2ZZNA

The complex structure of atrm5 and trnacys
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
336
structure length
336
Chain Sequence
MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords Uncharacterized protein MJ0883
total genus 81
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zznA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zznA03
5K0EA 5ERGB 4C03A 1PJZA 3I5UA 2IP2A 3KPYA 5EKUA 3TMAA 2NXNA 3B3JA 1ZGJA 1HNNA 2O0LA 2VDVE 3ER9A 2I9KA 3DLIA 1RJGA 5CD1A 2JH9A 3UA4A 3HEMA 3ME5A 2PX2A 4P58A 1X1DA 2P1DA 3PTAA 4OQDA 1P91A 2HTEA 4AX8A 2AVNA 4ER6A 3FPEA 1MJFA 4GQBA 1ZGAA 4L7VA 5ICGA 4DCGA 2PX4A 2YVLA 3FRIA 5EZQA 4CKEA 1JQDA 5FCDA 3O4FA 4PIPA 1X1AA 3LPMA 3THRA 5K01A 1DUSA 4LWOA 2YQZA 3JWIA 2EG5A 4F86A 4YV0A 2AN3A 2CL5A 3HM2A 4ER0A 2UYHA 5LQAA 3OZTA 4AUKA 2GS9A 3I58A 1QZZA 4MIKA 2C7OA 1M6EX 4FGZA 4M38A 1KXZA 3HVHA 5CVEA 1O54A 2AOTA 2ZW9A 3NWEA 5DX0A 5HIJA 2E5WA 3T7TA 4DMGA 3M4XA 5HEKA 2JHAA 3SX0A 1NT2A 5E9JA 3FUUA 1FJXA 3DR5A 4QVKA 1BC5A 4RYLA 5EGSA 5P8WA 4AZVA 4BP1A 3BXOA 5EEGA 3EVGA 3M70A 5K0BA 3NJRA 5HOQA 9MHTA 3I9FA 1D2GA 3ELUA 3FPJA 4DM3A 1KPIA 2FCAA 3B5IA 3LSTA 5E8RA 5DTQA 4E2YA 4QPNA 3TM5A 5FA5A 2Q41A 3BWBA 3EMBA 2B3TA 2CMGA 5K8VA 3K0BA 1SQGA 4F85A 2BR4A 1HMYA 1N7JA 1G8AA 1SUSA 3GIWA 3OFJA 4QTTB 2ZFUA 1R18A 4QVGA 2UZ4A 1G60A 4BP3A 2VDUE 3QOWA 10MHA 1AQJA 4PIMA 4RTNA 4KDRA 3T7SA 3UJ8A 1IXKA 5GWXA 5EZSA 4G56A 2ONYA 5E2BA 4E30A 4PONA 5FHQA 2DPMA 3LKZA 3FTEA 2WA1A 3GJYA 4PYIA 3KQMA 5EIWA 2B9EA 3FPHA 1KPHA 3K6RA 2Y1XA 4QPPA 2AOWA 5GOZA 3C0KA 5B1SA 3P9CA 4FZVA 1KIAA 3FYDA 1SG9A 4HSGA 2G8NA 2P3OA 2QYOA 1BOOA 1VQ1A 1YF3A 4PYNA 4P7KA 2ZIGA 2Z6AA 5D1HA 1NE2A 5HIKA 4KDCA 4P7JA 4RTSA 4RTJA 2ZVJA 2P7IA 1WXWA 3TRKA 4M7RA 3GCZA 1RI5A 3AXTA 5DSTA 4KVZA 2OZVA 1R8XA 5EHGA 2IH5A 3DTNA 5K0JA 3DMFA 2ZZKA 3BWYA 3M33A 4GOLD 2EJTA 1N7IA 2ZIFA 4HGYA 2I7CA 4O29A 2H00A 3GWZA 5D1NA 5DLYA 2VP3A 3UA3A 4RVGA 3X0DA 1N2XA 5CVVA 1JQ3A 1JG2A 3JWGA 3EGVA 4XUDA 3UJ7A 2BM9A 2O05A 2BM8A 4V0QA 2GAFA 3RW9A 4PYLA 4RTPA 3KQPA 3GXOA 2ZBRA 3JWHA 1QAMA 4OBWA 4PYOA 5EHIA 4C07A 3V97A 4X63A 2QM3A 2G71A 3GRVA 4YUZA 2PKWA 5DXAA 1VP3A 2WK1A 3OFKA 5T67A 5LQCA 4KIGA 3MTIA 4AZWA 3G2MA 4DZRA 1R8YA 3KR1A 1WY7A 7MHTA 4HC4A 4YV1A 2OB1A 3BKWA 3AWIA 5FQOA 5T6BA 3WSTA 4FR0A 3P71T 4BY9E 5DSXA 1P39A 3BGIA 5DX1A 2NXJA 5DM2A 1VBFA 2FHPA 3UZUA 5BXYA 1AQIA 5ICEA 4FSXA 3E8SA 4PCLA 3FUVA 5KVAA 2P41A 3OPNA 4PYKA 1SQFA 3HNRA 3TKYA 3E23A 4KW7A 3DLCA 5FULA 5HIIA 4FP9A 3PX2A 3GDHA 4PGGA 4WVLA 3R3HA 3A7EA 4B17A 2OO3A 1T43A 3KPUA 4HG2A 1G55A 3C6MA 5DM0A 5EMLA 3TQSA 3UWPA 2P35A 2PT6A 2ZWVA 2QRVB 3TLJA 5F2KA 2IFTA 3IYLW 3DXXA 3KR2A 4MTLA 3B3GA 4PWYA 5EEHA 1D2HA 3GU3A 2OXTA 4PYMA 1ZG3A 1P1BA 3HP7A 3HVJA 3U81A 3SMQA 1M6YA 4ER5A 1NKVA 5CCXA 5EC8A 2C7QA 4P7FA 3LBYA 4K6MA 5EMJA 3TPZA 4RTQA 4YUVA 1JG1A 2ZBQA 2XYQA 2AN4A 1ZKDA 5DTMA 3GRZA 2QY6A 4A6DA 1JQEA 2VS1A 3B3FA 3HCBA 4RWZA 4ER3A 2O07A 3EPPA 4RTLA 3LECA 3GRYA 1L3IA 4GF5A 2IH2A 2N47A 5CCBA 4FT4A 2ZULA 4RVDA 3EEYA 4ISCA 2JH8A 4A6EA 3PX3A 3I53A 3EVBA 2YXDA 4GEKA 4ER7A 2GA9A 1B42A 2AN5A 2V74B 2PSSA 4E32A 5FWDA 1R74A 2ZIEA 5C9ZA 1WS6A 3FYCA 3CBGA 3EVZA 3ER8A 1VIDA 1VE3A 4H0NA 3TOSA 3FTCA 3MCZA 1VLMA 2PXCA 3SSMA 1WG8A 2A14A 3KQQA 1KPGA 2YTZA 2HWKA 3GRUA 5CVDA 3KQYA 1IY9A 4LG1A 4XUCA 3H2BA 2JHPA 3LL7A 3LX6A 4XCXA 1EJ0A 1RI3A 2BR5A 2I6GA 1G6Q1 1XTPA 2R6ZA 2PJDA 4KWCA 3MGGA 5FADA 1TPYA 4C04A 5LQKA 1RI1A 1AV6A 5ICCA 3M6VA 4JXJA 1R00A 3G2OA 3FTFA 3NDJA 5KYGA 4OBXA 1RJEA 2UYCA 2OKCA 2PX5A 2ZLBA 4Z2YA 1XDZA 3R24A 3C3YA 3JWJA 3UJBA 2P3LA 2JG3A 4FS8A 1JG4A 2ZZMA 3EMDA 4R8RA 1X19A 2QRVA 5LQUA 2JJQA 2HR1A 1VP9A 5K0NA 3IHTA 4RX1A 2P7HA 3P2KA 3VC2A 3A26A 2PLWA 2YUIA 4RV9A 2ERCA 2AOVA 3DMHA 2G70A 3UFBA 4R6WA 3NW9A 1ORHA 3KU1A 3PB3A 4X61A 5CVJA 3Q87B 5EVJA 2IGTA 4PGHA 3L8DA 2ZCJA 3PLAE 4RTKA 2NYUA 4YMHA 3V8VA 2G1PA 5EKXA 4PCAA 3C6KA 1VPTA 2EJUA 3CCFA 1YZ3A 3CJQA 3QV2A 2AOUB 1EQAA 5E9WA 1BHJA 3LCCA 2PBFA 3LGAA 1X1CA 2XBMA 1SKMA 4YMGA 4CTKA 5F2NA 2CMHA 1F3LA 1QAOA 5E1DA 1KYWA 1IM8A 2HNKA 3REOA 2GB4A 4E2ZA 1EAMA 3HCAA 3CJTA 4BLWA 3G5LA 4IV8A 5CUQA 5DTRA 4AZSA 1YZHA 5DX8A 1D2CA 1NV9A 1SVUA 3OU7A 3CVOA 1EG2A 2OYRA 5K03A 1INLA 4UOEA 3BGVA 3DP7A 4NECA 3KPVA 3M6WA 1DCTA 2ZWAA 1L3BA 5F2OA 3UJCA 5EMKA 2C7PA 2XVAA 2P40A 4R8SA 3RODA 3RIEA 4Y2HA 4YUWA 1M0EA 3A25A 2OY0A 1L1EA 2P3QA 4KRGA 4POOA 1BKYA 3PT9A 4PYJA 5LQNA 2PWYA 1P1CA 1NBHA 1O9GA 2XYRA 3EVEA 2F8LA 4GC9A 2OB2A 2YR0A 1G8SA 1AF7A 3SVZA 3LHDA 2YXEA 2CKDA 4M37A 5HFJA 3SXJA 1F38A 5FWAA 1VL5A 3CKKA 2Y1WA 4MQ4A 1NW5A 2BR3A 3P97A 3SSOA 3TR6A 3HCFA 3HVKA 1UFKA 2AVDA 3FUWA 5JUWA 3MHTA 1NW3A 3MQ2A 3NDIA 2H1RA 3DMGA 2VDWA 5E1BA 2IDJA 4DCMA 5JR3A 5KQRA 3A7DA 2UYOA 2ZBPA 1UIRA 3NWBA 5BW5A 1NV8A 3KQSA 5K0GA 3ORHA 3DXYA 3ANXA 3DUWA 1Y8CA 3HA3A 1ZHFA 3UJ9A 1JG3A 5CIYA 1NBIA 2FK7A 4R05A 4X41A 1XVAA 1I4WA 1L9KA 1Q0SA 2XYVA 4GUAA 3BT7A 3SGLA 4EMSA 2O57A 3LDFA 1RJFA 3R6TA 2Z6UA 3P9KA 3TKAA 5GIPE 1H1DA 2PX8A 3KR0A 2PV0A 1QAQA 1OR8A 5CVUA 1WXXA 5EMMA 3NVMB 2CWWA 3EVCA 4QDJA 1NW8A 4P7GA 4Y30A 3EVAA 3P2EA 5G02A 4BLUA 2EFJA 5C0OE 4HRAA 2PXXA 1SUIA 3MCTA 5EQJB 1JTFA 2IDKA 4E2XA 4YUXA 4EVIA 3FPFA 1Z3CA 3G88A 2AOTB 3B89A 1XDUA 2YXLA 3B7PA 3ELWA 3THSA 2EX4A 1XXLA 5GIOE 4C08A 3KQWA 2ADMA 2ORED 3MAGA 5DM4A 4E70A 3HVIA 1RI4A 4QTUB 4RTMA 2R3SA 4KIFA 4DA4A 3QOXA 5BP7A 3P9NA 1FBNA 1FP2A 1O9HA 1MHTA 1EJ6A 3EVDA 1X1BA 3UJAA 5HZMA 2YX1A 3G8AA 3BWCA 1PRYA 1V39A 3ID6C 3PFHA 3OZRA 3E05A 3OE4A 2IH4A 5KQSA 3AJDA 1JSZA 4QDKA 5C1IA 3LBFA 2FPOA 2ONZA 3R0QA 2HV9A 3T0IA 3ELYA 1JR4A 5E1MA 3UJDA 1FP1D 5DXJA 4ATNA 2OBFA 1U2ZA 4R6XA 3FPGA 4FSDA 3OZSA 4C06A 3OCJA 3P2IA 3PS9A 3ELDA 4LWPA 5T64A 4PNEA 3I64A 3M6UA 2GH1A 2PXAA 1L3CA 1TW2A 3G8BA 3P8ZA 4EK9A 4MWZA 3DOUA 3UJ6A 2WA2A 3KHKA 5LR6A 4GC5A 5GP1A 2ZZNA 2XVMA 1KYZA 2LD4A 3FUXA 3HA7A 4XUEA 1UWVA 5MHTA 3FRHA 2H11A 1RI2A 4C05A 4RTOA 3G2QA 2FRXA 4OQEA 4GOND 2NNWB 4RVHA 3CJRA 3DULA 2BH2A 5E8JA 3OE5A 2B2CA 3KPJA 1I1NA 5M5BA 2OPBA 2PT9A 5K05A 4IKPA 5FTWA 3FUTA 3KPWA 3GRRA 2I62A 2IPXA 3LCVB 4CKBA 3IV6A 3DH0A 3TFWA 4EKGA 3GNLA 3FZGA 3HA5A 4HTFA 3CGGA 4CWAA 1Q0TA 2B25A 5LQRA 4GOOD 3NTVA 3KR9A 3TM4A 3NMUF 4FT2A 2PGXA 4YUYA 2JHCA 2NP7A 2FK8A 3C3PA 3LDUA 8MHTA 2NP6A 5ICFA 4GBED 5EPEA 3EEOA 3SSNA 5CM2Z 3VC1A 5U4XA 2BZGA 4CXMA 2NXCA 3E7PA 1JSXA 1NW7A 2ESRA 3KQOA 5EIFA 5BW4A 5HIMA 4OX9Y 3DXZA 3MB5A 2P8JA 4RSRA 1R6AA 5FQNA 5LQJA 5DRYA 3R9XB 3BUSA 1KR5A 3G89A 4HH4A 3LKDA 2PY6A 4DKJA 1ORIA 5FA8A 4DF3A 3VYWA 3VSEA 4X1OA 5DRTA 4F84A 2C7RA 3P9IA 3PFGA 1KHHA 2AS0A 2PVCA 3KKZA 2UYQA 4BLVA 5E9QA 1RJDA 1XJ5A 2AR0A 3M6XA 3G5TA 2AOUA 4EQZA 3BWMA 4X60A 3G7UA 4OA8A 4WXHA 5EOVA 4M36A 5KS2A 5GM1A 4V0RA 5IH3A 3LCUA 3CC8A 3OU6A 1XDSA 4IV0A 4CKCA 3S68A 1YB2A 2KW5A 3D2LA 3G2PA 5H02A 4DQ0A 3NVKI 2ZSUA 3HCEA 3MTEA 4QQNA 2AOXA 2DULA 2G72A 4U7PB 5GINE 1YFLA 3SR4A 5HILA 4ZTBA 5E1OA 3GO4A 3O31A 4E31A 1KP9A 5K0FA 2GPYA 3O7WA 5DT2A 2IBTA 5DWQA 1YFJA 1JTEA 5IKMA 5GM2A 2GLUA 4U7TB 2PWPA 1G38A 1WZNA 1QYRA 2NXEA 4HGZA 4QQKA 3A4TA 4RTRA 3HTXA 4YV2A 3ERCA 2B78A 4HTFB 3F4KA 2K4MA 4PINA 2AZTA 4CTJA 4MHTA 3AY0A 4GOMD 5K0CA 3GGDA 5K09A 1ZQ9A 2IBSA 4C4AA 1TW3A 1EIZA 3BKXA 2FYTA 3BGDA 3AXSA 1XCLA 2ZTHA 1DL5A 5K0LA 3EGEA 3HCDA 1I9GA 3A27A 3PVCA 4IWNA 5DM1A 2QE6A 4LECA 4E33A 3UBTA 3IEIA 3HCCA 5FHRA 5LSAA 1YUBA 4PYQA 3BZBA 2Z6QA 1FPQA 4E2WA 3KQVA 2O06A 3EVFA 2V7EA 3LDGA 3OU2A 5DPMA 3FTDA 3MERA 1XCJA 2HMYB 2IIPA 3Q7EA 4OA5A 4AZTA 4EKIA 3KQTA 1QANA 4RVFA 3SM3A 5FUBA 5E2AA 3EGIA 2VZ9A 3T7RA 1NW6A 5EG5A
chains in the Genus database with same CATH superfamily
1F9HA 1YZVA 2HJWA 4Z0TA 2AD1A 4NJOA 3OTOB 3N4WA 1ZGGA 1U8CB 2J31A 1Y1RA 5FCDA 3VYUB 4FNMA 1RWPA 4FFLA 3CUUA 2PYZA 1UL3A 2AOTA 3JS9A 4TKTA 4QOIA 3HJNA 1RAJA 3VXKA 3B6ZA 4RNMA 2LXFA 2X1BA 3RI3A 1E1DA 4NG4A 2HWWA 2HFZA 1PT7A 4OHCA 2CVHA 1UAAA 2D1CA 3GJ0A 3AR9A 1I3OB 3MJ4A 4NHEA 1JLLB 2HW3A 1YRLA 1R18A 4KHMA 2EERA 5JD5A 2R8OA 2YWKA 3FWNA 3BV8A 1P2BA 4C48A 3KZKA 4LYFA 4NS1A 2O8BB 3IAAA 1Q74A 1GU0A 3KLHB 5J47A 1UC5B 4H3VA 3MM8B 1KI9A 2AJTA 3SEZA 1ID1A 2IH5A 3DBHB 1POWA 1D9AA 3IXLA 5DLYA 2FVYA 5KAPA 3DYVA 3JSAA 1RFLA 3HY3A 1Q19A 4ES3A 4QFDA 4B6FA 1JHVA 2JA1A 1LW0B 1N1MA 2Q3HA 3EUNA 4C89A 2APOA 3M2UA 4KX3A 2ZIXB 3K09A 3V4SA 4JI6F 1SXJA 4ZQIA 5DSXA 2PL1A 4A9AA 3G6ES 3VX3A 3C3AA 5KWJA 1W44A 4FCVA 4I4LA 4Q03A 4YCMA 1F2TA 2ZXUA 3KR2A 1C7ZA 4MTLA 2FX2A 3YASA 4LBWA 4QUIA 3IP6A 4XASA 1RYZA 3IMGA 1N78A 3PPVA 2JGMA 3UAOA 3T1HC 5DMXA 2AUMA 3UOGA 3KUCA 3BDAA 1WB5A 5EJ6A 4Q4HB 2DGUA 1IOVA 2VF2A 3ZWKA 1ZXXA 1H7WA 3FEZA 4XUCA 2QA5A 4UOGA 1JHOA 2IHKA 3GT0A 1P9LA 3F2IA 3GEIA 3AIOA 1E1RD 5GVQA 4RPFA 3TNDA 5A9SB 2F00A 3FC9A 4HDKA 1XDZA 3AEQB 3QIPB 3COWA 3AM3A 4DE5A 1FWLA 1N34B 3VI4B 1RIIA 1I3KA 3W4IA 1S49A 4GLJA 3PQCA 3RC7A 2FKNA 3D1JA 2RB7A 1X9HA 1LEOA 1U0SA 4GOJA 4QTXA 3Q8YA 4KTVA 3VCDA 4KMSA 4WNAB 4XOUA 2O14A 4ZQHA 4RSMA 4E2ZA 3KXLA 4C6RA 1YZHA 3KVOA 1RKJA 1HXHA 5IWCA 3DYIA 3O3MB 4JI5F 4C97A 1QHIA 2SICE 5DHRA 4CV0A 2B21A 4FNHA 4ZO9A 1Z6PA 1T8PA 1UBFA 2C31A 5JXHA 4JHXA 4L75A 2KB0A 4X5OA 2XNKA 3MGCA 3U1TA 5J2MB 1CEXA 1GUBA 3OM9A 4INJA 2MYUA 4B3RF 1J20A 3RTGA 1UZUA 3LX8A 3W5IA 1U8TA 3L8GA 1HI8A 3T4XA 4CLTA 1I14A 2P6PA 3FF1A 2VTVA 1V5WA 5GIPE 3O95A 1U7HA 3IUBA 3LC2O 4AS3A 3OTWA 4JR1A 4TKVB 2R751 2EJBA 2CJYA 1SUQA 3PESA 2XNDD 2PUDA 1V5VA 4J6FA 1D0SA 5LBTA 5DT9A 4QTUB 3DEYX 3ZJVA 2ODAA 3UJAA 3Q8UA 1K27A 3P3DA 2J9CA 2G82A 4IL5A 5ICSA 1UT5A 1QD1A 4LWPA 4MI1A 4MARA 5CYGA 3USZA 2J0WA 3O8NA 1TM4E 1ZM9A 1Z6YA 2P6TA 3PE6A 5KFVA 1QSLA 3MMCA 3HN6A 4ENTA 3D6AA 2C94A 2W71A 1J25A 5JXIA 4EB6A 2B8PA 4CWBA 1IK6A 2VPYB 1CEYA 1JHMA 3UX3A 2JVJA 3KYIB 1FFDA 3FMOB 3IDAA 4TY9A 1SUEA 5D4OA 2QRPA 3T5DA 2Y1KA 3E2PA 2GJKA 2P0EA 4DR6F 4YWJA 2J4DA 5LB2A 1E7RA 4DM4A 1CHDA 2NXEA 3OCWA 4UOHA 2XTZA 2X3FA 1CHNA 3NDBB 1YQQA 4BCDA 3P7MA 1A98A 3IEIA 3ZTOA 1H0SA 1KMCA 4RVFA 2NSBA 1TUGB 4OHRA 5BVGA 2QTLA 3H4MA 3NXKA 3HSSA 1STOA 3U80A 3Q2OA 5B0FA 5K85A 5HO4A 3LKBA 3PZRA 4UTZA 3CJEA 4LFAJ 2XXJA 3UMCA 4ZYUA 4FF2A 1P6TA 3KSUA 5LQAA 1YS1X 1SVLA 4TUYF 1SUFA 3NDRA 3C6XA 3PW5A 3MG9A 1ZMTA 1PR3A 4PLGA 4KR9A 1P9QC 3GEHA 2FF5A 1ZK1A 2QU7A 1W52X 1WLYA 3HKCB 5B1EA 3BK7A 5IWAJ 4P2XA 1RVDA 3QW4B 3S99A 2W2OA 2WIKA 5K1ZA 2WSYB 2WJ4A 1Q1EA 1TJ3A 4FYYA 3CIZA 1TK9A 3AY3A 2D69A 2PCLA 4ZZIA 3GT7A 3WKDA 4D46A 4Z5XA 2UVPB 1JNXX 2VOJA 4O5AA 3QRPA 2ZYAA 1KQGA 3NKFA 1TAQA 1E0SA 4C14A 1NLKL 3D0GE 2HNZA 5KFKA 2BFMA 3FFTA 3STHA 2VUGA 4N76A 4QPTA 4X20B 3OZWA 3C7TA 4K6HA 3JR7A 1C7QA 4HDSA 4MVJI 3EY9A 1RT5A 4ZLPA 1NP3A 4X84A 4FTWA 3JQCA 4AY6A 2R6DA 3AUAA 5DK6A 1RCXB 4YUVA 4QZVA 3STXA 3I45A 4Y34A 1VSTA 1KOFA 2GA9A 5KSPA 3U1LA 2Y27A 4KFBB 4ABTA 3KZOA 3AF5A 3L6UA 2YH0A 3LW7A 3ND6A 3N2GA 1HH4A 5B7QA 5A7GA 4RD3A 1BVRA 1W49A 4AT1B 2BQRA 1BWPA 2A3RA 5JNUA 2VF7A 1XTPA 5FV4A 4E08A 2GLXA 3CLVA 1IN4A 1EVLA 4DR1C 1YOVB 3W5VA 1CUYA 2MJLA 3E6AA 3VGTA 3VF0B 2KG1A 4XJVA 2HS4A 6FDRA 2RHLA 1AC5A 4OYWA 2DNZA 5FWYB 3H5UA 1HQEA 5EXXA 4YAFA 1B0PA 3I2FA 3CRZA 3PSHA 3LUSA 2ECFA 4ZLJA 1S3SA 1F5AA 2PPVA 4MKHA 4PC7A 1ZVJA 2PGCA 3Q6NA 4YMGA 2MKCA 2CYCA 1LTHR 2G6TA 1F6WA 2D2EA 1Y5LA 4XYEA 2CXTA 2DD8S 2QR3A 2C7BA 4A8HA 3CVOA 2C5SA 4EUNA 3QH4A 4LE5A 1K8YB 1NX9A 1SPBS 2ANCA 1RYBA 1HYQA 1XHLA 4I3FA 4QWAA 4A0QA 3NIBA 3H2KA 1X7YB 4C8KA 4PHCA 4WBFA 3U0VA 3USCS 2XYRA 3HFZB 3VPBA 2QVXX 1N4AA 2KB2A 1T9ZA 3WRYC 3NNSA 4F3QA 2FWJA 3HCFA 3CD7A 2Z08A 3W8FA 3VTIA 1YV9A 3EGWB 3KOMA 3H5OA 1EBBA 4KSCA 5DRKA 4HAYA 1V7ZA 4HGPA 4EJ6A 2FPWA 2NUAA 3VHXA 1I7DA 2RUSA 5K8IA 3H2GA 3FBEA 5EQJB 1MEEA 4TVSA 2RGEA 3NIDB 4MH0R 5KTTA 1FK8A 4RKWA 1XZJA 4V2IA 4D9CA 4LK3A 4D6YA 1N6PA 1UKAA 3EVOA 3I0RA 1T9CA 5JSYA 2ZKLA 1R27A 3ZDEA 1E32A 1FVHA 1WKVA 3R5TA 1NFQA 1TTHA 4Z3OA 1H8HA 3QVTA 1PEAA 4EK9A 3DPUA 4GC5A 3PNYA 1PHRA 1UWVA 4QWDA 4WJKB 2WI8A 1JMYA 3T1YF 4GOND 2Q1SA 5AHKA 3DAGA 2WPNA 4MITA 3MAQA 4DMFA 3W2EA 5JBQA 4AKSA 1Q82T 1GDHA 3SHVA 3GZ4A 3ZE6A 3TX6A 1F1BB 2IUEA 4IEFB 4Y2MA 2NAPA 3LUFA 1LQUA 5T57A 5HIMA 2G40A 1CU1A 3U19A 1AKMA 5D0RA 4R3UC 4GKKC 1HY3A 3HMQA 3ZDZB 1F0PA 2AD5A 3FDZA 5LYJA 3BKUA 3IQHX 2ZCUA 3WTBA 4DQ0A 4Z53A 2M6RA 2PYIA 4LOHA 3EZNA 4UT4A 4W98A 3US5A 2FSVC 3M8KA 5CFRA 4XTCS 1KVRA 4OQLA 2R85A 4DVJA 2DR0A 5FD1A 1E77A 4C2BA 1M1YE 4BIIA 2BBTA 4ZVPA 4E4YA 3KBBA 4I2QB 3H5IA 1ABEA 1OIWA 4XX0B 4TU8A 4K6FA 3MK31 2J5XA 1FXSA 3JSBA 4KFRA 1Z2ZA 1B4SA 3AP2A 1XCOA 1DZ5A 2RHBA 1BMFD 2H1CA 5KPDA 2NSJA 1E2IA 2GHPA 1VA5A 3AODA 5KNBA 4B3TB 2LVWA 1E62A 2ZB4A 1TCCA 2ID4A 1LSSA 4NA2A 2SKCA 1H2VZ 4EEZA 3ZH2A 2NADA 5FF9A 2JRSA 3OLWA 5AQ1A 1XJWB 2GPTA 3MAAA 1DV1A 1UEKA 3AETA 1S5PA 3UBMA 2J0VA 4NOKA 5T5QA 5D6NA 4RSGA 5DO9A 4PXEA 4F91B 2MM9A 5JNWA 2UUCB 2DPMA 1CJKA 2N42A 1T0UA 4NZPA 3E18A 2W01A 2II6A 1MWQA 1ZCBA 4F97A 2OLKA 4ZEWA 1NE2A 3OIVA 2C4MA 1E6YA 3RU0A 3EC1A 1FE8A 5DNWA 4IFYB 2QDKA 3V81B 3R5GA 2JAOA 4KGVA 1OYYA 4EGJA 3AU9A 3WDKA 1ZMBA 1GZ4A 5EKTA 3SR0A 1E79D 2QYGA 2EKNA 4RMHA 1VC6A 1IONA 3JQ8A 4FYPA 1SIBE 1M9NA 4DCUA 2G0AA 1S1VA 4X7PA 2QYSA 4MS1B 1MIOA 3L8ZA 1GNKA 4GI1A 4MAKA 3MUNA 4DV1J 1M1YB 2DZDA 4D8UA 4US1R 2ZTUA 4FP9A 1GKLA 1AUDA 3FVRA 4EUSA 1C29B 1TZ0A 2IFTA 3W6PA 2GF0A 3KB8A 4P2MA 2P2QA 2V3WA 1Q8KA 1CEEA 2HMSA 4B47A 4CFYA 2IRXA 1EE9A 2CA9A 3EDOA 3NGTA 2JGRA 3EEYA 5HBGA 4HDKB 2V55B 4ACBA 3D67A 1GT8A 3VKWA 2M0GB 2RB5A 5CLGA 3L7UA 3R5HA 1E3QA 4HLUC 1PX0A 5C5IA 3DOMA 2ZROA 1OLOA 1XNRF 3IJPA 3Q6IA 1NSPA 3MECB 3R24A 3BK2A 5ECWA 1Q11A 4JJGA 4TU7A 2F8MA 4WWSA 4LGYA 1UVMA 5JWRA 1TYZA 4DADA 2EKDA 3GJRB 5JRDS 3DRSB 1R0BA 3TTVA 3PVSA 1IPEA 4RW0A 3CLSD 1YZ3A 2HHJA 5EXEA 1RJ9B 2O4CA 1KYYA 1U6JA 4EMUA 1U3CA 1NHWA 1EVYA 3N07A 1VB3A 3W6OA 4Y65A 5IPFA 3KPVA 2WJHA 4P4UA 2ZVQX 4WCVA 2XSJB 4BVAA 4CE6A 1R2QA 2GK3A 3GQCA 1QAXA 1E9DA 2OB2A 3VPAA 5HQ3B 2IU6A 2D0OB 3BGSA 4FZRA 4YAUA 4EJ0A 1S0VA 2W6QA 2YQ0A 3NR2A 4TWRA 3SBMA 4F12A 1Z5WA 1MTZA 5DWVA 5BYJA 3L7DA 5LYYA 2ROQA 3TF5A 3FKBA 2JAWA 2VRBA 3TL3A 4JL5A 2QUZA 1ZLYA 5E7IA 1GPLA 4MKAA 4DQDA 5EMMA 1UW4A 1PJ5A 1NW8A 4RPHA 4HD8A 2OC4A 3BZQA 1OBVA 1K0TA 2CKWA 2E5FA 4Z51A 4JI5J 4GUDA 3BK1A 3S1LA 3D8SA 4PCQA 3UB4A 3E5HA 2FPOA 3CXRA 3D4JA 3LW8A 3OZUA 4WESB 4FSDA 2FYXA 5BV8A 1N77A 4CKBB 4D4LA 4NV3A 4F2DA 2B7LA 1VGRA 4TYPA 4XYGA 2DNRA 1X4DA 1I1GA 3IOCA 4JI8F 3H5TA 4D4MA 2AHOA 2E5LJ 2CB9A 1OBHA 4B5KA 4CF6A 3OHBA 4LF8C 5IAEA 3CLRD 3I08A 2ZJRQ 3RYCA 4X65J 3AFOA 2ERRA 2GAJA 3GARA 4F8RA 4HWKA 4YRMA 2AFHE 4XQGA 4RF4A 3N01A 4NENA 2CDAA 4IRDA 3PC8C 2OPLB 5BNFA 2OUIA 5EA2A 3H0CA 1ZMXA 4BLQA 1N5LA 1JLEB 2G5GX 3WBKA 2ZI3A 4JI7F 3BR8A 2WWWA 2F2TA 1J97A 1CNMA 2IM0A 1RHJB 3BD7A 2WJWA 1TW3A 1Z38A 4MICA 1C0IA 2B35A 4BV2A 2RGNC 5H9FJ 1UKZA 3ZQUA 3PDHA 3QWUA 1ZJ4A 2G5CA 4KQEA 1VQKS 3N0XA 4JI3F 3OT1B 1EXMA 3DV2A 3NEAA 4POAA 3WMWA 1BVHA 4MP8A 2YVLA 4YALA 2UUAC 3SQGB 3ZTPA 3UGQA 4PKDB 4IKEA 5LNK6 3KOYA 3NB0A 1EIWA 3WP1B 1Z6AA 3W61A 4JLPA 1QHFA 5JNSA 1MC8A 3PR5B 3KJFB 4JT9A 5IWAC 3WFIA 2QD4A 3KJNA 3MTKA 3C7KA 4ECAA 1N7JA 3HD2A 3PV0A 5F78A 8OHMA 2CDRB 4LIPD 1B76A 4PONA 1XIVA 3AOBA 3DOMB 3CJSA 2HPAA 2Y1XA 3OFGA 1WU7A 2YKGA 3WAKA 4HNSA 1KDTA 5DCLA 4W9MC 5D1HA 5HIKA 1C9YA 4XD7A 4WFYA 3TRKA 1TIBA 2QPOA 3A3NB 1U1RA 4RDHA 3ULHA 4MV9A 3QT5A 4KO3S 4ELUA 1BYUA 1QAMA 4RK5A 3THOA 3NC4A 5CAEA 4YDDB 2FJPA 2G07A 2AEJA 4JEIA 2GK7A 1U7XA 1U90A 5KYKA 2ZD1B 3KCNA 3KC2A 3E23A 4LSZB 4B17A 4Q01A 1AFJA 1JZTA 1CUAA 3BORA 3K0SA 2QZ4A 4JVSB 2GQCA 3DUFB 4J07A 2C28A 4BSZA 3ZZYA 1O5IA 2O7QA 3OFND 1LW0A 4FEYA 2WD9A 1E7QA 4HQFA 2DJIA 5JYDA 5HK9A 3EDRB 2VDMB 3JVIA 4ZYYA 4IQGA 1TI7A 2A30A 3WLNA 5DNCA 4ANDA 1UMCA 4Q3EA 1UOOA 1N6NA 4GKKJ 1RI1A 4UC0A 1IHXA 4ZCSA 1QRRA 4Q6BA 2F1IA 2ZIWB 2OKCA 2OSBA 1VLQA 5JQGF 3K5PA 3PFIA 4J37A 3QHPA 1BQNA 4ZQBA 5K0NA 1IEXA 3B5JA 4OB6A 1JQGA 3P2KA 1G8HA 3COPA 3SQNA 2YL2A 4XPZA 4ANCA 3TXXA 1TL3B 3NTLA 3DM9B 3ZZ0A 4P2GA 5KNCD 5JSHA 1CP2A 5TQ0A 2O4UX 1XRMA 4B35A 3J7TA 1EP2B 4BHQA 3D7NA 4H1WA 4DSTA 3RVQA 1TV6A 3CSSA 3G5LA 2CEKA 4TM8A 4I56A 3AQIA 5CFMA 4OQYA 2K7JA 3E4DA 4X71A 2RAVA 4Z8YA 2QV7A 5F2OA 3QK7A 1MO6A 4BNUA 2ID9A 4GKAA 1RWNB 2BJ9A 1ZI9A 4NULA 5BT9A 2QD2A 5FWAA 1QU3A 2BANA 1F6TA 1AUPA 4RQAA 3I6YA 2IYSA 2O3SA 4UTGA 2VJOA 1T9GR 4ZIRA 3WOHA 3E4CA 4FCWA 4JLJA 1WEHA 3AZQA 1XMBA 4TRJA 3T3IA 1NPDA 3HFSA 4AQDA 3WA7A 1I3CA 4LWZA 3UWKA 3U7GA 2A7XA 3BIFA 2DC1A 1MAWA 4HN2A 1FFHA 3DF9A 1XXLA 3ZV7A 2RHSB 3EW9A 5DLDA 1KDZA 3K1JA 1OWMA 3DT9A 2NR0A 4OYIA 1M0WA 1TUGA 3O7MA 2YWEA 4G5QA 4XPIB 5E1MA 1U4BA 1MC1A 1OIAA 4N7BA 2O2YA 3DLPX 5ALSA 2JEJA 5B0GA 1A76A 2VHXA 1HHQA 4P0PB 5K51A 4DIEA 1RC8A 3G0DA 1RM3A 1YCDA 4X4TA 1T35A 4TTIA 1NQXA 3T5MA 2HBZA 1X1SA 4LF4F 4KDFA 3UH0A 3QLHB 4PAAA 3THWA 2UUBB 2HMIB 2WP0A 1Y5NA 3W5DA 3D64A 4XEUA 4U7UK 3HJCA 4WFXA 4FMBB 1ZFNA 3UHPA 5KNLA 1BUXA 2DFPA 3IPCA 1F4PA 4MK8A 2NPOA 3SS8A 4LZAA 1RHUB 3D6NB 4YRZA 2J3KA 3OUTA 2BFAA 3EB9A 1TELA 1JNRB 2L9WA 1Z16A 1DBPA 4G0PA 5CX1A 4MXDA 2DJWA 2VV5A 2ZVSA 2IY7A 5AJ3J 3ZTSA 3L06A 2GAHC 4BVJA 2X1GA 2C5EA 4F67A 1HR0J 4MPDA 3SNKA 2HCBA 4DUYB 5B1DA 5HF8A 1MW9X 4K46A 1YJBA 4IJUA 2HK2A 3GLFB 3OZVA 5D84A 2HRDA 3NALA 9ABPA 4LDNA 2W2OP 3C7CB 2B9XA 2TMYA 3DAPA 3OQJA 1HBOB 3WLSA 4QIWD 3W2WA 3C74A 3PXUA 1R8BA 3BA1A 3B51X 1KS2A 4DR3J 3RD5A 4JV5F 1NXPA 1G1MA 1ZD5A 1PG3A 5DGIA 1FJXA 3QXJA 4E2FA 3OSNA 5AJYA 2V5UA 3TQFA 5CXQA 2OMEA 2QGFB 5TT0A 3IVMA 1RAFB 3MEEA 1V1JA 4WTOA 4I9FA 1XX6A 1BD4A 4WBNF 1V3SA 3USES 2B5VA 3M9NB 4BBZA 1CUEA 2FUG6 4DV5B 4Q7JB 4HRXA 5GAEI 3NV7A 4J1SA 2QMZA 2GJ8A 3DKDA 3QKRA 5E0KB 1X5SA 2ODBA 5IJ9A 1W30A 2W2QP 3WWPA 2UUCF 1KEZA 4R98A 4S1NA 3FOFC 4L76A 2F67A 5IM4F 4B44A 3I9MA 4Q3LA 4RM2A 2V7XA 2JLVA 1MLDA 3LV8A 5HM6A 1JYSA 4RF2A 1KC3A 1FFSB 1ECPA 1BHO1 1P39A 4A2WA 3OT5A 5D5HA 2C88A 3I28A 4RUKA 3EXHA 5LPNA 5DULA 4TSFA 4PHGA 3ESCA 2NQ8A 4EW1A 1L6RA 2I9SA 3BGOS 1NDKA 2D74B 2QY6A 3C6UB 1CB7A 3RJZA 1V45E 4OI1A 3A04A 3N2LA 5DM60 1FL9A 3JD4A 4CLWA 2ALZA 3PGKA 3W6UA 1RAIB 2JFQA 4EFNA 1VHIA 4KT0C 3EVZA 4F4HA 2C2NA 3ROEA 2C29D 2JEFA 1GGFA 4IIUA 1LV5A 3GF4A 2RKIB 4H1HA 1W9MA 1T9TA 2GMJA 4CG2A 1J1ZA 4HEJA 2OIHA 4RW8A 1YR7A 1WVIA 4G4IA 2R6HA 3GPDG 2EZTA 2DT9A 1P45A 3IR5B 2RAFA 4JYAJ 1JU9A 3AVQA 3DL0A 4UDYX 4IDNA 1VFNA 1H2ZA 3AR5A 5CT6A 1BHJA 3DL2A 4CTKA 5BR8B 5IYZF 2X3UA 4TZKA 4BTLA 2QX8A 3PC3A 2IA6A 2YFYA 3H9EO 3HVAA 1VE1A 3NYRA 1CETA 1TMJA 1KZ9A 2F43A 4QDTA 3DQPA 3GCWA 3IV7A 2H9AA 2AV5A 4YP3A 1XF9A 1OFGA 3A1CA 2GO8A 1Y6QA 2HQCA 1Z2AA 3V1YA 1NBHA 2RHDA 5DVZA 4PPQA 4FIZA 1A72A 1GRCA 1NW3A 1MO4A 1RYYA 3HKEA 2QLNA 1OE0A 2V7WA 2O54A 3FF4A 3D5EA 2F4FA 4BNJA 2WW4A 2NO6A 3T34A 2QMUB 1G66A 1LWXA 1G7RA 3CNBA 4QWBA 1B8OA 4HAOA 4HF7A 1P74A 2VT2A 4DTIA 3EVCA 1JIJA 2XDWA 2FLVA 2YJNA 1PIEA 4KAFA 5JC8A 4O2RA 4YS6A 3H2LA 2VPYA 1U5AA 1Y0BA 3CGIA 1IN0A 4K8RA 4E21A 1ISSA 4L4XA 4OEHA 4DMKA 3A3NA 5JFGA 1TB4A 1ESMA 1GFSA 4YMTA 2FEOA 4QC2A 3ELDA 4L9WA 1PWYE 4ZAVA 3GVHA 5H5JA 1HTBA 3GGJA 3ZVRA 4DMMA 5TF4A 4RTOA 2M88A 2HFNA 3CQ3A 2AJFE 2VICA 3GRRA 2W2XA 4AN0A 4ESHA 3ZS8A 1EWRA 5FI5A 3LM8A 3IEKA 4FF1A 4O25A 1M33A 5BMVB 2VTKA 1F4VA 3PENA 2PY6A 4UJ3A 4B76A 1ZUNA 2WHXA 2WVJA 1ZN9A 2QNRA 5LJLA 3FMPB 2O8FA 3UH1A 2ZSDA 1KZ6A 3AB8A 3I2KA 1E4VA 4CKCA 2WIBA 2GD0A 1ECLA 1KZHA 1OKKA 4FBLA 1NHGA 2GKOA 2OPSA 3L8EA 3U61B 4BKQA 3OT1A 3QLVC 3L4JA 1D03A 2B34A 4KLZA 2JIRA 4W7HA 3ECCA 4G01B 1WHSA 4G0UA 2NCLA 4YRDA 4DHWA 4DDKA 2B94A 2RGDA 4D0GA 4B7ZA 4EBBA 1BX0A 4EZEA 4F4WA 5EG5A 5I7HA 4J5OA 1CJTC 4WV3A 3CKLA 2O0LA 2IZ7A 3F9CA 1GRQA 4I7FB 5D0GA 4TTAA 3H42A 3ZC4A 1P2DA 1M90T 1M2FA 2NVWA 1CRWG 2KZZA 3QE4A 4UM9D 3DWFA 1COWD 3FAZA 3PEHA 3DBRA 4G0ZA 1S4MA 3QSYA 2QN1A 5SY6A 4N56A 3Q2TC 2OHHA 3AJAA 2PANA 2G7ZA 2FUG1 4G5SA 1N36B 1HEYA 3DFMA 3GIWA 5EJAA 5AW3A 3L8FA 3W3AD 3HSJA 2ATXA 4KGXB 4OJQA 2VTBB 3TXYA 3FSJX 4PYIA 3QZ7A 2R2AA 4TL6A 3PX0A 4G8CA 1NIJA 3N6VA 2VFSA 4QGGA 1NI5A 3A4NA 2BH9A 4YHHC 2O2EA 4Q00A 4U7CA 4BECA 1BZYA 1NXOA 3DTNA 2KZ0A 3SBOA 4UDNA 5D1NA 2IAJA 3DZGA 1L4EA 4DL2A 1TLTA 2QENA 1P60A 3AL3A 4PN7A 5L39A 3R5JA 3KTQA 3FGNA 3E7XA 3BS9A 2A9RA 1HMVA 1RWWA 4GAEA 5EUQB 3IJEB 1DJLA 2QIPA 1B14A 2G9ZA 3C16C 4IOAQ 2IJGX 4JELA 4QX6A 1XR3A 2JD1A 3PHBE 4KW7A 3TCKA 5L7YA 1FRLA 3R3HA 1B8VA 3IEUA 4OIFA 3CLTD 2QRLA 3MWEB 3IYLW 1TMOA 1NQAO 1I4OA 3HP7A 3OIWA 4MRPA 2H0RA 2ZH5A 4XB2A 4Y6RA 1CCWA 1U1EA 4OHWA 1E2FA 2BFFB 2ZQYA 2KYZA 1XAIA 3QYYA 4N40A 4E32A 4NYZA 1S5ZA 2CGEA 4FK8A 1ANKA 4UVHA 2V45A 5KVCA 1G3RA 4BC9A 3TECE 4Y6GB 5C1BA 3AA9A 1AKTA 3U7RA 4BO6A 5T8KC 2OK8A 2I91A 2V4ZA 1IY9A 2REBA 3GJTB 1VC0A 3D0HE 3VTZA 1Z35A 4IQ8A 1WF0A 4MW2A 4LE1A 2OXIA 5ETNA 4L8WB 2VH7A 5IJWA 2FHSA 3BFPA 3OHSX 8GPBA 1QG0A 2Y0CA 4PO8A 5I42A 4Q8FA 5F8NA 3NHRA 2CUTA 2PBLA 2C8LA 3NRCA 1XNHA 3PJ9A 4OFBA 1Z63A 3Q1LA 4TQGA 4II2A 1G8KA 2G17A 3UWSA 1QAJA 2PIIA 1GN8A 4TS9A 4QE3A 3WYAA 2OGWA 1GK8A 2H4YB 3RRGA 5F12A 1BRMA 2HM7A 5HGXA 3KYLA 2CJXA 4CR6A 2E4WA 4BC7A 2OCGA 2XGMA 3PO4A 4B46A 4DHEA 2GX6A 2R7LA 1UIRA 3B5EA 1TL7A 2DBBA 2P4SA 5DGHA 4LZLA 3Q7IA 1Y4ZB 3LWZA 2LWIA 2ZH4A 2BKLA 5AK0A 1P1LA 3DM5A 1ONPA 4OCZA 3PRDA 4BX8A 2DPHA 4NE2A 5DEOA 3Q8LA 2PXXA 1IQPA 2WP8J 2NTJA 2ZG6A 2J6UA 3FPFA 3K16A 2V34A 1HGXA 1F9EA 3QEBZ 1W59A 5HBMB 1JZQA 4D9EA 5CDSA 3AG5A 3OVMA 3G0CA 4ND4A 2ACYA 3AC0A 2FLWA 5HF9A 2Y0PA 1AUVA 2EEPA 5DSZA 2R8EA 4GLFA 1IG0A 1R66A 3R0IA 1WC1A 4WF9Q 1KI7A 3ZW9A 1CDDA 4AJ2A 3FQLA 2YZKA 4DV0J 3G2NA 1JEEA 4FBGA 1YJUA 2SKDA 2NSLA 5JSQA 1ZK4A 4LSGA 2FWPA 2ZRCA 3KQLA 3DEIA 4TRRA 5KNDH 3BIJA 3EEOA 2O8EA 1YDWA 2QJFA 2A9OA 4PGFA 4NYJR 2FQQA 3PRYA 2V1XA 4BFTA 3HPQA 2VN8A 5JU6A 3N1UA 2UYQA 4PZLA 4L8GA 3GIKA 3VYVA 3WS7A 2Q1LA 3AHDA 4UEWA 3L82B 3SF0A 1JA1A 2MHNA 1F60A 3CE8A 1Q0LA 3KTOA 4NMLA 4ZTBA 3B52X 4Q15A 1JG7A 4HGOA 4UUWA 1J22A 4Z1OA 5BN4B 2IYAA 2OP5A 5IF9A 4ZP1A 1I9GA 1FRIA 1NVVR 3ETHA 2YJ3A 2Z6QA 4G4SP 3OU2A 4NEHB 4ZVUB 3WIEA 4C03A 3LC0A 1RJGA 2MDAA 2WM9B 2XQGA 2VC0A 4TX1A 2CXPA 1HBUA 2I6UA 2C9OA 3MILA 2VA9A 4DSNA 1RWOB 1FOEB 5EZQA 4DLPA 2W4CA 4M8NE 1K44A 1FRVA 4KG7A 4OB8A 1FLVA 2V2KA 4ZEXA 3I6QA 3SLRA 3DBIA 3HUTA 3R7SB 1E2GA 1UWCA 4AQYJ 3QEMB 4MAFA 1GQQA 1VI5A 1J5OB 3FK4A 3V6LA 4OYZA 4EPYA 2GZHA 1WHXA 4DXHA 4MUGA 5C8ZA 1CYEA 3FI9A 3QOWA 1OY9A 3Q3IA 4DEZA 1D0IA 1U98A 4CKXA 3K6RA 1DAKA 1JXLA 2AOWA 4URQU 1WC4A 3DOKA 3KUHA 1QUEA 4N8DA 1VC5A 3AM1A 1UH5A 2WHPA 1N48A 1THMA 2PX0A 3IOBA 2VP4A 1L6IA 2HLPA 1S1CA 4Y2IA 3IRWP 5HJXA 4XCQA 3E9DA 2B4UA 5JW6A 4JSRA 1TV6B 5ADUS 1WC3A 3FB4A 4JWKA 2G13A 5JZ9A 3UB3A 1XZNA 3K53A 4RK0A 4E5SA 3EH1A 3ZWVA 3D1QA 2ANBA 4YRFA 3WG9A 2QM0A 1RT5B 1T05A 4C6AA 4ARIA 1YSJA 3GROA 1YRWA 3L3BA 4DS4A 4DR4F 3KK1B 1YJRA 1KAOA 2P2ZA 5EMJA 8AT1A 4DLBA 4RHFA 4IH7A 3HCBA 4E8UA 5KFSA 1U4NA 1Z8FA 1U9IA 3ZJ5A 2CHQA 1NVXQ 1YDLA 2H4JA 3Q9NA 1ZN2A 4KJIA 2XYGB 2F9DA 1LFDB 2CK3D 3COZA 3O44A 1SRRA 1R0XA 3BDVA 2CF5A 2QAGA 1U1GA 4DV2C 2Z5LA 5B58T 1JLCA 1AQUA 1S1MA 2P78A 1MN9A 3L84A 1NLFA 4I36A 3OUUA 2VNJA 2OC9A 3CKYA 1X19A 4PVDA 3SEQA 4DZ6A 3W2IA 5J4HA 1NXIA 2QG6A 2RHTA 1SMKA 3RC9A 3G9QA 1HPZA 1B6TA 2ZD1A 1R0CA 2OXRA 1FYEA 4H7HA 1UEXC 4X4UA 4ALMA 3W1YC 3U7EB 1JEYB 4G1PA 3NX4A 1S9DA 3IBYA 5U9CA 3GZNA 3C8ZA 5EUCA 5BUCA 4BLWA 2YKQA 4BO5A 1JJ2R 2UUWA 4R2JA 2Q66A 3MJEA 5FPHA 1Q91A 4IRUB 5EYPB 3H42B 5F5NA 3VR5A 4DPYA 3IR7B 5E3PA 2P2FA 1PFVA 5IMBA 5A5FA 3LCRA 4X65C 4JLOA 3R3ZA 4KRGA 5KG0A 4YY3F 4D9FA 3AVOA 3SZUA 3ZU6A 1B3TA 2PZFA 1XC9A 2X0JA 3CKKA 1CSEE 2P6RA 4DLUA 2C83A 4H31A 4AK9A 1NV8A 4QGSA 1AGXA 4AL4A 3DXYA 2PI5A 3IKVA 1RHUA 4N5NA 1JMVA 3Q3JB 4QUKA 1Q0SA 3T3DA 1QVGR 3PNPA 5D8DA 1O95C 4LYYA 2V67A 4XJSA 3KJIA 3I1JA 3OLXA 2F1KA 1DLOB 5DLQC 4DR5F 3FVVA 2WSEC 1NSTA 3DFFA 2HRCA 4IGAA 5BSEA 5MFPA 5C1PA 4DR1F 2ARKA 4REQA 4W82A 3P9NA 3R5AA 3LNVA 1O9HA 3VZDA 3NHPA 4FDAA 3ELYA 3FLBA 3EEQA 2BTOA 3GG1A 4G23A 5D3KA 3GRCA 2XIJA 1I6KA 2ZDQA 3U44B 1H7XA 2ZYWX 4UUPA 1UPXA 1JSCA 4JOUA 4RJKA 2RHHA 1VRCA 1JLBB 1XN9A 1KK0A 2K2PA 3BZUA 2B2CA 2J9RA 2JLZA 3UXHA 4DCOA 2IPOB 3U3XA 4FYVA 4JFAA 5L4SA 3LDUA 4CIDA 2OG2A 3G2HA 4YFVA 3MEDA 1FW8A 1AUSL 4EUKA 4NBLA 3D9QX 1XTTA 1QG2A 4UE2A 2XMRA 1Y11A 4L4UA 1WPRA 5LOVF 1SIOA 2M5HA 1IRXA 4L85A 1NA5A 4M36A 5IJ0B 5GM1A 2PD1A 1W2WB 4RD0A 4Q0MA 1BE1A 2PZAA 3ON5A 4RW4A 1K1SA 2M6KA 2CXQA 2UXDC 1RT6B 2Q5HA 1CY1A 1PAEX 2HL6A 2MMGA 1Z73A 3U5TA 3ET5A 2GM9A 4XSHA 2JJYA 2WZQA 5ES3A 1RLCL 3D0QA 3RTBA 1NLZA 1KFDA 4D3HA 2GMHA 5EWLA 2OBLA 4YACA 3SHQA 2RB4A 4YCAA 3O4HA 2IUYA 4P4SA 3A9WA 4X3PA 3RSGA 2NO1A 3HEMA 3OPYI 4BXOB 4JI3C 4ZAZA 3QPIA 2YRWA 3NPDA 3W9BA 4QDUA 1SVOA 3HSZA 3E1KA 1RYSA 4XWTA 4AJJA 1QM4A 3IBSA 4FF4A 1KYQA 2XXAB 3DR5A 1BC5A 1J00A 1Z4KA 3U48A 4ZVKA 1TR0A 4F0HA 4D3FA 4C0LA 2ZR0A 2F3TA 3VGVA 3CCLS 4MUKA 4INZA 3QIPA 4QVGA 2P30A 4H0FA 4UTRA 4OJGA 1GQEA 1OW3B 1YZKA 4W90B 5AI4A 3OIUA 2A2CA 3NRBA 3RUBL 5AQEA 3WL7A 3I76A 2Z6VA 1SKYE 4ED4A 3FMIA 1L3VA 4WRRA 2HA6A 1R6VA 1ULRA 4QM7A 1ORWA 4CM8B 5EIAA 1KVIA 4M6WB 1CY4A 1VPWA 2B5JA 4M5DA 4NJMA 3LPLA 2PD3A 1WDLA 2X6QA 2FTKE 4CQMA 1ZBTA 2C78A 1JXMA 2VRCA 4KJZA 3V1NA 3UVEA 1K7FB 3RABA 4AT1A 3MGKA 3G6KA 3ZPXA 2A9JA 2GIRA 4QU7A 1P7PA 2AN4A 1QIMA 5LMZA 4F02A 3WNZA 2HRZA 3M6AA 1ODJA 5CCBA 4G1MB 2G0CA 3CZRA 1YU9A 3AEZA 4ASUD 5K8TA 1N3YA 4BYGA 3PUVA 2CSXA 1QGOA 2BUAA 3MCZA 5FOWA 3NKYA 4OZ1A 3BO3A 3BN7A 4Y6OA 3H2BA 1UEVA 2VG8A 5EUBA 4W1PA 1KAMA 3SOZA 1WH9A 2JFKA 5CW2A 3EC7A 3EUAA 4N8NA 1ZHOA 3DOEA 3PR2B 4TXJA 1PL8A 1OROA 1OD6A 3KJNB 3ABZA 1XJQA 1GPKA 3U39A 5HATA 2BSAA 1YKGA 3QE0A 4UTXA 4FFBA 1R8SA 3FLEA 3OX2A 1FYXA 5BYQA 3D2CA 2HQ1A 3ZZNA 3WRXC 2KDOA 3HZEA 5KHOC 3G71S 4KGXA 3LLCA 3U60B 4Q9AA 2BFPA 3D5QA 2I55A 5GV8A 2BR3A 4RO0A 3CO0S 3MEQA 3IPXA 3VKGA 4LFAC 5K0GA 2HBQA 1OPXA 1FJ2A 5B30A 1NASA 4ZJQA 2DPXA 1L4HA 4GZMA 1DRJA 3DLTA 3HU5A 2QQGA 4TQ9A 3OTQA 2OAGA 2Z1DA 5J2NA 2WMNB 4YH1A 1RVV1 2AJ4A 1EM6A 1Z8DA 4OLOA 2XX3A 1J5OA 5DZ6A 2J8AA 4ZQFA 2XMVA 3BHMA 3LXRA 2W1BA 2KM8B 4CO0A 1DTWB 2HNYB 2XMBA 2ZH8A 1HLWA 1QIGA 1A5ZA 2IHR1 1FP2A 1Z4JA 2QX0A 1GZ5A 3HO8A 3PIRA 1G17A 2JCGA 4HAVA 4WNYA 3T5LA 4JV5C 1LJUA 3POTB 1CD5A 4JI2F 3W60A 2JI4A 1R0WA 4D3ZA 3KE8A 2H11A 2GBFA 3JAWB 2CZCA 1K9VF 5A7HA 1BQMB 5L1JA 4Y0VA 1IXZA 5FR2A 1WV0A 2KVQE 2B25A 5B1IA 4GI3A 2FMHA 2IMWP 3INGA 1VRWA 3KQKA 4DF8A 2I2BA 1KRWA 3RVKA 2NZJA 3KQOA 1GFZA 1P4JA 2RQCA 1ORIA 1HBMA 3GYBA 1TEZA 4D3SA 5DN6A 3GLGE 3G17A 3AVXA 4QOJA 1RRFA 4TKLA 1I51A 3EPLA 1JXOA 4DUGA 1QOQB 3RJMA 1KSFX 5JFOA 4RBUA 2QI9C 3HMJG 4Q3OA 3WYBA 5LIPA 2CE2X 3L6BA 1ZJ6A 4RMNA 5HIAA 2JDIA 3MS4A 1QGED 4XQ0A 4IH6A 1OTYA 4CH7A 3I0SB 1JHQA 4FGUA 4KFTA 3RYFB 1DRWA 1V47A 3M1YA 3UOAB 1KDPA 2LIPA 2W2VA 2P9YA 4EG0A 2UVVA 3NG8A 4BVEA 4P36A 4AP6A 3HI6A 1T3NA 1U8WA 2AFHA 1AV7A 2HQBA 3MPUA 3WGYA 1ZM3A 3IWLA 2HK8A 1XEZA 1Q5YA 1ORRA 3GVXA 3EWGA 2AQHA 4RGVA 2DBZA 2QZJA 4BAUA 1R9GA 1A96A 2YV1A 3NC1C 1M8KA 4PC1A 3Q8VA 2QEXS 3U37A 4QVKA 4MZXA 3M9XA 2CWKA 4UHBA 4TXMA 1N1DA 5C34B 5LXTA 3BCHA 3EYZA 5DMHA 2JI6A 5SZIA 1LDYA 2G4LA 1U8YA 3WB9A 4U2EA 2GK6A 4UBNA 1CE8B 3FZEA 1WEZA 5T41A 1DOAA 4EG4A 1P2SA 1VQ1A 5A4JA 4BZPA 1VDHA 3TD9A 2RT3A 4AJKA 2IOYA 4EKNB 2O5DA 3UWMA 4CTNA 1KKLA 3ECSA 5DB4A 1TVCA 1XN4A 1F9FA 2GKGA 1XMQB 1PS0A 2E6UX 1N5RA 4CYUA 4JR2A 2PA3A 1QS0B 2GAFA 4M8KA 3PX6A 4RW6A 1J5EJ 1V7CA 3FKSD 1NJ5A 1FEZA 2DCMA 4HC4A 3LQYA 5HL7Q 4D1YA 4ZK2A 5JJ5A 1UXIA 4NEYA 1ADCA 2FFJA 5THWA 3UWPA 5CA1B 3A3OA 2HHXA 4K6OA 3V6HA 3EF0A 1U2RA 4EWLA 4LY0A 3SKVA 2AW3A 5LT5A 4DUGD 1RXIA 3CDBA 4PBTA 1Q92A 1JKMA 3INTA 2FMTA 5CYMB 4RW6B 3VYRB 3BN4A 2Q3EA 5JS6A 3FIJA 1ETUA 1MX5A 1WXIA 1QWSA 4GPEA 2X42A 5M2QA 4QKQA 1G5RA 1LV8A 3N59A 5K8NA 1RI3A 4M63A 4U9HS 4D4KA 2H5IA 1TPYA 3A3OB 5ICCA 1Z1ZA 3PNBA 2D3WA 3HRHA 3EF1A 3HFRA 1NY8A 3T9AA 1M1NB 2UXCC 3INNA 4HATA 1IKVB 2F1RA 1FTGA 4CKWA 2VC2B 4LF8B 2Y1RI 2PIAA 3UN1A 4YRGA 3I01A 5ED4A 2LXNA 2DTXA 3GLGB 5DHFA 4XLZA 5KOJB 3P2OA 3NS6A 1JAYA 1U2FA 3WMEA 3R5CA 1HNVA 1LJ8A 2GB4A 1ODIA 1S59A 4HN9A 2MMCA 2C84A 5IJ9B 5CHCB 4QULA 4ZOSA 2MZRA 2VA8A 4EUEA 1JXEA 4X62F 3DXBA 1QQ6A 3RJ9A 3G9TA 1GZ6A 3R8XA 4COOA 1HRKA 1NI4B 3B60A 3DRPB 2CE7A 4ARZB 4DA7A 4MROA 1GUFA 2DWUA 5FBQB 4Q45A 1UFKA 2I5PO 2Q9CA 4YAKA 2MZJA 4JOBA 3RV4A 1QPBA 3RAFC 3ORHA 1N34F 2E7XA 1BROA 1JXQA 3U9TA 2PRSA 3EWNA 4O4HB 3CCES 1X7GA 1XU9A 5IT5A 5JRJA 1A50B 3N2KB 1JIVA 5HZKA 3ACDA 4DDTA 1E58A 1QQAA 3CJ5A 4FYDA 1U5BB 1HNIB 1ZAWA 3RU9A 4GBJA 1HDGO 2ZRBA 3VR4A 1XDUA 1B8PA 4PTLA 2Q43A 4MKXA 3WK9A 2XULA 3BWDD 4M76B 2JIZD 1ZVKA 3MZ0A 1TZBA 1DWOA 2VF8A 2WDZA 4RVUA 3I62A 1L3CA 4GS5A 3LQFA 1BH6A 4UZCA 4ZPCA 1RAOA 3Q23A 3SZOA 3GD5A 5J4VA 1XLTA 4QUBA 3NONA 4JXXA 4IVQA 1PQWA 3DHNA 5DWDA 4OVKA 3UN2A 2HYIC 3I34X 4RY9A 4JI1B 3H5NA 4E03A 4NCHA 1Y89A 2PAFA 1P29A 4GKJB 2LXIA 3SSAA 4H7KA 5FA8A 3EQ7A 3PEJA 3VYWA 2CQCA 3QJ5A 3P5TL 4FDTA 2GPSA 1ISHA 1R27B 3N9IA 2W0MA 3QPWA 5JDCC 4PEVA 5EJGA 2ZK7A 4LIRA 3BBBA 3G6WA 1EGMB 3HSKA 5EJEA 5KTQA 5D3GB 3DDHA 4Z4IA 1A9XB 2OHGA 2FEMA 3NTXA 1O0PA 1T03B 4DRZA 1WC6A 3CB4A 3EEBA 2WYOA 5J2PA 2ZYRA 3LNOA 2WONB 2JMPA 2E55A 3AXSA 3K2YA 2CPZA 2ZTVA 4BO2A 3R0ZA 1T36B 2MY8A 1X1QA 2FJAB 1C4OA 4IXMA 1CR4A 5C46F 4CG0A 2KXNB 3STYA 1LWOA 5BVHA 4MWOA 1PYGA 3B3JA 3KXIA 4OP2A 1NJZA 1SKAA 3BGOP 1HYBA 2D0PB 4P4LA 3WSWA 3FMGA 3IP5A 3U3JA 4FS2A 2P9GA 4J9UE 3M4XA 1QCCA 5CA1A 2ZT8A 5EPOA 1R0AB 5KFCA 1HA3A 4BP1A 4HGNA 1IY8A 5HOQA 5BPHA 3TGLA 2H2FA 3A70A 3RV2A 2XNCA 2A4KA 4R41A 2GHRA 3RE1A 4LJ7A 1AGPA 3VR5H 5BSVA 2GPWA 4OIMA 2KU7A 1X5PA 3L18A 3FMFA 3AR2A 3JQ9C 4W5OA 1JLCB 4L9AA 3ISNC 2QRUA 5HYVA 3DEAA 4NXMB 1XFAA 3O4VA 4XJTA 1NULA 4CQLB 3HCXA 4MJXA 4BKMA 2ZYGA 1UKCA 3KVRA 4PBSA 5MN5A 4QTYA 4UM5A 5B12A 3D02A 1JT2A 4YN3B 4WASA 1Z4OA 1XMIA 3MPVA 3SYLA 2VK8A 4RA9B 3MUFA 3TANA 3T9BA 3AKDA 1VLJA 1HV8A 3HFGA 2PMZD 1CS0B 3HHKA 2JFGA 1J2UA 1QVWA 4CT4B 1SQFA 1T5SA 2HHAA 3FCOA 1NK6A 5I42B 1J2VA 1YB4A 2C8JA 5FWYA 3WLKX 2XYQA 3C15A 4O4IF 2I5JB 1VYUA 3ZXSA 1Y81A 3NU1A 1RMTA 5ANRB 3ZDXB 1BFUA 4KGVB 1I0IA 3TBHA 3UW1A 4NBKA 2WINI 5J5CA 1RWXB 4DMZA 1Y3DE 3MM6B 4GKJJ 1VE3A 2XCTB 1R0BG 3IALA 3GRUA 3SE0A 3KQYA 4ZC8A 1FX4A 4KWCA 1X7XB 4M88A 3KUGA 5FDLA 4N8SA 1MBZA 4EY7A 2G5TA 2PZLA 4R3WA 1GN9A 1S77D 2HPHA 4ZT6A 4LRSB 3H19A 1X0PA 3EX7B 2QYCA 3VPGA 4JI1F 1QSGA 2UUCC 1K97A 3BO2A 1PTJC 1Y5RA 1IKYA 4FPRA 2PMCA 4R9NA 4ZAYA 5KTOA 1P2VA 5BR4A 2GBPA 1MB4A 1T0TV 5I47A 3KSZO 1SCDA 3RKSA 3CJTA 2WJPA 5CUQA 3D31A 2NU8A 4QUEA 4BNFA 1WW8A 4JI3J 5EGNA 5H68A 1TQ4A 4M9XA 5FPQA 2EFEB 4HNUA 2YWGA 1HQ2A 1CLFA 3B70A 1BD3A 1NF3A 4DDWA 1HDRA 3II6X 4FXOA 2WU3A 4TLDA 3ITDA 1U2EA 4XUGB 3V1LA 1I24A 3DE6X 5I6DA 1T13A 2K8GA 2QTTA 1N9GA 2XYVA 1J99A 4B0PA 3SGLA 1CYDA 2IYTA 5ELMA 4RH3A 1EG7A 1NJ1A 2HO4A 3KLFB 2UUPA 2XW6A 3V4IA 3GDGA 3FCYA 3K71B 3U3RA 3IM9A 3NAGA 1K3FA 5BQXA 1Z34A 5GAHI 2B6AB 2X8LA 2CN1A 3RUIA 2LE0A 4LVUA 1T2CA 3CX4A 1EGQA 2R00A 4E11A 1L4LA 3B53X 5I8ZA 4F46A 2WA2A 1X9MA 2P9TA 1TQ2A 3FSIA 1XGKA 5A8KB 2VQEB 2QAIA 3ZHVA 5AH0A 1D3WA 4V24A 4WIQA 3CCQS 3LCVB 2R5FA 3A6GA 4YXWA 2B0CA 2NUPB 1USKA 2MYFA 1H73A 3TH5A 2KJWA 1DP4A 3LXUX 4NBWA 3NHZA 3BRWA 4KV7A 1PFWA 1U28A 4QBKA 1FS4A 2CZVC 1OBOA 2WM2A 5JXJA 4UBKA 2H59A 2YY7A 4ODIA 1B0ZA 1PJCA 4BKOA 5C8XA 2ZYIA 3BWMA 3ZWNA 3PEUA 3LUHA 4DMCA 2DY9A 3AI1A 3FSXA 2PR7A 3H3XA 3O31A 2H9YA 3EZYA 1JTEA 1WZNA 4H4OB 3RFXA 3K0EA 5C8DA 1V3RA 3F4KA 1NHKL 4E13A 2VSNA 3I31A 3PI7A 5GONA 1JZSA 1P1HA 3FOAA 3B1YA 4MKRA 4EO6A 2CQDA 4ZI5A 5A06A 1S2NA 5LBUA 1S2GA 4IYJA 2JIQA 1DKLA 3L0YA 1EVZA 3UGJA 1YONA 4KYUA 2FW8A 3QY9A 2HCRA 3W4KA 1DARA 2JH9A 3ADDA 3ONNA 1V9LA 2XZDB 3DAYA 4N6GA 4FBUA 4IMPA 4XGIA 4RJIA 3UK7A 4V3CA 1EBUA 1WG1A 2F3PA 1V8FA 5CH8A 4J75A 1R4NA 4HMPA 1TL5A 5UKDA 1QLWA 2Q4TA 5LJ5Y 2W2KA 2O1WA 1RPZA 1LSUA 1JEYA 4DMRA 3ZI0A 4Q6WA 1U94A 2B3TA 1P27B 1HNZB 1GV1A 4WZAB 3JCZA 4D4IA 3RU3A 3P9ZA 3HKWA 1HKHA 4ES2A 1Z26A 3L7IA 4ZJYA 4YRSA 4C29A 4NLWA 1TU0A 4P3OA 2UKDA 2YYZA 2QNBA 2ZBIA 4MIWA 3RS8A 2AJCA 3A4MA 1CP3A 5JCOC 3NBYC 5AVZA 4ZPDA 1BDBA 2YICA 1H3EA 1SJRA 2YMPA 1JFFA 3EMVA 4WVFA 2RKBA 3D0KA 1I0ZA 2A94A 5C24A 2XJ9A 3AD9C 1O90A 3GXBA 2O19A 4ZV4A 3CEPB 3IS3A 3IV9A 1TYAE 1EUZA 4P54A 2H08A 1T91A 3N79A 2OP1A 4LY3A 4E6EA 5JAZA 3FZ2A 3PDIB 3G2IA 3IM8A 1YTUA 2HSDA 1DDIA 3CCWA 1WCV1 3NUQA 1MWYA 2KRBA 3R75A 3JQMA 2EC5A 4DV3F 3DRSA 5HKKA 1IOWA 2CVPA 3QSIA 3CD5A 2M5YA 4N3GA 3MVEA 5ALJA 3F78A 2FVXA 2GPNA 2CLDX 5HQJA 5BR8C 2JL1A 4YB5A 3O93A 5TARA 1IUNA 3L0PA 2OCIA 3QZ8A 4URHA 2LV8A 1PJRA 2VA3A 2DHEA 2CNWD 5INTA 3FYCA 5KT6A 4H0NA 3CURA 3D8HA 3EDMA 2HJHA 3G02A 2WMOB 1LPAB 4UU0A 2PTHA 4PTYA 2EKPA 1XMQC 2GPAA 2ON6A 3HP1A 2QVBA 1ZR4A 3U4IA 1KQPA 2HOQA 3LKVA 4LBVA 3FUCA 1TIPA 2SCUB 2Q7XA 3EY4A 3TQQA 2QTZA 4UATA 4OF4A 1WEYA 1U1OA 2GZAA 4RIIA 4I6EA 3VDMA 3CVVA 4H18A 4ZXPA 1LRJA 3DMJA 4LC9A 1U28C 4R2XA 3QYAA 1DRZA 5KFXA 4FLFA 4IV8A 4WCFA 4YRJA 1NBAA 2CFIA 2RHWA 5G0WA 3AKZA 3DHVA 2P4UA 4N4AA 1A0OA 3HKDB 2Z09A 2MY7A 3TJRA 4BB0A 2MTBA 3I72A 3KEGA 1RQPA 2VAXA 2C2MB 1YE3A 1XZEA 4RZ3A 5CX1B 1AUXA 4ZA1A 1FVSA 2W6NA 3I96A 5AKIA 3OL7A 1HQYE 4G1QA 3MM9B 1NBIA 5FXMA 2XYHA 5CT8A 2PFKA 3IXMA 2FZ4A 3OWXA 2Z6UA 2TS1A 3IBTA 3L4EA 5ESDA 5L9NA 2JEOA 1SUIA 4EENA 1JTFA 3X1KA 2C54A 1N5TA 4XM2A 1CZLA 2W6MA 2AJ1A 1XZQA 1C4XA 4B9LA 3A4YA 2Q8NA 3G68A 1EE1A 2IV2X 3E05A 1UXGA 1UBCA 2K2QB 1M5VC 5C53B 2RGUA 5KTKA 3CUSA 1LSOA 5HMZA 1RTHA 1GILA 1N36C 2UV8A 2CNOA 3W7VA 4YRKA 2L48A 5HRAA 4B71A 1N34J 4DV4F 3TFWA 2Q3CA 1UM9A 1VGYA 3SVTA 1KC1A 3NO4A 2BFEA 2VJYA 4D97A 1S2LA 3TAUA 2WSMA 4QYTA 2QA2A 2RVJA 1NZ8A 2IRYA 4J3FA 1Y3FE 1UJ4A 4DV6F 3CZQA 2HEKA 2GEBA 1MAVA 2GBIA 2N1BA 2C3YA 3OFEA 3AQ4A 3BHJA 4DV3C 3QBTA 3ST7A 2PKEA 2FLKA 3Q0TA 2Q5IA 2J48A 2QSJA 2GLUA 1VIAA 4MGZR 3PJWA 3P9QA 4U7UD 4GOMD 4B7CA 1KIMA 5IUNC 3ABOB 5CABA 3OJEA 3PVCA 5GAEU 4ZA2A 1HF3A 1O6CA 1BQXA 1JLAA 1E3TA 1VQYA 2IIPA 4PZDA 5L3RA 1AW0A 4R1PA 2Q29A 2CLSA 3GEBA 1BX3A 3DMTA 3QVXA 2MCQA 1UBNA 3IIEA 2FHOB 4WFKA 2OZKA 3H0KA 3KE9A 1SC3B 2HIQA 4ZALA 5DI3B 2NV6A 1PGOA 1G9SA 1FUUA 2BKVA 5CJ2A 5TPZA 1P0MA 4A0RA 1U4OA 2PMDA 4A16A 4MGEA 2BGGA 2HN9A 1VL8A 1R15A 1JDUA 2E37A 2D7DA 2W42A 4BMSA 1RW4A 4N9QA 5ERYA 3SZ2A 4AD6A 4KREA 1NZJA 4CDMA 3KLPX 2ODNA 4FB4A 3B9RA 5B1SA 2DR8A 2DYKA 3D6FA 1E6YB 3SS7X 3M8PB 4RTJA 1GKIA 4JJZA 4WXOA 1U8ZA 1OVGA 1FSFA 3ZBTA 1VQ7S 3N5KA 4RU9A 3IIIA 3DZ8A 3PX7A 4RTPA 5AJWA 4KPCA 2BEJA 4PZAA 2C82A 2CVZA 4UUQA 2GO9A 4PZ0A 3G2MA 4IIVA 1A9YA 3RIMA 3QFHA 3KB6A 2PGIA 4YV1A 5T6BA 3O90A 1VBFA 1IB0A 2EFCB 2ASEA 4LE2A 1TZ2A 3TAQA 1YB7A 2ZUBA 2I99A 1UPAA 1UVLA 1TGVA 5K3EA 3AEUB 2BP7A 1P0QA 1ZG3A 3FGPA 1JEJA 4DJDC 4PSKA 1JG1A 3GRZA 2OGTA 3T4UA 2G08A 2WWHA 2YW9A 2DCUB 2X4GA 2XUQA 4IFEA 4RK1A 4RCZA 5DOZA 1GZUA 3TQOA 1I7PA 3NS7A 3CNQP 4LFBF 4P9NA 4U3JB 2B4VA 2AWZA 1LDBA 3AR7A 4PUOA 4JVNA 1Z29A 1KZGB 1G6Q1 4FKYA 1EFPA 4RBVA 1GL3A 4L5BA 2Q3FA 1LA2A 5LOVB 5T14A 2BVZA 2HA7A 3LLVA 1KOGA 3MM4A 2CPFA 4J9SA 1DZ3A 2O01C 4QZVB 1BE4A 5FNVA 1K88A 1VQ9S 3GDOA 2PS3A 4AD8A 1MP0A 5ECDA 1VMDA 5EVJA 2GI4A 3QITA 1RXEA 1H6CA 2YWDA 4D99A 4DSUA 3BICA 3L77A 4K9SA 1DAMA 2GLTA 4Y1EA 1R0AA 4M9SA 1CUDA 4RY0A 2YOHA 2NYHA 3I6MA 1IMOA 4MUYA 2K1RB 4F96A 3DOCA 1F6DA 4MPJA 1GTEA 2ZUAA 2H1HA 4OMCA 3OD2A 5A6PA 2Q5FA 1L1EA 4LPKA 3U1MA 2GN9A 4ARAA 1IJKA 4OI4A 1AF7A 3D1OA 1QIEA 3K32A 4GKBA 4ACAA 1DIRA 3HHDA 3V32A 3EZLA 1SK9A 1MN6A 3VZCA 3DVQX 2CG8A 1IHUA 2UP1A 1M10A 4DJJA 1Q1KA 1LNSA 2D2IA 1HZJA 1IDOA 3EXIB 1NF8A 5JSZA 4RZXA 1IIBA 1WW2A 1Q15A 3EXFA 3LUPA 1E0KA 4JX8A 4RFLA 3FSGD 5FJIA 4Q9DA 4F3OA 3O8QB 1T6YA 4A2QA 2R3SA 3DAFA 2PLRA 3DOJA 3MT0A 2PZMA 2GT1A 2O0JA 1B0VA 5DYTA 4E0BA 3ROZA 3FNHA 3OJFA 2BRLA 1V5IA 1TW2A 1O2DA 2P5VA 1NUHA 4ZV7A 4MGIR 4ROSA 2DBQA 3WRYA 1U0SY 3S28A 4IFIA 3RTDA 3DULA 1LWFB 1KGDA 5KG3A 4UTOA 4XZ3A 4RW9A 1VCHA 4MO9A 4G8JA 1NKEA 2PIDA 2WQ6A 3RVNA 4F7VA 4RXUA 1O92A 1W2IA 2X2PA 4CEJA 2EJWA 2F4VJ 3K9CA 2G9OA 3A9RA 1DG3A 3DHYA 1KHHA 2FPPB 1AO0A 3Q89A 1LPMA 1AA9A 1WDWB 4F3MA 3HCEA 1YFLA 2I2DA 4Q39A 2C3MA 1NRXA 2QUAA 1PV4A 3O2NA 4HI0E 4Y1GA 2VG6B 4BFZA 2D6FA 1EX1A 2D3UA 3L0BA 3ILJA 1IBLF 3Q7PA 4G37A 1GU7A 3BRQA 3PRVA 1GMWD 3O4JA 5TVKA 3HCCA 3VC3A 1KN6A 3PXGa 1PNTA 2BXJA 1V48A 2O3JA 4ZMRA 4EFAC 1SPXA 5J1PA 3SM3A 3O8CA 4C2TA 4IMRA 3R27A 4ENPA 4OX9F 1PJTA 1JPNA 1JX4A 2NXNA 3JZMA 4ZGWA 1CC8A 4FKMA 4UOQA 1H3FA 3JQ7B 1UA0A 4YDHB 2HA3A 2P6UA 1I3MA 4LBPA 4J9NA 1KHTA 1T94A 2QP9X 3E9ZA 2IS6A 2DO0A 3HM2A 1PDVA 1UMBA 4H3KB 1TQHA 3MJCA 3LY5A 2OPHA 3OX1A 4B9NA 3SX0A 2W9AA 4K2AA 5BW8A 2F3SA 3VJRA 2C00A 4WN9B 3K1YA 3P0IA 5EWEA 2DBYA 4UZSA 1TK5A 2Y0DA 1HD0A 1FX2A 3WI7A 1UVIA 1F2VA 3ZNJ1 2VSYA 1BQMA 4G56A 5HJ7A 5BOSB 4WH0A 1FYDA 4OHKA 3L6OO 1B74A 4EYQA 1DQPA 1ZEMA 2XUAA 1M5TA 3HB5X 5D01A 2VU5A 1TF5A 3B3QA 1R8XA 2GYYA 2J7PD 1OY8A 1H6KX 4E46A 2NU9A 2JFFA 3L7LA 4MRNA 2F48A 4OBBA 4BLPA 1MROB 1ZKMA 4EHLA 3HGMA 5JZBA 3ETOA 5H9EJ 2RQ4A 1LFWA 4LSZA 2Y1JA 4H27A 1QIKA 3ETNA 2P9BA 4NESA 2KN4A 3CBQA 1KMHB 4DL7A 4DNXA 4G5OA 2X23A 5K8UA 3ESZA 3MMBA 3TX2A 4AP5A 3JVEA 3V9PA 5JHHB 3C14B 4KJXA 2XF2A 4DR2F 1R6YA 3B2QA 4RH0A 5KX5B 3FEXB 4FNGA 3BWXA 3JQ8B 1R9NA 1VIOA 1NX6A 1C3EA 5CDFA 2O5VA 4V0SA 1HQDA 1XTQA 1LBTA 2ZETA 3QEJA 1V3QE 2AZXA 4UCWA 4GMXA 2CNKB 1J0XO 1WM1A 1X31C 4TQSA 4ETNA 4JQSA 4Y2UA 4MQEA 1S9EA 3BD9A 1ST2A 2QZ9A 2DNPA 3LIPA 1NN3A 1DRVA 3QKSA 4CL3A 4G36A 4DV4B 1U9YA 4TZ6A 2OQIA 5EL0A 3RUFA 4AMUA 1GYPA 2RH3A 3RYIB 2AQKA 4QUHA 4DU8A 5DLEA 2CUYA 5BYSA 4QQ8A 5I3UA 4CM4B 1XZPA 4F50A 1FESA 4HTAA 3HT3A 3P45A 3WE7A 5FWNA 1W0JD 3R7FA 421PA 2VQSA 2WSBA 1K6EA 2KHZA 4K3UA 4D82A 1Z0JA 2WMDA 1DCTA 1RXUA 4KV9A 1MT3A 4UD2A 4P4SB 2QBYA 1NW4A 3ZNUA 3HJBA 5DASA 1TU0B 1DFDA 4PYJA 5J40A 1RT1B 4YMIA 1G8SA 3WYNA 4C11A 4Z49A 3SBXA 4LR9A 3JQQA 1YRUA 4JBLA 2V4UA 521PA 1JG6A 4XB6B 5IF3A 1BO6A 5IJZA 1RLMA 3P9PA 3A6PC 3ZZRA 1FTYA 4MW6A 4I55A 3GFSA 4P32A 1I33A 2X9GA 2GEDA 1UEIA 2OHIA 3QGMA 5KOYA 1P5ZB 1MO5A 5EHNA 3VZPA 4LPSA 3U7HB 4DJEC 4UFNA 4EM6A 2GRUA 4Q8EA 1JJIA 2FZCB 1Q6ZA 1FVQA 2HBRB 1ZXLA 1A9ZA 2XDYA 4FQ5A 3KSDO 4GR5A 1Y8RA 2HV9A 3QYJA 1I10A 1K5DA 6REQA 3RTVA 4UNIA 3HUUA 5A2QD 3MPUB 2VHYA 3ENNA 3PEFA 4EI9A 4G89A 1O0CA 2X8AA 1LXCA 4MYSA 1H38A 2B2XA 4WLNA 4BB5A 4HR7A 4DYVA 4DZDA 2WHQA 2QP4A 1UOQA 4FHGA 1CJUA 1QAIA 3JAWA 4MCIA 4DC9A 2QF7A 4HLUA 3QKWA 4BNNA 1V7QA 3U9LA 4BV3A 3ZIAD 4DS5A 1KO1A 4TOIA 4Q3CA 1ICEA 4CMEC 3Q5DA 2YWXA 5DGTA 2WUEA 3NS5A 4MFBB 4H08A 1OXBB 3KSRA 1FUEA 3KFWX 1RTZA 2HA0A 2I0XA 2NUPA 4L27A 4NYOA 3B1XA 4X95A 5DT2A 2ILZA 1L5GB 3PU6A 5C1DA 4HJRA 2FUEA 1AKVA 1F2HA 2AKAB 3H99A 4Q34A 4YV2A 4IDKA 3O8OB 3VHXB 2IBSA 2XDQB 3MWDB 4LSWA 4NZ0A 1AUQA 1T4MA 2A78A 2A0KA 2ZI4A 4DNQA 2FHJA 4ICLA 3QI2A 4I1SA 2EWVA 3A8EA 3GPAA 3L09A 4LTMA 4LJLA 1WG4A 5IP5A 2ZUDA 2YV3A 3OEED 4FGKA 3BMNB 3TB4A 1PUXA 2PX4A 3PL1A 1B00A 2GO7A 1K3TA 3FTPA 4F4UA 5LN1A 2GXAA 5K0BA 3M70A 3PKZA 1D8YA 2Y68A 1U48A 4WJBA 4XAKA 3GCXP 3BN3A 1PR6A 1SQGA 3PFNA 3QG5A 3U56A 1RU2A 3ZWDA 2EEYA 2HPUA 1KMQA 2BCGY 1M5RA 5TXGA 1QRSA 3SYKA 2B6HA 2CJWA 5A8RB 4LJ8A 4JV0A 4YY3C 2XQKA 2RAPA 2QUIA 2P2JA 4TWBA 3I2GA 1N36F 5T8SA 1ZUWA 3IS9A 4TZTA 4BV9A 2GAGC 1S0NA 4HZUB 1YBUA 5JMPA 1DIHA 4ECEA 3OJUA 1NLYA 3WIBA 2FSSA 1ZA1A 4BAGA 3KLBA 4L0DA 1T0PA 2V0GA 1RKQA 1KYVA 4PCLA 4N5LA 5CYQB 2OOSA 3QO9B 4LSLA 4L95C 1UEUA 5LD2B 3P9SA 4O1MA 1XFDA 3G8YA 4TUYA 3MBKA 2GHVC 2XHEA 5IK2A 2RKOA 4MIBA 3B38A 3KUKA 4GZ3A 1CPYA 2N47A 3IQWA 3B2EA 4J9MA 2P9QA 3HDTA 4H6VA 1YR9A 4YR0A 1DCMA 3GBSA 4DG8A 1VHLA 1OT3A 1KFEB 1J70A 4QXMA 2RJZA 3R3VA 4IXTA 2YN0A 1S97A 3LHIA 4ZI3A 5DBIA 1L9XA 3ZO7A 1NBEA 2FR1A 1C3OA 2B8TA 1LF5A 1E96A 2VHQA 1JDBC 4M46A 2YOGA 3S2YA 1SKWA 3HP4A 4RORA 3AVUA 2VH1A 4HT3B 1SC3A 3PLAE 3PACA 1PAUA 3CEDA 3C6TA 1ZPDA 4V02A 4INPA 3V6DB 1NXVA 4L5IA 1LWEB 1YR3A 1N2OA 4MKYA 621PA 1NU8A 2JANA 4B8YA 2REXB 3J7Z5 5AKJA 5FAXA 1ULAA 1GL9B 3LHDA 2AWNA 1IZ8A 3SMZA 3DZBA 1OX4B 4EY6A 4EY8A 2VDWA 4EF5A 4RD4A 4PHFA 2QTVA 1T9WA 1Q17A 4DILA 3CVXA 4S1OA 3H5LA 4DU7A 3FFXA 1OSCA 4OYHA 1K7CA 1EESA 5K5EA 3PROC 1XMSA 2DR6A 2FNAA 1EMDA 3TZBA 4RXMA 4M8IA 2K2WA 5KOWA 2YXLA 5DDOC 1RT7A 3WYFA 1XNRC 3HFJA 4M3NA 3NT4A 2VXBA 4RW7B 3SXPA 1SBNE 1DEKA 2DTJA 4HUJA 3LS2A 1HK7A 2A58A 2QM7A 1QMPA 2NU9B 5FKJA 1J5EC 4RKRA 3C1TA 4PSAA 3SBEA 2Q8QA 2F8HA 5TF0A 2QFJA 3UJ6A 2X6TA 1FXLA 5IC4A 1QF6A 3BQ9A 3FSGA 3MFQA 2D0IA 5BV0A 3BGUA 1Y9JA 2PT9A 3KT6A 2BMEA 1AH2A 2OPRA 4GYKA 4GECA 3IT0A 3IUQA 4C2UA 2NU6B 1FDWA 4LK2A 4QHSA 2XUHA 1TQLA 4E4TA 4C7JA 2ZYVX 5I7SA 4ZPWR 1NWCA 4JUDX 4K4WA 1ZD1A 5A2GA 2QJWA 4FPXA 3VZSA 2L19A 3M6XA 2CDBA 2AI3A 1SZCA 2X9LA 2LCWA 1FS5A 4X6UA 1PQPA 1PZEA 5T6MA 1M1XB 4IOCQ 4AY2A 3UJHA 4DAEA 1CZNA 1YFJA 2IBTA 2VDKB 3BXZA 1RA6A 2OAQ1 1KEWA 4NLSA 3CLRC 3LSYA 2GEJA 4JI7J 3A13A 1JR3D 4HWTA 1DLJA 3QIDA 4DKXA 4LX0A 1CUGA 4TWIA 4YHBA 3RH0A 2FJ0A 4J4TA 4CCHA 1YWGO 3NIWA 1ICIA 1CG6A 1XCJA 3MERA 1RYDA 4FZ3A 4I5EA 4KHPC 1VMIA 1UMKA 4G3IA 1UQRA 3UCUP 2QUBA 3WOVA 4AY3A 7FDRA 5K45A 2QSFA 2OAP1 6REQB 2HFVA 1O03A 4ALJA 4JH0A 4J7CA 2ECKA 5EWGA 2LQBA 1XMQF 3B36A 1C1DA 2I2YA 3ND5A 3I9FA 5K0CA 1U3DA 3EBOA 2W6PA 2W48A 5JEDA 3GFQA 1PJ8A 1I94J 2I4TA 3HR7A