2ZZNA

The complex structure of atrm5 and trnacys
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
336
structure length
336
Chain Sequence
MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0883
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
total genus 81
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zznA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zznA03
2ZZNA 1ZHFA 3KQPA 1BHJA 5EKXA 2XYVA 3KQTA 3BXOA 1VE3A 1TPYA 2OB1A 4ER3A 4YUWA 4ATNA 3FUTA 2P7HA 2H00A 2YXLA 2H11A 3I64A 2JHAA 4QTTB 2ZIGA 4QQNA 2BM9A 2PBFA 1AV6A 3P2EA 3EVCA 3ORHA 3FTDA 4FSDA 2JHPA 5KQSA 3TFWA 4CTJA 3NW9A 4C08A 5K0FA 1JG2A 3A26A 2ZZKA 4KIFA 3OE5A 3UZUA 5CD1A 2G70A 3CJRA 5BP7A 5K0BA 5DX0A 2NXEA 1KPIA 3EVBA 3VYWA 1UWVA 1OR8A 3LKDA 4LWOA 4WVLA 1X1CA 2B78A 4FP9A 5EG5A 5IKMA 2FRXA 4GOOD 3SM3A 3AJDA 2O07A 1NW6A 3EGVA 3E8SA 4RTKA 3LDUA 3BWBA 3CKKA 2UYOA 3CVOA 3P2IA 5DWQA 3MERA 2PKWA 5E9WA 3UJBA 3UWPA 5C9ZA 3LGAA 4YUXA 3EPPA 4FT4A 3HCAA 1WG8A 1JSXA 1DCTA 2ZBRA 2FK8A 3PTAA 1QAOA 5CUQA 3B3JA 4PNEA 1AF7A 3B3GA 2FK7A 4OX9Y 3EVDA 3FPEA 3I5UA 4EMSA 1Z3CA 3SGLA 1BC5A 3ID6C 3OU6A 3X0DA 5HIKA 3FUWA 1QAMA 4YV1A 5K0JA 1SQGA 4YMGA 2G72A 5K0LA 4HSGA 4Z2YA 2NXCA 5E2BA 5GM1A 1I4WA 5DTRA 4XUEA 1M6EX 3JWGA 4MHTA 3RIEA 3VC1A 5LQNA 8MHTA 5EGSA 5E8RA 2GPYA 5F2NA 5K0GA 1RI3A 4E33A 3MQ2A 4PYMA 1JQEA 3KR0A 3PT9A 3OCJA 5FWDA 3ELDA 2Y1XA 3LBFA 3M6XA 4MTLA 3G8AA 3KKZA 4HTFB 4OA8A 4QDJA 4RX1A 5FADA 1VBFA 5GM2A 5EZSA 2PXAA 2BR4A 2VDUE 1O9HA 1R00A 2PWYA 2YXEA 4YV2A 1B42A 1NKVA 4IKPA 3DMFA 2GLUA 3KPWA 4C07A 1VIDA 2VDWA 4DQ0A 3OPNA 3PS9A 1IXKA 1R8YA 5BW5A 2GB4A 5DTMA 3P9CA 4OBXA 2XBMA 2ZULA 1TW2A 4P7KA 3FRIA 4DZRA 1JSZA 3M6UA 1UFKA 1PRYA 2PT9A 3HM2A 4R05A 2ONYA 3FTCA 2ZFUA 2ZLBA 3LL7A 1X1AA 4GC9A 5GOZA 1YF3A 3NWEA 3SMQA 1X1DA 3DTNA 3FPGA 1YZ3A 2BM8A 3KQQA 7MHTA 4GUAA 3HTXA 3BWMA 2IFTA 5E8JA 4E31A 2AVDA 3DOUA 1XCLA 4O29A 5FHRA 2PXCA 2ZTHA 4G56A 3HVJA 2ZBQA 2HV9A 1G60A 3T7TA 5FTWA 3U81A 3GIWA 2P7IA 4GOLD 3A7DA 2DPMA 4QQKA 4YUVA 4RV9A 1ORIA 2NXJA 3NMUF 3IHTA 3LDFA 5CVEA 1O54A 5CCBA 5FWAA 3GU3A 3KQMA 2OZVA 3A7EA 4HGYA 3FTEA 4U7PB 2P35A 1ZKDA 4WXHA 2OY0A 1WXWA 3NJRA 5CVUA 3BWYA 1L3BA 4JXJA 4PONA 3EVZA 1JTEA 3OZRA 1XDUA 3I53A 3P8ZA 3IYLW 1I1NA 4GC5A 1RI2A 4FGZA 4PYOA 5BXYA 3BT7A 1F3LA 3C6KA 3GDHA 2B9EA 2XVMA 1SUIA 3BWCA 1G8AA 2R6ZA 5DX1A 5LSAA 3TKYA 3HVKA 4C06A 3R9XB 4E32A 1XDZA 3VC2A 1AQJA 3QV2A 2AN3A 3TQSA 4AX8A 2AN4A 4A6EA 5EVJA 2JHCA 1EJ0A 4B17A 4X1OA 1RJGA 3O31A 3G2PA 1R8XA 1BKYA 1FP1D 2IH2A 1EQAA 4QPNA 5C1IA 4BLVA 3KU1A 1D2GA 2AOTA 5CVJA 4PYLA 2ESRA 5E1BA 3OFKA 4CKBA 2VS1A 3S68A 2PT6A 2UYHA 3OZTA 3BGVA 1EG2A 3BZBA 4GOND 3V97A 3ELYA 1P91A 3B3FA 3TPZA 1ZQ9A 1EJ6A 4ZTBA 2OXTA 4X61A 3O4FA 4X60A 5F2KA 2G71A 1JG3A 1KXZA 2R3SA 4KIGA 5HFJA 3JWHA 4X63A 3AY0A 5GP1A 2AOWA 3K0BA 4PWYA 2IPXA 4RTLA 4CXMA 3UJ9A 2GS9A 5DT2A 3T7SA 1NV9A 2VP3A 2OB2A 3DMHA 4AZTA 3G88A 3TKAA 1Y8CA 3HCFA 5T6BA 2H1RA 1NBHA 2BR3A 3DLIA 4CKEA 1JG4A 3P71T 3Q87B 1Q0SA 3FTFA 1DL5A 2UYCA 2P40A 4H0NA 5K0CA 3M6VA 5EIFA 3KQSA 5LQKA 5GIPE 2Z6UA 3OFJA 2PSSA 2C7QA 2CWWA 1D2CA 3EMDA 3H2BA 5BW4A 3DXYA 3KR2A 2ZZMA 2YTZA 3JWJA 3UJAA 4ER0A 5CVVA 3EEOA 4BY9E 1FPQA 1KPGA 1XXLA 3DMGA 3FRHA 1VLMA 5E9QA 3TM5A 2QY6A 4C04A 1M0EA 2PX8A 5T67A 5U4XA 5K0NA 5FQNA 5P8WA 3LPMA 3MTIA 4QDKA 3FUUA 2PV0A 4RTJA 10MHA 3DXZA 1SVUA 1NT2A 4C05A 2KW5A 5ICGA 3HCBA 3M6WA 5EMMA 1G55A 1KIAA 3KPUA 5F2OA 3SXJA 5DM1A 5K05A 5DX8A 2C7RA 2CMGA 3CGGA 2G8NA 2IDJA 3DLCA 4R8SA 5DTQA 4AZVA 4E2XA 1Q0TA 4MQ4A 3IEIA 4FR0A 3GRVA 3LBYA 4RVDA 4IWNA 3CCFA 4E2ZA 1NW7A 3SSOA 2O57A 2P3QA 3BKXA 1NW3A 3PLAE 3LDGA 1KPHA 5E1OA 5HIMA 3LECA 4CKCA 2GH1A 4GF5A 3P9KA 3SVZA 2PJDA 4PCLA 4HG2A 1F38A 2B3TA 5EHIA 5HZMA 1L3CA 2BZGA 3KQWA 5KVAA 5FQOA 3FYDA 2OKCA 4YMHA 2IP2A 4X41A 5DXAA 3RW9A 4RTSA 2I9KA 2EX4A 2AZTA 2V7EA 4OBWA 2AOVA 3PFGA 2I7CA 1H1DA 3P97A 4MWZA 1R6AA 2ONZA 4R6WA 3PB3A 4RWZA 3RODA 3TLJA 2E5WA 3OU2A 5EMKA 1JR4A 5EEGA 2G1PA 2JJQA 4E2YA 2NNWB 3GO4A 5LQJA 2PY6A 3QOWA 3I58A 2PWPA 2BH2A 5ICFA 1QZZA 2IIPA 2NXNA 3G2MA 3ANXA 3FZGA 5EOVA 2FCAA 5EMLA 4CTKA 2XYQA 1P1BA 4AZWA 2I62A 5D1NA 3GGDA 4E70A 3HP7A 2AR0A 4HH4A 2ORED 2C7PA 3R6TA 2QRVB 5DXJA 3G5TA 2UZ4A 3OZSA 4EKGA 1YZHA 2QRVA 1XDSA 1XCJA 3R0QA 3E23A 1NE2A 3KHKA 5DPMA 5GINE 3D2LA 2P3LA 1PJZA 3NTVA 4KDRA 4RVHA 4CWAA 5HOQA 3DUWA 4PIPA 4EK9A 2IGTA 2FPOA 4YUYA 1VPTA 3UJCA 2CL5A 3LSTA 1YUBA 3LCVB 3LHDA 3FPHA 2YR0A 2PVCA 5FCDA 2CMHA 1QANA 4AZSA 2P41A 3KPJA 1QAQA 4FSXA 3FPJA 3HA7A 2QYOA 1RI4A 2JH9A 3EMBA 3VSEA 3UBTA 5CCXA 3CJTA 2QM3A 3GJYA 4UOEA 1I9GA 3P2KA 4XUDA 1D2HA 1JQ3A 5B1SA 1EAMA 5T64A 5DM4A 2P8JA 2NP7A 2ERCA 4IV0A 3FYCA 5LQUA 5EPEA 4V0RA 3TR6A 2IDKA 3MCZA 2YUIA 4RYLA 3C3PA 4QPPA 2AS0A 2AOTB 2CKDA 3MB5A 3A27A 4QVGA 3C3YA 3AWIA 3NVMB 1RJEA 3E05A 3F4KA 1QYRA 1RJFA 2WA1A 2YX1A 2F8LA 3AXSA 3A25A 3ERCA 4KWCA 1G8SA 3LKZA 5EC8A 1NW5A 4GBED 2ADMA 3R3HA 2AOUB 2AVNA 3PFHA 4BLWA 4DF3A 1L3IA 4M37A 3EEYA 3P9IA 3HCCA 2AOUA 2O0LA 2I6GA 3G5LA 5DRTA 1TW3A 4OA5A 4KVZA 4PGGA 5K8VA 4KDCA 4LG1A 1N2XA 2HTEA 1RI1A 4RSRA 2YQZA 3BKWA 3MAGA 5JR3A 3GRRA 3EVFA 1BOOA 3A4TA 1M6YA 4NECA 5C0OE 4QVKA 4F84A 4YV0A 5CVDA 3AXTA 2B25A 2O06A 3GWZA 2Z6QA 5MHTA 2HNKA 5KS2A 4LECA 4RTPA 3UJ6A 4F85A 3BGIA 3PX2A 2P3OA 3MHTA 1P1CA 3G7UA 4EKIA 5DM2A 2ZWVA 2HR1A 1AQIA 4R6XA 2V74B 5GWXA 3GRYA 2O05A 3T0IA 4ER7A 4POOA 1UIRA 2HMYB 3JWIA 5FUBA 2YXDA 2IBTA 1SUSA 2IH5A 5FA8A 1WXXA 3NDIA 4PIMA 4E30A 5M5BA 3ME5A 2OO3A 3GCZA 1VP3A 3HEMA 2PX4A 2EJUA 2K4MA 3DR5A 3DULA 4C4AA 1YFLA 2Z6AA 5KQRA 1XTPA 4GEKA 3GRZA 2AN5A 5H02A 3WSTA 1HMYA 4PINA 4DKJA 2AOXA 4PYKA 5DSTA 2N47A 1EIZA 4PYJA 1V39A 3KR9A 3KR1A 3CC8A 4DCGA 2JH8A 3REOA 3CBGA 3M4XA 4V0QA 3TOSA 3GNLA 3NWBA 5LQRA 1SKMA 1U2ZA 9MHTA 5ICCA 3EVEA 1ZGAA 2VZ9A 1JTFA 5JUWA 3C0KA 1ZG3A 5ICEA 3M33A 1WY7A 2UYQA 5LR6A 3EGEA 3HCDA 4M36A 2ZBPA 3SSMA 5CIYA 4RVGA 3ELWA 4U7TB 5K0EA 5K03A 2XYRA 2HWKA 3DP7A 3EVAA 4PYIA 4BLUA 2FYTA 4F86A 3KQYA 2IBSA 1P39A 2ZCJA 3DH0A 4IV8A 2ZW9A 3LCCA 3R24A 1ORHA 5HEKA 3NVKI 1X1BA 5DRYA 5KYGA 1IM8A 3BUSA 2PX2A 2PLWA 3I9FA 4RTNA 1NBIA 1XVAA 3UA4A 4DA4A 1MHTA 1NV8A 3PVCA 3HCEA 4XUCA 5LQCA 4YUZA 3FUXA 2WA2A 1IY9A 3ER9A 5EZQA 1KP9A 3KQOA 2ZWAA 2A14A 4EQZA 3M70A 3TMAA 2YVLA 3ER8A 1RI5A 4L7VA 1JG1A 1DUSA 3EVGA 4FS8A 4P58A 4GQBA 4QTUB 2NYUA 1L1EA 2EG5A 3KPYA 3O7WA 3G89A 2ZIEA 4HTFA 5D1HA 3V8VA 3T7RA 1KHHA 4BP1A 4R8RA 4RVFA 1KYWA 1N7IA 4FT2A 4GOMD 4HC4A 3QOXA 4AUKA 2OPBA 5FA5A 5GIOE 5G02A 4E2WA 5FHQA 1N7JA 3C6MA 3IV6A 4M38A 4MIKA 4A6DA 5CM2Z 4RTMA 1KR5A 5FULA 4P7JA 1FJXA 2XVAA 5EKUA 3EGIA 1SG9A 5EIWA 2PX5A 3UFBA 2IH4A 1HNNA 2OYRA 2PGXA 5HIJA 2EFJA 3Q7EA 3THRA 2WK1A 2FHPA 2ZVJA 4Y2HA 3SR4A 2QE6A 1MJFA 5EEHA 3CJQA 4XCXA 1VL5A 2C7OA 1X19A 3E7PA 3ELUA 3G2OA 4PYNA 5HILA 5K01A 1L9KA 2BR5A 2ZIFA 3FUVA 5ERGB 4ER6A 5EQJB 1O9GA 4M7RA 1G6Q1 1JQDA 2LD4A 3UJ7A 3KPVA 5EMJA 1KYZA 1NW8A 2PXXA 1RJDA 2DULA 3L8DA 4FZVA 4HGZA 1FP2A 5DSXA 3BGDA 2VDVE 5E9JA 4ISCA 2Q41A 1G38A 4RTQA 1INLA 3SX0A 1R18A 3B89A 3OU7A 1FBNA 3G8BA 3UA3A 1XJ5A 4EVIA 3HA5A 1T43A 3GXOA 1SQFA 3B7PA 2P1DA 3MCTA 2GAFA 4Y30A 3MTEA 3HA3A 1ZGJA 3TRKA 4C03A 3GRUA 3K6RA 1VP9A 4PGHA 5EHGA 3B5IA 3HVHA 3THSA 4DCMA 3TM4A 4DM3A 3NDJA 4RTOA 2Y1WA 3LX6A 4PYQA 4K6MA 4KW7A 4KRGA 4P7FA 3HVIA 3LCUA 2JG3A 2B2CA 3FPFA 3OE4A 2EJTA 4RTRA 5K09A 4ER5A 3P9NA 3PX3A 5DLYA 5DM0A 4BP3A 3DXXA 1VQ1A 2OBFA 2NP6A 3HNRA 3KQVA 3UJDA 3MGGA 1WZNA 1R74A 1YB2A 2GA9A 5E2AA 1YFJA 3SSNA 2ZSUA 5E1DA 4P7GA 4OQEA 4OQDA 5LQAA 5IH3A 4PCAA 3UJ8A 3G2QA 5E1MA 4DMGA 5HIIA 1WS6A 4HRAA 4LWPA
chains in the Genus database with same CATH superfamily
1QFSA 1E2BA 2SHKA 4PW0A 3HJGA 5IM4A 1RYZA 2X42A 1DCMA 3I2IA 1CJKC 4QSMA 4UMEA 2DGSA 2G9UA 4I4NA 1DXOA 5HLFA 5F9LA 4MV8A 2PSEA 3NIWA 2PS0A 4KAIA 1QQ6A 3N75A 1YRBA 1TKTB 4LHSA 4UVEA 3U4CA 4BV9A 1XDDA 2UYOA 4LF1A 5TPZD 4FT4A 1S3FA 5C7YA 3MZ0A 5E3QA 3ZWQA 1IKVA 2PUVA 5LMNC 5BMVF 5CA1B 4J9KA 3WGLA 2D74A 4LUCA 5A05A 3G9ZA 4TSRA 2PUFA 3WHLA 3K05A 4RPLA 3FYHA 5JD4A 4HEQA 4USHA 4G5OA 1L5HB 3GI1A 1S1XA 4ARVA 2ONYA 1KI4A 1NBMD 1DWQA 4MYHA 4YMVA 3C7CB 3IRUA 4E31A 2PUDA 4XXHA 1JJBA 3W5YA 4J7CA 4A8FA 4MR8B 4AWAA 3ABRB 3KJVA 4BKQA 2BBWA 1HYSB 3QXSA 2B6AA 2H4YA 2XE4A 3D5EA 3L1UA 4RPCA 1T1JA 4QR1A 4ZI7A 1XDUA 1G2OA 2XB2D 3GJQB 3NJ8A 2R6CA 5H9EK 1B6RA 2QF7A 1CR1A 1CJUA 1E6VA 1ZJJA 3QQCD 4BVKA 2VHQA 3R1LA 3N76A 3BGUA 3G17A 1Y8QA 3EX7B 1RAOA 4CV1A 2UYHA 5J1EB 4CDMA 4CM9D 1QQ5A 2R3SA 4UC0A 1FBTA 2P1RA 3QZUA 3BH6A 1QVGR 1DBQA 2ZJFA 1E0SA 2ZUTA 3ZX4A 1M8PA 2WKWA 4RAQA 4Q1BA 1JEAA 2O8CB 1U2RA 4RO0A 2PT7A 3LUCA 1L5FA 2QL6A 3AHDA 1NMSA 3CT9A 1P9RA 3LPLA 3FCOA 4MW9A 3R9WA 1E0AA 2QLXA 2CMGA 4B2YA 2RAVA 1W36B 1Y33E 3R77A 2H4HA 1L3KA 2XY6A 1F0PA 1EVKA 4XDYA 3GYBA 1AVTA 3U6BA 1U5AA 2ZI4A 4IZIA 4ENWA 2R60A 1T13A 2R84A 1Q0NA 3PQ4A 4EGSA 5D0RA 4Q8FA 5CITA 4LRUA 2R2TA 3MURP 3RB3A 3RS7A 3OIGA 2C3YA 4ENQA 5IN4A 1CNEA 1FSSA 3QVVA 2UZ4A 1RAFA 4EG3A 3I34X 4FYHA 4KO4S 2VJNA 4F9GA 1CZUA 1U11A 1C9DB 4BU0A 3WISA 1R0AB 1WG4A 3EGZA 2C3PA 4NRDA 1KJ9A 4U7FA 1GOTA 1XZCA 5LQUA 2GXUA 3QUTA 1H1LA 3G1UA 4JI0B 2KN4A 2A9JA 3IUBA 4MVXA 3U31A 3ZQ6A 3GCWA 3KLVA 1GCOA 1N9GB 4G0NA 3CKMA 1QKKA 2QGZA 1G8SA 2X13A 4M37A 2J0UB 2QM8A 4YP9A 2VBWA 3EVFA 1HMPA 4KXMA 4UUBA 1EK6A 5CB4B 2Q9UA 1QNFA 2C88A 2PCLA 4IDEA 4ETWA 1I3OA 1S9EB 1M1NA 3INTA 3JQAA 3VR0A 5GAHU 3F5MA 1JDNA 3IEMA 1UK6A 4LI0A 2ZUCA 3CNQP 4C76A 2PUGA 3FZNA 4DQSA 5B1YA 3UG7A 1LNZA 1O4WA 3H5LA 1SPBP 2DNOA 2WFAA 3I04A 3K4PA 3FEYB 1G98A 1E7YA 4BUZA 2EGTA 4NFYA 1JLSA 3NASA 4RVGA 5KFRA 1XKTA 4HFMA 4GLLA 4AY4A 4RW8A 2W42A 2Z30A 3SLKA 4C21A 1HGXA 3BORA 2GNAA 1SKBA 3OPXA 5L39A 4JDPA 2GVDA 2GZ2A 4A4JA 1IBMB 3TSYA 4N7RA 2IIBA 4B71A 2GD0A 1QR2A 3DE4X 1T2UA 4MIKA 3NM6B 1E94E 4NG4A 3TYTA 1P8GA 3MIIA 1W75A 3ZUGA 5J1SB 3TS1A 1XDWA 3BSWA 4Q21A 4JLSA 3GFFA 1HR0C 3QI2A 1K3UB 3OM8A 4WINA 2ZBFA 4YT5A 2DRIA 4X4VA 2YCLA 4LF7F 1VP9A 1KY2A 3E70C 3KK2B 2I1VB 1NWCA 5GONA 1G64A 4EA9A 5K8LA 4DL6A 4UTOA 1OAOC 1GP2A 4LHWA 4LWPA 4YUWA 2YXLA 5JZMA 4A23A 4FSDA 3ULKA 4RW7A 4HFRA 3UCFA 2QFIA 1XCMA 4KDFA 1IJEB 2FP3A 3D4LA 1C0TB 2E7ZA 3CUTA 1GFWB 1O90A 1M72A 2LQJA 1H0SA 4AMUA 3LPEA 2C54A 5LQNA 4IW3B 4JI0J 3ACCA 3MQ2A 2AK2A 4P83A 3G8AA 2YY6A 1YVUA 5TR9A 3AM5A 4YAKA 1A96A 2UUBF 1NKTA 2HMVA 3TFOA 1C4AA 2MZRA 3US5A 4DV7C 1PCAA 3O9MA 4FBGA 5BJRA 5AKGA 1R8CA 5C1PA 1ULRA 4K88A 4AS1A 1IZ8A 3ICCA 4GOLD 1DAGA 1FESA 1QRUA 1RMTA 4QJBA 3UEBA 4BLRA 3GLUA 5CB6A 1O77A 4ZDWA 3WV5A 3ISVA 5FPKA 3BAZA 4PZPA 4IQGA 1KLMB 4AI6A 5JC8A 4WOPA 2XMDA 4CM5A 1PZMA 4EG8A 5IWCA 1D03A 3RF7A 3VI4B 1A82A 1Z8DA 2IZ7A 3N2ZB 5BYSA 1T91A 4ZT2A 3BREA 1IBMJ 4P72A 2JFOA 5ETJA 1QC5A 3EZ2A 3I5BA 3OXGA 3TKAA 3F5QA 1BD3A 2CPEA 5L3VA 2F4VC 3T9DA 3EULA 1EFHA 3P9QA 3RTAA 1SD2A 3EWGA 2Y1RI 3UJAA 2Q21A 4AZ0A 3ZLUA 2KLHA 3OUYA 4GKJC 4CF4A 1F8GA 2CVIA 4W5TA 1D2NA 2CVPA 1V7PC 2WTFA 4YJ3B 3QZ7A 3FNBA 5BNZA 3CO0P 1HE1C 4RYDA 2AMJA 4EY8A 1SUPA 4C88A 1PTKA 3IRVA 1OGYA 1UXHA 5LFAA 4CQJA 1NTRA 2J7PD 4BFUA 3EUEA 2C7PA 1YOVA 2BR0A 1C4WA 5JDIA 2ZJ7A 1I33A 3KLOA 3QF7A 4JU8A 3ROMA 3N01A 4YUYA 4NZMA 3N6LA 1RKIA 1TTHA 1BEUB 2M52A 1IDOA 1UH5A 3BF7A 4GO1A 5CU7A 4FNOA 2LQ8A 1UW4A 5JDCC 4KNWA 1RACA 4Z51A 1OIAA 2KJQA 2PDAA 4YDDB 3C48A 4FE4A 3HGMA 4FFLA 4JJIA 2J07A 4UW2A 4BB9A 1HZZC 1EVIA 2IJRA 1U48A 1IK4A 1DKQA 3HLUA 1KZ6A 2FZEA 1YE8A 3O74A 3A4TA 4TLCA 2VFAA 1Y1PA 4R2LA 3L7DA 1A2OA 5KG2A 3OIWA 2PUHA 3U3XA 3DOMB 5JJCA 2ZUVA 2QP4A 3B6KA 1ZDMA 3DJFA 4RVSA 3TA0A 3HSGA 3A12A 4IS3A 2XC9A 2C8JA 1XVUA 2YW9A 3IIIA 1VQMS 1GPH1 1JXQA 4XDZA 4CMAA 1NF2A 3T12A 3KEQA 4NATA 2ZK7A 4IGIA 4UM7A 2P2ZA 4YJHA 3KX2A 3TZ6A 3U4QA 4BBJA 1GUYA 4B6FA 5AD1A 1OMSA 3Q7PA 1M10A 3E01B 4EFNA 4OP3A 1DZ3A 4E5YA 4V19X 5L6MB 4LR8A 3ITHB 2HG4A 3VTZA 3GZ4A 3IWXA 3R4CA 3WLQA 4ED0A 4HDOB 2DNLA 2W4IA 3E53A 2PT0A 2WEKA 4MX8A 1T5BA 4N54A 4TUYF 4J0QA 1MH9A 4CQLB 2IYOA 3EE3A 3SXUB 2Z5FA 3PYMA 4BBAA 2XQGA 4WY5A 1EP3B 1C30A 1G6Q1 4JI8C 3LWLA 4AMVA 4EUKA 1Z5GA 5D0GA 3MK31 3GXOA 3PEWA 2HK2A 2IJNA 2ZSIA 3MWEA 3D6HA 2C96A 2DY9A 4DCMA 3IA2A 4PLHA 4BFXA 4AMGA 1NA5A 1WMBA 3BIFA 4QXRA 2YWDA 1YBVA 3AG5A 3GEPA 4BP3A 5C4MA 2BFFA 4UHKA 5LJ5Y 5JEDA 3SJUA 1BLUA 5ER6A 1T9KA 1KR2A 1UA0A 4WCFA 1ZA1B 3D1OA 2VBZA 2COLA 1NFRA 2QLBA 2F8TA 1C1BA 3PQDA 3PKZA 3PJ9A 3C1UA 1HNXF 4A91A 1PDOA 1KFDA 2B4UA 4O4HF 3R3TA 2YWCA 4DUPA 1GQ2A 1F8UA 1B23P 3VX3A 2QG6A 2GK6A 2VHWA 1WOMA 2XDAA 2ZB7A 2JZOA 3HJHA 4JVNA 4R0NA 4LC1A 4LCEA 2ZJ3A 1REQA 1JILA 1RXEA 1Z2DA 2QSUA 5E8RA 1ADCA 2VPXA 3EMVA 3REQB 3DT8A 1TEHA 2ZPAA 3EYWA 4XGIA 3C2QA 2C2MA 2G9NA 1U3TA 1Z15A 2D0IA 2YC4C 4CODB 3QPIA 2HHTA 1KI3A 1KAHA 3SIPB 1BJKA 1TRKA 5GAEI 4OI4A 4RK1A 1ETUA 3EVNA 3ZGOA 2ZB2A 2OY0A 5HKBA 2OHOA 2HRZA 4P73A 3H4IA 5CH7B 4R84A 4Q2LA 1DWUA 4YFVA 3JQBC 4TYPA 1FDRA 2FYXA 4JI5F 1MO4A 4UTZA 1KFCB 5HDQA 3KVVA 4UJ5A 1NB2A 2QU7A 2RK3A 4K0KB 1E6UA 3U7JA 4RNCA 4WKNA 1WI8A 4GOND 3T0GA 4MHOA 2ONJA 2DVIA 1JG3A 1GL9B 1KXZA 3I3OA 5B3AA 4X63A 4J5OA 1MX5A 4Z4FA 4Q05A 3FD8A 1UKZA 3D2BA 1KKGA 3CVJA 3FNFA 1C1CB 1CJKA 2VQFF 3ZC3A 4HV4A 2MHNA 2NZWA 3CZCA 1T2VA 2R4FA 4WFJA 4A10A 5JI3E 3P3DA 1U8XX 3FVRA 2OFPA 4MYDA 2H8GA 1R0KA 2A0KA 3B60A 5NLLA 5EMMA 4URFA 5C51B 3TJ8A 2IDJA 3FPKA 2ZWPA 4RVDA 2IHUA 2DLCX 3VU8A 2J3KA 1NZDA 2DHRA 1E6CA 3TEHB 1XT6A 5BRAA 3LUKA 1KZHA 4LFCC 5TJ9A 4X4SA 5L9NA 2P79A 1V8DA 4WT7A 3EUNA 2V9PA 3WLOA 1VIXA 3C3DA 3DRPA 2ZJRQ 4IH1A 1JDSA 3PEVA 5ALRA 4CCYA 1QRTA 1HIYA 1E1RA 2C3MA 1GG9A 4J9RA 1VGVA 4GX2A 2YWWA 3U17A 1F48A 4LOIA 1BDMA 3CJ3A 4I2QB 4C8NA 4EIWA 3AHIA 2P9CA 4W7SA 3RYCA 1J7KA 4X65C 4URWR 1RRMA 3GJYA 5T64A 4WK4B 2EEPA 2FXIA 1XAJA 2QR5A 2B6HA 4NJEA 3RBXA 4RYLA 1CUHA 1T36B 3MM5A 5FUQA 2ACVA 4I0WA 1OCEA 1I4LD 4D8UA 2KB2A 4BLSA 2B8EA 4NMLA 1SCJA 2JIZD 2X3UA 4GMHA 3JAKB 4PYDA 2MYUA 5ALHA 5D3MA 5KS2A 4RPFA 4RQAA 3T6JA 3USZA 3T1NA 1EVEA 3FNIA 4Q8EA 4U96A 1A9SA 2AHOA 4ZVSA 3KYCA 2C8KA 4XFDA 2V2VA 1M8GA 3KR1A 1Y6QA 1BRTA 1UKEA 2Q5HA 2OZKA 1XWLA 3I1FA 3UWDA 3TZXA 4CT4B 2DWUA 4GWLA 3TD9A 2J9FB 4G2TA 5KYGA 1XX6A 1OYOA 4QZVA 4ETIA 1XLTC 3JWPA 4REQB 5EZQA 1U3UA 1BWPA 4P08A 2HJVA 4K0KJ 2ZRQA 4L9RA 1OU0A 4D92A 4GQBA 3ICOA 2DIVA 4A8JB 4B3MF 1KMCA 4JB0A 3PIPQ 1IXSB 1NT4A 1LPSA 1N48A 3MLAA 2OAGA 2HMSA 3BJYA 1G6BA 1S4EA 1A76A 4GLFA 1QSLA 2V9ZA 3NGLA 5LCIA 4XQEA 1NRJB 2Q0XA 2B4QA 5KCMA 4Y1RA 5EE0A 1PFUA 5KFWA 5FIIA 2J3QA 4D80A 1A5ZA 3T9BA 1V9LA 4JS0A 2Z04A 3NONA 3RVBA 2PRJA 2HOQA 3QVSA 3H97A 5DNCA 4AKSA 2YUTA 2UVUA 1YL7A 4UOZA 3KUKA 1Y3CE 1H6AA 3EOAI 4LISA 1SY7A 1RRVA 4ZPTR 3LNTA 3PHBE 3UQSA 5CLGA 3BPSP 2VWQA 1LRLA 1OZGA 5E1MA 3Q3GE 1X9MA 2H6EA 4JIGA 4N49A 2BONA 4QWWA 1D2EA 1Y3FE 2A10A 4IJKA 4NBTA 4YBZA 5FNVA 3HR7A 3F90A 1TVKA 2DWPA 1JSLA 4GM0A 1V4NA 3QA9A 4NBLA 4NE7A 1GCUA 3ICPA 2CZQA 2AFIE 3BIJA 4CQNA 4ZVQB 4ID3A 2ZRBA 4YB5A 3SGLA 3ET6B 1ZPWX 4JA0A 1XMOC 5GM1A 3RIHA 3H5RA 1NBMA 2QA5A 2CYBA 2ZSAA 5KPDA 1JLBA 3N6RA 3ND7A 4ZHSA 4HB0A 1PI3A 3KR0A 3AB4B 3DFIA 2FVRA 2MSCB 2PZLA 3CO5A 1WZIA 1ZIXA 4V0OA 3H84A 2SKDA 3RKSA 3D3NA 5K3EA 5D0EA 1MZVA 4N3GA 1IXKA 4TL6A 2ZLBA 5CJJA 2P5VA 3AUXA 2ASBA 3E5RA 1TFWA 4LSNA 5IJAA 4V39A 4DUYF 1BE6A 3U1VA 1HPLA 1EK0A 3EVTA 5A1TA 3SV3A 3M49A 5SUHA 2CUYA 4NU5A 2CGEA 1H0KA 3MEQA 2F3UA 3VMFA 4YB7A 4D0NA 2IVFA 1E3TA 1RI2A 1MOZA 3FDSA 5CP8A 3RJMA 2OV6A 1RWNA 3NAIA 2GYUA 5CX1B 1CJBA 3I30X 1I94F 2E6KA 2ZOSA 5LDGA 4DLEA 3VH4A 3E8MA 2C7VA 1R0YA 5FO1A 3NG1A 2JZNA 5IWAF 1AV7A 2IW3A 1PQWA 1Z5UA 4XSGA 4D9EA 1L4BA 1W5AA 3AOCA 1EHIA 4NXNC 4XYEA 1OT5A 2B5VA 4NR0A 2CU6A 4KO2S 5LMUC 2OHJA 4AZVA 1MG5A 5IS2A 2OPQA 2HFNA 5JSZA 5HFNA 2O57A 3JQRA 3NKLA 2VSXA 3L4KA 5H82A 3DYBA 2VPZB 2A86A 3QTLA 4MR9A 2C9CA 3RUAA 3CCCA 3FCCA 4L22A 2RHWA 4Z5XA 4IDCA 3KUGA 4YUDA 1FKAF 3B3AA 2DR3A 4FDVA 3I3SR 2UVWA 4ODJA 3CW9A 1C41A 1GZ6A 3A4VA 4UMVA 2HKEA 4L51A 2XMBA 3MEGB 1CYEA 2V94A 1Z07A 2XAAA 4CL8A 5BOSA 3MB8A 4EK9A 3TVYA 4FVMA 4M7WA 1FQOA 2IX3A 5K51A 3PRHA 3BMQA 5H70A 2OWDA 4RW6B 3OAAD 4CO3A 2WOJA 1QYDA 4IAOA 3KALA 1FUKA 3M2VB 1GJRA 2PMCA 1UEIA 3O8NA 2XZOA 4U4AA 5AW0A 2ASYA 4KSCA 5LUBA 1PC4A 2BTQB 2ADMA 3GOHA 3OSNA 4DQVA 1WG1A 3ZCUA 3EW7A 2ZJZA 1R4ZA 1Z28A 2FETA 3BL8A 3D4OA 1UWKA 1QHSA 2VJVA 1K7XB 2OQRA 3RC3A 3R2DJ 3TDNA 1JKJB 3D02A 1C2PA 1OTXA 1LS6A 3K20A 1ZSVA 2W71A 2VO1A 3RB0A 2F5GA 2PIAA 4WK6A 1HBMA 2OXFA 1K4YA 3ZDYB 4FVTA 2Y3YA 4G24A 4MUMA 2VL1A 4TGLA 2HFOA 1Y4AE 1QM4A 1OF1A 1H8ED 1E6KA 4NDZA 2XODA 4YJDA 8LDHA 4I5DA 3V1LA 3GT3A 4WZBB 3RYIA 2X1MA 5DWVA 2RARA 1ULUA 5IXJA 2ZBUA 4EZEA 2GXQA 2ZOGA 4K8RB 5IVKA 2WV7A 1HNXB 3GFSA 3RAGA 1VQKS 1NNEA 3H11B 5DLFA 3HN6A 4O4HB 3PXGA 2HI0A 5H0IA 4FNAA 4L8GA 4IIJA 5KINB 1PW5A 4C7MA 3UT0A 1I1QB 5BV8A 1DXYA 1N5YB 3T1TA 4DJEC 4DM4A 1FP2A 2ATCA 3D0HE 3ETLA 3MBKA 1IPFA 1ECLA 3LVQE 1F0XA 1KK0A 1RADA 5B4TA 3TM4A 3MR2A 3QPCA 2R8ZA 5JDCA 1DEKA 4U8HA 3K15A 1A9XB 1AGRA 3NTLA 4KMRA 1HZZA 3CDUA 3H5IA 2DJ5A 4MLZA 3HT0A 2N1MA 4YXWA 4RW0A 1FNCA 3ZS9A 1IY1A 5FOXA 3IXMA 2J6IA 2Q3HA 4A16A 3GGCA 1ZFNA 1HSZA 1VLYA 3L79A 3ANTA 5BSRA 1L4UA 3DDCA 1N5KA 4P33A 3UJBA 4DSTA 2YKMA 1TD1A 1AFJA 1CG2A 3PHJA 2QSYA 1PHPA 1NNDA 1DT5A 1BXZA 2FZGB 2O5CA 3EDRB 3I4PA 4D1YA 1YQXA 1XZNA 3B53X 5ALWA 3I01M 3O4JA 3JAMD 3SC6A 1VSVA 4WQMA 4MA0A 1E8DA 1H2WA 1HQKA 4LYYA 1TK3A 1Y3DE 4NZ7A 1PR9A 3Q2IA 2PXCA 4U6NA 1TJ3A 4EH1A 1WOPA 2PZMA 2VT2A 2JEZA 4DB2A 1ZKDA 3H0PA 3THYA 1VK3A 2Q1YA 4RH3A 4C8ZA 3PUVA 2R6ZA 2WUEA 4LC9A 5KFCA 1NG9A 3J81j 2ZBVA 3U4DA 1OFTA 2QBYA 3JS5A 5I7HA 1ZJ6A 1E2FA 2Q5CA 4RJKA 4G5GA 3K5IA 4E5DA 4NI2A 2B7CB 5ULLA 3WLIA 2G06A 3KV1A 2HHVA 3GR0A 8ADHA 1SWVA 1RWVB 3V46A 4MGYR 4RW9B 4Z7YA 1HNXJ 3EFOB 2V5UA 3UK6A 5CT5A 2W9BB 4ONEA 3ZYZA 1P33A 1CJCA 4O3PA 4KGDA 3KZMA 1YDMA 1IZYA 1JAZA 4OBEA 4YIHA 3F7OA 4A3SA 3KTQA 4H0CA 2QJOA 2QY6A 1RZ3A 3BYRA 5K0NA 2ZJAA 4JR2A 4X84A 1FFWA 3I9V1 1OO0B 5DCUA 2H54A 4JQOA 1AKNA 2X15A 1SURA 3IP9A 2HK9A 4N39A 4MULA 1CUEA 3P32A 3PW2A 3CZAA 4RETA 5HX7A 1NVKA 1ZJ4A 4K6FA 3EY9A 1MAHA 1L8AA 1AIPA 3V2GA 3GFXA 3SVLA 3OOWA 2XSZD 4W98A 2E5WA 3STTA 2CSXA 2IBKA 3D2CA 3MAQA 1R9MA 4R16A 2Y4NA 4B76A 1V0JA 1IM4A 1S7HA 3FVVA 3G5UA 3JTNA 2C9MA 5F78A 2O9JA 3W7AA 2OPPA 4NCJA 4CWAA 4CO4A 3CSSA 4E7OA 4M9QA 5LU8A 4OX9B 2DAPA 6REQB 3NBXX 4QDTA 13PKA 2YVKA 1LPAB 1M6XC 3E5MA 5ETSA 1G8FA 3CJTA 3Q8YA 4O4JF 2W6PA 1YRLA 1REGX 4M3NA 3C45A 3QNUA 3JQBA 2Y4OA 1RJEA 4I50F 4USVA 3NMRA 4LRCA 1IUKA 1UZDA 2EJVA 4C29A 1IVNA 3IUSA 4DCOB 4HPJB 1YZLA 1VKJA 2AFHA 4OKNA 2O3QA 3K9QO 1FSGA 1P3DA 4DSIA 3EYAA 1PL6A 1VLHA 5BT8A 2HR1A 4V02A 3PW4A 2NUTA 4YUAA 5ECGC 4DHVA 3HF5A 3NS5A 2YWHA 1XRCA 3KE9A 5D5PA 3JPYA 5H02A 2ROGA 4WNIA 4LYJA 1ZC3A 3I6YA 3LGXA 4DCGA 2Q79A 3W2WA 1E79A 1NVAA 1OXXK 3DDOA 2WD7B 421PA 1IL0A 3UNYA 1OPIA 2ERRA 3HJAA 2XM3A 2XYPB 1SOMA 2J5XA 1Z7GA 1MU2B 1M5KC 1YH3A 2O1EA 3ZS8A 1SBZA 3TIIA 4XWOA 1NSYA 1TA0A 3ZXYA 3K9GA 5LP6F 3SDEA 2YJTD 4L0MA 2UZAA 4AKEA 4G37A 1XCGB 2HJHA 3MMNA 2HNZA 4P86A 1ZW1A 3D54D 2QU8A 2R9LA 3EGIA 4UJ3A 2JIMA 3KBBA 3CG0A 3KLEB 3QJYA 5FFFA 1TGYA 1G66A 3TJRA 2WMYA 1E69A 1WF0A 4DM7A 3K9HA 1CULC 2BHLA 4RTQA 1MCZA 5I6DA 3HFSA 5KIAA 2QA1A 3AVXA 4WFQA 4EJ0A 2GARA 2FZVA 4OXXA 1TEVA 1Y1SA 3QAEA 3RU9A 1C0UA 3ZNQA 1DC8A 1XJWA 1FFSB 2DT9A 1K4MA 4KV8A 3UOGA 5CA1F 3CJ4A 4LOLA 2KXFA 1FXDA 3MC1A 4DN6A 4LY6A 1EFVA 4DJBA 4PV7A 1HTWA 1BEZA 4JVLA 2BJHA 2MZSA 4XWAA 3HXPA 3RAQA 2BFBA 1EXNA 3LZCA 3DL0A 1YDFA 2X8AA 2VTEA 1UFLA 2GF9A 3WGUA 4WFIA 2O2XA 4Q0BA 5B3JA 1MW8X 2WAYA 1S1TB 3BRQA 2EFEB 2ODBA 2ZM6C 4FGSA 3H9UA 5ITZA 1FNSA 1K8QA 2NUAB 1RM3A 3FN4A 3OZWA 2WJGA 5CDHA 1U0NA 4XDHA 2POKA 3NG8A 2IS2A 3TXYA 4OA8A 2FSGA 4KUHA 3IJRA 5DZSA 1F2HA 3DM9B 3QVGB 2P9HA 3DMFA 5LKRA 4FFSA 1E9AA 1T3HA 4YACA 5LLTA 1TFRA 3A10A 3CNNA 2VIHA 1KVJA 2XBMA 1TFYA 2XQVA 3BD7A 3L6UA 1W2HA 5D2CA 4FFBA 2JRSA 4RSHA 4EU0A 3N8IA 3TX6A 2B8PA 2XD9A 2LMIA 3E5NA 4I5IA 5I9IA 1KZYC 4TLEA 2DEIA 4PUOB 2QRRA 4CV3A 4EGAA 3I0RA 4ZC8A 3UAGA 1R4NB 3P2JA 3FVWA 3WFJA 1H3NA 4OTZA 1FRJA 2AN3A 2RB7A 2P6MA 3F71A 3LP1A 4IYQA 2BIFA 1MENA 3IEVA 2HCBA 3PRKE 4RZXA 2FMFA 3X1XA 5F9MA 4OI2A 1S72S 2X3FA 2HEGA 1VRCA 3ETJA 3UCEA 1RYMA 2OSVA 4GE0A 1V5WA 2A33A 5HKLA 4QWDA 2C57A 3KNAA 3H1FA 1T7PA 2EYQA 3P71T 4IGAA 5CFNA 2WWYA 3RLFA 3L7MA 4KP7A 1GK8A 2C84A 1TQDA 1CDOA 3DMGA 1RAGB 3I62A 1DG9A 4H7IA 4A8TA 2QROA 3L6BA 2FPGA 1MT3A 1V3VA 1DMRA 1MW9X 1QM9A 2VR1A 1U28C 1HWJA 2JK1A 4O4IA 4U6QA 4MYCA 4D9IA 1WKBA 4YQYA 4O1MA 4RD3A 3ISND 5JT1A 2DVMA 1EWYA 4JI0F 3EA4A 2NV0A 3PBKA 2ZWIA 4PG7A 3QOWA 5EA2A 1QZZA 2J6HA 4YAUA 1HE5A 2AI2A 1VHLA 3PGXA 1WB6A 5ENVA 1YBMA 3NHBA 3COPA 3LOPA 3V8RA 1T1RA 3UIEA 3U2QA 4PRKA 1IB6A 2DFTA 1DHMA 3SEOA 1C9YA 1Y7HA 3KG2A 3OLZA 5CB4F 2CLDX 1QAQA 5HKKD 5CVTA 4K6OA 1X0VA 4Q3KA 3ILVA 5J4YA 3M7VA 3CCWA 2JIZA 1RRKA 1PSWA 1RPJA 4MUXA 2FJUA 5ED0A 2PD3A 4ARCA 3FSGA 4PXDA 4GBED 1LWCA 3W2EA 5C8ZA 1RI1A 3UAYA 1NLFA 4HHJA 3BXHA 3TQOA 2OE2A 1E2JA 5FL3A 3ZXIA 3GWZA 2Y68A 3TIXB 1IBMF 3GQBB 2MYFA 1SC4A 1PNRA 3ZGVA 4JT4A 2IDEA 2Q5EA 4QNNA 1GQSA 4R98A 1WF1A 1WDLA 2PGDA 4AICA 2X3DA 2QM0A 3DR5A 4FKMA 4D81A 2WJJA 3JQKA 4F2WA 4LJ9A 1N5DA 4ZDNA 4IP0A 1KBOA 2Z3WA 4V2UA 1VBNA 3UH0A 3SZMA 4O59O 1G7RA 5K03A 4Y00A 4FNIA 1S1WB 1RM5A 3A1UA 1DC3A 4OHKA 3Q83A 5KFTA 2PLWA 5EIHA 1T03A 1Q0UA 4PIVA 3MQ4A 2O8BA 4LQDA 1E6LA 1H6DA 3JD0A 5KWVA 1P6UA 4YRKA 3H4MA 2OO4A 1NFFA 1YBUA 5BVGA 2F9JA 3AOAA 2X9GA 1K0RA 1VJCA 4EGCB 2KZFA 3IAM6 3R23A 5EWLA 1WF3A 3KYDB 1KR5A 3HLKA 3TDKA 3IQXA 4IDAA 4HL6A 1LFDB 4JSYA 5EPUA 2QTWA 3MTAA 2QLJB 2GIQA 4EJ2A 5F1YA 2CVOA 1WBJB 2R7RA 1KDOA 4MUGA 1AD2A 5KT3A 1S4FA 1SKAA 3TI9A 3T5KA 5ALXA 1KDRA 3O92A 3U26A 2VDJA 1A72A 4TV8B 4LXQA 3WR5A 3NAGA 5CK5A 5HHTA 3HNRA 4P5PA 3FH0A 2REOA 2YFYA 1E99A 3HXMA 4J2HA 3Q40A 1BHJA 2NLWA 1M1KT 1CERA 4CTAA 4J37A 8AT1B 3FSRA 1XRNA 4L9WA 3KMQA 5D3KA 3IC1A 1BJRE 2G1UA 1R3DA 1J1IA 3LHSA 1QY7A 1MRZA 2JL9A 2CUNA 1X86B 4OQJA 2AFVA 1JJCB 3ISNC 3NPAA 3Q3EA 3OT5A 4Y98A 3WLAA 2LFVA 5DWQA 1TKZB 1N5TA 1JTVA 1CIPA 4G86A 1ITPA 2O3DA 3MPDA 2O8EB 4K46A 5H3HA 4HI0E 4FZJA 1IXRC 4DMMA 4ITRC 2VPWB 2QMUB 2R7VA 3QPWA 3O1HB 3DBIA 1GNKA 2KFYA 1WR8A 3AA9A 3T7DA 3UNXA 1UC8A 1COWD 3CVWA 3QNWB 4Q18A 3ZWKA 3TTUA 1EP4B 2DIUA 3ZHTA 3QSYB 3PLNA 2WVDA 2WFLB 2M2IA 4F11A 4EO6A 1FXWA 3KB1A 2XNSA 4KWTA 4R9SA 3V4ZA 4AG5A 1UVIA 4MKRA 5CAEB 1GYQA 1APBA 1MMDA 5JAUA 1NCLA 2QC3A 2R8IA 3FVQA 4FZ3A 2ODNA 3RVQA 1SHTX 1QYVA 3AU9A 5DBOA 4HRVA 5B58T 4B17A 4JJGA 4M1ZA 2X3YA 1EQAA 2IVZA 3NTUA 3OR2B 1ZB8A 2AW0A 4FD2A 3EF3A 1TB4A 3HI9A 3QIDA 2QJTA 1ZQ9A 3B3QA 1F14A 2VSQA 2DJWA 2GN2A 3LP5A 1DT3A 1V16A 1MAVA 1SQ0A 4DBVO 3V6JA 3UWOA 1YDWA 2JC3A 1GZUA 3WV4A 3WIOA 1VPDA 2IK8A 5A5GA 4AL4A 1M33A 4KR0A 4D9KA 2ZRLA 2WJIA 4LBYA 4MR7A 5HKOA 3SR3A 2P6SA 2HLDD 4QDKA 3EERA 4P4GA 4RU1A 1MNAA 1R3UA 3JVEA 2J0WA 3FYSA 3KZXA 3S01A 3L43A 3HO8A 4AURA 1Q0TA 2D13A 1DRWA 5LYJB 5CLFA 5EGNA 2FLOA 3AA8A 1JLAA 3SSOA 2Q45A 4NQRA 3K2YA 4PPFA 1OI3A 4I1TA 2G5TA 3AEQB 4I46A 2C2ZA 3PFGA 1U7LA 1QORA 3A9VA 2ZUAA 2QZZA 2NW6A 2FOXA 1SC3A 2GK7A 2H65A 1FK9A 3W5DA 1E1YA 2AXEA 3BWXA 3DGEC 4CH0S 2WW8A 4CZCA 2G1DA 2P91A 4IKOA 5DRKA 1FMFA 4PNZA 1UP4A 4K8OA 3TVZA 4URZR 2W8KA 4J0DA 1PKUA 4PSKA 3CCQS 1VPTA 3D1LA 2ZOMA 4LEIA 3FPJA 1ZS6A 3WRVA 4RV4A 3R3XA 4M95A 1SQ6A 5EPEA 2F3QA 1SXPA 3HZHA 2JJ2D 2D1FA 4K50A 1RJFA 1JJ7A 1EB9A 5DG8A 4OGKA 3U4AA 3A25A 1JK9B 1T24A 3R5CA 2P5TB 5AUPB 2GKSA 3G5LA 1RHRA 4Z9AA 5IDQA 1LBIA 1YZGA 2BP7A 4PNHA 1VL8A 3AT1B 4OXIA 1EX6A 1QYCA 4TMZA 4GECA 2AX1A 1YQ9A 1LW2B 4LSZA 3DEIA 1SZDA 4GKVA 2EW2A 3UD3P 4TLDA 3A37A 1LTHR 2KB0A 3A2LA 1M1HA 5JAIA 5G0RA 4Y28C 1GGHA 5LOVA 1QU2A 3RAEC 1MX1A 1AX9A 2PM8A 1DBRA 5L3ZA 1HA3A 5CFQA 1SKMA 1MABA 1LWOA 4TPSB 3IBGA 2HVZA 1MFPA 1V5IB 3GFRA 5I42A 1P9OA 3A9UA 2NX2A 5EZYA 4E11A 4HF7A 2ZW9A 3IMEA 3RW7A 3DLKB 4EPWA 3AR7A 3V48A 1POXA 2QUIA 2ZRCA 8OHMA 1BYIA 2ORIA 1RBZA 3S81A 5A4DA 2A0UA 2CQ1A 1IOVA 1QTNB 1RCXB 1W87A 4WZQA 4YJKA 2RJOA 5EVCA 3CJSA 1V1MA 3CEPB 4GDFA 3MWGA 3C1OA 3NDBB 3WRXA 4ED7A 1UEJA 2YNHB 2PGXA 1FFGA 2WABA 3DMJA 1ECJA 4P80A 2H7CA 4UCFA 2PSDA 1B41A 2QI9F 3LFUA 1FBNA 4R83A 4NJMB 2BOVA 3DDNA 3V4SA 5AVRA 1VQNS 5JSUA 2B1RA 3UAOA 1G0NA 1PFVA 2XVYA 3QWIA 5T3YA 2H5LA 1DNPA 4LTDA 1JFFB 4Y6IA 3Q0AA 4ZOEA 4MIWA 2VCEA 5BV0A 3BBFA 3E3OA 4ZPJA 3TQHA 2FFAA 3EPLA 3KT3A 3ZK7A 1X94A 4ZTZB 3UO0A 1GKKA 1T8TA 1E4OA 1L4NA 2LVWA 3CPEA 5BRJA 3BBCA 2FDRA 4JL6A 4ATNA 1BMTA 4FTWA 3BGWA 2FSHA 2JHAA 4NA2A 4IS2A 3NGSA 3P7MA 2J7UA 4YRLA 1YZ7A 1Z0AA 2I2XB 3K72B 4DTIA 4AYBD 1K06A 1C4XA 2BFPA 4BNXA 1W26A 1F0KA 2XGMA 1C9KA 2ZM5A 4IV5A 4FXDA 4QEKA 2XUGA 3PD0A 2ZI9A 3WO1A 1QAMA 2EIXA 3FDIA 1C8KA 1KWGA 1TE2A 2HJGA 4KGVA 3FOCA 3TPFA 2IRXA 1JR6A 3DMNA 3CZPA 3ASZA 2HYIB 5K0TA 5ADHA 1CS4C 1G1AA 3ZZPA 2K2PA 5KOXA 2DNHA 3HNOA 4TKUA 3A6LA 2O0KA 4K0KF 4O3NA 2FLKA 3A14A 5EXSA 2ZDOA 3O0DA 3RUFA 5EWJB 1BXGB 1NOKA 4XI9A 4FFMA 2Q3EA 2A8YA 2W93A 5KMGA 2INGX 4OQYA 3JYQA 2QLLA 3V2IA 4FB5A 4ARIA 1YMUA 1U7TA 4FX5A 3UK0A 1CULA 3RYFA 2CXQA 1TCBA 3DTVD 3KL2A 1N6IA 2ILVA 4ZPAA 5IV3A 3IAHA 4DQQA 4HWPA 1EX8A 3RPEA 1KEUA 3SF8A 1A98A 1QX3A 4NEQA 3K5WA 3PUKA 4BJHB 4RHEA 4UHBA 3TPCA 4UD6A 5KAPA 2AR9A 4KGZB 4IH7A 4YRNA 5GJBA 4DFMA 4OQMA 4M1EA 5F2KA 1Z4LA 5HF6A 4EFMA 4F71A 5CPFA 4RTLA 2Q8NA 2PUTA 1RYRA 1RP7A 1RWOB 3V1TC 2FFQA 5J2QA 2R1UA 3FLMA 4OI1A 1E3WB 3C14A 1VRVA 2W22A 2GIRA 5LSLA 2XSZA 3MHPA 4J0GA 2OPLB 3GJ6A 1KYYA 1JIJA 3FMVA 1Z4UA 4NYPA 4DL4A 2CF6A 1AU9A 2ASEA 3I09A 1YR2A 1KPHA 1PL7A 1NHGA 3PYFA 1TNDA 2XDYA 3K9WA 3GJSA 3U7IA 3CRQA 1ESEA 4O8ZA 2PWAA 3WAGA 3MA0A 1QDLB 2WTEA 1BCSB 4R9VA 5L9AA 3VJLA 3VVCA 4QSHA 2OP0A 3S5JA 3PQEA 3RRZA 4IRMA 3B2NA 5DBEX 2V7XA 1L4HA 4HH4A 4WKBA 3W9JA 3LX8A 2IS1A 4EKGA 1Y5IB 2WNSA 3OCYA 2VI5A 3CUYA 2R7SA 4N5HX 3HY3A 1WHTA 1E61A 5AFSA 4LZJA 3R7SB 5FUMA 3T5JA 1JJAA 1GT8A 1ZO8A 3IPCA 3FFIA 2W2TA 2BJWA 5C34B 2G9ZA 4FYJA 1NUAA 3E1SA 5HM6A 1ZAXA 4NMHA 1KKUA 2XQKA 3I0MA 5AMXA 3AETA 3CD6S 3EJ6A 4NG5A 3OKAA 1QUPA 1Y1LA 3AF4A 5AVKA 1WQ3A 1CZRA 3UDVA 2AD9A 3ZGZA 2PL1A 3V4VB 4BLQA 3WGNA 2OAP1 1XNRB 4KPCA 4MO9A 3CM0A 1PNQA 3DOKB 3V1NA 1EVYA 1K98A 1NJXA 3ADPA 4DBZA 3M32B 3BD6A 2Q4DA 4RE6A 1YZYA 2N47A 2ALYB 4WZMA 1RQ7A 4OHFA 1V39A 1N75A 3TOSA 3VZDA 5ICCA 2J33A 4MI3A 2VKQA 3LQYA 4ZAZA 2VUIB 2GT1A 2DEUA 1TKXB 2XXAB 4LDAA 4PYRA 4LE1A 3BSSA 3K31A 5AK0A 5JCPA 3ZLBA 4BE4A 3MGJA 2YXNA 4J0HA 1T02A 4P58A 1FFAA 4BNDA 3K1TA 4HGRA 2ZE8A 4ZT7A 1OQ6A 3DO8A 1OE0A 4B73A 3E9MA 5KPJA 3DDUA 1XA4A 5DCYA 3WK9A 2ROPA 4C3VA 5BSEA 4D3SA 2F43B 2LKZA 3BMNA 3FUVA 1L4FA 1SRQA 2VF7A 4R2JA 4MI6A 4JI3C 4PC7A 1YI1A 4ZI3A 3ZI0A 4PGAA 5HL7Q 3BRWA 3KSAC 2IQ5A 3K7EA 1JOSA 1I5OA 1NZAA 1TK5A 3IQEA 1AS3A 3DHWC 1ADYA 3NAHA 1UPMB 5AHOA 5K8MA 1A9YA 1OJ4A 4F97A 3V81B 3CW2C 2M3DA 1N33C 5FJ4A 2GHVC 3ZWYA 2NYAA 2V50A 3NNSA 5FO0A 4BMSA 4L72B 1EQ2A 3UUEA 2DB1A 3IJ5A 2I1QA 1TYCA 4C7OA 3JYTB 5CB0A 1N2CB 1FDSA 1GN8A 4XR9A 2ZYDA 3P2MA 5E9AA 4TMXA 4YR7A 1JQKA 5GMKa 3EZUA 4Z7JA 2C04A 1NXQA 4PNEA 1BC5A 5HIKA 1N56A 1ID1A 5K0LA 3PRDA 3U09A 5FWNA 4F93B 4XGRA 5F2NA 2O4UX 3ELDA 3U3DA 1SCBA 2KFZA 2CADA 1JFSA 1PLLA 3I76A 5HP1B 4YTEA 5EX0A 3F44A 2CFTA 3R7WB 4M8LA 3IQWA 2GUWA 4LBVA 4EECA 1XNRJ 3KSMA 3PJDA 3VAJA 5J2MB 3F2VA 1LXCA 1H6KX 4CETA 2BAGA 1Y10A 4HEHA 4C2BA 1U6JA 4LJ6A 2CDRB 2RAUA 4Y3UA 2C2KA 3PFBA 2QT7A 1GQEA 2QPAA 3W2TA 3BWYA 1Q16B 3M5DA 4R2IA 2QSWA 1VC0A 4WTOB 4DQXA 3MLBA 1WY5A 3NV7A 5TGZA 1JJ4A 2FJBB 1RC1A 1HZJA 2XMUA 4K3VA 2QP3A 3SC2B 2OEJA 5TC4A 2WM8A 2ESRA 3EXIB 4V38A 2XSJA 4ISBA 1T0JB 3OR1A 1YQGA 4LWQA 4WNAA 5CCEA 1H0HB 1YV9A 4DY4A 4OV1A 4N65A 2PLFA 3IVXA 1S5PA 3VDMA 5KOJA 3GR6A 4P2BA 3Q10A 2X9NA 3NS7B 2EW9A 2FB0A 2AR7A 2BJ3A 4DLLA 1OH5A 3FIUA 4B7ZA 1GN9A 2DHQA 1GDTA 1NF8A 1QE0A 5IJXA 3Q24A 4BY9E 2DLNA 1RA6A 3WMFA 4BNZA 1RFLA 2WJPA 1JAIA 1JQAA 1GL3A 1JHPA 2FRDC 221PA 2FPMA 1LZKA 3PYLA 4JJ8A 5I9BA 4C8YA 3P96A 4D4JA 1U8WA 5G41A 3KK1A 2C22A 3KJQA 2HBYA 4AY5A 3C3BA 4HVCA 1IN6A 1YRXA 1UUFA 1NRKA 4S1NA 4JITA 2HHHB 1UEUA 4PCLA 4LZLA 2RBGA 3HVUA 1Z5OA 3PB3A 2X1VA 1FNNA 1D7OA 3FCVA 5HKKA 3ONEA 4ECRA 1CS0B 2P0AA 2YNFB 2XXBA 2I6XA 3B1YA 1ZXXA 2FG6C 4NCKA 2D3TA 3SZOA 4TYAA 3H05A 4KMMA 3DAGA 2XZWA 4Q7MB 2BZ2A 2WHOA 4JXXA 2WJ6A 1LQ2A 4A5OA 5DI9A 1J2TA 4QPPA 3HBFA 1BQNB 4UATA 4DV2F 2QMHA 1YRAA 2G1JA 2FF5A 5LMZA 1CV2A 5CK4A 2XNRA 4KWCA 3A6PC 2QA4S 2Y0PA 3PJEA 1M1YA 5KTSA 3O6VA 2FG7C 4ZANA 1U3CA 4QG3A 1IG3A 4CG2A 3AVTA 2MJLA 1M6YA 4DB4A 2GDZA 5KOIA 3L7NA 1X7YB 1SVMA 3OY2A 5GJWC 5BSKA 4F3RA 1R7RA 1FX4A 2XMJA 1A8UA 2M1XA 3A0UA 1R27A 1YJUA 2R2RA 4DG8A 2YN2A 1J8QA 1JPNA 3ZIAA 2K3IA 4V0QA 5LZ4A 2KJWA 5ICEA 4YRCA 1JT9A 3DDZX 1H2YA 4L8LA 1D1SA 5J1PA 3BJIC 4N7MA 3M8KA 4JKYA 3DOHA 2NOAA 3KAJA 1FO1A 1IKXB 2BCEA 3EY4A 1DEXA 5EFZA 1BDIA 3BFKA 5CBPB 2KQUA 3H1GA 1U8EA 3BMCA 2GD6A 1T5OA 2OEKA 3OT4A 4C0QC 2KL8A 1UETA 1KOFA 4GT1A 4UQGA 3KHUA 1CF2O 4NNJA 1P5HA 3LXXA 4MWDA 1IDN1 5CA5A 4CO2A 2E4WA 4EY3A 3CDAA 2IIVA 3K1ZA 5FXMA 4UDYX 3MOSA 1RMYA 5K3CA 2WZCA 4DYDA 3H0KA 3VR5D 1R6UA 1IVSA 3WJ2A 2VDVE 5DM7Q 4AT1B 2ZTLA 1RWPA 1R0CA 4U7CA 4C03A 2J9XB 5L3QA 3PDCA 5FA6A 4DR2C 5CABA 3NHMA 4PYQA 3PEUA 3F5DA 5C5DA 3DXXA 4G4JA 3CPJB 1X2EA 3W6PA 3L0ZA 5DDPC 1IQRA 2P2GA 3EZ5A 2NVUA 4G23A 5DN6A 4HRAA 1QB7A 5ITHA 4LRAA 2VZ0A 2XT6A 1ADGA 3NW9A 2H85A 4ZCLA 5AOAA 2FY1A 4FXVA 2W5UA 4DR3B 4N9QA 1TQ2A 2C4UA 1PWXA 4WVLA 4K05A 1X14A 1RKBA 5FBZA 2W2NP 2BY4A 1NXIA 1TM1E 4OB6A 4PHTA 1KQNA 5AXCA 4ZYVA 3TRDA 1N3LA 2WB2A 2IMWP 1U26A 3WSWA 3I2YX 1BVHA 5JD6A 1II8B 4YONB 1LQLA 2PS9A 2VP5A 1I0IA 1GAEO 1EZZB 1UM8A 5A06A 1GFIA 2Q0QA 3CH4B 4F6LA 3DB1A 1N32C 3MD9A 4CHGA 1RYFA 1EK1A 4UHEA 4ZLPA 2ZI6A 1RG9A 2DR7A 2NXUA 1OH8A 3MXHP 3CF4A 2VSYA 1EWTA 3DF9A 1YACA 3SHQA 2OOKA 3KC2A 1D0IA 2DNRA 2Z57A 4ZJPA 4DLGA 4YMSA 3F6PA 2Z8QA 2J6TA 3RF6A 4RXUA 1HARA 3MEDA 1JW9B 3A6KA 2J5QA 2R42A 3QTBA 1GPYA 3IE0A 2BX6A 3UV6A 1X1QA 3TQSA 4DZTA 1EJ0A 1FSZA 4OM8A 3RASA 2CNOB 2HZ7A 3RTBA 4KMOA 1M2HA 1ZK4A 5CFMA 3Q8QB 4D8YA 4G0YA 1F8YA 2I55A 5HO4A 2YPZA 4LPSA 2ACWA 2H3EB 1RKJA 1OLOA 1R43A 2HGSA 2LA6A 3QEBZ 1QHHB 2GS9A 2IZOA 4ANEA 2V0GA 3MJTA 1UAWA 2PGIA 4P4UA 2R96A 2BC9A 4NLLA 4J91A 3ICQB 4RLQA 3OZCA 4II2A 2CLKB 2GPNA 3I55S 2GPAA 4LNHA 1B4DA 5FF9A 2Q0SA 3RRMA 2FVSA 1SVNA 1TK8A 2YMMA 1JVSA 1DFIA 3KK0A 4NLSA 5K05A 1OTYA 3C6ZA 4EHBA 3DLCA 4OX9F 5GTDA 3W2IA 4E2ZA 3DLEA 5EUMA 2CDAA 2CMFA 1HWUA 2FEKA 5DWDA 1L3CA 1ZH8A 2E1RA 5CAAA 1N0UA 1HEYA 1CUCA 5JRJA 4B46A 3OTOC 3D6MB 1H1DA 4GX5A 5C2GA 2JJQA 4WZZA 1CS4A 3SLRA 4CMGA 3KEFA 1VTKA 1JF8A 4D82A 4AZWA 2B8JA 3PC6A 3LYUA 4BGVA 2KS6A 5ALUA 1YK9A 4DR3J 4PIPA 2PEBA 5I7AA 3LCVB 3FPHA 4YBRA 2YWEA 4MLCA 3R27A 4KHPC 3JAWB 4O2BA 1SXJE 2H2WA 2KZMA 3JSAA 3HJNA 4O3FA 4DCJB 1IY2A 3NM5A 4XOIA 5WRFA 4DLWA 1VKNA 3ZQUA 1HKAA 2GCNA 4AK9A 1XV5A 1F20A 1H73A 3AP1A 1SHJA 1SH3A 2ZSDA 5L1LA 2DETA 1KHWA 2A9QA 2N46A 1N25A 4MLPA 2BJEA 5BNIA 2LCWA 1SD1A 3IGNA 3BK2A 3N2LA 4ZI5A 1Q74A 5TPZA 1CUJA 3DOCA 2GZOA 3EG9A 1VBZA 4B0OA 2R4TA 2BANB 4MRSA 3P49B 6PFKA 3CC8A 4RD4A 2HMUA 3CH6A 3PR3A 1LK7A 4S1VA 4HDKA 3EIHA 4PWDA 2TSYB 1LI4A 4GVBA 2DHCA 3QKRB 3TEFA 3DM5A 3QZ8A 1MROA 3NGUA 3TLZA 3OTCA 5J2UA 4G1QA 4BYGA 2WIBA 3OPMA 2HF2A 4RKFA 4AD8A 1K3FA 3WICA 2ZS9A 4MNTA 4XSHA 4NYJQ 2G4BA 3OL9A 2XCPA 3HV0A 4QATA 4ZVPA 1QH1B 2XUKA 4JQSA 1XZHA 5JPCA 3KLFA 3G59A 2A1UA 1D4OA 2XB2A 3OX2A 7AT1A 1H42A 4FYYA 3TRGA 2C7OA 3G2OA 5K4HA 2ZIFA 4RA6A 1UMBB 1N6QB 3AR4A 4URVR 1TLFA 3T3MB 3WMEA 2VA3A 3L46A 4UOCA 3JU3A 5FLXD 4CM9A 1B0ZA 1NIJA 3LYLA 2CKMA 4MEBA 1B93A 3P9NA 2GN6A 4TXHA 3S28A 1GCIA 3O1LA 1NUUA 3RTCA 3RIGA 5JBIA 4RORA 3E0QA 2HUPA 4RDIA 1RQXA 4OYPA 2PWBA 3CEAA 1JR3D 2PBFA 2DWQA 3JALB 1OAOA 1W5FA 2Q2NA 3OA0A 3DW1X 1HT3A 3C8DA 4WY8A 3I4LA 1GSHA 4GX1A 3LDUA 1KQFB 2IY5B 2AC7A 1V25A 5C9ZA 2C58A 2G9VA 3M8PA 4ZYYA 3B3JA 4JB8A 1CX9B 4C0WA 1M8JA 3TZCA 5C42B 4N8NA 5FEMA 1T1SA 4YX9A 2UZ1A 4L4YA 1M76A 4ED2A 5HMWA 2FSUA 2WONB 3JSXA 4D4KA 1Z6PA 2QLMA 1H74A 1JQEA 3RVKA 4W5JA 2RC6A 3OCJA 4RPHA 4MTLA 1WQ4A 2ZBEA 4P8RA 4F04A 4BHTA 1FRQA 3BR9A 1QOPB 5FBLB 1FP4B 2CEKA 2R00C 1F3FA 5CGQB 1KMMA 2PUEA 5EMNA 4I99A 5HA5A 4UQPA 5CB8A 4Q4JA 2IHNA 3IOBA 2FZCA 5DNAA 4DIOA 5TQVA 2Q99A 4MQEA 1TFUA 1Q50A 2GJ2A 1DAEA 1Y3BE 4MYUA 4RW4A 2WF8A 4WFAQ 4WXHA 1BCRA 4CIWA 2XMKA 4JEMA 4MO2A 1BA2A 3ZNNA 3FJYA 2I6QA 1S3SA 1HBOB 1SJ4P 1TQHA 3BWCA 4JLOA 1AXGA 3ZTYA 1XL1A 1BD6A 2HBRA 4YY3C 3AF1A 3SJCA 3WNVA 4DV3C 3PC4A 2FE1A 1JIUA 4LXYA 4PQFA 3CEJA 5CA0F 3OCCA 3F7NA 3F8SA 1YR9A 1P44A 2KM1A 2HX1A 4HTJA 3VGTA 1SIBE 1LSOA 2CFIA 2QV6A 2W6MA 2GJIA 2VPQA 2UZ3A 3DWEX 3SCKE 2DR9A 3L1KA 2WSBA 3FOWA 1T9UA 3PSAA 3R5XA 1QUEA 2GPSA 1EFTA 4M9XA 4BQNA 2CWWA 2LQBA 4FCTA 1KWKA 4HT5A 3TIVA 2PX8A 5FQNA 3OH8A 4Q0MA 5DI3A 1QVZA 2OPRA 2AC4A 4Y2MA 4DV2B 3JQCA 3IX7A 5DYNA 2OZLB 2AQHA 4MUYA 2XOEA 5A5FA 3DXFA 2WTBA 1A2BA 4RY0A 1NMEA 4KQZA 3K9CA 3KZOA 2WHXA 1R1DA 4CMKA 3RNOA 3LBYA 4X45A 3MWLA 1EJ2A 4DR4C 2ID7A 2B4PA 2R8EA 2D54A 2H51A 2IWRA 5KYXA 1DC6A 1F06A 1SA0B 1HBNA 2AG6A 3TH5A 3JZDA 2VFRA 1K97A 1ZH5A 2GJ4A 1VI2A 3SK0A 4ARZB 3GJ7A 2POCA 1PJRA 2VHEA 1KRPA 4QT4A 5IHXA 2JFHA 2VYQA 2BELA 3DAOA 1N8TA 1FMJA 1SHKA 4ALMA 2FWPA 4FYWB 3JVIA 3U4GA 4HNTA 3DYAB 1FB5A 3HUUA 1JXAA 3MUOA 3PY8A 1Z0JA 2M0GB 4K9DA 2OCKA 3H87A 4TY8B 5IC6B 5KG5A 1H2RS 3AESB 1U1IA 4M5JA 3W9YA 5DNDA 1YFZA 1HO3A 4OF4A 4XTTA 5GAJA 2ZIXB 3CNQS 3AEUB 1UBEA 2Q6TA 2BF7A 3QQPA 2NSDA 2Z8YM 1SPBS 4DCSA 1U8ZA 1A95A 1PK9A 4ML3A 1PYDA 1T2EA 3GC6A 2ZJQQ 4XO0A 2F3TA 4O2RA 1NU4A 1W1WA 1RHJA 3IR7A 3EXHC 4IIBA 2POQX 3TI7A 3IVCA 1FCJA 3HB7A 3L9WA 5BYBA 4ES1A 1NOIA 1PJ5A 2FRDA 2WHQA 3X2FA 2CQ4A 9ATCB 3TLEA 2W25A 4U7UD 3PHGA 1HWLA 2ZH6A 4YJGA 1PX2A 1ZNZA 3I87A 4DBLC 2NO4A 3AI3A 3TMAA 1GG8A 4H6PA 3QGPA 4MRPA 1QK3A 3JSMB 1NHKL 3HE3A 5HG0A 4DMCA 4TV8F 2HPAA 5CEJA 2I2WA 2NSYA 4JBXA 4USUA 3ZH9B 5IM5A 2MQQA 2RI6A 4L74A 2C0CA 3TCXB 3TANA 4BC7A 2CBZA 4OYHA 2PMBA 4IH4A 4UTRA 4Y2HA 3V4IB 3MPVA 4Y2CA 1YR6A 2XNCA 1SUEA 3A1DA 1C8LA 3ELUA 4JBGA 2UUCB 2LD4A 3K6SA 1JFVA 4JT2A 5C1BA 4QJIA 2YY5A 3BBPA 1VIOA 4DV2J 4GPTA 2WWVD 2H8KA 1R89A 4RY9A 4HTAA 1T3LA 4MP8A 2ZZTA 4P0QB 3N3BC 4LMRA 2HMAA 4U2EA 1G4HA 3M4JA 2A5YB 1C7FA 2H2GA 1O95D 2CNKA 4DSLA 2RKWA 1WI6A 3NQ41 1QZ3A 2HNYB 1CVLA 1ABFA 4ITVA 1PG4A 3M2UA 2XEDA 3EVCA 3W6ZA 1W6UA 3I9V9 4QWEA 3GL9A 1IPHA 4RSMA 1Z82A 1Y4SA 2I4OA 4MKBA 4N18A 3UC9A 5A3RA 4OYZA 1Z38A 1F9HA 4WTYA 2HMTA 4US0R 5SZJA 2OLWA 1HG0A 4BNJA 3BO3A 4YO8A 2VEDA 3GFHA 1E20A 1K6MA 3SYKA 2DMRA 3T3GA 1WZUA 4PZZA 5C53B 1YSCA 2J7PA 2SCUB 4FONA 2ALZA 1N54B 2XE7A 3WBBA 5KYUB 2H9ZA 2RIRA 4F9TA 2R7QA 1QQ7A 2PT9A 4KH1B 1DLOB 1XYYA 3NWRA 3ZCPA 3JZFA 2IFTA 4I2VA 2ZUBA 1RPZA 5FHRA 1PS8A 1Z83A 2VRBA 2NACA 2AE2A 3PK0A 3V4RA 5HIAA 3A7EA 4RCVA 5CW2A 4JXJA 1NK0A 2EJBA 3MM6B 4U6SA 4CLHA 3LC1O 3BSAA 5J2NB 1KBQA 2YASA 4PPNA 3TE6A 2WU4A 3GGOA 4DU8A 3QMQA 4YAFA 4G4GA 1RWMB 1LPOA 2P9BA 6YASA 1NN5A 4OJGA 1UWAA 2NUPA 1X4GA 2Y67A 1KLNA 5HYVA 4MIEA 1EAYC 2X2FA 3OMWA 2VNIA 5LYJF 3VV2B 1QZUA 3HKCB 2IHBA 3NCPA 1CZNA 3H4BA 3GG0A 5DFAA 1QRRA 1M6VB 4AVYA 5HFJA 1KYXA 3B1ZA 4CPDA 4ZAFA 5H5JA 2IPXA 4HZUA 1GTVA 4M9CA 1RI7A 2OB2A 1T6NA 1A77A 4UXHA 2BR3A 1YB7A 2JFFA 3K59A 1CZLA 1IMJA 3VQTA 2P40A 2IMOA 2GN0A 1L8LA 2N3ZA 1VQ9S 3GT7A 1MX9A 4BLOA 5D85A 3QUBA 5T67A 3T1YF 1OXBB 3B2EA 4WK1A 10MHA 1R10A 4Q19A 1ZM4A 5AHWA 1JBQA 4NV1A 3SYTA 4BWGA 2OV8A 1N9KA 1F1BA 2FTRA 4Z7OB 2OFGX 4LYEA 4CKCB 3CIMA 5JMWA 3TJAA 2PJDA 2XUAA 2PQ0A 2M32A 2JLFA 4S2UA 3PL1A 5MGBA 4BX3A 5KFOA 3RVLA 2BH2A 1JLFA 3HBNA 3BXPA 5B3LA 5BYRA 1WVIA 4JYZA 2VXBA 3MJDA 1M5HA 2ORED 4I1UA 3P2YA 2QRVB 4ID8A 5I4CA 1VCNA 2CHQA 1AA1B 3WJ1A 1O95C 2I5JB 4GPAA 4M5KA 1QANA 1ISRA 3LGNA 2ZR8A 4B3TB 4YCJA 5DHQA 3T1VA 5CH5A 3P2KA 3FF4A 4V0SA 3OIUA 4QIHA 1NURA 3OM9A 1DCFA 1ZTTA 1KI7A 3UXHA 2MKKA 3H2YA 1CQWA 2YX1A 3LUBA 1Q0RA 2RE1A 2DYAA 2PROA 4LQ9A 2PMFA 4NBWA 2C8LA 3R8CA 4BNFA 1NDQA 4YR9A 1GITA 2ZKUA 1ZVQA 3BAFA 4X20B 2EBFX 4M5DA 1JQGA 4ECVA 4QGGA 1OBOA 2VQ3A 2R8PA 3L8HA 1VHQA 3B85A 1WXXA 2JLAA 3GCZA 4ICLA 2XRYA 1UPPA 4QEZA 2DUWA 3V6MA 2VXCA 3W3SA 4OX9J 1W8IA 1D6NA 3ANLA 2IM0A 5HBRA 3D6FB 3KXWA 5ETNA 3BUSA 4QL3A 4EPVA 1AYEA 4ECQA 3SCLE 4E2FA 3C8ZA 1KP9A 1XN9A 3RC2A 3ER8A 1VXRA 4F38A 2PRZA 4FS8A 2YKAA 1XMPA 2FEWB 3ETOA 1XLTA 2AJCA 1E8MA 3GJTB 3QOXA 5G1NA 3DZGA 4DV0B 4LBHA 3J7TA 4NCXA 1P1FA 1DRUA 4C14A 2MGZB 4CEJA 5FL7D 1ZRMA 2HSZA 4NOKA 5IBQA 1QF6A 4L15A 3UMGA 2QLFB 4H08A 2W00A 1R88A 3L6EA 4BGUA 4YB1P 3VDQA 1J0DA 2NV2B 1WDDA 2V03A 1NZ8A 1KSPA 5C8DA 4KTVA 5J63A 1V47A 4A8QA 3OT1A 1XJ5A 3W4JA 2WIKA 4P98A 3GFBA 4Z0TA 1HSOA 3SF0A 4F2HA 2XGPA 1YJVA 2VDOB 3QEMB 4EFAC 2QVYX 4AW9A 3HVIA 3LO8A 4JWTA 4QUDA 3OE4A 4ZKEA 3ETHA 4N4AA 4H4MA 4IX1A 1MRSA 5FPHA 4DA9A 5JXHA 2HS0A 1FHTA 2FLWA 3VCDA 2W6OA 3KQTA 4B74A 3OFEA 3CRVA 1USWA 4D4HA 4HNQA 3M8QA 3H42B 3R75A 4FFWA 5LJIA 1EXVA 4C4WA 3K70D 1PG2A 1SAYA 5HDBB 5KFIA 2M9MA 4R5PA 4US1R 3NWOA 4CMBA 1CC8A 3EGVA 1X5OA 3GKUA 3SO4A 1NUEA 1J5PA 4I6YA 3LGAA 4FS1A 4B3TJ 5A7GA 1AF7A 2FWIA 2A78A 5F8IA 1K68A 3O2SB 2CXPA 5CA0B 1V35A 1YG0A 3PXAA 4J4BA 2XTZA 1T9DA 1KJZA 1ZGGA 3H6KA 3N59A 5K3BA 3KKKA 4NLYA 4QU0A 2GHPA 1W2IA 2ZWOA 2P62A 3WVNA 1BFUA 5GOZA 4PXAA 4NCBA 3L1VA 1PGJA 5F9FA 3HVJA 1UXKA 2AQ4A 1BMQA 4U2FA 3E7FA 4GIBA 2WJAA 3HSYA 3W5UA 1B26A 3G0HA 1ZBDA 1RB0A 1E63A 3ITEA 2JLVA 2G09A 3PHEA 2WMNB 4B3BA 4BMNA 2GX6A 2C5BA 1EKRA 1WXFA 3L5KA 3OESA 2JAUA 1TH5A 3J81D 1R0WA 2JAHA 3A3NA 1CIVA 2PT6A 2J46A 3AZPA 3FDZB 3B3FA 1U8CB 2TECE 1HC7A 5BPFA 2HFSA 1WHSB 4RK6A 3ANYB 4CXMA 5LNK1 2X0RA 4DV0J 4A5SA 4N5MA 4N5IX 1MJHA 2VTBB 2XMTA 1IC6A 3WTBA 1E64A 3MCUA 4OKIA 3CMCO 1ZD1A 1KPGA 5JATA 1J99A 5KKNB 3F47A 4CCWA 2PV0A 1YULA 3CSDA 3HCBA 4M0KA 2L2QA 2DGVA 4ZAGA 3R6WA 1NJWA 3W64A 3RJ9A 2R6AA 1EZ4A 5FR2A 1MVLA 2H2HA 5AT1A 1WCIB 3LDGA 2I3BA 5EQDA 1ZCZA 4D3FA 4DDUA 4CT8A 3SXLA 2OKCA 3VWSA 3LUDA 3BMOB 3NBMA 2W7OA 5GAGI 4ZYXA 2HQOA 1WLYA 3HDHA 5KT6A 4GWGA 4Y0NA 2WYIA 1F6BA 2NNWB 1ATZA 2YVSA 5DETA 5JG7A 5G2OA 5AHKA 4YP7A 3X2SA 3WNBA 4PCQA 1OQ3A 3P4YA 1UOOA 3CCTA 3VNVA 1R3NA 3TB6A 1XNRF 3C3CA 1NJYA 3ND9A 3KPJA 4EUNA 1J70A 1XU9A 3DXBA 3MJSA 4PEOA 2Q29A 2QDKA 4EABA 3ZJ5A 2QM3A 1BFDA 5B1SA 3AVPA 2J4CA 4LFAC 4EO8A 3K70C 5CJ2A 3USES 1LWEB 1B16A 2GJAA 3RZAA 5H7XA 4Q3LA 4G0WA 3AXSA 2YKQA 1B70B 2L42A 4G4SP 3Q0EA 3WWEA 1IIRA 2AF3C 4CM7A 4G63A 3DRRB 1YQDA 2LPMA 3CCVS 2EX0A 1BXRA 5L1IA 4C4AA 3VR6H 1YD7A 3FNHA 4P6VF 3FMFA 4EARA 4BFTA 1Z7EA 4QOJA 4PYJA 4GBMA 1FKOB 3FROA 5JCJD 2IY7A 4ZVMA 1ISHA 4CTNA 4RHTA 5K4AA 5B6IA 1DELA 2W70A 3WHIA 1ULAA 2WICA 2HIYA 5AVXA 2PYDA 2JH3A 3PRYA 1HFKA 2XDQB 3RARA 5KO2A 1NOJA 4XJVA 4GR9A 3ZWMA 3JVVA 5KQPA 2A9KA 2NIPA 2ZWAA 4EQZA 4Y6LA 3OKPA 5CM8B 2QAJA 1W0JD 2MSNA 3CXUA 2WOMA 5A19A 5M2UA 4O4LB 3M5PA 5FNZA 5BWBA 5GZ6A 3UQZA 4JUIA 1SHUX 1SU8A 3OQVA 1M34B 5FLXA 1S7CA 3TF5A 3UDLA 1NNLA 4JI1C 1N57A 2GCFA 5DHAA 4ESEA 5HCUA 2HY7A 2FZWA 1RAEA 4ND8A 1T26A 2Q41A 4QPJC 1DTTB 2F1IA 4F4JA 4PGHA 1XE3A 2W9CA 3A6FA 5K8IA 5JY1A 3OE1A 1JUDA 4RTRA 4K81B 4B0PA 4DF8A 4JAVC 2VDNB 1KC8T 1BX0A 2E4UA 3ZCTA 1T5IA 1V4BA 3OZDA 4YRPA 3DM2B 3M9NB 3L7KA 1B6SA 2UZIR 3BKUA 3G0CA 1MO3A 1W46A 1VQ4S 5K0FA 1PO6A 4DR1C 2OESA 3PGKA 2P9GA 5K0BA 3DOJA 5D00A 2IA0A 2QGFB 2QP9X 1HTTA 4L4RA 3RGWS 2ZIUB 3H0EA 1T25A 2PS3A 1Z3CA 3QMPA 2YV5A 4TQAA 4OD0A 3UUFA 4UE2A 4HQ0A 2Z2ZA 4EKNB 4A15A 5H16A 5K0GA 3MMBB 4DREA 1UPTA 3QELB 4WASA 4FWBA 4IKPA 2RBEA 1T15A 4TVBA 4Q7JB 3GTYX 1N7GA 3NGDA 2BGJA 3AR5A 2OM6A 4BO8A 5JUMA 1UC4B 2DQKA 2UVDA 3OAAA 3L4BC 4WXWA 5J4KA 3ABOB 4GPD1 2GHIA 3S7ZA 3T1YB 4QQKA 4TT8A 4MMOA 2IC5A 4MIAA 1EFAA 3W9HA 1DJ0A 1P4GA 3JPWA 4LN1A 3D7NA 3NWPA 3OZRA 1J24A 1I1NA 1NKEA 1PP4A 3IG1A 2JEJA 1DJMA 4ZVKA 3LUAA 2WU3A 2AN4A 1LU9A 3C4JA 1QE1A 5C1IA 1BHSA 5BO5A 5IF9A 2VCYA 2MQOA 1RCUA 1CUYA 5BWOA 2YVAA 4RJJA 3SM9A 1N6OA 2V1UA 5H9FK 2Z08A 2HHHF 3GLIB 4AJKA 4OYAA 1NPRA 2UYYA 2AGOA 1ZUNB 5AM3A 2NVWA 2BGMA 4P92A 3A6HA 2P6RA 3R7FA 2CJYB 3AJAA 1CQNA 1LTQA 3AZOA 3VU9A 1H8EA 3TIFA 3EEOA 4BBPA 3OTBA 4QDOA 3LBAA 2W58A 3AHGA 4ECEA 1NLZA 4L78A 4J1TC 2QHXA 4M89A 1F4VA 4OLJA 4BSZA 3L1HA 4O0IA 4N76A 3OJEA 3E3LA 2I7VA 3ISJA 2IGBA 4UBOA 2NUUG 4Q00A 3LP0B 3GJRA 4I5EA 3I6PA 5AE2A 1XHFA 4OHOA 2I4NA 4W4MA 3D3WA 3EDQA 4QGSA 2PZAA 3F7MA 4KPUA 2GJ8A 2IUEA 4DCUA 4MIBA 1X7GA 1B43A 2IW1A 3RVRA 3MM8A 2RU9A 5HOQA 4GS5A 4NZOA 2NZ4A 5JC1A 4EPXA 4YXFA 1V7QA 4HCJA 5HMYA 4RCZA 4EMBA 4YP1A 1GQRA 5A3VA 4Q9LA 4AUEA 1EFPB 2NWQA 3E4DA 2NPOA 2A0FA 1JNXX 4X97A 4G84A 3IMQJ 1QP7A 1M6XA 2CLOB 3PHCA 4C0KA 3RU3A 4RMNA 4HLDA 4MOWA 3DOIA 3W2FA 4U8GA 3SBEA 3JQFC 5TF0A 5DK6A 4HH0A 3LWDA 2WU0A 3JQEA 1IKWB 3ZCXA 1U1LA 5FP0A 2IC3B 1EAYA 5IABA 2W0SA 2RHSB 2OJ3A 3KTAB 2HNKA 5KFKA 1WU8A 3PX2A 3MAAB 4TLBA 2Q6OA 3I6IA 1YRQA 2I2AA 1J9GA 4LRTB 2OGSA 4PRLA 1AOXA 2DFLA 5FOSA 3T1YJ 4BNHA 4M1OA 1KKLA 2G0TA 3WLRA 1KC1A 3CISA 4BNGA 1JZTA 3JAMA 5JHGB 3D8UA 4HDAA 1Y5MA 5E5NA 1IK6A 3VO8A 4WZAA 2JLCA 1KAOA 5B0EA 1MNQA 1DI0A 5IZHA 3BTVA 3LPDA 1W93A 1AQ6A 1MG0A 4IVNA 4N0PA 1WDMA 4M38A 1ECBA 1G3IA 1UOQA 4LNUA