2ZZNA

The complex structure of atrm5 and trnacys
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
336
structure length
336
Chain Sequence
b'MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0883
molecule tags Transferase/rna
source organism Methanocaldococcus jannaschii
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
pubmed doi rcsb
total genus 81
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zznA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zznA03
3V97A 2E5WA 3FUWA 4KRGA 4CKEA 3C6KA 4PCAA 4ER5A 1AQJA 2XYQA 4RTKA 1VLMA 4RTMA 1P1CA 3UJDA 3DXZA 3T0IA 5K05A 4MIKA 3BGVA 4WVLA 5D1NA 5DLYA 1R00A 2ERCA 4HC4A 2B3TA 3TRKA 4A6DA 3KQVA 1L1EA 4WXHA 2UYHA 3NVMB 5E9WA 1D2CA 3AWIA 3NTVA 4KDCA 3D2LA 4PWYA 1G8AA 5T6BA 3VYWA 3M70A 4KW7A 4XCXA 4RWZA 3GO4A 5GP1A 4RVDA 3LCUA 4MTLA 3SMQA 5C9ZA 5LQNA 4Y30A 5JUWA 2YX1A 4IWNA 4PGGA 2OPBA 4YV2A 1RJGA 3KHKA 3P8ZA 4X60A 4Y2HA 3KPVA 2QM3A 2PT6A 3MCZA 1KXZA 5FTWA 3OU6A 5LQCA 5DWQA 3ELYA 4QTTB 5C1IA 5EEGA 1BHJA 3KQPA 3LKZA 5CIYA 2I9KA 3TOSA 1WG8A 1D2GA 3DTNA 3CJRA 1P91A 3P71T 5GM1A 4DCGA 3HA3A 2CWWA 4BP1A 1EJ0A 5E9QA 5DXAA 4EKGA 4YV0A 1RI3A 4RTPA 3LBYA 3FRHA 1QANA 4OQDA 1JTFA 3A7DA 3EGIA 3BUSA 5KYGA 4PYKA 4DZRA 3JWGA 2QRVB 1EAMA 2WA2A 3M33A 3U81A 3UJBA 5EIWA 2YVLA 3CVOA 5E2BA 2FRXA 3G2QA 4R8SA 2ZULA 4DQ0A 3DXYA 2ZBPA 3P9KA 3EVCA 3R3HA 4R8RA 1ZGJA 4C06A 1R18A 1YFLA 1NBIA 2AN3A 3E8SA 4OBXA 4FR0A 3MTEA 3KPUA 3OCJA 3O4FA 1VIDA 3VC1A 1G6Q1 4CXMA 3CGGA 4QTUB 3A7EA 4QQNA 4V0RA 1RI5A 2B2CA 3UFBA 3UJCA 4OA5A 2ZTHA 2Z6AA 5DTRA 4YMHA 4NECA 3GJYA 2JH8A 5H02A 2V74B 1JQDA 2CMGA 3OFJA 3KQSA 1NW6A 4XUEA 1N7JA 3HA7A 5DSTA 5LQKA 1M6EX 3KQWA 4FT4A 4EK9A 1G38A 4P58A 2OKCA 4PYNA 5EKUA 3G5LA 3KQYA 5K0JA 1SG9A 1WY7A 2B9EA 2NNWB 3BZBA 3DXXA 4IV8A 2YR0A 4F85A 2GH1A 4MQ4A 1L3IA 3B3JA 1X1AA 2ZIFA 1I9GA 4GUAA 4QVGA 5ERGB 3HVHA 5LSAA 2I62A 2ZIEA 3G8AA 1Y8CA 3LCVB 2FCAA 3PB3A 4PYOA 4KIFA 1SUIA 4IV0A 5EZSA 1VP9A 2G71A 1INLA 2EFJA 5DX8A 4EVIA 4FT2A 2HNKA 3PT9A 4CKBA 10MHA 1I1NA 1TW2A 5F2NA 5EMMA 2OBFA 1KPHA 2HTEA 1G60A 4FSDA 2IIPA 3HEMA 1V39A 2OO3A 1NW5A 5BW4A 4AUKA 1QYRA 3DUWA 2DPMA 2I6GA 3C3PA 4PIPA 3T7TA 4C4AA 4E2ZA 1T43A 3FPHA 1NW7A 3IHTA 5CUQA 1SUSA 3EGVA 2CMHA 5DPMA 3UA3A 5LQJA 1M6YA 3G5TA 4C08A 3OZTA 2BH2A 1RI4A 3EMDA 5EC8A 2UYCA 5ICGA 1PRYA 2PT9A 2HR1A 2H00A 1P1BA 1ZKDA 1JQEA 2HMYB 1EG2A 2YUIA 3E05A 1JQ3A 2PX5A 1KR5A 3I58A 3ME5A 3UJ7A 2NXCA 4LG1A 4C05A 3PVCA 2DULA 2P3QA 3L8DA 3A26A 4PYLA 5C0OE 4EQZA 4HH4A 5BW5A 2OY0A 2O0LA 3IV6A 3RODA 4POOA 3I9FA 4YUVA 3NVKI 4LECA 3LDGA 1VBFA 3FZGA 2Z6QA 2GS9A 3RIEA 4C07A 4HGYA 3FPEA 3GRYA 5K0EA 3G7UA 2F8LA 3TLJA 1DUSA 3LCCA 3EVAA 2ZWAA 1IY9A 3FUVA 3OZSA 4PIMA 3I53A 4GBED 1KHHA 5DTMA 5CCXA 1ZG3A 2ESRA 4M36A 2H1RA 4RV9A 5DM0A 2PY6A 4LWPA 4QQKA 3MHTA 2VS1A 1KYZA 2CL5A 4OA8A 5EGSA 4DM3A 5E2AA 4RX1A 2EJTA 4O29A 3KPWA 1VP3A 1DCTA 3Q7EA 3TQSA 1WXWA 2VDWA 1KP9A 3SVZA 1JTEA 2K4MA 5DM2A 5FHRA 1JR4A 5MHTA 4DA4A 3DOUA 5HFJA 2B78A 1NW3A 3MAGA 3SGLA 1U2ZA 3DULA 2BR5A 5CVVA 4DKJA 2PSSA 4E2YA 4YUYA 3B3GA 3DMFA 3ELWA 3H2BA 1QAQA 4AZVA 4R6XA 2Q41A 2AOVA 3FUTA 2P35A 3JWHA 5EOVA 4C03A 1MJFA 2PBFA 1Q0SA 3CJTA 2AVNA 2C7PA 2PXAA 3NWBA 1EQAA 4KIGA 4DMGA 3AJDA 3KPYA 1JSZA 4M38A 4EMSA 3OFKA 3G88A 2Y1WA 1NV9A 5BP7A 2BM8A 3LSTA 3M6XA 1N7IA 3JWJA 4G56A 5DRYA 3JWIA 3EEYA 4GOMD 2P7HA 3X0DA 4UOEA 3G89A 4P7KA 3AY0A 1XDZA 5GIOE 4BLWA 2WK1A 2C7QA 4E31A 2PLWA 3HCBA 2R6ZA 4KWCA 4RSRA 3TKYA 4AZTA 8MHTA 3SXJA 2IBTA 5FWDA 3FUUA 4E30A 4ER6A 3NMUF 1H1DA 1VPTA 2FYTA 3B89A 5E9JA 1ZHFA 5E8JA 2CKDA 3HTXA 3BXOA 5KQRA 2O06A 2PX2A 3KQOA 3QOWA 2ZW9A 1D2HA 4PYJA 3OU2A 1R74A 2PJDA 3HNRA 4FZVA 2OXTA 2NP7A 2AOTB 5ICCA 3KKZA 3K6RA 1L3BA 1SQFA 3NJRA 1RI1A 3BWMA 1FP2A 1O9GA 4K6MA 2IDKA 3EVZA 1YB2A 4ISCA 3ER8A 1AV6A 2KW5A 2ZLBA 1YZHA 5FHQA 5HIMA 4AZSA 4PYMA 4RVGA 4PGHA 5K0NA 3TMAA 5LQRA 4X61A 3UWPA 1HNNA 3KR9A 3DH0A 3PTAA 3PS9A 3FUXA 5BXYA 3PX3A 4RTSA 3HM2A 1R8YA 3TFWA 3ELDA 1NT2A 1UIRA 3P9CA 3KQQA 2YXLA 1FP1D 2XYVA 4E33A 4GF5A 3UBTA 2JJQA 4DF3A 2ZZNA 1QZZA 3PFGA 2P3OA 4RVHA 2Z6UA 2R3SA 2XBMA 2AOWA 2XVMA 3GIWA 2G72A 4F86A 5K0FA 4RTQA 1RI2A 5ICFA 3DMHA 3IYLW 2AOTA 4QDJA 4BP3A 2BR4A 4GOOD 1AF7A 3LDUA 1NW8A 2JHCA 1QAMA 5K0LA 3KPJA 3I5UA 1L9KA 3K0BA 4QPPA 4KVZA 1XCJA 5FA8A 5FCDA 1WZNA 2OZVA 2VP3A 2ZVJA 3M4XA 3WSTA 4QPNA 5HIKA 5U4XA 3ER9A 1O9HA 2LD4A 1YF3A 2PGXA 2GB4A 2PWYA 2ZBRA 1HMYA 3CCFA 4JXJA 4PYIA 4RVFA 2ZZMA 1BKYA 5DX0A 4PYQA 5EMKA 3G2PA 3P9IA 4AZWA 4DCMA 4U7TB 5K0GA 3FTCA 3HA5A 1BOOA 1YUBA 2IBSA 3AXSA 3P97A 3OZRA 2P41A 2VZ9A 3LKDA 2QY6A 2XVAA 4U7PB 2I7CA 4PONA 3SM3A 2EX4A 2AOUB 1ORHA 3O7WA 5HIIA 3R9XB 5DXJA 5FULA 1NV8A 2AN4A 2VDVE 3KQTA 3SSMA 3BKXA 3UZUA 4E32A 3DR5A 9MHTA 1ZQ9A 2C7RA 4FSXA 1XVAA 2YQZA 2IFTA 2QYOA 4V0QA 4L7VA 5K09A 2NP6A 3QV2A 2P7IA 3EVBA 5GIPE 4B17A 1VQ1A 5DRTA 3T7SA 3GRRA 3SX0A 5HOQA 2UZ4A 3BGIA 4HG2A 3RW9A 1R8XA 4CWAA 4YUXA 5CVEA 5IH3A 3M6VA 3LL7A 2PVCA 3QOXA 5CCBA 2ZIGA 2B25A 3M6UA 4FGZA 3A4TA 3LDFA 2XYRA 7MHTA 4R6WA 3DP7A 3OE4A 3C0KA 2JHPA 2ONYA 4IKPA 5CVUA 1WXXA 1N2XA 1X1CA 2N47A 3GU3A 1RJFA 2GLUA 4FP9A 2AN5A 3EMBA 5EMJA 1F3LA 4M7RA 3GWZA 4EKIA 1M0EA 3OU7A 4X1OA 3UJ6A 3R24A 2P40A 1DL5A 3GCZA 3HCAA 2AOXA 2ZSUA 3NW9A 3NWEA 5F2KA 4MHTA 1FPQA 1XTPA 3CBGA 1XDUA 5LQAA 3G2OA 2P1DA 3HVIA 3EVGA 3EVEA 1B42A 2FHPA 3KR0A 4HRAA 4ATNA 2A14A 4CTKA 3P2EA 1KPGA 4FS8A 4XUCA 3FPGA 1RJDA 2O57A 3BWCA 3HCEA 5K0BA 3R0QA 2YXEA 3EVDA 2AVDA 2AS0A 1JSXA 4E2WA 3NDJA 2IGTA 5G02A 2AZTA 4YV1A 3SSOA 3GRVA 4PCLA 3VSEA 4OX9Y 2HWKA 3ANXA 5EPEA 5EQJB 3E7PA 5CD1A 1EIZA 2ZWVA 4RTNA 3Q87B 4GOND 1Z3CA 5DX1A 4GOLD 2UYOA 5FWAA 2V7EA 4A6EA 1VE3A 4GC5A 5K03A 2HV9A 1X19A 4GC9A 5DM1A 3CC8A 3ORHA 4ER0A 4CTJA 1FJXA 5EHIA 2PX8A 4C04A 1L3CA 2C7OA 3BWYA 2FK7A 2NXNA 5T67A 4CKCA 3TR6A 3ELUA 2IPXA 5LR6A 3LGAA 4X41A 1AQIA 1JG3A 2IP2A 5DT2A 3E23A 3ERCA 4PINA 3PLAE 3P2IA 2O05A 3LX6A 5GM2A 2JG3A 2AOUA 3THSA 3FYDA 3LECA 5GOZA 3FPJA 4BLVA 5K8VA 1O54A 1MHTA 3VC2A 3A27A 4YUZA 3EEOA 3BGDA 1SVUA 2PX4A 1UFKA 4LWOA 2FPOA 1X1DA 4OBWA 5E1BA 3GDHA 5HIJA 2Y1XA 1EJ6A 3MTIA 3HCDA 2PXCA 3LBFA 3MERA 1JG2A 3R6TA 3TM5A 2NXEA 3S68A 3SR4A 5ICEA 2ADMA 2P8JA 2EG5A 2PXXA 5E1OA 3DMGA 3LHDA 5D1HA 3UJAA 2OB2A 3GGDA 3TPZA 1IM8A 2H11A 3C6MA 3UA4A 4YUWA 1YFJA 2YXDA 3AXTA 4RTLA 3M6WA 3FPFA 4YMGA 3FTEA 4M37A 2FK8A 1QAOA 4OQEA 1G8SA 3GXOA 5EZQA 4R05A 1XDSA 3FRIA 3FYCA 3GRZA 4GQBA 4HSGA 4P7JA 1ZGAA 3B7PA 3TKAA 4RTJA 2P3LA 1XXLA 5FQOA 2GPYA 5FUBA 3V8VA 3KQMA 3FTDA 2G70A 1KIAA 2QRVA 5K0CA 5EKXA 5HEKA 3SSNA 1SKMA 2ZCJA 4X63A 3I64A 3NDIA 3CJQA 5E8RA 2PKWA 5CM2Z 3KR1A 4BLUA 3OE5A 2IDJA 2GAFA 2NXJA 2ZZKA 1NE2A 2O07A 3B5IA 3P9NA 5DTQA 4RYLA 1SQGA 2BZGA 2PWPA 4HGZA 2ZBQA 4HTFA 4ER3A 2IH5A 3EVFA 3REOA 5EIFA 1KPIA 1F38A 3DLIA 5GINE 2G1PA 1I4WA 2G8NA 5HZMA 1G55A 4E70A 3P2KA 3CKKA 3IEIA 3EGEA 2JHAA 3BKWA 1P39A 3MCTA 5DM4A 2QE6A 5F2OA 5FQNA 5LQUA 1Q0TA 1JG4A 5CVDA 5DSXA 2OYRA 2GA9A 3G8BA 3HP7A 3HVKA 4P7GA 2BM9A 1TPYA 2BR3A 2OB1A 2IH2A 1FBNA 3B3FA 3GRUA 2VDUE 1OR8A 1ORIA 3C3YA 5B1SA 3UJ9A 3UJ8A 5KQSA 4P7FA 4XUDA 4PNEA 3G2MA 3HVJA 3MQ2A 3MGGA 4QVKA 3TM4A 1IXKA 1YZ3A 1WS6A 3BWBA 5M5BA 1UWVA 3DLCA 1KYWA 3EPPA 5HILA 3LPMA 5GWXA 4F84A 2PV0A 1NBHA 3MB5A 4AX8A 2WA1A 4H0NA 4KDRA 3THRA 5IKMA 4GEKA 3KR2A 5FA5A 5JR3A 4E2XA 2ZFUA 4RTOA 2YTZA 1XCLA 2AR0A 5E1MA 1R6AA 3OPNA 5T64A 3KU1A 3HCCA 1JG1A 2UYQA 3GNLA 4QDKA 2IH4A 3F4KA 5P8WA 4ER7A 4RTRA 3T7RA 3PFHA 3A25A 1XJ5A 2EJUA 1NKVA 4ZTBA 2NYUA 5CVJA 3PX2A 3BT7A 2ONZA 5KVAA 3FTFA 2ORED 5FADA 1PJZA 5EG5A 1TW3A 3O31A 1VL5A 2JH9A 4HTFB 3ID6C 5EMLA 5K01A 3HCFA 5KS2A 4Z2YA 5EVJA 5E1DA 1RJEA 1BC5A 5EHGA 5EEHA 4MWZA 1X1BA 4BY9E
chains in the Genus database with same CATH superfamily
2V68A 1LCIA 2PMFA 3VJRA 1KBOA 3OX4A 3A1YG 3J81k 2PPVA 2VBYA 2FP4A 2ZUSA 4HUJA 1H7WA 2QFIA 1VKJA 1UEUA 2J3EA 1R8PA 1FPMA 1J9GA 5CK4A 2UVVA 2EFDB 4LN1A 3NGLA 1RI3A 3OTCA 5BN5A 3BERA 2VPYB 3DD5A 3ICLA 2B5JB 5EWEA 3U81A 4R71A 1Y89A 2VA3A 3T9EA 3OF5A 5LZ2A 2AQ4A 4CTMA 5HUJA 1VLAA 3A6PC 4DR6C 1PFWA 3DZIA 1ST2A 1EEHA 2C2GA 2A78A 2Q9CA 3BZWA 4OH7A 3PT5A 1EK1A 1PQYA 3ZXYA 2ZIFA 1GPH1 3DRRB 4I1UA 3TQIA 1WF2A 3DCNA 3O2EA 1VSBA 3R76A 2JEZA 3EDQB 3MJRA 1D4AA 1TA0A 2HYDA 5E4FA 2UVDA 3EGVA 1E7MA 1Z4IA 4OUDB 1P1FA 1NZ8A 5BN1A 4RPGA 4UAJA 1NK5A 4ISBA 4PRYA 5E3QA 1FUEA 4WKBA 4L51A 4H3HB 2QTVA 2CXPA 3HF5A 2XXBA 3DMPA 2V8VA 3FUVA 5CCXA 3PLRA 3S7TA 1SJFA 2H1RA 3POTB 3PD0A 1QNLA 4NMLA 3H6HA 3HKCA 2HLUA 2WU4A 3MF5A 3NDPA 3C7AA 3K8YA 1VISA 4NFHA 4F4XA 3T4EA 2ZQYA 1J5PA 5CVVA 1UCNA 1G21B 2EK1A 3IEUA 4GBGA 1S2NA 4HNQA 5F7OA 1F9HA 3BGUA 5A2GA 3U49A 1MC8A 4IXDA 3TTUA 3G0CA 3K0EA 2IU4A 4M1YA 4NHOA 2LQ8A 3MFQA 2PKXA 2ZXEA 1YL5A 1HZZC 4ABTA 5AM2A 1FRMA 3WBFA 2NS1B 3K6RA 3MCMA 2DVIA 1JQGA 3UMGA 5C42B 2AX4A 2YWDA 4K6MA 1T8YA 3Q5DA 4NNJA 1VCOA 2XGGA 4E5MA 5A6VA 4MFBA 1A8SA 1AS0A 3O4IA 3V8NA 1YQDA 3C3EA 3TFWA 4HLBA 3H0CA 1M8JA 1UBUS 1P4HA 3AF0A 3Q8QB 4O4GA 4O02B 1YWXA 2D3ZA 1OLXA 4PZVA 2NZWA 4C30A 3EMVA 1V35A 4WNYA 4UUWA 4G9EA 5T4FA 2BH9A 4ALZA 2OAGA 2YQ3A 3F90A 4RD2A 1DC4A 4I4LA 5F41A 1YKFA 5ENVA 4GNRA 2Y67A 1Y9EA 1E9EA 3ADKA 4N5NA 2CXOA 2ZANA 1Z2ZA 3TLMA 1ORHA 3BQ2A 5CX4A 3O9MA 2W4QA 3N2QA 4RKQA 3ZWWA 4B4OA 1UT8A 4B17A 5FR2A 3FEXB 4EW6A 3ITEA 5FPTA 1G8MA 4C4XA 1K2WA 3FKSA 5IKXA 5CVEA 4P34A 1N5DA 4IKPA 2X6QA 2B7LA 1E5XA 5HVNA 3R3ZA 1N6KA 1NFFA 3MILA 5CLQA 2R7XA 3G82A 5MDHA 3OTWA 2I8CA 2DKNA 2EBFX 3LY9A 1B0VA 3A1WA 4FGJA 5G02A 2J7PD 2QSUA 4WDRA 5COBA 3EE6A 3NP7A 1V4VA 4NE2A 4DANA 1LV7A 3TD9A 5LUAA 1LFAA 2CXXA 3MDFA 5FRDA 3QPVA 2H2GA 1SHZA 3HJBA 4WKNA 4JNKA 3J7YI 1UXJA 1KSHA 5ERXA 2FC9A 4HB3A 1QHIA 4LY6A 3V81A 2CSXA 4IW3B 3SR4A 1WB6A 2A6OA 1TRKA 3FTQA 5SV2A 1U90A 4JZKA 1JEDA 1LJUA 5KTQA 1DFHA 4DV4J 3D67A 3GRPA 1JA0A 5FUBA 1Q3HA 1TKZB 2VP9A 5HEKA 1RHJA 1USKA 5DS7A 3ZWYA 4DL6A 2CPIA 1XQ9A 4EFKA 4EATA 4J03A 2FPPB 2XTJP 1XZ8A 3B7GA 5BR1A 3PDIA 3LYHA 4FEYA 3WWPA 5DULA 2O14A 2Y0BA 5CVDA 1RQLA 2UKDA 3HDQA 4P7GA 3VOAA 4ILMA 4TVAB 3RJZA 2W9BA 3MJVA 2J7WA 3HUDA 2Z4SA 3LNCA 1X0XA 2IZ0A 3KAQA 2HCBA 3A12A 2A3RA 4UUAA 1DTWA 4FPIA 2C57A 2XWQA 4M99A 1NFQA 3MM8A 1SIUA 4M8KA 4FCCA 1JJIA 1ZAVA 3UUGA 1SL0A 5EG5A 2HN9A 4HJRA 3I39X 4EUNA 1Y4AE 3U4CA 4G0PA 1UZAA 2Z09A 4JI0B 1VLMA 1EUZA 1KK3A 1J5OB 2PJZA 1P8AA 1KTVA 5AR1A 5C9ZA 2FPIA 4XJVA 1E94E 5E4JA 2FPRA 4QXMA 4DV1J 1T1JA 1QDEA 1KZ7B 2D2VA 3P9PA 1O8BA 1I80A 5ALDA 4P72A 1XZIA 1IHDA 3ECAA 5H9UA 4DHWA 3A2MA 5DETA 3WLSA 4XYGA 3Q2IA 3IAM9 3R9KA 4F04A 4KGXA 4OL9A 3UFBA 4F2GA 4IJVA 4K4XA 1XEWY 1LFDB 4MKGA 3FLMA 4YAWA 5EQDA 4KR7A 3LOUA 3EVNA 1TJ3A 3U3JA 1WXHA 4FDMA 3PEYA 1FLVA 3GROA 4CDMA 1KRPA 1SU8A 1QPZA 1O94D 3D7NA 3HHLD 4YEAA 2YBEA 2E7ZA 4TLLB 1Z0DA 5EMMA 4CKEB 1KZ6A 5F78A 5J40A 2F3TA 2VYQA 1QYRA 4Y9UA 5A4JA 3FPHA 1Z6XA 2IOHA 3RKUA 4CCWA 3PHLA 2VR1A 1ZKDA 1JHUA 4S2EA 3JYTA 2WUFA 5A6SA 5KMGA 2WIBA 4M5IA 1FNBA 1QO9A 4FFMA 4NYMQ 4N3AA 5HMWA 1G8JA 4O0NA 1FMLA 3RSCA 2V1UA 4MCIA 5HCNA 3QNWA 2FDCA 3GIJA 3CZ5A 2BFNA 3VR6D 2IPOB 3DEJA 4R2XA 1Y7LA 3PE3A 3G1WA 3SC3A 3BL5A 4FNIA 3UVEA 5JAIA 4OX9J 1YBMA 2JHEA 3O8RA 2W8BA 3ZTRA 1IMJA 1TX4B 4RS3A 3PJDA 5I9TA 1A7UA 1JXOA 1IZ0A 2Q41A 2F8HA 3FUTA 4C03A 4TUYA 3H97A 1YS7A 3CX3A 4UBOA 1SU6A 1ZC3A 4Q0BA 3RS4A 1KQFA 2AW0A 3IAXA 1IC6A 1R0AB 1I51A 2RKIA 3R40A 1HA1A 1W19A 3FJ1A 1JHVA 5KCZA 2FHJD 1Q86T 2JGNA 2Y71A 2CPXA 5A9SA 1O93A 1JLCB 3E81A 1QJCA 2ZKIA 2P8SA 4FNMA 1Z5OA 2G7ZA 1JV2B 2R68A 5BV8A 3VU9A 2FLLA 4ETIA 3ZJ5A 3K0FB 3BORA 4AY3A 4DXDA 5FFFA 3HVTA 1RMQA 3UBTA 3PI7A 4NCIA 3NUZA 4H7PA 3HB9A 1XOIA 2FUG9 2VSOA 4EMUA 2OMOA 2YW2A 3PHGA 4CM4A 1ULTA 2BHRA 5JS6A 4FE7A 3VC3A 1UPUA 3KLPX 3W5ZA 1JKIA 3F78A 3I8XA 5AIBA 4L7IA 1Q8LA 3GU0A 3KDOA 2V8DA 2VG5A 4F26A 3DLTA 1DJNA 2AN9A 1UBOS 1QGED 3I6BA 5CH3A 2PR2A 4EJ6A 4QAQA 2VNIA 4GD3Q 1L7PA 3M2RA 2EL7A 2QSYA 4TKLA 3M4YA 1XTPA 4B9LA 1PV1A 4KTVE 3NAGA 3WR5A 1JXMA 4ZOLB 4TXJA 2D8AA 5LZ9A 1YI1A 5JQGF 3R8YA 3CF5Q 2LRHA 3OG9A 1VRTA 1WTCA 3N2KB 4MA4A 3ILOA 5EHIA 1IHUA 2GN8A 3DLAA 1VCNA 4KBGA 3FR8A 4EB6B 4K9SA 2ZNZA 3UTDA 5ETTA 4WFAQ 3H8SA 3H99A 4EI9A 4A0QA 4M9XA 3BQ0A 3WGUA 5CYPA 4DCSA 1IY1A 2ZT6A 3GEIA 3HU2A 1MAAA 2F62A 1NZAA 2IBMA 1XAGA 3KHLA 2CXTA 1MD9A 2CLCX 1LQ9A 4P83A 1K1EA 4OF4A 2H85A 3LZCA 4PG7A 2V5AA 2QRVA 1CZNA 4DV7J 1J06A 3EZNA 2WKWA 3AUAA 2F1HA 4PICA 3FHOA 2BZGA 3CF4G 3EICA 2E87A 3WQBA 3P2KA 4AVYA 5KQGA 3IP5A 4B40A 1X8XA 4L6AA 3VKFA 4HY3A 2BRKA 3QIDA 3FPBA 4LJKA 4UM9D 4RHUA 5K8UA 2MKKA 1V8PA 2OGTA 3N58A 5CFRA 2IEDA 4UUMA 1YG0A 3PR2B 3QPIA 4BWGA 4JC8A 4IFBA 1DC5A 4XWAA 3EGWB 1YV9A 2MZJA 1IU9A 1OE0A 1AKTA 1WD5A 2C5LA 4RK5A 1UVJA 1GG5A 3KJXA 1RLIA 4P92A 1MVLA 4N8EA 2GERA 4BQSA 1L1EA 3D2CA 1PZFA 5E9WA 1U8FO 1MNAA 3OY2A 3GUVA 1IWPB 4WLVA 1ZMTA 4CT5A 3AB2B 3IOEA 5FDLA 1O92A 2XE6A 2ZYSA 3LT4A 4Q7EA 4LJ6A 3MCVA 2CRLA 2O3QA 2PT7G 3UANA 2PNFA 4ML3A 1GFZA 1EQUA 3AFMA 2HFNA 2Q50A 3ZU3A 3FYSA 4IQMA 1SC1B 5LD2B 3C6XA 3BQ9A 1QE0A 1W94A 4Z4QA 6GPBA 3AMVA 1XEAA 1I4EB 1SIZA 1K6JA 1ZM4A 4YJ3B 1I3LA 4P10A 2POQX 4HS4A 1Y4ZB 3LRXA 2FHJA 3T7CA 3L9WA 4EGCB 3JALA 3GA0A 3BH0A 1V5WA 4F1KA 1W8DA 1JLFB 4PROC 3U7JA 2NUHA 1X4CA 4N18A 3T7TA 4J1TA 4Q1VA 3UA3A 3CDEA 4YJHB 1QP0A 3L5OA 2EZTA 1PRYA 3V4MA 1Q6ZA 2BJDA 3IV9A 3JD0A 4JBWA 3ZDAA 2YUIA 5KWSA 2UZ0A 5K0TA 4KO8A 5A6WA 3T52A 2PN6A 3DGVA 4OQLA 4XGNA 5KHAA 3TARA 5B0GA 3FPEA 4ZWNA 1SJ3P 4O2AF 4QHTA 5ED4A 3DMNA 1VJTA 4KXVA 1XPRA 4OA8A 5K9FA 3BGRA 1AA9A 3D9QX 3H3XA 4DQPA 3TLYA 1OYOA 1LXNA 5TB5A 2QMXA 2VIIA 1JIVA 2E8FA 1H23A 5LNK1 4RDHA 3MQ4A 2P9CA 3NHBA 4A8TA 4BJHB 1EUCA 3VDQA 5K3BA 1C80A 3UKOA 5AXAA 3EQ2A 4F3OA 5I3UB 3QH4A 1NSPA 2BBOA 3E03A 5GIOE 1ZVJA 2QRGA 4HTIA 3AL0C 1B2LA 1FK9A 1I7DA 4P3YA 3LRPA 4RK1A 4B9VA 2AOTB 3QUCA 1V1MA 2XLJA 2OCDA 4DTIA 1XDWA 2WJYA 5T3UA 1JMTA 1IN1A 1GVHA 5J2NA 4X7MA 2PE5A 1YZFA 1YZUA 3M8PB 4J0FA 1N36C 2FZGA 1MP0A 1C1BB 2Y9PB 1S77D 4C8MA 3V6LA 2I2YA 2AP6A 3W6PA 4X62J 4DOZA 4W1RA 2RFLA 1QZZA 5C18A 4G5XA 4RPHA 2DGTA 2F1RA 4JLNA 4Q3BA 1QDLB 3VYSB 4UDYX 4QPTA 5THXA 3N39C 4HXFB 1PSDA 2YRFA 1NUEA 5ALGA 4MRMA 3OFEA 3G6WA 4TMFA 3OJOA 3HHDA 2Q4DA 2R8OA 4CR8A 2A5LA 5TT1A 2LPMA 5DI3B 4RW8A 1O58A 2J9FA 3NOCA 2VQ6A 1ESDA 3WB2A 2O50A 5CCBA 3HSZA 3C0KA 1YULA 4KU4A 2OFHX 1Z37A 4IXWA 2P40A 2UUBB 3A9SA 4QWCA 4IGEA 4FFBB 1XZKA 4EPRA 4L0CA 3ML1A 1BRTA 1BFDA 3QPBA 2WIGA 1XDGA 4FS8A 3PKIA 2R7RA 4CIYA 2G0CA 3I83A 3NHKA 1HBUB 4LHWA 4HDNB 1DUIA 1H0RA 4GOND 2FPKA 1CHNA 3GD5A 3I76A 4DIBA 2XWYA 5CAEB 2MMAB 1M67A 3WBKA 1JXEA 3MMCB 3AY6A 3LM8A 4EJSB 4CMIA 4YRZA 3G87A 3M30B 1YITS 3JVEA 2OBLA 1OKKA 4FNOA 5K4AA 3A4IA 1OIAA 1BROA 1F8UA 3TWOA 2O2CA 1V3VA 5AJ3J 3PIPQ 4FQ8A 1VECA 2IA5A 1EZ1A 1UMBB 4CDIA 2B3TB 4IIJF 2ZDGA 2J3JA 5IZCC 1T5LA 4RH3A 2XNSA 5HBMB 3LX5A 3DXSX 3DBVO 1RLJA 5L1JA 4WKYA 1Y5LB 5MAOA 3H1BA 4DLAA 3K53A 1PFVA 3LC1O 4D8XA 3NDRA 4LF8F 1ZFNA 3GWCA 3W9UA 4CTAA 3W34A 3P1JA 3TRDA 1N88A 1QCYA 5HANA 4ZP7A 1MC4A 3PC6A 1Y4SA 4DV7B 4E5YA 3SKXA 1ZCZA 4E70A 3ZQ6A 2WINI 4C7JA 3A4NA 2JANA 1NKEA 2GA9A 4X20A 3IP1A 4EF5A 4MGZR 4MVJD 4YR9A 2E7WA 1ZOIA 5MN5A 1XMSA 1JN0A 2BMDA 1DURA 2G0IA 1JLSA 4P22A 1NHGA 3C4VA 1YZNA 4XD7D 3HI4A 4RW9A 3RI3A 4DLLA 5CVJA 3TZZA 5JS1A 3LT1A 2OPPB 2RD2A 4GBJA 4RIEA 3J81A 4DU8A 2QL5B 3G8CA 2Y4OA 3HBNA 2JFDA 2JI7A 1E59A 4RTKA 2HBZB 5JSZA 3GUYA 3O2SB 1C50A 1WEHA 1FRNA 2R8XA 2HMTA 1NSAA 1UZUA 5L3ZA 5EP1A 2VQEB 3KPVA 5KHLB 1Q7CA 4DSKA 2OFPA 1Y1QA 3E9DA 3R44A 4NBKA 1FTQA 5K8CA 3OOSA 5LPNA 4C3MA 2PLRA 4FF1A 4QR2A 4FPXA 1NC1A 2IS2A 4YB1P 3CUVA 4DQ0A 5I7HA 4OJHA 3SEOA 4IHQA 3X1ZA 5AK6A 2RH4A 3EXYA 5I3ZA 1Q0PA 3NBQA 2HEIA 3RR8A 1QZTA 4QU0A 3QJ5A 2RRNA 1RWOA 4KQWA 1S4FA 1Z4NA 4M5DB 3MFYA 1XIVA 3UFXB 3SBOA 4ENVA 2IMWP 4Q3DA 3K0JA 4LISA 4KNYA 5A02A 3GGPA 3OOWA 1S12A 3JYPA 3WMXA 3ZHRA 4RK0A 1JXLA 2JFHA 4UTNA 3VTZA 3WIDA 4BFCA 4BV8A 3P4UB 2AT1A 4A8MP 1HH4A 2DSTA 1BMTA 1K89A 4Z7JA 5CBPA 3LOQA 1TMOA 5I4IA 4PUGA 4AMVA 2FGJA 5GJCA 2ZSJA 3L8DA 4LF7J 5K5MA 1WDMA 1Z2OX 2OLJA 2C3MA 4GKJF 3OESA 3RAXA 3DTTA 1VQ9S 5AMXA 3LLVA 3RC1A 4EGQA 3I61A 4RZRA 3MHTA 2YWWA 3W6ZA 2V34A 3D7KA 3OLQA 1ZR2A 1K92A 1H8HA 3AQ4A 5C51B 1ZH0A 1XNQF 1TC2A 1NW3A 1QAQA 2CQBA 4LRQA 2EQAA 1U7PA 2KDNA 3I6ZA 4X4PA 1EVJA 3D6MA 3G1UA 3K73O 4FJ1A 4AQYJ 3BB5A 3K5IA 4WK2B 4A0GA 1LQTA 2G5PA 1JIXA 2D5BA 1EARA 5FBZA 5EJIA 5J23A 2YKQA 2D7VA 1TAGA 3CF4A 4ENWA 5KU1A 1GKIA 3LCMA 3WRXA 1JHYA 3MELA 1M2JA 5D87A 4PS1A 5H81A 3HNRA 2OO4A 4L4QA 3D6MB 2QN6B 1D6SA 4DLYA 5EWLA 4D5EA 5FYQA 3ORYA 1TJ5A 2JK1A 3VH4A 1PYDA 5HR5A 3DNFA 3ETJA 1YH3A 3ESAA 3STXA 1LU9A 3IR6B 3VSCA 5AKHA 5FEMA 1PJSA 1FVHA 4RZ3A 2INGX 1YOBA 4K6CA 4QDJA 5ADZA 4Q5VA 1S9EB 3L77A 4XJXA 1D3WA 1HBNB 2RI1A 1T2DA 3AZOA 1DAPA 2NACA 5G4DA 3FG9A 1W87A 1DLOB 4QWDA 1S1CA 4B4KA 4J91A 3SFZA 2W9AA 1Z7WA 4EW3A 2Q8QA 4PW0A 3REFA 4IYQA 4OJNA 5BWLA 3WJ2A 1RR6A 1Z3IX 1S0NA 2JGDA 4FP9A 2GW8A 1IIBA 2YNMC 3NW9A 1FPQA 1C3LA 4B6GA 1U3DA 3TSZA 1P5FA 2L82A 4CTKA 3T94A 2GZSA 2HAEA 5KREA 4GI3A 4CO3A 1POWA 2OCLA 5A9TA 1XK7A 1RXIA 4H0CA 1P7WA 3NLCA 4X84A 2ODWA 4PFJA 1Y0BA 4V0OA 1WVMA 4D4MA 5DGDA 4WA7A 1ZA2A 4HXGA 1ZL0A 1L6RA 3CTMA 3WKEA 3ELUA 3OQIB 3RVPA 1CDOA 3MUEA 3ZGVA 2J9ZB 3MOGA 2JZNA 1TI7A 2QSZA 2JI9A 3U7QB 5NULA 1KOFA 2E4AA 2WVFA 3WQPA 4I6AA 3ZW8A 3NHLA 4D97A 2ZIXB 4HTAA 5F4ZA 2W11A 3RR7A 2PG3A 3GJ8A 5BOSA 1OBOA 3D4LA 2GAFA 2O8FA 3A0RB 4WBNF 3GB0A 3LRTA 4TYQA 4BQEA 4ZVTB 4JBNA 3QT7A 3G6VA 1E69A 4TKMA 4RKFA 1TDJA 1O6FA 1ONBA 3L7LA 2PKRA 1HT2E 3TTWA 4ECSA 1P33A 4YRDA 4AJEA 5BORA 1SUAA 2FQXA 1UWVA 3T1QA 4XI9A 4U7HA 3U37A 2M8DB 4EG3A 4DR7F 3LSYA 2RHLA 4YEDA 1G9SA 1N33C 2VF4X 1NUTA 4TS9A 1JE0A 2DTDA 4FQ5A 3S2EA 4YH1A 2NADA 4BO0A 4ETZA 1K8XB 2X3UA 1UAWA 1BC5A 1Q7RA 1GTVA 4GT1A 2TECE 3K96A 2REQA 4Y2SA 3BGVA 3P26A 4BBAA 3D64A 3AWIA 4EO7A 1Z33A 3I96A 3AF4A 3U4DA 3IIJA 4BO2A 1NUSA 1UOQA 3U56A 5C53B 5C81A 3VPFA 4A23A 5I9LA 3II6X 2YTCA 1JSRA 2K3KA 2OXFA 1L5ZA 2RQ4A 2H3HA 4N7BA 1WUIS 3UNYA 5JH7B 3ZBQA 3EAFA 4UBMA 4FS3A 3Q9UA 3OWXA 1M2KA 4FXOA 4MT1A 3S0JA 2FZLA 5AOAA 3IQFA 2PSDA 4E88A 1H42A 2WVHA 1QWOA 3GH1A 1JBQA 3A9RA 5AVTA 3R1LA 3ZZ0A 2K8GA 1NMEA 4JB2A 5JVDA 2C2EA 1DIHA 3OR1B 1LW6E 5ERGB 3VZRA 1Y8CA 2FCAA 1R9MA 4YMWA 1ODLA 4YRCA 3ROPA 4J9VA 1MAVA 2QG4A 5IHPA 1HDZA 4YN3A 1L6IA 2GVNA 1OY1A 3U3RA 4R9NA 4CKWB 2BH2A 2C78A 4TTVA 2IHZA 4LJYA 1P4GA 3KKFA 3TZEA 4A2PA 4DR2F 3INGA 6AT1A 4IJQA 1B8PA 2OEKA 3KJZA 4M7WA 2ID8A 1VQSA 5KOHA 1QAXA 4JYPA 5J47A 3OAAD 3KVVA 6PFKA 3AEQA 3FW1A 2CNOB 4C78A 1MXAA 1JLAB 3IMCA 1QO0D 1Y5NA 3GIKA 3N2YA 2I7XA 3DLKA 2PL1A 1OFTA 3ABSB 3I1JA 3OQPA 3F47A 2DBQA 1VFNA 4BB0A 4WXRA 3CMCO 3SQNA 4TLAA 2Z8QA 2IM0A 3GG0A 3I2HA 5G0WA 1RAEB 4B3BA 1WMEA 4UOEA 3W9SA 4X7PA 1EFKA 4CLZA 3EVMA 4RCZA 1FRIA 4ZS6A 1E2DA 2HHSA 3UH0A 4E30A 4F11A 2C59A 3E3NA 1IBLC 1N52B 3ZC3A 3AH8A 1FRLA 4QDUA 1CHDA 3KKZA 3CUKA 4DSNA 2JBWA 2IYYA 3DU5A 3X1YA 4ZN6A 1GZ3A 1SKRA 1XMJA 4D3FA 3EAGA 3OTIA 3C15B 4U1RA 1AKRA 2W93A 1UIRA 3C3LA 4ZODA 2JHGA 1I2MA 4W82A 5AVOA 1GT6A 1E7SA 4GOJA 3KYDA 4JI7F 2BL4A 3NEYA 4MWSA 4ZP6A 2J5QA 2KLHA 3OZRA 4DM7A 2I7CA 4UAVA 1BDJA 1P6UA 1KTQA 4ZVUB 5GONF 2DGVA 3NZEA 3ZS9A 5ETQA 1MB9A 5ER6A 4P8RA 2JL9A 1WW3A 2BJ9A 2NPFA 2GZOA 1VMKA 1G0OA 1FSGA 4H3KB 1TGVA 2Z2KA 4OKNA 1ZX1A 4H7JA 4LUBA 4K2HA 4RZ2A 3OU7A 4QJ4A 3AI3A 4PQUA 3A14A 3WWOA 1WI6A 3DV0B 4Y0FA 2XLCA 3TJAA 2FFJA 5AVYA 2BKXA 1I3OA 4FYWB 2V3VA 4OFXA 1ZRHA 1BOFA 4GI2A 2PMDA 4RORA 1QTMA 2EATA 2K7FA 5DX1A 5EZYF 1SVMA 4JB0A 1J25A 4DPLA 2X2PA 4F97A 2PX8A 4B2LA 3WMEA 1S9FA 3O3CA 5GADl 4DQLA 4W5NA 4B3GA 3HXOA 4Q37A 2JG3A 1S49A 3J7TA 2C2OA 3U1LA 5CLIA 2UDPA 2B8JA 4KOEC 1RAIB 4OB7A 3JTNA 3NYQA 1EP1B 5I8PA 2DFDA 5KX5A 4CW7A 2MJUA 4CMHA 4YK7A 5C5DA 4P74A 2YQ4A 4PUOB 2PA0A 2MSCB 3SYLA 2GQ2A 5FBWB 3V4SA 2D2FA 7AT1B 3KT0A 3WXBA 2D3OR 1I5OB 4R3UC 3PXCX 1PAUB 4RYLA 1JP7A 4BN5A 3C5VA 3VU3A 5HXAA 1F38A 1JQJC 3BYZA 2Q3MA 4YRIA 1BFUA 2HVZA 3GZNB 4TL9A 1FXDA 2OYRA 1UOPA 5BSEA 3ZD8A 1T1RA 3O5TB 2R11A 2ZIZA 5ALYA 3P6YC 1C3EA 1WR8A 3OTOJ 2QC3A 4QWAA 3C8ZA 3EH2A 1L8LA 4B09A 1NN0A 4QL3A 2RGRA 1PSZA 5JI3E 1JDJA 2FHMA 4DBQA 3HNOA 5K4GA 1JLGB 3DDWA 5A4AA 5B3JA 2FLWA 4XYEA 1OMSA 4RTMA 3MT7A 2PFFB 3W1YC 1CUYA 4F0MA 1I94J 3IH5A 1Q79A 4DSEA 2W6JD 5CGQB 3CCUS 3FKJA 1S1XA 3N2IA 2ZD1B 2ECKA 3WZ2A 5KNCD 1EGHA 2HJ9A 1T9XA 3UJ3X 1TIPA 1RAJA 4NXNJ 5THWA 1DJMA 3IAHA 4OX9C 4BP1A 3I0ZA 3CNBA 3HUFA 4FCVA 3HHLB 3SBEA 2V6MA 2PX3A 4ZAXA 1WC6A 4UZEA 1C41A 3SR3A 4FR2A 5B1HA 2WJPA 1OJLA 3D8HA 3WAJA 4N0MA 4IJWA 4NY1A 3GP8A 5DTRA 4IQFA 2CK3D 3W6UA 1V1RB 3OFJA 4KK3A 5ALMA 1T5BA 2FOLA 5KFJA 1TU0B 4W92B 4QRHA 5BVHA 3N4WA 1EFUA 1L1RA 1X6VA 3NM4A 4J9OA 3AB3A 2HFVA 3FNFA 3F44A 3D8BA 2AHOA 4NYIR 4NJMB 4D9MA 4BWMA 1PK8A 1ZI8A 5KTPA 4G5SA 1V9SA 2Z08A 3CCLS 4PAWA 5IYZF 2BFWA 3L4KA 3NRCA 4PVDA 4GQIA 3KG0A 4HDGA 4MEJA 2H0RA 4BNJA 1Q53A 1XN1A 2K1RA 3LALA 1A69A 4R2MA 1KEUA 2D7JA 2PSSA 1QHNA 2ZKLA 3WGMA 4KPEC 1HBOB 1CG2A 4J7AA 5C1DA 1K9MT 3MUFA 3FCCA 3PFOA 3GUCA 1N7IA 1O6GA 4ED9A 4YQYA 4HH1A 2WU3A 4A2QA 3GAFA 3MUVP 3TTVA 4JC0A 2R6ZA 3HZHA 3REQB 1AQ6A 1LWNA 3QVJA 1XD8A 2P11A 3PACA 3GLTA 5BY2A 1AZWA 3G6KA 2VJUA 4L22A 3OEED 1LI5A 2YNHB 3AKCA 2ZBFA 2OAUA 1AZSB 5LSOA 3V1MA 3WGOA 2CV2A 4LAFA 4OXIA 1KEZA 3C2PA 2ZEJA 3F1KA 3ZGYA 3VZQA 4DV6B 1Q95A 1X4FA 4U0KA 2J9DE 1UVMA 3AF3A 3P9ZA 4CLRB 3AWDA 1WY5A 1P1TA 3HSSA 1PNRA 1XRQA 4UC0A 3PDNA 2WIJA 2G76A 1WZNA 2HGLA 3I87A 3DR3A 1NAQA 5IWAB 4KE7A 3LWMA 2YQ1A 3AU9A 2X5JO 4EHHA 3V2UA 3A3NA 5TARA 2R42A 1P2GA 2BVNA 1TQHA 2I2XB 3TQRA 3CPHA 3HFZB 1SJQA 1RTJA 1X8KA 4QZVA 5F8IA 2QL6A 3SHWA 1M8PA 2XYRA 4LW8A 1T0IA 4JR0A 1I10A 3LPCA 1WSBA 3OQNA 4I55F 3ND9A 3HCAA 3P8BB 1FNNA 4ESOA 1XJWA 5JNWA 3EXIB 4QARA 4LTDA 4TYMA 4JQCA 4HEJA 3BMOB 3J7A1 2AZTA 3K9NA 3VSEA 3K5LA 2Y9HA 5LM3A 5HZKA 1LWCA 4S35A 2D2EA 3GLQA 2PEZA 4ANFA 1F17A 1UDBA 4NOMA 4JODA 1ZW6A 1KZGB 3CTRA 1DG3A 3RRXA 3EC7A 2F3JA 2MY8A 4B3TJ 4TU8A 4YUZA 4MA0A 3GDHA 2CD9A 1HDYA 1R8HA 2GAHC 4LQCA 1WCJA 2BC9A 2VHEA 1XVUA 4D26A 1V5VA 3EY9A 2ZATA 1ACJA 2AUTA 4NFYA 2JJ8A 1SVKA 2MYNA 3TKAA 3SOZA 1XAIA 3YASA 2YJ4A 5DHPA 4EG1A 2ONFA 3KAJA 4II3A 3BS4A 1C0TA 4RMNA 2VP5A 3LWZA 4FHDA 2IPLA 2A1IA 1YJBA 4RF3A 3OZDA 4FNGA 5TQ2B 1IJFB 4KR3A 2X0KA 2V1XA 3WAKA 3C46A 2B99A 1X94A 4I0WB 3H2KA 2V9ZA 3WNVA 2OB1A 4IYRA 4AL4A 4B34A 4ZIWA 4DR1C 1CJUA 4HNRA 2G08A 3PENA 5HF6A 5JG7A 3ZLTA 2D59A 3AERA 1I2CA 5I51A 1G4UR 2AFHE 4G85A 5ELMA 3DRYA 1L7RA 3T7RA 2OV8A 3H5UA 3D4OA 5TDHA 3RYLA 3SCIE 1ANKA 2E4YA 4A26A 1NVEA 1A9NB 1T05B 3ICQB 1R66A 3O90A 3GZTB 2LXIA 3JAWA 2BFEB 3ADOA 2HHAA 1G8PA 1XEFA 4BTLA 5F7XA 3SZ3A 3OHPA 4CF5A 3LGHA 1I0ZA 5TGDA 4H4OB 4ZAFA 4AKIA 3AX6A 1SBZA 1U1KA 1O90A 1XMQC 2NIPA 1U2EA 4LMZA 1IM2A 1KJJA 4OHMA 3MGJA 2EWHA 1GNTA 1C2TA 1XRBA 5CCEA 4IDQA 4LJAA 5KFEA 2AN1A 3AKYA 2A57A 3K1TA 4O4IB 2XYPB 3UO8B 1WHWA 3AVTA 1VI7A 2VD3A 4ARSA 3CGGA 3U48A 1T3TA 1WOPA 5IBQA 4Y6RA 1OV6A 1XPJA 2GJIA 2OPPA 3N8NA 4D9FA 5EE3A 3UKJA 2B9EA 1U8AA 4XFDA 3KNZA 5LYJB 1DRKA 3V2HA 4LNAA 3M1VB 2G0AA 5F21A 3BH6B 5A4KA 3K6SA 5GJWC 3F56A 3TDNA 5BW4A 1V39A 2ZB2A 4MR7A 1S72S 2ID9A 4KXLA 2HRBA 4JXKA 1D2AA 3E2IA 3HKDA 3LHKA 4C05A 4DYHA 5EKDA 3UWOA 2WAOA 1W46A 2NUBA 3DDHA 3NVKI 1MEOA 4JZYA 4FHEA 4GBMA 3RIEA 2QFJA 2XT9A 3NS6A 3VTIA 4AQDA 3QRQA 4JSRA 4PIMA 4Y3CA 3O0TA 2Z43A 2C2KB 3ABOB 4FYHA 2BFCA 3TQSA 3CLRC 5JNRA 4PAGA 3B51X 1EVLA 2A9OA 2FEWB 1XDDA 1GL7A 3MHPA 1S2MA 4WZAE 5KAMA 5ANRB 4CIAA 5CITA 4ZI2A 2XUZA 3C70A 5KWJA 5JWRA 4X9XA 4QRIA 4X1YB 2HY7A 4BZXA 2GARA 2QZPA 2IBTA 5MN6A 1N5QA 3BBFA 3U2QA 4YP3A 1X13A 2J31A 5L3QA 4B9SA 3PV8A 4LI3X 4Q15A 1EPUA 3OTBA 3KJNA 3ZS8A 1AKEA 1FTCA 4KSCA 4BV9A 2A92A 3KJEA 4EW1A 5FDFA 5ED0A 2Z2ZA 4YDSA 3HLKA 4C48A 2Y68A 1SXJD 2MKIA 3PR4A 2RK3A 2G72A 3IT0A 3FHLA 4BQQA 2I2AA 3FF4A 1Z9BA 4M5NA 2F63A 2A5JA 3PYMA 3QY0A 1IY8A 4KR2A 1ZTTA 1TO2E 1GDTA 3CZPA 2YBVA 3ASYA 4L6IA 4G1IA 2IHBA 1JFSA 3ECCA 4LYAA 4OBEA 2XY7A 3PK0A 5JY1A 4QIHA 4WIIA 2QTZA 3TKLA 2HJHA 4I5FA 1YQTA 1AKMA 3EBOA 3PHEA 3HFRA 1E20A 2B25A 4NZZA 3ZJVA 1QV6A 2JHPA 3VTKA 2B5WA 4YBZA 1CK4A 3M3PA 1UKUA 4KBIA 4MRAA 4RJVA 3EXHA 3M8PA 4OGFA 1M6VA 1NNUA 2W2OP 5J2NB 4XWWA 2XD9A 4KQ1A 3JQ7B 3ROGA 4Z0NA 4JI0F 1T3GA 4ZGWA 3ZQ4A 1EM8B 4LZZA 4Q4AA 4BVGA 2CQPA 4A6EA 4GC9A 4LYDA 4C4ZA 2C2YA 2XNHA 3Q7RA 3VXKA 1DAHA 4F6LA 2A33A 4G0NA 1P45A 3DYAB 1HNIA 2C9BA 2L9NA 4AI6A 4RLSA 2EG5A 1WUKS 1ZD4A 3Q11A 2EVWX 1T9KA 4R68A 3PPIA 4AF7A 1L4GA 1CY2A 4AJJA 5BSKA 3W79A 2IPAB 2LU1A 1WG4A 3H9EO 1YNSA 3T5LA 3DOKB 1VA4A 2CJYA 3FMVA 3OE5A 1W7WA 2LLZA 2EW9A 3MWEA 4FGLA 1T4BA 3L07A 4JJGA 2W2NA 3UY4A 3HMQA 3BC1A 1YDWA 4JYMA 1OR8A 2RG7A 1VK3A 3SR0A 4NPCA 3S1AB 1CJUC 3ZWDA 3WNCA 3T5CA 3M89A 3CEAA 2IJGX 2JATA 2PRJA 4F2PA 2LDXA 2C04A 2POKA 1QKJA 1LWEB 4WJBA 1CY7A 4HFRA 5KFBA 3O6VA 4XDGA 2YDYA 5K20A 4ZDIA 3BD7A 2CFXA 4HKTA 4R83A 1YI2S 4HYQA 2VEDA 3AUJB 4BQFA 4I1YA 3U1MA 4ZK7M 1SG0A 2YHSA 3RFUA 3IGFA 1QQ5A 2DHEA 1N1EA 2JLAA 5C1IA 1P61B 4PG8A 4CEHA 3SIPA 1FP6A 3VU0A 2Q3LA 4CM1A 1A9XA 5LZ5A 2DISA 3TUZC 2VUGA 2B3DA 4AURA 1UBRS 2DF8A 3BD8A 2NUTA 4NZMA 3IILA 4B85A 3W9HA 1E1MA 4EHLA 3ZWMA 1AYEA 1SH7A 4M7OA 2Z6AA 3BHIA 1T2VA 4J75A 4K40A 5I9SA 1E9RA 4ECZA 5B5SA 2QA4S 2KMLA 3DNMA 5H1SV 1Z5VA 1ZGCA 3M9OB 2JFKA 3RVMA 4BZPA 4HN9A 2AZ4A 4D9CA 1GL9B 3LHFA 3BSAA 4HDOB 4KGVB 2GEUA 4DLPA 2P2QA 4FUQA 4KV8A 3V48A 1EG7A 1JJBA 4FB5A 1OF1A 1XB2A 3TEGA 1V5FA 3KB1A 2VYCA 5ALPA 3JYQA 2HADA 3I6PA 1V6CA 1PGNA 3DI6B 3GPAA 2CNLB 3NONA 2H2DA 4FZ5A 1DAKA 3E7WA 3UG6A 3IV6A 4L5YA 4QO8A 2JKVA 2HYIB 3BJYA 1BXRB 4EBFA 5GAEI 2OV3A 4G5YA 4MGHA 1D2EA 1SIOA 3PEUA 4QWEA 4HJXA 3JQ8A 1EXDA 3QE3A 3RUIA 4P2MA 3DT9A 1TLFA 2QYGA 3VPSA 1KDRA 3GFXA 2YN0A 2I5PO 3GLIB 1C3OB 3L6UA 2YHIA 1ZS6A 4O33A 2I29A 1U2DC 2YMQA 3B9QA 3SU8A 1T5OA 1GNSA 3EEYA 1L9XA 1J2VA 3TW6A 2YWJA 4F91B 5C7IO 2DD8S 1E9SA 2IEBA 4RU1A 3W8FA 5M34A 5CDFA 2V4JA 1HLDA 1EX6A 3PXEA 3ER8A 1GZ5A 3GEPA 2BHNA 3RRZA 1P7ZA 3CJ5A 1QH8A 1WCXA 3WFZA 4YIHA 3IAS9 4TYAA 1VL0A 4B2YA 1UM9A 2W2KB 1PT8A 1JNYA 4RVHA 2Z6UA 3LC2O 2OP5A 5WRFA 3ZWOA 3W0LB 2O2EA 2AEJA 1KBZA 2I71A 4X8LA 3W5DA 1CVLA 3HU1A 5DX0A 3GVIA 4PYQA 2J30A 1FS6A 2Y0DA 3K8WA 1Q21A 2XVAA 2BUBA 3PGA1 2EZ8A 3LUAA 2V9KA 8ATCA 1W44A 5BNIA 4HXYA 4C7QA 2TSYB 3O8QB 2OG1A 4G1MB 3RIMA 5DG7A 4C22A 5DGHA 2XLKA 1ZYUA 3OQ1A 1KAOA 4P6VF 3CUSA 3P9SA 4IIGA 3A6JA 4YDDB 4DCUA 3K9WA 5YASA 1X7XA 1HE4A 2V97A 1IK6A 1OI2A 3MECA 4NU0A 3RVJA 2DO4A 2RH8A 4GKAA 2VAMA 2NV6A 2HPVA 5IANA 3QBDA 4M95A 4ESEA 2W4PA 3ZKWB 3IKMB 3LX6A 2JVIA 2H1VA 1YJQA 4FYDA 1HYEA 1K7EB 2PXXA 5CLJA 2V7PA 3IEXA 4J7UA 2ALZA 2QE7A 3AXTA 3UJNA 5J2UF 2OUIA 3KLNA 4RCVA 1R31A 2A7XA 4QDTA 1KMCA 7YASA 3WLFA 2DFKB 2DPHA 4DCJB 3IIIA 5ESDA 2YNFA 3N1UA 3FSXA 4R69A 4BDPA 2GO1A 2WJ6A 4USHA 1SVSA 3LP0B 3GNQA 1AG9A 4E07A 2YWRA 4TRNA 1W59A 3M4JA 5FTNA 2X0IA 1SZDA 3M5DA 2CUZA 3WYBA 2HA4A 4RJLA 4DV3J 2IWRA 1WKBA 5AXCA 4F3QA 3DOEA 2CGEA 3UPFA 4B3JA 2XZTB 3U5ZB 2WILA 4NEHB 4AJPA 4M7PA 1XF9A 3TJMA 3M83A 3ZXIA 1FYEA 2XYQA 3M6AA 1NPRA 2WSSA 3CLSD 4K9OA 4R2KA 4D8TA 3WKBA 2ZJFA 2QX6A 1KHWA 4EHIA 5KFLA 2VHQA 5COAA 5G0RA 1RAHA 1GGEA 4DRYA 3VU8A 5HGXA 4ANCA 2CAJA 4EH1A 1DLIA 5AHRA 1YRWA 3DBIA 2J0UA 5A8RA 1SXJB 3OCVA 1PDWA 1V43A 1Y7IA 2PGIA 3PXBA 4NX2A 3R3YA 2WG2A 3T06B 2BLNA 1D8AA 2ZSFA 1N5YB 3V8BA 4ZKDA 1N6QA 3VBCA 3T1HJ 1NOKA 5EIEA 3NASA 5CCDA 1GGMA 2GH1A 3H2YA 4ED7A 2WWTA 2N46A 2KZZA 4ZOQI 3IIMA 4RNOA 3AEKA 1L5RA 2VZ8A 4IS3A 1N5VA 4UEKA 4FSDA 4NOKA 1VM6A 1T8SA 3DUWA 4C4AA 1XHLA 2BQ3A 3GG9A 3M8QB 1JLLA 2CN1A 4BVJA 2GQ0A 1IR0A 2V4QA 5J2TB 1FLAA 1P7CA 3KHTA 3NPMA 4IOLA 1N5OX 4FMPA 2WEKA 4V0ME 4U0JA 4KXWA 4EFLA 2APOA 3GCWA 3RJTA 4NL4H 2JPDA 3G2NA 4LI0A 5GJVC 4OV6A 1XO1A 2XXJA 1U2ZA 4G26A 1NJ8A 4HFJA 4AZ0B 1XLUA 3LNOA 1X87A 1KS9A 1VYTA 4O0MA 3ZI0A 1GZUA 1G59A 2B1GA 3T15A 1GNVA 3EJWA 3NM6B 2OBNA 3SBDA 4OREX 4ZVRA 2EFGA 4GOMD 1U5BB 4WCFB 1V11A 5E5NA 4IHKA 1K1SA 1PV2A 5JCJA 2JLRA 1H1DA 4OM8A 2DFNA 5E33A 4PS0A 2ENWA 2BBSA 4ZAYA 2XAAA 2Q3CA 3URMA 3Q12A 4MWCA 4ZI5A 4WN9A 1AGRA 3GRAA 1UVIA 2AMCB 1QTRA 3RYHA 5I7UA 2BE2A 3CCRS 2QB5A 3LPDA 2QU8A 4IINA 3TDEA 2GAJA 3VA7A 2A0WA 2EGHA 2VAPA 4MUIA 1Y3IA 1T8EA 3LDUA 2JZ5A 4OZ0A 2E4UA 2G1JA 4DX7A 5AH0A 4NZOA 4MAFA 4D8UA 2BISA 1TL1B 4MHOA 2N1BA 3NBKA 5JC8A 4BHTA 2IBSA 1H6BA 5E2QA 3ETMA 3FHCB 2YL2A 3KSUA 5ECDA 3RV4A 1HFWA 4LJLA 2OCXA 3LTEA 1TRHA 4BZQA 1JKXA 4IXNA 3NTOA 1BWEA 2DLDA 3I0NA 1N8RT 1CEZA 3M4NA 5EWJA 2C5BA 1M5KC 3SX0A 4PZUA 3ZVNA 1ECJA 4XLTA 2HYIC 4EZ6A 3DP7A 2XT0A 1BGXT 3DLJA 4YGYA 3REGA 2EW8A 4LJ5A 2Q0XA 1FOEB 3Q8XB 1V9CA 3QA9A 1IB0A 3KK3A 4ZFNA 1M2FA 5C42A 3UHAA 2X9NA 5AVWA 2ZI5A 3LFTA 1Y3KA 4OX9Y 3Q87B 5B09A 3MF4A 3NBMA 5DM1A 2VP2A 1S99A 1E5QA 4IH6A 3RUHA 1VG8A 3KLFB 3I6IA 4AKGA 4OMCA 5A2QA 5FD8A 2WSMA 4YUDA 5IN4A 3ZLUA 3TCXB 4Q4JA 3CBQA 1YJNS 3TZQA 4RY9A 3U9SA 5ER9A 1L4YA 2N9UA 4ZMRA 2DIUA 2BFBB 3G1TA 2Y1EA 2WWWA 4YUWA 4BJ3A 1OQAA 1ZD8A 2G36A 4UNNA 3QX8A 3PTWA 2AQKA 1KIAA 1HKUA 2QA4G 3RYFB 2HPHA 4HAYA 4BMVA 2NQTA 2F4FA 4NATA 3U62A 1NIPA 2VC2B 4R1QA 5A0FA 1K47A 3I9V9 4MMYB 3JTPA 2YRWA 3DW1X 3WDOA 1BD6A 5B1SA 3C3YA 2MDAA 4JD5A 2QI9C 4WK0B 3GFHA 5TPWB 5EIXA 1U6KA 4OU5A 2E49A 3IVRA 1A1SA 1H0SA 1USGA 2BFOA 2ATCA 5IAGA 1DPFA 4UM7A 3G0OA 5U1PA 5GADI 1J90A 1SBHA 1UXIA 2IBOA 1XQYA 1KAGA 1IBCA 2O0HA 1SCBA 1U2RA 1M8KA 1XT6A 4MEAA 5JFGA 1FXLA 1XTUA 1A9RA 4IQ4A 3VZIA 1U3CA 3IVCA 5GAHU 2GWHA 4MVJM 3ZGLA 2PKCA 1E6WA 3RABA 4BQOA 4PGGA 4DRZA 3H8WA 3BMCA 3ZGNA 4YMEA 4KLZA 3CQ1A 3D68A 3O8CA 1UW4A 5EJ2A 5F51A 5CABA 1RWUA 1OX6A 3CNEA 3QKRB 4JL5A 2FY1A 3KKNA 4KB5A 5IHXA 3OT1B 1SKQA 1GOTA 5IN5A 5GMDA 2EZUA 2HRYA 1N9GB 3TB6A 5FLXU 1KJ9A 3DNCA 1G7TA 3LUFA 4Z0TA 5IT9Y 3TIXB 1WXEA 3SEQA 3PNBA 4LKRA 2PU5A 4H1VA 3LWLA 3I72A 3N5CA 1A2BA 1P73A 1L5UA 5GMOA 3GLFE 3SXUA 1CJVA 1Q83A 5HF5A 5DX8A 3DKRA 1NSTA 1NK4A 2C7GA 1UXGA 2JEGA 4JLPA 4UUQA 1ISSA 4ZPJA 1YZVA 2ZRAA 5G1PA 3K8ZA 4CL8A 2OM6A 4B9AA 4KGZA 1U9IC 4YPOA 2KFZA 3TX6A 4ZCKA 3LK7A 3W3SA 3R9XA 1RNLA 3V46A 5EUQB 4OUKX 2EIHA 4DR3J 3MM6B 2HMUA 4JASB 4AUNA 4PLPA 2ZHOA 1JIQA 4QCLA 3BHJA 4KIUA 1P7LA 3LBIA 4MJKA 1EJBA 1U1NA 3Q3VA 3MRSA 3M6MD 1LBIA 4X93A 4D3YA 1IDOA 3UG7A 2BV3A 5AUNB 5ENZA 1TFUA 3COWA 2BGTA 4OHXA 4HB4A 5KKAA 3RCBA 3AVVA 3K32A 3EISA 5FPHA 4LVNA 1UC9A 4AP6A 5F4BA 5JD6A 5M04A 4RZIA 1A7GE 4H1HA 4OK5A 3NEJA 3ADCA 2YWXA 2VF5X 1IBMB 3HCRA 4DV0F 2UVUA 3SZRA 1EK5A 5KNBD 3OBIA 3OE7D 3FA2A 3F49S 3KB2A 5MLCV 4C2BA 2FCRA 2NUPB 3KTAA 4KN6A 3QI7A 1Z8FA 1CNEA 1XZAA 1RGVA 5T7LB 3NKLA 2YQ5A 1G4HA 3PTAA 3ELDA 1E6YB 3BN3A 3CJSA 5F7ZA 4OQFA 3D2WA 1L7AA 3IALA 4CVNA 1S6OA 2QLBA 2XJ4A 1RWKB 4O1IA 1R4NB 1W47A 4B3HA 1IN4A 4KQ2A 4F5YA 3IJEB 4KYVA 1U28C 1R0YA 1FTWA 3P9IA 5JYBA 3MPOA 4JYBA 4BKPA 1P6XA 5KFGA 2JAXA 3O8OA 3MM5A 4I8XA 1QRRA 1XHJA 3EW9A 3P20A 2UUCJ 4CMCA 4NRUA 4ZO4A 2WUDA 2QTMA 2FQYA 1UFLA 2V65A 3BTUA 5JSKA 3TZBA 2C82A 1Y1LA 3IKLA 2NR0A 4ZGBA 3WGYA 3GWZA 2FVSA 2QMQA 3VVBA 1VYAA 1ZLXA 4HDMB 4LC0A 3EVGA 1B42A 2AMFA 4XUCA 4WY5A 1FUGA 4QOFA 3B6IA 2AS0A 4LZPA 1A5BB 4R4JA 1MNEA 1RW4A 4J29A 4LGVA 3K70C 2F8TA 3PF8A 1FRXA 2G7MC 1TM4E 2V7EA 1YTLA 1N36F 1Z0ZA 4ND5A 1WZUA 1P9NA 4BEBA 2BFFA 1VTKA 1GYQA 5EJ8A 1KI2A 1U5AA 1KC3A 4KAJA 4X44A 4C7OA 4ZLPA 1UDWA 4CYUB 4CL2A 4F2WA 4ZC1A 4JI5J 4PGAA 2AZ3A 3MMNA 4QWWA 1MU2A 1QQAA 4TWAA 4EQ6B 3LHDA 3QYFA 1VEHA 3D8SA 3BE4A 4EGAA 2JRSA 4X6YA 4MW9A 5ALQA 3WQRA 1B0ZA 4HUQB 3EA4A 4HLQB 1KFCB 4BECA 3PVSA 1LQLA 4YMVA 3D6UA 1UVNA 1QUVA 2EVZA 1I5EA 4UXHA 4FFRA 5CNMA 3HXQA 1A9ZA 3JQMA 2QD2A 3AIOA 4DNOA 1ZGBA 2ZZKA 1ECFA 3UMVA 3W3AA 1ODSA 1JKJB 5CXQA 5JANA 1RLCL 3EGEA 3TL2A 2RHBA 2LDIA 1D9XA 1Z28A 3GHHA 4TXHA 3NGTA 2ODPA 1JE1A 1WHXA 5ADWA 3KK2B 1I32A 4U3JB 1FJ2A 2J5KA 5K0ZA 2GCGA 4O2BA 3HQ4O 1KYYA 5FA5A 4MIYA 3WYDA 1IEXA 2F4VF 1WELA 1FJGC 4MS1A 4NCNA 2ZAMA 3H5TA 4H9GA 3ZGXA 4LF9F 3BPSP 3W65A 4MPDA 5DBEX 1I94B 1SH2A 3G3EA 3V97A 1A8PA 3DL4A 1H8EA 3AIIA 3D66A 2EFNA 3VPHA 1U0TA 1H1LB 1PR4A 1I3KA 1YZYA 4A8OA 1ZNWA 2JRCA 4YO7A 1EP3B 1FF9A 1N4DA 2XH8A 1VL8A 3HO8A 1TTHB 1M5SA 2QZZA 5AYVA 4O4HF 5LOVB 4EU0A 3VI4B 2OPQA 3FNEA 3H4DA 2PMWA 4DRXB 4UFPA 4X6XA 3A7DA 3KMQA 2C5HA 1N34F 4NABA 5HROB 4JJEA 4CP5A 2VOEA 5JAMA 3WBZA 4UDNA 1DBPA 2WPNA 1FD8A 1T9CA 2CBZA 2AR9A 5TMBA 2EAUA 1SKUA 3K9LA 3E2EA 4GAEA 3CO0S 3W8EA 1P44A 3TRFA 1YD7A 2BHTA 4OYLA 3NORA 1JILA 2RHJA 1ZJ4A 4CV1A 2QR5A 1PC4A 1PP4A 1KPHA 3ZXSA 1Y8RA 3TO8A 5D15A 3C3PA 4DZDA 4UVHA 1TT5A 4JBIA 2EGTA 4BMOB 2O5DA 4K03A 4B6OA 3OZWA 4I1PA 4BGVA 1YJVA 2LZ0A 3HO6A 4TKZA 4FNHA 4YQZA 1DJPA 4H3SA 2PSJA 1Y9DA 2HQBA 2PDAA 2PH1A 2HHHC 5LJ3Y 2P2GA 1U80A 1NQXA 3M2VA 3X2EA 3AG6A 2L17A 4UKDA 3C45A 3L7MA 1MN7A 2F43A 4PWZA 5EXTA 4OI0A 2HT1A 4IFYB 3BA1A 3K5WA 1B6GA 5FUMA 4Z9AA 2P67A 2IIHA 3HYLA 4AZVA 4RJ2A 4IOAQ 3L7KA 1FFSA 5D6OA 1VHQA 1RM4A 3AHGA 4JI2C 4MKFA 4UTXA 3ND6A 3QU7A 3S01A 1REVB 3HD2A 2QZJA 4ZYWA 2YKNA 5HQ8A 2WICA 3QQ5A 3FOEC 4H08A 2YW9A 4FW8A 1W4CA 2MYPA 2IYVA 3AB8A 4YCNA 3L8HA 1WAMA 1F60A 3K71B 4XVQA 1YC2A 2MSEB 5HHTA 2X23A 3EPRA 4BX0A 4QEDA 5JAUA 1SVLA 5IK2A 2X6TA 4PLZA 1B6TA 3DVQX 1R0SA 5H1YA 1D4OA 4WK1A 1DOZA 1J1ZA 2CFRA 2FFAA 1ZJZA 4TVSA 4ZYVA 4XSHA 4Z7CA 1JAXA 3I5UA 5KSZA 4R5PA 3GGSA 4I5IA 1HOXA 1TL3B 4KNVA 1COWD 5K0GA 3B3QA 5FNVA 4CM8A 1LS6A 1JFFA 1QRTA 3HO1A 1LDNA 1LWFB 1IWOA 4DA8A 2VTBA 3EUAA 3IURA 5HBGA 1KNXA 2IFTA 1JU3A 5EXXA 2NP6A 1PHPA 5C8XA 1E0KA 2XNCA 1QR6A 5KFUA 5B6PA 3EHDA 5FJ4A 3QOXA 2AC4A 1AKUA 1RXEA 2BJ7A 2QE5A 3MWDA 1C2YA 1YJCA 3QGHA 3T1HB 5C24A 4CDGA 4BMXA 4KE6A 3K57A 1OY9A 2DTXA 4HS9A 3KR0A 2A14A 5AK5A 2OPHA 2C2XA 2J8SA 4C2TA 2M2BA 1T6NA 4ZOLF 4YV1A 5KFFA 1DQRA 4WZ6A 3J7AN 5D0RA 4I6YA 3MAHA 1T8TA 1C9JA 4LHEA 2R5WA 4MLDA 4ZPDA 1WLYA 1Y37A 5DT2A 2WF8A 3T1HC 2FG5A 3FWZA 1JH9A 4IO0A 3Q9LA 3NC4A 1VZ2A 1QYDA 1JG2A 2NXEA 5AKLA 1BXKA 3L8YA 1V16B 2QP4A 4I4NA 5CVTA 2VKRA 5HBRA 3EZ6A 3TA2A 1F0NA 4Y28C 1K9SA 4ZLNA 3IT1A 4QR0A 3DE0X 5L53A 2I9SA 1AURA 3T7IA 1XNRF 3ETHA 1H2YA 3VNRA 4NAUA 1KHVA 1RTHB 4Y6GB 4V0LA 4X00A 3CF2A 3CJ8A 2CNKA 5GINE 2C2MA 1RPAA 2B1JA 2E5LC 3CKKA 1IR1A 4ZEVA 2ISSD 1SVDA 4OFZA 4MV8A 4I9FA 1Z6QA 3DTVA 2JLFA 2GM5A 4B9UA 5C25B 5CXUA 4ND8B 4QVKA 1Z6AA 5A05A 3ONWA 1T2NA 3MB5A 3WV5A 1CDDA 3D9BA 3TA0A 4OYXA 2H0QA 4U63A 5KTYA 3M8ZA 2JGKA 1PLJA 3ZV4A 2L48A 3M8YA 1XL1A 1ODFA 3ZXWA 1WLSA 2F8EX 4TKVA 3GQVA 3A36A 1RKBA 4ZJLA 1R0KA 4N8DA 2AR7A 1RPJA 2RHSB 4WBNB 1TMYA 2FY8A 5M2RA 1I1HA 3DVLA 1JEEA 1NN5A 3ILJA 3JVIA 4WL0A 5CYQB 1HQCA 3LHIA 2VHJA 3UOAB 5E6SB 4URHA 3FN4A 1E6VA 1SC4A 4PPFA 1RWPA 2XO7A 4RMIA 3AZQA 4OQDA 1FDTA 1RACA 2LIPA 1EAMA 4G9BA 2ZVQX 5KG3A 3HJNA 4W9NA 4NEQA 4UUPA 4L95C 1GY8A 1YOVB 5KYUA 1G6Q1 4AS2A 5FUYA 2FOIA 3MG9A 2OAQ1 2HDWA 4TYBA 4H3VA 3ELHA 2D00A 4NVRA 2RCNA 4IM7A 1VPLA 2Z5LA 2D4HA 3TOZA 1PT5A 1WE2A 2IVFA 2Q5QA 4TMZA 3PO5A 2CSUA 5LWQA 2G71A 2YFHA 1S7HA 3GE9A 3D5QA 1E6UA 4F46A 4WLFA 2XUDA 1UOEA 3H5OA 4EO8A 4NXMC 3MT9A 4KSBA 5KO2A 4ZGGA 1W0JD 5THKA 3PFNA 5JYDA 4WJKB 2OSRA 5ITWA 3LP1B 3TVTA 3DPIA 3HL0A 5D0HA 4FOTA 4ENOA 1TIKA 3PQEA 1W93A 1IEWA 1LKZA 1H05A 3ZEIA 4UJ3A 2D06A 3OBBA 3ZJTA 4DV6C 2FDXA 3DZCA 1GAXA 5K2MA 1GN9A 3DBOB 3RTGA 1UBKS 2YYSA 4LWPA 1HHQA 2YV2A 4YRGA 3E3MA 1Y80A 4PYAA 4MWDA 1IY2A 4GFDA 2ZJPQ 4LSNB 4GHWA 2OBVA 2AZMA 1RFLA 1VLQA 2ATLA 2AK3A 2LA4A 2G4BA 3KHSA 3UWTA 1AFJA 1EQAA 1M76A 1GARA 3RFXA 5GVSA 2V4UA 3HZEA 3CW9A 1Q7BA 3GZ7A 4HBZA 2WK1A 1PBUA 3F3KA 1J23A 3TH5A 1JIUA 2QS9A 2MHNA 1GXSA 4PYJA 1T4MA 4QOSA 4EP1A 2JDJA 3OVAA 3IVGA 4DI6A 1UBTS 2ZJ5A 1OFHA 2CPFA 2OMEA 4NENA 5HZHA 3DH0A 3FUXA 3JRXA 3K9FC 5CB4A 5I4CA 2FN9A 4DQKA 2SXLA 4HUTA 2SBTA 5F3WB 3QIVA 3FE2A 4H7HA 3IXQA 2G17A 3L8ZA 3KQNA 3GJ6A 5DDOC 3CEMA 2J9CA 5SZKB 3VV2B 1L1FA 1N2CB 3F5MA 1QVFR 3B2NA 2CF6A 1MQSA 3CPWR 4PZYA 1KAMA 1QKKA 2YWFA 2FWAA 3AB7A 3E27A 3OQMA 4ZALA 1RE1A 1ISRA 4X3PA 5L7YA 3UGQA 1I6LA 4WOJA 5C7PA 2I1RA 1U2TA 3ZZNA 3G8SA 2VN8A 2XVXA 4OAQA 3IP8A 4O4HA 2KB0A 2AN5A 4LRFA 1FMJA 4BKOA 2JVKA 3EULA 5AWFC 3VAKA 3EYWA 1JLBB 2KO1A 3C6UB 1CVJA 2H07A 3PFBA 4ZVPB 1HR0J 1QGOA 2OGWA 2M9KA 1UEXC 3A3YA 2GTPA 1LBEA 3FYUB 1Z2CA 4XAKA 3PYXA 3RFFA 2XY4A 1QZUA 4JT8A 1U8YA 1O6ZA 2EF1A 2JSXA 5GM2A 1SVNA 1E2IA 2VICA 5CX1A 4IDKB 2RONA 5E1BA 3UYLA 2J33A 3WFJA 1DO0A 2CF5A 4PSDA 3UKDA 1T0JB 5C46F 1CC1S 1U4NA 3RUAA 2H11A 3P5BA 2R25B 4B0PA 2FPGA 2XVYA 4RFSB 4YB8A 1Z13A 5TGTA 1DRJA 1TYDE 1KU0A 4XX0A 4DQDA 2MSDB 3RBZA 3GYGA 1EBUA 1O3YA 1NX6A 3LUSA 4KCGA 4LDZA 5LP1A 1U7ZA 4J9MA 2Z6VA 1G8YA 2BDUA 4HFMA 2OLKA 2BSAA 2QRMA 3UT5A 3J80Y 2IW3A 1Z0SA 2DUJA 1OWMA 1WEXA 4E09A 3GLGE 3GFFA 3KEFA 3PHBE 1CB0A 4DG1A 5K8IA 4J7CA 5HRAA 3EPPA 5KYWA 4B4VA 2KVIA 2GV1A 4OQXA 2P2ZA 2DC1A 4HZGA 2GYYA 4R2IA 1HLGA 4MDEA 2NO4A 2IRXA 4EZ9A 1C1CB 2WNSA 3BZQA 4MB2A 4FOOA 1E3TA 4C20A 5I7WA 1EGVB 1XRCA 4GPZA 4A10A 1M6XA 2RIJA 1QGDA 2B1IA 4OSOA 2YZ7A 1ML4A 2F1KA 1II9A 1LBTA 2P69A 2UUCF 1YDHA 5L95A 1F60B 2AE2A 4WTYA 3NAQA 2X5KO 4ZOBA 1ISMA 2KFYA 4N3NA 1JWLA 1XTQA 1JR6A 3EZLA 3DTNA 3O3MB 3CIZA 1VL2A 2L2QA 2X41A 2EKNA 2XO6A 3F73A 1DLJA 4DX8H 1GFSA 2QA2A 2X7XA 2ZULA 3BH7A 2FFHA 4UQPA 1M7GA 1DHTA 2RGGA 2HMAA 1P5RA 4KDEA 2VDQB 4Z9XA 4XWGA 4OGKA 4KHPC 2ZTHA 1AXGA 5ILGA 1NOIA 1CJTA 3V2UC 4X65C 2OZPA 5KOWA 1M2NA 4NBTA 1WZCA 3PRHA 4ELTA 4LC1A 4PZZA 2BKNA 3NV7A 2QRRA 3LA0A 2V7TA 2IDZA 3K58A 3Q6MA 1QAIA 4MW4A 1Z4JA 3LBNA 2PUFA 3K0SA 4CNQA 1QVWA 2H3EA 3SS9X 4DR1J 4ZPXA 1NW7A 1XVVA 5FLXY 3D5EA 3R5JA 4KQ9A 1BN7A 3UGJA 1T26A 1NTRA 4M5HA 3DOOA 1VG0B 1RZRD 1W4AA 4CKZA 4HT5A 2GHQA 3V4FA 2RHTA 5D4LA 2VCHA 4V1Ak 1WHYA 2GIRA 2XA1A 2ZIAA 4ZYLA 1LRJA 3E9YA 5KAPA 4PN7A 4R98A 5DNVA 4ZVSA 1QGYA 1S79A 1Z29A 2C20A 2OKGA 3DZ8A 1GGFA 5ICMA 4AQYF 1C8BA 3WRVA 4KVAA 5DIZA 2AYXA 5LB4A 1JSZA 3CKMA 3S1LA 2NZ2A 2HGMA 2XB6A 3CIOA 4K5QA 2CFIA 4YTEA 4IG0A 3FFWA 4LFCJ 1HZJA 4A8KA 2NN3C 5LQDA 2VQEJ 4BS9A 3C15C 5JFOA 1UP7A 1T95A 2BM1A 2CZCA 2BDTA 3QTLA 2OKQA 3OC6A 2YMMA 4YV7A 4BX9A 3KHGA 2WDPA 4M22A 4GYYA 4J9KA 2OO5A 3CJKA 1HI9A 4AZSA 3T12A 3ETDA 3K3PA 3BVPA 3D81A 1PG0A 2XDQA 3MGBA 4IX1A 3I5BA 2YY3A 4PBSA 3DM9B 3P9CA 4IILA 1KEKA 3GIMA 3RRYA 1IOWA 2QN2A 5IM5A 5F77A 4LZAA 3KPJA 3G0HA 1X7ZA 4EA9A 4X1IA 4WINA 2BUNA 4FYYB 1JJVA 5AKIA 1YZTA 4R7TA 1TL7B 2XE8A 4Z7OB 3FOZA 3FCHA 1BX1A 4J16C 3VGUA 3SSMA 3WYFA 2VWQA 3K4HA 1QG0A 2VVTA 2FGCA 1CQMA 3WJ7A 1G3OA 4A0RA 1J5EB 3OQOA 1J7JA 4DN9A 2VTVA 3KV1A 3VF0B 1QVGR 3UMFA 4OLPA 1UIMA 1IL0A 1VJGA 5AKEA 2J6UA 3V9PA 1BQNB 1M8FA 1RFGE 2AQ8A 4NHEA 5F12A 4UXJA 3HDYA 5KFKA 5L9XA 4QAJA 4Q2LA 5EPEA 4MVJG 3T0FA 1RHRA 3PC4A 5DYYA 5T67A 2XMJA 4X1KA 5C5IA 5ISMA 3COZA 3EWAA 2YKMB 3GDGA 2L9DA 3BTSA 3V6JA 2C8VA 2AEMA 1E1DA 3E0XA 1FDSA 2I6QA 3TRIA 1IRXA 3QO9A 5C8DA 5DLPA 4MS4B 4HWOA 3ZWPA 5E1OA 5KT5A 5F76A 1REQB 2G28A 3H42A 4Z0PA 3G5UA 1P77A 1FBTA 2BPOA 4X63A 3TTTA 3PWKA 2PKWA 2JA2A 4L0DA 4S24A 3VNVA 1NE2A 1ODKA 4JI4F 4Y2KA 5FIUA 3QF7A 1Q0RA 1YDFA 3CSSA 1DFGA 9ABPA 4I5DA 3DF9A 2QI9F 1TJPB 1RTDA 5KDLA 4IJUA 3OA0A 2EG9A 3VHXA 3WQHA 1UBLS 4PNEA 1H2XA 5ETRA 1V8FA 2CNLA 1RAAA 3P2YA 4RVUA 2MLYA 2QLJB 2C95A 2GFHA 2GPWA 3ZQKA 1IKXA 3JZFA 1FYDA 3HU3A 4RTRA 1P80A 3ZXXA 2DH5A 4O5AA 2E0IA 2UXBJ 2D7CA 2QKYA 1ZWLA 3RAEC 2D6FA 4NMXB 2IP1A 2HHHB 4P3KA 1N6PA 4BFZA 1P1KA 1DHRA 3CJ0A 3U4QB 2ZE2B 2DGQA 2M6KA 3TLAA 1HDXA 4HRVA 3AUSA 4EMBA 4MUMA 1VI5A 4Y30A 4IWNA 3VVLA 4ERNA 4UQTA 3B1WA 2B9VA 1ZIOA 1WC0A 2YNIA 4LIRA 2K7ZA 4O4LF 1UVLA 5JTTA 4AQ7A 4AJOA 1P4JA 2AYZA 4TS1A 5CB6A 2DNPA 4QECA 2YVAA 3CN7A 4M5JA 2W2OA 5G4KB 3NUQA 2EDAA 2DCUA 1M1UA 1LZKA 1NFRA 2DQKA 4LRTB 2CHUA 2VRCA 2OHFA 4NBNA 2HNBA 1JDBC 3J80A 4FYIA 1PZNA 2BOPA 4WS9A 1UADA 1V7CA 1YL6A 1A97A 2WJ3A 1RIIA 1AV7A 3KQYA 3B9RA 1C1XA 3TNLA 2QWXA 4C8NA 3BWEA 3MM6A 4N65A 1R0LA 2C4NA 2P5YA 3ESCA 4BNNA 3NCTA 4K6FA 1UKCA 4L0MA 1KFEB 1RXVA 4KZKA 3Q5EA 4K26A 3S1AA 2EFVA 3I58A 1HARA 2W4CA 2OY0A 1AB6A 2F1JA 2C8KA 3AEUB 4Y2GA 4YRRA 3M9NB 1ATZA 2EKBA 1CE8A 2W9XA 1P2SA 2SCUA 2IYSA 4ND1A 1G20A 1UBSB 1FFHA 3GEGA 2Y92A 5C8VA 2BF7A 4MKIA 2VFAA 4DL3A 4LHVA 1M1ZA 3ZQUA 1U9IA 1BQXA 1NUUA 1W36C 2E44A 5H9FJ 3VM6A 5F33A 3BKUA 2ASDA 1FFXA 3RDPA 4K4ZA 3RRGA 2NNLD 4C0BA 2FUEA 3B1KA 5A71A 3KPYA 2YZNA 1DBQA 2QG6A 1KMQA 5B55A 1HH2P 3SO4A 1MB4A 2XMVA 1SWVA 3KKKA 3FD8A 4TXNA 1TK3A 1LVGA 3QTBA 4LCEA 4UREA 5FWDA 3S2UA 2JAUA 3W60A 3WMFA 3FOWA 4F5EA 4W7HA 2E4VA 2O06A 1OUMA 3E5NA 3NHYA 2MKHA 1ZESA 3B82A 5MGNA 3NJRA 4JA0A 3GP5A 2I78A 1YZHA 2Q43A 3PE4A 2FG6C 3H9JA 3ES9A 4N77A 4URVR 1RC1A 3KR9A 1R0CA 3RW7A 4GR4A 3IBGA 1AGYA 4D4IA 1OILA 4D9EA 5HQTA 5LP6A 2XYVA 5IQQA 2CU6A 4GMGA 4LDAA 2R751 4M1QA 3AP1A 2QJOA 2DR7A 2PGXA 1E4EA 4LF9J 4H7IA 5CG2A 1OXVA 1X80A 3KK1B 5AXDA 5IS2A 3IVMA 1S9GA 4H77A 2GJKA 3U4AA 2HJVA 3W77A 1SK8A 2AN4A 5K3CA 2OSVA 3GLGA 3GJQB 4JP1A 5K6AC 3RNLA 1QK5A 1FXSA 5L8RC 1BS1A 2ZOSA 1E7QA 3ICPA 2O5RA 4HAXA 1WTBA 4K9PA 4NS4A 3U17A 3C4JA 1VQLS 2X5XA 2M5HA 3ET4A 1UZLA 4D8WA 2AFHA 3UK2A 2OCPA 2CJXB 1I2BA 1W5TA 1OLUB 2OR3A 2Z4RA 2MM9A 2HA2A 3K9BA 2B4UA 4EY5A 1GGVA 1D1TA 5ICSA 1TZ2A 4OVKA 2ZJQQ 3F0TA 3D4JA 4W5OA 2ZSBA 4H1WA 4HT7A 3EDYA 3S1SA 1AQIA 2JNJA 1BIFA 4KRXA 4P54A 4RCYA 4UFNA 5AXBA 2JFGA 5C5EA 3MN1A 1W36D 1LY1A