 2ESRA 4O5AA 5HQMA 1K3UB 3HZOA 4YR2A 4IDDA 3NIFB 1X9SA 1T0IA 5L1KA 3SOZA 1LFWA 3WGTA 3GRRA 3NRJA 1GUZA 3VNAA 3T1YB 3DTNA 2GM9A 4DLBA 2VDWB 1IBLF 3QSYB 2WJGA 3MVEA 2EATA 3W62A 3KEFA 4EFNA 3IIJA 3PRYA 4OX8A 3TZZA 4R8VA 2W2PP 1V48A 1T6BY 3UJHA 3OTHA 4RW6A 1GMVA 2P3SA 4WYLA 4HGNA 5DLQC 2UZ1A 3MHPA 3S1SA 1OD6A 3PRHA 4FILA 1G5HA 1SCJA 4LRSB 1R6YA 2ZAIA 1SJFA 1LEOA 5IXSA 4MQ5A 5HROB 4LGMA 5FHRA 2JFGA 1P5RA 4CYMA 2ZIUB 5BWBA 1SQ6A 2WABA 3SWWA 2VJYA 4JQYA 1EFRA 1TK2A 1DAEA 1Z2AA 1Y5LA 3LOQA 3IMFA 1AN0A 2RRBA 5E5NA 5LLSA 1V3RA 2Q6KA 4FLFA 4JBHA 5SZJA 3MS2A 3A8JA 3LWZA 1WSBA 2H1LA 3IAUA 1TA0A 4DLZA 2AFIA 1XD9A 5FADA 2W37A 3HPQA 1PG5A 4KHRA 3EXHB 2PGNA 1A50B 2FFAA 5HF9A 3TN7A 4EZIA 1KEVA 1T5TA 5DDOC 2WRMA 1LDYA 1R15A 1UMBB 3CDUA 4Y2SA 1QGZA 1X1SA 1ISJA 4DDKA 4AMGA 3NCRA 2X9GA 1QRAA 1SVMA 1YL5A 2FC8A 1X5OA 1B8VA 1CEZA 1N6HA 1FDSA 3NG1A 3LPDA 1UFVA 2ODAA 2IPXA 4WQMA 2PD3A 5IFMA 5MAOA 5ITZA 3A13A 1NPYA 2GUWA 2B4VA 4DUZC 2IZZA 1CYEA 4R9NA 5AUOB 4EEKA 4B6EA 5J4YA 3UNXA 2P9QA 3RHZA 2CE7A 4AQYB 2VJMB 1QVGR 1Q95A 4YVFA 3C3AA 1A8SA 5AH0A 3ZWMA 2CQ2A 1MJHA 3ICOA 1TA9A 5CXXA 2HI0A 4FHZA 1JIVA 2BMEA 4X44A 4BX2A 1H1LB 5AM5A 4O2RA 5AW2A 1JH9A 4HQNA 4DDMA 2G3YA 2VN8A 4CM8B 1NMQA 4CO5A 1NG9A 2GJ8A 3OVBA 2CMDA 1E2PA 3RUIA 1TPYA 2OAGA 3JSXA 1VIYA 5H9FK 1T5IA 4FN5A 2Y4OA 2QZSA 4O3PA 5TMEA 1WC1A 3R0XA 4QO8A 1Z0UA 2JVRA 2LCQA 2OBVA 4YRDA 2HBQA 3PNPA 1NXPA 5L53A 5DSXA 4HOYA 3EGDB 1KOFA 3ESZA 1IOLA 1LX7A 3NCPA 1DAMA 1PAUA 3SHFA 4LMRA 4LYAA 2XHZA 5FWAA 4JB2A 1ZS6A 1DKRA 1KYVA 1QHXA 3D6AA 3IQEA 5IC5A 1RISA 4LVNP 4KHPB 3UMFA 2JW5A 4DSAA 3SU8A 1WVMA 3RQSA 5JFOA 4W6QA 3QJPA 2P2BA 5ALXA 2BJ8A 1QLNA 4L57A 2WF6A 3RYFA 1PE0A 4WZAB 4AUNA 4NE7A 4INJA 2YN0A 1S76D 2EL9A 3LY8A 1H2HA 2JLXA 1V4BA 1E7YA 3KALA 1AU9A 3ZVLA 1KKMA 3IO3A 3E8SA 4E1VA 3Q8KA 3ECCA 3AR8A 3NAZA 4WOJA 1YA6A 3ZZPA 4GLBA 4B82A 1KEEA 2V9KA 3QIPA 2ODQA 3NDJA 4OUDA 3DKPA 3A70A 3X1DA 2GJAA 5ALTA 1XMVA 1HE2A 2GI4A 3ZHVA 3QLVA 3ZPXA 4AG3A 4LR8A 3RD5A 1BD3A 4KHMA 3ZZRA 3N28A 3C3BA 2BQRA 1KO4A 2E5IA 4QDXA 5KFOA 3KV3O 2WJAA 3QKRA 4NJEA 2KHZA 2HSEB 5AJ3J 1K66A 4EGSA 4EHDA 4MPDA 4TY9A 4WPGA 3IFSA 3UD4P 1W2GA 2Y4NA 2A7XA 4PN3A 4X4UA 4RA6A 2ZYDA 4OFXA 2YRXA 1M1XB 1QTIA 3G2KA 3BSOA 1LZKA 5EVJA 3R6LB 3VR5D 5KSPA 1C1BA 3KDOA 4WZBE 1JB1A 2C2XA 3ZW9A 4DGSA 2IITA 1BU8A 2QAGB 1QDUA 2VNHA 3MCAA 4X3CA 4YYZA 1KMMA 3AUKA 4LW8A 4EYSA 3LP1A 1U1KA 3LCJA 2ZRDA 3F71A 2A5YB 2FOXA 2NMVA 1Q4RA 4A3SA 3K4PA 1OSNA 3JS5A 3R3UA 5EIOA 1UPUA 5FQOA 4WPAA 4B4DA 4LJ9A 3BXEA 2C5AA 4WK3A 2CQDA 3HV2A 2ZTSA 2LXUA 2CSUA 2G7MC 5HN0A 3EFOB 4V1Ak 2DECA 1T05B 3F74A 4AD8A 1GT8A 5F8HA 1FL9A 3LAMA 3MCNA 4XDZA 3UPDA 4D8TA 1STOA 2E66A 1S01A 4Q7JB 2Y05A 3GH3A 2XVZA 2Q2OA 2EP8A 3V6HA 1EWYA 4GAEA 4EKDA 4U2FA 4WTYA 3NGUA 1FXWF 4DCPB 1XVUA 4DLSA 5DGAA 1JQEA 4OXIA 1TUBA 5KQPA 1FMCA 1E8NA 3EGWB 3MAHA 3NBYC 1JXVA 5DDQC 4BTLA 3ROPA 3SOPA 4WINA 1FQWA 4AG5A 2ECQA 1NY6A 3SZMA 3WMGA 3HCNA 1B4SA 3GRYA 1WMDA 3NHSA 3RUAA 4RELA 3DZIA 1E2MA 4BNLA 1EHYA 2XUAA 2LZ0A 1V8BA 5BMOA 5SZKB 1N6QB 1O97C 3GGPA 3EVGA 3C5HA 4JV2A 3DA8A 3A2NA 5K2MA 4J0JA 4OJKA 3K1JA 2YMPA 2E3JA 4J6FA 4FFOA 4PS0A 3GG0A 1NZFA 3D4BA 1N2SA 4TLDA 1WXWA 4HB0A 4CYUB 2PZMA 4RS4A 2RH3A 1XUOA 3HD1A 2QV0A 2FWPA 2NXJA 4S24A 4LPKA 4A5SA 1N3LA 1KO5A 2PXCA 3C24A 4IGFA 1PZFA 3B8EA 4JUBA 3DC7A 1M74A 4EF4A 1KA9H 2X4DA 1S6OA 1KR2A 5CFLA 3VH2A 3PFEA 1HKHA 4XLZA 4Y6IA 1ZO8A 4QWMA 4RSGA 3FG9A 1L8XA 5JCJD 1IBKF 2E5HA 3FZYA 1AT1A 4BJ3A 2IXAA 5AI9A 4M5GA 3TKYA 3K20A 3A1FA 2ZXEA 2VT6A 1AVTA 4TWJA 3KLPX 4RX1A 3OZWA 5I4CA 3SQOA 2C3OA 3IVCA 1BXRA 2VJAA 4EYKA 3IAM1 3AUYA 3QNUA 5FD8A 3BIFA 4OI0A 2E4ZA 3DFIA 2BLLA 3H5IA 2OB1A 1K4YA 2FCRA 2IZ1A 3TIGA 1H4SA 4U7CA 3QMMA 5L3SA 5DGXA 3AVPA 3K70B 2VQEF 2R86A 2C7OA 4GICA 1X3SA 3RW7A 2B9EA 4FCWA 1M6HA 3TAMB 2C4MA 4URSA 1AB8A 1KVSA 5FI1B 1FX0B 2PLNA 1CWUA 4NFHA 5J2QA 2HF7A 2CVPA 3WKCA 2OGZA 5H9UA 1TZKA 5JAIA 4NZ0A 5CYFA 5ESXA 3LVFO 3FSGA 3UZUA 1FWLA 1NHKL 1Z08A 3KKQA 3EQ9A 2ZDHA 4IL5A 5C0OE 4D7AA 4E3WA 1J8MF 1V6SA 4ZV7A 1U49A 3Q9SA 3H04A 4BO3A 4YA6A 3KO8A 4LMZA 3EUAA 3TSYA 3T3DA 1SKSA 5KFNA 2ZH7A 2PH3A 2UUBC 3Q6MA 5EZ5A 4IOAQ 3C48A 2XUQA 3KK3B 1SPXA 3KUDA 1I4EB 1XRNA 3I72A 5JLAA 3BMOB 3DLKB 4CNBA 1JLGA 4ME6A 1ORDA 2GWRA 2C42A 1YE8A 4FSXA 1Y5MA 3KBBA 3SCLE 4M0UA 2F17A 3R0IA 3OA2A 3IDQA 1I7LA 3EAFA 1RBZA 1BH6A 1GCUA 2Q3EA 3OP1A 3FTQA 2YBEA 3T4EA 2X41A 2ZR7A 3KB8A 1U8AA 4K0KF 1YJ9S 4IIVA 2W7OA 2FLLA 1HSZA 3I6QA 4GBGA 1T5SA 4WCFB 2NSCA 3KG4A 4C7QA 4YR0A 2K7ZA 3V8QA 1D09B 4RSHA 1A9ZA 2JFUA 2PQ2A 2C0QA 3VO8A 5B7QA 4CLXA 4IP0A 2AXQA 2F3UA 3RC8A 2OCLA 1G21B 2GCEA 4DV2F 2GYYA 1FW6A 5E3CA 1MVNA 1RKXA 3RU2A 5EI5A 3KCNA 1JDTA 2WA2A 2FPSA 2JGNA 2IH5A 3VYTB 4ARSA 1XMPA 2YJ3A 2AC2A 4C7KA 5K20B 3N6RA 2D62A 5U4QA 2WVHA 3LGHA 3DHNA 2Y77A 2IHVA 1U31A 3REFA 1VJWA 4RU1A 3FSJX 4BX8A 3M7IA 5G41A 3N0VA 5CCXA 2VXOA 1UK8A 1AIPA 2H18A 1ULAA 4EJSA 1P7CA 2PRJA 4R98A 2MHCA 5HQLA 1YK1A 5KMGA 1RA6A 4IW3B 3ZE2B 3RRFA 4ECXA 2PD4A 2C59A 4IKPA 3SFTA 1S79A 1R89A 3EGVA 1FNCA 1X0PA 2VXYA 4CMEA 3SLGA 5KFSA 4BFWA 2PI5A 2IW1A 3A36A 1XK8A 1OB2A 4FGSA 4CLRB 1F0KA 2X0IA 2DBVO 3ND8A 3R7WB 1WWHA 1ACLA 1RHUA 2V7QD 1MN7A 3KQYA 4C2MA 5IJ0B 5LNK6 4WXWA 4F46A 3VF0B 1P4HA 3CO9A 1NR1A 3MT9A 1W0KD 2FW7A 3RFTA 5IYZF 3OIFA 2M3DA 3R1IA 4FCCA 1UJCA 2YXNA 3KOWA 1XNQJ 5GJVC 1U45A 2W2MP 1U04A 2YKNA 2FPWA 5A3SA 3T35A 3LWLA 1JK9B 3IP6A 3LD9A 4OI4A 3WLIA 4M5DA 4GGOA 2DBRA 4Y2HA 1SUFA 1L7AA 1OOEA 1P4AA 3BSSA 3QWAA 1XJWB 1S8OA 2AJFE 5DFAA 2RG7A 2MKSA 4I7EA 4MV0A 4EGCB 3D3CJ 3CG0A 3NTUA 4KSYA 4LYHA 1QB7A 3O4FA 4C87A 1QAQA 1UBUS 4MGYR 4AZSA 1ZUWA 2J9YB 2GMLA 2ASJA 3OJXA 3KLEB 2GGPA 2FIUA 4UBMA 1RPZA 4MVJM 3MMXA 4C2AA 2A0FB 2YNMC 2XH8A 1GNSA 3TE6A 1NU4A 1TTHA 1X4GA 2EW9A 1ZN7A 1Z07A 4ZJOA 3DB1A 4GRSA 1NN5A 1TUGB 2HRCA 4KSCA 4PXCA 2ZFUA 3MLBA 3LTEA 2IU3A 3ZGOA 4PQUA 4I0WB 3UGKA 3ZJVA 3PGJA 3GLSA 4ZDIA 4EZ9A 1PT6A 4A8YA 4BXOB 4C4AA 3DBRA 2J4FA 4X64J 1OFHA 2VHWA 3F4LA 1I80A 1W5FA 4OREX 4EIWA 4U3JB 3EEIA 4DOZA 3KOUA 2PMWB 1H23A 1L8QA 1RJ9B 1Z6TA 3OXGA 1PBNA 2W2KA 1OFIA 4MINA 5I01A 3ACBA 4NASA 1RJJA 3C14C 4A8JB 1HNVA 3FJOA 1EK0A 5I4BA 2IJFA 1NB7A 1IKXB 4BWGA 1E5QA 5FYDA 3I2IA 1RJDA 4FK8A 4FZRA 4NRTA 1M2VB 1E5DA 3O2QB 3EDYA 3BEDA 2PL5A 10MHA 3BXPA 1Z45A 1R27A 1ICEA 3MFIA 3HJBA 2ZIFA 4FBMA 2L9NA 4WIIA 1FPMA 2BBEA 4I55F 3PJEA 4A48A 3FC9A 2HMIB 1K98A 3HKWA 3EJWA 4NCAA 1YNOA 2RHCA 5D5QA 1YRHA 4RIFA 1YS4A 1J33A 3MM9B 4I46A 3R7BB 3QYYA 8AT1B 2HHCA 4ZZIA 1GTMA 4YLEA 1NAHA 5KYYA 2J3LA 9GPBA 1YRTA 3AU8A 3FEXB 1SZDA 1ECPA 2LKDA 3ES9A 1F2TB 2Z43A 2XZOA 1SVWA 3M6WA 2B8TA 1OW3B 3C8ZA 3UUEA 2YNFB 2UVPB 1F5CA 3PHJA 3JWEA 2EBFX 4X63A 3F8SA 1Z7YA 2OD9A 4MQEB 3PGKA 2ATCA 1E3LA 1RAGB 4AVYA 3V8VA 1A8HA 1UEKA 5C35A 5E41A 1WH9A 4DV1J 2W01A 1T10A 3HI9A 4PO8A 4LXTA 3MAQA 3IUYA 1TU0A 3I0RB 1R0RE 2RNEA 4Z8XA 2V74B 1C7IA 5E4TA 4F0KA 2I7CA 2WOOA 3KFVA 4EA8A 2VG5A 3I45A 5F21A 2Q45A 4PROC 1XBWA 3WLRA 1RAOA 2BRUA 4JSYA 4YDSA 3HVWA 3EM1A 4IJ6A 5DM6Q 2FWJA 5IUJC 4M9CA 5K8CA 1JG4A 4TN1A 2JJ4D 1QGED 2WT4A 3IX7A 2ZJPQ 4LF9F 3HLKA 1ML4A 2HSDA 1RT7A 2H3EB 2X6TA 1X4AA 2MY7A 2VBYA 1R10A 4C0WA 1TIPA 2JFOA 3ITHB 2HQSA 4ZDKA 1OZFA 3MUEA 4PUOA 4OJ1A 1UVMA 1N5DA 1JLCA 3PDIB 1HD1A 1DBRA 2WWTA 3Q15C 5G1NA 3QXXA 4AL7A 3KUKA 3TIIA 2XS5A 4ZCTA 4QG3A 4N0EA 3N2GA 3BQ1A 4H1TA 3E1GA 2E1MC 2HIQA 4Z4HA 4Q02A 3UIEA 1QH8B 2UVVA 1FRXA 5ENVA 5JSKA 1C1XA 3DDZX 4PHFA 1PNRA 4GKKB 1X7ZB 2AX3A 4YJFB 5IJZA 1G1XA 3MRXA 1HNIA 3R27A 1UP7A 3L7LA 1NH8A 1C0LA 3IMCA 3KLBA 1TLLA 5KYWA 2OFFA 3ZEIA 1XWLA 1VOTA 2GS8A 2IYSA 4EFLA 3H9QA 4TN2A 4PPDA 9ATCB 3OPYA 2MKYA 1U7OA 2UUTA 2GV1A 4Y2UA 3IUSA 4KV8A 3ZZ0A 5AKYA 4O4RA 4C7XA 2WWFA 1DXYA 1AGYA 2B5VA 2Y9MB 1BOOA 2VZ9A 5DOZA 2O2EA 1LA2A 5D6GA 1E2UA 1QYVA 3RF7A 1IFXA 3ZEAA 3BB3A 5I9SA 4DS4A 3BCHA 3CCQS 4D9NA 4NDZA 1HW8A 3CVWA 4RUHA 5C2GA 3D8HA 3DULA 1EVLA 2AHRA 3PC7A 5CVCA 4PPYA 2OKQA 5B53A 2DNMA 1M2FA 5ALQA 3RYHB 5AXMA 2ZC3A 5ETMA 3VR6H 5HVNA 1UIRA 3DL4A 1J97A 1VM6A 1PJ5A 2AR7A 4KXYA 2CHEA 3W8NA 5JMOA 4B6SA 4RH3A 2V5HG 2AOUA 1XD2A 2VF3A 3CPJB 2ZYTX 1OH5A 5EP1A 2MKCA 2FW8A 4FS8A 1T3GA 1S9FA 3ADDA 4QFBA 4CN9A 2ERXA 1W5TA 4WY2A 4G81A 3U7FB 4Q37A 3NGXA 4P2BA 2QTVB 1X1EA 3KXLA 4F72A 4LX8A 4EJ0A 1S6QA 4NMLA 2O66A 1C1DB 3DCJA 2ZPTX 1CD5A 2GAGC 2O8BA 4CLYA 4DWJA 1L4YA 3V2UC 2DO4A 2GAIA 4IR7A 2F40A 1A1VA 2HPUA 3UDLA 4LFCB 1BQNB 4MR9A 1A27A 1KIMA 1M7HA 1EK1A 4A73A 4JI5F 1VG0B 3JTNA 2LU2A 5J1EB 3LECA 1ECGA 5KFUA 1ZXBA 4OQXA 4UVGA 4F2SA 3M9XA 3W6NA 2V9WA 3GF4A 1IK6A 2QTHA 3PXBA 4G25A 4F7VA 2QI9C 2RH9B 4XVCA 1KLNA 3IG1B 3GYBA 1OXVA 1I1HA 1AZLA 3W34A 3VGTA 3G5AA 5GAEI 2Z2JA 5BV7A 1KY4A 4OV6B 1E98A 5JC1A 3MFQA 1BE1A 3GBPA 1HBUA 2XF8A 2H00A 1RT5B 5HJ7A 2JEYA 2QUJA 2ONZA 2DMRA 4J3JA 1L5HA 4JI0B 2FN4A 4WACA 1GKLA 2Q7DA 5D0HA 4XRRA 3UJDA 3W61A 4B85A 1NQOA 1P0FA 4E0DA 1MU0A 2EEYA 4BLUA 1NDCA 1PHPA 3RAGA 2OVBA 2WFZA 3W6UA 1XCMA 4ZXFA 3G6YA 2J5KA 3RROA 5DHPA 5LNK1 1JHZA 1VE7A 4GWGA 2G0TA 3FGOA 4KX3A 4NDNE 3C3XA 2FF7A 2O8FB 2QRVB 3UFXA 1C4OA 5TVGA 1VQOS 4OZ5A 3AHHA 2YVSA 1VQ4S 1ISIA 4CUZA 2QLWA 3D6TB 8MHTA 3P9KA 4KYVA 3NMAA 4CO2A 2H5IB 4EG5A 4ZYXA 1KONA 2KT3A 2B1RA 3ZHCA 1JHMA 5A76A 1D6JA 3AJ1A 1SB9A 5ALJA 4QOJA 1SH2A 1I94F 2WB2A 1V1RB 4B3TC 1JMYA 4HWSA 3OFGA 2BJOA 5HMZA 4MNTA 2EKZA 5A0VA 2WVCA 3ZY6A 4BQFA 3NAGA 3LQQA 1S1TB 1CJVA 2ASEA 4EUEA 4ED1A 1NRXA 1RLIA 1ODKA 2CLDX 2QSUA 2IUSA 3HUTA 5A0YA 1OAAA 3L4KA 3Q0IA 1LNZA 3SSNA 3DLPX 3KIPA 4RZXA 4ZAFA 4M94A 4CM5A 3D4IA 1I7SB 2RE8A 1JLQB 2FPGB 5I5EA 1BD4A 4ANFA 1BWPA 1MZPA 1AV7A 1WPQA 4QRIA 2C95A 3BD6A 4RW9A 1QDLB 3NBXX 4IJKA 1R8CA 1U8ZA 5KJ6A 4TKUB 4HB4A 2Y9HA 2KU7A 4IDCA 3Q9UA 4RAOA 1Z2NX 2SECE 3TNFA 1Y1PA 2O57A 4YJDA 4D4IA 3H1AA 4ZOEA 3UT5B 1PBUA 1HG0A 1VPTA 1RLOA 4PTLA 1J9EA 4GR4A 2VNIA 3DWEX 3DI6A 3M0EA 4ES6A 3VJLA 7FDRA 4RC9A 2IGTA 3NVKI 4CU5A 1QO7A 4NY1A 4RETA 2IXBA 3D0RA 1CNMA 1KKGA 2ZSIA 1KJYA 1M0SA 1DC4A 4CF4A 2H59A 4X8HA 3I62A 1R50A 5GWXA 1O08A 3AIOA 2QA4S 5AJ3F 3LPNA 3TSCA 1AZSB 1K75A 2D3OR 5JI3E 2ILZA 2OXRA 1CJCA 1EGAA 1HEYA 2HD4A 5DN6A 2N1BA 2F62A 4J0QA 4P9SA 5F7OA 4XM2A 2RU9A 3BWDD 3WVNA 4O1HA 4PRKA 1N9GB 1DUIA 1PSZA 2MEWA 2C4HA 3QLHB 1RI4A 4HUQB 5H5JA 1LU9A 3CPEA 4HRVA 2H4WA 4YBZA 1VG8A 4I4TA 2Z2LA 3R2DJ 3UR0A 1H8HA 1EVEA 3CC4S 2H2AA 5JHGB 3PZRA 2FK7A 1Y6RA 4EBFA 4PWWA 4GE0A 3UWPA 1J7KA 3QEMB 3UGQA 3NOXA 5DGHA 1P19A 2FOIA 4GGMX 3A05A 2VQFC 1EUQA 2L9WA 1W94A 2P79A 5TPZD 1N3YA 1L8AA 3HHLC 5J3JA 3H86A 1MB2A 1L4HA 3CZ9A 3GG1A 3GAFA 4BX0A 4E4YA 3OM8A 3HL0A 5EINA 2D74A 2R8YA 4ZVQA 4L27A 2H65A 4IZHA 5CCDA 2IS6A 4PUHA 1T0BA 1QVWA 2JG3A 2X6QA 5EXEA 1IPFA 3V7FA 4URWR 3KK0A 4MUAA 1SU6A 2WUFA 4AF7A 1RC1A 1DJNA 4CCSA 1VGVA 2BMWA 4TVSA 1BC6A 2Y6VA 3DE7X 3BCUA 1PYSB 1H4QA 2P0AA 1D0IA 2OWEA 4I8IA 1ORWA 4NOLA 5HTOA 1JQGA 1JR2A 2YW2A 4JLNA 4GM0A 4GKJJ 2I1LA 4ECRA 4XJXA 1Z39A 4NK4A 1FK9B 3GLGB 1GA1A 3OZBA 2B9XA 4J1QA 5BJRA 3IXQA 1M72A 2CPEA 2GRJA 1BCSA 3OZFA 2ISCA 2M8HA 1L1FA 1FE8A 3C41J 1GTZA 5FNZA 4BYMA 3BRWD 4Z0TA 1J4AA 2WLSA 3DCYA 3VNSA 2Y67A 2HNZA 3NTQA 1JPUA 1Q0LA 2NO5A 5DX0A 4PLVA 1CK4A 1KHHA 2EXUA 4JIMA 4Z4CA 1MOPA 3A1UA 4ZZ1A 4H60A 5DEIA 2R79A 1TL7B 1Y3JA 2OLJA 1ZRNA 4F4JA 2FOLA 2FXIA 3MCOA 2EG5A 3R5TA 3N8HA 5CURA 2Q29A 5LQUA 5CB6A 1EFAA 3KLMX 2O2GA 4EEZA 4J16A 4RE6A 2RC5A 3KKFA 4OYYA 3S6JA 3MM6A 3MLAA 1M1YE 4PC3A 1TKXA 1PZEA 1Z5VA 2RAPA 1Y9EA 3LA8A 2Q8NA 3H8JA 1IN8A 2AG6A 1N4DA 3FCXA 1NVKA 2XG8A 2QE7D 1EVYA 3OHPA 2WRZA 3UA3A 1QIMA 4ILRA 1FLOA 5H3CA 2VAWA 5AE2A 1MP0A 1RPAA 2R87A 1CP2A 4PZUA 3IKTA 4ZI5A 1NE2A 3JWIA 3WSTA 3I2HA 1BDMA 4JI7C 1RI3A 4KMOA 3ICQB 1U0RA 5DW3A 5FJ4A 3EY4A 2FYXA 4C6SA 1UVNA 3AZOA 2WSYB 4UBNA 4Q3DA 3RVMA 5MDHA 2E5LC 1M33A 1G5TA 3KEMA 1GGEA 3I6ZA 3LAKA 4JI8C 5SY4A 2X3DA 5BXQC 3IAAA 3KSUA 3OJSA 3MR7A 3Q2SC 1TD1A 3D4JA 1FTRA 1SVLA 1QTMA 4J9PA 2Q2WA 2ZE8A 4USKA 4FGJA 3LC7O 1CCWA 5B4TA 3OXFA 1H1TA 3CN7A 4MRSA 3ZXXA 2BEJA 2FJBB 4MDYA 4NA2A 1N2BA 3BIOA 2XTJP 2YKQA 1IBKJ 1X9HA 1OHHD 3MPUA 4BJ1A 4PYDA 3NM5A 5T3UA 2NQTA 1TEZA 3QVXA 3WFIA 4AJLA 3PA6A 2NG1A 1EP9A 1F2UB 4JFAA 1QLJA 5CU7A 2GJFA 1NI4B 3C3WA 3CJ0A 2DFLA 4KR9A 3LCCA 2V3CC 2CNOB 3H2SA 5F3ZA 2VQEJ 1YJ8A 1I2CA 1U6JA 2I4OA 4DMGA 1RDFA 4M9RA 4MKFA 2REOA 1O6ZA 5GOTA 4AQ7A 2WZ1A 1MNEA 5IT4A 3FYCA 4EVSA 5E6RB 3OFKA 3QLUA 4NYMQ 3IRUA 1OIWA 2I8AA 4FXWA 3COJA 2AC4A 2JAUA 3AR3A 2BMVA 4CKCA 1RABB 3AYXB 2D7SA 4NECA 5I45A 1FP4B 3D0KA 4Y1GA 2IE8A 4TOIA 1I6LA 1G8PA 1U1QA 1QRUA 3UOWA 1TUEA 3AEUB 6REQB 1MO2A 4LJ7A 2GQ0A 2AF4C 2N47A 4F6RA 1JDBB 1VCOA 2BE2A 1YB1A 3EA5A 3HB1A 1Q86T 1N5VA 3H20A 2N3OA 1OROA 3UD5A 3KETA 3TEJA 4D81A 4E5KA 1RBYA 2I8LA 3D2LA 5K0BA 1NZJA 2CMHA 3H5OA 2QMQA 4QNNA 1DO2A 4Y2GA 1XMOF 3GP5A 3HM2A 1VQ7S 3CNQP 1DJPA 2PPLA 4BNVA 3M8SA 3HCAA 2PK3A 3N58A 1M2GA 5H70A 4BNIA 1Y8QB 1M6WA 3AM5A 5KDDA 5A7FA 4K0KJ 1CUHA 2HTEA 3GCWP 3QVLA 2PSJA 3U1VA 4YR9A 1JS1X 3TZEA 4PLWA 3QPUA 4X4OA 1TL5A 1XJQA 2C5SA 2R42A 5FP0A 3N2YA 3GGDA 2PI4A 4U67Q 5IWCA 1FXUA 5HGJA 1BQMA 1GSAA 3JYNA 4DV2J 5JNVA 3POTA 1G2QA 3F90A 3EA0A 3N2NA 4KIUA 1UWKA 2RJ3A 3HXMA 4UF4A 2FDXA 2KM8B 5CM2Z 3RFUA 1TK9A 3PQ2A 4XXHA 4KXFB 2XKBA 3AR6A 2ZUBA 1EESA 3H1TA 3A6FA 1N6NA 4BNMA 1RRKA 4ZPBA 1Q0PA 1Q7BA 1Y81A 4OYHA 4MGEA 3B7PA 1ISFA 4WOKA 3FFAA 1KMHA 4QTTB 4DIMA 2Q9AA 1IEQA 1SA0B 3D1HA 4GI1A 4PSCA 3GGJA 1RXUA 1KQOA 2RCNA 4Y7CA 4C2TA 5FUVA 3N4WA 5FBQB 1DWPA 2IUTA 4V0ME 3E81A 1QGAA 3OZTA 1F6WA 3BGLA 3GWZA 2A4MA 3DD1A 5H68A 3ULKA 3SIWA 2CRLA 1GL6A 3AU9A 4PYRA 4BNDB 2IPOB 5A7GA 5K4HA 4DR3C 1KZYC 2ZT8A 2FWIA 4OYPA 3H9BA 5EE3A 4FYMA 1UZUA 3NGRA 3IM8A 4REOA 4M36A 4BFUA 3L7IA 5LLTA 2JCVA 3OJFA 1L7QA 4DIBA 2Q49A 4HQFA 3IURA 5KTMA 1HKAA 4F4CA 2HF2A 2OL4A 1FFGA 4ER7A 5C1PA 1BYIA 1J0EA 4X64F 5AKKA 1HDXA 3F5FA 1CZOA 5J43A 4GZ3A 1YMQA 1KRPA 2ZJBA 3P0JA 3GNQA 1J2JA 2JARA 3RKUA 2Z5FA 4Q9JA 4DQPA 2ZE5A 1NJIT 4DL6A 4RZ3A 1L1EA 1KS2A 3KZNA 3VNVA 1HLFA 3UAZA 2IBKA 2DHAA 2F4NA 4MA5A 2QYHA 4FVCA 3WGQA 4C1BA 5C1BA 3LI2A 4BEWA 2NSJA 1T1SA 3L7KA 4RA9B 3BJYA 4DIUA 1T9AA 5FWNA 5AVSA 4WLNA 3AEQA 3ZTWA 3WKBA 3UPTA 2H7CA 3AUUA 2RF2B 2P41A 4I99A 3M5CA 2Q66A 1SD1A 3DQQA 4Z0NA 1J70A 3RG2A 3RUDA 2AJ2A 3UF0A 1JDZA 4M1OA 1UM9A 1B8PA 2Z2MA 4PPNA 2MSKA 4LS3A 2FV8A 4IMJB 4XWTA 4NWBA 2I4TA 2B61A 3PUWA 2BKAA 3WLKX 1ZCZA 4WKPA 4I9HA 4RFSA 3O3OB 2IJNA 3EXAA 2X0NA 1MAWA 3NGSA 4HYYA 3TLKA 3G02A 3C43A 4W92B 2FPOA 4B3GA 2QZJA 1RTKA 1GG9A 3JAMA 1YFJA 5JXWA 3UPUA 1T8RA 1GMWA 4R41A 3STUA 1TVRB 2ZS8A 1Q44A 2O8CB 1ORTA 1ENYA 1ND5A 3C85A 4QBTA 3UT0A 3T15A 3NS7A 4RD0A 5E2IA 1JKJA 3DLCA 4BN4A 1G20E 2V2KA 2VSOA 3FBWA 2X8LA 3KMSA 3ZD6A 1BCRA 1LLFA 2J4DA 1GQ2A 2QMZA 1U0FA 1C0TA 4TY8A 1EJ0A 2GQCA 5LA6F 2CYAA 4QELA 4WL0A 5A4JA 1RHRA 2HFKA 4UXJA 5AYVA 4MWZA 1I3MA 4EYEA 4ZS6A 5EERA 1POWA 1I51A 5B4UA 5AXAA 4RBUA 4TL6A 5I7SA 5I4KA 2Q5OA 1RD4A 1E9CA 2P9JA 3E3NA 2PKEA 2EX1A 2AYGA 2D6FA 4ETZA 2PL1A 1P8GA 4C0HA 3NGTA 2WW4A 1P7PA 2VSXA 2B0GA 5AI8A 2Q4OA 4V1CI 3E3XA 2CPJA 2R3SA 1F17A 3R3WA 1J99A 2RHSB 2ZKLA 4FYIA 3PUYA 2HEGA 1R6XA 3S8EA 2EHJA 1RY2A 1Q15A 4EO7A 2OORC 2QN7A 2WU4A 4H08A 3HYCA 4EHAA 5FWXB 3E01B 3F3MA 5L1LA 3IDSA 4TTSA 2WVBA 2R6JA 3HB5X 5FR1A 2DPGA 3LBAA 3L6UA 3WIBA 2K3IA 5H81A 2VXBA 1MT0A 3W5UA 1A4RA 3ROQA 1TX4B 4V02A 4KY3A 1NL3A 2VQ6A 4FP9A 1XN9A 5GADI 2JLEA 2W2QP 4G5HA 5DRYA 3K0EA 2HHPA 3ZDRA 4LZZA 1SC3B 1GEHA 2PAFA 3UUFA 3GH1A 3CEPB 2NAPA 1XTRA 5C4MA 4UHCA 2BFMA 1L4KA 4FM9A 2JNJA 5FFNA 1QFXA 5EGYA 2WE8A 3BH6A 1RTTA 2OUKA 4OQ4A 2DPYA 3ZCQA 4ELVA 4R1NA 1DG3A 2H5LA 3VTKA 1GAQA 4M0PA 2O2XA 4R1QA 5BVHA 4LF6J 1NQAO 1RWMB 1R5OA 1S97A 1GQYA 3ZD7A 1JLAB 1J39A 5HDQA 1JFFB 2BGKA 5AM3A 4MDEA 4LF9J 1PJ2A 4XQCA 4EYHB 1AXGA 4M6WA 2ERCA 3FOCA 3H9CA 4HLUA 3MIIA 4PC1A 3OQ2A 5B1SA 2QN6B 4C06A 1RJWA 4ZCPA 3VC3A 2CNWD 4WKCA 3W90A 2OT3B 3S82A 1F0NA 4OXRA 3BD8A 1ECBA 2DQKA 1QFMA 2D3TA 4DMFA 1DKLA 1KJIA 2I7TA 2UAGA 4NX9A 4EG6A 4DQDA 3TD6A 1OIXA 4JEHA 2CCKA 2V6MA 3K6JA 3D6NB 2R3VA 4DFKA 3T61A 3L4SO 3VFDA 1E9SA 5G0VA 4E7OA 1XLVA 1S3FA 4DUYJ 3R40A 4FBUA 3H4MA 3BO4A 1O51A 4NHEA 1HNWC 1G5PA 3NXSA 2AD5A 3WLQA 2VSQA 2XA9A 1KHVA 4PAAA 1H65A 1J5EJ 2Q8PA 5KC8A 3JQFA 3K1AB 1T36A 4YQFA 1CVLA 3YASA 1RBAA 2LQ5A 1B0PA 4M95A 3SS8A 3OR2A 4NLRA 3PC8C 4PQRA 2QRLA 5F35A 3GAAA 1PEKE 2BW0A 2SXLA 2IKQA 3ONNA 5JAHA 3THYB 1EH5A 3IAM6 1C4KA 1R2QA 3SJUA 4HDOB 4LOAA 2W4MA 5FOTA 2OG1A 3BCSA 3AETB 1N1GA 2AFHB 2OBFA 1HUQA 4MW6A 1M34E 2N4DA 3BKWA 1JZSA 2DXIA 2O6LA 1EB8A 1GD1O 2BGRA 2XXJA 4DM4A 1Q8BA 3CJKB 1R0ZA 4DXDA 1BW9A 3WQHA 4QWBA 1CE8A 4J5OA 3DSRA 5GAEU 4KYTA 2MLXA 1YQUA 2VPIA 1K4MA 1PVOA 3DEIA 1YRUA 3KOAA 3JSAA 3W6ZA 3FPFA 4O2AF 1NC1A 4LF4C 4OJMX 4MV1A 4I6JA 5EZQA 4YAUA 1W46A 3AZPA 2UYGA 3I32A 2ZKTA 1P8AA 1SHZA 3K4QA 5DTIA 4H4DA 1NBHA 1NF2A 2ZHOA 3AUTA 4C0SA 5LL6P 5IZCC 2L9DA 3UW3A 1HYQA 4CLHA 3F7OA 1CVRA 3DP7A 4NEHB 2D1YA 4NL5A 3K1YA 3TMAA 1JWLA 5DBFA 3NP9A 2ZSEA 2BYCA 3CPSA 2MYNA 5TQJA 3NPDA 3AF5A 1Y3BE 4YQWA 2XCSB 3HUDA 2D1QA 3NBQA 1M5KC 4EKNB 1NRKA 3U9TA 3ORSA 2OECA 4Q5VA 4X1IA 4MEJA 1ZK2A 2O4UX 1BLUA 3VR0A 1Q21A 2DVMA 5I42B 3I39X 2CXXA 1NUHA 3RR2A 4FFNA 1UDXA 1B1CA 3FLAA 5G40A 3HXLA 5C2JB 3F0NA 4Q7AA 2AF3C 5BY2A 2EF0A 3DM9B 3IVGA 4R8RA 2G5PA 3FVWA 1XXHB 3PRJA 3BDAA 4K5SA 4JBYA 1XERA 4JI5J 1JSCA 1N4AA 5DNUA 2FPMA 3FUUA 5FORA 3MRTA 4E5DA 2JGEA 2PCJA 3W5JA 3K9LA 3LLMA 3ZU4A 4JEIA 2YV3A 3K9CA 4PO1A 4S1NA 1CJTA 5KNBH 2C2DA 1NSTA 3K0FA 3MNFA 3TCNA 3T19A 3A06A 4TYQA 3EWIA 2AUMA 2HT6A 1QNLA 3H87A 3R41A 1RUSA 3AK4A 1T4BA 1BRTA 1NC3A 1P1CA 3EBOA 2PCLA 2CXHA 1QBGA 4ADSG 2I5PO 1EUCA 4M22A 3GVXA 2CNLB 3GT0A 4X85A 3KUGA 4WBNA 2ZJ1A 4IR1A 4PM4A 3KUXA 1GIAA 3S4YA 1NPDA 3HCWA 4C22A 2AFVA 1EU1A 5ALVA 3TSOA 2HPHA 4RO0A 2PZLA 1W73A 4NQRA 1Q17A 3ZWCA 4CQMA 1RDRA 1Q7RA 3WL7A 4CNZA 4LY3A 1ZK4A 4QREA 3LLCA 4G3XA 2XS2A 2G0JA 4NCBA 1O0BA 4DX8H 3LUKA 4AWBA 5LMNC 3K5NA 2H16A 4D8WA 2MSTA 2KHCA 1XFAA 2W9CB 4USUA 4JL6A 4UM9D 2JWNA 4W9NC 1G7CA 1QONA 2P4SA 4O23A 4Q9DA 2VFUA 3DOEA 3J7A1 1JQJC 3ONEA 1EBUA 4JVMA 1I7DA 1Z3CA 3MC1A 1CZNA 2EFPA 4IYJA 1A4IA 3LLUA 2EVWX 1DO8A 3UCXA 1MRSA 4HEHA 3AR9A 1KP6A 3PUHA 4LC1A 1LVUA 4Q4AB 3UK2A 1BMFA 2MMAB 2QP3A 1XRJA 4H3VA 1I94J 4U9HS 4LOKA 2BJDA 4PX2A 2I6TA 4WXEA 3LUFA 1CRWG 1UOOA 1U5AA 2OHIA 4PG4A 1JMVA 3CD0A 3I28A 2YFHA 3UWOA 2QSWA 3URKA 1CERA 3R7FA 1N0UA 3QFHA 1ODTC 3TNYA 1A69A 2XLBA 1H6CA 1YSJA 4D45A 1VCNA 2CY1A 2KYZA 3MMNA 5IDWA 1TVCA 3ZDBA 3NV9A 2PA3A 3CW9A 3EDCA 3KBOA 5BW6B 3FKSD 5FI0B 2MMGA 1XZGA 4DXHA 2G2ZA 3N3AC 2J4CA 3QY0A 1E4VA 1VI5A 4U5XA 4P5DA 5EP3A 1AX9A 3KELA 3IR7A 3PHHA 2PC6A 2IRXA 1BMQA 3IV9A 2DYJA 1UMCB 4M1TA 1GJRA 3U4GA 5JO9A 2H48A 5JYDA 4TROA 3KS9A 2WBMA 2I6SA 1S9EB 3O3LA 4IO9Q 3PHCA 2BE7D 3P9PA 3TXYA 3GXOA 3ZCVA 4UUOA 2DXFA 4NMMA 2W2OA 3I2KA 3VJMA 3GL9A 2MCQA 2FPIA 3OCXA 4CV1A 4LQDA 3ZTPA 3L18A 3DRYA 1YQDA 3BC1A 1GQEA 2W48A 2OR3A 5JVDA 1OS5A 5FLXA 4JUAA 1JPJA 3MWBA 5F3TA 4KGVB 3G6VA 1D1SA 3GP3A 3RHFA 2HXSA 1LUAA 5F5LA 1N8RT 3V1MA 3JWHA 3U37A 4XPIB 3DOUA 5HK9A 3C8DA 2VDLB 3BD9A 1GMUA 2BJWA 3EIEA 2ZANA 1D2RA 3EBPA 1H2YA 3DLGA 3UAVA 4GKJF 4I2NA 4B2YA 3EVMA 3FMFA 4DLRA 1DHTA 2ZDOA 4N7TA 3LK6A 1N88A 3FDZB 1ULHA 3HULA 3QE0A 1EM8B 4ERNA 4L3WA 2XMDA 4QWWA 5TGTA 3S44A 2GT1A 2G5CA 3O83A 2DTDA 1M0TA 4GPBA 5ABPA 5JQGA 1AUDA 4I5IA 4X71A 3H2UB 1B7GO 2XM3A 2HS4A 1GSIA 4LC0A 3VJKA 3N54B 3S2GA 4MJ7A 5LZ4A 4QZVB 4ITVA 4HYEA 1YR1A 1SHLA 5D8DA 2R8ZA 1U25A 2B8EA 3GEEA 2BFWA 5AJHA 2QLMA 4HHUA 1FD2A 3O8NA 1QSYA 1QO0A 2GGSA 1LWNA 1EB9A 3UK0A 1SQSA 1VXOA 1PJ3A 4ZKAA 3S3TA 2FPXA 4N77A 4AY5A 4NQZA 1EWKA 1U1LA 3IHLA 2D7JA 5AIAA 5BN1A 3KKKA 4KWIA 3BUSA 8ADHA 3R24A 1T29A 3VKGA 2I1VB 3AQPA 4U5QA 3AUSA 4HDSB 1G1MA 4Y2TA 1B3BA 1UT6A 5DWDA 4OX9Y 3WLSA 1K44A 2EZUA 1N4LA 2QM8A 1LFPA 4OGKA 4C30A 1Z7EA 1PGPA 4ILKA 1N5KA 2EU8A 3LZ6A 5GVQA 5BNZA 1ZHHA 5HKOA 1AO3A 4BIIA 1W4CA 2QW8A 4EM6A 1V35A 1DEHA 3QMPA 4CIVA 2XXAB 5JAUA 1VJTA 2AQ8A 1ZMOA 1G9TA 2AXPA 2HHSA 4F4WA 4LCBA 3U56A 3I4CA 1MOZA 1RLUA 1NRJB 3PNQA 1I6MA 1U9IC 4C4XA 4EY7A 5IWAB 3HSGA 1RZ3A 1W5EA 1ZUNA 4AWAA 4MVJE 5ICFA 1ZH2A 2R8OA 2MINB 5LQJA 5B2ZA 2OAQ1 3W8FA 1SKYE 3FAZA 4ZKDA 2RKIA 5DYIA 2IODA 3B3AA 1BKSB 3MEDB 2CEKA 4RHUA 4N18A 1OX4A 4D0LB 3HWX1 1SBNE 1EVIA 2NIPA 1N54B 4LGCA 3RBEA 5JBNA 3U3XA 1Q79A 3JYHA 3CQ9A 4ZYUA 3TPCA 2DCUA 1Y48E 5DS7A 2VBWA 2ZVDA 4NLVA 1Y11A 3SZUA 2B9YA 1ACMB 4J03A 4C5BA 2HJRA 4ZT3A 2W43A 3AX6A 4PV7A 2QTCA 5F76A 2D1RA 2HPAA 3BCRA 3OAAD 1QYRA 2XYHB 5EAIA 3I30X 1NYRA 4X41A 1JA1A 4DA6A 4AIRA 3NKYA 4JU9A 3VZSA 4AAYA 4KNWA 2CL7X 3TZYA 1M1HA 2NO7A 1AN9A 1OCEA 1WDLA 1JTEA 1VHJA 4FZ5A 5L8RC 4CODB 4LDZA 1HW9A 4XB2A 1TMGE 1SVIA 1NBIA 3AO0B 4Q4JA 2JIQA 4IUDS 2M52A 4P52A 3CCBA 2V4JA 5HS4A 4CDGA 4DDVA 5HZHA 1SQFA 4C89A 3AM1A 1T2EA 2Y1KA 1UMJA 3J7AC 3E2MA 4BVEA 1Q6YA 2HYIB 4MYHA 5BQ5A 2HCTA 4ANDA 2MXYA 1MIOB 4YQYA 2PGLA 3S7TA 2HC9A 1ZRSA 1PFYA 1T4CA 3IOMA 4GOXA 3K31A 1YASA 1RYRA 3PW7A 1SURA 3N2IA 5JW6A 4PW0A 4P9NA 3GA7A 4CFZA 1IKVA 1U7ZA 5ALEA 1II9A 2KKHA 4Z7OB 5CH5A 1A95A 3SYTA 3GLIA 3TMKA 3NBPB 5A04A 3R77A 3A1DA 2UZ0A 3USZA 4NNOA 5KFQA 5FPSA 2J0WA 1YZFA 2HVHA 2J41A 3LP2A 3FI9A 2UXDB 3DMYA 3HFGA 3QIDA 4QBUA 3DT9A 4NYMR 3O0TA 1AGXA 3JASB 5B3JC 1L4MA 3IDZA 4WK2B 4U6QA 5DGDA 1GNTA 1VA4A 5KQLA 3OQNA 4JI4B 4RMNA 2JCSA 3CZQA 1E99A 2W9XA 3MOZA 1GZ4A 3MCWA 2IFTA 3Q0TA 1SOUA 3VR6A 2YWWA 1Z63A 2VAPA 1TZMA 5F8IA 5BYBA 1N8TA 5B7GA 3U4QA 4A36A 4LZAA 1L3IA 5BSTA 2K4MA 2NUPA 1TZCA 1B4DA 2P2YA 1ZEJA 3WQSB 3MHYA 5D86A 3GZ7A 1U0NA 1KMIY 1A8UA 4YRBA 1MX1A 1V7ZA 3K7RA 1OTYA 5T5QA 3HKDB 1TK8A 1D3AA 3CO0P 4P22A 3PNSA 1O5JA 1AFIA 1PSWA 1SL0A 3W1YC 2QRPA 2NQ2C 2WD7B 1PGOA 3B1KA 4OQPA 1WPRA 1ZGGA 3UMBA 3HXKA 1XMOJ 3P6YC 1U0GA 3PYMA 2BFNA 3I9LA 1S1CA 3G0HA 4RUKA 1RA7A 2OFWA 2ZUVA 3GJYA 1HH2P 5BR7A 1ZRHA 2MSCB 4F2DA 1A8IA 2FFQA 4UOCA 3AC0A 2EGGA 2IEGA 1YCHA 1H3EA 2N1MA 3RIMA 5JNWA 1VJRA 3GT3A 4B4UA 1J09A 2QUBA 3CU5A 5JPDA 4PHTA 2AG1A 2QGFA 2JL9A 2XHEA 3CIOA 1PLKA 1HE1C 4FXDA 4C88A 4YCAA 2HA6A 5HIKA 5E6UB 4DG1B 1JYFA 2XLIA 3QGMA 2K7KA 4AUKA 3OUYB 3A0RB 3IE1A 3URMA 1SV5A 4CCYB 1MB4A 1Z2DA 3T7AA 3R44A 5HQ8A 1P9RA 2WHPB 2CNBA 2C4KA 4L7IA 3HP7A 5DRTA 2VJOA 2ZJRQ 5E8RA 1MO5A 3NNDA 3QXHA 1Z3IX 3F6EX 3KJFA 1O96B 1G7RA 5KTQA 4PIPA 2YICA 1SC4B 1ZR2A 3A8IA 2IZ6A 4LC9A 4NOMA 1QK5A 5AK3A 4U0KA 1JAIA 3AJEA 3SI7A 3PFNA 4WNYA 2BV3A 2RC6A 4OCZA 2ZBIA 3ZDZB 3E8OA 4RQUA 1RAHB 4AWXA 3UKDA 2ZBRA 3CGWA 3ZBPA 2G67A 4EX6A 1C0KA 1LPNA 1ULZA 3M8KA 4ZCMA 2CLKB 2ZH1A 1YQGA 2AI1A 5DK4A 3JRXA 5E38A 2HFSA 2RGWA 4NA3A 3EDMA 1QP4A 2EKPA 1YE3A 3JAKA 3KYLA 3SEOA 2JLZA 2PUTA 5KUTA 4PWDB 1DBIA 3W5BA 5ALRA 3TR5A 2C8VA 2PGIA 1SCNE 2ISQA 1NJGA 2DRBA 1FBNA 4FYKA 2WWGA 3EC1A 4WFJA 4EYGA 4B9SA 1LF0A 1W4AA 3OY7A 2P1DA 4ETMA 2HGLA 3ECAA 4Y6LA 3REQB 2OQRA 4GI2A 5BQPA 1HMVA 5CQGA 2H1SA 4QGBA 5TX7A 4DJTA 3GJQB 1DAHA 1QIEA 3RAFC 3A6HA 1AUPA 1P8JA 3IB6A 3HJAA 1JJAA 3IULA 3HB9A 5T41A 1DJQA 1E3TA 4HBGA 3GN2A 3NASA 1VISA 5LMZA 3V55A 2E48A 2ZT5A 5FIIA 4G5QA 3OT1B 2ZIEA 4WJKB 1UWDA 4LJRA 3CD7A 3G0GA 3VTZA 1H38A 2MM9A 5A5DA 1UAAA 1DTQB 3GBVA 2HWTA 1JN0A 4RIEA 2JEZA 1UWBA 3BFJA 4ZANA 1N2CB 5E7QA 4TYMA 1ULRA 4WE1A 4C0QC 3B6MA 2XMPA 1VQ1A 3PEYA 1PI3A 3KR9A 1SBRA 3R7AA 2GPNA 3PCRB 2OP5A 4ND2A 3LFUA 2AZ3A 4URGA 4UUAA 4EHKA 1W1WA 5FCDA 2KSQA 3RYLA 3MAAC 2NLWA 1G8YA 1WZEA 4D1YA 1WRBA 3VAIA 1T13A 4MTNA 1WIWA 4M1KA 1MC4A 4PX9A 4DQ0A 4FDMA 4CGYA 3QNWB 2I3DA 1FQKA 3RRYA 3GN1A 4LUBA 4PG7A 2B4TO 3E51A 2VHJA 4DHEA 3EEQA 4PWYA 4D3FA 2XECA 4LGYA 2BKLA 1VIXA 4IX9A 2IYXA 3FOWA 2QX4A 2PGOA 1RI7A 4LBYA 4LVCA 1SJ4P 3REOA 4FYXB 4LUCA 1T0PA 4JT8A 4Y9DA 1BEUB 4G1BA 5YASA 1P9LA 1DJMA 1P77A 2AZDA 1QXSA 1FSPA 4Q3AA 2VPWB 1K86A 5LSLA 1EYZA 4LF6F 2J9EA 3S81A 3DE5X 3WICA 3WDLA 3W7AA 3ZG6A 4G5RA 4RIHA 1LKZA 4IIGA 4LJSA 1O1YA 2QN8A 3G5MA 3LE8A 5FUWA 1SM4A 5G1PA 4TXLA 2XNJA 5FPKA 2TMGA 1QYCA 3CHYA 2P7IA 3KWJA 5LQKA 4CN8A 3LT5A 3RS7A 2OO4A 1Z0AA 1WUUA 2MIIA 3EG9B 2B8QA 4HWKA 1OWOA 3A2LA 2O59A 1X80B 3CF5Q 1LW0A 1K1QA 1RWXB 4Z4FA 4EUSA 2ZJ5A 1A8PA 2PJRA 4FNMA 3NT4A 3MR6A 5AQEA 3D8RA 1GVHA 1HR0B 8ATCA 5JS8A 3KQLA 1KVKA 2PG3A 3HB7A 3OQOA 4CMCA 3FTDA 4KUEA 4DUYF 4X62F 4WKYA 3M2UB 2Z4SA 1J5EF 5FNVB 3BA6A 5CHEA 3HP1A 2Q4BA 2G36A 4HGYA 2PROA 1ODJA 2GEUA 3QLEA 2G09A 1ZC3A 1XRLA 4KPEC 2AC7A 4F3YA 2GVZA 4DLPA 1IJBA 1ESCA 2PRYA 3TL6A 1YTLA 3LUHA 1TKTB 4ZVNA 1W36B 1UBNA 5AXKA 2V9CA 2JZOA 3G6KA 2QTNA 4KO2S 1RQLA 3VV2A 5KWSA 3R1LA 2BDPA 1P0CA 3GXBA 3VVMA 2IYZA 5FWYA 2GZOA 3WRWA 4C7VA 1KR4A 5B6JA 4ZYTA 4EMDA 5GJWC 3II6X 4XB1A 4GXQA 2ZM5A 4NOKA 1CP3A 3TP2A 3CCTA 1JI3A 1QGOA 2IM1A 3EH1A 3C1UA 3U1MA 1QM4A 4Q8FA 2G0AA 1X42A 4YDRA 2WIGA 2WKQA 3SC6A 4E5VA 1CBKA 4JFRA 5L40A 1XHEA 3ME5A 2YWEA 4G5XA 3SSAA 5IFLA 2H54A 5TDHA 1T94A 4C76A 3B9BA 3IWLA 4DIOA 1OX6A 4W99A 1SXQA 2E8CA 1N34C 1SJQA 4XKJA 5IZ4A 3VR1A 1WG8A 2QZZA 4ZIRB 4XGQA 5ARDA 2JC0A 4MVJD 1QAIA 2GD2A 9LDTA 1TFYA 3N0WA 1DJ0A 2BMFA 4RNDB 3JPYA 1HQEB 3S1LA 1MJNA 1GXUA 1R37A 2GWHA 1XEAA 4DCJA 2BFAA 5DTEA 4ANEA 1GTVA 3UE2A 3S1AA 3OLBA 4TRRA 4YRTA 4CTAB 1A5BB 4ZVKA 3P94A 4YEDA 4K05A 4NOJA 1J0CA 4CW7A 1TVKA 4CQJA 1EETA 2P5VA 4J94A 5J2TA 3LUAA 4L4XA 2C7QA 2D2EA 4MWCA 2WF7A 1CUYA 4JYAC 4ISCA 1NDKA 4NYJR 2PBZA 3TZQA 2AGQA 1ZZFA 3D59A 1LWXA 2G9ZA 5F2EA 3OCWA 4FHFA 5DW0A 4LRTB 1G8AA 1F0XA 2R8PA 2TMYA 4DARA 2GCOB 1LJ8A 2QSJA 2GPYA 1XCPA 1E1KA 1FYWA 4LNUB 4CL0A 4DW8A 4N01A 2FZKA 5K0NA 3VI4B 1O90A 2O2SA 2JJ8A 3CB2A 1TKBA 1E9VA 4MX8A 2Y1OA 2O8EB 3O1IC 4ZHQA 3E7XA 1G4UR 5CXTA 1O54A 3PFCA 2BFEB 2R6HA 2ATVA 2RGBA 4J29A 2G9RA 1Y0BA 4YGXB 4D0NA 3UMGA 1NV8A 2OP0A 5DV9A 5A9SA 2UZAA 4ZWNA 4IH1A 3IFEA 3OQMA 3VVCA 2H1IA 3HYNA 3GX1A 3KTAB 4HACA 2QMHA 3OPYI 3B3GA 3LHFA 3THXA 3K7EA 2P62A 4QA9A 2HWXA 1JBEA 4M5IA 1XNRJ 3PV8A 5ETPA 5A1IA 2OC9A 1WDDA 4UBIA 4YN3B 5B6PA 1RAFB 5CJJA 3V4PB 1XZDA 4ED4A 3RJ9A 1OASA 5ESDA 2I78A 3NH9A 2ZRAA 2ISSD 5JROA 4KVAA 1MQSA 1ZESA 4QQFA 4XX0A 1N0VC 2P6NA 5LVAA 2VUHB 4EF6A 1XRPA 2GVNA 5IC4A 5IH3A 1KGSA 1ZU5A 3QMQA 4F6LA 4KLZA 3LH5A 4LZJA 1XQVA 1N6PA 4R2HA 4G1FA 2HQGA 2IOQA 1BWVA 1OI7A 2IC3B 4CPDA 2JVOA 3UB4A 1X1DA 1YS9A 1Y4UA 1BNCA 3W9JA 2IYAA 3PWKA 3VR3A 1DFGA 1P80A 1V5IA 4DR6J 4E46A 2XMKA 1E5LA 2B20A 4YRMA 2W4IA 5F5XA 5CYQB 5HVGA 4HXGA 3RGGA 3ZZUA 1A4UA 2DJIA 4U0JA 3SCIE 4RTKA 2QD3A 5JAOA 1Y8AA 1LBTA 4WIAA 3I73A 3KQQA 3FUVA 3L0OA 1XCOA 4C8MA 4QW8A 4RHCA 4RJJA 3C4QA 4FFLA 4D9GA 1Z16A 2YKAA 1VE6A 3FMWA 2HADA 3KKEA 1TKCA 1VGQA 2Q2NA 1X15A 1HTBA 5DNCA 1NUTA 2Q1XA 1KOLA 1YQTA 2NZ2A 1H4TA 3GNSA 2VEOA 1JAZA 3K5PA 3RUEA 2Z58A 4LBIA 1UODA 3K2QA 4R25A 2AWZA 4YP0A 2J33A 4X6YA 2EGTA 5SUHA 1GSHA 4YAGA 1OZHA 2G9NA 3TQCA 3ROZA 2R1UA 3BDIA 1D5WA 2Y93A 5BMVF 2MKKA 3Q7RA 1NBEB 4UBOA 5ERGB 4BP9A 5GTDA 4JP8A 4KIGA 1RYYA 4I4TF 4CEIA 3HM9A 4D4KA 4AKSA 2VNJA 4OKIA 3ETJA 1J8DA 3C2QA 3R8XA 2DWUA 4L8WB 3CCZA 3PYFA 3UAOA 4UEJA 1XT6A 1T6XA 4UQPA 1A7GE 5BOVA 1U2SA 3Q6NA 3D8NA 1FJGF 4RGQA 1ZLXA 4A0RA 5JSZB 2G1UA 5CAAA 2V8OA 3HCFA 3TQIA 1VJ1A 2D5IA 5EMMA 4PXYA 4TXNA 3GJ7A 3LGMA 4LFBJ 4K87A 5A4KA 3ZCTA 1FP7A 5B30A 2H06A 3GSDA 5A6PA 1E6LA 3JQCA 1J5OA 5K4GA 1UOQA 4B31A 1WL8A 2HJWA 4D9EA 1TP7A 1U63A 1WTAA 1PEYA 3DCAA 1MG5A 2KW5A 2X2PA 3J80U 4ELTA 3EEFA 1G5FA 1OYOA 4R7TA 5AJWA 3U7RA 3MWGA 3TZCA 4Q5IA 4TN5A 1OY8A 1I5EA 3UMCA 3TDMA 4DHWA 4WJLA 1EX6A 3D6FB 1DCFA 1E3QA 4UFOA 1S4QA 2OEPA 1D3WA 3G2QA 1TD9A 2PMFA 5FO0A 5LMCA 4QAJA 4R0JA 4HKTA 2JJ2D 5IDQA 1HNZC 3VKHA 4QNRA 1HRKA 1S1WB 4D3YA 3OJWA 1MDBA 3KOOA 1D1UA 2Q9BA 5THXA 3DHEA 3IOBA 5CG2A 4I55B 3R7SB 4RADA 4NU5A 3IODA 1M2JA 4DCOB 2NP7A 3L02A 4JL8A 2C5LA 4ZOBA 3MWFA 1YWXA 1FFAA 5DWQA 5H16A 1FJHA 3MCSA 1YJQA 1GCAA 2Z8YA 1QCYA 13PKA 3D66A 5IQ6A 2Q6CA 2BM8A 2PIAA 4IJVA 1KORA 4XW2A 5E6SA 3FX2A 4MV8A 3ASUA 2A1UA 4HF7A 4RJIA 1FNXH 3QBEA 2Y1FA 1U0HB 2Q1SA 2DBZA 4BC7A 3SX4A 1TVEA 1Z22A 2NVUA 1JR4A 2KYRA 2C2OA 1KJ8A 3M4YA 1ZD4A 1EKSA 3NYQA 1OLUB 5C25B 3WK8A 3W78A 3H59A 1KMNA 4H54A 3TDEA 4MS3B 5EJ9A 3UEOA 1TW3A 4KFBA 4PAOA 3VGUA 1V7PC 3IAS1 3G2MA 4F50A 1NVTA 4AB1A 3M8QA 3ZGNA 4CQ1A 3H11A 3Q7QA 2Q4EA 3WB0A 3TQEA 3BRQA 3J81Y 3E82A 4PGAA 4JLKA 1NW9B 2G1DA 3OZUA 1JLMA 4EHNA 4EPXA 4Y1FA 1AMUA 4LSWA 4P81A 3SSOA 1KI6A 4O4LB 3RVSA 1MOQA 2I38A 2HQOA 3ZHTA 3N53A 1IBCB 1UMDB 2VG6B 4UVIA 3X43A 2WDZA 4Z2XA 2C3PA 3K09A 1AW0A 2DVIA 4Q9IA 1RMYA 2R44A 5EXDA 1GCIA 3KJEA 5CMLA 3V9PA 4MWDA 1E66A 2QTLA 1E2JA 2C78A 5LCXA 3BQ0A 5IOLA 2EFOA 1DPGA 2PRZA 2DGVA 3NBUA 2H1RA 2HQBA 1XYGA 1ZNXA 4LHXA 5BT9A 3CSSA 5TARA 3U7QB 8GPBA 3VDXA 4ZVVA 2WB4A 3AFHA 2ICAA 3BGOP 3SZLA 4KTTA 3SC2A 1M90T 2X0RA 1RKIA 5CM9C 2F8HA 1IHXA 4CLFA 4XAKA 2P4UA 3OC6A 5GAGI 3V2IA 1E0JA 3DD5A 5EIEA 1W5SA 2V68A 2FHOB 1OX5A 3EPKA 2FLVA 4ZOLA 4A1FA 4JQOA 5JJ5A 3CWQA 1HBMB 3SZGA 2FWRA 1WB5A 4X91A 4KRXA 4MMOA 1P4RA 1SOMA 3VZQA 4KVGA 3VPDA 1QAOA 3G96A 1J8YF 2IIQA 3V8MA 4LF5B 1E1LA 3I87A 1QJCA 4JVOA 4LPSA 4B80A 4AJNA 4KIJA 1D8YA 4QPXA 2B0JA 2HMUA 1MAVA 4ZVTB 1YC2A 3DRRB 4XQGA 3RB3A 3AILA 3D4OA 2LA6A 2JLFA 3P5SA 1NAIA 1YA8A 1QG2A 1YBHA 4BE7B 3K17A 4NLOA 1D4FA 4N8OA 2CDNA 1BGWA 5K45A 1YZNA 2HX1A 4BLOA 4CLTA 5BN5A 3RS4A 4J3FA 3SMQA 2VZ0A 3HRKA 3W5AA 5KFHA 2O06A 3KZXA 2I4LA 1P5ZB 4RKRA 2ZWOA 2B5WA 3EYAA 3T34A 2VONA 3P9CA 1RGVA 1GR0A 2KDOA 4XH9B 4H59A 1DFHA 3HCCA 3NYWA 3K6RA 1YFZA 5DNVA 3L4EA 1EFKA 3HJNA 5CFPA 3RF6A 3L6EA 3PYEA 4Q3BA 1XZMA 3GFOA 3VDMA 5ICEA 1KLMA 1T3TA 3O1HB 4LYEA 1Y9JA 5J2MA 2NZUG 3I0NA 5KCMA 4KK4A 1CUGA 4AN0A 4DSKA 1CDZA 4JKIA 5KFXA 2OPLB 3DL7A 1ZOTA 4IQ8A 3ADCA 3C39A 4GMKA 1X77A 4K7JA 2IBSA 2ZB2A 1Z6QA 3M81A 5EIAA 1NV9A 1X8XA 5HO4A 2AX0A 4ND5A 3BZWA 2YH0A 4BQNA 4S0XA 5HATA 4OKSA 3WADA 4PICA 1YBVA 1HIYA 5FD1A 1CUWA 4LXGA 4CF7A 5BNIA 2BZ2A 3RYTC 3IEMA 1KN6A 3VISA 2CBZA 3H2HA 5EYPB 4BJ6A 3K5WA 1HDIA 4TRNA 4MGHA 3VSEA 2CZCA 3RAMA 4YP1A 3AB7A 5AW6A 4M9QA 1MB3A 1KYYA 1Q1BA 3MD0A 4B0PA 4BAZA 4OYBA 2XYQA 4CM9D 1H72C 4NDAA 3RPEA 1NT4A 1H9BA 2OMOA 1N6IA 1LQTA 4B3MC 3I5UA 1KQGB 2FGJA 3FMOB 4FEEA 1LRJA 3DOJA 1I24A 4UFNA 2I5JB 2XSJA 3UO0A 4X1KB 5CEFA 4OG2A 5L95A 2M98A 4ZTUB 2EFGA 5JH7A 2K2QB 1OAOA 5NULA 3DKDA 4RVOA 3A6EA 2Y1DA 2VFRA 2VAVA 5KT3A 4Q3OA 4JI2J 1ETUA 4DL5A 4LSZB 3MAGA 2D1SA 2W6OA 1SXJE 2C2MB 1TC1A 2ETXA 1FO1A 2C5FA 2B25A 3BF8A 3EASA 5D3KA 4AMYA 2KBFA 3R0ZA 1U3VA 1JYSA 3KUHA 3ILJA 1TZ2A 2CQCA 4XK8C 1LTQA 2X0FA 1EXVA 1HDOA 1NURA 1ZFNA 2DNLA 3Q0EA 4FYHA