2ZZNA

The complex structure of atrm5 and trnacys
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
336
structure length
336
Chain Sequence
MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Uncharacterized protein MJ0883
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 81
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zznA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zznA03
4BLWA 1NKVA 1JQEA 2BR3A 3MB5A 1XDUA 4P7KA 5HZMA 3GXOA 2P41A 3CJTA 3JWGA 4E32A 3BXOA 3MCZA 3R0QA 4IV8A 4QQKA 2PSSA 4BLVA 4C05A 5G02A 4YUVA 5GINE 2P7HA 2HV9A 4PWYA 5E1BA 3M6VA 2IDKA 5T64A 3C6MA 2ZIGA 4PGHA 3VC1A 1KPIA 4DZRA 2P7IA 2AOTA 3REOA 3BGDA 4GOOD 3I58A 2GPYA 4KDCA 4RTLA 2O06A 3KQSA 2I62A 1VE3A 5K09A 3ANXA 3OZRA 1FPQA 2VP3A 3DMHA 4E2YA 4ER0A 5GIOE 5E1MA 4FR0A 5LSAA 2JJQA 2AS0A 2YXEA 3CVOA 3KQYA 5CCBA 1BKYA 1EG2A 2Q41A 2OXTA 1NW3A 2IGTA 4PYIA 1NW6A 2EFJA 2OY0A 1RI2A 2Y1XA 1VBFA 4Z2YA 2NXNA 4KIFA 2IBSA 5B1SA 3P2EA 4V0QA 4OA8A 5E1OA 3GGDA 4PYOA 5H02A 1JG1A 2AOWA 5K0FA 4DQ0A 3AJDA 2PJDA 3EMBA 2ZFUA 3UJ9A 3BWMA 3FTCA 3NVKI 1PJZA 3FRHA 3KR0A 2PLWA 1KP9A 3EPPA 3EVDA 2BH2A 2YR0A 3THRA 4YMHA 2C7QA 3P2IA 5LQAA 3B89A 2ZIFA 3QOXA 5C0OE 3TFWA 2ESRA 3M4XA 3T7TA 2IH2A 1XJ5A 4GOLD 3LX6A 4QPNA 1QYRA 5GM1A 4K6MA 2O57A 3M6XA 4XUCA 4C07A 1NW7A 3LKDA 1EJ0A 5KQRA 4PNEA 2NP7A 4KWCA 4P7JA 2UYHA 2R3SA 4RVDA 2HTEA 1XVAA 3A4TA 3GRRA 2GAFA 5DXJA 3SSOA 1L1EA 5HILA 3OFJA 4C08A 5LR6A 3B3JA 5FA5A 5FWAA 5HFJA 3GRUA 4YV0A 2XBMA 1R6AA 2N47A 3BKWA 3HP7A 2AZTA 2PY6A 4M7RA 3CCFA 3GNLA 3IV6A 2XVAA 3MGGA 4FGZA 4QDJA 5DX1A 5BP7A 1RI3A 4A6EA 2NNWB 4WVLA 1WS6A 1KHHA 3C3PA 3UJDA 1V39A 1O9HA 2VZ9A 5IH3A 3TLJA 2ORED 3G7UA 5CCXA 2CMHA 2G8NA 3FYCA 4YMGA 3ID6C 3RIEA 1F3LA 5DXAA 4DMGA 1KR5A 2VS1A 3I5UA 3G5TA 5ICCA 2PX2A 3B3GA 4XUDA 5HIKA 4IWNA 4QVGA 1D2GA 3R6TA 1QZZA 2UZ4A 3V97A 3EEYA 3ME5A 2P3LA 1L9KA 2PVCA 4HTFA 2I9KA 4PIMA 5EKUA 1YFJA 1WXWA 3ORHA 3EEOA 2A14A 4HRAA 4KVZA 2GH1A 1P91A 3HVHA 2EJTA 3DH0A 3KPWA 5CVEA 5DT2A 4EQZA 4ER3A 3OPNA 4FS8A 5EC8A 1R8YA 3PS9A 3DR5A 1YUBA 4CKEA 1NV9A 1NBIA 3DUWA 2ZVJA 3DXZA 3G2MA 3OZTA 5FHRA 1TPYA 1B42A 1JQ3A 5CM2Z 3KQQA 4KIGA 1T43A 4HGZA 1NW8A 5DLYA 2AN3A 5FUBA 3PFGA 3EVFA 3BUSA 1VL5A 3KHKA 1HMYA 3KQMA 2AOTB 1O54A 2LD4A 5JR3A 5LQUA 1QAOA 3BGVA 2BM8A 3HNRA 5E2AA 5FQNA 2GB4A 5EZSA 2FRXA 1JG4A 2AOVA 3B7PA 3FPEA 4QPPA 5ERGB 2O0LA 5FTWA 9MHTA 4WXHA 4MQ4A 3HA7A 3NW9A 3NWBA 3S68A 3D2LA 4OQDA 4EKGA 1KIAA 4RTJA 3DP7A 3TQSA 1YB2A 2B9EA 4ISCA 1WY7A 3GRVA 2PX5A 4R6WA 5F2KA 4E70A 4QVKA 3GWZA 2VDVE 4R05A 5EMMA 1X1BA 2CKDA 3UBTA 1Y8CA 2ZLBA 3FUVA 4MWZA 1AV6A 2OBFA 4Y2HA 5DM4A 4C03A 3DMGA 5DRYA 4KRGA 3NMUF 2ONYA 3L8DA 2IDJA 3G2OA 1R00A 3P9CA 1RI5A 1SKMA 2IIPA 4KW7A 4BLUA 3P9KA 3VSEA 3JWJA 3K6RA 4AUKA 4RTOA 1KXZA 2ZIEA 3DTNA 2KW5A 3LPMA 5EEHA 5EQJB 5K0GA 2JG3A 5LQKA 2GLUA 3T7SA 3R24A 4P7GA 3DLCA 5EIWA 3P9IA 1SVUA 2XYRA 1RJEA 3EVCA 3U81A 5C9ZA 1RI4A 2PWYA 2ZZKA 3FUWA 3FUUA 4E2ZA 1M0EA 5DRTA 1TW3A 2IH4A 3PB3A 4XUEA 2NYUA 3LDFA 1QAQA 3R9XB 1JG2A 5K0NA 2AN4A 2CL5A 4KDRA 2ZULA 1M6EX 5DSTA 3C0KA 4C4AA 3TOSA 5GM2A 4GF5A 4C06A 4C04A 1G60A 1RJFA 5EMKA 1ZQ9A 3SM3A 5GP1A 3K0BA 3A7DA 2AN5A 1I9GA 2WA2A 1RJDA 1VP9A 5K0CA 1WZNA 4HTFB 8MHTA 3GIWA 4PCLA 4L7VA 2ZSUA 3OE5A 4LWOA 5GOZA 3UJ6A 2Z6UA 1SUIA 3LSTA 3PX3A 5DTMA 3O7WA 3UJCA 3ERCA 5E9JA 5K0LA 4CKCA 3KPYA 4RTMA 3FTDA 3CJQA 3BZBA 4GOND 5EMLA 3UA4A 5GIPE 2PBFA 4FP9A 1P1CA 3CJRA 4H0NA 1VP3A 3LKZA 1Q0TA 1G6Q1 5KVAA 3BKXA 4GEKA 3KR1A 3LECA 4POOA 3E7PA 3OE4A 3LCVB 3G88A 2AOXA 3THSA 1XCLA 4LWPA 4NECA 3T7RA 1IY9A 4X41A 4OQEA 2B2CA 5K0BA 2V7EA 3SVZA 5CVVA 1PRYA 1D2HA 2OKCA 2IPXA 5BW4A 2IH5A 4YUWA 4M38A 2NXCA 4RYLA 3NDIA 1I1NA 3KR2A 4JXJA 3VYWA 2PX4A 3NVMB 4A6DA 3LDUA 3EGVA 4MTLA 3M6WA 3BWBA 1MHTA 1X1AA 2PKWA 2QRVA 3CKKA 2PWPA 3EGIA 1IM8A 2YXDA 4UOEA 1X1CA 2ZWVA 3EVEA 2HNKA 3GRYA 5HOQA 5DTRA 3PTAA 2B25A 4DM3A 4RSRA 3HCDA 4B17A 2G70A 3SSNA 3TR6A 1ORHA 1F38A 1R74A 1YZHA 3P8ZA 5T67A 4DKJA 2AR0A 2QY6A 5FULA 1EIZA 1SQFA 3UJ8A 2WA1A 4OX9Y 3HVJA 2BR5A 3PX2A 5E1DA 3V8VA 1N7JA 5D1NA 4CTKA 1WG8A 4O29A 1BOOA 5ICFA 2PT6A 2H00A 2VDUE 4EK9A 4E31A 3FPJA 3G2QA 4FT2A 5DM2A 4PYJA 3GRZA 3UWPA 5E9WA 1NW5A 4V0RA 4PYNA 3LCCA 5FA8A 3OU6A 2YQZA 4EVIA 5M5BA 4YUZA 5LQRA 5MHTA 3KPJA 2JHAA 1FP1D 2C7PA 2V74B 2Y1WA 4PYQA 1D2CA 3JWIA 2DPMA 2QYOA 1L3IA 3KKZA 4U7PB 1U2ZA 4PIPA 1ZGAA 1L3CA 3VC2A 5HEKA 3T0IA 2ZBPA 5E8JA 3FPHA 1FBNA 3SMQA 3CC8A 4AZSA 2YX1A 3ELUA 3WSTA 2B3TA 4PINA 4QTUB 4RTSA 2YTZA 3MTEA 1AQIA 3PVCA 4LECA 4RVHA 4E2WA 3IEIA 2BR4A 2UYQA 1BC5A 4CXMA 5DX8A 5DM0A 3FPGA 4G56A 2WK1A 5EOVA 5EVJA 2FK8A 5CVDA 1FP2A 3IHTA 5CUQA 1XCJA 1VPTA 4PYMA 4RWZA 3HVKA 4GC5A 3CGGA 3HEMA 1XTPA 3AXTA 5CVJA 4HGYA 3KQPA 5DPMA 4HC4A 3Q87B 2CMGA 1FJXA 3JWHA 3LL7A 4MHTA 2EG5A 3MAGA 4U7TB 3P9NA 4FSDA 5F2OA 5K8VA 3GJYA 2BZGA 3G8AA 4E2XA 3ELWA 3G5LA 1SUSA 4EMSA 3C3YA 4YV2A 2OPBA 3FZGA 2ZBQA 3P71T 3G2PA 2QE6A 2P3QA 3MTIA 2G71A 3SSMA 1SG9A 1BHJA 3BT7A 3HTXA 3HCAA 4PYLA 5C1IA 2OZVA 3G8BA 5K0JA 3GCZA 4FZVA 1ZG3A 5EKXA 1WXXA 4RV9A 1I4WA 1Q0SA 2PGXA 3KQTA 5K03A 2ONZA 3NDJA 1JSZA 5HIJA 4EKIA 3MQ2A 5T6BA 2EJUA 2UYOA 4RVGA 5HIIA 3SXJA 4PCAA 1P1BA 2VDWA 2O05A 1YZ3A 2PV0A 3B5IA 2JH8A 5HIMA 1JSXA 3SR4A 1NV8A 2YUIA 3BWCA 3OCJA 3PT9A 2R6ZA 3NTVA 1H1DA 2QRVB 5EHGA 3HA5A 1G55A 3TKYA 3P97A 2JHCA 1DCTA 1YFLA 5LQCA 3DMFA 3F4KA 4OA5A 5DX0A 1RI1A 3FRIA 5DWQA 3TMAA 4R8SA 2P3OA 2P40A 4M37A 5JUWA 3FUXA 3OZSA 5FCDA 1AF7A 1NT2A 5EG5A 3EGEA 4F86A 2ZBRA 5KYGA 1SQGA 4FT4A 2AOUA 3DXYA 3E8SA 5CVUA 5FWDA 5P8WA 3R3HA 2ADMA 1N2XA 2I6GA 4LG1A 3HCCA 5EHIA 4PONA 3LGAA 1QAMA 3OFKA 4IKPA 5LQNA 4X60A 2FK7A 2OYRA 1R18A 4M36A 5KS2A 5ICGA 4MIKA 2OB1A 2AVDA 3ER9A 3M6UA 2YVLA 1ZHFA 4BP1A 4F85A 1JQDA 3E05A 2NP6A 2XYQA 4QDKA 1UIRA 4RTPA 2Z6QA 3PLAE 5E8RA 3TPZA 4CTJA 5EPEA 5ICEA 1EAMA 3TM5A 3I9FA 3HCEA 4X63A 3X0DA 4RTRA 3UFBA 4OBWA 4DA4A 3FUTA 4PGGA 4DCGA 1KYWA 1VIDA 3OU2A 2GS9A 4FSXA 3UZUA 1XDZA 3C6KA 4YUYA 1JTFA 3M70A 2P1DA 3KU1A 2HWKA 3KQOA 5EEGA 4BP3A 5FADA 2ZWAA 2NXJA 2PXAA 2GA9A 3A26A 4RTNA 3Q7EA 5EMJA 1XDSA 3OU7A 1G8AA 3LBFA 3FPFA 3IYLW 1DUSA 1OR8A 5DSXA 1ZKDA 2ERCA 4HSGA 1EQAA 3EVBA 1JG3A 3LDGA 4GQBA 4P7FA 4X1OA 5LQJA 4PYKA 3HM2A 4GUAA 2P8JA 1YF3A 1G38A 2FHPA 3GO4A 4ZTBA 3O31A 2DULA 2XVMA 4GOMD 5FHQA 2EX4A 3P2KA 2AVNA 5DTQA 1ORIA 2YXLA 3B3FA 1QANA 1RJGA 3HCFA 4ATNA 3KQWA 2HR1A 1L3BA 1XXLA 2F8LA 3M33A 4YV1A 3ER8A 2Z6AA 3G89A 1DL5A 2HMYB 2ZCJA 4R8RA 1Z3CA 3LHDA 2XYVA 5GWXA 3TKAA 1P39A 3DLIA 3EVAA 2G1PA 3QOWA 1G8SA 2O07A 2H11A 4HG2A 4ER5A 3BGIA 3KPUA 3HCBA 3UJAA 1AQJA 2PXXA 2E5WA 3SX0A 2FYTA 2JH9A 1N7IA 2UYCA 4CWAA 1INLA 3HA3A 1ZGJA 5CIYA 3MERA 3AY0A 4AZWA 1M6YA 2QM3A 3UJ7A 2FPOA 1NE2A 2G72A 3EVZA 4GBED 2C7OA 5DM1A 3EMDA 3LBYA 5BW5A 2PXCA 5EZQA 3LCUA 1UWVA 2JHPA 2K4MA 5BXYA 2IBTA 3A7EA 2I7CA 4CKBA 3I64A 4ER7A 2AOUB 4GC9A 4P58A 7MHTA 2BM9A 3KPVA 4ER6A 4BY9E 2C7RA 2H1RA 4RVFA 3FTFA 3NJRA 1R8XA 3E23A 4IV0A 4OBXA 3UJBA 3MHTA 1KPHA 4E33A 3UA3A 4RTQA 3BWYA 3HVIA 2PX8A 3PFHA 3FYDA 4F84A 5F2NA 5K05A 3ELYA 4QQNA 3NWEA 3GDHA 3KR9A 10MHA 2PT9A 4XCXA 2NXEA 3H2BA 2ZZNA 4QTTB 2FCAA 2IP2A 3AWIA 1NBHA 1EJ6A 1UFKA 3TRKA 3FTEA 1KPGA 2OB2A 3QV2A 2ZTHA 1TW2A 4AZVA 3AXSA 3ELDA 4Y30A 3RW9A 5K01A 4X61A 5D1HA 4E30A 1O9GA 3DOUA 4YUXA 4DF3A 3KQVA 2OO3A 5CD1A 3TM4A 1X1DA 3CBGA 3MCTA 2B78A 5EIFA 2ZZMA 3DULA 2IFTA 5U4XA 3DXXA 5EGSA 3SGLA 4HH4A 4AZTA 5KQSA 5E2BA 5FQOA 1IXKA 1MJFA 5IKMA 3O4FA 1JR4A 3EVGA 3RODA 1JTEA 3GU3A 1X19A 4AX8A 3I53A 4DCMA 5K0EA 2P35A 2ZW9A 3A27A 1VQ1A 4R6XA 3A25A 1HNNA 5E9QA 4RTKA 4RX1A 2CWWA 1VLMA 1KYZA
chains in the Genus database with same CATH superfamily
5C52B 1E3LA 4YJ2B 3R8CA 4C9BA 4QZVA 4JYZA 1QYXA 3RJMB 3OOSA 4ZPAA 1A76A 1UDWA 4YIKA 5TEWA 4BXOA 2KJQA 1DPFA 2DQZA 5AJZA 5L46A 1E64A 1SY7A 1NL3A 1KDTA 3ESAA 3NAZA 1YVRA 1KZ9A 2IU6A 3EUFA 3KDPA 2IPOA 4H3VA 5J4KA 2GYWA 2LIVA 1MB3A 2YVKA 1E5TA 1NU8A 2OP0A 2NUUG 3ETHA 4D2IA 1U2QA 3T7TA 1FNOA 5AVJA 3DF7A 3DV0A 4J29A 4D9MA 1AK1A 4Y18A 1WEZA 3A2NA 3T19A 2N47A 4Y6SA 3R9XA 2CLKB 3ZY2A 4BDSA 4YP7A 2EAUA 5F8MA 4M9UA 3B70A 4N5NA 1RADA 5BR8C 5JAPA 4LF6F 5LD2B 2CB0A 3H5LA 1C1CA 5HZKA 4OIMA 4FD3A 5FD8A 3MGBA 5EC8A 2AWNA 3PPIA 3KDNA 3AVVA 5L3SB 1QYIA 3A6JA 1ODKA 4QYZJ 4ZT3A 3FF4A 2X3YA 3C98A 4LA4A 5E2AA 5FQNA 5FTWA 2OHIA 3A1TA 3V00A 2NS1B 3C5CA 4YQWA 1H22A 3DO6A 4P3OA 1NY6A 4M5IA 2FWAA 2RT3A 3CPHA 5HLFA 2W22A 4M3NA 4OQFA 1WXHA 1P9QC 4XSGA 2GJAA 3GD7A 2XZTA 3SCIE 2A9FA 2WTAA 5A0YB 4RA6B 2UUBF 2HWHA 3EBPA 2W2VA 1WHXA 4LRUA 2XKBA 3RWOA 2HQCA 3SEAA 1A5TA 2AFIE 4JBGA 3UQSA 4Y6LA 4V0NA 2AN5A 3D8RA 4DY4A 1FT8A 3ZOZA 5L1LA 4DV4F 1NK0A 3J7A1 2XM3A 4KIWA 3TNVA 2ZRJA 2GCNA 4M0CA 1UJ4A 1TK8A 2GFIA 3B7GA 3RYIB 3O2QB 1ESCA 1UJ6A 3NC4A 4BRZA 4PRZA 5D0GA 5EERA 3GUHA 3LYUA 2IH5A 3GILA 4X66C 2B36A 2I4RA 5KSWB 4WHMA 4E21A 1T1JA 1Y00A 3SZGA 2WB4A 2W9CA 3TTSA 3EWAA 4YALA 4ID9A 4OKIA 3HHEA 1RRMA 4GE3A 4B3TJ 1M1XB 4UAVA 1UC5B 1NW5A 4HZGA 4AWAA 2XIJA 2RB7A 2AFIB 2B94A 3OCVA 3BHIA 2P9TA 4BFLA 3D7MA 2I4MA 2V5AA 5M2QA 1RAEB 1K88A 4DPMA 2VO1A 3CPWR 4I2NA 2EXXA 2IPNA 1H4SA 4UAGA 1CJUA 4KN6A 4RHEA 3FHOA 4PAMA 4RWZA 3KTAB 4BBPA 5L7TA 2JD0A 3FR8A 3H97A 4ECRA 3EZGA 4CIWA 3R9LA 821PA 1FA0A 3VNQA 1CVRA 4R7ZA 5C1IA 3HKCB 5EKXA 1IZ7A 1NOKA 3JQ9C 1IL0A 5DM60 2BGLA 4I0WA 5DLPA 3TIIA 3O8QA 1V47A 2VT3A 4A8JB 3F4KA 2C2ZB 4ZMRA 2R8BA 1CV2A 4TUYA 3GEPA 2X9NA 1X9IA 2YJGA 3T5KA 3Q85A 5AM3A 4RUAA 2DR0A 3L0DA 3QI2A 1VHDA 4JV5B 3FFIA 3T1YB 1R18A 4AJLA 2YCBA 4TTRA 1B0VA 4J7XA 4M5MA 1M2VB 1PQ4A 2VFTA 1B8OA 3I9NA 5IANA 5KOHA 1YK9A 1EAMA 1GX6A 2H18A 5K3DA 4AJPA 1EETA 1E3JA 1PA4A 4Z7YA 3W65A 4CZ2A 2FPIB 3ZGOA 4W5JA 1R8JA 1CJTB 2BFCB 2R7QA 2QVXX 3UXEA 1L7QA 5CFNA 1DP4A 5JSHA 2GJ2A 2JEGA 1X42A 3V8RA 4AROA 1SXJD 4MO2A 3SSRA 4FFBA 4KQHA 3HJGA 2JGDA 3PQ6A 2NSCA 1WLYA 3LUJA 3T3OA 1GXSA 4F5DA 4EYHB 3DMRA 1ZCAA 5LYJF 1B99A 3D7SB 4QU8A 3UJAA 2H9AA 2VDHA 3SOPA 3MWDB 4ZREA 1QONA 1NURA 4B3RF 4Q24A 2YWGA 3VDMA 2VB6A 4ZJZA 2MLYA 1MOPA 3INYA 4IV0A 4I9NA 5JAHA 2IHTA 1E2JA 3ENAA 3QMPA 3G17A 4LQ3A 2GN1A 5KQSA 3HHPA 3JD0A 1FYXA 3QBEA 2O8NA 3VF0B 1X19A 2AWZA 5BVHA 5L3QA 2HMIA 3PDUA 1QK4A 1E6MA 4RK4A 2V0CA 4AC9A 3DO5A 4NI5A 1HBNB 2CHVA 4FCWA 2PH7A 4Q4HA 1XLWA 3M5WA 3VFDA 1NI5A 4U2CA 2ISCA 3QSYB 4BNIA 4ZOAA 2YKQA 3CVWA 1NW3A 1YJVA 4B46A 4NVRA 5IN4A 2HAIA 3RKRA 3DYVA 4CV1A 1FP6A 1W2IA 1AKNA 4L85A 5HTOA 1PJZA 1X7ZB 2WB2A 4ARIA 2JSXA 4YC7A 3VR5D 3B85A 4M5KA 3BF8A 4NMWA 1VG9B 2ZB2A 2C2YA 5HMMA 3G0OA 2KXNB 1QU3A 1HEUA 1XVIA 3FBWA 5DI3A 3NM4A 3SLKA 1QVZA 1XMOF 3WVNA 3NI2A 2VPXA 2YKAA 4R8UB 1QRTA 5EYPA 4Q1BA 5HCUA 1T11A 4GGPA 3U61B 2PVCA 4LHZA 4M9CA 2RH3A 1MXAA 3T6JA 3O8DA 5A0TA 2R7MA 5CVEA 2A18A 2FTKE 2B7BB 1JU3A 1COWA 5B36A 1Q1BA 2K7ZA 5DGTA 3SHVA 4D74A 1R4MB 2VJAA 1GL6A 2HVDA 4NLSA 5EJ9A 2LD4A 3DMTA 3GJ8A 3FFAA 1CSEE 4P4TA 5GMKa 3HKEB 1FRLA 1WCV1 5HP1A 2TRSB 1WZ2A 2D41A 2WRZA 3TQSA 1BG6A 4DJDC 3SAJA 3ASVA 3IH5A 1YE5A 1A2OA 2FFAA 4JV0A 1L5MA 4Q9DA 2VZ0A 4F6CA 4W82A 1TE2A 3LD9A 1MLDA 4BNFA 2EZ4A 3CVJA 4JMPA 3VYVA 3M2TA 1RHUB 5EEHA 4DQSA 4HNAA 5D5QA 5IT5A 1KHWA 2XYRA 2Q6VA 3FD8A 3EEBA 4J1TC 2EG2A 1SVOA 5TMDA 2KQUA 4JU9A 1GG9A 1FCAA 2VKZG 3PBKA 5BUSA 1S10A 1LI7A 1UA0A 2HHWA 3T7DA 3MPWA 4Y2SA 2VQ6A 4DV0C 1ZK2A 3HDGA 3MT7A 1ICEA 5GOZA 1OC4A 1BGWA 4JUBA 4NIMA 4ZVQB 1K63A 3LOUA 2HSGA 1EZZB 5SYNA 4FJ0A 3W5BA 3DMJB 2SICE 5J2MB 1E2HA 1BVYF 1IY9A 3MF4A 4N4AA 2CXCA 4Q05A 4CT0A 2RCYA 1KP3A 4WXMA 1SNYA 4D1YA 2ZKUA 2HXYA 5F4BA 4BRUA 1MHTA 3B6ZA 2BD0A 1PG5B 4XQEA 4D92A 1EFPA 3TQRA 1RG9A 3IKVA 3QSIA 1RRCA 2Y0CA 1TD9A 3D5QA 3K0EA 1H0HA 5G0RB 3SFZA 1Q78A 4CLPA 1U7OA 4OX9B 5C25A 4KIAA 4F6RA 4E5UA 2KVIA 3X44A 5LMNC 1ROFA 4IFTA 3A28A 1KK1A 2HQOA 2ID4A 3RB6A 2U2FA 2Y1WA 1H3FA 4CM1A 5LC1A 2NCKL 1SCQA 4NMXA 2QTTA 4ZO7A 2QXUA 4OJ1A 2A8YA 3LT4A 4E2WA 3O92A 4LYJA 4QGSA 1HI8A 1SWVA 5C18A 2R8XA 1N1MA 4KB5A 5AQEA 5BWLA 1NUPA 1P1JA 1EHIA 4AL5A 5AE3A 3INRA 4GSLA 1KDYA 1SZDA 3GJTA 4FYJA 1E62A 2O05A 3RVNA 2ZJFA 2HRRA 5A3QA 2YUIA 4ICLA 3WSWA 2D7JA 1X0FA 1IVZA 2CZCA 2ERYA 2CGEA 4ENSA 1YL5A 5B53A 3IUQA 4M8SA 1XCPA 2QN3A 4FT4A 5D6OA 5JZSA 4X5OA 1ULHA 3O94A 4O2AA 3I1JA 1E3IA 3OTIA 1ZN7A 3KEQA 4XARA 4QYZK 3RBAA 1LLDA 1Y37A 2IYTA 4AM8A 1L5QA 2LTAA 2Y68A 3QKSA 2PO4A 2Z6QA 2PX3A 2WUFA 2GESA 4HJRA 2QZZA 1F48A 2PSDA 3O8NA 1L4FA 2BEWB 4RLFA 1NH8A 1AKMA 4QTYA 4HSEA 3ESCA 4RW7B 1SU8A 4WACA 3OLQA 5A2QA 2WVAA 2H2FA 3MPOA 3T9CA 2IHYA 4MKFA 4YRCA 2E55A 4OI6A 1PZGA 1GN9A 3ES9A 3UJNA 3H1FA 1UC8A 2JDID 3UYKA 3TB6A 4N56A 4TYQA 2HCTA 4QFDA 4Q3CA 1HLPA 1UPXA 1HBMB 2E5WA 4Q9JA 1RI7A 2V1UA 3BQMB 2NVUA 3OTBA 3H99A 2LZ0A 1NK4A 3TSAA 4DR5F 4GMHA 2BJEA 2MJLA 1MTOA 3ZQKA 2QGFB 2IXGA 3L8HA 4Z1MD 3UTCA 5BN1A 4EBDA 1R9NA 3W60A 3TSZA 4HDOB 1L4HA 2R8YA 4TKVB 1R64A 3J80Y 3VH3A 4F84A 3GP8A 2RSQA 4QDXA 10MHA 1FFSA 4NFSA 1NJ2A 5FOXA 1BD4A 4LC9A 1PJ2A 3E3MA 4OHYA 5E3QA 2JFNA 2ENUA 2JI4A 3UAVA 2Y6VA 2Y4NA 2FPPB 4BLVA 1KBQA 4RH1A 3HN2A 4MRVA 2F8EX 4CLSA 5FEUA 4L5BA 4HJXA 2JVRA 2IZ5A 1GP2A 3PIOQ 5J43A 1O6CA 1HD1A 3S82A 3RNLA 3GG2A 4MZXA 4Y6OA 3NT5A 4LJRA 1V8FA 1G3IA 1JPJA 1T5DX 5KFGA 4UUMA 4C21A 2PM8A 2PR7A 3CUSA 4USUA 5IAGA 1RBMA 4FINA 4B3SC 4K40A 2FWRA 3SQLA 4JYBA 3V4MA 1EZ1A 4Y6GB 2QR3A 1J0BA 1HNWJ 2DF8A 1D0IA 2EQAA 3EEQA 5FA5A 4NCGA 5C8DA 3HP7A 1QDUA 4TL7A 5L4LA 2C98A 4NCHA 4MAAA 3C3PA 1EP1B 2HSJA 3Q1LA 3JXOA 2K3IA 4IHKA 4JBLA 1Z0DA 2I9KA 3Q10A 2ISSD 1UZNA 4D4IA 2W71A 4EQZA 3BQ1A 1EQUA 5EN1A 1N2FA 1QV9A 1Q5PA 1YDMA 3IHKA 3A4IA 1SHLA 1LK7A 4HVTA 1POXA 1X4EA 4DL3A 3LSYA 1G7TA 3BBCA 4L16A 1RD4A 2V8PA 1WG4A 4ISCA 1VRTA 1TKXB 1ISGA 5JADA 5HGJA 3FUVA 4G0QA 4MUBA 1IZ8A 3N0RA 1FLNA 1CUWA 4M5DA 1TL3B 2GXUA 1QIGA 1Y1QA 4CLOA 4IDKB 3TZXA 4JI4J 2CVHA 4LF5F 1DC4A 2E1PA 1BDIA 3TPCA 1AKEA 3H05A 2PMKA 1QWOA 4Q9AA 2C2MA 1ACLA 2NYIA 1KMIY 3LQ4A 3I9KA 4F4KA 2D7CA 1WDTA 1RYRA 3RBEA 4MYSA 4QTZA 4CQMB 4ECSA 1ITPA 4MUFA 3V8BA 2A59A 4GD3Q 2N4DA 4RNHA 1CLFA 1IG0A 4FBGA 4RH3A 2J48A 4F7WA 1TK0A 4MWTA 5DBOA 1ML3A 3LTEA 2WG2A 4KPCA 5EWLA 3LLVA 2P8IA 2V63A 1QYDA 5HBMA 2XNHA 3DU5A 2V9PA 5LMUC 5GAJA 4B6QA 2YXDA 2FGKA 1XKLA 1J27A 1FVQA 5D8HB 2DQYA 1NUUA 2QL5B 2BI8A 4EELA 1OU0A 2PT6A 4ZD6A 1FUIA 3T0GA 3CD7A 3QRWA 1M2JA 1VFPA 3LCCA 1J9GA 3PDHA 2FYXA 1HQDA 4ZCIA 4UPEA 1X4AA 2BXJA 3HXMA 1EMDA 2Q4RA 1DU4A 3U7HB 2ZGVA 3MIZA 5GZ6A 3T3GA 2C2OA 3FTNA 3CW2C 2ZQYA 5CA0F 3GG1A 3WMGA 3SSAA 1FIUA 3BF7A 4N40A 3RYHA 2IPMA 2WFLA 3DTVD 5DGDA 2VSFA 4OHOA 3RSQA 3IWXA 4HACA 2ZC4A 2JCYA 2O5CA 3K9FC 5EZ5A 2MMGA 1K8AT 4KE6A 1UMCB 3SCZA 421PA 5T6BA 2XNKA 4OHCA 3DGEC 4RF2A 2XX3A 5FNVA 2PV0A 3LGHA 4MQ6A 1FHTA 1YJXA 4EYOA 4X54A 2ZUFA 4RIFA 2HWXA 4DFJA 3DMFA 5E6SA 4J9RA 3PFWO 2WJZB 3NT2A 2VH2A 1XOIA 1ZISA 4QSMA 3KXDA 2ASBA 5CFPA 3FSIA 4JQCA 1M72A 4OOEA 4B33A 4NH0A 5DJ5A 2WJIA 3UMYA 3LPAA 4EMTA 5ALWA 1XUOA 3BN4A 4N39A 2PAAA 3KZVA 1RKUA 1XRPA 1BWEA 3MM4A 9LDTA 3Q0TA 4ASUD 4R0VA 4URWR 4IO9Q 3I9V1 4TY8B 3OJ0A 1Z29A 3EMTA 1CFZA 4RGQA 1VEHA 4Y2RA 5U1PA 2WJ6A 5CR9A 2X14A 2P02A 2HR1A 2HMYB 3C4VA 5M2PA 4BQQA 4F4XA 3FGZA 1Z75A 3KPUA 4W7SA 1QNFA 1KQSR 4ENTA 3F46A 2J5BA 4N8OA 1RM5A 5I8WA 4Q34A 3O8LA 5FWYB 3ETLA 3AVXA 5LA6F 2Q3PA 5TJHA 4J8PA 1QIJA 2EG1A 4X00A 2B8JA 2I8EA 1FSZA 4BEJA 1IXSB 2WIDA 1BQNA 1I2AA 2VQFB 4G8DA 4FE4A 4D4MA 2Q2NA 2OXEA 4RTKA 2CWWA 1Z5UA 2G6BA 3GRKA 4I1TA 2CJYB 3SMVA 4N8SA 2WBMA 2D1QA 1H4TA 1LFPA 2GLTA 2GR9A 3AHDA 5IYZA 1JW9B 4Q3KA 2VA8A 3GJSA 5KKCA 3WLSA 2LEPA 1X1EA 1KTVA 3KSMA 1JLCA 2DBRA 2Q4DA 1PSWA 3ANSA 3C3BA 3CWQA 4DEXA 1OBOA 4Q3OA 1OY1A 1P6UA 3D7LA 2Y9MB 3LRXA 1NWHA 3M6XA 4Z0HO 2PLFA 4KN9S 3KOYA 2QRKA 2FX2A 4ZKEA 3BM5A 4Q02A 2Q9CA 6FDRA 2NU6A 5AKGA 4ZIWA 4XTTA 3CUKA 2R1TB 2P2CA 1E6VB 2B4PA 3KFLA 1ZJ6A 1IXYA 1V39A 5CFRA 3P0IA 3T1AA 4BLQA 2QTLA 5HIKA 2QQ0A 3GH1A 3ME5A 2IVFA 5DN9A 3USES 1LKZA 4JYAJ 4YVFA 5KTRA 2O2DA 4M9SA 4C5BA 1RM4A 1F8UA 4OYCA 4PLCA 2VU5A 5IDVA 4PKDB 3FPEA 4QBTA 3JALA 3V4FA 2XNQA 2HIYA 3BKUA 2G1JA 1CBKA 2JH3A 2IK8A 4ZA1A 4M89A 3PGVA 2NU7A 2X0FA 3FKSD 1KXZA 3FIUA 1PDVA 3ZVMA 4XX2A 1N7GA 5KYTA 3UMFA 5BYKA 4WOPA 3IEMA 2QTGA 1R0BA 4C8YA 4FN5A 1TL1A 3ZXWA 3JSAA 3M2PA 3NWPA 4RVOA 4MQFA 4CI0B 2J3EA 2O1PA 1DAKA 3OECA 3UOGA 3A3KA 3LTOA 3RBVA 4E5NA 5KNCH 4WOJA 5K0CA 2GF2A 4BFTA 1OWXA 2PZAA 3UJCA 3TZQA 1TAUA 5CU7A 2JATA 3ONEA 3NPDA 2DH5A 4H0NA 1C0LA 3WBBA 1U2PA 1WTBA 4IG0B 1DMSA 1UBGA 5AO9A 4NBNA 1GDDA 3GJ0A 4B7AA 3DYBA 2OFWA 1RBQA 5MLCV 2ZT8A 3SICE 4W6ZA 4P8RA 3CKKA 2PWPA 5F7JA 1IPEA 3GRYA 4LRYA 1W47A 1YQTA 4B71A 5LDHA 3OV7A 3M6FA 3L79A 1OT5A 4LV5B 1QORA 1MRSA 4O4JA 3UD4P 3RLIA 5FUXA 2QVYX 4U0JA 1F17A 1MO4A 1HBJA 2OFPA 3OTOC 3CWCA 1LPAB 4TLDA 1U7PA 3G5AA 3ILXA 5LL6d 4BNWA 4LEIA 4J90A 3WLTA 4JI7F 3GGSA 1VK3A 1NNSA 2EJVA 2PN1A 2F4VF 1S0UA 3ABRB 1QRSA 1TJYA 1TA0A 1OH7A 4B32A 2C8JA 3E9EA 5I9IA 3IHTA 3EFOA 3QVGA 1U5CA 3GFGA 1G5PA 3SO4A 3QG5A 4Y6QA 5DDPC 4Z37A 5THQA 4EB6A 3L18A 4YY3C 4M0KA 5KYYA 4M5LA 4O4HB 4OF4A 4BO0A 3NCHA 5AJXA 3OIUA 1XNQF 5KOJB 1SHTX 1B26A 1PJLA 3KEOA 1B93A 2IU0A 1YBVA 1ZD2P 4F60A 1UXJA 1V4VA 1CNEA 3SF8B 3SZ2A 3VAAA 1K6EA 2PGLA 3G0DA 3QVWA 2GPWA 2VBZA 3IEXA 3CCQS 4IO1A 5L38A 4BJHB 4XD7D 1OLSB 1ZI8A 4FXVA 4L9SA 4P3YA 2F4FA 2BDPA 2KFYA 4NLYA 3ZBUA 5B4UA 4MOWA 4PPQA 5TE9A 3AR4A 4YB5A 2D5IA 4LE0A 1V16B 3U4IA 3REGA 3IBCB 4AF6A 3KU1A 4RD6A 1CVLA 2Z2KA 4HNUA 3CNQS 4I4NA 4GR9A 1BX3A 13PKA 3A32A 3FOFC 1AZSA 5LQJA 4L8GA 1JIHA 1G38A 3JYNA 4PG6A 4LBHA 4K9PA 4FFSA 1AMNA 1LSUA 5DTQA 3LF0A 3GLSA 2AF4C 5KOWA 4PZAA 1UMDA 3RV2A 3AKYA 3L4EA 4HEQA 4RZ3A 4LF5C 3N01A 4EECA 2FRDA 1I6LA 4BX0A 1E8DA 2RHLA 2E5LJ 5BW5A 2J9GA 2WHEA 3QMQA 4EPYA 3QW2A 2I4TA 3BIJA 5A62A 5AHWA 1P2SA 4YUDA 4LYHA 3UJBA 2X42A 2HA7A 3WGLA 2OCDA 5G3ZA 5HS4A 3I6QA 2RHMA 5L6LB 3M8PB 1OIXA 3AR6A 3L4JA 5TT1A 2FUKA 3EIXA 3HI9A 1WP9A 2VTKA 2H3EB 2Z09A 5HM6A 4JI5F 3ZZOA 2PH5A 1N2BA 1V1MB 4RJKA 1PL8A 5U4XA 5LYYA 1EESA 1BE0A 2CL0X 3DLEB 4JL5A 2ZW9A 1XL1A 4HQNA 1Z5ZA 1WA5A 3VZIA 3RABA 3NEAA 1DAHA 1SH7A 2CZ9A 4F67A 4YJFA 1R15A 4QQKA 2ZWPA 3HFVA 1HBOA 3UK0A 3IOEA 5HW0A 2HJWA 2ZYTX 4DVGA 3FOCA 3QVLA 1X92A 2QIFA 3AR9A 2X77A 5E1OA 1VE7A 3V33A 1JPNA 2A86A 3RTDA 3PWZA 4I4BA 4L72B 2FLKA 3GVPA 2J0SA 1UFWA 2HAFA 2BCEA 1VYUA 5KPJA 1CZLA 2B4KA 2Q5CA 1XJ5A 2VHCA 5ALOA 5DGCA 1JYEA 3DBVO 4AQYC 1TL7C 3PVSA 4MVJE 4AKIA 4O3PA 3RG8A 2OFGX 3A12A 1ZA1B 2H2AA 3P2MA 1A4IA 5HK4A 3SD7A 2AQHA 3OUTA 1C1XB 1KTQA 4O4IA 4LSZA 2EJTA 4DLEA 3DDKA 4WCVA 2IYWA 3MTQA 1JNXX 1NMEA 3Q2IA 1RBZA 1B42A 1NQTA 5AI4A 2CQGA 5I7RA 3EXCX 4YGXB 3JQAB 3T1VA 1W2BR 3I2FA 2Y9HA 3TSOA 5H9VA 2QUKA 3L82B 4K9RA 1LPNA 3ZZNA 4DBLE 1JEDA 4GLBA 4OL9A 3FH0A 3HDYA 3T5JA 1ZU4A 4WCFC 2PI4A 4ZTUB 5AM5A 3HXPA 1KO4A 4A8MP 4OHUA 2BYCA 5CBPA 1V4NA 4MB2A 1A9OA 5F3RA 3I9LA 3P19A 2XUKA 3C8ZA 3F6SA 4AUKA 2VJMA 3FYSA 4URUR 4JENA 4BVKA 2ZYIA 1OW3B 4BFWA 4NU0A 4CF7A 5KFCA 4KIJA 1XZ8A 4PROC 2PCJA 4PPYA 5DHFA 3RK0A 1U09A 4GX2A 2ZXUA 3EWIA 4CLTA 4P4GA 1RE1A 5I7WA 3TZLA 2IYPA 5JCOA 1Y4UA 3QE0A 1UVNA 4JUZA 1GPBA 5KC8A 3AI7A 1J97A 4B87A 3H1GA 1X1TA 2IPXA 3OTHA 3GEDA 2QI9F 2PBLA 3GGPA 4FDAA 4ZARA 4ZOCA 3LT1A 1T2CA 4DJFC 1MB0A 2YWFA 1G63A 2E82A 3FDZA 4L8FA 2IMOA 3UJ8A 3BSSA 3QEOA 4DEZA 3EMKA 5JSFA 2QORA 2XKJE 4WN9A 4YV7A 3SQWA 3QEKA 2NUPA 1WXGA 1TCCA 4NKRA 1DLOB 3OH8A 1LQTA 4X1IB 4NU8X 4UMFA 2H1SA 4G63A 1DSSG 3NV7A 5B0CA 3I9JA 4RGBA 1US8A 3A3PA 2P75A 1H1TA 4CG1A 4GC5A 3RTBA 4N76A 1UKYA 4I1VA 2QKYA 3DW1X 2D1SA 1T9AA 4TWBA 2Z8YM 1ISRA 1TVCA 5G0VA 1YQHA 4BNYA 1URNA 2QLMA 4OAOA 4QJIA 4C0OC 1R8AA 1N8KA 2E7GA 4OHMA 2XKKA 4Z6KA 4QQ8A 1HNVB 2NTVA 5H7XA 3P9QA 3OFFA 1S9FA 1QC5A 3AJ1A 1G55A 4DA7A 1CJVA 3EA4A 4M1KA 4LJMA 2DGOA 1S59A 3Q2KA 1PE0A 1KQGA 4C4YA 2JAHA 1N92A 2GNKA 3LUFA 3ZW9A 1NQXA 3RVBA 2A5GA 4ZVEA 2HVZA 1TZMA 4HDQB 3KUUA 3SZUA 5E8RA 4NU6A 2A1BA 3W3AH 5J47A 2HHJA 1J42A 2FXIA 3HS3A 3WQHA 4BO9A 3W2WB 4JZKA 5K5MA 3Q7EA 1GO2A 3SQNA 2IZ7A 4MV1A 4KT0C 1TFUA 1XCGB 1SI9A 2Z5LA 1IBLJ 4TWRA 2UV8G 3DLKA 4M0UA 3A4LA 1T10A 1R6UA 5D6NA 2JL1A 4DQUA 3LHDA 3T15A 4I2PA 5C1DA 2CJQA 3T94A 1U3WA 3PP8A 4JIMA 2HHHB 2ZAMA 4UNNA 5K4AA 2HA0A 1OB5A 1PS9A 1KS9A 3T7CA 5CP8A 1KA9H 3WOVA 5CJ2A 2XUJA 4LSLA 1TJNA 5IWAF 4BTLA 4A92A 3FTFA 3OZGA 2ONFA 1RJ9B 3GD5A 5ARBA 4V2IA 2SCUB 2NXEA 5KWEA 1QK5A 3VAIA 2FWBA 1WD7A 4ESEA 4D5GA 4X4TA 1TEZA 3KQVA 1KH2A 1XE3A 3E3LA 3MM8A 5E3HA 3VALA 2B83A 1KYTA 1G66A 5ETOA 3C74A 5ALPA 1F0YA 1RBOB 4RSGA 2P7HA 1U2TA 3HJTA 1JA1A 3LO5A 2XBUA 1XMQC 4C7XA 1VCHA 4CGZA 3SJAA 3R3WA 5JMWA 3IP0A 4ZK7M 221PA 4MUAA 4H4KC 4D0NA 2H2GA 2XRMA 3WK5A 3UM9A 1XRMA 4XSVA 2JEOA 4IH9A 4MEBA 5K0FA 2PKQO 3L46A 4F6LA 2OLWA 2Q29A 4DLLA 1LD3A 3MCVA 1GZHB 4JBCA 2G1UA 2R1VA 3W8GA 4IZOA 3NGKA 3GAFA 2AIRA 5CD4H 2W6ZA 5B0BA 5F77A 3O9MA 3K15A 1HMVA 2F4VC 1UJ2A 4XO0A 2XZLA 5AW6A 1VECA 1GQYA 1OC2A 1S9EB 4D98A 2C5AA 1G3OA 3MJTA 2F1RA 4LIRA 5IC6A 4Z9FA 1YWGO 4F2RA 1MMFB 2A1TS 2LDIA 5HMZA 1ZVKA 1ZI9A 1QE5A 3P0HA 2GRUA 4PEVA 2W6PA 4ZIRB 1VJQA 1IG3A 1M34A 1XC7A 4F3OA 5HHTA 3KQQA 1FFEA 2PT7G 2DHCA 1YSJA 1USGA 1A82A 1JG4A 4DL0C 3K89A 4M2LA 1X1QA 1O51A 1YMVA 5C7YA 1RYHA 4I56A 2CV0A 5A7HA 4X6YA 1FJEB 2BYTA 3WY9A 2XDQB 4K8RA 3TTUA 1NBWB 3PZBA 1XROA 1QAJA 4CCYA 3B6IA 3S1TA 3B52X 4DR1B 3B5JA 3U7EB 3T7KA 4OLOA 2KM8C 3X1ZA 1R6DA 1QFMA 1NBEA 4ZVOA 5JC8A 5I01A 1QAQA 4KDRA 2IVMA 2LCIA 1B1AA 3SZMA 4F2WA 3E3AA 3RUHA 1E98A 2N7CA 5DLGA 2QOEA 2IVYA 4AJJA 1OGIA 1XEXA 4INOA 3R9WA 3ZR4B 3F47A 1N56A 1V60A 2Q0SA 1XWIA 1S9GA 2P2GA 1AQUA 2AOXA 1GZ7A 3ZWPA 4ECVA 3HKDA 2HRQA 3IEUA 3AEQA 4HEJA 3B6KA 4R41A 1OOEA 3SLRA 4D9CA 3X43A 1GRNA 2ZSIA 1Z6QA 3E2PA 2QRVA 1QO7A 1PK7A 5AHKA 1VBMA 1U8CB 2ZOGA 5AKLA 1ZS9A 5J63A 4PWWA 4J3NA 4MMXB 4WK2B 3DV9A 1WZCA 1HPZB 3CDEA 1T4CB 1SU6A 2VJVA 1AE1A 1QGUA 3W6ZA 1RACB 2NZJA 2GVNA 2JJ1D 1VQKS 3ZWQA 1XJCA 1IKYB 1VHFA 4G8CA 4KQMA 2HHVA 4P80A 5EXSA 4HT3B 4EKNB 1U5BB 5DN6A 4MJKA 2ZTSA 1C2PA 1JLGB 3I9MA 1H8HA 2FX3A 1BC5A 3AOAA 1FP2A 4KR6A 1NA5A 1VPTA 4NYPA 3QA3E 4MKGA 1R8BA 3KVOA 1XTPA 3QRPA 3CX4A 2PUVA 3K96A 2CUNA 4O2BF 3IPXA 3J7AC 5F8HA 3TUZC 2HBZB 3K5PA 2PI5A 1NJSA 4L0MA 1QO9A 1YZYA 4EKIA 1WBJB 2PNJA 2VZLA 5LJIA 3E9DA 5D84A 3AIOA 2FJXA 2FR0A 3RR2A 5EHGA 4PZ0A 4Z8YA 5IF3A 3R5JB 3DJYA 1HA1A 1ZK4A 4NLXA 4G67A 2PL9A 1C0KA 5KFEA 4BASA 4TYPA 2UU9B 5J4HA 5GADU 1BXNA 4C78A 4YRMA 4S3MA 4H4OB 1K0RA 1XJWB 1W581 4LF4J 1Q83A 1ML8A 4MJ7A 4AZ3A 3B1VA 3NORA 3JSBA 4UTVA 3CLSC 3LXUX 4MA0A 3GJQA 4C0XA 1DQYA 5CXXA 5ETJA 3RV4A 2BA9A 1B8VA 3OP1A 3ASUA 3CD5A 3FOWA 1KAMA 3H11A 3V42A 1LI4A 3QP9A 3K9QO 3EOBI 1SC4A 2IXEA 3MCUA 1TYCA 1GZUA 2ATVA 4JJIA 4DYDA 3PIIA 1JLQA 1PQPA 2HF2A 1VI2A 4AVYA 2YXLA 1SKYE 1U9CA 1AQ6A 1YZ6A 1GZVA 3DWEX 2J5AA 1E2KA 3IA2A 3DLIA 1GNSA 1H66A 3AQ4A 1DCMA 1F0XA 2A0FB 4KTVE 2H06A 2YNIA 3NT4A 4PU0A 5CIYA 3ZY6A 3C6UB 2HW3A 3OOEA 5ILGA 1CQIB 3HE3A 2E4AA 3GMSA 3C5HA 3AA8A 2Q3BA 2E2WA 2QL7B 3W62A 5B5SA 1UKAA 4ZI7F 3GZTB 3NBKA 4IDEA 5C7IO 5F2NA 2QX0A 1U9IC 2G6TA 3ITNA 3A4VA 1JNZB 1Z4IA 2B1IA 1B2LA 3K2IA 2AE1A 4RW9B 3C85A 1UEKA 5E2BA 4BLOA 1PGPA 1DLIA 3R6DA 3WK8A 5T4HA 3RUIA 3L1IA 1SKYB 2MZJA 3MTDA 1PYOA 1U28A 1Y5NA 2PPVA 1G8YA 2ZIGA 4YJ3A 1EWQA 2P7IA 2ZZTA 4E2FA 1TYDE 1GFWB 4A8SA 1BE8A 1T5LA 3KZOA 3MF5A 5E4TA 1NXXA 1VE5A 4PXEA 3RC3A 3U6KA 1R88A 1KBOA 2P4EA 4LF7B 2ZFUA 1VS3A 2ROQA 3IEVA 2KWIA 4DSIA 4Q82A 2RJNA 1D09A 2UYGA 4YPOA 1Y9OA 1ZHHA 2I78A 4FYXB 1CUFA 3AV0B 2FJBB 1CY8A 5AW5A 1W8DA 3VISA 3J7ZT 3MGGA 4L4UA 4EFMA 3UR3C 4D9HA 2ZBIA 5F7OA 2BBWA 1YDFA 3V7FA 5H16A 2QW1A 1MABB 4XEHA 3B3GA 2AD5A 1VB5A 4I46A 2UZ4A 3RHTA 4BE7B 3U7JA 2I6QA 2I65A 3TSYA 2VAVA 3MPUB 1RS0A 3I0ZA 2IYQA 1ONOA 1XJQA 1JDPA 1T43A 1WOYA 3HU3A 3ETGA 5K0TA 2FUCA 2DEJA 2G1KA 3RC7A 3I62A 3PTWA 3QVMA 1T4BA 3ZCPA 2UVPB 4KHZA 4DR3J 1NYTA 2CXQA 5I9BA 1J0XO 1NHUA 1L5UA 3PXUA 3AV3A 1LOUA 2JPDA 5AXKA 4MS3B 3TXXA 1SKMA 1P74A 4X62B 4UW2A 3RDPA 3M81A 1MXCA 1P61B 2OO7A 2BFMA 4U6SA 2ID8A 3OFSA 1W85A 4Z4CA 1XQWA 5LWHA 4MRMA 1MC5A 1JG2A 5I7UA 4YCMA 3LUAA 5K9ZA 3PW2A 2Q3MA 3B5EA 1RWBA 3ILJA 5T4BA 3Q9UA 4ARZB 2G25A 5FH9A 1Y8RA 3D31A 3IKMB 3KPYA 2C7VA 3EYWA 1FPMA 1ZUWA 2AZ4A 3CONA 1XCOA 1EU1A 2WICA 4Q1FA 5CLJA 1RT9A 3L07A 2XAAA 4XA8A 5FBZA 3B78A 1C0PA 2IRYA 3K53A 1FWPA 4YLGA 3MT9A 3Q8WA 3OHPA 1F38A 3KE8A 2ILTA 3JAWB 2NZXA 2AA3A 3E58A 2AUNA 2XNSA 5FBQB 4OLJA 3KALA 4ZZ3A 3GJ6A 3RFVA 2RS2A 1U8WA 3FCAA 4KQ1A 4JC4A 4G5XA 2GVDC 2WY2D 3D3WA 3SHQA 3WAKA 2P0EA 3UCFA 5IRCD 5B7GA 2PRJA 2FN7A 3ILYA 5B7QA 4JR2A 4KGZA 2RVJA 2HUNA 1N4AA 1MG7A 2WUGA 2AEFA 2DHMA 4HLDA 2IF2A 2YYAA 4H7IA 4O4GA 3OR1B 4WAUA 2ECQA 3KUEA 1YIJS 2J7PA 2BH9A 4DV2C 1TLFA 3ZZZA 2ZRCA 3WXMA 4RVGA 4K9MA 4FNIA 2I6UA 5HVFA 2VPZA 1ZZNA 5JUWA 1C0TA 2VT6A 3DLLQ 3QEJA 2V6JA 4CETA 1S1VB 2ZH6A 5K3SA 3VGPA 5L3ZA 2E4XA 2QG4A 2CWKA 4PONA 4L4SA 2XMTA 2OEJA 1QM5A 5JVDB 2XBLA 2IWHA 1M5PC 5TSDA 4X24A 1VCNA 1K73T 4HTJA 3FPSA 5TB5A 4NLLA 3NKFA 1CJMA 3X1KA 4PM4A 1XDSA 1RKBA 5E6UB 1Y3DE 2NG1A 3VGVA 2F43B 1RUSA 4X65C 2G17A 3PJEA 1Z2CA 2LXUA 4UEKA 5HX7A 1XXLA 1HQEA 1VR6A 2BLNA 3QWAA 2VDWB 1D1TA 4TYNA 4C8NA 2P3SA 2PXXA 1RT6A 4MDEA 1NDPA 2ACEA 3DT6A 3TIGA 1WB5A 3H4BA 4RAQA 4GBED 1Z6YA 4B3MC 3NCPA 3NKYA 1YUMA 2BM9A 4HDKB 1L5HB 5AI5A 2RGNC 4PRLA 1XP8A 2DT9A 2HU5A 5A5VA 1MXHA 3NWEA 3V4ZA 3MUFA 1DG3A 1F9FA 2R8HA 4EBEA 4WOCA 1MU2B 1FJGF 2AX0A 4HWGA 1F60A 4ANEA 3BM7A 1YGYA 1CUBA 4YP9A 3CR7A 3L8YA 3R4VA 3O4FA 2XO7A 1T0UA 7FD1A 4ECZA 5DBGA 1CR1A 4DV5F 3JQBC 4KREA 3AVWA 4WFKA 2H57A 3A6HA 4BEBA 2ZJ6A 3ZE9A 5AI0A 5AKJA 2AOTA 2M6LA 3KYCB 1TO1E 2O7VA 5KTQA 4J0HA 3QIAA 2HK6A 3IAUA 4GKJB 1U4NA 4KZKA 1B16A 4RQUA 3R5SA 3QWHA 3OJWA 1M2HA 4NG5A 4NK4A 1YR7A 1NLUA 2HK8A 1RTIA 4NEQA 2HG4A 4E12A 1JFLA 4DB2A 4I6JA 4ONEA 2J9RA 3QOXA 2ESRA 3QWBA 3M9MB 2P4QA 2CHEA 3IEKA 3W7AA 3ZWWA 2BELA 3I32A 2BEUA 2Q0XA 3ZTRA 2WSSA 4KE5A 2V0NA 2DNLA 4RPFA 1KZGB 1B7FA 4C14A 1TYZA 4U39A 4P3XA 5A9SB 4DA8A 4DDHA 4W9NA 4DR7C 1H6DA 4IH1A 4PLZA 5CM9C 1P6XA 2F62A 4G1PA 3AOGA 3KLEA 1BDMA 2ZH8A 3AUUA 3CF0A 2XECA 4DUZC 1ARZA 3T9ZA 5A19A 3F44A 4BC1A 1SA0B 2NM0A 4QIHA 1PQYA 4OHFA 4GX0A 2VAWA 2J8ZA 1E5LA 2RE8A 1WEHA 2VR1A 3WK4A 4RNFA 3BGOP 3AVUA 4BMOB 2O2XA 2W6NA 1JHOA 4WA7A 3M2UB 4GRDA 4KN5A 3U9LA 3C7AA 2BGJA 2WP8J 5DM4A 4BVJA 4J6FA 2X9GA 4XM1A 3B9BA 3PU6A 1R00A 5HVHA 2PFKA 5A2QY 2J5XA 3JS9A 3KTQA 3I1FA 4NI2B 2JG3A 1CY6A 3UAYA 1B0UA 1T9BA 3RVDA 2P5UA 5IPFA 4NLOA 3ONVA 3OQVA 2JK0A 4Q9LA 3QU4A 3LP5A 1YJUA 4C06A 2ZSDA 3AVQA 4JBHA 2BEJA 1TKDA 3NGTA 4HDMB 2RK3A 1K7XB 2G04A 4DYVA 2QTWA 3WRXC 4JU8A 5ALZA 2VJCA 3CJRA 1ENYA 4QYMA 5AKYA 3BB5A 4PC1A 6FD1A 4LF9C 1SJ9A 4C11A 1HQKA 1RWXA 2ZB8A 3JY6A 1BXRA 3OWXA 4M98A 4UVGA 4IFIA 5SZKB 2PSZA 2QBYA 3M1IA 2HNAA 3WK6A 4J4HA 2QGNA 3V8VA 4W90B 4CDMA 3WQRA 2JS7A 3UB2A 3ZH9B 2PJRA 4K6KA 1D2NA 2FMHA 5KNBD 5LVAA 1HRDA 1YNOA 2H51A 2IY9A 4LI0A 2RGWA 1JFVA 2ZXEA 4UE2A 4D46A 1OFTA 2GKSA 3HEMA 4HYQA 4RSHA 3CTMA 2YOHA 4BNXA 4WBXC 1Q3TA 1KWKA 3K73O 4GPZA 3HUDA 2JLZA 4Z9BA 1Q19A 3F74A 3WZLA 5D3ZA 1BS2A 3KMQA 3HJHA 3QJ5A 4JQYA 1K8ZB 4G0VA 1K8QA 1YHYA 1P0FA 1HE8B 1GNRA 2P68A 2XNRA 1P29A 4QG7A 2D4HA 2JKVA 4CLEA 3J81D 3VH2A 2RGCA 4TT3A 2QX7A 3BEOA 3OG9A 1I14A 3RASA 3HYNA 4YCDA 3KHRA 1M9NA 1L4EA 3ZZTA 2DH6A 2EJWA 2GRJA 3PYXA 1E7MA 1PL6A 2EARA 2IW1A 2AQ8A 3IG1A 4M1TA 3TG2A 3TP2A 5ADVA 1Q1KA 4MV7A 4J0GA 4TZ6A 3DRXA 3CCTA 1G8KA 2XGMA 3L2OB 4BMPB 4BP3A 1K47A 3Q98A 1SQ0A 5C35A 3NHZA 1NMQA 1LJ8A 4X3PA 1ODTC 5LQDA 1DB3A 2I6SA 3H16A 1XJ0A 3S8EA 3ZCUA 1O2DA 3OZAA 1S5PA 1ZEMA 1YB7A 1F5NA 1NK5A 2A2ZA 2WHPB 1I32A 3CLSD 5EJIA 3GCDA 3JAKA 3FF1A 3EIQA 4J91A 2QU7A 4U7FA 1U1MA 5JCJA 4DANA 2FW9A 1S2DA 1S3GA 4JX8A 2EWHA 5CXUA 4DV1J 3AILA 2J5QA 3GXBA 3O8OA 4P1ZA 1B8NA 1SU4A 1LWEB 1TKTA 4BB9A 3D28A 1DIGA 4CMEC 4PN7A 4DCTA 4YWJA 4XLLA 1FUEA 2G09A 3E7XA 2BFEA 3EERA 3TIVA 2PYDA 2Q3EA 4E33A 1GCAA 2AXPA 2P4SA 4A82A 2ABYA 3H2GA 3N87A 1Y0BA 1DPGA 1DHMA 5IJ0B 3PPWA 5FAKA 3AHIA 1AD2A 4LGMA 2IUYA 2OK7A 3H42A 1BQ3A 5GADI 3JD4A 1S4FA 3RT9A 3C6XA 3MS4A 4NMLA 3VNBA 1RWKB 1NRIA 4DZDA 2OORC 1Z08A 3RIMA 4J0JA 3QX9A 2XCAA 1NY8A 3MCOA 4DZRA 3QGMA 1NX9A 1SFRA 2WAQD 2I2FA 3B6EA 1JDVA 2FW8A 3C5VA 2VDLB 1Z7BA 4YAOA 4DDKA 1XWFA 1TKZA 3QF4B 3RAPR 2OG1A 4R9VA 4YRFA 2IBKA 3OJFA 2V9KA 4ARVA 5KWIA 4WZAE 1ZC3A 1KYXA 4WY5A 4CIYA 5IT9D 3GGJA 2DHGA 4OHWA 4WV3A 2NT3A 3QSGA 2OI2A 1EUQA 3FFTA 2MTBA 4K6MA 5KDOA 3A14A 1VXOA 1D2MA 2VKTA 2W2LA 1XZFA 5DLEA 1YR6A 1O8CA 1SBIA 4K2XA 2XPCA 1ND5A 1EM8B 4BVAA 2CZ4A 3EOAI 4JLJA 2RF2B 1AS2A 4MP6A 4XX1A 4PUOB 1N4DA 5BOSB 4BVLA 3U4QA 3FLEA 3G5TA 4XUDA 4FW8A 3K1YA 4B8WA 3EGDA 2HFKA 1WMFA 2GH1A 3PHTA 4GMFA 1SKRA 3IAS1 2P62A 3AKDA 3ORFA 2IE8A 2R25B 2ACMA 2JZ5A 3F4LA 4YDQA 1RT7B 1MWYA 4WZAB 3CC2S 1JFTA 9MHTA 5IC4A 3OICA 4FZJA 4XVQA 2DPIA 3ZK8A 1NMYA 3C87A 4NX2A 1RP7A 1NW4A 3FFXA 2JJ8A 1B0AA 2I7XA 5AJ3F 3LUYA 2RMKA 3PDIA 4UTXA 4H35A 3L6OO 4ID5B 1H2EA 4V0SA 4QXMA 2VJKA 5I7VA 1QQAA 2WFAA 3GEMA 4UM9D 3RRFA 1LK5A 3REQA 3CEHA 3BX1A 1MEEA 2D74A 4IKOA 1NQUA 1QIMA 3QZUA 4H3KB 3IVGA 1JDBC 4BQRA 2B43A 2PZKA 1K66A 4H6VA 3NYWA 3HCXA 3D6NB 3TLXA 5K0LA 2ZBEA 1P7WA 2XHEA 1QF7A 1VLAA 1IBMB 1YWXA 4LF6C 4TLAA 1G8MA 5AUQA 2FZKB 4UVIA 4X41A 4NJMB 4A7PA 4YJHB 1CY2A 3BCSA 2DR2A 3ZV6A 2C3UA 1KZ7B 4HH1A 2PA0A 2WKWA 1BRMA 1KVQA 7MDHA 4NHOA 4JGBA 3PX2A 4P35A 4CNQA 1TAGA 3TDMA 2P1RA 3S81A 5KT3A 3K0KA 1SUPA 2C5EA 3V7NA 4ZOEA 2CNLB 2SNIE 4JD5A 4DV5C 3RRMA 2WWGA 1MXFA 1Z0SA 4EK2A 4AZSA 2UUBC 1PCAA 5DDIP 1JLFA 4YAJA 3FB1A 3JQFA 4KHPB 3GJ7A 4R9SA 3PR2B 3D3CJ 5LFAA 2O1WA 2WQ7A 3F90A 5CYMB 1B64A 4ODJA 2PKCA 4DV4C 1Q1EA 1NY5A 4I3GA 2AGVA 4BFXA 5AI8A 1P9YA 2PQ6A 4W63A 2QYHA 3T3PB 3LRTA 2FUNB 5ALKA 2TMYA 2FQ1A 4F9TA 1RKXA 3K5WA 4I55A 2QT9A 4O08A 2P5TB 2X40A 3TKYA 3CWJA 3V7UA 3A1YG 5L9AA 1PV2A 4JI6J 2UYYA 4EGFA 2MY8A 4PZ9A 5EDWA 3D3NA 5CGZA 4D8TA 5IVHA 4DABA 1CUJA 5FJJA 5DHUA 2OYRA 2YY7A 3ZCQA 1IWGA 2P0YA 2CJ9A 2G4LA 5EWMB 3TRIA 4EJSC 3HRKA 4RUBA 3GZ7A 4A8OA 2WE8A 5F1OA 4B6RA 1JR3D 4IR1A 2H5IA 5A6WA 5L1JA 3OFGA 4NEHB 3ETMA 3WIBA 4BL5A 1V6AA 5C7OO 1SIWA 3BMOA 4XJVA 5CK5A 4JKIA 3W8PA 2J08A 1NR7A 4M1MA 4WP9A 2J3JA 1KWMA 3PD0A 3I5BA 1JXEA 5JSZB 2QL9B 2QUAA 4HAXA 3UB3A 3R1IA 5C32A 2LVWA 3JSMB 4L2IA 1FRJA 3ER8A 2LPMA 5FUQA 4MVJP 4DN6A 3QOWA 2PMDA 1U1GA 3B13B 1W8IA 1DJNA 4C6TA 3CZMA 3VU8A 3DG9A 2YPZA 4GW3A 1OYYA 4B8YA 4LPKA 3UX3A 4CJXA 1BXZA 4MTNA 4AYWA 1K0FA 5BV2P 1YQXA 3AR5A 2APOA 5TMEA 4UOCA 3IQHX 2PZEA 1HTBA 4IMRA 3UMRA 4KBGA 2HLTA 2CPZA 1BWSA 5HO4A 3FSGD 5T8KA 2EBHX 3ZWCA 5DGXA 3ZK9A 4MZDA 3N76A 3ZY3A 2Y2VA 1RAFB 1TZKA 2W4CA 5IBRA 4I3FA 3P27A 2AXNA 4LYYA 1H2TZ 3GQCA 4IGIA 2B4YA 2QG6A 3IDAA 4DQIA 3M5DA 1JJ7A 3EG5A 2IYSA 5DYNA 4C4OA 4PEOA 3VYRB 3PNYA 3GEGA 1NW6A 5DLFA 1G6BA 3OHBA 1PG4A 3ZHOA 3FWHA 3GOHA 4MMOA 3ZO7A 4Y7DA 4O3QA 1PQUA 5IAKA 1OX4B 1QGAA 4MO9A 2HBRA 1AN0A 2IYXA 1Q0PA 1QYRA 1X8JA 4PO9A 4GBGA 4B3RC 2IU3A 3KV1A 2ZPTX 2JARA 2VG5B 1PAUB 3SS8A 3C14C 2F17A 4INPA 4Y1GA 4CT8A 1JQBA 3EIOA 3ZLJA 1KQFB 1PR4A 1S2MA 3IRWP 1E2BA 2D9PA 1ETUA 1WSWA 2KPOA 4ND8A 5BOVA 1KI8A 5WRFA 3HFGA 5ELMA 2OD4A 5CNIA 2HNZA 3L8MA 5CM2Z 3LUPA 2KBEA 4KPGA 2KRBA 2QD4A 1U9ZA 4X8HA 1I10A 5K8PA 1DVRA 3H4IA 2GZ3A 1FSGA 4KWIA 3D2AA 4NDAA 2VXYA 3I92A 1QVRA 4KQEA 3UBTA 3M1LA 2I0FA 3AFIA 2ZJ8A 2BUAA 1L7DA 4QUEA 2QLBB 1GMWD 1MVOA 4DU7A 4K8OA 4UHDA 3PC4A 5E9AA 1NQOA 2QD5A 3GMGA 4ZOLB 3D3BJ 4R8MA 2B7CB 1NLMA 1WMAA 2JJ2A 1WMDA 2OENG 3LRPA 5GM2A 1SKUB 3GV0A 4OYBA 4PXDA 1VP9A 1XMOC 4KZPA 4CIVA 3I5YA 2XI3A 4QOSA 1HH2P 3EGOA 5LIRA 4J9MA 5IAJA 5JLAA 4BQPA 4K1XA 3CEPB 1W49A 2MZTA 4FOTA 4OXXA 2QRZA 3SWWA 1ODLA 1D1QA 3ULKA 2J32A 3IR6A 4IS2A 1KZYC 2PD6A 4Q1VA 2GJSA 3IJPA 5HOQA 4BVHA 1U7HA 1PLLA 3HCDA 2HNYA 4Y0NA 1U7WA 5BSVA 3DVLA 2HBQA 1BJRE 4ECAA 4MV4A 4YDDB 2GEFA 2HJVA 3QHQA 2GHWA 2WUVA 2HQRA 4ZDWA 2FETA 1FDDA 3ONWA 1XF1A 4PCUA 2IJNA 2ZJAA 4UUBA 3QHAA 2RG1A 2XCTB 5JECA 4ZJOA 3G8SA 2AN9A 1TT5B 4PG7A 4AKTA 2POCA 1J5PA 3LUDA 1E99A 3JRNA 3S8MA 4G56A 3AU8A 1NDKA 4JB8B 1U2EA 3KQPA 3G8DA 4AUMA 4H4DA 3F6YA 4CKCB 4MHTA 3IALA 3TTYA 4HCJA 3JVEA 3NIBA 2DCUB 1YRXA 5K2OA 5D4OA 3QGPA 3BPSA 3OJEA 2VHVA 3KQTA 2CNDA 1EYZA 1AXGA 1TQ4A 1U0FA 4QR2A 1NPPA 1FMLA 1ZOLA 2BHTA 3SR4A 1AUVA 2BSQA 2JCVA 4NYMQ 2FDCA 2BFOA 3BK2A 4GH5A 4HLQB 4OI3A 4KFRA 3ND5A 2XYGA 1E1QD 4QOIA 1DGQA 3R3HA 3ZE8A 3DBRA 5AIBA 1RT5B 4WU3A 1Z0JA 3Q8QB 1L7OA 3HHDA 2EZ9A 4IBOA 4KQ9A 1LRKA 2V5HG 3GV7B 3QVJA 5EPEA 2OBMA 4JFAA 1L5RA 4DLBA 3E18A 4C3OB 1QX4A 5BMOA 2FN3A 2PZFA 5L51A 1Q8IA 1V0JA 3C19A 3KQOA 3JYPA 1O0CA 4ARUA 4PUIA 1J22A 3MWJA 2NXJA 3UGJA 4FM9A 1L7NA 3QKRB 2QMZA 1LS1A 2R48A 4BMXA 1VHLA 5J9FA 3IPCA 3JQGB 1Q0NA 3NX4A 1KEEA 4KL8S 3H3XA 4UBNA 4YP3A 5D8DA 3D0IE 3AI2A 1X87A 3OIDA 4EENA 5JS7A 3OQBA 1TVRB 2ANCA 4USKA 3BGIA 1W96A 1UBFA 3HYRA 2PN2A 3PL5A 2P9FA 1XYVA 1VRUA 2R84A 3TLYA 1DTWA 1RMTA 1DRWA 2QGZA 1PKEA 2K4MA 4IH7A 2F59A 2F8MA 2ZM6J 1BFDA 1E2MA 4ZVMA 5JHGB 3NB0A 4QIWD 4F02A 1QZUA 3R44A 3F49S 3HKBA 3VBCA 4IDCA 4K9SA 1LBTA 4MWGA 4F4DA 2BVNA 4C88A 4JBXA 1NOJA 3KKKA 4AP6A 5IXSA 1X9SA 1I6KA 3PEUA 5REQB 1K7CA 3SYZA 5BW6B 2QY9A 2X1GA 2R6JA 1U1OA 1U98A 1NN3A 5D86A 3UENA 3T3NA 1O4VA 3OCXA 4PC6A 4BJ3A 3KJVB 1P3DA 3M6VA 3KJNA 4PQUA 4WFNQ 1VI5A 2JGRA 4JI3B 2BFFA 5LL6P 2IIQA 1F1JA 5JBQA 2A1UB 1O5OA 2CNNB 3IBWA 1CYDA 1P2TA 4MW6A 1UBSB 2VQEB 1XMIA 2EFHB 4RC9A 1YE8A 1XZQA 4DR5C 5KQRA 4R8VA 2O20A 3QELA 2WONB 1AQYA 1ECCA 2Y0EA 1GNPA 5HKOA 2NU9B 1IN1A 4AXIA 4KTTA 2J07A 4QIEA 2WHXA 2C5FA 3I0MA 3AKZA 2J0QD 5FYDA 2WJYA 4Z8XA 1M0WA 4E7PA 1SCJA 4YTEA 2H7YA 3O26A 4IWNA 1M5OC 3CM0A 4LQCA 1FXWA 4LAFA 4MUNA 5ITWA 1Q7GA 2MMAB 2D2IA 1RWVA 1W5FA 4PGFA 5C31A 5A6SB 4CU5A 4LFCJ 4YA6A 4LRFA 2AT1A 3RBXA 4UCFA 3EBOA 5ER6A 2QS9A 4QUJA 4CCAA 2LCWA 2X5KO 3L7OA 3HCOA 3LVFO 4FZ5A 4PZYA 5CA1F 2CPDA 1XPRA 2HQSA 1ECPA 4HK4A 3NMUF 3A8JA 2GLXA 1Z5NA 5AM2A 1P72A 5JDIC 2VJUA 3VTZA 3U56A 4RANA 1U65A 3KM0A 2YDXA 3TEFA 4GOXA 3TBFA 2YPYA 3HGQA 3BEDA 3BRQA 4U95A 3IT3A 1GEGA 1M8FA 1K0UA 2CFRA 4GLFA 3FTDA 5DHRA 1M5KC 1KF0A 1F20A 4P92A 5GVSA 2CF5A 4KH1A 3H25A 1W5BA 1XCLA 4RW4A 3WLHA 2D3OR 2Y8WA 3RS0A 2B3DA 4H6XA 2ATEA 3A9UA 2JGNA 3LDUA 4I1IA 1GX5A 3EVOA 2VJBA 3FJOA 3NBXX 3MM7A 2I03A 5CM8B 1RPZA 4NBWA 3LZCA 2PAFA 4JKOA 3L7UA 4LDPA 2IA0A 3AUSA 1Y6JA 3QG1A 4XRRA 2ILVA 3UWPA 3MAAB 3VR2A 1JLLA 3ZE0B 1UETA 3HNPA 3FPKA 3GIRA 5AW2A 4OZJA 5J2UB 2YV3A 1IBKB 4EHFA 4MUIA 3OQIA 2JASA 2JHFA 4JYMA 3NWOA 4CBVA 2MYUA 1G98A 3BFKA 3CLVA 1VCIA 2CXTA 5EP3A 1RZMA 2RHJA 3SZRA 3ZCRA 4OB8A 1BRTA 1PT5A 2UYQA 1MUUA 4PYMA 2Z83A 4UJ3A 1N0VC 3GR0A 3SKXA 5KINB 5H9FJ 3G8AA 2GARA 5FPKA 3PZRA 4GPBA 2JGMA 3B36A 3HCAA 4TTAA 4OHXA 5HIJA 4O4LB 3WYGA 1BX0A 1BX1A 1GAXA 3VC3A 3MT0A 4HMPA 5F76A 3IT0A 1OJ4A 2VRWA 2X4DA 1Y3KA 1T1EA 3PC3A 4R8SA 1M8JA 2PD3A 5DRKA 1F8GA 1DJPA 3EZNA 4U9IS 2WU8A 5CDTA 4LC1A 2KDOA 3U4GA 4EB0A 5GONF 4YAEA 2QUJA 3UJHA 5DTJA 3GUCA 2XYQA 4IIJB 3O9VA 3HCEA 3M30A 1NK8A 2BMEA 2MR6A 2OAQ1 2OAEA 4LHYA 2ZU0C 4DDVA 1YR3A 4P98A 4ZLLA 2WYUA 3GNSA 2I34A 1WPXA 3DL7A 4AJ9A 1PK9A 1P73A 1EX7A 4BFZA 4S1TA 1GQSA 2JFWA 1SHUX 2ZRMA 4OJTA 1UKVY 1SUCA 2CL7X 3DBLA 5K3FA 3VR1A 3RV3A 4G9BA 1JB1A 3B6JA 1EFVB 1ZTTA 5EGNA 2JI8A 4M5GA 3HSSA 3EVZA 4C7OA 3SHOA 5JRHA 5CG2A 3K0CC 4BY9E 3DVSX 4YONB 4KV9A 1QKJA 3N8HA 1Y7LA 1QQBA 5BRNA 2COLA 4ZICA 2UAGA 4WBFA 1XYGA 2GT1A 3QT6A 1GCIA 4ANFA 1EJ6A 4ILLA 3GHHA 3RW9A 2KB0A 5SV2A 4DF3A 1UXIA 2B78A 2PKQP 2G9UA 2AUMA 4MYUA 4AP9A 1JR4A 4P71A 4IIXA 1PW7A 1W0JD 3QHPA 1A50B 5C80A 1JQKA 4PLTA 4Q01A 1JAXA 1Y8ZA 4ALKA 4USIA 4MGHA 2B30A 3SFVA 4JGGA 5F9NA 4NDZA 3D0HE 1RCOB 1J1UA 1HV8A 1XZIA 1PFWA 2Z95A 3TLGB 3FA2A 1NUSA 2NZYA 1U47A 3V81A 4J16C 1RAGB 1LSSA 1OWPA 4IUYA 4LFBB 3FTCA 1QIKA 4OQ4A 3H8YA 3EPPA 4D4KA 3SYRA 5CT4A 1T03B 2BMAA 5FB3A 3PHHA 1XTJA 5A4AA 3QJPA 4ILEA 4JI0B 1G2OA 3JV7A 1JECA 3SSOA 3EBLA 3E8XA 2N3LA 4I5DA 4DR6J 3T4PA 3ZNQA 3CCFA 4C48A 2DYAA 3UK7A 4S0XA 3L0PA 5KPDA 1K9VF 2JJMA 4MVJH 3EQ9A 3VGSA 2Z8YA 1DINA 4DWIA 2A4KA 3IUEA 3TNYA 1YA8A 3IGNA 1P91A 1PT6A 1NZAA 4ILMA 1T05A 5CAEB 2QX6A 2VDRB 1PJSA 3FCUB 2O7SA 1DC3A 2N9UA 4JJGA 5KG4A 3EVFA 3UKJA 2ZS7A 3KQMA 2OR3A 1SUQA 3LANA 1WHTB 5EZSA 3LUSA 5A6PA 2XCIA 1E8NA 4PQRA 4OQDA 4P36A 4DHWA 1ESDA 5KOYA 2REOA 4DL9A 2H1VA 4B3OA 1SC9A 1A77A 1RY2A 4D57A 3JWPA 4ENWA 4OCZA 3R6LA 3Q9SA 1YC2A 3RIGA 2AMCB 2HPHA 4NYJQ 4NRTA 1U1FA 9LDBA 4A2QA 1VIVA 3E03A 3QEBZ 1F2GA 3OA0A 2SECE 3O4HA 4USWA 4ZA2A 1G1AA 5F9FA 4YQEA 1FTNA 2J4CA 1XALA 3DFKA 1Z7EA 5JJIA 1OB2A 4C3MA 2YFHA 1C4OA 1I9GA 1U11A 2VJNA 4A9AA 5DTEA 2CG4A 2J0UA 2YX7A 4YWHA 3RVQA 1RXOB 4V1CB 3O95A 4CGYA 2OCIA 2PTHA 1SD1A 1MBZA 4GAEA 1PRYA 3BKTA 3B53X 2P90A 4MS1B 1S12A 2Y9PB 4RM3A 3NGUA 1DE0A 1RRPA 4QIGA 3S40A 4ZHQF 1Q0RA 2BLLA 1KJWA 1IB6A 4O0NA 1QHHA 4TSFD 1C1YA 3W05A 1SULA 3OZBA 4OI1A 1Y0HA 2DY1A 4LZLA 5CDFE 2LEBA 2PEBA 1MPXA 4OVKA 4ZYTA 2CNKA 2EBFX 3VC2A 4U7GA 4UCXA 4N9QA 1ZH6A 3PXAA 4D9BA 3ABIA 2XWPA 4DPTA 1TIKA 1YQEA 2IVZA 1NIPA 1NVGA 4ZEMA 4M9ZA 2MSDB 3KZMA 2VI5A 1SZPA 1HR0F 5FUMA 1HL3A 4MDYA 3EZ9A 3HTXA 4LT6A 4IYRA 2WF8A 1RLTA 4PHGA 4H27A 1BCRB 2MDAA 3BICA 1S76D 3IAXA 3QLHB 4QREA 3QKWA 2BDEA 2HSWA 4Q43A 1YU6A 2HNDB 4WGGA 3PYDA 1SOWA 3BSWA 5BSHA 5ECGC 2QPOA 5CHEA 1IQPA 4D7AA 3HWRA 3QFWA 3KLGA 4NYMR 2QUHA 3OJXA 4NABA 2Q4BA 2X58A 4H6WA 3AM5A 3U0BA 5HBGA 1F9HA 4M1YA 3CSUA 2CSUA 4LY0A 3VGTA 1FW6A 1QAYA 1H8EA 1DXHA 3NGXA 3CF4A 4LK3A 4JI7C 4OHVA 3RTVA 3THOA 2LU1A 1QPBA 4CMAA 3DOLA 5I3UB 4ZZ1A 1YB4A 2ON6A 1TM4E 2ZT7A 3WNVA 3O31A 2KYRA 4V1Ak 5TX7A 3I45A 1KO7A 1AJEA 2XGOA 5FUWA 4M76B 2RHGB 2WVJA 1JSRA 1MC8A 1OFUA 1NQWA 1XNQC 4OUKX 5HCNA 3H5VA 2G72A 3PESA 1OLOA 4OHZA 1G41A 2RIJA 3A6FA 4EYSA 4JEMA 3MMZA 2CPXA 5KNDD 3HD1A 4LXTA 4MKXA 4ZCRA 1CS0A 1QTNB 1PD0A 2OCBA 3DBOB 4FCCA 5SY4A 4QXOA 1V3QE 3NL0A 3WJ7A 1X4DA 4J2TA 3OE7D 2OO3A 3G82A 3NEPX 4WKCA 4LYDA 1MJFA 3BSAA 2MGZB 5AVRA 1CNFA 2H2HA 4M7WA 3OPMA 3LO8A 1QLWA 4E4TA 2HF9A 2M52A 3I09A 3ZWVA 1KKGA 4IQXA 2DGVA 4ZYVA 4RTLA 2FWPA 4AUEA 2F3SA 3RE1A 1V7QA 4EI8A 4FFMA 1PVVA 4J0CA 1WG1A 3HO1A 4DQ0A 3OD5A 3WLQA 4QOEA 4CM4B 3MT8A 2R7UA 4TV8F 1H6AA 2JIZD 3IHWA 5ITVA 3G13A 2G1AA 1C8KA 1LQUA 2V9CA 3ELHA 2PUCA 5H9FK 2WV9A 2UYHA 3GRRA 2XTZA 1JKMA 2WOMB 1LW2B 4H1HA 5ALHA 1PBAA 2YS6A 3T9EA 4F4IA 2RU9A 4ZPXA 4ETNA 4JI5C 1PYGA 4PLYA 1U9JA 1EWRA 2PBZA 3HX9A 3HADA 1XMPA 1KAEA 1XEZA 1QRUA 4C7BA 3B1JA 2CNOA 4A91A 3CNOA 2JW5A 3N7UA 2M5OA 3NBUA 3TCXB 1YZFA 3D4JA 2PUGA 3OURA 2JF0A 1FJ7A 4K4UA 3E15A 3LGMA 3U1TA 3D3JA 2ATWA 5DGBA 3NHMA 3CZQA 4CL3A 3LT2A 1XXHA 4KW7A 1FEEA 1ADYA 4OGLA 2NO1A 3LJKA 2MCQA 3QPDA 4ABTA 3KJIA 4RIEA 4LOJA 1K08A 1Z22A 2F00A 4Y0VA 1OHHD 1H2ZA 3I05A 3R0IA 3LDFA 2GGPA 3GJRA 3EUNA 2HH9A 1EAYA 5G0WA 2O0MA 3OL8A 4L3VA 4OYYA 3AK4A 1D1UA 4YHHJ 1L5YA 4OSOA 3ETNA 3DCNA 1PR2A 4ZLNA 2GIRA 2WR8A 4YDSA 1JEJA 1N6RA 4ZLJA 1PCXA 1XVVA 2WAAA 2HRTA 2F1HA 2B2CA 2BFWA 1BVHA 1Y8QA 1NPTO 4FOPA 5EHHA 3EF3A 1GQEA 4RNDB 2AR0A 3B60A 1ULZA 5H4HA 3GIIA 1EXMA 3PWKA 1M2FA 4EK9A 3J80D 3CSKA 4Q1EA 4PXCA 3BQ0A 2HRUA 2FWMX 2GAHC 3K9BA 3U40A 5CX4A 2Y92A 3RK1A 1WC0A 1CJKA 2XF8A 2DXFA 1U2ZA 3UK6A 2EFGA 2GMJA 3B1XA 4U9UA 2HLHA 4DNQA 2VHGA 4A2CA 3IKJA 2XVYA 4B3DA 4JP8A 3ZNPA 1EUCB 3ZLTA 3ND7A 1CHNA 4OMCA 3Q87B 1VKZA 1NK9A 4ZP6A 1GSOA 3IOYA 1ZH2A 3CDAA 5KEIA 4KBFA 1PLJA 4PX2A 4KRFA 5EE5B 3DHEA 3FI9A 4UTZA 2ZRBA 5HVGA 5BNFA 1PJAA 3U19A 5DX0A 4LRXA 5KFVA 2DRDA 2QI9C 4BO8A 4B9AA 2BMFA 4JROA 3UMCA 3V8NA 4YMSA 3AW8A 1ML4A 1J09A 3BIWA 2CWDA 1N33B 1YGPA 3WHIA 3PC8A 4RTRA 1EFHA 1Y4DE 4R1SA 4MKBA 3X2FA 2P1DA 3V4RA 3H2IA 3LYLA 5EA2A 2YVAA 3BGSA 2XSJA 3OQ2A 1XO1A 3VTAA 2UZ0A 3LDGA 4Y2XA 4PYKA 2ILYA 4D3FA 1N0IA 2HGNA 1ZH4A 4LYAA 2UUAB 2F48A 4P0QB 2BBOA 1UZLA 5H3HA 1UPMB 4AD8A 3VX3A 4RWEA 2B56A 1NDHA 1HDRA 4UOQA 5C8YA 2CUKA 1VL1A 4HDHA 4TU8A 2VSYA 4IDFA 1XRNA 3NS7B 2QQEA 1KC8T 4QXRA 1WDWB 4CZCA 4PHHA 4RD3A 3SY8A 5F9HA 4CODB 2CNWD 3I01M 4YACA 3B4MA 3T5DA 5TDHA 3BWYA 4R40A 1PO6A 4JI8J 3JATA 3EQ7A 4PVDA 4LZJA 4QBIA 1ULSA 4RZHA 4EFAC 2PMEA 4NLVA 4X64J 1RTJA 2ZZMA 1XAGA 1R7IA 3N0XA 1EK0A 2F9JA 3F3YA 3I1IA 1TK5A 1B73A 3CJEA 3MB5A 2P41A 1AH2A 3NDPA 3P1JA 9GPBA 2GHRA 4GKKJ 3OPYB 2JJYA 4LFAB 2O06A 2BQUA 4DSAA 2HCFA 4OZ5A 4PVCA 4DLVA 3KD2A 4M1WA 2VHYA 4TPKA 4NZPA 1WR8A 1DMRA 5BWOA 3RS3A 2FSPA 2MKCA 3Q9LA 2GO1A 3X3HA 3WOHA 2J76E 2QIOA 2HYIB 4B74A 2YKPA 3KOXA 2OHGA 3KOWA 4TUYF 5IWAC 4NSNA 2WJVA 3LBHA 3U1NA 4M7RA 1QVWA 2AJ8A 4DIUA 1O9HA 3EHDA 3SI7A 3LIPA 3LUCA 3QT8A 2CLOB 2ZRGA 5HIAA 3ZG6A 1CIJA 4ZAFA 4CIOA 2QRRA 4PUHA 1M54A 1PJBA 3TUFA 2HIMA 5FHRA 4ZAYA 3IR7B 2HSDA 4GNRA 3N4WA 1O95C 1QCYA 3KWLA 2VBXA 2JLWA 3ZZ0A 3KJGA 4QQBA 3SS7X 3WGZA 2Q7XA 2EQBA 5DWVA 1JQJC 1E77A 1CUGA 4BE4A 1D6SA 4BMYA 4KRGA 2FQQA 5H81A 3G2OA 1I2BA 1AFJA 1MROA 3C15C 3HCPA 2HSEA 1U8SA 4RTOA 2AJ4A 2MKKA 3S1LA 2BCGY 5KYUA 2JAWA 4LSMA 1BQXA 4NYJR 4RJJA 3L4SO 1QP7A 1Z6AA 4LBVA 5DSTA 1JWLA 3AA9A 1QOPB 2GI4A 4AICA 2ZJ7A 1I3MA 1EA7A 2YW2A 1EFAA 2HIQA 1JMKC 5AXLA 4I4IA 4UDXX 2PEZA 2D3UA 2ZK7A 3K4QA 3QWUA 1OVGA 3TW0A 4CL0A 2V96A 1S6PA 2LUOA 2IKSA 1YD7A 1FU4A 3LDHA 2NQ2C 2VSXA 1UBCA 5AK4A 1HNZB