2ZZNA

The complex structure of atrm5 and trnacys
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
336
structure length
336
Chain Sequence
MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords Uncharacterized protein MJ0883
total genus 81
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zznA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zznA03
5EZSA 2JHCA 3B3JA 2FHPA 4ER5A 1QANA 2H00A 5BW4A 4CTJA 2BR3A 4JXJA 2CKDA 1Y8CA 1N7JA 2BZGA 1RI5A 2ORED 2ZULA 3K0BA 3RIEA 4M7RA 4YUXA 3LPMA 1SUIA 4GOLD 1L9KA 2I7CA 2B2CA 5E8JA 5EOVA 1EJ0A 5DT2A 1SQGA 5K0JA 5EGSA 3KPUA 5DM4A 4GOND 4POOA 3FUUA 3AJDA 3LCVB 3P9NA 1RJEA 3GRYA 1L3IA 1KYZA 2AN3A 1KPIA 4FSDA 5LQNA 3DXZA 5K0EA 5CD1A 3BUSA 2Z6UA 4U7PB 1NV9A 1KHHA 2G70A 5KS2A 4BY9E 1QAOA 1ZHFA 1VQ1A 4BLWA 3FTCA 3NWBA 4O29A 3NDIA 3FZGA 3AWIA 1VLMA 3TFWA 4ER7A 4RTKA 1Q0TA 5CVVA 2UYOA 3DXXA 3KPVA 4EKIA 2XBMA 1N7IA 5EG5A 2PXAA 3NDJA 3OZTA 3O31A 2C7OA 5EKXA 1L3BA 1KPGA 5CM2Z 4C08A 1VL5A 2JH9A 4FT2A 5EPEA 3UJ9A 3QV2A 5EVJA 3JWIA 4ER0A 4L7VA 3KPWA 2ZWAA 3QOWA 1NW8A 4HSGA 3PT9A 4Y2HA 1WS6A 4QPPA 1VIDA 3FUVA 2ADMA 3G89A 3U81A 3GDHA 3IHTA 4GF5A 3SVZA 1JQ3A 2NYUA 3A7EA 4OQEA 3NVMB 1TW3A 3DTNA 3UZUA 1NBIA 3TLJA 3G2PA 2NP6A 1PJZA 2H11A 3EEYA 3OE4A 4P7KA 5CVUA 2P3QA 3DP7A 2GA9A 1VP3A 2GB4A 5K0FA 2EG5A 1M6EX 3MGGA 3GJYA 3G88A 4XUDA 5ICGA 3UJCA 5EIWA 4OQDA 2ONZA 3GRRA 3HTXA 3HCEA 3DR5A 2OBFA 3MTEA 3P9CA 4PCAA 3G2QA 2OPBA 3BWYA 3HVKA 3JWJA 4OA5A 5FWDA 4EVIA 1WXWA 5K0LA 3THSA 3KPJA 4EQZA 2AR0A 4YV2A 4PYOA 2NP7A 1TPYA 5HIKA 2UZ4A 1SG9A 3OFJA 5ERGB 3P2EA 3BGDA 1ZGAA 3KQMA 3LGAA 2VDUE 4WXHA 2PX2A 1DCTA 1XJ5A 1DL5A 2Q41A 1ZKDA 3G2MA 5DX8A 2HMYB 2PGXA 2AOXA 1F3LA 2WA2A 2BR4A 1SQFA 3BWMA 4M36A 2PY6A 3EMBA 5ICCA 3V8VA 4P7FA 1KIAA 1YFLA 4B17A 3M6WA 2PT9A 1SKMA 3B7PA 2Z6QA 1RJGA 5FWAA 1XDSA 3KPYA 3VSEA 4AZSA 1L1EA 3G2OA 5FTWA 5HFJA 2YX1A 2VZ9A 4GOMD 3JWHA 3TOSA 1ZQ9A 2QYOA 5DSXA 5KQRA 4PGHA 5EHIA 1X19A 4CKBA 1IXKA 3CVOA 2PXCA 2YQZA 4PYJA 3EPPA 3LECA 2HV9A 4GUAA 4RTNA 5IKMA 4PONA 2QRVA 3FTEA 3DLIA 3FUWA 3HA5A 4C05A 4CXMA 3IEIA 3DOUA 1D2HA 2VDVE 4PCLA 1R8XA 3DMHA 3REOA 3C3PA 3P9IA 1NV8A 1XXLA 4H0NA 3THRA 5DM2A 2IIPA 3EVFA 3A27A 3KQVA 5GM2A 2PV0A 1VBFA 4RV9A 3SM3A 3ER9A 3P2IA 1R8YA 1G60A 1WXXA 3OU2A 3B5IA 2IGTA 4HGYA 3NW9A 5EKUA 1NW6A 7MHTA 4E2WA 3KKZA 1FBNA 1I4WA 1JG2A 3UJDA 2ZIFA 4CTKA 2G71A 4YMHA 4R05A 4HG2A 2XYVA 3MERA 1P39A 5JR3A 3ANXA 3PX2A 3R6TA 4LG1A 3UJ7A 2CMGA 3LX6A 3FUTA 3PB3A 5LQJA 2XYQA 4RTPA 3Q7EA 2PX8A 2IBSA 2PWPA 4EMSA 5K8VA 2GLUA 2GS9A 4KW7A 3X0DA 5CUQA 2OYRA 2ZBPA 2YXDA 1UWVA 4V0QA 5D1HA 3KQSA 3NJRA 3HA3A 3MHTA 3EVZA 1RJFA 3FRIA 3TR6A 2CWWA 4EK9A 3A7DA 1JG3A 5GWXA 3HCFA 4C4AA 2YXLA 3B3GA 4HTFA 3VC2A 5K05A 4FZVA 2P3LA 3LDGA 5E9QA 4RTMA 3KQYA 1MJFA 4PNEA 3ELYA 4BP1A 3FTFA 5K09A 1AF7A 3P71T 5DPMA 5GOZA 3PVCA 3KQPA 4OBXA 4YV1A 4YUVA 3T7RA 5HZMA 5K0BA 3R9XB 1QAQA 4R8RA 10MHA 3EVCA 4IV0A 3OU7A 2WA1A 2AVDA 2R3SA 1MHTA 2G1PA 3DMFA 4KDCA 3I58A 2DULA 1U2ZA 3TPZA 3EVBA 4DKJA 2ZVJA 4PYNA 2GAFA 2PWYA 2I6GA 5DRTA 5DTRA 4RTRA 4P58A 5EHGA 3OFKA 5EMLA 4F85A 2ONYA 1JTEA 4AZTA 1SVUA 2AOUA 4AZVA 2IH5A 1FJXA 3LKDA 2P1DA 4ER6A 3GRVA 3MTIA 1BHJA 5CVDA 1XCLA 5CVJA 4F86A 3KR2A 4KWCA 3GRZA 3R0QA 4BLUA 4M37A 5LR6A 1YF3A 5EQJB 2O0LA 4MQ4A 2P8JA 3GWZA 4E33A 5KQSA 4PGGA 5C0OE 5DTQA 3KR1A 3MAGA 5GINE 1IM8A 4PIPA 3SR4A 2HTEA 3NWEA 4Z2YA 3RODA 3DULA 5BP7A 1NBHA 2C7RA 4NECA 3NTVA 2UYCA 4YUZA 2YR0A 5E8RA 3KQWA 5D1NA 2EFJA 3CGGA 1FP2A 3E05A 4QQKA 3T0IA 1HMYA 3UBTA 1Z3CA 1ZGJA 2IDKA 3G7UA 4FT4A 4LWPA 1VPTA 4RVFA 4PINA 4RVHA 5E1OA 5GM1A 4KIGA 3EVEA 5LQKA 2PJDA 1FPQA 4RTJA 5E2BA 5FULA 3ELUA 4G56A 5FA5A 2P7HA 2PVCA 3FYDA 5DRYA 1JR4A 3ERCA 3BWBA 3OZSA 2OKCA 5C9ZA 3A4TA 4DQ0A 2PKWA 2OO3A 3M70A 1YZ3A 2V7EA 1R00A 1D2GA 1JG4A 4RX1A 1WY7A 1P91A 2BM9A 4R6WA 4YUYA 3EEOA 2AZTA 1XVAA 2ERCA 3LDUA 3R3HA 2AN5A 1NE2A 1KR5A 1G8SA 2FCAA 2ZW9A 3GO4A 2C7PA 2B25A 1O9GA 1F38A 1RI2A 1YB2A 3K6RA 2VDWA 4PYMA 2C7QA 4IWNA 2OZVA 3BGIA 4PWYA 5KVAA 3SMQA 3UA4A 1X1BA 3DXYA 3CC8A 3GGDA 1G8AA 3HCBA 4BLVA 2HWKA 3G5LA 3GCZA 3A26A 4M38A 5E1MA 3PFGA 4IKPA 2KW5A 2ZBRA 4GQBA 5DX1A 1XTPA 2WK1A 4E30A 3ER8A 1JTFA 1O54A 1M6YA 5FQNA 5DTMA 5HIMA 3C6KA 1AQIA 3GNLA 4V0RA 3FUXA 5U4XA 5MHTA 3FPFA 3LBYA 3ORHA 3KR0A 5M5BA 3OCJA 4MHTA 5G02A 3DLCA 2OY0A 3B3FA 2JJQA 4RWZA 2UYHA 3E8SA 3ME5A 1YFJA 4WVLA 4QDJA 4A6DA 4EKGA 3TM5A 2VP3A 3EGVA 3DMGA 2FYTA 2GPYA 4YV0A 4P7GA 5KYGA 2IBTA 2P7IA 1BC5A 3CJTA 3QOXA 2ZIGA 2YXEA 3O4FA 4PYLA 5FADA 5HILA 1JQEA 3O7WA 5FQOA 5GIPE 5DXJA 3FPGA 2P41A 2NXJA 2ZLBA 2ZIEA 2PLWA 5EMMA 5ICFA 1YUBA 4FSXA 2NNWB 2ZCJA 2IP2A 3TMAA 4DF3A 2B3TA 3AXSA 3EVGA 3MCTA 2AOTB 4KVZA 1KP9A 4E32A 3M6XA 2BH2A 5E9WA 5EMJA 5T64A 3FPHA 3CBGA 4PYIA 3C0KA 4E2YA 1P1CA 1JG1A 3UFBA 1INLA 2JG3A 2FK7A 1DUSA 3LDFA 3TRKA 3GXOA 3UJAA 3ID6C 4YUWA 4AX8A 3AY0A 5C1IA 4F84A 5EEGA 1EG2A 2ZBQA 1X1DA 5B1SA 4CWAA 2H1RA 5ICEA 5LQCA 5FUBA 2AN4A 3KHKA 4HRAA 3TKAA 3FPEA 1R6AA 2G8NA 3L8DA 2FRXA 1VP9A 3PS9A 4IV8A 4U7TB 5EEHA 4DZRA 8MHTA 3Q87B 2DPMA 3HNRA 1X1AA 1HNNA 2Y1WA 1ORIA 1T43A 4K6MA 5K03A 2LD4A 2AOVA 5T67A 3UA3A 4E2XA 3I9FA 4XUEA 4X61A 3OZRA 4FR0A 3G8AA 2QM3A 3B89A 3KR9A 1P1BA 5DM0A 4C06A 3BKXA 1I1NA 4KRGA 5LQAA 2QE6A 2BR5A 3PX3A 4R6XA 3LCUA 5DX0A 4E2ZA 2N47A 3E23A 3EGIA 3DH0A 3F4KA 2QY6A 1X1CA 4OBWA 2NXEA 3LKZA 4E70A 4LECA 1UIRA 4GOOD 5FCDA 3V97A 5FHRA 4FP9A 3P2KA 1RI1A 3CCFA 2HNKA 4X1OA 3P8ZA 1N2XA 1NT2A 3M6VA 3UJ6A 4DCMA 3ELDA 1OR8A 1QAMA 2ESRA 5F2OA 4PYKA 3S68A 3MB5A 3HCDA 2YVLA 4XCXA 4DA4A 2HR1A 2ZZNA 1QZZA 1NKVA 3G5TA 2UYQA 4RVGA 2VS1A 5H02A 5EC8A 1BOOA 3A25A 1EIZA 2ZFUA 4PIMA 1FP1D 3HEMA 5FHQA 1XDUA 5DSTA 3WSTA 5HIIA 5CVEA 2CMHA 4C03A 2XVMA 1ORHA 2P35A 4P7JA 4CKEA 3M4XA 4X41A 1G55A 3HP7A 2JH8A 2FPOA 3VC1A 5EZQA 4C04A 1ZG3A 2K4MA 4HH4A 4ATNA 1QYRA 5DLYA 4X60A 3HCCA 5E1BA 3BXOA 4OX9Y 3UWPA 5IH3A 3KQTA 3FYCA 1NW5A 2JHPA 2AOWA 3T7TA 2PSSA 4RTLA 3PLAE 5FA8A 4BP3A 5DWQA 2EX4A 2B78A 9MHTA 3G8BA 3KQOA 1I9GA 1AQJA 4RTSA 3ELWA 2O05A 3P97A 3GRUA 3EVDA 1H1DA 1G38A 2XVAA 2V74B 5EMKA 3OU6A 2OB2A 4RTQA 2IFTA 4QQNA 5K0CA 4OA8A 3BWCA 4YMGA 4AZWA 2QRVB 3FRHA 5HEKA 5CCXA 2YTZA 3I53A 3UJBA 3CJQA 3GIWA 3HVHA 2R6ZA 3LBFA 4PYQA 4QTTB 3TKYA 1BKYA 3RW9A 5E1DA 1EAMA 2O06A 5K0GA 2ZSUA 3HM2A 5T6BA 3EGEA 1D2CA 2PXXA 4QDKA 3BKWA 2JHAA 5EIFA 3BT7A 2PT6A 1RJDA 1NW7A 3C6MA 3HCAA 4RYLA 1IY9A 2CL5A 3SGLA 3OPNA 1B42A 1G6Q1 2I62A 1V39A 4UOEA 5BW5A 3P9KA 1NW3A 3HVJA 3I5UA 3LL7A 4HC4A 5GP1A 5GIOE 5LQRA 5LQUA 3PFHA 5P8WA 4DM3A 1M0EA 2Z6AA 2EJUA 5LSAA 2E5WA 2A14A 3HA7A 3HVIA 4KDRA 1EJ6A 4ZTBA 1R18A 4DCGA 4ER3A 5CIYA 3SX0A 5F2NA 3DUWA 4QTUB 4QPNA 3OE5A 2PX4A 3VYWA 2I9KA 2O07A 1JSXA 3JWGA 4A6EA 2IH2A 2NXCA 3MQ2A 1WG8A 5E2AA 4QVGA 4AUKA 3C3YA 1XDZA 4E31A 2B9EA 2AVNA 2IDJA 4CKCA 1JSZA 3MCZA 2YUIA 2O57A 2NXNA 3UJ8A 4HGZA 1R74A 4FS8A 3LSTA 1JQDA 3NMUF 2F8LA 1VE3A 2AOUB 3BGVA 3IV6A 3T7SA 3TQSA 4GEKA 2AS0A 2G72A 4R8SA 2ZTHA 1KYWA 2ZZKA 3H2BA 3LHDA 4MIKA 4RVDA 5K0NA 2BM8A 5BXYA 3KQQA 1KPHA 4DMGA 3SXJA 3EMDA 3I64A 2ZZMA 1O9HA 2P3OA 3EVAA 4LWOA 1XCJA 5HOQA 4ISCA 5JUWA 3GU3A 1L3CA 1Q0SA 1WZNA 3CJRA 3FTDA 5E9JA 1AV6A 4MWZA 2GH1A 3BZBA 4QVKA 1TW2A 1RI3A 3IYLW 2AOTA 4RSRA 3AXTA 1RI4A 2P40A 3D2LA 2ZWVA 3E7PA 4MTLA 5F2KA 3SSMA 4GBED 1EQAA 4KIFA 2IH4A 2OXTA 1KXZA 3CKKA 2XYRA 3NVKI 5K01A 2OB1A 3M33A 4GC5A 3TM4A 4GC9A 3PTAA 3KU1A 5DM1A 5HIJA 3R24A 5DXAA 3SSNA 4Y30A 4FGZA 1PRYA 1YZHA 2PX5A 3FPJA 4HTFB 2Y1XA 2EJTA 2IPXA 3M6UA 4X63A 4RTOA 3LCCA 1UFKA 5CCBA 4C07A 3SSOA 4XUCA 2PBFA 1SUSA 2FK8A
chains in the Genus database with same CATH superfamily
3ZIAA 2C5EA 1TM5E 1MX5A 4DMLA 2ZULA 5B2EA 4PLYA 2I7CA 4CKBB 1RB0A 4BX9A 3TDEA 4UM9B 2JKVA 1UWDA 2PD6A 3BN7A 3M5WA 3W2GA 4B1FA 2YWFA 2XDQB 5EY5B 3WP0A 3WS7A 3CPEA 5FL7D 3T41A 2Y0CA 3I4CA 4ECEA 1TAQA 1RWUA 3QV2A 2VNIA 4MICA 5JNUA 4NXNJ 2XMGA 4LRBA 4N6GA 4QOTA 4Q3OA 1AUPA 3QW4B 4UBKA 4WGGA 4BXOB 2M2BA 2CLSA 3L2OB 5I9BA 4L9AA 1G4HA 1C4XA 1FVXA 3N0VA 3UAWA 4K4TA 2FW0A 3BSYA 2IPOB 3TAUA 4WX2B 1REVB 3U61B 1DCTA 1RXEA 1B00A 2VFUA 1G5PA 4CODB 4DJEC 3OZIA 2EKQA 3GVXA 1AZSC 4RZSA 2H52A 3Q5DA 3ZV3A 2QIPA 5IKEA 3P9PA 2JEIA 2VH7A 1OJ4A 2YIJA 2C9MA 4LF9B 3E22A 3VNQA 1JFLA 3AI7A 3ZWOA 4GEGA 3IC5A 3DMPA 1BMQA 1WXXA 5FPQA 2YZGA 1DEHA 3HZOA 3AODA 3R41A 1Z62A 3ZC4A 1QSYA 4AYBD 4BNIA 4QM6A 3P9QA 3B52X 4HDSB 1SPBP 2C9DA 1JXMA 3F2VA 2C3PA 3HHLC 1KERA 1ZICA 3NP7A 2XT0A 3PX4A 2V1UA 4H18A 2AUTA 5FTNA 4IQ4A 1WELA 2DE0X 3KK2A 2CDBA 1H6KX 2IDEA 1H2UX 2B92A 2AEMA 2A3JA 4OGFA 4J0CA 2F4FA 1J0AA 3CJSA 2WHQA 3P49B 2BVZA 2RCNA 3FGVA 4LF5B 1OWLA 2OUGA 4TLDA 3Q8UA 3WYEA 2ORWA 3RS5A 2PUBA 1V0JA 4MKYA 1H2FA 4CQJA 2HMVA 4DB4A 1JG7A 3ZCRA 1TL1B 1RAIB 3QNWA 3U13A 1DKMA 3H5YA 3JYQA 3GCDA 5AJVB 2HA5A 4FYDA 3QNUA 3BWBA 3G2NA 4UU0A 4TV8B 2XWJI 1H8HD 3KKPA 3ENAA 5FI5A 1ZK4A 3KMQA 1O9GA 4W5RA 1GT8A 3L8GA 2AXEA 4O4IB 3AL2A 3K2IA 4R9SA 2WTNA 2UUTA 2H5JA 3MGCA 4HI2A 1NPYA 5ESWA 1RWMB 1OU0A 4LGYA 2ATXA 3OMXA 2XSZA 3E7DA 4YAIA 3K92A 2AYBA 1S0NA 3TSAA 3ZWBA 2Q3FA 3MCTA 3TZKA 2XZTB 1AQNA 2CNNA 5ULLA 3NWRA 1U6BA 3KYBA 4CQLA 1KF0A 2KBEA 1SJRA 5H3HA 1CYEA 1WP9A 1WP4A 3GQVA 4C6SA 3WIDA 2HK6A 1PFUA 2XE6A 4BIMA 1ZB8A 4P83A 4YX9A 2GPAA 3EA0A 3A14A 3ADBA 2YZMA 3RAMA 4Y0AA 1CULB 2O3TA 5D8DA 3WDMA 1NVFA 3NBUA 5EINA 5F8JA 4LQ9A 3PL1A 3DLEB 1QQ7A 3B1ZA 3E58A 1SB9A 4M0FA 1TK8A 5IG2A 4MCHA 2JW5A 4J0EA 4UTGA 1LSOA 4L0MA 4F4FA 4X0EA 1XQIA 5JT1A 1T10A 4FZJA 4BNZA 2IY9A 3T3NA 2DCUB 6ADHA 1MLDA 3VQTA 2K4MA 3EDOA 4XB2A 3JQPA 1D7AA 3PNQA 2ZSFA 4RAQA 1PBUA 4DA9A 4CL2A 1OBFO 3L9ZA 5H9EK 1ZNWA 1E60A 2WIFA 4LMAA 1YACA 2IZ0A 1P4JA 1ZM7A 3G8QA 4KLAA 3GGGA 2F7SA 4YRIA 3NJ8A 1P1LA 2PT6A 2J9CA 4OI0A 2Q1WA 1CF9A 1KJNA 1YIOA 5TF4A 5HZGA 1YSCA 4JB3A 5LSAA 2E5WA 3UV3A 2DQSA 4CTAA 4FTWA 2J87A 5AJWA 5HM8A 2EI5A 1TYAE 2X1LA 4LZAA 3BDEA 1TQHA 3JYLA 1Y1LA 3I5CA 4IRMA 3UHOA 1PGNA 1MGOA 5A4FS 3L07A 3SI7A 1JQDA 2IVFB 4YEAA 3J80Y 1V60A 5E3AA 3RB4A 1EA5A 1O9HA 1R1DA 2I67A 3H75A 3PF9A 4M5DA 4EP1A 2GH1A 3MBKA 4M5GA 1ZIPA 4AC9A 2EFPA 4B9AA 4N47A 5FPPA 2EJTA 3HJRA 1G64A 4LVCA 4HVZA 4TPKA 1MN9A 1PSDA 1STOA 3RTCA 4YP7A 1I1GA 1DQAA 2FTRA 5EXDA 4AWXA 1R4ZA 1S1WA 1XRSB 1BG6A 3OY2A 4I5IA 4YJFB 1N78A 3MMZA 1JYEA 4DQVA 3TQIA 1L7XA 4EHLA 1CY1A 5CNIA 5CXUA 5B4TA 3K0CC 5EWMB 2ZVQX 2BOVA 2TS1A 3TIIA 1GZUA 4U39A 4DFKA 2ZBEA 4MTPA 1UK6A 3U81A 3L7BA 1Q7LB 1LTQA 2PWBA 1FF2A 5JANA 5HAOA 3KKQA 4W82A 2NP6A 4NCKA 1WLYA 5E7QA 3MPWA 4ODJA 3V6LA 1WCYA 2B36A 3GP5A 5EUMA 4C7OA 4DV7F 1WEKA 5E6SA 3EGNA 1TVRB 4ZDNA 4Y9RA 2JEOA 1OQ6A 3OFJA 4MQFB 2EK6A 5DEIA 1UEVA 2DHXA 3ROQA 2DRBA 1Z4PX 4MKVA 1YFLA 1C3OB 4F46A 1N2BA 4CI9A 3F7NA 3QF4A 2WBMA 2PN1A 4E51A 1HYQA 4K86A 4DV3B 4WY2A 1J7JA 1AVTA 1I94F 4MPTA 3DLTA 4Y6OA 4W9RA 3KOOA 5EHZA 1DOZA 4G8BA 4WKRA 4TMKA 5L39A 3KKNA 3KLBA 2F8HA 3ONQA 3OTCA 3UBMA 2I8CA 1Z13A 1BGWA 3O8OA 2W6JA 2GS9A 5KFRA 3FWKA 1UWVA 1T8RA 2ENUA 2IYPA 4I0WA 4PF1A 2BMFA 3B3GA 1Z0AA 4RW6B 3LC2O 5AJYA 1RRPA 4BZXA 3UJ3X 5AQ1A 1W9HA 1UT6A 5JCPA 5FNVB 4EYIB 1C1XA 5BSMA 4QC2A 1CZRA 3WGQA 4UOQA 3I5YA 3RPEA 4MUIA 2O14A 3QX9A 2R1TB 1LDMA 4DDWA 4UM7A 2NM0A 3P19A 1V37A 4INJA 4K9SA 1I7SB 3U31A 2V7QA 1RMQA 1NH7A 3SEFA 2IM3A 1FFSA 2D5LA 1UWCA 3VJKA 4P33A 4H7PA 1QIGA 5BSHA 2KDOA 3TLMA 1EP1B 2ASEA 1O58A 1J97A 1D2GA 1FSGA 3M4YA 4DQKA 1X1SA 3UK0A 3EF1A 1Z29A 1HORA 1TUGB 1EFLA 1VRUA 4OAQA 3JQCA 1IKVA 4YJHB 5KMGB 1ABEA 3LUAA 3SLRA 4JEUA 1ODFA 2FFRA 4YMSA 1RKBA 4PROC 2E44A 3ZZ0A 3LBYA 4QDXA 2ANBA 2Y1FA 5KC8A 4NBSA 2Z30A 5EXPA 3DKPA 3VVUA 2IXBA 3HJNA 3VR6A 3RH0A 1NYLA 4U63A 3ILOA 2X1BA 2GVZB 2O5EA 3KFWX 2P41A 4ANDA 3KSUA 3JATB 3HL4A 3EVGA 4J9RA 1Z25A 1R88A 1J0CA 3N79A 1NUTA 3GFOA 1JG1A 1J06A 4KKVA 4Q4CA 1QZUA 2KBFA 3A1CA 2F3SA 1WF2A 5FUBA 3LZ6A 2FHMA 1WZ2A 1A9SA 5JFTA 5GONF 1QUEA 2J30A 1DXQA 2OC9A 4BNYA 2PQ2A 2Z30B 4ZC1A 2R7RA 4L8LA 1X1CA 2FPSA 3T52A 1UIRA 2PAAA 2CQ3A 1KVJA 1B0AA 4ZYLA 4D6XA 3LP2A 1RLOA 1CHDA 2ZFUA 1S2NA 3EQ2A 2YQ0A 5BWOA 4J7UA 1BQ4A 4WFXA 1Q16B 3BQ2A 3RREA 4FKXA 1J8VA 2ONJA 3MTBA 2ADBA 3DM2B 1PL7A 4Q7KA 5UKDA 4NEQA 4MR9A 2LIPA 3LRPA 4IJMA 1HMVB 4MQLA 4RTSA 4B76A 2P79A 3U02A 4B9LA 2AYYA 1THMA 1EESA 3KTAA 5AXKA 2EV9A 1GADO 3AHIA 3EXYA 3MEDB 5AHWA 5FI3A 5CIWA 5F33A 3A9CA 1L5GB 1NIPA 5KFDA 4J0GA 4C4WA 1OFUA 2X6TA 4NEGA 3BDPA 1L5FA 5L9XA 3JWGA 1M1HA 2DCMA 3VR6H 5F4BA 1F2TB 3LWNA 2DHMA 5JSUA 1E6YB 3HRKA 1J5EF 1Q7GA 1ZI9A 2FE4A 1KPHA 2CXTA 2WICA 2OWEA 4HZUB 4RDHA 4AY5A 2NN3C 1N8TA 4KIFA 1OAAA 3CQ3A 1AXEA 3H65A 5LZ5A 1UBMS 4P1ZA 4OXQA 4BN4A 1PV1A 4J4TA 5AJHA 5ARBA 3EG9B 3SSOA 3B7WA 2GYUA 2I4MA 3RARA 1J2RA 1OGIA 5DZ6A 3BMNA 4BDPA 3EPKA 5KFSA 3DO8A 3D5EA 2O1EA 1DZ5A 2F3RA 3V6DA 2PI4A 4DQRA 3P9NA 2FETA 3AOBA 4BP8A 1WCXA 3P9RA 1AMOA 5E6UB 2EGUA 2WFAA 3IEXA 3NOGA 4A8JA 2V7GA 1DV2A 3EIEA 1BMDA 3UUWA 4DCJB 4QR1A 1NW4A 5F3RA 2VPZA 1VA5A 3Q7RA 1O5IA 2DFDA 2FHSA 1Z5GA 1Y80A 1RNLA 2DWOA 4A8XA 1U63A 1IHYA 4P3PA 5KSPA 3RYTC 5K8LA 2XJ4A 5IVDA 3DNCA 1E1NA 4N7RA 3G8DA 1RYFA 2COKA 3D2WA 1E9DA 3DHEA 3GT3A 4WXHA 3R0IA 3BHNA 1ZBQA 3IERA 5JASA 2V5AA 1KI7A 3M6WA 1RPZA 3TNFA 4V03A 5JH7F 3COSA 1ID1A 1FFHA 1TJ5A 4LZLA 1N77A 4QDOA 2QRNA 2MQQA 2P5TB 2QA1A 1VC0A 4UJ5A 3UMYA 2V7TA 2GJAA 3THRA 1HE2A 1T2AA 1RHUB 3V1YA 1J27A 4PRKA 4WINA 3KIPA 4UEWA 1OWNA 3QX3A 3WKEA 4EX7A 2GIFA 2FVQA 3QXSA 2LV8A 1YCFA 3C3CA 3I82A 4QBUA 4X65F 3DZGA 4M5DB 1SQSA 1ZAXA 3FH0A 4I9UA 4XIIA 1ZJ5A 3VZPA 3A2LA 3SFVA 3PZBA 1UZDA 4GO7X 1T8PA 3RYLA 5DPMA 5BSGA 1Z36A 1KR2A 3G0IA 2UYGA 4HYTA 3QFFA 4M7OA 5LJ3Y 4KGXA 1XZKA 3MC1A 4F3QA 4ED8A 5FWXB 4QLOA 4C4ZA 5CXXA 3ND5A 3CS3A 5TPZD 5KQSA 3QXXA 2QU8A 1E66A 1LXCA 3BILA 4YO7A 2IDKA 3TWOA 3H13A 3L7UA 1N6QB 1JAYA 4OYIA 4YJ2F 1W88B 3R09A 4NCAA 3JQ7A 2XZOA 4MWTA 4W98A 4X66J 1TAUA 3N8NA 4JROA 2LQ9A 2VXOA 3CNHA 1N6NA 1YBHA 1G8AA 1MAVA 1RSCA 4IKPA 3I72A 2IK8A 5A03A 4DSLA 4XA8A 3ZS8A 3KB8A 3A1YG 1C9YA 2OO5A 2YV2A 1Z12A 3DVLA 3RB0A 4NA1A 2Z9BA 4EGJA 2Y0DA 1GAQA 2K7KA 1JQEA 2QYSA 3M2VA 2TMYA 5LVAA 5K8MA 2ZIWB 1YUBA 1Z4OA 3E9NA 2ONKA 3AXSA 1RLUA 3FPHA 3FSIA 1FXWA 3Q8WA 2AD1A 4BVJA 1LW2B 3MXTA 2NUHA 2HWWA 2D62A 4FI3C 3UATA 1P5RA 1NRIA 2XZPA 3I9V6 4DNOA 2IOYA 4UOCA 1NUHA 1BDMA 4J0QA 3VVLA 3DL7A 2IYOA 4MKFA 3VH2A 3FMGA 3L18A 1NK0A 1YR3A 1GZ4A 3KMSA 4X66C 3HA2A 5AK0A 3TEMA 4KACA 5TY0A 4CIBA 3NTOA 4X60A 1X42A 2LFVA 3FD8A 2MMAB 1GRNA 4O4GA 3ZBQA 1V1JA 4L74A 2ZB7A 1ZZEA 4TKUA 1DFGA 2Q5JA 4A8FA 3PVSA 4KJZA 4G1QB 3NO4A 4B6EA 2OXCA 3IRXA 4KIUA 1MSWD 2FY1A 1HQDA 5EIFA 3H40A 1GGMA 1CXZA 1BJTA 1EBFA 4EG5A 3RVBA 5EKTA 4LSNA 1JSZA 3A1EA 2YUIA 3WFZA 3AU8A 4U4AA 4WXPA 4UXIA 3ZIAD 3V8PA 1EKRA 2XNRA 3QZUA 5BV2P 2H7XA 4KLZA 4TTJA 5L8VA 3V42A 4HRXA 3TNJA 3PR2B 1TW2A 3VJRA 5KFTA 4RORA 4N0EA 1N92A 1EUDA 4MCJA 1PYSB 3CDUA 1MR3F 1EP3B 3MJCA 1V26A 2NWQA 2BANA 4BC9A 4MS3B 3AKDA 4FMCB 3TK1A 1VIYA 4PXSA 4KHMA 4A92A 3ETDA 3ZWCA 4LF1A 2XTAA 3I2KA 3MWDA 2V7UA 3PE4A 3H87A 5IFKA 2VJQA 4XI9A 4OQLA 4JC4A 1QQBA 2QD5A 4KHZA 3WL7A 4JI5J 5A1JA 4RW7B 4RD6A 1TU0A 1M2OA 1X7YA 3OZTA 1KPGA 2WHRA 3RVSA 1R0CA 1Y8RA 1JWBB 2NYAA 2E9ZA 1UM9A 4FB4A 3PO5A 3NVAA 3OXLA 1GFWB 3A7EA 3K89A 2FNAA 1TVRA 4N7BA 4KP7A 2G7MC 2EIXA 4B82A 4INOA 1DURA 4TN5A 1G6OA 1TL5A 4HLBA 3FW1A 3AA9A 5T8KC 4I2NA 1M3SA 3L1KA 4DBZA 3ESXA 5F3TA 4KGMA 4C11A 4ZVOA 2ZWMA 1HA1A 5EKSA 1GGNA 4EPXA 3COJA 4HKTA 1DX9A 1JIKA 4GNKA 3UMSA 1DVRA 3L7DA 1MC5A 1U6KA 4CWBA 4RW4B 4CKBA 1IBMC 2RBGA 1CUJA 4YHHJ 3OOSA 2PX3A 4QEDA 3ZN2A 3UH0A 2X3GA 4QTYA 1MU0A 1LF0A 3TGLA 4ELUA 5EP4A 4YAWA 3EXAA 3E27A 4KU4A 4RHEA 2E7WA 5AHOA 1IYZA 3SZLA 3WGUA 2GQCA 2RKIB 1GYRA 5EJIA 2DPIA 4U7CA 1H66A 4RSMA 1KO5A 2M4MA 4JUAA 2O8DB 3V2UA 4JT2A 4E4RA 1HSZA 4JELA 5CITA 2H65A 3HMKA 3VV2B 1AUOA 3LA0A 1TV6B 3GUZA 4YAJA 1ORTA 3MT9A 2JFNA 3DCJA 1EUQA 4TS4A 3KR1A 4MFBA 4JU9A 3C5VA 2QMXA 3NAGA 2ERYA 2EFJA 1YRYE 2GBLC 3KK2B 3KT8A 3MD1A 1V8OA 2FR8C 4D0LB 5BSWA 2ODPA 3EEOA 3RJTA 3FEYB 3HO1A 1A9QA 4NHEA 1NE2A 2LXIA 2K87A 1F9EA 4OHRA 1H85A 3Q89A 3CLUD 2EK1A 1BHSA 3PIPQ 3WRYC 1QG4A 3SDZA 1IE3A 1KS9A 2CYBA 4ZS6A 3OXFA 3B54A 3OPYI 4E21A 4X1YB 1RMTA 2QZSA 2CHFA 1TGVA 4JN6B 2GPSA 1Q8KA 2VF3A 1Z8NA 5A1GA 2WF6A 4LHWA 2G1DA 3V1TC 3EZYA 3TECE 5DV9A 2NW6A 4L8VA 5JATA 4RIEA 1FXRA 3OJWA 3SC2A 2D00A 5EE0A 4LVUA 1P7YA 1IG0A 1ULHA 2VDOB 1TT5A 5ALQA 1INLA 1USVA 2EKZA 3ZXIA 3ML1A 3ZLVA 2VXCA 3KJNA 3U4GA 2H3EB 2OCGA 2VDJA 1TZ2A 4JKOA 3KKLA 3VVTA 4GU5A 2Z98A 2DQZA 2V3CC 1FQKA 3V80A 2FSSA 1B3BA 1EZ4A 3I0NA 2AHOA 2ZH8A 1FSFA 5JDCA 1ZAVA 3B1JA 4DPMA 3M6VA 1BX0A 2NUPB 3FVRA 4PY2A 3CLVA 2Q5QA 2BKAA 3U7EB 4PW0A 2IXEA 3RB3A 4JI5C 1FA0A 1G2OA 2AF3C 3THWB 2ZROA 4QREA 3A13A 5G0RB 4I3HA 5IFLA 1IL0A 2IYLD 2UUBC 2JZCA 1NZ8A 3L4KA 3LI2A 1CG6A 2D13A 2P9ZA 3TINA 1NFRA 4X62C 1NLFA 4YLGA 5LYJA 2V74B 3VZHA 1X74A 3GILA 4BO7A 1C4KA 2GAHC 4AQYF 2XOXA 4Q03A 5GADl 2DNRA 3HCAA 1QE0A 4AX4A 4V19J 2BHLA 4DLSA 3I01M 2RHOA 4QFBA 4YRJA 3LCRA 5KT6A 2C77A 1NM2A 2DH7A 3DPUA 2P5SA 1NVVR 1EI9A 1IBLJ 3LQ2A 1NVUQ 4DIMA 2WM8A 3BGLA 1CUZA 4ZCTA 1JLCA 3BBBA 4X4SA 3RBZA 3GEEA 1LLDA 2BOPA 1E3SA 2AN1A 2PMWB 2P40A 4LVOA 1EB8A 3WGMA 4NYIQ 4GC5A 5HX7A 1AO3A 3K72B 3T38A 1N48A 1J07A 4Q4HA 2BFPA 1C7QA 2OORA 1OIVA 2Q8QA 4KN9S 2H00A 2HNDB 4UNSA 2QJ3A 1HT0A 3UDEA 2F43A 2JK0A 4EW6A 4EW2A 1CJCA 3WB9A 4LJ5A 3BE8A 4B34A 3H90A 3H0EA 4CM4B 1ZN2A 3JTPA 2IUFA 4O63O 3TFWA 2YKQA 5I7HA 4B3XA 1HNWC 2ZU0C 3NV9A 3KZVA 3G6XA 3NU1A 3DPSA 5HUJA 1EFAA 3ILIA 3I12A 4Z0TA 3PESA 5F2EA 2R48A 4UHBA 3ZR4B 1Q95G 1FDTA 2W2KA 2UYYA 4K9LA 1ZIDA 2XBPA 4TN1A 4Y2VA 4JAVC 3LQ1A 3L0IB 3GRCA 1HQUA 3DDUA 2DBRA 3CTMA 3RANA 2XH8A 2NQ8A 5KT5A 3A3KA 3GR0A 3IT1A 3UD3P 3HSYA 2AOXA 1EJ7L 1Z18A 2BRUA 1YA6A 4RNOA 2YWGA 4CI0B 4I64A 3TTUA 1IY8A 4L57A 4JC8A 1I10A 3KXPA 2BBTA 4CP5A 2R47A 3LECA 4WD3A 3OSUA 1JDPA 4JBWA 1XE3A 4EARA 4LFBC 3W60A 4FUTA 1PQPA 5CFOA 2FEKA 4JV1A 3CH4B 4PNPA 3IVRA 3DMDA 1CJMA 3RVOA 2QPLA 3MZIA 4F96A 1M73E 1MZVA 4DV6J 3U0VA 5MAOA 3D0IE 2XCUA 3OKAA 1SG0A 4JLSA 4J9LA 3AJ1A 5K5EA 4U5YD 3I52A 4MKHA 2AI3A 5A6VA 3OF5A 2H16A 1IB8A 3K09A 5HVHA 1SJQA 1UP4A 3BSOA 2V6AA 4XIGS 1GMUA 1IBMJ 4G1IA 3QFCA 1QCZA 4XGQA 1AKMA 4L9SA 3I58A 3W34A 3DL4A 2PNJA 1ZPWX 2B6AA 1C9DB 4AZVA 1SVUA 4UE2A 1H7WA 1L4GA 4Z5XA 3IBWA 1L0BA 3M32B 2Y1JA 2P62A 3R0QA 2GKOA 4Y1FA 1ZN9A 4K1LA 5I3CA 1S49A 1TCAA 3KZ1E 4NCNA 1A2KC 4QXOA 3WBJA 4B3FX 2OV2A 3ILHA 1SPXA 2FP4A 3EVEA 3T15A 4DLKA 4DT1B 3CX4A 4FBTA 1YMQA 4HPJB 4EBCA 1OBCA 4H2DA 1NPRA 1E3DA 1U8UA 1ZP6A 2COEA 5KFKA 4YK7A 4MWGA 4Q9DA 5CT4A 4PWYA 1IJEB 3Q9LA 3OQ2A 2N1BA 3AVOA 2RGAA 2FW8A 2W9BA 4LSMA 1C30A 3MZ0A 1ZOTA 1M6YA 1RAHA 2J07A 3A9SA 2DJ5A 3GPLA 2OQRA 1AMUA 3GCWA 4QU9A 2Y77A 2LBPA 1EWYA 4JDPA 3GT0A 3D0HE 3ESCA 3O7WA 4US2R 1E89A 4F1WA 1H1LA 4DLWA 1Y1PA 3GT4A 3HGQA 2XBLA 4DY4A 3NHJA 2VA3A 2ZJ1A 5J2NA 1RC8A 4RDIA 1QFZA 4Z99A 4MSUA 3PUIA 2YC4C 5FNVA 3TIXB 5D7NA 2G4VA 1QM4A 4EGLA 1NKSA 1U45A 2XX3A 4MA0A 3EPGA 3QO9A 3I9FA 4FN4A 1UZHA 4MYDA 1RWQA 3MM5B 2QY6A 3H5SA 2CXCA 1UJNA 3NYWA 4AY6A 1BYUA 2CNWA 4F6RB 2DEIA 2XE7A 4C2MA 5BQXA 2L41A 4NCJA 4NZNA 2WTFA 2HS0A 4AJEA 1VK8A 4YXFA 5G53C 1YDWA 3DM9B 2DGOA 2O5RA 2MQNA 1E77A 4ZT3A 3UAVA 4DQPA 3H3FA 2GLXA 1RHMA 4QBFA 2V6GA 3FVQA 2B21A 4PLHA 5IT0A 5EMKA 4RNHA 3J81A 3G8YA 1VCOA 1V7QA 3A4YA 1VRVA 4LWQA 3AR8A 4NL5A 1IZ0A 2B8TA 4F4JA 4D25A 2L48A 1IOWA 1EVYA 2X5KO 3C6MA 721PA 3PQDA 2XE8A 1XZBA 2DT5A 4ZICA 1T8YA 5GTDA 5TMDA 1FJGJ 5HI7A 1DADA 2ILTA 3PJFA 5SYNA 4OYXA 4U2CA 1DEXA 3KK3A 5TV2A 3W9BA 4CKCA 1R6TA 2YNMC 5D4PA 3HFKA 4RHTA 1E9VA 2HHLA 1NOIA 1G8MA 1U7LA 1REQB 2A2ZA 3C1AA 4G0PA 5IAKA 1X7DA 2WJ3A 3GFGA 2KYRA 4LV5B 4XM0A 3I0MA 3OQJA 1YCHA 4UZBA 2V7BA 4L3KA 1TKTB 1HBOA 1AV7A 1U2SA 3HF5A 3E1SA 4KLCA 4NICA 2IPNA 1NX6A 4LZWA 3LVFO 2DKOA 1NSFA 2GNPA 2NMVA 2VA9A 1SRQA 2FHKA 1DHRA 1E6EA 4MUFA 5KFVA 1K1EA 2R11A 1GXTA 2IPLA 3Q2SC 5BNZA 1Q91A 2O50A 3W04A 4WN9A 4GKJC 3RSOA 1U5BA 1LS1A 1PZFA 3TL3A 3T1HB 5E3CA 2ASJA 3DXXA 1T0IA 3F1LA 4YUDA 4AJ1A 3EIXA 2DHSA 4WZAA 2J4CA 5I4IA 2D8MA 1A9YA 3QI2A 3T7DA 4F3TA 3ZG6A 1FXWF 4E5MA 4LF4C 1C8BA 1RYNA 3IPYA 4G5OA 4ECTA 1K1SA 1S1CA 1EGHA 1DBWA 1OV4A 1FFYA 1D5CA 2HSJA 4LTNA 3N1UA 3VDRA 4J7CA 2BR4A 1R9NA 3HY6A 4WK2B 4HAUA 3TCNA 3VSEA 1GD1O 5DDQC 2VZ9A 4CM1A 2CCJA 1VYUA 4UMVA 3DHYA 2X4IA 2H7CA 1WOPA 5CT9A 3FUWA 2ACVA 3OJOA 2UVQA 3WB2A 3NWJA 4B74A 1PFVA 4BBZA 3N9IA 1W0CA 3JQAB 1ZN8A 2KG0A 5TGTA 1VI6A 4O0IA 1G9XA 4UHEA 2AMVA 4O1MA 1VIAA 4BNTA 5E7OB 5A5VA 4TTIA 4HI1A 4EHNA 2KHCA 5D4OA 5CH5A 2QMUB 3WQQA 3F3KA 3H2ZA 1GPUA 3OQPA 4RH3A 2XO7A 5J1TB 5BQOA 4DYHA 1XHEA 1UK8A 2JVJA 4O3MA 3P71T 3V81A 4P4TA 1BHO1 4MVJE 2JC0A 1Y3IA 3SX2A 1EETA 1G98A 3NBMA 4IIBA 3K0AA 3NMRA 3IO3A 3IP7A 5FEMA 2GIQA 4Q37A 4KXYA 3JRXA 3UO0A 3PUXA 2JGFA 3H0PA 2HDWA 2GCGA 2XEDA 1XCLA 3KR2A 1DEOA 4CMCA 4EMBA 4R8UA 1EAYA 1TEZA 1M2VB 3S6JA 1BDJA 5DOZA 3SF8A 3ELBA 4KR2A 4A8PA 3NBAA 3WLKX 2OYSA 3IQDB 3LGXA 3PYFA 3WKCA 2OM2A 3OZSA 1VG9B 4BKPA 2X7JA 1SQ6A 3KOWA 1WG4A 3L1UA 3GIIA 1MDBA 4XPEA 2ZT5A 2B34A 1QTQA 3DOIA 3J7A1 2H2HA 1QQ6A 4HB0A 4UUQA 4QAJA 2IYAA 1N5VA 4LNUA 4X7PA 3ANLA 4K88A 4KUGA 3B3FA 3E2EA 3HBJA 3WMWA 4JUIA 3ZYZA 3DMGA 1S4QA 1RAIA 4ETXA 2YXEA 4FEAA 2HHXA 5JOQA 5B3LA 2FVXA 4RFLA 2CDCA 4BAGA 3CJ0A 2ETVA 3GJ4A 1B93A 3MM6A 1X1TA 3CZAA 3MRSA 4ALIA 3TX8A 4KTVA 2Y6UA 3DQQA 1OSNA 1GG8A 3GZTB 2AN4A 2FLWA 5IHXA 3ENQA 3MWKA 4HX5A 1HLWA 3CEDA 3DFFA 2DOKA 4MV0A 1KO7A 5DGAA 4CEJB 5CEJA 3TDNA 3B1FA 2IBOA 2G88A 4YLEA 1JA0A 1V5FA 4L0DA 4LC1A 1LFWA 2FR8A 2ZUBA 2X22A 3S1AB 4AK9A 1P2SA 1DV1A 2P2FA 3B36A 5FPTA 3IMFA 3FWZA 4C8MA 2VYVD 3CB4A 2ZYIA 4F2GA 2DIUA 2TMKA 1UDXA 5IAOA 3JSRA 3AUJB 3D9BA 2I6WA 4R1TA 5GZ1A 2ZITA 1QOZA 5IAJA 4WOKA 4B9UA 1VDHA 3LW5C 2HBQB 4EY4A 4NE9A 4D42A 4UUWA 1B0UA 1Y6ZA 2GNAA 1CC8A 1PR1A 4CMHA 2NO4A 3ED1A 2BKXA 3PGXA 4NH0A 3I6PA 5T6BA 3NTUA 1XSEA 2FHJA 3J7TA 1ISGA 5GP1A 1MORA 5KAPA 2EFYA 2NSDA 4I9FA 1VB5A 4FYMA 4CMEA 3PE6A 4KBYA 2BFAA 3UW1A 3F9CA 3ONDA 3AJAA 4KXNA 3IUQA 3HDSA 4RABA 4OKIA 3I64A 3IMEA 3KDAA 3KELA 1UP7A 1T24A 4QASA 2XDQA 3CE8A 3QPCA 4YS2A 4X65J 2IOQA 3FRYA 3FBTA 4R1LA 2I2YA 2Q99A 1HNZJ 4KGKA 4PG7A 1R0BA 3S8SA 1I7DA 1JQBA 5AKKA 3LCCA 2BTOA 1YL6A 3TTTA 5G4KB 2ORED 2XLCA 3PC4A 1KSGA 4TVAB 1PUXA 4CIXA 4B44A 4B6GA 3UK2A 3TL6A 1B26A 1A9NB 2DR7A 5F12A 3TW8B 1H3NA 3NKLA 1VL0A 2DH5A 4PSDA 4FC6A 5A04A 4AUMA 3FEXB 5EG5A 5D78A 1YWXA 1VBNA 3G9XA 2IJNA 5EVJA 2Z4PA 1NW8A 2Y3IA 2FP4B 1CDZA 3DBOB 4USHA 1OX4A 3H9JA 4U7UK 3FNHA 1GCAA 5CVUA 1P6TA 4W99A 3S0JA 3BOSA 2HHPA 3MGGA 3GLSA 4D3ZA 4R41A 4J2TA 3CCLS 5FWDA 2Q3DA 2BYCA 4LE2A 3CW2C 4IHQA 1Q84A 2WSSA 5DYGA 2HN9A 5KQMA 5T7BA 1F4PA 2YNMA 2CXXA 4BL5A 2JD0A 4EEKA 4Z6KA 4FYYA 4B17A 1SKMA 1EX1A 1ITZA 1V3TA 1TUWA 1WTBA 2JHGA 1R8SA 4KYZA 1IXKA 4Q5VA 3SV3A 1ADFA 3UNYA 3C15A 3DOUA 3L8FA 3H2LA 4UQPA 4UVGA 1SU6A 4L2ZA 2UXDF 5B1EA 3WLEA 4RV9A 3L7AA 3PPWA 5HDBB 4M98A 3I01A 4IR1A 5FJIA 2I91A 2RIPA 1N2HA 3DJFA 3ESZA 2OE2A 4FGUA 5LIRA 4M87A 4JVNA 3H8VA 3C4VA 4KN8A 4JX8A 3NJRA 1TVEA 1ICIA 3LO5A 3PGKA 5TQ2A 1Z0ZA 5A71A 2AW5A 4Y6SA 1TO2E 2GGSA 4OYZA 3GR1A 4AKIA 4DV6C 1WSBA 4QX6A 1DRZA 4CIVA 3UR3C 1SUQB 1XMPA 1A8QA 4PO9A 1P7LA 1YRWA 5IT9A 1RZUA 1YZYA 5JCJA 4DSIA 2M5YA 4LF6F 4PQGA 5EFZA 3GYNA 4B31A 3A9UA 4RPHA 1WB6A 1L8LA 3JALA 5I7UA 1HDGO 1UFRA 2VH2A 1UEJA 1T11A 4WK6A 2MKCA 2ZYGA 5CIQA 2NUAA 2ZI5A 4F7VA 3KBBA 2WOMB 1QMPA 5CXQA 1BWVA 3EOAI 2OV8A 1WNFA 1EVIA 1H5QA 5ICMA 5C42B 4R98A 1Q2XA 2OXFA 3HJHA 2OLKA 3AVPA 5D4NA 1E5VA 3GGDA 4Y1EA 2VPXA 4ZO6A 2QN3A 4D3GA 1D09A 4J75A 4LRTB 4HY3A 3BSWA 2PYDA 4NMXB 2VHGA 1CQXA 3UPFA 4JEIA 2RHGB 3L6BA 2G9NA 3GIJA 1XT6A 2YNIB 5DO2A 2QENA 2V97A 4QQFA 1GH8A 1WTCA 1OGJA 2CQCA 2GVDC 3AF5A 1II9A 4ZMSA 3O8DA 2BKVA 2O0HA 3R44A 3JALB 3IJ5A 1GV0A 2YY6A 4TMYA 1KDZA 5DGDA 4CWAA 1X1DA 2MSSA 3K8OE 2X58A 4DC9A 4GDFA 1MWQA 3HBMA 3QRRA 5IYZA 4J0HA 5DM0A 4ZGBA 2RHMA 3I2HA 4PSKA 5T3UA 1NXPA 3H2IA 2OMEA 4JYMA 1CR1A 4DUZJ 2JBWA 2Y9PB 2LDYA 4ZV9A 2JF0A 4HEQA 2CYAA 1LBSA 3I32A 4OV6B 5I3ZA 3V4FA 4EYKA 3MCOA 2A9JA 5HIIA 1NJFA 1DBVO 1YIDA 3CX7A 1WQ1R 4DR2C 1TA4A 3D3WB 2FMFA 4N5MA 3D0RA 2NTYC 2Z58B 2A0UA 2HO5A 4QXAA 3GAZA 1SUBA 3QAEA 3JD3A 4OMDA 2MCQA 1PVVA 2X0FA 2JGMA 1MJNA 1OYEA 2BFDA 1E2HA 3R6LA 1FFWA 3FPBA 2Q46A 5JV5A 1YZ7A 2B9XA 3BG5A 2Y27A 4HV4A 5DJ5A 2PFKA 3OI7A 1XHFA 5KFEA 2OLEA 2IDJA 3CPJB 3REQB 3PYLA 4PAWA 2CWDA 3BGVA 3FZ2A 1M6XC 2H3EA 1BJRE 4KQ2A 1S10A 1WUIS 3B1XA 4BZQA 2RU9A 3C43A 3AD9C 2Q2NA 4DQQA 4RSRA 4URWR 4INZA 3PD0A 3H97A 1BN7A 5L38A 3I4FA 1E1CB 3PFIA 3L3BA 5C42A 4RF2A 4XUCA 3JZAA 1J23A 3IN5A 1GTRA 1EBBA 1FX1A 1SUIA 1MEEA 3I9ZA 1W25A 2A9PA 4GNRA 3MM4A 5JH7A 4V0NA 1VLZA 1R0WA 4UZCA 3BYRA 1XHLA 1JF8A 1M2HA 4J29A 3AL0C 4BLWA 3NGDA 1A27A 1E1RA 4EUKA 1W35A 1HNVA 4A15A 1UKEA 3DA8A 1IIBA 4N5LA 4QL3A 4EB3A 3ZU3A 3C14B 1SUFA 3I9V1 5L95A 3JYTA 2G06A 1GILA 4HQ6A 4HXEB 1KXJA 1VGRA 4GKKJ 3PWTA 2WZQA 4HDGA 5CXSA 3DKKA 3DLGB 5BW6B 3EDCA 1WKCA 4B3RB 4GYWA 3REQA 1BS9A 4FYIA 4G1VA 1UAGA 3M9LA 2EWWA 4GICA 2P6OA 3BB4A 5EJMA 3ZCTA 2P9FA 3U3MA 2R3VA 3G96A 4LOKA 3JAMU 4Y2CA 3R7LA 3LXUX 2QAJA 5EHIA 5T5QA 4DPXA 2OCYC 2OAGA 5CYGA 1F0YA 1LLQA 2JKYA 2JX2A 1J56A 4TM8A 1DCMA 3SN6A 3L01A 4E2WA 2FUKA 3HB7A 4M6WB 5A3RA 4IAOA 2DFVA 3RUPA 3WRWA 4ZWNA 2EBFX 3ZZRA 3VYSB 2BP7B 4CL8A 1EDZA 1GXSA 2QRJA 4V38A 4ONEA 1FYVA 1GA6A 3ZCUA 5CJJA 3SC4A 4FXOA 2F5GA 4MVXA 1KEPA 1LQLA 1EFHA 1GPH1 1F12A 1N57A 4U7FA 3Q2TC 1E79D 4FI3F 1NSPA 3WVNA 1Q8LA 2WFLA 5IYZB 3PW5A 2AFHA 5CVJA 3BIWA 5AE1A 2SNIE 1CJTA 1H05A 2X0RA 4OI3A 2QV6A 5HKKD 4PZVA 1RT4B 4ZAZA 3NWPA 5IMBA 2HS4A 2KJWA 2OG1A 1UEIA 1Z22A 5DRYA 2V2KA 4IOKA 4J1TA 1PG0A 2X8JA 2GRAA 3LDUA 1SNYA 4Z51A 3O1IC 2QORA 3DZCA 2RBEA 1C3LA 2WWXA 1ATIA 1CU1A 4XR4A 4KFRA 4K6GA 3GRAA 1T5DX 3Q8RB 2YX4A 2ATIA 3QPBA 1JR3E 4U96A 2O8EB 3QLUA 4P2MA 1NJ5A 4WDQA 2VC0A 3ZGVA 4UUXA 2RIRA 2ATVA 4Q7JB 1RJJA 5DULA 5I45A 5JBQA 5IX8A 4GMGA 3DF7A 1C0LA 2XRFA 1L7VC 4L72B 3NUZA 4IR9A 4O4HF 3TQRA 2C3UA 2BW2A 2FN4A 1DZ3A 2G83A 2IA0A 1I4LD 5FTMA 3TAXA 5KOXA 2AC4A 3I04M 4UZEA 4RFSB 4NYOA 4C06A 2UUAC 4FCCA 3RWOA 4R0JA 2F6RA 2YKAA 1C4WA 5K99A 1XNQC 3ORFA 1XGKA 4FQ7A 3T9ZA 1ODLA 4LJ9A 3IRXB 5FKJA 3AIOA 3URMA 1GJRA 1Y4ZB 5AW4A 3I76A 2NU6A 1RT6A 5AI8A 1D8YA 4DN9A 1G55A 1VXOA 2AXQA 3W3ZB 2WP0C 2WM2A 5AR1A 4CNYA 2CB0A 2ZH6A 3TDMA 2CDAA 3LCMA 1PV4A 1QVFR 3FFAA 1FDAA 4XJXA 2ZHBA 2H63A 3CRMA 2QROA 1KKHA 3GG2A 3ZDEA 2Q7XA 3D1HA 2JFKA 3TE6A 3GFVA 1BD3A 1RJDA 3K8ZA 1WUKS 3G17A 5GIOE 5ENVA 4RK6A 4D8TA 2EP8A 2XRYA 2BE2B 1A4IA 2VNAA 4DG1B 2DZDA 3VYWA 4CF7A 2KHZA 4PLFA 2REXB 4B09A 5KQPA 1SXJD 3IQEA 4DDMA 4NLVA 5JAPA 2WK4A 1I2MA 2QVGA 4E3WA 1JXOA 3UMJA 1YGYA 3N7TA 4LRXA 2H8GA 4UHHA 4YR9A 3FWHA 3AY6A 2XITA 2XAUA 3KU1A 4PTZA 2RGNA 1R4MB 3EGXA 1Q1QA 2ORVA 1GQFA 3WZMA 1KRXA 5GPBA 2CLDX 1U8YA 3VU9A 2LEAA 4MYCA 1QANA 2KMLA 4L08A 4FYWA 1FBTA 1KI2A 2E55A 1GPYA 3MJEA 2CPJA 1KEKA 1F60A 4JLOA 1L3IA 2A3RA 4KXUA 5FEUA 1KPIA 1YRBA 4Z54A 5C7YA 1RWPB 2N9UA 2IVZA 2O2ZA 1BXRB 4ZDJA 1V43A 1HBOB 2BLLA 3UVJB 1RT6B 4R2LA 4TOIA 2Q6TA 1FLNA 2CXRA 2ZD1B 4UULA 2WJ4A 2IV2X 3OM9A 1L5LA 5H9EJ 1GAWA 1N34J 4FS2A 5IFMA 4Y2RA 2MSNA 2WI8A 2WG2A 2NYHA 4WKBA 4ED4A 1NL3A 4M1EA 3SQXA 2OPBA 4UVDA 8ATCB 4JR2A 3BMXA 3TARA 1S4EA 2W6OA 1K7FB 2XNDA 4U9IS 3OAAA 3ZCQA 2V7PA 3UVJA 3VNSA 1P1KA 4IG0B 1NU6A 4YJ3B 2H1YA 1M0WA 4MS4B 3CE9A 4S2UA 4DSNA 3VMFA 4QLBA 1V6CA 2RK4A 1YZQA 4DLNA 2F65A 4S1WA 3OT1A 1SVLA 5DASA 1CUCA 3HA5A 2H5IB 2NGRA 2VQEC 3RJ5A 3G9CA 2I0XA 4NLLA 3Q3EA 2G71A 4ILKA 4HT3B 4RSGA 3GV5B 3DEZA 2IBSA 2IRUA 5AVTA 2WKQA 3D3BJ 1SKSA 1F2UB 3F56A 4OFBA 2DR0A 1WDKA 1Y11A 4L78A 1PR6A 2ZKLA 2R6AA 4D7AA 2JFVA 1HD0A 2GA7A 4MP3A 3HV2A 4BHQA 1SH0A 4NYMR 3EVCA 2MWMA 1HLDA 2YRXA 4IH5A 2DPXA 1FNXH 2EW9A 1GG9A 3KXKA 2HRCA 1Q4RA 4KOEC 5DZ7A 1VMBA 3BREA 2M1XA 2CBGA 4KWTA 1Z6TA 2FWPA 1Y1RA 4O6VA 2I1QA 4WBXC 2QM0A 1X9IA 3NB0A 2XCSB 3FGOA 3FDZB 1JAXA 3GFPA 4BFZA 3E18A 4W8OA 4JHLA 3FZNA 1QGED 3T7KA 3RASA 1E8NA 3GMSA 4TLRA 4Z9XA 3JSYA 3TZLA 2R5WA 2RJZA 1UPCA 2TRSB 5KG1A 3RJMA 4QBHA 2OEJA 2UV8G 3VR2A 2HLPA 1CUHA 1XZAA 3RRXA 2ZQYA 3GLVA 3KVRA 3G2KA 3LQ4A 1R0SA 2PGLA 3CMES 2D7SA 3VAHA 1YJRA 3MAAB 5AHRA 5JWHA 4UDNA 2OBNA 4OYYA 3G2XA 1SIOA 4DT1A 2QKYA 3U1VA 4KVZA 4UC0A 2QW1A 1HARA 4LK2A 4YP9A 4NV0A 1NK7A 2XMBA 1MJGM 2J8ZA 4W9NC 3DP9A 1WHVA 3TA2A 3FGZA 3K0EA 2PKQP 3RGGA 1QNLA 3MR7A 2R6FA 3PGA1 5EEHA 4K9NA 4JXXA 1RQRA 3DLGA 3T8YA 5JC1A 3ND9A 3ZYCA 2F3UA 2AYZA 1V35A 4FB5A 4K0KF 5B6PA 4WGFA 2VPYA 3O0DA 4TVKA 1P31A 5BSKA 1G5TA 1NDUA 2GWHA 4EG0A 3DKVA 1BA3A 5HRUA 1E3WA 3L8HA 3VZCA 1QDUA 5ALIA 1YJVA 1LRKA 5AD1A 1T2FA 4JYZA 1FDNA 1ISHA 8ADHA 1RYBA 3SF0A 4WXWA 3KTAB 1RACB 2CYYA 5KFBA 3WXBA 2B82A 2FLKA 1J0XO 4WCFB 3BFJA 3OTOF 1QHGA 3OTWA 3OQ6A 1UAWA 5KT7A 1RXCA 3EUNA 4X64C 1RLTA 2C4NA 3KLFB 4M60A 4BVGA 1YTUA 3K53A 5EIBD 1C3VA 4MQEB 1K5HA 2HU8A 2CK3D 2V45A 2CPDA 4OA8A 1U7ZA 3MFYA 5AVZA 1MXCA 1LH0A 3SLKA 5B55A 3PQEA 4NU6A 1B8VA 1F0KA 1E5QA 3PHTA 1T5LA 1XPRA 2QQEA 4EELA 1G4AE 3I6MA 1I6LA 3JQEA 1G6BA 3M05A 3OE1A 1NJXA 2IEIA 4OQMA 1K1QA 2XZLA 1XEFA 4DJDC 3BTUA 3RRNA 5L8RC 3FKSD 1PC5A 3PRBA 3DTVD 2DGVA 2R7NA 4DX7A 5FOSA 4AG3A 4USMA 2V9WA 3I9NA 3ZZZA 3GUHA 2OWDA 4OXXA 2IPXA 1WZIA 3D2AA 3HJCA 2MY7A 5TR9A 2FHPA 4ER5A 2BEKA 1QIHA 1ZVJA 3EFHA 4TQSA 1PKXA 3ORQA 1OIAA 4OX9F 4LF7F 4C5BA 5BNIA 1QONA 5LXYA 2DNQA 5LQNA 2B61A 3N76A 2X77A 3CTRA 2G04A 4QPXA 2OV6A 1E9FA 5JJCA 4GE3A 4U2KA 3FYHA 3VTZA 2G1HA 2O2EA 1P0PA 4I14A 1DJMA 3FHTA 1IOZA 4Y2HA 4FGKA 2PN2A 5C8XA 5KNLA 2V59A 1LQ2A 4JJKA 1SC4B 1VKRA 3PRHA 2A6PA 4ZV4A 2QTLA 1GTL1 3IA2A 1KVTA 1ESEA 1NQXA 4CN8A 5E3QA 3D6UA 3ZE9A 4XIFA 4FMBB 1WW2A 4FHZA 3KHUA 4GKKF 2WMYA 5A0TA 5ALTA 2CQ1A 1H2ZA 3D28A 4ENUA 1N33J 2V9PA 3IKTA 3LP5A 3VKGA 2FLPA 3AEUA 1WDMA 4TROA 3V9AA 4N6OA 5A0YB 5JG7A 1RTTA 1V11B 1XLTC 2I22A 1D0SA 4IH1A 1ICEA 1M10A 3R2JA 4V19X 3DMJB 4R8MA 1PU2A 3OU2A 1XD2B 4R51A 3WLLA 3EA5A 5FLXA 4EGFA 1VPWA 1MU2B 4BO9A 1N5KA 1DINA 2MQMA 5IVIA 4WKGA 2Q4OA 1U80A 1XRQA 4OJNA 1GPMA 1PD1A 5JZMA 1YS4A 2YNGB 4JY7A 4D4HA 4Q6WA 4MKZA 4NZMA 4KKOA 3EC1A 5D0RA 4HNAB 3KHLA 5KYYA 2YWWA 2JLWA 2Q3EA 3KSAC 2XHCA 1QAQA 1GXLA 4HFNA 4ENOA 4A0QA 1AE1A 1PR9A 1CBKA 2YWXA 5AXLA 1O3YA 2QJOA 5JISA 2EBHX 5F7XA 1JTEA 1XCGB 3BJRA 1RCXB 3QO9B 5CK5A 5FA6A 3SYTA 1IZYA 1FYFA 3USCS 3DNPA 4YTEA 1E9AA 1RT5B 2VT7A 4NOHA 1IPHA 2VOOA 3SS9X 4PWWA 4KKOB 2BHRA 4C7BA 3U1MA 4MUXA 4JMLA 3FBGA 1W36C 4KNVA 5KNBA 4R68A 3FCSB 3SJZA 3FSJX 3SKVA 1SL1A 1XB2A 5B64A 3D3WA 4ZPDA 4RHCA 1SHKA 4X1YA 1P2DA 4DWVA 5KYNA 4W5JA 2IZZA 3WP1B 3KXDA 4BRZA 1QZTA 4LQCA 3TZEA 4F25A 4WEOA 3HNPA 4WECA 4RWZA 2ROPA 3EGVA 1C80A 2GJFA 2CUYA 4PX3A 4AF6A 3CG4A 2QSFA 3MINB 4G86A 3E53A 4ZK6A 1K73T 2D8AA 3MCAA 3QTTA 1AKWA 3ET6A 4EUEA 5INTA 2GZDA 1CPZA 1PIWA 4ZU6X 3GJ3A 5FLXD 1QCDA 2GF0A 4OGGA 1EWQA 5TLSA 3K2YA 1CVLA 4ZZ1A 4HDOB 1C3JA 3UA3A 1HBMA 2V50A 2BEVB 2GKGA 4B75A 1YS7A 5LYJB 5C7LO 2YNIA 2P02A 4RMIA 1C1BA 2G1KA 3AONB 2J0XA 3K9LA 4C2AA 4GPAA 3RHZA 4B71A 2N7CA 4YJDA 1HQEA 3GV7B 5IXSA 4KYVA 2YVLA 3LUPA 3EXIB 1IWGA 1SHLA 1UEKA 2CQPA 2DXDA 4IOJA 3ENZA 2ZVIA 2I4RA 2Q3JA 1QFXA 3HFSA 1ABBA 4PUIA 5L1IA 1IBLB 4JV0A 3PPVA 3KQTA 1PEAA 4BQQA 4X6LA 3R3ZA 3TW4A 5DIFA 5IMSA 3OQHA 4FEGA 1JAHA 2H1VA 4IDDA 3S3TA 5G4KA 1QPGA 1SMKA 3FRHA 2ZOFA 2ZQ5A 3I53A 2ODEA 2XKKA 5CH3A 2YJ6A 4DV4C 1T3HA 4HCJA 4HUJA 2R7KA 4L76A 2QXTA 3BT7A 2X19A 4YACA 4UAGA 1GEGA 1I3OB 4KC0A 1S9HA 4ZI3A 1VI7A 1E1YA 4BYMA 4B3TF 5A7HA 1W36D 2DKNA 1NDKA 1W4ZA 1DAGA 4HACB 4BV8A 3PNYA 1FESA 3GPBA 1XI2A 3WKAA 3G86A 5GAEI 3MT8A 4WPAA 4REOA 1T25A 4CE6A 4HVCA 2A10A 2F4NA 1AV6A 2CNNB 4GL2A 3CZMA 4UW2A 4KHPC 3K4QA 4M9UA 1RKJA 3SQNA 3V4PB 2W2KB 4FGZA 3AGPA 3MWBA 4F0KA 3ECCA 3MWFA 2QI9F 1JYFA 3ZHUA 1APSA 4HGNA 2ZIAA 3AG5A 1VHJA 2B30A 2W2PP 2C2OA 3L4BC 1NJWA 3C8ZA 3PIOQ 1UOQA 3HB4X 1WE2A 5DGCA 4JL8A 4O8ZA 2C3OA 1VI5A 3D6JA 1NA5A 3OLBA 1XMOB 4I1TA 4TLQA 5DM6Q 1UKUA 4A8KA 5DCYA 3JQBA 5LZ8A 3I08A 2DU8A 4QFDA 3RRKA 4HDKA 4IUYA 2VTBB 1PT8A 2BRLA 3QQCD 1C0EA 1N2IA 1USUA 5LMUC 3X2SA 3DV2A 4KFSA 3SPXA 3PRYA 2BJEA 3E3NA 1Q0ZA 2VUHB 2Q6KA 3V4IA 2A9OA 1B4SA 1X5OA 1SUCA 4NDAA 4WBSA 5IBQA 5B1DA 3HXPA 1S0OA 3T3FA 2H3HA 4Q19A 4NLUA 3JS9A 4GZ3A 1ZJWA 3OP1A 1G9SA 3G0BA 5GM2A 1I1HA 1SBIA 1FF9A 4H7DA 1XMOJ 1VCTA 3E3MA 1E1QD 4OZ0A 5A4MS 2I4OA 3DC2A 3CJ5A 5FIIA 3ZXWA 4A8TA 1FMLA 2IM1A 2KFYA 3R1LA 3CLKA 1AN0A 3GUVA 4NBUA 4B40A 2JC3A 3K58A 2JGEA 6PFKA 2FMHA 1RXYA 4XK8C 3SEOA 3SJCA 3R9XB 1TVMA 5HA5A 3IR6B 4N77A 2PWYA 3SF8B 4G89A 1JKXA 4CLOA 2VT6A 4TSFA 1NMEB 4FWBA 2VKTA 3J80D 1BHJA 4M4SA 4CH7A 3HHNB 1X7YB 5FR1A 1BGXT 4RW7A 1P4RA 2C2YA 3OTGA 4FHFA 3FRZA 4LE1A 4CMEC 2ZNYA 1HFKA 4J2HA 4ZJPA 4USJC 4B2YA 4IP0A 2CQBA 2K1RA 1E58A 3TQ1A 1LPPA 3DLPX 2H29A 5IHPA 4YUYA 2XHZA 4RF3A 4Q66C 3AK4A 4DIOA 3INRA 1O9BA 4R9UC 2BDPA 2Z56A 3QEMB 1U9JA 2XUPA 4JDUA 1I2BA 1NJZA 4GYYA 2XB6A 4BLVA 2X8BA 2AFIA 1NYRA 4OP3A 3MR6A 1EUDB 1WF3A 3S1AA 3P5BA 2JARA 4IHJB 1V3VA 4Q3NA 3ULKA 1TE2A 2IOFK 4PYLA 1Z15A 1TLFA 1O6FA 4CEJA 2VG6B 2A2DA 4KV9A 1VHFA 4A26A 3PPIA 4BQFA 6CHYA 2CNBA 4LZZA 2FDXA 1CUEA 2BBEA 3H25A 4YNBA 4TTPA 4DV0B 2DFLA 1K6XA 4XYEA 2FN8A 1TM4E 2P77A 3AKEA 4U8HA 3THYB 3PHBE 1VQ6S 3RK1A 1QWIA 4HVAA 2XM3A 1QG6A 1I7QB 4JL5A 3UMFA 1ZUNB 3U4CA 3TOXA 1EQ2A 4H7HA 2VDRB 4TKUB 3MPUA 1N8RT 3ZQ6A 4E07A 3QSIA 2YHBA 4GOOD 4U00A 5FCDA 5LB4A 4KNWA 3JQ6A 2HUPA 3D7SB 2HEGA 5TX7A 2MTBA 2LGJA 2W71A 4FFBB 4DG5A 3KXLA 2YS6A 1VPLA 2FLOA 3IR7B 2FHJD 4XWWA 4B4OA 3CNLA 3HV0A 3RAJA 4K0RA 4Y0FA 1MG7A 2VDPB 5C32A 1C7RA 1OIWA 1X9GA 4LXTA 2FPRA 1XRNA 1RY2A 2XUJA 1YKFA 2C2NA 1P7CA 4GC6A 13PKA 4ZQEA 5KFGA 2BGMA 1M5VC 1JRLA 4QGGA 3DLLQ 1TKTA 2QSWA 1ZCAA 4RW4A 2YOHA 1L1RA 4JI8F 4ZIRB 5CIYA 1QGUB 3TAPA 2O07A 3GLGB 5JAZA 1PX2A 1H1TA 3INTA 4JFAA 4AWBA 3KCNA 4EFLA 1R89A 4MVCA 2GN6A 1LPMA 2DWUA 4WF9Q 1D04A 1KK2A 4PZCA 2IH4A 4Z8YA 1FY2A 2NO1A 1BMFA 5ARDA 2VPZB 2OK8A 4F8YA 2H92A 4RIGA 4TQ9A 4ZRMA 2J7KA 4X63A 1HBUB 4QULA 1LVUA 3V8MA 2AV6A 5E6UA 2RIJA 2EXXA 2V9ZA 3WK9A 2DRDA 1HDXA 1ORRA 1Q2UA 1I3NA 1CT9A 4EJFA 2W7AA 5GY7A 3A9WA 2PUAA 2LTAA 1JJVA 3STTA 3GD5A 2J9FB 4ZVSA 1B7FA 2QPOA 3DCAA 1M6WA 2PXAA 3HKBA 1MPXA 4IIGA 3KZKA 4L4XA 4WA8A 2G0IA 5EP1A 2FZKB 3ZHSA 1IRXA 3NVMB 1H2RS 3QIVA 3K70B 4HUTA 1FJCA 3MWJA 2XYHA 1D2EA 4BFVA 1E6KA 1GTJ1 1YCDA 4OM8A 3QQPA 5ETTA 1WXWA 4XO0A 1U3GA 4EKYA 3WADA 4FE4A 1E3MA 2KB0A 4O3OA 3M1AA 1E3JA 3S2IA 2GERA 3SO4A 1X60A 4TYWA 1HZZA 4QUGA 4DIUA 5KTYA 4IO1A 4B3MB 4PC1A 4RV4A 3VAYA 1KSFX 2P2CB 3M34A 5CFZA 3HB0A 4OL8A 4NYPA 4G1QA 1YVDA 3PR5B 4Q4HB 4U2GA 7REQB 1SD1A 3N6VA 1LNZA 1GZDA 2X8JB 5TC4A 1SIWA 2N42A 4LFAC 3QKSA 4BBYA 3W2VA 2NT3A 4YB5A 4RTPA 2YNHB 2C97A 4CTMA 3J7ZT 2IUEA 4CIDA 4R54A 3NR2A 1RJFA 1IJEA 1CJVC 3LP2B 4B0PA 4TYPA 4L6CA 1EDBA 5C81A 1MJFA 3LOQA 3HJTA 5FWYB 4C5AA 3GFHA 4DLGA 2FPPB 3CNNA 4DOZA 2AFHB 3NL0A 2J3IA 3NIBA 3CR7A 3CW9A 1SKUB 2PT7G 2DWCA 5G2OA 4IDEA 1EFCA 4JI0B 3C45A 4U67Q 2NUTA 5I4KA 4BSZA 2Q1LA 3NBPA 3IMQJ 4PIPA 5CFNA 4QKQA 2C2DA 5CA0F 4Q8EA 2JI7A 1JBEA 4R5PB 2DH9A 1GVHA 2AQIA 1YSJA 3RRJA 2FQ1A 4XGKA 4O4HA 4Y6PA 5HKKA 4B6FA 3HI9A 3CCRS 2AFRA 4Z7NB 3EWSA 3P27A 4XFJA 3R3UA 2EU8A 4O3SA 2HCJB 4IWNA 5BRAA 1HLFA 3U4QA 2H54B 5BYSA 2WVDA 1E79A 2GDZA 1RTIA 5J3JA 2AG5A 2HEKA 2OY0A 4CLDA 2C7BA 1QO7A 1E7MA 3P7MA 3O44A 4QJIA 2B2NA 1GPKA 5F78A 2X13A 1SJ4P 1HLGA 2DUWA 2MYFA 1JEDA 1YU6A 2HCBA 4TUYB 3OJCA 3WX4A 5F7ZA 5LD2C 4N7JA 2MPUA 3NOVA 2B4KA 4BEVA 3MEDA 4IV8A 2UXDB 5A2QU 3CRNA 3LT2A 2UVUA 4DHEA 1ARZA 3SVTA 1BH2A 2XWBF 3LLUA 5DNWA 4WFYA 2R1ZA 1NIJA 3DH0A 3PYMA 2OILA 4OD0A 3MEGB 5K3FB 4LT6A 5F2OA 5E2IA 4DR7J 2AH5A 2X15A 2XWYA 2BE9A 2VA8A 4H59A 5GVQA 2G4LA 1FRIA 3D4JA 1X0FA 1RE1A 4OQQA 4V0ME 3CLTD 2G17A 4RF4A 3IM9A 1YTLA 2BI8A 1L5KA 3NLLA 4BKRA 5IC6B 2VLIA 4G5QA 4PX9A 1U25A 1ANKA 1PEKE 3LD9A 4HB3A 1I5OB 4XW2A 4CKZA 2EDAA 1EGVB 3UENA 3L82B 5EWLA 2SKEA 1AQ6A 1OI2A 3QX7A 4X1KB 1KMNA 1QRUA 2JL1A 4QUAA 3HS3A 4U6SA 2F43B 3B78A 5B0CA 4G5FA 2R8ZA 3A8EA 1SQ0A 3KU4A 5CEEA 4ID5B 1ISJA 3P9KA 4QU6A 4D5EA 4PQAA 2PFSA 4DLYA 3R9WA 3CLRD 3PGMA 1V1RA 5KOIA 2LCFA 2HG4A 3TXYA 4CZCA 1M5UA 5FH9A 5A1TA 4HHEA 4I5EA 2IEDA 3IB3A 2J9EA 3DAGA 4V3CA 1HRDA 4OG2A 4XX0B 1VK3A 1DIAA 2ES4A 3K70C 1HOXA 2L69A 4QVKA 1VLHA 1R4NB 3SYLA 2Z4TA 3T5PA 3W9UA 2WIBA 5CLHA 1HWJA 2Z58A 2C2WA 1N6LA 3G2JA 1O1YA 2CFXA 4KQIA 1WDLA 4OJMX 4JJZA 4I6YA 3K32A 3F98A 1VCNA 3HVTA 4OF4A 5HMZA 1PJLA 1DBDA 2FGOA 3ZDZB 5ALKA 4I4BA 2DR2A 1P27B 3O3OB 1V8DA 2ZZTA 2F59A 1X7XA 4OP2A 5K9FA 5AFSA 4RNNA 3QEAZ 1ISIA 5EZYA 3OUYA 1RA7A 1LSJA 4NLSA 1H94A 3NGLA 4ER0A 3OEHD 3L92A 2B9YA 3UE2A 3NT5A 1FTNA 3WGZA 2NYUA 4KV7A 4XQ9A 1JSCA 2DYKA 3RFXA 1RT2A 2V0CA 4JBIA 3B1YA 4I7EA 5DCWA 3GT7A 1PJ4A 3FHJA 3LUYA 2OH2A 5K3OA 4EG4A 3KPJA 5H83A 2HF9A 1XJ5A 5TQJA 3WGHA 1DKUA 4WCFC 3GLUA 4HL9A 1NRJB 3RYFA 4M36A 5KPJA 3KPYA 4JI3F 3WYFA 2LVBA 3MJVA 1WLSA 2RAPA 2ZE5A 3VVMA 5F7JA 5BMOA 2JIOA 4F11A 3HUFA 3D8RA 1GRRA 4Y6RA 4N56A 2QE5A 1LK5A 1PDVA 1G60A 1YO6A 3UUGA 4PEVA 1UANA 1JG2A 3N53A 3WG9A 4EBEA 1OXSC 1JX6A 2PH3A 1NMQA 1IQZA 2BW0A 3ODPA 1CBUA 3KQSA 4DV3C 4C4AA 3RC3A 3CLUC 1Q7CA 5E9QA 1ZAKA 4K2JA 3LXRA 3GXBA 2C78A 3AFGA 4O8CA 2XMPA 2ZSDA 4Q44A 2WOOA 1TMGE 2P9GA 5KG6A 1LPBB 2JGJA 3OA2A 1PEDA 3W9HA 2IDZA 1FFCA 3PFBA 3ISND 1Z6QA 4B7CA 2XMWA 3JSAA 1FSPA 1N2CB 3FIJA 3QWUA 1F17A 3O1JC 4DB2A 2KRRA 2FSUA 1VRCA 1IBKF 2H59A 3SK0A 3FPSA 5TQ2B 1USWA 2RHBA 4IRKA 1CIJA 2XAAA 2F8EX 3JS5A 3RGIA 3MM9B 1S3SA 4UTPA 1U02A 2JFZA 3DE2X 1BXGA 1H72C 3WMGA 3V7NA 3JATA 3HL0A 2QD1A 2CLFB 3NNDA 5JW6A 4FNIA 4LX8A 1A7KA 1C1DA 1U11A 3SJUA 2J41A 1Q53A 2DIVA 4Y2GA 1F9FA 1U2DC 3CZRA 3RIYA 3B1VA 2ZBIA 4R1NA 4QYTA 2ZRDA 3JVDA 3S1TA 3H84A 3JYPA 4F26A 2HQGA 4DPLA 2JGIA 4UZFA 5B3AA 2BQRA 5L1KA 2HLHA 4PZLA 1YJWS 3UHPA 4C3VA 4MVJD 4ZFNA 1G7CB 3AB8A 4GP6A 4GRIA 4RMJA 3S2FA 3WTBA 4ZVEA 1UKBA 2YJ5A 1UBFA 4URHA 2PYIA 1NNLA 1TUEA 1QMGA 1NF3A 2ZBDA 4HS9A 1NZFA 3NHUA 1GK8A 4JKYA 4H17A 3J80U 1VP9A 1SBHA 4R1SA 1IM5A 1NHWA 5TMPA 2C2MA 1JWAB 2K7JA 3HJFA 2AE1A 1P1BA 1QFSA 4HF7A 1Z35A 4WESA 3KOAA 2FZVA 3RVPA 2DTXA 1MIOB 2P67A 2C0CA 3FYUA 2PGDA 3OBBA 4F06A 1WMSA 4XGIA 3HJBA 5AM0A 2H2IA 3PIRA 1JH9A 3T1HC 2GBLA 5EC8A 4C0WA 1TDJA 4ZPVR 4Q3BA 2J6UA 4RCYA 3PNVA 5K4GA 1EXMA 3TLKA 1TH5A 1BD4A 2YUTA 3B6MA 2MSKA 4TMXA 5IYZF 3A9VA 3CJKB 4BUCA 1X8DA 3CJQA 2PEYA 2IM0A 4QTTB 4LF9F 5HJ2A 3RW9A 1ECBA 3Q83A 2ZI9A 3QIPB 2QTWA 2XGPA 4W4MA 1YIAA 2CY1A 1B42A 3AJEA 2BXJA 5I9TA 1X8XA 2JGAA 1OJLA 1C2PA 1PQYA 5AKJA 2D41A 1EHCA 2H65B 5F1KA 5E2AA 1QH9A 3BH7B 5HCUA 2ZI4A 1CVJA 4ARVA 2VPQA 1R74A 1E98A 3IXQA 1LLFA 1YG0A 1PJAA 4JSRA 5CTJA 2F67A 1D0IA 1Y3BE 1UEUA 4UREA 3EOZA 2HMIB 1G1AA 2XR1A 3PQ5A 1ZCJA 4PR6A 3CSSA 4ICLA 1OAKA 2MKYA 2Q0HA 5DHTA 1NBOA 3BGFA 3SSNA 4P93A 2Q4EA 2WAYA 3RVLA 3IESA 3GARA 3G8CA 1E4YA 2I1LA 3GEBA 2ZTSA 3R7DA 3QU5A 4HDRB 1LW6E 2W7TA 4DEXA 3VISA 5KHAA 3QTBA 4YWJA 4OYBA 4BECA 3H05A 2IZ5A 4RC9A 3UMMA 1UPPA 4DYDA 5FLKA 3HVTB 2GNKA 3OCZA 3N7UA 4YREA 2DLDA 1OTXA 4PPZA 1S1WB 2UXCF 4M0MA 4E22A 3U1NA 5AO9A 3PXGa 2KSQA 4YRDA 5TJ9A 3DGVA 5B7PA 3KVNA 2O2HA 1ETUA 2Z3VA 2RG1A 3MCVA 5HO4A 4GMKA 1NF2A 4FZ3A 5T4FA 1GNKA 1PBNA 4B4VA 2CVQA 2B5VA 2FX2A 3Q2IA 4EPYA 4HFRA 3AR9A 2QE7A 2R87A 1F2DA 3SFGA 3V4IB 2HMIA 2FEAA 1PC4A 2I54A 3GONA 1QZXA 2CW5A 1B0VA 1WD5A 4YV2A 2J0QA 3PQ6A 3DQZA 1QO0A 2ZYUX 3HABA 4F3RA 2IJFA 2W6CX 3IILA 3B6ZA 1SN7A 2KE5A 2A86A 5TJHA 1AHPA 2JGLA 1RAFB 3T7IA 4L73A 5BOVA 4LF6B 5E4YA 5ADZA 3OY7A 3B38A 3ZJVA 1L7EA 2GA8A 4JXZA 5BRNA 1XX6A 1UPXA 3JCZA 1CZKA 3RVJA 4ASUA 2DGDA 3C3PA 3IP1A 1WEXA 5HBGA 5LA6B 3U4IA 3LX4A 1O9TA 1KC3A 4JUDX 3ZDRA 1KNZA 3G8TA 3T3OA 1J6UA 3OQIB 4WNAB 2CXPA 1CB0A 2QE7D 4MYRA 5I9LA 1N1MA 4NFYA 1M1NA 1DFHA 5AXMA 4LJ4A 3A1WA 5JNVA 1NXVA 1ADGA 1U8SA 3R1HA 3HU5A 1DTWA 1NHKL 1XCPA 1DUIA 4DS5A 1I2CA 3FTFA 1AF7A 1R4AA 2Q43A 4PR3A 2H48B 3N87A 3W7VA 2OPSB 3II6X 2DD8S 1YZUA 3EXHA 3VAZA 3AB7A 3HNOA 1KZ1A 1UW4A 1U1NA 2QG9B 1FJXA 4WP3A 4C2BA 1IQUA 3T1HJ 2GBFA 4FFPA 3CKLA 4WP8A 3MS7A 4J1TC 2RB5A 5E4FA 3A1DA 3L6OO 4PXCA 3JQGA 3X44A 3F3MA 4KH0B 4X20A 3ZI0A 3KJEA 1YT5A 2EEZA 3RW6A 2FOXA 1AROP 2R751 1QLHA 2HIQA 4F91B 5LZ2A 2Y1KA 3KYIB 1YB2A 3TGPA 1KEEB 1PD0A 1KLMB 2CG4A 3QSYA 4J9OA 4JSTA 1GZ5A 4WZAE 1DKNA 4S04A 1D2AA 4X24A 2SCUB 4DILA 2KDNA 3GU0A 5KVVA 2YFKA 3FOBA 4E30A 3F6PA 4WKCA 1RLMA 3KQKA 5FUXA 4HR2A 3QGIA 2BGWA 2HF7A 4EKGA 3QFWA 3U7JA 4RLSA 4RD3A 2GQQA 1A6LA 1TCCA 2VK8A 3DE1X 3BL6A 8AT1A 3RKUA 1HQEB 3SZMA 5AM2A 3O4VA 1RWNA 3Q12A 1YI0A 1HHTP 2DBYA 4E32A 3PSAA 1YZ6A 4PWDA 1P74A 3SJAA 4FDVA 2NTEA 1N34C 3QNWB 1KDTA 2QYCA 3FRJA 1AK1A 4X85A 3T4PA 3ZFVA 2XZDA 5DBIA 1DG1G 1ZD4A 2A18A 1DJQA 1JGTA 1U2CA 3VSAA 1Z38A 2E4WA 3R5JB 3PX3A 5BMVB 4DWWA 3LFTA 3IAM9 2XMTA 3FFBA 3DOCA 2XTJA 1KK0A 5DK6A 5IFIA 4N8SA 2B3TB 3DD5A 3PUJA 3K5WA 1U90A 5I4BA 4MVJF 2FQQA 3K05A 3GJ7A 2Z4SA 4YJ3F 2QLJB 2A30A 4BX8A 5I42A 1QYRA 4BMSA 5HK9A 3FYCA 1DRKA 2Z2MA 1CS0B 4IH9A 3ZZ1A 3EZLA 4W63A 1AUDA 5LBTA 3VDNB 1K5PA 4DRXB 1FUKA