2ZZNA

The complex structure of atrm5 and trnacys
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
336
structure length
336
Chain Sequence
MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords Uncharacterized protein MJ0883
total genus 81
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zznA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zznA03
4PNEA 1JTEA 1BKYA 3I53A 5K0LA 4BP3A 5EMJA 2G1PA 2JG3A 3B3JA 3GO4A 3QV2A 1X1AA 3PB3A 2P3OA 3TFWA 4AZSA 3NTVA 4RTKA 3TOSA 4QVGA 3VC2A 1O9HA 2HNKA 2ADMA 4M38A 1FBNA 3RIEA 2G8NA 5HIJA 5C9ZA 5GP1A 4P7FA 3OU6A 2C7QA 4DA4A 2PX4A 4PYKA 2YVLA 4AZWA 5K8VA 4C04A 3T0IA 2NYUA 5CIYA 4O29A 4PGHA 3KQVA 3LDFA 4ER5A 5E9QA 1QAOA 2ZBRA 4P7JA 5ICCA 1VP3A 2PXXA 3DXZA 2WA1A 2ERCA 5EPEA 1O54A 5ICEA 3TMAA 3FTFA 3MB5A 5E1BA 3AXTA 2E5WA 4PYOA 5E2AA 2YXLA 3KR9A 5EG5A 4FZVA 5GIPE 1WXWA 1F38A 5E1MA 4E33A 3EGVA 3DMGA 4IV8A 4YUWA 2NXEA 3QOXA 2YUIA 3H2BA 1JQ3A 1R00A 4EKIA 4UOEA 1NT2A 2GLUA 2ZTHA 4YMHA 1NW7A 1VQ1A 2F8LA 3C0KA 3GXOA 3FUXA 3EVDA 2NXNA 4RTPA 4X1OA 1NE2A 2PX8A 3BWMA 5EC8A 4BY9E 4E30A 1R8YA 4RVHA 2B3TA 2FPOA 5D1HA 5LR6A 1XJ5A 4E2WA 3DLCA 1VL5A 4FSDA 4RTJA 1X19A 5MHTA 2IH5A 1B42A 1XTPA 2AS0A 1L9KA 5E8JA 2B9EA 5KVAA 3GRUA 3G5TA 4LWOA 4QDKA 3MTEA 3UJ9A 5EHIA 2FYTA 1G8SA 2V74B 4QQKA 3F4KA 1P1BA 2I62A 2ZIGA 5K0NA 4R6WA 4GF5A 1M6YA 2I6GA 4MIKA 2UYQA 2PKWA 5EHGA 3SMQA 4YUXA 3ER8A 2FCAA 3BZBA 4ER7A 3I58A 4PYQA 5EOVA 3EPPA 4HTFA 5E1DA 3VC1A 2G70A 4EK9A 4EKGA 3ID6C 3EVGA 5U4XA 1WZNA 5KQSA 3NWEA 3M70A 4IWNA 2BH2A 5GM2A 2OXTA 3O31A 4BLWA 4DMGA 4ER0A 4XUCA 4QTUB 2JHPA 3PVCA 7MHTA 5EKXA 1G8AA 3VYWA 3HVIA 4HGZA 1HMYA 2IPXA 3B89A 3R0QA 1NV8A 5DX8A 2CWWA 4BLVA 1YFJA 5EIFA 4BLUA 3LSTA 4OBWA 4KIGA 5T67A 4DQ0A 2P41A 2OO3A 3EVBA 3KQPA 3R24A 5T6BA 4F85A 4RTLA 5LQJA 3BT7A 5DXAA 2YXEA 4FS8A 2ZBPA 4FGZA 3EVAA 2AN5A 3OFKA 4MTLA 2QY6A 5IH3A 5FHQA 3KQMA 1RJFA 3HTXA 3LHDA 1G60A 4K6MA 3A7DA 3UJ6A 1P1CA 2ESRA 2CMHA 2QRVB 2IBSA 3FRIA 3NDIA 5BXYA 5EEGA 4QDJA 2AOUB 3M6UA 1JQEA 3UWPA 1TW3A 4GOMD 3TR6A 3LDUA 1YZHA 4RSRA 3U81A 2BR3A 5H02A 2UYHA 2IH4A 5CVJA 2ZIFA 3PT9A 1SUSA 3LKDA 5K03A 3DUWA 5HFJA 2VZ9A 1G38A 3TQSA 5GOZA 4OX9Y 2QRVA 4CKBA 3SSNA 5HIIA 5KS2A 1I1NA 5GWXA 3HVJA 2DPMA 4ZTBA 8MHTA 3P9KA 2PXCA 3G89A 2GH1A 3FRHA 4WVLA 1FJXA 5GINE 3IYLW 2AVNA 5K01A 3G2OA 1EAMA 4AZTA 2BM9A 1Y8CA 5FA8A 1G55A 5JR3A 3UJAA 5F2NA 5CM2Z 3CC8A 3NW9A 2PSSA 3FPEA 3OZTA 3FPFA 3FUWA 3SSMA 3ELYA 5F2KA 5FA5A 5DM1A 4E31A 3X0DA 1MJFA 3PS9A 3OE5A 3CGGA 3DH0A 5LQAA 2XBMA 1D2GA 2AZTA 3G8AA 2AOXA 5DX0A 3IEIA 4EVIA 4RYLA 2C7RA 3OFJA 4RV9A 1VE3A 1DL5A 2BZGA 2ZBQA 2AVDA 1IY9A 3QOWA 4RTQA 4KVZA 2OKCA 1DUSA 4HSGA 3VSEA 5K0EA 3OE4A 5EMMA 4A6EA 3CVOA 4MQ4A 1QYRA 4AZVA 3FTDA 1XDSA 3GWZA 3C3YA 5DTQA 2ONYA 5LQRA 2BR4A 2VP3A 3B3GA 2JHAA 2K4MA 3EMDA 3P9NA 4GOLD 4PYLA 3SGLA 3E23A 3HCFA 5FWDA 1D2CA 3P2KA 4HC4A 3HA3A 2BM8A 5CVEA 3G5LA 2C7OA 4QPNA 3Q87B 5DSTA 3KHKA 2AOUA 2P7HA 4OA5A 1SVUA 1X1DA 2IFTA 3IHTA 2GB4A 3FUUA 5GM1A 3TM4A 4R05A 2ZZNA 1NKVA 3SVZA 3TPZA 1XCJA 1T43A 2PX2A 4PYMA 1O9GA 2PY6A 2ZSUA 2PLWA 4B17A 3JWGA 5DX1A 4YV1A 1RI1A 4YUYA 2N47A 2LD4A 3GNLA 3LBFA 2G71A 3HP7A 3DXYA 4YV2A 3C6MA 4POOA 2V7EA 4R6XA 1Q0SA 3ELWA 1AQJA 5DTMA 4DM3A 3G8BA 5ICGA 4OQEA 2YTZA 1SQGA 3G2PA 4M36A 4RVGA 2VDVE 1JTFA 3B7PA 4CKCA 1XDUA 3THSA 1YFLA 4R8RA 4MHTA 3P9CA 4U7PB 4RTSA 2NXCA 1WG8A 2P3QA 1ZKDA 4FSXA 4V0QA 5C1IA 2ZIEA 3MAGA 4YMGA 2A14A 2P35A 3G2QA 3G7UA 3EVFA 4CXMA 1YUBA 2Q41A 3LL7A 3DMFA 4IV0A 1XDZA 1NW8A 4XCXA 4CKEA 2NXJA 1KP9A 1NBIA 3PX3A 2PX5A 2QYOA 2YQZA 3KR2A 5FWAA 3UA3A 3NVKI 2NP7A 2JH8A 3EVCA 4DF3A 2YX1A 1ZGJA 5K09A 3PX2A 1EG2A 4PIPA 3OU2A 4YV0A 4X63A 1WY7A 3A7EA 3FTEA 3KKZA 1N7IA 1L3IA 4M7RA 4GOOD 3GIWA 3FYDA 5P8WA 2PT6A 5EGSA 1L3BA 5HZMA 3THRA 3PTAA 4RWZA 2CL5A 2ONZA 3HCCA 3JWJA 3GRVA 5B1SA 4KIFA 2JJQA 4H0NA 3SM3A 1X1CA 4A6DA 3EEOA 3LCCA 3ME5A 1RI2A 1ZGAA 2XVMA 2IDJA 3ELDA 2FHPA 2IP2A 2QM3A 3A27A 4PYJA 3L8DA 3ORHA 3I5UA 1ZG3A 5DRTA 4PYIA 1NW6A 3HA7A 3KU1A 1BHJA 2HWKA 3BWBA 3BGVA 5FQOA 3TLJA 4EQZA 2ZW9A 1EJ0A 1YZ3A 5F2OA 3M6XA 1KHHA 3G88A 1QAMA 2EG5A 5LSAA 3BKXA 3EEYA 3BKWA 3PFHA 5FUBA 3TM5A 3A25A 1JR4A 3HA5A 2EFJA 2PXAA 5CVVA 5ERGB 2R3SA 5EEHA 1NV9A 3E8SA 4FT4A 1PJZA 3MCTA 3UJCA 4HTFB 2HV9A 3K6RA 2PVCA 1SKMA 3R9XB 4FT2A 1R18A 4HH4A 5D1NA 3GDHA 4FR0A 1WXXA 3G2MA 2ZZMA 2H00A 4KDRA 5FADA 3TKYA 3UJDA 3UFBA 5DRYA 4QQNA 1NW5A 3OCJA 1L1EA 4HGYA 5IKMA 4GUAA 3GGDA 2Z6AA 3ERCA 2QE6A 3KQWA 1UFKA 3PFGA 3CJTA 3DP7A 1IXKA 2ZLBA 4PCLA 1ORIA 1P39A 4PYNA 2FK8A 2P3LA 1P91A 3HCEA 3T7TA 4ER6A 1Q0TA 9MHTA 1U2ZA 3EMBA 4C05A 3AXSA 1BC5A 3JWIA 3OZSA 4PONA 2OYRA 1N7JA 2JH9A 3NJRA 2IH2A 3FTCA 1RJDA 5DT2A 5EMLA 1KYZA 1R8XA 2B2CA 1KR5A 3GRRA 5BW5A 2UYOA 3KPWA 1X1BA 1R74A 2GS9A 1V39A 2EX4A 3EVZA 2AN3A 5E1OA 2GAFA 1I4WA 3LCUA 3KR1A 5G02A 3REOA 4GEKA 2H11A 1RI5A 4RTMA 3P9IA 3UJ8A 1QANA 3KQYA 4E2XA 3MTIA 3GJYA 5CD1A 2VDUE 3KQQA 1XXLA 4PWYA 5K05A 2AOWA 2PBFA 5FQNA 2PWPA 3DTNA 1TW2A 2G72A 1JG1A 2O05A 2HMYB 3HNRA 4KW7A 2O07A 4E2ZA 3V8VA 4ISCA 2WK1A 4NECA 3I9FA 5C0OE 4OA8A 4PCAA 1RI3A 4XUDA 3BXOA 3MCZA 4M37A 1EIZA 1SUIA 3KQSA 2PV0A 3ANXA 2EJTA 3GCZA 5DPMA 5DXJA 5E8RA 2XYVA 2XYRA 3BWCA 4KWCA 5E2BA 3M33A 1INLA 4JXJA 1I9GA 4E32A 2P8JA 5KYGA 3ER9A 2IIPA 2OY0A 4RVFA 3SX0A 4MWZA 5K0CA 5M5BA 3CJRA 4YUVA 3C3PA 4GC9A 2OPBA 5CCXA 3BUSA 2PJDA 2IGTA 4DCMA 5K0FA 1NBHA 1QZZA 4FP9A 5HIMA 4BP1A 1YB2A 2AOVA 5K0GA 4RTOA 3GU3A 2AN4A 5DLYA 4HG2A 2FK7A 3NVMB 5FCDA 5FULA 2ZWAA 3DXXA 2OB1A 4DKJA 3O7WA 2ZWVA 4U7TB 1AQIA 2P7IA 2I7CA 5DM2A 4F84A 4HRAA 2O06A 2CMGA 3EGEA 3FUVA 4LWPA 5EKUA 10MHA 2B25A 3M4XA 1ZHFA 1MHTA 2AOTB 1G6Q1 2ZULA 3BWYA 3K0BA 2YXDA 5EIWA 4AX8A 2Z6UA 2PGXA 3KPJA 3FYCA 3KQTA 3KPVA 2JHCA 3ELUA 3SXJA 1FP2A 2ZCJA 3HM2A 4WXHA 4AUKA 3M6WA 2Z6QA 2PT9A 1BOOA 5K0BA 5KQRA 3UJ7A 3T7SA 1D2HA 1KIAA 2H1RA 1EJ6A 3GRYA 3MHTA 4C03A 1NW3A 5FHRA 1VP9A 3CKKA 4X41A 5GIOE 2KW5A 4YUZA 3CJQA 3S68A 1ORHA 4C07A 3HEMA 2B78A 3DLIA 3UBTA 2P1DA 1VPTA 3A26A 1RI4A 3FPJA 4F86A 5BP7A 2IDKA 1WS6A 5EMKA 5HEKA 3KPYA 4Y30A 3TKAA 3AJDA 2I9KA 1FP1D 3LKZA 3OZRA 3MERA 1KXZA 2OZVA 3KPUA 4C08A 3BGDA 5DM4A 3LCVB 4G56A 4QVKA 3UA4A 1DCTA 5CVDA 4LECA 5JUWA 4RVDA 2UZ4A 1KPGA 3DR5A 4CWAA 3UJBA 3AWIA 3MQ2A 4L7VA 4Z2YA 2HR1A 2FRXA 1JSXA 4DZRA 1SG9A 3SSOA 4C06A 5EZQA 3P2EA 3NWBA 2OBFA 4XUEA 4PINA 1OR8A 5HOQA 2EJUA 2OB2A 4GQBA 3PLAE 5DM0A 4PIMA 4IKPA 4RX1A 4LG1A 1PRYA 1VBFA 3HVHA 4E70A 5CVUA 3M6VA 2C7PA 3IV6A 3LBYA 1RJGA 3B5IA 3CCFA 2AR0A 3DMHA 2ZZKA 4CTJA 2Y1XA 1Z3CA 3BGIA 4PGGA 1IM8A 1YF3A 4GC5A 3OU7A 2XVAA 3EVEA 3C6KA 4QTTB 2O0LA 5DSXA 2VDWA 3RW9A 1R6AA 2PWYA 3FPGA 5LQCA 4V0RA 3FZGA 1UIRA 5EVJA 5LQUA 3T7RA 1VLMA 2GPYA 3SR4A 3EGIA 1ZQ9A 3CBGA 1L3CA 1EQAA 3AY0A 1VIDA 2DULA 1KYWA 2O57A 4P58A 4P7KA 4RTRA 1N2XA 3NMUF 3HVKA 1AF7A 3DULA 4ER3A 5EQJB 5LQKA 1KPIA 3HCDA 3B3FA 3KQOA 1JG4A 4KRGA 4R8SA 1M6EX 3O4FA 4OBXA 2ZFUA 4KDCA 4OQDA 5HIKA 1HNNA 2ORED 1H1DA 2CKDA 1JQDA 2HTEA 3FUTA 4X60A 5HILA 5T64A 3P2IA 3LDGA 1UWVA 3LX6A 1JG3A 3DOUA 4X61A 5DTRA 5FTWA 4E2YA 1M0EA 2UYCA 3NDJA 3WSTA 2WA2A 2VS1A 3R6TA 4GBED 3HCAA 4CTKA 1F3LA 2XYQA 4Y2HA 2NNWB 1SQFA 3UZUA 2YR0A 3LECA 3LGAA 3D2LA 3P97A 4C4AA 1JSZA 5CCBA 2R6ZA 2BR5A 5DWQA 3KR0A 5E9WA 5LQNA 3HCBA 3V97A 5K0JA 3E7PA 3P71T 1XVAA 2IBTA 3JWHA 2Y1WA 3E05A 1KPHA 4ATNA 1XCLA 3Q7EA 5BW4A 3TRKA 3GRZA 2AOTA 2NP6A 3OPNA 1RJEA 3LPMA 4P7GA 2GA9A 1JG2A 1TPYA 3R3HA 3P8ZA 5EZSA 5CUQA 3RODA 4RTNA 1AV6A 4QPPA 3FPHA 2ZVJA 1QAQA 3I64A 2P40A 4GOND 5E9JA 5ICFA 1FPQA 4DCGA 3A4TA 3MGGA 4EMSA
chains in the Genus database with same CATH superfamily
3STUA 2R8BA 3DZKA 4G36A 5ETKA 1M7BA 2HQIA 1P1KA 3IP5A 4DIEA 4GVXA 1X31C 1DPGA 1UT6A 4L16A 3KKPA 8RUCA 3VAHA 4RCVA 4LF6F 5CIQA 5IDVA 4Q5VA 3N8HA 2I3DA 3L3CA 4ZOBA 2HIMA 4IMJB 3TN7A 2FIUA 5IHXA 1IBLB 4EUSA 5GPBA 3L6CA 3CNQP 5BORA 1QM5A 4C2UA 3RUPA 3RG2A 4DFPA 2BKPA 3E2PA 3HXPA 1JVNA 3VOTA 2GMHA 4G1IA 2XTJP 4GECA 1Q7RA 3BWEA 5DFAA 1EARA 2HMWA 3D0OA 4KUEA 4CUZA 4EK9A 3TOVA 1G18A 3KNZA 4CF3A 2D1CA 3CVUA 5JZSA 4MS4B 4UOFA 1RQNA 4DJFC 3DHNA 5AW4A 1FQWA 4ECVA 1XIQA 2XRZA 5EMNA 3NO4A 1VRUA 1XERA 2OCGA 5CEFA 1R8AA 4IZIA 2AOUB 4DWIA 1KQFA 1EK2A 2BR3A 1S0UA 1P2DA 1A50B 1OWXA 1ONNA 4FXPA 3C6TA 2RF2B 2VLIA 1WELA 4I1VA 3SEFA 1N5SA 5DI3A 1EWRA 1YIJS 1JKHB 1WF2A 3QOFA 3NKYA 4H0FA 1RQ2A 1A82A 5J4KA 1WKJA 4PZVA 3FUWA 1QE0A 4Z4EA 4GSLA 3UAXA 1ZAKA 3K59A 3UGKA 3DU5A 2HDNB 3QU9A 2J6HA 3A8IA 1NPYA 1H0RA 1WW8A 1PD1A 3V81B 1YQTA 4YMTA 1ONSA 2IE0A 5D3MA 1AURA 4OQMA 4KHPB 4LHYA 1CF9A 1EIYB 3LG2A 5DMHA 4FF2A 4BECA 3JYNA 2PRYA 3UATA 5F52A 4ZDWA 3LUDA 4EECA 1T43A 3LQQA 2A0KA 1ST2A 4O0LA 1YZNA 1SQGA 1HY3A 3B1WA 2J8ZA 1PUXA 3IQEA 1U65A 1IVZA 1KJJA 4QHSA 3AM3A 4XX1A 3PHTA 1Y89A 4ED7A 4P72A 3QVMA 3JALB 4DDWA 4AJPA 2DMRA 1E2UA 2GK7A 4OYPA 3IRVA 4BYMA 1XNRB 1DIOB 4Q03A 1JIJA 4RQAA 1Z6XA 2VKTA 4FEYA 1A04A 3PQEA 4CT9A 5EWMB 4MLCA 3AY6A 3D7SB 2VJUA 4TKMA 2V97A 3DZ8A 3STYA 1U8ZA 5C24B 3MCTA 1X5OA 4DQXA 2UUCC 1RT5B 1QIMA 3ZOKA 2R48A 1E3IA 3EIXA 4RQBA 4WZZA 1TCVA 1Z4MA 4HAWA 4RY0A 3MWEB 3PT5A 1MABB 3KZ1E 4W90B 2O19A 4ZPDA 3ECSA 4HUQB 5L8VA 3B6JA 4PCAA 1DKOA 3HXMA 3FI0A 2V59A 3U62A 3M9NB 2FMIA 1R9GA 3TR5A 3T1YJ 4UM7A 2MSEB 1VPLA 4RJVA 2CPHA 1O92A 5FL7D 1T26A 2AFHA 4F9GA 4EA6A 2RFLA 4TKUA 1OB5A 4B3SF 4JLSA 3CCMS 5KG0A 2C4NA 3GPAA 3TPFA 1FRKA 3HK2A 4JU8A 2ZULA 3T5TA 4QECA 2JLVA 1SIUA 1B8PA 2VYCA 1JEYB 3SQOP 3TXYA 1P0PA 4MDYA 4II7A 1CUIA 2GZDA 2DQZA 4YCMA 5B2EA 3KLGB 3EG9A 3RVNA 4OJ1A 4MVWA 3QUQA 4YN3A 1ACMA 2DRDA 3EXIB 2YXPX 5B57C 3OY7A 3H9EO 1S48A 1KXZA 2AHRA 1KVRA 3QHQA 4XGRA 4JLNA 1XKXA 2Q3LA 4LE1A 3K2YA 4EGSA 3CB4A 1ZD5A 1WU7A 3GD7A 2AV5A 3OHBA 4NLVA 3IR5A 2MKSA 2YX4A 4XW2A 3IMGA 4Y2KA 3EZYA 4IJVA 4O6VA 1YJCA 4YHBA 4CUKA 2CKDA 3RSOA 3M5DA 4IH1A 4LJ5A 3NXZA 5AKLA 3OIGA 1KBQA 3DZDA 4WCEQ 1DG9A 1DC8A 3NY0A 3VAYA 1XU9A 3MLEA 3KJNA 2Y1WA 4A6PA 2Q5CA 4K46A 4TMTA 2DGTA 4W98A 3CLKA 3RU2A 3I32A 4LYYA 3MOJB 3C74A 4BLGA 3WK8A 3FDZB 4AL7A 3NWJA 5CYFA 5E7OB 1DGQA 1ESCA 2RBEA 2B4VA 3D67A 1CUUA 1DPFA 1U2TA 2IUUA 4C0QC 1QVGR 1RZUA 5K8VA 3I1JA 5KVVA 3ZXYA 3M2VA 1YS4A 4MVJP 2MKJA 4MAKA 2ZJOA 3N8NA 5E9QA 4XVUA 1VP3A 1YZLA 3WWCA 4X66B 1T5DX 1SV5A 1AUOA 4F04A 3IUSA 2XEXA 2V0GA 1NYRA 2PUWA 5ERXA 4QFBA 3EVDA 5BMVA 3G9ZA 2E5LF 4ITVA 3N54B 1DURA 4ECAA 1PO7A 3LC2O 5EZYA 2EKNA 4J37A 2GFIA 2CV0A 2QORA 4ZTUB 3V8RA 4HH0A 2FDRA 4BFVA 3OHPA 4DIFA 2Y0PA 1CUGA 4IOAQ 1R10A 1ZUIA 1XHJA 4LF9C 4AJ1A 2NU6A 3GV5B 3SNKA 5KFRA 3TRGA 5L3ZA 4E1VA 4BCAA 2CVZA 1M66A 3HU1A 3AUFA 1Q57A 1QHNA 2E9SA 1E20A 4UD6A 1XUOA 2V8VA 2VQ6A 4YJFB 3RYCA 1SVSA 5JYCA 2BEVA 1EX9A 1RT6A 2AMFA 2QRVA 3OHMA 5AFSA 3JSXA 4H4MB 3KLHB 2O8VA 3R76A 4M55A 3X1KA 2XDQA 3OQ1A 2B8NA 1MUUA 1B0VA 1A69A 1N32B 3PHEA 5BUZA 1BWEA 4MKGA 1RFGE 1U0HA 4RHTA 2C83A 1Z7YA 4UUNA 3R9XA 3FI9A 4TMWA 1X80A 1JDBC 2ZU6A 3TSOA 2W9BA 1RMYA 1W36C 4AU1A 1TFYA 3CR3C 1SY7A 5CP8A 1QIKA 1D4ZA 2PEBA 3LZ6A 1Q1BA 2UDPA 2JL1A 2DNMA 3RHFA 3TF5A 1S2IA 1T0IA 3COYA 2PNFA 1CY8A 2OQIA 3KP1A 1E77A 1TK5A 4Q12A 2HNZB 4LF7F 2BE2A 3AOBA 1X1DA 4WXEA 2EKPA 4TWRA 5JROA 3PROC 3C6MA 3OQJA 1CVIA 5JMWA 3FSGD 4GAEA 1H2BA 1DAMA 5CITA 3C7DB 3DC7A 4LF9B 5KU1A 2OFPA 1OWOA 4HQOA 3R7NB 3GPLA 3LAXA 3SG0A 4YV0A 2VUHB 3FTEA 4L4ZA 4KIUA 3M4YA 3Q5DA 2P68A 4BVHA 1TZJA 1V1MA 2CDCA 1HZZA 5CMLA 3RV4A 5HBMB 3HR8A 4EBBA 3MYRA 5E6UB 5FQOA 5HVHA 3L02A 5JFTA 4QD3A 4AP5A 1AKEA 4PHFA 1TCUA 3VNRA 1V0JA 2W2XA 2XBUA 3R3WA 1DBVO 4D3ZA 5BSTA 3BOSA 3BGOP 2Y71A 2F8EX 4U0JA 2QE6A 4E5PA 1CVLA 1OH6A 5U9CA 2JH9A 4JSYA 2EX4A 3CTRA 6PFKA 5AJ3F 3GFXA 3KQYA 3BFKA 2FEWB 3MGAA 1ODIA 1XMXA 2NYIA 1U5CA 4GOJA 2IS4A 3HRKA 1NLYA 2UUWA 1HDOA 3ZLBA 2QM0A 2CDNA 1S76D 2W2KB 3V33A 2WOOA 1I0ZA 3QXSA 5LMNB 5KWEA 2E9RX 5IFLA 4GPEA 4U7TB 2WU1A 3C5CA 3FUVA 4Q0MA 4IDDA 2ZE8A 4BVKA 5B0EA 5K2OA 1COWD 2WWFA 3QVWA 1D8ZA 4RYDA 2NV2B 1RAHB 4WGGA 4C4TA 4LF4J 1A4IA 3KU4A 1YITS 5KOXA 3EIQA 2OWEA 4U7HA 4DX7A 1RYZA 3J7Z5 1E3DA 2PUVA 3D4LA 2OV4A 4C08A 4HFNA 3LCVB 4V02A 2GUWA 2O0JA 2FUG1 1XJCA 3BGUA 4II3A 4EJMA 2ADCA 3GT0A 2HNYB 2O2XA 3V1YA 4RD6A 3HFVA 4K8OA 4CLSA 4AZ0B 3FFWA 4FKXA 1IY8A 4B43A 3R7SB 2OTCA 4GO7X 3ZCRA 2R25B 3T1AA 1A76A 5I4IA 1N34B 5FTNA 3AY0A 2LU1A 4NOZA 2I4TA 1DX9A 2E5LC 1KPIA 4JYAF 3HCDA 3FVYA 3RF6A 1AXGA 1CUYA 4HKQA 3N01A 3IWXA 5IT9A 3KNGA 3AQOA 4HZUB 2XE8A 4WFJA 1LW7A 1L4GA 1ZOTA 4BBYA 1MV8A 1P1TA 3M8YA 4OYMA 4DRYA 1X0PA 6AT1B 3BH7A 5CUQA 5LVAA 2IU4A 4BNLA 5CDSA 5JJLA 3U7RA 1NTRA 4BP3A 2G1PA 3QAUA 4YRBA 3HADA 2JSXA 1MQ8B 5FORA 3HF5A 4KR3A 3VOAA 4AZWA 1SZDA 4AMBA 1NSQA 1FNDA 4P7TA 1WRBA 4OQNA 1N4DA 3V9AA 4JQCA 3LO5A 4HHJA 1XA4A 4KG7A 1U0JA 1Y37A 1KZ6A 1O5OA 1HIYA 3UCGA 3U44B 1PCAA 3WMGA 1Y0HA 2BJOA 4YQYA 4V3BA 1KI4A 2N1BA 2WPDD 3DBRB 1PJBA 4MV1A 5TV2A 4DN0A 2IXTA 3CUNA 3IVXA 1OU0A 4PHCA 4RDHA 4JOQA 4Q1FA 1SKUB 4IRMA 2JFOA 3EVGA 5CG2A 4UXIA 4R9VA 2HU8A 1JGTA 3TQIA 1RAIA 1R27A 3KUUA 1D1SA 4NQZA 5LQJA 4MVJA 2MPUA 4HDOB 4JI5B 1D1PA 3HMQA 3PW7A 5DBIA 3AUAA 4GWLA 3RJZA 1NVWQ 4LHXA 1NA5A 2JD0A 4WK0B 5G4KA 1K68A 1X4BA 5KS2A 1VL8A 4J0EA 2MZSA 5K85A 3C43A 4FHGA 5FLXY 4FUTA 3R2CJ 2JBAB 1NYQA 2OORA 1UAAA 1NG1A 2HHAA 1WAMA 2VJBA 4B40A 4LXUA 4M60A 1O93A 2VK2A 1SXGA 1FTQA 3QEAZ 1CRZA 5FR1A 3K1JA 1QTRA 4UMEA 2ZBQA 2C2RA 2IVYA 5IM4A 4A23A 4CNBA 5HKBA 3LAWA 3SJBA 5GAJA 1WB5A 2BMJA 3TW8A 4A4JA 4DR5C 2ZI6A 3DB2A 4LRSB 2VRNA 5CPFA 2JVOA 3JQ8B 3DFKA 4HNRA 3IERA 1TTHB 2KS6A 1E5DA 3AEYA 4PAAA 4XWOA 5IDQA 5CEEA 1QAXA 3QOYA 3W90A 2YTZA 1NULA 4L6CA 3BA1A 1NQWA 1TVEA 3W77A 4URHA 3ZKWA 3W2FA 3AUJB 3J7ZT 2P3QA 1NE7A 1UVNA 1WZ2A 4KU4A 4QHYA 4FVMA 3R5JA 3PXEA 1L3BA 2GO8A 3WGTA 2ZYTX 3PKYA 4KPGA 1UMDB 4DBLC 2VH5R 3BPDA 2C97A 4P2MA 3JYTA 2W4MA 4M83A 2RGBA 3WRWA 1YVFA 4F71A 3G8TA 2DGSA 2ROEA 1LJUA 3PPIA 1NW5A 1VB5A 4QOIA 4AWBA 1VJ0A 4PPZA 5KTTA 1JLQA 3T9FA 3KXKA 3Q88A 2GRAA 3PZBA 1ZGGA 5FF9A 2E4AA 4QRIA 2AJCA 1YBUA 1SIOA 3OM8A 3N2NA 3EVZA 4UNSA 1V39A 1SOUA 1B4DA 3USZA 2F4VJ 4CF5A 1R4AA 4EG8A 3A11A 2PCJA 3QM1A 4HFJA 4K03A 3K32A 2O20A 1GCAA 2E3JA 5EYPA 1ZRHA 5GQSA 4OA8A 1EIZA 1VJ1A 3ZGVA 3KWJA 3IAUA 2ZI7A 1FMTA 5L4NA 3ER9A 3OJUA 4LX0A 2XOEA 3NANA 3LWLA 1QAYA 3RIXA 2FWJA 5KFVA 3NVMB 1KMNA 1L4HA 1GT6A 4RZRA 4DLPA 4HNVA 2UV8A 4K9KA 2Y93A 4JI8C 2EP5A 1GPJA 5G3ZA 1UWBB 1YJ7A 3E82A 5LMNC 4C8ZA 5DXFA 2MZRA 4B9TA 7FDRA 1Z0DA 3A12A 3T1HC 1AZSA 3CZPA 2BMBA 3D6VA 4UXJA 4CQNA 3UTCA 4AAYA 4MPRA 3TTUA 4DR4C 2J1LA 1R0YA 2XNCA 2GS8A 3SC2A 1A1VA 2RGDA 3TTXA 1QFZA 3EXIA 2Q6TA 5FBWB 3NETA 1CUCA 2X2EA 3GLFB 1IBKC 4IJUA 4ZOLF 4HYTA 4FMCB 2ZI5A 1I94J 1I1OA 3ZDYB 3C6KA 4JT9A 3TEGA 2WVCA 3FPGA 5D3KA 1A7KA 1G63A 4E12A 2VUGA 1IONA 4NFSA 1RHJA 4DR5F 2V96A 2GEFA 4W99A 4E11A 3UJ3X 3ICOA 2VP9A 3GB0A 3BBFA 1G5FA 2B5JA 4EL5A 2PKXA 1UDAA 4ZPTR 1VYVA 3UHAA 3FIUA 4MKXA 1NAQA 3MECA 3Q7EA 2BT4A 1CULA 4RQTA 3DE5X 4P10A 4GLLA 2BJ9A 3LYLA 3G79A 2WJ6A 1D9AA 3UVJB 3LANA 2R7TA 3JZDA 1JFRA 5AVUA 2CLIB 4RUBA 3QYFA 2IPOA 2JMPA 1F20A 3R5XA 2CIMA 5EXXA 3P5BP 1NU8A 2I55A 3MGJA 4G1QA 3QYAA 2D74A 3NP7A 4PPDA 2A4MA 3NT2A 4OV6B 3GEMA 4L5CA 5B7GA 1RXWA 3N6RA 4ZI2A 1CSEE 4PLPA 4OP2A 4BEVA 1ZD2P 2IEDA 3ZTOA 2VTKA 3OD5A 5DU2A 3CF0A 3GVPA 1WCJA 4C7MA 4D25A 2HKEA 3RTGA 4FFRA 3UJPA 1AXEA 2J7UA 5U4XA 3THTA 2RGNA 1D6NA 1B3RA 3JALA 3X2SA 2JDIA 3DQQA 5AM2A 4QASA 4QU7A 2IPXA 4WUTA 1WHVA 2DFNA 3LXRA 1HDGO 2IITA 4F0HA 1Q0RA 3K5HA 4QUJA 2NUTB 1RYMA 1E79D 2QSYA 2BANA 2ZRMA 1RBOB 4DA7A 3H5UA 2NTVA 2AK3A 1Q1EA 2HLUA 4ZLLA 1RYHA 2XE4A 4OZJA 3F7NA 2VXBA 3HKEA 4NZZA 2P6MA 1MAVA 4BO2A 3H2HA 4KQMA 1L5FA 3EEFA 1OGJA 5GZ6A 4XDYA 2AZDA 2Z08A 1QBGA 4IQ8A 4LRDA 2SCUA 3W05A 1VL2A 2ZH5A 5JWHA 1RTDA 3LUHA 1FFSA 2Y67A 4KMRA 4EVIA 3OOSA 3A4IA 4J7XA 1ZOSA 3MK31 4ZYWA 1O9TA 3USCS 4ENUA 1Y82A 1VL6A 2W8BA 1RZRD 1HNWJ 3HA3A 4IS2A 1OVMA 5I7AA 4U5YD 4NCBA 1E89A 3TM4A 4TMKA 3HUTA 2YV3A 3D5TA 3MW8A 1JJ2R 3KFWX 1SV5B 3M2UB 4PSDA 1T1SA 3O2QB 1C5KA 4KYVA 4BJ1A 2J4DA 3ZGLA 1YRQA 3Q3IA 3W2VA 4XD2A 2OO5A 3BF4A 2HZAA 5DLPA 1H7XA 3T7DA 1QPZA 4HKTA 2NYAA 1H0SA 4B6EA 2X77A 2NO4A 3D4BA 1XMIA 4ZQIA 3RSQA 2BJWA 2UYGA 2D69A 3DMPA 1ZJWA 1FFXB 1J9ZA 5REQB 1DWUA 2E8FA 1GZ5A 3NAMA 5BSUA 2HNBA 5EL0A 4CDNA 4P33A 2L9WA 2VRBA 3RB3A 3NEYA 2XUAA 1ZG3A 2FR0A 2G9ZA 4LNHA 4WKPA 2ZW9A 1KAMA 1MC1A 4QT0A 1X7DA 1GAEO 1FF9A 1GTJ1 3BPSP 3PJWA 1ZUNA 1DEHA 3VZIA 2V8PA 2G7MC 2MYUA 5D51S 2BE2B 2NUAA 4GI7A 1ZSVA 3GXBA 1CNFA 1CIJA 4PYNA 1P39A 1IKWA 1AHPA 4K7JA 1AO0A 1GRRA 2ENWA 3KBOA 2XGQA 1CR6A 2O14A 3G23A 4NH0A 2ICAA 3NG1A 1ZP6A 2YWXA 2KVIA 1T36A 1Q7YT 4QU8A 4DUGD 2O05A 2PT7A 3CF6R 1CNMA 3UDCA 1WF1A 1W19A 4OXKA 3MCZA 2LKCA 3HJRA 4LY9A 3RSLA 1MA0A 5A5FA 4ELVA 3NC0C 4D1YA 1YRTA 2AZ3A 1AYEA 3UDVA 3JZFA 2F2TA 4YJHA 5ARCA 1IBKB 3JR3A 3DXXA 2R8KA 2ZI3A 4DKJA 1H72C 3G7NA 2LXIA 3ZZTA 2P75A 3UMYA 3MFHA 1WXFA 2V55B 3T1YB 2OFWA 3G8YA 3PFEA 3BSWA 3IPRA 3ZU2A 1CK4A 1XEAA 2O6LA 3OUYA 2LMIA 4XJSA 1WSBA 2AFIE 3PD0A 2W0MA 4ALKA 1H73A 1YWXA 5JSKA 3LKZA 1LQ9A 2VF4X 5A05A 5E6SA 2MYPA 4DFJA 1M6VB 5J40A 3G6KA 3VNVA 5E6UA 2NREA 3H90A 1RJGA 2R1TB 4NXNC 5DM70 1HT2E 5KG1A 5LP6F 3RWOA 2GDZA 5EVJA 5IK2A 4HYQA 5CYOA 5T7LB 1VQ7S 4LYFA 1SGWA 2Y9HA 4L57A 5T3UA 4X90A 3CCVS 1UFOA 2YWDA 2W5UA 3Q6NA 4NX9A 2O2EA 3EAQA 3KHHA 5LZ5A 1M0EA 3EAFA 3S8EA 3KUEA 2AJFE 4A8XA 4TTTS 3M6LA 1CJTB 2YWBA 4ITUA 3A10A 1SH3A 2BJDA 5MFPA 1S7IA 5ILQA 4GLOA 1TPYA 2XITA 3R0VA 3J81U 4QODA 1KU6A 4YAKA 4BNFA 2IIVA 2ZT5A 4NOKA 3K0EA 2GQ0A 2C2WA 3LQ2A 4REOA 4YR3A 1VE5A 4ZVSA 1RYFA 5JAZA 1AFJA 2HNDA 3R7AA 3N9UC 4UDNA 2YQ5A 1UBNA 1KSHA 5AOVA 2FPRA 1N33B 2C8KA 3HJBA 1TDJA 1RCFA 1JKXA 3I9MA 5F7OA 1J07A 2JLSA 2JIZA 3RC1A 4G4SO 1P1BA 5BRNA 5JXJA 1YZFA 1DWQA 4MTNA 3WI7A 5JECA 2BJ3A 3TZQA 4P2BA 3IP7A 1VLHA 5DGIA 3A0RB 2W2MP 4WEQA 5MDHA 2KB0A 2BONA 4MMZB 4MO9A 4EP1A 4W6QA 1W36B 3EF0A 4GR9A 2D4AA 2NSBA 4M5HA 1JZQA 4DIMA 4PUGA 4DLAA 3A6DA 4F6LA 1T5IA 3HPQA 4N6NA 5E0KB 2Y77A 1HE1C 4ZK7M 1NDUA 2AFHE 5E4JA 2PXHA 3SM9A 2IBMA 2P3SA 3HJNA 1GLVA 4IJMA 4YCSA 2A1IA 3ITDA 4IG9A 2AGPA 3WADA 5A5DA 1DL5A 1KFCB 1NDLA 4COKA 5GJWC 3C97A 1RD4A 2AB0A 4O4JF 1E6KA 1JQJC 3D3KA 4FI3F 3ACCA 2QT0A 3N8GA 2ZK7A 4LOAA 3KZMA 2A0FA 2Q3BA 4NNPA 1U5BB 4C5CA 1LW6E 3SE7A 4QT4A 3HYLA 3H97A 2NU8B 2B8WA 1WLYA 1E4VA 1E0SA 3OR1A 3T0GA 4KY3A 3FOCA 3BWDD 1JI0A 5LNK6 2JFZA 4H08A 4XO0A 3W60A 3PUZA 3TNFA 4GEGA 3VHXA 4JI4F 1XRQA 4MEJA 1W52X 2HQOA 3HI4A 2C2GA 5KI6A 1HG0A 5K8UA 5T8TA 1T4BA 1W5AA 2CQ0A 1B64A 1EJ0A 1T8RA 5KFHA 3ZXUB 4S1NA 3ZWDA 2W71A 1STOA 3BZQA 4F36A 3FFTA 5JU6A 1IQPA 5I3UB 4XI9A 3WBJA 2G9OA 3L79A 4ZQEA 5LLDA 3G2MA 3S8YA 1IJKA 3AI2A 2ZH9A 2AJQA 2IM0A 3D28A 2VA8A 5HK9A 3ESCA 1CJKC 4ER6A 1U2ZA 4G0QA 1M54A 4QWEA 3W5BA 1M34B 1QGZA 1GCOA 4JI5C 5FPSA 3SYNA 2UZAA 1LWEB 2OTJS 2C20A 4ZCTA 4LRYA 5JLJA 5NLLA 5BV0A 4HMPA 4S0ZA 2D2IA 2GCOB 2DGWA 2XM3A 5G0RB 2CPXA 3LHSA 2E82A 3F67A 3PFBA 2EKZA 3U4GA 2YRXA 4NK4A 4JBYA 1NXPA 1MO5A 1SMKA 1AZSC 3A6EA 2XCRB 2GIQA 2DO0A 1NYTA 4BVJA 2IXDA 3IQWA 3MM6B 1GMUA 1RXIA 1Q81T 1A7JA 2HL6A 1C30B 2NW6A 5ADHA 3RC9A 3HM2A 2BLNA 4GKJC 3SFTA 2VG7A 2IAJA 4AQYB 1WW2A 1RKQA 1J5OA 2IT1A 3GC6A 1XMSA 5EMKA 4Y30A 2GM4A 1HDXA 2LXFA 3OW2R 3L07A 4C0SA 2A92A 2CZGA 1ANKA 4NJEA 3AEKB 1QGED 3QFFA 4DQVA 4P52A 5LSOA 1H4VB 2VUUA 1JK9B 5LMZA 3OESA 2CAJA 2A3NA 3AXMA 2IP4A 2Z95A 1T9KA 2CCJA 3CBGA 4ZN3A 2B0GA 2ZTUA 4N39A 4OJYA 3DBHA 1KJNA 1NJSA 3T94A 3DVSX 4GBED 3WL7A 2K2QB 4MQ6A 4FHDA 3L8EA 1JIXA 3X1XA 3FCSB 3Q2IA 4Y18A 1LLCA 2YYZA 2HWHA 1RTHB 3C16B 4JV5B 4FLFA 4BS9A 1R4MB 3OT5A 3EULA 1CUBA 1JPVA 3KZNA 1S6OA 2E21A 5D3MB 3VSBA 3OCXA 2HT6A 4WCVA 1Z6TA 3A31A 2FZVA 4P93A 2C7QA 4QUEA 1YO6A 1NBMA 2D5LA 3USES 2I76A 1O5TA 3TZXA 5T5QA 5FT9A 5CNKA 4AIRA 4DW8A 3QEMA 1KJ9A 2E18A 1BE1A 4LDNA 1E2FA 2CLFB 3ANYB 5AT1A 3EDOA 1QS0B 2YH2A 5H1SV 4PZCA 4DCCA 3BTVA 1H9BA 1XSEA 4CLXA 3D6UA 3H0CA 5ALYA 1P9LA 5CR9A 1RT2A 2Y1CA 3F7OA 3O3OB 3ULKA 3TIXB 1I3CA 4R1TA 5EKXA 5IBCA 3VYWA 3MTGA 2HHWA 2H4WB 1X92A 2WSSD 1Y6GA 2RILA 1GUDA 3F5DA 4JVNA 5B2ZA 3IX7A 5A5GA 4UNNA 3CRQA 3KBBA 2FSVC 4PLTA 4V0OA 2A5JA 1Z13A 3UWPA 2HWWA 1L9XA 2PEZA 5IW8A 2AGQA 3HU2A 4FYMA 1CY1A 5F9MA 2PYDA 5EJ6A 5HIIA 5HK4A 3AVVA 1SJQA 2C9BA 3ZLVA 3K58A 2B8QA 5DZ6A 3NKLA 1UC5B 4CYMA 4Z9FA 4EHAA 2DQYA 1D3AA 2VCYA 2DNZA 2AUTA 1NBOA 3HP6A 3NQ41 4QIFA 3TAUA 4RJKA 1NVBA 3JU3A 3NIFB 4TTRA 4KDEA 3JYPA 3I1FA 4A1FA 3CRMA 5CXXA 5L1KA 3PR1A 1J0EA 2KVQE 2X15A 4BGEA 5E4FA 1XF9A 2K4MA 3UN3A 3C3WA 5G40A 3TYXA 2BISA 4JLKA 1IEWA 5DM7Q 4UDOA 3LBAA 1FDNA 2O23A 4BLTA 2OPHA 3PJXA 1GPNA 3KRTA 2JNJA 3FYTA 4DLZA 3RAEC 1UOPA 1IKXA 2BHRA 1IAVA 2ZAYA 5EMHA 1DTTA 1VQ4S 5D7NA 3QUCA 3IT1A 1X8JA 4N5DA 2YBEA 1WUHS 2ADOA 2H2FA 1LBIA 4EUKA 2FZEA 4LOKA 1TJNA 3FPCA 2WJHA 3KZXA 3HHKA 1PYOB 2YZMA 2BEUB 2FQQB 1FEHA 3FBEA 2IYQA 4R0MA 1DIBA 4FS3A 2FHPA 3O74A 3HJHA 1HNVA 2XGSA 1KRXA 5IDWA 2J9XB 1WE2A 3ZFVA 4RJJA 3ITEA 4J0HA 3KCNA 3NNNA 4L2ZA 1MPXA 1R1DA 3ORQA 3MR7A 1N8RT 4NEHB 3ZBTA 3E8SA 4MW7A 4DNOA 3AIKA 4ARIA 4F3RA 3QMMA 2QRZA 1E4EB 2DB3A 3VYVA 1LWFB 5ER6A 1VSBA 1HA1A 3BSSA 4D6PA 1DTEA 1R74A 2VR1A 4WY8A 1ZZFA 3N07A 3K3PA 4JI1F 3COVA 5DN6A 2HMYB 1T9DA 4X5OA 1A27A 4DV5C 3VALA 5CT5A 1CIVA 3R9WA 3AD8C 1GPWB 4LJMA 2ZRFA 3WGUA 3OA2A 3F9IA 3N2KA 2PLRA 3BUSA 2ETXA 1RBMA 3R5KA 3M9OB 4EH1A 1H2UX 4LREA 3OCZA 2QN1A 1T5BA 3HCNA 2H51B 2XNJA 2ALYB 1TO6A 2JLEA 5EUBA 2AOTB 2BRLA 3ZTPA 2PKQP 4G81A 5HSPA 4UNPA 2C42A 5A9SA 3TECE 3NWGA 4I0WA 2WWWA 2FUG9 3KLFB 4AX4A 3PSAA 3ZDFA 2IA5A 1YOVA 3A8EA 5A8KB 1C4AA 3PGJA 4WINA 4QVKA 1L4EA 4INAA 3JQEA 2KI2A 3REQA 5C1BA 2R79A 3FAZA 5K6AC 5EX3A 3ESRA 3CVXA 4V19J 4C30A 3RQSA 4MKVA 1TQDA 4WN9B 3OL9A 3K2QA 4Z3OA 1SH0A 6REQA 4ZP8A 3H87A 1JLBB 4CMAA 5IZ4A 4N47A 5LQDA 2JFPA 1T24A 3Q8PB 4Q7KA 1V8PA 2NZ8A 1XLUA 4E21A 1TVRB 5EKDA 4XOIA 3F6SA 2GEBA 4ED3A 4DQKA 5LL6P 3DLLQ 1XYYA 4S0MA 2QLJA 4NLPA 1Q3KA 2W4DA 4W8HA 3BJMA 3PRDA 3W5SA 2X0KA 3C6XA 1I5EA 3FLBA 1B0AA 2CNBA 4EMSA 1L0BA 2JG3A 5HVNA 4CMEA 1N6IA 3AHEA 2XSFA 3RUEA 2G8NA 2AYYA 3LZCA 3Q2SC 2W2KA 1IHPA 4PRZA 1EEXB 4GG1A 4F56A 3BO2A 1OH7A 2QT1A 5EPEA 4IJKA 1TGVA 2PKEA 1MB9A 5GONF 3WDOA 3I3SR 3QBVA 3E7XA 1W76A 1M5OC 2XZTB 1Q16A 1UBLS 1YDMA 2PFFB 1PNOA 2EJCA 4TKVA 1POWA 4L1KA 2FZLA 3I9ZA 2DBZA 3WWOA 3G5TA 3R5DA 2XLKA 2FXVA 3QQCD 2CXSA 2ZPAA 4UHEA 2PUBA 3LOUA 2DTEA 4LZWA 2J5KA 1WP4A 5AVTA 2IYAA 4MRRA 1QIJA 5ALPA 4TLLB 1ECCA 3QJJA 1I2MA 1PWEA 4YREA 1MRNA 3A1CA 2CQPA 3PXAA 1SC9A 4K6MA 4DUYJ 3WC0A 4YTEA 1U6ZA 5DQIA 1DV2A 4DIBA 2X40A 1XK7A 3DUWA 4MS3B 2VWHA 3U7QB 3V6MA 4TS4A 1YA6A 3MR5A 2QMUB 1I3MA 3DP9A 4RA9A 1JLQB 5GINE 3TCKA 2N3OA 1I01A 4HTAA 3SP1A 4CF6A 3KDPA 3SYLA 5DM1A 2ZVDA 1BS1A 1QV9A 1F1BA 2IHJA 3VAFA 1TV6A 2OBLA 3S82A 4GBMA 5TMEA 3SYZA 1JOSA 2R7OA 4GOLD 4ZAZA 4JV1A 1OY1A 2NU7B 4YDHB 2BM8A 1EDEA 4FILA 2JEGA 3OXLA 3IB6A 3AI7A 2ZM6F 4OF4A 2FWBA 1HHSA 4J0JA 5JYBA 3I34X 1QHSA 3ZLTA 1HNZJ 1OQAA 5KCZA 5D3GA 1SBIA 3LOQA 3ETOA 4RWWA 2B5OA 3J81Y 2Y1OA 1SURA 1HQEB 1X5TA 4DV1J 3UD3P 4BN5A 5B1IA 4A03A 1QDEA 2N4DA 1J7KA 1N78A 4MJ7A 1PYTA 2R7SA 3K1AA 2IHYA 4A8JC 4M0UA 4PE5B 5DGXA 3AY3A 2XS2A 3OE1A 3D6MB 5EIBC 1U8XX 1QSYA 1ZC4A 4RBTA 2DWOA 3PX6A 4Q3OA 4IQ4A 3PUYA 2Q9UA 4FMDF 4Q48A 4KWIA 1F6DA 1YS1X 4MA0A 4UTZA 2MR5A 3ZE7A 4YECA 1FRMA 4LSNB 3LY5A 3D7LA 2R7LA 4A7PA 4ZAVA 2YTCA 3VC3A 2QBYB 3CWJA 5CBPB 3AVPA 1PJ8A 2NZUG 5J63A 3H6GA 4B87A 3ONVA 1UC4B 1SUPA 3W7VA 5I9SA 2PD6A 3QITA 3MF4A 3L7PA 2VTVA 2CBZA 2IEGA 1DFGA 4KIWA 4OHKA 3P2YA 2OCYC 1M6NA 5E9AA 2PH5A 1UL3A 1VG8A 3Q8YA 3HLUA 1P2GA 2VNKA 4ZREA 4BMCA 1VQ9S 2IYTA 2BCGY 2GJKA 4YFYA 4BHTA 3G3EA 2CKWA 4GDMA 1TCAA 1ZNQO 4DZ6A 4ANDA 2JRLA 3WQBA 3WBFA 2FPMA 5EZYF 1WPRA 2HSEA 1OCEA 2O52A 4M5LA 4X97A 5FCDA 1T15A 4GRIA 3AEQB 1RRKA 3VMFA 2PE5A 4WQMA 721PA 2UUBB 1QFMA 5U4QA 1ZY2A 3SO4A 3BQ0A 1BCSB 1NLZA 3MM9B 3CHYA 4GPIB 1TL1B 1OLOA 3HJUA 1VLYA 3C8UA 2VPPA 2J0XA 3KALA 3DMTC 3TL3A 4J16C 2XI3A 1S1UA 2MT9A 4JI6C 2PAFA 1IN0A 2EK6A 3DKKA 2OBYA 1QHXA 1JS1X 2ZRPA 1P1IA 1WTBA 2VJDA 4ES2A 3DLEB 1ZL0A 2GK4A 2HSDA 1XEWY 4M9UA 5KFJA 1CX9B 4NASA 3UCFA 4CNYA 4QGSA 3HLTA 1BEZA 1U1RA 5EXEA 4Y2CA 3KHRA 2XTJA 4R7ZA 1U1KA 2I3ZA 3EN0A 1UKEA 4JJ6A 5IBQA 4GO1A 3N74A 2FQQA 5IBRA 4CLZA 4N5HX 1VIDA 1UK8A 3EARA 1XL0A 1WMDA 3IBGA 1FLAA 4JI4B 4RV5A 4GBGA 4FFVA 2ORWA 3DLPX 1OT3A 3H1EA 1G8HA 3VHLB 4YBRA 3WO1A 4IIJB 4UC0A 5IFKA 1HDZA 5KINB 1KNQA 4N56A 5K0JA 2EFEB 3AF6A 1E3LA 1OLSB 1TVCA 1HWKA 2PGIA 5M2PA 1ULAA 3M1LA 1U25A 4MRAA 3KG4A 1E4YA 2Q45A 3DRYA 4YP1A 1HE4A 1U7UA 1C4XA 2XZDB 1NJFA 5KVSA 5HATA 4NU0A 3SDEB 4KO1S 1S9GB 2XCLA 1T35A 2WKRA 5DBFA 3W2HA 5JAIA 3Q23A 3H2BA 4H2DA 3CKLA 4Q24A 4OJTA 2BBTA 2BGIA 4OYZA 1UDXA 3RAFC 1Q83A 4XM2A 2FSFA 4TLDA 4OJGA 2V74B 3NAIA 3I9OA 4FBGA 2QNRA 2XGGA 3LRTA 1ZQ1A 2CVOA 3KVVA 1NQTA 3NWEA 3F3MA 5ESRA 3DMJB 1FZTA 3GLGB 1FFWB 3JCZA 5I7HA 1UBFA 4BE7B 2BMFA 4L4RA 4CT5A 4M86A 5EWMA 5IAKA 1R50A 3GR0A 4Y1FA 1WSAA 3PGXA 1PJRA 2XDWA 2HMIA 2D2XA 1QVZA 2EGTA 1SBZA 1LS6A 2G5CA 4CGYA 4QA9A 1AE1A 1HNXB 1UQTA 1J5EB 2ZR8A 3P3DA 3KEGA 4QQBA 1RHRA 1U2DA 3TUFA 1KFEB 3QXJA 2XBLA 4QQFA 1M1GA 4Q18A 1V43A 4QO7A 2PEYA 3AGPA 1OFGA 1FJCA 1XMQB 3RFCA 3ELYA 3QELA 2FLKA 1AUQA 2C7RA 2J3JA 4JP3A 3JVUA 2D6FA 1P27B 4OX9C 1BJRE 2BI8A 2J32A 1C7RA 5AJXA 3TI9A 1TP7A 3QE9Y 3GIMA 2EU8A 4ZVTB 1RZRA 1YKFA 1KVSA 5KNBH 3WWDA 2G71A 3SJAA 5LLSA 3KLEB 3ZCTA 2UZ0A 1WL8A 2P27A 4YNBA 4OI1A 5C51B 3C98A 4BIIA 2FRDA 3T3FA 3PX2A 3HXLA 1Z8FA 1IN6A 5AO9A 3EUEA 2AKAB 1SCIA 3GRVA 4RO0A 1GPUA 4PX3A 2B4AA 4JC5A 1LPMA 4DILA 3OFGA 4WJKB 1EP3B 4OYXA 4AJLA 3FZQA 1QLWA 1R64A 1QVRA 2ZR9A 2GRUA 4W63A 1BS9A 3A6GA 1TM4E 1G5IA 4Z7JA 2P5UA 5J4YA 2Q8NA 3KX2A 4AF6A 1RHMA 4GXTA 2JEJA 2XZDA 4WCFA 2ZUEA 3PPWA 2CA9A 3OCJA 3DSRA 2VBFA 4KUHA 1J2UA 2BHNA 3BREA 2Q3DA 2C7GA 5KX5B 1Z8HA 2F8HA 4DLYA 2UUOA 1AMOA 2EDAA 4F8EA 1H38A 1DAHA 4HQNA 2PD3A 2J6BA 2XNKA 4IAOA 1GO2A 3QSYA 3LYUA 3T5BA 4HX9A 4BX8A 1D09B 1B8OA 1JPNA 3K31A 1AJEA 4RABA 2O8BA 2PT5A 5FWYB 5KTYA 4U2FA 3A28A 1DLIA 4DM4A 4DXLA 1XPRA 1V48A 4X4RA 3TEJA 4Q2MA 4I14A 1ONBA 2PROA 2HJ9A 1EFVA 4IH4A 4TQSA 1FSSA 1JQAA 1DHMA 1DNPA 4RTOA 3BM7A 4RVCA 5EUHA 1Q22A 1DFHA 1RJJA 3VSAA 5A4IS 5BYJA 5K3OA 4WZAB 2OA0A 1DZIA 2ZWVA 2CMGA 4GRDA 2NACA 4QXAA 5IJ9A 3KPJA 4A91A 1Z1ZA 1YR9A 5K6AA 4DV6B 2XTMA 1KIAA 5FHRA 1WPGA 1MSWD 3S68A 2HBRB 4B3RJ 1L5GB 2HFOA 1NHGA 3O4GA 4F86A 4PGFA 4I55A 4ZARA 1PL0A 5K3FA 3DHXA 4C11A 1MX1A 1RWWA 1IOZA 1BQMA 2WAQD 5HBGA 4G09A 4R71A 2PA8D 1N0IA 3ENNA 5L8RC 3M8PB 3WLTA 5CURA 2QVGA 3EA5A 4JV2A 5J2UB 3RK1A 2PGDA 3NCHA 4PPNA 1P6QA 5EE1A 4KKVA 1TUBB 1OYYA 3GUYA 1T2EA 4DCOA 1ONPA 4IZHA 1HNNA 1U6BA 3EIHA 3OLBA 4GKJB 2AJLI 1MVOA 3V8MA 3DT8A 2JX2A 4EKDA 3LUBA 3K1ZA 1OFUX 1RTTA 1MG5A 5A2GA 2BEWA 4ZVUA 2WVFA 4EDFA 5FWYA 2ASLA 3SBEA 4P9SA 3JASB 3NTLA 5H0IA 3ABOB 2ZB8A 1MXAA 4ENPA 2ZWMA 1RAAA 3WZ2A 4JVOA 2ZJ4A 5LN1A 3A6HA 4B84A 2PRKA 3CWCA 2QW8A 1FSZA 1A71A 2R8HA 1TL3A 4ZOCA 4JI6B 3HMKA 1YULA 3GV7B 1IVSA 2C22A 4V19X 3ET6A 4QOGA 4Y00A 3MB5A 2A9JA 1O03A 1OGYA 3IC5A 5BW6B 3BDAA 4YJ3B 4WZ6A 2W2VA 1V26A 2GX6A 4JH0A 1JSCA 1UEIA 2FXIA 3R5HA 3RTVA 4RUCA 2NZ2A 3F2IA 4AJKA 4CV3A 4R2HA 4QBTA 2ZU0C 3QKWA 1DRWA 1KP3A 1Q7CA 3OA0A 1GH8A 5C1PA 1UXOA 2Z2KA 4HQ0A 3FTNA 1IBCB 3OBBA 4OIFA 5EY5B 2OXTA 4IPTA 4B47A 4GD3Q 3VI3B 4M1ZA 3NV7A 3U5TA 4ID3A 5HMLA 1AO3A 5ITVA 1ZISA 4HGRA 2CWXA 4DNFA 4BV3A 2ZBPA 4HAIA 4JA0A 3VR6A 1U8SA 1Y3IA 5AD1A 4NDNE 2RHCA 1RBLA 3CSUA 5BXYA 2ZTLA 1S1CA 2IYNA 2XYPB 5G41A 5FWXA 4KNVA 1XNQJ 4CQ1A 1NVXQ 3ELBA 4J94A 2ZBEA 1E5XA 4B3RF 1D5WA 2FJXA 1KJIA 4DQQA 3H7IA 4P2FA 3DE0X 4ZDJA 3T0FA 1SJ9A 2O8CB 4GLJA 5H8WA 1E3WB 2HXGA 1E0JA 4NYIQ 1T9BA 4HS9A 5YASA 3SQXA 1TZ2A 1TKXA 4G5GA 4WA7A 2W2PP 1PIEA 1VQSA 1J8DA 4UQPA 3UWKA 3D02A 3TZBA 4ND8B 4QPNA 4WFXA 3C5WP 5DSTA 2OC9A 1O95C 2HX1A 2I2AA 1MBZA 3JVVA 2HMIB 3FSEA 2J07A 4HQFA 1OWLA 2IY7A 5DTMA 4ZVPA 2H4HA 3TXXA 3G2PA 3QX8A 4HFRA 4AMUA 3JZIA 1VDZA 1PILA 3TBKA 3DW1X 4MT1A 5ESWA 3CJKB 1WUYA 3CGIA 2X2PA 2NUHA 1QRAA 2R4UA 4DC1A 2Q1WA 4ZOEA 4DUGA 2GQCA 1ZHOA 1Y1LA 5DI9A 1TRHA 2ONZA 5CFQA 3BMCA 5H83A 1TYBE 1KR4A 4OJHA 1QNLA 2XT6A 5KC8A 4Y0FA 5HKKD 4ZKAA 1D2RA 1JIVA 5IEBA 3BKXA 4MRPA 3BKWA 1NJZA 2AX1A 3TSZA 2KM1A 3EICA 2CRLA 1GOTA 2XKAA 4NWIA 2JFDA 1C2YA 4URUR 3QE4A 2YNIA 2LQ5A 1B70B 4AP9A 3TLMA 3G0HA 3GRPA 4G41A 2LECA 3A1TA 4D82A 1UZLA 2O0HA 5L7YA 4RC9A 1WOYA 3HDHA 1KBRA 3TTYA 1R0RE 4RW9B 4IEEA 1KDNA 1AA9A 2G77B 3FVQA 5BYAA 5D0RA 1OLSA 4F2GA 3NGTA 1ZNZA 1GLNA 3R27A 1NHKL 1FP7A 1T3SA 5FOUA 4MWZA 2D9PA 2PX3A 4EB0A 1FDAA 3LY9A 5L4LA 5IZCA 1K6MA 3WLHA 3TTSA 3QKSA 1Y7LA 2G25A 3JX9A 2MZJA 4UBJA 3WYNA 4F84A 1FVXA 3BCUA 1VS3A 2HCRA 2QLLA 2JI7A 1DRKA 3WJ2A 1FOEB 1JU9A 2VFAA 4ARCA 1OLUA 3LP1A 3MC1A 3RROA 1Z26A 4YPFA 4TYBA 3K6JA 4YX9A 4Q4JA 3S2EA 2L0XA 5C46F 2Q1UA 4S05A 1L5OA 2NQ2C 1E6UA 1EFLA 1RHQA 2YZGA 4B3TB 2YWFA 2IM2A 1M6VA 2H1YA 4XWAA 5CLLA 1TJ3A 4MLDA 1N6QB 1IL0A 1ADYA 2NT3A 1A5TA 3HHDA 3IMQJ 3ASYA 1Z6ZA 3GFQA 3K0SA 1L3CA 2BKLA 1TL3B 1O96A 2Z98A 3ZV5A 3PDCA 3BDIA 4ENRA 1U0TA 5DT9A 2FVYA 1BMFD 3DLGA 2HGSA 2V9PA 3GSIA 2LDIA 1Q1KA 2QL7B 1EJBA 1JDUA 2WTBA 4PLYA 1URNA 1ZW1A 2NNWB 2YWEA 3KM0A 2G1UA 2ATCB 1ZMXA 1FWLA 1PK9A 1H8ED 1KYXA 3OQHA 4JIGA 2VJNA 4O44A 1QFJA 4XWKA 4P86A 3ONEA 4H4EA 4EW3A 4MWTA 1Y4UA 2Y0SD 2HNKA 1H4QA 2OCIA 2DHAA 3FYSA 1SC6A 2PO4A 5A7GA 3IJ5A 4AMYA 4ZVOA 3QA9A 4O2AF 1T3NA 4LN1A 1ND5A 4QREA 1RTDB 3QJPA 2PXXA 1PSZA 2OPQA 1E1CB 3AXTA 4CIXA 2HGNA 2WUWE 1TFRA 3WGIA 1M90T 4UTVA 1E9CA 4Y2SA 3U9TA 3PSHA 3ZZ1A 1UZDA 4DLWA 3GLSA 3AV0B 3DRXA 1P2BA 4NICA 5CX4A 2VOOA 4J2OA 4JI4C 2QUAA 2Z1DA 4DL4A 3PCXA 2R8ZA 3NHZA 2HQSA 4M6WB 4JJEA 2NUUG 2IRWA 2BCJQ 1TKTB 1UWAA 2BFDB 4O08A 1ZXXA 3UM9A 3O3LA 1MWYA 2Q8QA 2NUTA 3Q1LA 5A3VA 4HPVA 1U0HC 1ZIOA 3F6YA 1GGJA 2R7NA 4K6KA 4CKWA 2OZPA 3DCAA 3ZJ4A 2W6NA 3LHDA 4M9RA 1IOVA 1RWKB 3M1AA 2IQIA 3J7AC 2CMDA 2WJ3A 1ACLA 1VRVA 2L17A 2MGZA 3KHLA 3T5JA 3GCXA 5K03A 4UE2A 5JVDB 1Q6YA 5DNWA 1FNXH 1I51B 3L7IA 4EYGA 2JI9A 3H5OA 1E2JA 4KH1A 2VH2A 5F1KA 1YNOA 1I3KA 3U48A 2PSSA 3H2JA 1X0VA 3KTOA 4X4PA 1ECBA 4DQRA 3L0CA 3ZD7A 4KB7A 5BR4A 5KG2A 1AKQA 4I4CA 3EVWA 1E2LA 3FQLA 2JI8A 2VPXB 1PKXA 3UN5A 1D1UA 3O6QA 3X1MA 1KMHA 2HD4A 2X41A 2W2LA 1OHHD 1BE4A 2EQAA 3OT1B 4ASUD 4Z0TA 3H0PA 3WOVA 1F2TA 4Y2XA 4WJLA 1FE4A 1K3UB 2ZHAA 3KYCA 2RHLA 5AM1A 3KV1A 4DIOA 1LB1B 3V8BA 4RZUA 3H1BA 2XSJB 3LW5C 1OE0A 3JPYA 3ND8A 3H59A 1WTFA 1MF7A 2PTHA 2FQYA 4GKKJ 3KLMX 2DYKA 4LDJA 3IA2A 4RTSA 5A1JA 4GVPA 1TEHA 3CXRA 2IYOA 2R1VB 1I24A 4QQ8A 4LYGA 2UU9F 5K0TA 3G2IA 1N7IA 1M76A 3R6LB 3LWNA 3TLGA 1WD7A 1T2NA 1UPFA 3I6YA 3WLAA 4JGGA 5AHOA 4AQYC 5LA6B 2OTLS 3TCXB 3D0GE 4BXOA 3B78A 3AHHA 3A1FA 1OW3B 5TQ0B 4CL8A 2KJWA 3M6XA 3H9JA 1XS3A 4BWGA 4PR6A 2H4WA 4DAOA 2ZYDA 2GHPA 2HHJA 1KO1A 5DYYA 2QEXS 2BKNA 2FDXA 1JNYA 2NTNA 4CT0A 2AQIA 3SDEA 4YQZA 2HG4A 1PZFA 1A5SB 4A0QA 3DZGA 1W88B 3K94A 3KHSA 4IQXA 7REQA 4MKBA 1PAUB 4EPXA 3GJYA 2QLFB 2V9CA 3QELB 4RE5A 4UW2A 1N1GA 2YOFA 3DTYA 1GKUB 4GPTA 2OMEA 2XYVA 4DLEA 2RB5A 1USGA 2OEMA 2XKKA 1ZAVA 1NR7A 5L1LA 3IIEA 4MARA 4QX6A 3BSCA 3WGHA 3QU7A 2XCTB 3R4CA 1SPBP 3ONWA 5CTAA 1XJWA 2PBZA 5K3EA 2FG5A 3PM9A 1KAGA 3KPVA 4GZ3A 2DO4A 1Q0QA 3AY7A 4ICLB 1G17A 3GLHB 2KL8A 2WDPA 5EX0A 2OIHA 1H5UA 3TLYA 4HHUA 3FMWA 5C5IA 4TUYB 4DR7F 2MDTA 3O3MB 3PHBE 3RT7A 1RHJB 4PRLA 3WXBA 4Q4CA 2OO7A 1AKVA 5A8KA 3I55S 1P2TA 2FYXA 3L5KA 4CI0B 3OLXA 2DCUA 4GR5A 1HARA 4OXIA 2R4TA 4TL6A 1EGHA 2ISQA 3BH6B 5FLEX 1RAGA 1K66A 2B37A 5LC1A 4UVIA 1C1DB 1GXSA 4CUJA 1QVFR 4IS3A 1UPAA 1M2OB 1IY1A 2X14A 2VA9A 3ENAA 4HNHA 3TTWA 1LF5A 3BGLA 1C80A 1IHXA 2WJPA 3GEHA 3B3FA 4EHFA 3QO9A 4PEOA 1FCAA 3PDIA 1U7DA 4F26A 1Y5LA 4K87A 3S44A 4C7OA 4HB2A 2OHOA 5IF3A 1IQ0A 5E9WA 3OLVA 4L6AA 3L0DA 4DV2B 4X1IA 2IIHA 4CT8A 5BUQA 4LDQA 1X5SA 1RT1A 4XTTA 1GPLA 3VWSA 3DEAA 1T9YA 4RH3A 3D8UA 1G3MA 2WYUA 2DAPA 5HDBB 5F8GA 1A8QA 1CQWA 4J07A 3VX3A 4KGXA 3HFGA 5IN5A 3TBHA 1M5PC 1E66A 5DN9A 1MVLA 4WDQA 2DR9A 2C2KA 2J3DA 3M83A 3EF3A 3HYSA 4JI1C 1TO2E 1Y3KA 2X23A 4PLGA 2QN8A 2NU7A 5C8YF 1C1BA 4ZEOA 3A1SA 4YI5A 3CH4B 5B7QA 1Z29A 2EWMA 1PYOA 1P77A 4HX5A 2VHYA 1OHHA 3ETMA 3LNOA 5D7BA 3LE8A 1R12A 1RQ0A 4OI4A 1JLFB 5AW9A 2CWWA 4Y2GA 2JANA 2GYYA 1O94C 2BUAA 4MW2A 2AN5A 2C4VA 2LGJA 5KFQA 4RM3A 5TMPA 4C8YA 3HVTA 2N0SA 3L9XA 3FAKA 3UY4A 4HTJA 4HD8A 2FMXA 1LK5A 3MMNA 1E4OA 2Y4OA 1Z4QA 3MMXA 1PHPA 2BKAA 2KZMA 1S2NA 5KYKA 3H1GA 3IP1A 4B3OB 4AZTA 2GAOA 4F11A 4RXMA 2OM2A 3BFPA 5MFZA 2JJ1D 3K8WA 3X0DA 4BJ5A 4HBZA 1LW0B 4BVGA 3M32B 4OX9J 2W0SA 1F4VA 1HLFA 4YH1A 2YMMA 4MQFA 4OZ0A 4X66F 3O8QB 4GWKA 3OZBA 5AHWA 4GMDA 2G5TA 1CQPA 3P2KA 2POQX 2P2BA 4BN4A 3TDEA 1RI7A 3QGIA 1T0PA 2JVJA 4G0WA 4RVSA 3OTOF 4B09A 1WSVA 5JMOA 3P9CA 4Q45A 5FOWA 2QSUA 5IASA 4PG5A 4RF3A 3D64A 1PT7A 4OUDB 2NLOA 3RYFB 1XZDA 3GLVA 2Y76A 1V25A 3NXKA 3HCCA 1U0RA 1H8HA 3CJ8A 2IXBA 3MT0A 5E33A 1BU5A 3AR7A 4FHFA 1FXUA 3YASA 4DXDA 4XLTA 3IO1A 4GBJA 1BQ3A 1MB2A 1ZLXA 3ZS8A 5DYWA 1Z83A 1TUEA 2VF2A 2P1ZA 4Z9BA 1G7CA 4KGVB 4YP6A 1YFKA 3UQYS 3EX7B 3CC4S 3CSKA 1V7ZA 1TNDA 5HUHA 1HK7A 1NBAA 3LWDA 1IXKA 2LIVA 2CPYA 4CLRB 4OLFA 1C1XB 1A2KC 1ZZNA 3D6NB 3WQSB 1KETA 3H84A 1FQJA 4U7JA 1F1BB 3GDFA 5B30A 1NLFA 2UXDC 2RB4A 5HG0A 4WAUA 1ESEA 1AW0A 4LYJA 3OETA 3QBJA 3FHOA 1T0UA 3BMQA 3C3BA 4PEVA 4YB8A 4R5MA 2Z3VA 4FP9A 1UZAA 2CZ9A 4HG2A 1YB7A 5E7JA 2X8JB 1W7WA 5HZKA 1P0CA 4CHGA 4ZKEA 1V16A 3WHIA 2L69A 4FNIA 3FTFA 5BR8B 1JKJB 3ZLJA 3UJ7A 1EJ6A 1DO8A 1V1JA 4C0KA 3MMSA 1ARZA 1SUQB 3CYFA 2WZ1A 3NHSA 2VG5B 1PV2A 3HPOA 2FJVA 4WK6A 5A9RA 3DUFA 2O8EB 4CH0S 1F9AA 5IAJA 3EDYA 5GMKa 5H9WA 2OFHX 5I9LA 2V3CC 4P4GA 3AHJA 4B35A 1WD5A 3W9UA 5IAOA 1GZSA 4D43A 3OKAA 3O5AA 5GADI 2HVDA 1MU0A 3RLIA 2Z3ZA 5JSZB 1O0PA 4X66C 3ZIAA 1V4NA 4I3FA 1GAQA 4A0SA 1VRWA 4RNOA 3OWHA 1M72A 4IHJB 3I5XA 1G4CA 3H9QA 2XCPA 1KL7A 2BELA 4M1MA 1Z39A 5DO2A 1PJ2A 3H2YA 5BWLA 3PNMA 1S1TA 1K8XB 2HWIA 4QBIA 3KAQA 3P97A 1YE8A 2R6ZA 2PLFA 1L8AA 2ODNA 5ALDA 3LKVA 1GNQA 1TJPB 2PZKA 4BBPA 2FP4B 3X44A 4HVLA 4PG4A 3Q7IA 2OZEA 3IKTA 1E99A 2IF0A 3GO4A 2QLMA 4D4JA 1ULTA 3IRWP 5SYMA 5BQ3A 3VXKA 2K06A 2R6R1 3BBCA 3L1HA 4WIIA 4RR5A 1R16A 1AGYA 1ECJA 1SU8A 1ABFA 3SCKE 4TLEA 3PTZA 1NU6A 3MM7A 4G9EA 4H7EA 1BMDA 3W61A 4CIVA 4K6HA 1UUFA 4TL7A 3FBGA 3DOCA 4F4IA 1VQ1A 3CLVA 2NZYA 3OL6A 3CA8A 3GJQB 2ERYA 3DB1A 2DITA 3T5LA 1DBPA 3JY6A 4IOKA 5EHIA 2DKNA 4YAGA 5FO1A 3K89A 4LF4B 1S1VB 4LV5B 3Q9UA 2GRJA 1N0VC 3L4BA 4CCYA 5JQWA 3PUKA 4A0HA 1C0UB 2QTHA 2C29D 1TC2A 3ZGZA 3TD6A 1SUBA 2YVUA 4DBVO 2GEDA 4PAGA 3P2JA 4WKRA 1CS0B 4EMDA 1EQ0A 1HOXA 4X4UA 4BFTA 4K6CA 3PQ5A 2A78A 2ADBA 4ZLNA 2H9IA 4DLLA 4TLMB 3OTOB 5D85A 2EF0A 2ZIXA 3GARA 3AF0A 2CJ9A 1V5EA 4MUGA 5BV7A 3M30B 2ZSEA 3SR3A 4W6ZA 4O1MA 3TG8A 1Z0ZA 1NN5A 4NU5A 4Q47A 2KTQA 4EF5A 3K53A 1FRQA 1QTNA 4B3MJ 1U7LA 2J0WA 3I62A 3GQBA 3DKPA 2EXUA 1U1GA 2HHTA 4MIOA 3LC7O 3IUJA 4WASA 4F1KA 2V5AA 4G5HA 3V8PA 1PS9A 2OO5C 3GLFE 2WWTA 2V6FA 4NCAA 4F67A 5M29A 1SK8A 2MM9A 4NDZA 3X43A 5JNSA 5EUQB 4HC4A 3KOXA 1XNQB 1MCZA 2KJQA 1QB8A 3RJ5A 2WABA 1VKRA 2VJPA 2PH3A 3EJMA 1XXHE 2IY9A 3JWGA 3PKJA 3RSGA 4B0PA 4NAUA 4UBNA 4P71A 5GGXA 5I4CA 2Z30B 3WSVA 3NMRA 4ZZ2A 1Z0FA 3CNEA 1C0EA 4GZMA 1A2BA 4PV7A 4LF5B 4LY0A 2QYOA 2VBCA 2OXFA 3RVKA 5BSHA 3N6NA 3TI0A 5H82A 2I33A 3LUCA 4U1RA 3W5CA 4DR4F 3DLTA 1Q7BA 4TU7A 4FF3A 2ATCA 1CUFA 4BX9A 1L5NA 4EHLA 1PFYA 1PVDA 3UMCA 1K7YA 2E87A 1SWVA 3I0SB 3A25A 1KONA 1XAGA 3PQ2A 4YBZA 1N1DA 1BD6A 2FJ0A 2DWPA 4NS4A 3INTA 4CIWA 4ZDIA 2YUTA 1W4AA 4IEFB 2D1SA 2BFBA 3TZKA 1ZRMA 1OASA 4O3SA 5AKKA 4YJFA 4ZU6X 2GWRA 2MZTA 2VOEA 3ULHA 3QPVA 4C4RA 2N46A 4DCPA 3COJA 2AX3A 4E2ZA 2PBRA 3OQBA 4Z9YA 1WB4A 4A5SA 3BN3A 3IBYA 4XUDA 4QWBA 4WCFC 3G5AA 5HN0A 2V03A 3ANXA 2EJTA 3SFZA 4C89A 1J5EJ 3B2NA 1RMTA 4LSWA 4ZPAA 2FUKA 4JXXA 2R6HA 2QD5A 1UBKS 1YJWS 1GZ4A 1QQ7A 1PG3A 3FVVA 2I0XA 5LD2B 3D7RA 4GHWA 2ZE2B 1Z2NX 3I6IA 3AZQA 2XYHB 3TD2A 2FSUA 3SZRA 1GZ7A 2PR2A 3ZCUA 2ZCJA 4Z1MA 4ERNA 3N0VA 1EWYA 1GZ6A 3TLAA 3WICA 1YS9A 4M0MA 3A26A 2KYXA 1I30A 1I5OA 2YASA 1LW2A 5JS7A 1CPZA 1I7NA 3CE8A 1ZWKA 4HOYA 4CWAA 1LD3A 1C9NA 4RLFA 1NYLA 2OSBA 2EIHA 4BLOA 4TZ0A 5IV3A 3KL4A 2OB2A 3T9CA 4IG0B 3WQHA 2TSYB 3GZNB 1B3TA 1S6PA 1Q8IA 1CD5A 1HT1E 4GKAA 2VT6A 4QEDA 3FZGA 5C42A 3P4XA 2HT1A 3EGIA 4R51A 4OLOA 4OHOA 1P4JA 4ZQBA 5KOWA 2DG2A 4GMHA 1UJ5A 1JQDA 1VIYA 1YJRA 2RMLA 4P2SA 3FMOB 1DBSA 2HRZA 1L5RA 1M2EA 2EQBA 2PMBA 1LWOA 1SI9A 4CNZA 3UHJA 2QNIA 4XRGA 4S3MA 1RE0A 2IXEA 3WV5A 4QVIA 2I5JB 1NK4A 4JI4J 4QU5A 3QV2A 5E7IA 4G3IA 8LDHA 4OQFA 1DOAA 1WWHA 1QLHA 4AJEA 2H1FA 5HTKA 3TSAA 1GGMA 2IW3A 5LWHA 2G63A 1K3TA 1JR2A 4LFAB 3LI2A 5ES4B 3TO8A 1X86B 4Q05A 3CCBA 3GYXB 1U2SA 2IL1A 1P3DA 5IXUA 1ZH6A 1W25A 2XMTA 3FN4A 4YMHA 4ZCSA 1JEYA 4O4HB 3RRMA 4MP3A 4DXAA 2HXYA 3VVUA 3WRVA 4E2WA 1B1AA 4WLEA 4BE4A 3ZNJ1 4DUTA 1ELOA 4DIUA 2DEIA 5K4AA 1MJGA 4MB0A 4RMJA 3ER8A 2FCAA 1U2GA 2ZG6A 2FCRA 1N0HA 4CMHA 3CNBA 2JCXA 1N2SA 3FLAA 1UC8A 1MXBA 4C4WA 2Y1JA 4EG6A 5KG4A 3CE6A 1YL6A 4EMBA 1EVQA 2P41A 3I82A 3RYHB 4TNOA 4U63A 1QIIA 1OGIA 3B52X 2WQ7A 3FUYA 3DE3X 2ESRA 2FPPA 1AZTA 4I4TA 1JQEA 3ZX4A 2DBYA 4ZMBA 2CK3A 3C7TA 2QJWA 2B61A 3ZK9A 3P27A 4CYUB 3CJEA 4CTAA 4IVPA 4NLUA 4L5BA 1GK8A 5IT9Y 2IYUA 5DBEX 2BDUA 3O9VA 4XGIA 4PR3A 2YNGB 5CFRA 3WGOA 1N5OX 3UJAA 3R9LA 4OD0A 1NJ5A 4JI1B 4MQEB 1E1QA 1Z4UA 1TX4B 1E8MA 2NU9A 1YCFA 2LP4Y 1EB0A 2WSLA 4UEKA 4MR9A 4MYTA 3JQ8A 3PHHA 2MHNA 5DOZA 5F8MA 1YQQA 4J3NA 4GYYA 4AKIA 5KHLB 3KZKA 1TMGE 4ID5B 4I5GA 4NLGA 1LNSA 4ER8A 1FW6A 3SY8A 3C8MA 3ST7A 2BANB 3H2UB 1E6VA 4NEZA 2WNHA 3T5DA 4IYRA 3WK6A 4WEOA 2QMQA 3THSA 2J9FB 2BBSA 2GR9A 1KZ7B 4YRJA 2ZIEA 2HAEA 3KELA 3VAMA 3NBAA 5CT4A 2YQZA 2AEEA 3MD0A 1KQFB 1V41E 3EZOA 3A1YG 5CJPA 1EGAA 4RWZA 4DLGA 3DBRA 4BE9A 1E5VA 1T8WA 3LAMA 3MXHP 2NO7A 1M2HA 5C7LO 4E51A 1V4VA 2VN8A 5SY9A 4ZI5A 2W83A 5GZ3A 1VFNA 4ETXA 3RVOA 2Q4EA 1HKHA 5KNCA 3INNA 4CU2A 1PJZA 4RANA 4XASA 1Y1KE 4GLBA 4MQEA 3WLMA 1PNVA 3E9MA 3H7HB 3FDIA 3U02A 4D8WA 2I91A 1IXRC 3CSDA 4O3QA 4KE9A 3CZ4A 2G4VA 5BMVB 4DQSA 1JYSA 3BIWA 3I4HX 3QT7A 3QVTA 5C2GA 4N8EA 2VNAA 2VHEA 4NU8X 4PIVA 3MWGA 1XXLA 3IMKA 3E9YA 3LQFA 2YHBA 4M5MA 4TVAB 4MCHA 4OLBA 1FSPA 1QHYA 3PYFA 1P72A 1HR0J 2J48A 3PGVA 2ZAMA 2NUPA 2IX3A 2A7QA 5DISB 5HKOA 4D9CA 4MXDA 2H3HA 3GJ6A 5IKOA 2HZ7A 4ETMA 1EM8A 4DZTA 3BWXA 2GZ1A 3U0BA 1YS6A 2FVCA 3FMPB 1KI8A 2X7IA 3TZYA 1RRFA 5JCOA 4BCBA 1YCGA 3M4XA 2YRWA 4GO5X 4J76A 1TK3A 1N8SA 4CIDA 4PQFA 3B4MA 3UYLA 3LUPA 2W70A 4UTRA 1K0FA 5EWJA 5KYWA 2BI7A 2WK4A 3AW9A 4HZUA 4D45A 3RRFA 5E6SB 4IIBA 3OEWA 3AJDA 3K17A 4AQ7A 4A8OA 4ME6A 1N6OA 5FPPA 4EHJA 4PLVA 2I7XA 3NB0A 4UM8B 1MRSA 4G3XA 2O3RA 4EFNA 4QYMA 3UK2A 4XUEA 2FGCA 4ALIA 1R4ZA 4Z99A 1B4SA 2K7ZA 1O9BA 2KLBA 1FDRA 2C4MA 1FT8A 5JWOA 3AF3A 2MQLA 1YV9A 5ALGA 1G20E 4JXKA 1MB3A 3BJRA 1T3LA 3C1OA 1QF6A 2KRRA 4LBIA 3PGA1 3E48A 1WHSA 1V2HE 1XRBA 2GFQA 3P2IA 5TGZA 1LBQA 2E4ZA 4Y2IA 2B7CB 3I83A 3WZMA 1DKRA 2YY6A 3VR4A 4MUYA 2HJVA 5IKXA 1J0CA 1QP0A 1MAWA 1QRTA 1HA3A 3I0RA 5B4TA 1HX7A 5ITWA 4Z2XA 3OM0A 2G9RA 1XRAA 4RKEA 2ZRGA 3EGDB 1E92A 3MM4A 2QJFA 2N82B 1WETA 1F1JA 4JBGA 2EWWA 7FD1A 3V7WA 1H3EA 1C1CB 2UVVA 4YAJA 2PZ8A 4RKFA 5J4LA 1B23P 2VQSA 3PJDA 4LQLA 3FBTA 1CULC 3CEJA 4L95C 3IPYA 3AETA 3RB0A 3C46A 5KT3A 2ZTHA 2DFVA 4OJQA 4WXMA 1RY2A 3LXMA 5IVHA 4P80A 3PZRA 2B9VA 1JJAA 3W9HA 3MTEA 5FTLA 5EIXA 2P2ZA 3DLKA 5K20B 3HR4A 4AQYF 4X7MA 3G13A 2Y27A 2HAFA 4V1CI 1RT4A 3TZLA 1WZNA 3FJ2A 4XUGB 4C4YA 3HCXA 2JHPA 3QG5A 5A2QD 3B89A 4D9KA 5AVZA 4KO2S 3PQCA 1Q0ZA 3TDNA 5IH3A 4RPCA 1PGJA 1PT5A 3OZ7A 4FYVB 1JLEA 2VUTA 1W581 4ESHA 2PLNA 1PJ4A 4NYOA 2X3FA 4JJKA 3TQCA 3H4BA 2SBTA 5D4OA 2I6SA 3AILA 4KQKA 5I9BA 2GKSA 2FZCB 3QBDA 1CEQA 4DRXB 2XWQA 3IYLW 1XD8A 3RABA 2RHDA 4JL8A 2QMYA 1CV2A 3BK2A 4Z7NB 2C2EA 3U3DA 1OFIA 4QE3A 4R2MA 1G5RA 3WTBA 3IEIA 4RV9A 1N9GB 5JMPA 3G0DA 1WUKS 3GPBA 3V7NA 3VJKA 2PGLA 4UTGA 5K51A 4Y6LA 3I9V1 4PANA 3U0VA 4NE2A 3G2NA 2PZJA 1MAAA 4Z7YA 1BDJA 4KJIA 1MROA 4EB8A 1BDIA 2O8DA 5CD9A 5D15A 4MR8A 3GY0A 3TQTA 4EB3A 3OE7A 5K0ZA 1ULSA 4CYUA 4MH4A 4R2JA 5H3LA 3G1WA 2OHFA 4C6HA 1P9RA 1OQ3A 1VGQA 2E8EA 1J5PA 4R1QA 2C31A 3MYYA 2P5VA 4OBEA 1S5ZA 3IT3A 5H70A 4WXOA 1RPJA 3A27A 1QE1B 2RGXA 1JLEB 1S97A 2VT7A 4QRDA 1NBEB 1LDMA 1K8RA 1TQ4A 3JAMA 5KBYA 1RAEB 3CO0P 1Z4LA 4BB9A 3FF4A 4NYMR 1JDZA 2XMJA 5JFOA 1QMGA 3WB9A 3T61A 4FPXA 1WXXA 2ATLA 2OWDA 2DVIA 3P9RA 2DSTA 9MHTA 2DRAA 4MUEA 3NVDA 3FTCA 3NGDA 5HO4A 4LI0A 3EZNA 4CFYA 1VHLA 3G8DA 3PW2A 1NDCA 4P4NA 3HHLB 1EWVA 3K0KA 2GVDA 4G1EB 4RVFA 4F21A 3OUZA 1Q53A 1YL7A 3TLBA 4G8BA 3CNQS 1VR6A 2HDHA 2FK7A 2YZKA 4ZXPA 3K70D 2VQEB 3WDSA 1SOMA 2XPCA 3A36A 1Q15A 2HRQA 3BYRA 4KXLA 2GMJA 4K2HA 4MKAA 5EE9A 4TXMA 1S7CA 5DW3A 1VPTA 2PJRA 4LRUA 1FDVA 3AFOA 1ZK3A 4G1CA 1DBWA 3TDKA 3ZI4A 4X8OA 1LU9A 4MJ3A 2O48X 2DY9A 4PIMA 2IELA 3MBIA 5IJ9B 5LM3A 1A9QA 3ED5A 1N2JA 3OD1A 4B73A 3CX6A 3OVSA 2OGSA 4TV8F 3GLTA 7MDHA 4EPWA 5FX2A 2R42A 1XD9A 2X9GA 1CLEA 4KGXB 4FNAA 3ABSB 3CVWA 4AO6A 5LQKA 3O4IA 3G6XA