2ZZNA

The complex structure of atrm5 and trnacys
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
336
structure length
336
Chain Sequence
MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILKSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVGDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEHLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVDMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSDVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIKLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords Uncharacterized protein MJ0883
total genus 81
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
A PF18093 Trm5_N tRNA methyltransferase 5 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zznA01
3.30.300.110 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Met-10+ protein-like domains 2zznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zznA03
4E2YA 4JXJA 5G02A 3LHDA 3MHTA 2YQZA 3TFWA 4GEKA 5K8VA 1YF3A 2I9KA 4DZRA 2YR0A 3T7TA 5KQRA 1M6EX 3TRKA 1FP2A 1G38A 3V97A 3GJYA 3IV6A 3LCCA 4GOND 5GP1A 2ZCJA 2BM8A 1N2XA 5T67A 2ZIFA 1N7JA 5EIFA 4OX9Y 5ERGB 3P9NA 5FULA 5F2NA 3CVOA 1JSZA 4C4AA 4LWOA 1INLA 4YV2A 1JSXA 1QYRA 4DKJA 2PKWA 1XXLA 2R3SA 4HH4A 3EVCA 5FA8A 5LQJA 5MHTA 2JG3A 3T7RA 3FPJA 3CJTA 2PT9A 3Q7EA 4AZSA 5ICCA 5D1HA 2ZIEA 2FYTA 1OR8A 3NJRA 4QPNA 3KR1A 2EG5A 2ESRA 2OKCA 5ICGA 1FBNA 3BGVA 2Z6QA 1X1AA 4FS8A 2ZW9A 3HCDA 2CKDA 4BY9E 4E32A 1EJ6A 2PX2A 3OFJA 3TM4A 3DXYA 3KPVA 3OCJA 2Y1WA 5DM2A 5EMKA 5HEKA 3SX0A 3PX3A 4RTJA 3EVZA 1R8XA 3DTNA 1VIDA 3E05A 3M6UA 4PYOA 5IKMA 1YUBA 4A6EA 3A7EA 4CKEA 2CL5A 1BOOA 2NXEA 1ORHA 1TW2A 3GDHA 3BWBA 4R8RA 4RWZA 5EOVA 4OQEA 1VP9A 1G8AA 5DLYA 4DF3A 2HMYB 1ORIA 1WS6A 2PGXA 1N7IA 3I53A 4PGHA 1SQGA 1NBIA 1NBHA 3BUSA 4X1OA 1VE3A 3DH0A 1SVUA 3VSEA 3ORHA 3UJ8A 1AV6A 2HWKA 5BXYA 3UJCA 4QTTB 4M36A 5LQNA 3HM2A 2JH9A 5HILA 2OO3A 2YXDA 4DM3A 3GWZA 1TPYA 1ZQ9A 2V74B 3KU1A 4V0QA 3TMAA 5C9ZA 1R6AA 2IGTA 4XUEA 3EGIA 4L7VA 1JG4A 5F2OA 5FA5A 1KR5A 3UZUA 2GH1A 3K6RA 5EIWA 3OFKA 3H2BA 3GRRA 3RODA 1MJFA 1VQ1A 4MWZA 4F86A 3L8DA 3P9IA 3OZSA 4KWCA 5FADA 4DCGA 3FUUA 4RVHA 1XTPA 1D2CA 1DCTA 3ELUA 4OBWA 3MERA 2VS1A 3OU2A 4C04A 3PX2A 3DMGA 4M38A 5E2AA 5GIPE 2DULA 2IFTA 5GM2A 5EEGA 1TW3A 5M5BA 2PSSA 3OPNA 5DRTA 3VC2A 2ZIGA 5CCBA 3P2EA 4QVKA 2ZZKA 1I9GA 1O9HA 3BGIA 3GO4A 1VP3A 1EG2A 4IWNA 4X60A 4CTJA 4PGGA 4QDJA 5FCDA 1VBFA 5JR3A 3ERCA 2AOVA 5CVVA 3AJDA 4AZVA 3FTDA 4P7KA 4HTFB 2YX1A 1KP9A 5H02A 3G2PA 3JWGA 3UFBA 1EQAA 4GF5A 3HVJA 3F4KA 4RVGA 2NNWB 4YUYA 3NVKI 1AQIA 5GWXA 4ER0A 2GA9A 3BWYA 1VPTA 4HGZA 4PYJA 2AS0A 1Q0TA 1FJXA 3ANXA 5K01A 3EVGA 4P58A 2P7HA 2Y1XA 3REOA 3EVBA 2UYQA 1ZKDA 3ELDA 4MIKA 3ER8A 1KIAA 2C7QA 2C7OA 3DULA 5HOQA 3FTEA 4OQDA 2P41A 5FHQA 1JTFA 3SSMA 1R74A 2F8LA 1XVAA 4YUXA 3KHKA 1SQFA 5B1SA 2WK1A 2B9EA 2P3QA 3FPEA 4X61A 3O7WA 2ZFUA 4ER6A 2FHPA 3U81A 2GB4A 3EMDA 3HA7A 4K6MA 1JR4A 3DUWA 2FCAA 2QM3A 3LECA 3LKZA 3KR0A 3X0DA 2Q41A 3HNRA 5FWAA 3B89A 4CTKA 3BWMA 1P39A 4WXHA 3M6XA 1F38A 4E2ZA 2AN3A 3PFGA 2FRXA 4ZTBA 4DA4A 1RI5A 2ORED 4X41A 2P1DA 3PT9A 3JWHA 3KPYA 5E1BA 1L3IA 2PV0A 5CVJA 4E30A 4QQNA 4RV9A 2YTZA 3A26A 3FPGA 9MHTA 1QAOA 1RI1A 1L9KA 3LKDA 3ME5A 1YFLA 4MTLA 3HA3A 1NV9A 1QAQA 2AOTB 2I6GA 3MCZA 2BR5A 1NV8A 1KPHA 1Q0SA 5DT2A 4YUZA 1AQJA 1IXKA 2NP7A 4GOOD 3PFHA 3GGDA 3BXOA 3SR4A 2ZBRA 3LDUA 3SXJA 3GNLA 4HTFA 5CVDA 4UOEA 3NDIA 5K0LA 3MTIA 4FR0A 1R8YA 3HCFA 3FPFA 4EMSA 3G2QA 5HZMA 3B7PA 4E70A 2ERCA 1EJ0A 3IHTA 4XCXA 2JHCA 3S68A 5LQKA 1UIRA 3EVEA 3LDFA 2ZZNA 3R6TA 3THSA 1UWVA 2EJTA 3HCCA 4V0RA 2ZWVA 2AVDA 1XDUA 3DLIA 3HP7A 3C6MA 5DSTA 1O54A 3AWIA 3MQ2A 3KPUA 4HRAA 1QAMA 2ZZMA 5DPMA 3UBTA 4GQBA 3GIWA 3FUTA 2AZTA 2OZVA 3AXSA 2ZVJA 3NDJA 4RTPA 5E8JA 4KIFA 3BKWA 4FP9A 5E1DA 3FZGA 3UJ9A 1H1DA 2UYCA 2AOTA 3TKYA 3NWBA 5E2BA 4RTLA 2PWPA 2AOUA 3CJRA 2XYQA 3KQYA 8MHTA 1HNNA 4PIPA 1HMYA 1QZZA 2EX4A 3P2KA 2KW5A 2ZLBA 3LCVB 3A27A 2HNKA 1G60A 3KQQA 3LX6A 4P7GA 1JQ3A 4Y30A 3FRHA 3AY0A 2JHPA 2ONZA 4GOLD 4QTUB 5FUBA 1KPGA 2BR4A 4QDKA 2VDVE 3PLAE 1MHTA 2PBFA 3E8SA 1IM8A 1L3BA 1AF7A 4E2WA 10MHA 1XDZA 2WA1A 2JHAA 3KKZA 5K05A 2IDJA 1R00A 3LL7A 1WXWA 2A14A 3LPMA 3UJ7A 2IH5A 1EIZA 3DMHA 2WA2A 4BLWA 5C1IA 3LBYA 7MHTA 3O31A 4RYLA 3EEOA 3KQSA 1SUSA 4U7TB 3G5LA 4KDRA 2QYOA 3GRUA 3LGAA 5HFJA 4GC9A 4P7FA 1G8SA 3GRVA 3M4XA 5HIMA 2JH8A 1NKVA 2AVNA 3ELWA 3DXXA 3HVIA 1JQDA 3BWCA 4M37A 5CUQA 5F2KA 4F85A 3DLCA 1NW7A 2UYHA 3GRZA 2QY6A 3DP7A 4PYKA 3M33A 4KIGA 4XUCA 3G88A 3RW9A 4ER7A 2XVMA 5ICEA 5K0JA 5LSAA 1RI3A 3P9KA 2P40A 4R6XA 3DMFA 2UYOA 4IV8A 2YXLA 2NXJA 3TKAA 1PJZA 5CIYA 3A7DA 2QRVA 4KW7A 4FGZA 2C7PA 2PWYA 2O0LA 5E9JA 1FP1D 3HCEA 1ZGAA 1X1BA 1JG3A 3FTCA 3NW9A 3OZTA 1NT2A 3EGVA 4BLUA 3HA5A 4X63A 2HTEA 4PCAA 2GS9A 2PLWA 5EVJA 2ZULA 4HSGA 3UJDA 5KVAA 5LQRA 4AZWA 1JQEA 1KXZA 3A4TA 2IPXA 4AZTA 3B3FA 3KQOA 4FSDA 4YUWA 3LDGA 4RTOA 4MHTA 3THRA 1M0EA 3R24A 4RTNA 4EKIA 3EMBA 5CVUA 3P8ZA 2IBSA 3NMUF 2AR0A 4EK9A 5K0CA 1D2HA 1L1EA 4DCMA 3R3HA 4NECA 2G72A 5ICFA 3G2OA 4RVFA 4BLVA 3HVHA 5EMLA 4ER3A 1RI2A 5LQUA 4F84A 5HIJA 3B3JA 1RI4A 2O06A 3HCAA 3WSTA 5U4XA 2ZSUA 3AXTA 1Z3CA 3T7SA 3FUWA 1VL5A 1XCJA 2E5WA 3HCBA 1BC5A 4BP1A 5BW4A 3BGDA 1ZGJA 3CCFA 2H00A 2EFJA 3CBGA 5BW5A 5KS2A 5FQOA 3UA4A 2P35A 5EC8A 4OA5A 5EPEA 1P1BA 3KR9A 2LD4A 2IDKA 2AOXA 1JG1A 2BM9A 2G8NA 1YB2A 4RTMA 1YZ3A 5E9QA 3P71T 4C07A 2PXCA 3ELYA 5DXAA 2I7CA 3V8VA 2O07A 4HC4A 4IV0A 4LWPA 5EKXA 2H11A 1T43A 4E2XA 5K0NA 3PVCA 4FSXA 3C6KA 5E8RA 3OZRA 1P1CA 2PX5A 2ONYA 4PINA 3TM5A 4POOA 4RTRA 4PONA 2OY0A 2K4MA 2YXEA 2FK7A 2QRVB 4KDCA 2G71A 4YMHA 3CKKA 1RJFA 2NXNA 4OA8A 4Y2HA 1PRYA 5DRYA 5K0GA 3I5UA 3E23A 2CMHA 4GC5A 5GOZA 3JWJA 2OXTA 3K0BA 5K0FA 1L3CA 5K0BA 5EHGA 3I9FA 4FZVA 4FT4A 1FPQA 3KQMA 5DM0A 2V7EA 3EVAA 3KR2A 5D1NA 3KQTA 4HG2A 1DL5A 1NW5A 4PIMA 3SVZA 4WVLA 4P7JA 5GM1A 4O29A 2IIPA 4PCLA 3VC1A 3P2IA 2ADMA 2P7IA 5EZQA 2DPMA 1X19A 3IYLW 4LG1A 1JG2A 5K0EA 5EQJB 4QQKA 2OPBA 4R8SA 5FHRA 5BP7A 3FTFA 2PX8A 3C3YA 3MAGA 3FYCA 4IKPA 5DM4A 5FTWA 2HV9A 5E1MA 3UJ6A 5E9WA 3B5IA 2PJDA 3FPHA 3SSOA 5DX1A 2VDWA 2B25A 2NXCA 1SUIA 2QE6A 1I1NA 3M6WA 3PS9A 4PYQA 4PWYA 5LQAA 4ER5A 4C06A 1KYWA 2PXXA 1XDSA 4R05A 3KQWA 3FUVA 3TLJA 4EVIA 4RTQA 1U2ZA 5K03A 4GOMD 3UWPA 4QPPA 5KQSA 3BKXA 5CCXA 2IH4A 3C0KA 4A6DA 1RJDA 3IEIA 2IBTA 3GRYA 3G5TA 2GLUA 5KYGA 4B17A 3QV2A 3G89A 4E31A 4MQ4A 4PYLA 2B3TA 3EVFA 2I62A 2ZWAA 3HVKA 5DWQA 5LQCA 2IP2A 4DMGA 3G8AA 1G55A 2JJQA 2UZ4A 2PVCA 2NP6A 3BZBA 3D2LA 3QOWA 1ZG3A 5JUWA 1O9GA 5EMJA 2Z6AA 5DTQA 3SMQA 2BR3A 3HTXA 5DSXA 5LR6A 2GPYA 4RSRA 2PXAA 3C3PA 1JTEA 4EKGA 1G6Q1 5CM2Z 5CVEA 5EZSA 3FUXA 2PT6A 5HIKA 2XYVA 3QOXA 1R18A 3I64A 2OYRA 4AUKA 3EGEA 2ZTHA 1NE2A 3MGGA 2XBMA 3MTEA 2PX4A 4PYNA 5P8WA 2C7RA 3EEYA 2AOWA 4BP3A 1RJEA 3ID6C 2IH2A 2OB1A 2YVLA 3NWEA 4EQZA 3NVMB 1XCLA 4PYMA 5DM1A 3JWIA 4ATNA 4M7RA 1WY7A 3SGLA 2BZGA 3KPWA 2AN4A 5FWDA 2B78A 3OE4A 2B2CA 2N47A 2G70A 1M6YA 3M70A 4RTKA 3DXZA 4GBED 3TPZA 5EEHA 1WG8A 3OE5A 3UJBA 3M6VA 3PB3A 4RVDA 4XUDA 3BT7A 4R6WA 1X1CA 2FPOA 3G8BA 3E7PA 1F3LA 1BHJA 1X1DA 3GXOA 2Z6UA 4PYIA 3PTAA 5K09A 1Y8CA 3G2MA 3Q87B 4CKCA 3VYWA 4FT2A 4YV0A 3R0QA 3R9XB 1DUSA 1VLMA 2XVAA 2OBFA 3P9CA 4RTSA 1SKMA 2ZBQA 3OU6A 3TOSA 3HEMA 2AOUB 1KPIA 5CD1A 1D2GA 1NW3A 3KPJA 3KQPA 3UJAA 1WZNA 3KQVA 5EGSA 3EVDA 3A25A 4AX8A 2CWWA 1V39A 1P91A 5DXJA 4CKBA 4KRGA 4E33A 3ER9A 3B3GA 3MCTA 4GUAA 3FYDA 3P97A 4OBXA 5DTMA 5DX0A 3DOUA 5T64A 4LECA 2P8JA 2VDUE 1XJ5A 1UFKA 3EPPA 3GU3A 4CWAA 5DX8A 4YMGA 3MB5A 5C0OE 3CJQA 3DR5A 5FQNA 3RIEA 3SM3A 1EAMA 3SSNA 3TQSA 4DQ0A 2HR1A 1YZHA 4C05A 3NTVA 2BH2A 4Z2YA 4CXMA 1BKYA 2EJUA 4YUVA 2P3OA 4YV1A 2O57A 2YUIA 1WXXA 5E1OA 5IH3A 2H1RA 4C03A 2P3LA 2R6ZA 1NW8A 3I58A 3OU7A 3FRIA 5EMMA 2ZBPA 1SG9A 2AN5A 2OB2A 4G56A 3UA3A 4C08A 1IY9A 2GAFA 3TR6A 1KHHA 1NW6A 3GCZA 2VP3A 2FK8A 5T6BA 2NYUA 1RJGA 4U7PB 1YFJA 3T0IA 2VZ9A 4ISCA 2G1PA 2XYRA 1ZHFA 3LBFA 1I4WA 5DTRA 4QVGA 5EG5A 5EKUA 1KYZA 4PNEA 4H0NA 3G7UA 4RX1A 2PY6A 3LSTA 5HIIA 3O4FA 5GINE 1B42A 1QANA 3CC8A 3LCUA 2CMGA 5GIOE 3CGGA 5EHIA 4HGYA 2O05A 4KVZA
chains in the Genus database with same CATH superfamily
2OPQB 3GDOA 2AYYA 4DZRA 1XHEA 4BYGA 4REOA 2TRSB 1NUPA 3Q24A 2BJ3A 3GMIA 4AL6A 4OX9Y 2WSEC 1BNCA 4DKJA 1G2PA 5HROB 3Q2KA 3I62A 2Q5HA 1IBCB 1Q22A 2C2RA 1NRJB 3AVQA 2XY4A 2E7VA 4G5YA 1PSZA 2J0XA 1R3DA 2V7TA 1I3KA 2NO0A 2QRNA 3GOQA 1W47A 2G7MC 2HWKA 2H1OA 5LOQA 3FCCA 3J7AC 3FLEA 5JE8A 1J5OA 2R5FA 3DHWC 2FVYA 5F3WB 5BSGA 1LI4A 4RK7A 5FUQA 3KL2A 2VHWA 1QQTA 3OU2A 3ICCA 2IFTA 3N8DA 4FNMA 1T94A 2HO4A 3ILVA 3EJMA 5BQXA 1EINA 1DTQA 2W2MP 4UNPA 2VASA 2BZ0A 1LLUA 4XDYA 4TUYF 5FFFA 1L7VC 2Q3FA 1U7DA 3GD7A 5DBOA 1PJCA 4C11B 1D09A 3TI7A 1WIWA 5KU7A 5GMOA 3EVGA 2C54A 2B0JA 2VL7A 3DULA 4FMPA 1QLJA 1SVIA 4HLNA 2RGWA 2JCXA 1EAYC 2MGZA 4X65C 1NQOA 1ENYA 1RYNA 4MPJA 4PANA 4JT8A 4QQNA 4C9DA 3OZXA 1RZMA 5AI9A 4B4KA 4KQ2A 3T9NA 3H87A 5K8CA 4ALJA 3TOZA 3FJYA 2OZLB 1U1IA 3WFJA 1IQ0A 4G5SA 2C5FA 3DLGB 3KYIB 2VDHA 5BRNA 4UZEA 5IEJA 4P4UA 1C30B 2X40A 2UYCA 3QM1A 2ZYUX 3TSOA 2XNHA 1FJHA 3MG9A 1M1YA 2WHEA 1E6YB 4RS4A 4MK9A 3ZIUA 2XKKA 3GHYA 2VUTA 1W36B 3H1AA 5KOJA 3ZBPA 3SN6A 3M30A 1QYVA 5A5FA 5IWAB 4OYAA 3WGNA 2IMWP 2E4AA 1FVQA 2CDRA 4LVCA 3ELWA 1LRKA 3G5MA 4OP2A 1RCXB 1EYZA 3ZGVA 1X7WA 4FYVB 4P2SA 2BMJA 1BQMA 3CJ8A 4LXXA 1FU8A 2QSJA 4IHAA 4WOKA 1ONSA 3KTOA 3GYGA 5BWMA 3UAWA 4CEIA 4L0QA 2FQQB 2G0CA 4JLOA 3VC3A 3TRHA 1DJ0A 1E9FA 5KFCA 4ECRA 4HEHA 1MO4A 1NLZA 3RUDA 2DNKA 2BELA 5GADI 4N5HX 2V6GA 4ABYA 2O3QA 4FD2A 3LO3A 2BLLA 1XRCA 2X8LA 4MS4B 2XMRA 4POOA 1CRQA 3TQRA 2VQFC 3M81A 2Q3HA 3VDXA 3QSIA 4L5JA 2CV1A 4MX8A 4EO4A 4BO2A 1V4BA 1L3UA 4Q9DA 2ROPA 3INTA 1PG3A 2ZG6A 1XKQA 5C2JB 4BLGA 4M2LA 3FFIB 2DHAA 3R0ZA 4NEZA 5K0EA 3WLOA 3DEJA 4B35A 5IK2D 2CLFB 3WY9A 2H7VA 3UPTA 4CF6A 2BJ1A 3QVKA 5AE1A 1FTNA 5KZMB 4L3KA 1IJFA 2HJGA 2E87A 3QJYA 2QN1A 4O33A 3R8CA 1C0TA 2FV8A 3QV2A 2J9RA 5I4BA 1T5LA 3RIMA 4HFJA 2JSXA 3G8AA 3SYLA 3U3ZA 5DN9A 4RFSB 4IW3B 3DMTC 2GMLA 2DERA 3LX4A 2DGQA 2W0MA 4EHDA 2OZPA 3EFHA 1UEIA 3T5JA 4RORA 4JYAC 5EX0A 3ADOA 2HZ7A 2HSDA 2FSSA 2CCGA 2WWHA 4RTKA 3ENVA 3M70A 5BNTA 3QLUC 1N34F 4YRFA 4TWAA 3LP0B 2M52A 1I2DA 1MLAA 2XWSA 4GLFA 4CM6A 4XLZA 3QLHA 1ZN9A 3OU6A 2IYYA 2AF4C 4NOMA 3Q7RA 3V2IA 4B6JA 5AVRA 2BHLA 1AJEA 2BKNA 1SBNE 2MZ1A 4HTAA 4DUGD 4RD1A 1IUJA 4MMXB 4EKEA 4BV3A 1CUZA 4R7TA 1L5QA 4ZLNA 3HMJG 4IDKB 1JIVA 3HSYA 4I56A 4NJOA 4Q1DA 3T1HB 4E51A 1FYWA 2Q46A 1QIIA 4FGLA 2BFFA 4YRDA 5KSOA 4EMBA 4NFLA 1K7CA 2PUEA 3W5IA 5B0AA 1RNLA 2EJWA 2MKHA 2QD4A 4WN9B 3V7YA 1F2HA 2JIZA 1FA9A 3I8SA 3IQHX 4OD0A 2PKWA 1ZA2B 3IUQA 2WU1A 2JLAA 2VAWA 2CBZA 3CVYA 2IY5B 4WLEA 3D02A 3NV9A 4CIYA 1KVTA 2KTQA 2FMXA 1JKJA 5IM0A 2CPEA 1JKJB 1U25A 1X3SA 2GW8A 1Z39A 2YFYA 4KLAA 4OH7A 1SVUA 1Z4KA 3EXEB 3DGEC 1NI3A 3Q7QA 4M1QA 1CJKA 2DJIA 1JG4A 1WXDA 4Y2JA 4CG3A 3IULA 3RODA 2XAAA 1ZOPA 3BXPA 5DM60 3WSWA 3IUBA 5IF3A 4WKCA 3PX2A 4ASUA 4BZQA 2DYKA 1GZ5A 3COVA 3FFIA 4TZ6A 3U7RA 4E6EA 1HYQA 3MAHA 4KO8A 2VBWA 1AQNA 4B73A 1GTEA 1ZX1A 5BORA 3KOXA 2QPAA 5FPPA 4YFYA 3WAKA 2XSJA 3LW7A 2I3AA 2VYNA 5EUMA 4LHXA 3H65A 4IOBA 1T3GA 3P4YA 2E5LF 1VPTA 2VU5A 3HCWA 5CDGA 1QP0A 3R4CA 2JFZA 4TU8A 4RSHA 2X5XA 1FRMA 4DV1F 3KQKA 2PANA 3F8TA 2J85A 1ZJWA 3WZ0A 3E18A 3LKZA 4QU5A 2BDUA 1YJ5A 2MZTA 2QP4A 2QTVA 4HX9A 1RWOB 1GFWB 1V71A 3QWBA 4HMOA 5DQHA 1KJJA 3OXFA 1O4VA 4PGAA 5F33A 1WOOA 3W5CA 3I34X 2Z5GA 3G6ES 1JAHA 1E1DA 2DXIA 4LF2A 3ZJUA 3UE2A 1O9BA 3T5GA 3NWBA 2ZOMA 2Q6LA 1X7YA 1HA1A 4FBUA 2WIAA 1FRNA 1ND6A 3PSHA 2ILYA 1FZQA 3QNWA 2P5VA 3ZDQA 1U9YA 2X1GA 1EFPB 4AUMA 2JH8A 3DMJB 2CXOA 2DEJA 2HEGA 3A13A 3AV0B 4RL1A 2ADCA 1T6NA 3HMKA 5TPWB 2C5BA 3FJ1A 4JBNA 2HQRA 1P1HA 4K4TA 4WFNQ 2X86A 3GR6A 4ZK2A 2ZBIA 1GIAA 2GC8A 4WEOA 3UOGA 2ZTMA 5GZ3A 3L06A 4H6PA 3KQOA 3L5KA 3JWPA 1RZRA 5CHYA 1FTCA 4KHRA 3GFVA 2AR0A 3QE9Y 1NYTA 2H6EA 3RYHA 3LY7A 4QU7A 2KVIA 1K47A 2P2FA 2NM0A 1USUA 4LF4J 2C2GA 3FWPA 3AXTA 4M7WA 1GZ7A 5IABA 2VZ0A 1VS3A 3NKYA 5DNDA 4L6V3 4NVRA 3A36A 1DEXA 1T9ZA 1YZ7A 3WGHA 1ZJ4A 1O95C 4YWHA 5AI4A 2ZVQX 3MMBB 3N6RA 3UN3A 2I4TA 4DC0A 5EWLB 2CCJA 4IKOA 1P3DA 1KOLA 4IJUA 2EBFX 2G71A 1P7ZA 1QG0A 1IBKF 4B76A 3EWAA 1GUDA 1YDMA 2D5AA 3HB5X 1IBLF 3RWBA 1PYTA 4PNZA 3TLBA 3C7KA 3NBZC 2DTXA 4D0LB 5C46F 1CEEA 1OO0B 5E9WA 2V34A 1G3IA 5BR8J 5LJ5Y 4I1VA 4YJ2A 5KTQA 5A5GA 1SUAA 1UMDA 2BANB 3LALA 1XVTA 1N36C 4MVJA 4ZYYA 3DI6A 2Q4TA 3DI6B 1VGRA 2CB9A 3U6BA 4AQDA 4DV7B 4WXYB 2XQKA 4TLBA 4Y2SA 2VTVA 1VBNA 3ORQA 1XT6A 3WLSA 4FBGA 2B20A 4IVNA 3U3RA 2GN4A 4Q3BA 3VX3A 1CY8A 3R5XA 5CW2A 1ULZA 3D0KA 2AZ1A 1N9GA 1E9BA 1NA5A 3CZMA 3EQZA 5BYBA 1SCQA 3FB1A 2SECE 2P77A 5IKEA 4QGAA 2Y0EA 3SYZA 5I3UB 2CKMA 2J9GA 5I3UA 5EMNA 5LLSA 3IP0A 3CT4A 2H1LA 4ARUA 1CNFA 3S2SA 1FTQA 4KFCA 3P97A 5TC4A 4CMAA 4DEZA 1M1NB 1UJ2A 1D2NA 3TE6A 4AP9A 4OLPA 1GQFA 4PZ0A 1OTHA 4DQDA 3UJHA 4ZQEA 4YC7A 2HGLA 4HR7A 1KHHA 2C2YA 2IOFA 2PUTA 3TANA 2RE1A 3IA2A 1W4CA 4G09A 5ILGA 1E6EA 1AK1A 1G6KA 5GINE 1RWMA 2M7SA 5LQJA 1RWMB 3IQEA 4OZ2A 4ZLJA 2DAPA 2IS2A 5LDHA 2VQ3A 4AKIA 4ZCLA 4ZDWA 4BFLA 3UVJB 4ES1A 5KTSA 1CUAA 3RAFC 5GP1A 4O59O 3QY9A 3SE0A 3DSRA 2BGWA 2AYXA 4MLDA 2DNGA 4F6CA 2NCLA 3WK5A 1MU2A 2IZZA 2XJ4A 3ZHUA 1A71A 2EQAA 1D6SA 2Q28A 2X2FA 5LOVF 2R65A 2E44A 2ANBA 4BO8A 4GR9A 4DUZJ 3Q2TC 2VKZG 4R25A 4UHBA 4CM8B 4C2BA 2R7SA 2HNBA 3P0FA 3ZE6A 4QOGA 1LJUA 4F3TA 5L39A 2WKPA 2WABA 3KAKA 3OFKA 4NYPA 1UBJS 3WRYA 1DEOA 2A1TR 2W24A 5KCZA 1Q1KA 4QQRA 2GXQA 2C5AA 3TAMB 4FFWA 5IAEA 4J3FA 1PEAA 4Q45A 4O4LF 4IIYA 3NHFA 3OSUA 3E7DA 2DKOB 2R96A 1I2BA 4BQPA 3LOPA 5JMTA 5BQ3A 3S8EA 3HVJA 3IUPA 4P2BA 1BA2A 5J2UB 4JEMA 1DPFA 3OJXA 2MQ8A 3BYRA 3MPUA 3HXTA 4WY8A 3B54A 1Q7YT 4X54A 4MZDA 5FOSA 4R1QA 4D96A 1X31C 2VUSA 1SVMA 2CPHA 3DQPA 1JEJA 3PNBA 3EPJA 4HP8A 1OFUX 4HPJB 4ICIA 3DDZX 2H31A 3PFNA 3F3SA 4FYXA 1IBRA 4ETZA 2VT2A 3NOXA 5KKNB 5CVJA 4AFNA 3R41A 3MM8B 2GYYA 3OH8A 1TAQA 4HAWA 3O2IA 2EKLA 2C2NA 1ZI8A 2Z1MA 1Y3JA 4KHPF 1EGHA 2BE7A 3SR4A 3K1JA 2OGSA 2HCTA 3THOA 3HSKA 2VG7B 4NCBA 1VJGA 1K9SA 5ITZB 1VE9A 4LEIA 3T4PA 3O3CA 4DFKA 4EFKA 3ZWBA 4FFMA 3W3AA 1GOTA 3HKBB 3PWSA 1OXXK 2E4UA 2I6TA 2FA9A 1MOPA 3AR6A 1LV8A 3AERB 1GTJ1 5GTDA 4JKOA 4TMWA 1S1XB 4PXYA 5F8NA 2ROGA 4F04B 3MM6A 1SJ1A 4XLLA 3G6YA 5F3ZA 4REQB 2RHGB 3HVUA 4TM7A 4ZAZA 4JB8A 4A2WA 3STVA 4WZBA 4D41A 2AKAB 3HVIA 4WZBB 1T9YA 1X7XB 1HR0F 1BMQA 1P8AA 4G5XA 4DJFC 3DMTA 3DEZA 2IBMA 5AK3A 5IJ9A 4WKNA 1JG3A 2R8HA 2ZIXA 1RTTA 1W5AA 2DBVO 4LJYA 1IBLB 5ARBA 3TSAA 3PQ6A 4YUWA 2X9LA 3L1JA 1KDPA 4F2WA 4GX0A 3RUBL 3CLSC 2W42A 3PLRA 2JGIA 1GPKA 2Q0XA 5U4XA 4RPJA 2B7LA 2Z3ZA 3CVKA 1UEUA 3O4GA 3CCFA 3FGZA 4FB4A 1A0OA 2Q5IA 4R8LA 2PRJA 3L0CA 1W59A 1NVWQ 4GPD1 3BO2A 1P0IA 3BIWA 4CE6A 3BSYA 4BL5A 3GGCA 3R7DA 1P0CA 3O2SB 1S2LA 2E8CA 3TM5A 3V46A 4DYVA 3MWJA 1C7QA 4XPCA 3CX3A 5K3SA 1Z16A 4KWEA 4Y2RA 2GZDA 3I9V6 2GIQA 2JFDA 1DHRA 1SXIA 2CMHA 3E23A 5GOZA 4NAUA 2IZ5A 4HEA6 1U3WA 3GJRA 4NU5A 1YR3A 3JQQA 2YKAA 1VYAA 4AXBA 1E5DA 4IDEA 2FZCB 3PNOA 5HMZA 3L0YA 3NOQA 2QU7A 2QE6A 5EGYA 4KI7A 2Y1LB 3KQWA 4FF4A 1P4AA 3TUIC 3VHXB 4IX9A 1RT7B 3KB6A 4MQ4A 2X5JO 3U4HA 5BRJA 1GGKA 2GVZB 3BZBA 2C4VA 2CDRB 3HTXA 5LR6A 1NJIT 4F4IA 4TLQA 3G6KA 4ITUA 2B4UA 1E7SA 4OHMA 1C8KA 1THZA 4FKBA 4GNKA 5TB5A 2QE5A 5AM4A 4Q1EA 4CCWA 1YAHA 4XRGA 2DJ5A 3AB7A 1Z5WA 3DZCA 3M6VA 4OOFA 3RRMA 1AMNA 3W64A 3HVRA 3C8UA 2HQOA 2MQOA 1YWGO 3BTUA 1U5BB 2RD5C 2FRDA 3PRBA 4XPZA 4QGGA 5ETOA 4BNJA 1R2QA 2IOFK 4PYAA 4RE5A 1XYGA 3PCXA 5IJ0A 3TIXB 1BCRA 5A3SA 5JSUA 4LF5C 3M4YA 2YBVA 1ZM3A 1P6TA 3CDWA 1JXQA 4GXNA 4H16A 2VRNA 2PE8A 1VGQA 4NXNB 4O3FA 3JQBC 2J41A 4DJJA 3T0IA 1GTL1 4B3TJ 2QX9A 3OZWA 1KYVA 3Q4GA 5EG5A 2QTRA 5IJ9B 1SJ4P 4DWIA 1RABB 5ETJA 2PX0A 5A9SB 4P73A 3RDPA 4Y6SA 3V34A 5EJEA 2D7JA 1INLA 3W66A 5F64A 5D3QA 3KLIA 1ZLYA 4ROTA 2MSLA 5L8RC 3QLVC 3VV3A 3K32A 3KXLA 3SZLA 4OPMA 1QMGA 2OD9A 5IKMA 3O4RA 3O9MA 1FYFA 2P6SA 2OAGA 5ECWA 1N6PA 4X1OA 3CISA 5IDQA 5B57C 5KNDD 4BNHA 1FJCA 3ESXA 1PZFA 2IGTA 3UX3A 1GAWA 1OX5A 3HY4A 4QQFA 1H1LB 1MJFA 4RA6B 1A8HA 1JPJA 3H20A 1PQPA 4TLAA 3MJRA 3HU2A 3CW2A 3OLQA 4JB0A 3FI0A 1GGJA 2CYCA 1DC3A 2E9RX 3AFIA 2FGOA 4MGIR 3DOJA 3EXIB 5HMYA 2H4YA 1Q1GA 3IX7A 4KFBA 3ND6A 1KP9A 4E07A 2IM0A 2QN3A 2Q43A 1FXSA 1FERA 3D4LA 3WL4A 1KIAA 4B2PA 1GARA 2CE7A 5C7IO 1HD1A 1FNOA 4R0JA 1U1GA 1T1SA 2VNSA 3ZWMA 3LGXA 2V7XA 2EG1A 1JWWA 1SOMA 3G2NA 4DV4J 3NHLA 3R0IA 3OL8A 2JBWA 1M10A 4MFBA 2FX3A 4X41A 2XT6A 1U24A 2Y1EA 2ZRJA 5L4SA 7ADHA 2DNLA 1IKYB 3BKTA 4JUCA 1NDUA 3HHDA 3ORRA 3D8RA 5TQ2A 1G4AE 4LFBC 2A0KA 2WMDA 3JV7A 3N53A 7FDRA 4G97A 3BSAA 1YQUA 1ZNXA 4EYQA 1MMLA 3ZZUA 4QU8A 3GT3A 2ZVJA 3GZ7A 5E1DA 1V1RA 1WR8A 2XUOA 3AY0A 1JDBB 3UOWA 9ATCA 3TK1A 2XUHA 1K6XA 4XZ3A 4UEOA 5DOVA 4MI3A 4YJHA 1TD9A 4Q47A 4HSEA 2VDKB 4N41A 3ET6B 3IV9A 4PRZA 3VBEA 1EUZA 4NP6A 4PYKA 5EWLA 1EVLA 1X8DA 4WZZA 2JGRA 4X91A 2HRCA 5TE9A 2VDQB 4OH1A 3C70A 3ISNC 4CTMA 3PTZA 4UVGA 3ZKAA 2DR3A 1G5HA 4CDIA 1UBUS 5C8DA 2YNHB 1FKPA 1KLMA 4OIXA 4MVJG 4M1WA 4J3JA 4KQ6A 2BLNA 5BSVA 2PYZA 3PV8A 3GLRA 4R31A 4CH7A 1MHPA 1P45A 4ZEXA 1ZUD1 4Y7CA 2I54A 3TJ9A 1K4MA 2ODBA 5I6DA 3B70A 2A3NA 2GZ3A 4DV4C 2B36A 4H4EA 4E2XA 1ECGA 1UT6A 2ZB2A 1V8DA 2O23A 1K0VA 5KFXA 1YA6A 3GBSA 3S29A 2GVDB 4IFVB 3ICPA 3PJDA 5KINB 1LRLA 4ZI7F 1XYYA 1ZTTA 3SVZA 1ULTA 3ZCRA 4B9LA 3NHZA 2BGKA 4P3YA 4PCLA 1T8UA 1YB1A 1U8WA 5KFFA 4V0MA 5HI7A 1GTMA 1N33J 4W6ZA 2GF0A 4EHJA 5DX1A 2Y8EA 2D4AA 1YRYE 4Y7DA 4DCOA 1UAYA 4K6CA 2R1TB 3G89A 4LC1A 4QPZA 4FDVA 3IQWA 1RCUA 2D1TA 1CJUC 1Y3FE 4DV3B 2Q3EA 1GU1A 1DJNA 1X4GA 5G2OA 4QPCA 2W2KB 1RKXA 5EWGA 2GKSA 1C3OB 1Y37A 2PSHA 2I4NA 4QJ3A 3ZDBA 3OTIA 4DR3C 2IHZA 1WP4A 1WHTA 5AI8A 4AJOA 3ICQB 3EODA 4C5AA 4W9NA 2N9UA 1AO3A 2QJOA 3LNCA 3T0GA 3EVDA 5IDYA 4IKEA 3UF0A 3IR6B 1XPRA 1X15A 1LWEA 2OLWA 2W6JD 3I5BA 4FUQA 2Q6TA 1Z8FA 4G5HA 4R2WA 3NTVA 5KFOA 2V6IA 3MFHA 2RQ4A 1JIIA 4Y9UA 4NYOA 3MCSA 2PS9A 2XY7A 3H0CA 5FTLA 2FPKA 1I0LA 5DOZA 1H2AS 1UBFA 3QLVA 2ZSIA 1ZN8A 1ORRA 5HZKA 3N39C 4DC9A 1E2BA 5A2GA 2WTAA 3CF6R 5EIFA 2W4CA 2ZPAA 4HZUA 2A5JA 4ZMSA 5AD1A 3MXTA 1NC3A 5HHTA 3SMZA 4EUSA 2W9BA 3KR1A 5DN6D 5F7XA 4MXDA 5EXPA 5BPFA 2X6QA 4LOJA 2VHEA 1UEXC 2MINA 3NIWA 1AKQA 3KEGA 3CVXA 4DQUA 4KHPC 1LJ8A 3QU9A 2ODNA 3VNSA 4UW9A 2O8NA 1P9YA 2WU4A 4EUVA 3NBFA 3CPEA 4AROA 2IEIA 2YCBA 3WDOA 1I2CA 3LKVA 4ZOAA 4IYRA 2R60A 3V5NA 1ULHA 3PC8C 2B4TO 1N88A 3C5WP 5GJCA 1W0JD 2Q4EA 3FUUA 1D2CA 3DVRX 4EB0A 2DT8A 4EGLA 4NPCA 4JLAA 3QF4A 1C29B 2RFLA 3FG9A 3CUUA 1NXOA 1GG8A 1VOMA 2QRHA 3GQBB 3INNA 1E9SA 4KREA 4ETMA 5IN5A 3CDBA 1E1RA 2R6GA 3PK0A 2JX2A 4BN4A 1DG1G 3EIFA 4M0FA 1LWFB 4MVJI 1LWFA 4ZLLA 4N9QA 3I09A 4IILA 2MJNA 1A1VA 1PJSA 2AD5A 5JYDA 1DQZA 5KKAA 3KLEA 5BSMA 4O0MA 4PGFA 1GQRA 3QUBA 4FQ8A 4EY8A 3KEQA 4D4KA 2F3PA 1G5QA 1M1HA 3IJEB 2C29D 3FYUA 3RREA 1S01A 2PH1A 1AUVA 4TRJA 4UNIA 5KKCA 2DNZA 4ZCTA 1VIXA 5J58A 4TWBA 4O2AF 1Z36A 3I0RB 1BEUB 3G13A 4BVAA 1QGDA 2IYPA 1M1XB 1UWVA 2ZDHA 2ZWVA 4PFJA 3PNPA 5HVNA 3DYAB 4OX9C 4IJ5A 2IX3A 1T9BA 3BK7A 4UTGA 1H0SA 4N4AA 3UW3A 3L41A 4M6WA 1NDPA 5E8JA 8MHTA 5FPTA 3RWMB 4IXDA 3MAAA 2HA2A 1JQ3A 4N03A 3CQ3A 1Z17A 3IAUA 2LEAA 4B33A 5D0EA 3MXHP 2XLCA 3LOQA 1T34A 1E96A 1MPTA 1NR7A 1XWFA 4HRXA 2VWPA 2HY7A 3L82B 4F1WA 3VZCA 5E3JA 5GAGU 4EWTA 3EF0A 1STOA 4QBUA 4EG0A 2OZLA 5H4HA 1EXMA 1KJIA 4GL2A 1YR7A 5IANA 1ISJA 1AMOA 1SKYE 1TKRA 2YIDA 2HNDA 1X1BA 1BHSA 3H9BA 4J16A 2FXVA 2RCNA 4Y65A 3OQ1A 2OVFA 3U7JA 3KG1A 5BYKA 3TDMA 5A03A 1OFUA 3JR3A 1QOQB 3ZZYA 3N58A 4ARCA 3OJ0A 4QW8A 5JSZA 1NNLA 2OCXA 1TKTB 1DJLA 5H80A 1JQGA 2W70A 4AWBA 4L8FA 1DG9A 1E5XA 2Z2LA 2EC0A 2CZVC 1V4VA 3UT0A 3NFRA 3GJTA 2CV2A 2JAXA 1ZAVA 2D1CA 1VC0A 3P2JA 4ETWA 1XXHA 1JHXA 3EMKA 3FGVA 1AGRA 1Z0FA 3KUKA 5FUVA 2A9PA 1HUQA 1Z5VA 1HWIA 1REQB 1P4GA 5AQEA 4YAFA 2PXXA 4OHYA 4LF7B 2VTBA 3ENZA 2I55A 4B9EA 3P19A 3AJEA 4JC8A 2PWBA 3AP3A 3E9YA 3HVKA 1RPAA 4M1KA 3IVCA 2BKXA 3R3ZA 3T1QA 5CVEA 3EVMA 2OG1A 4PQAA 1K0TA 4EGJA 2WT9A 4E7PA 2AOWA 3ZKWB 1Z8HA 4ZC8A 3L7JA 1SOUA 1U4NA 3AH8A 4E4YA 4U7DA 4DY6A 1SK8A 3LUDA 1Z2CA 1JQBA 1EQUA 2HGSA 4RJLA 4Q7JB 1Z45A 2JA1A 4B9VA 2BBOA 3VYWA 2P8IA 4ZCQA 5CQGA 2GPNA 5DCUA 1KS9A 4LRXA 3VMFA 4C5CA 3GDFA 5CT9A 2JEJA 3OAAD 4ZVOB 4UM7A 3FD8A 4CKXA 3TARA 3ZHZA 1VQLS 2J9XB 4JL6A 1FFAA 4N9WA 4OCZA 4DA0A 1I33A 3N2GB 16PKA 4BO6A 5J2QA 3O82A 1QUFA 1JDVA 5LMUF 1F60B 3FQKA 1GDDA 2G1AA 2UDPA 3G7UA 4Y98A 3STUA 3NM6B 1U2SA 5EHIA 2FN4A 1WO8A 4N0PA 2VF4X 4IYJA 2AHOB 1QYXA 1ZL2A 1VK3A 4FYYB 3I2IA 5HQ3A 1OGYA 1JLFA 1QRSA 2IRXA 2FZCA 2JA2A 3NBQA 3GZNA 3UJNA 3TQQA 3KK1B 2PT9A 4U96A 2VKTA 1C0PA 1CD5A 1UDCA 4YN3B 5KOJB 1ZZNA 2BJ8A 3E0XA 3EG9B 3GFZA 4G8DA 2M0GB 3T3HA 3PR3A 3RSOA 1LQ9A 2PFKA 2VD3A 4E3WA 4QJ4A 4RK0A 5JYBA 4HNTA 4R8RA 3PFKA 4KHMA 3IT2A 1JECA 1L4NA 2DNHA 1B0ZA 2OV8A 3D4BA 2EC5A 4C0OC 1E5VA 3DH0A 1RVV1 2WJZB 3PKJA 4M36A 1EFAA 5EQDA 3UN2A 2IIQA 4JD5A 4OZ3A 3FOCA 2AD9A 4FDUA 4F4AA 5AW6A 3RPEA 4DR1B 1BCSA 4LJ8A 3I76A 4M0DA 2IP1A 1CJKC 3O21A 1QX3A 2JI7A 3TA0A 2QM0A 3NHJA 2XQCA 4PSAA 1I0ZA 3AV3A 3WLAA 4MH4A 4QNRA 1L5MA 1VG8A 1IXYA 4BWVA 3H4VA 2Q4BA 1YZVA 1G5PA 4DG1A 1RLDA 5KFQA 3U5ZB 2IDEA 1L7BA 1IBMJ 2ECKA 3T7CA 1SKAA 2QVGA 2DGSA 2YW9A 2V5HG 1PA4A 4DLPA 4IFTA 1GPWB 3PFIA 1N5SA 3QRWA 3ZKWA 3T9FA 3LECA 4R69A 3L02A 4HMPA 1P39A 2XNQA 4MV8A 3PFGA 4W5JA 1VIVA 1TH5A 4JP3A 4X6YA 4LFBJ 1TJYA 2CN1A 2I91A 5L1JA 3HA3A 4G3XA 3ZK8A 5KDLA 3LC0A 4GOOD 1F9EB 1F9EA 3ZDAA 1N0WA 3BWEA 3W6OA 3R6TA 4MCAA 2YJ3A 2NZCA 1ZMOA 3QWPA 5DO9A 2VJBA 4US1R 1QWIA 2LGJA 3TX6A 4I5EA 1BXGB 3QI2A 4Q3AA 2XT9A 1RK8A 4KDFA 1JXMA 5AYVA 2GEUA 1VJWA 3GP3A 1MROA 5H83A 4ALKA 2VXCA 4RA6A 3DLGA 1U3FA 4Y2KA 3OKFA 2KPOA 1LWCB 1GYPA 4BLWA 3I3SR 4L5CA 1DDIA 3IRXA 2CUYA 4OXXA 4RKUC 1JLFB 3WQSB 3FHJA 4HUQA 5EIBC 3E15A 1ID1A 5T14A 1Q83A 5LMUJ 3MOSA 1HDZA 1P5ZB 4NZOA 2RHWA 3ZV5A 2MCFA 3DR3A 2HHSA 1Q8LA 2QEQA 4LBVA 2DK2A 1N34C 5ICMA 4K05A 3OLBA 4I7FA 3UDLA 5BR8F 1JHQA 2ZETA 3W6PA 2ZR9A 4Y0FA 4B3RB 1XLUA 1JL3A 3CH4B 2PSFA 1R0LA 1JQAA 4H54A 4BWGA 2ICAA 3VRHA 1N6IA 4RHEA 3IV7A 3LXRA 2FW8A 1PK8A 2YTCA 5IXSA 2M1ZA 4GKAA 1TL1A 4L5IA 1PT7A 1PD1A 1JU3A 1CS0B 2FY1A 4ZD6A 4KPYA 2YXBA 4Y2HA 1NXPA 4IR9A 3UJPA 2XCQA 1G21B 5D1NA 2Q3MA 3ZLBA 3N87A 1WXIA 2JJ1D 4RMGA 1KO1A 4K9MA 3FPHA 4XWOA 5KFJA 4DDTA 1FTGA 4URXR 3CXUA 4WP9A 5B3AA 2GLUA 1TU3A 3M32B 4ONEA 2JCBA 3AB3A 3O8RA 4RWEA 2ZXEA 5HJXA 2HJWA 1PFGA 2YW2A 4ZQBA 4BFCA 1UXKA 4GLOA 3R9IA 3NVMB 1ADBA 1WY7A 4ZTZB 4CCYB 2VAVA 2AP6A 4QRHA 1VI5A 4DCSA 3W78A 3JZMA 3WGGA 4U9UA 3F4BA 2DHEA 4BC1A 1LF0A 4JV5B 3NATA 4GYJA 2FEMA 3DV0B 3PHGA 1U7TA 2ZBQA 2KJQA 2CVPA 3KPJA 5EGSA 4QFDA 1GYQA 4J2HA 2AEEA 2M2IA 5K20A 2DQSA 4B75A 1N5QA 3SM3A 3QG5A 4AJIA 2CEAA 1YS1X 3O2EA 4JYCA 4YV1A 1XA0A 1Q7RA 4BVEA 1XTTA 1T6YA 3R27A 2ZD1B 4IFBA 1AXRA 2RGRA 4P74A 3DVSX 1V96A 2UUPA 4UQLA 4JI1F 4XTTA 4ZOQI 1NOKA 1LW0A 4DPMA 4UOHA 3DEHA 2YOFA 3R3WA 1XQ9A 4ZZIA 4PZVA 1S2IA 1PNQA 1FEHA 1JGTA 1RIIA 3I9ZA 2J9CA 1GUBA 2I71A 5E0KB 2QX8A 1X5OA 1AKWA 4I66A 2ZI3A 1KJYA 3SDEB 1RQNA 2BGIA 1VZ2A 5K6TA 5L1KA 4W5RA 2ZB3A 1X4EA 4QFBA 3EDOA 1V26A 4IKAA 3A8KA 2DR9A 1EX9A 1YCGA 3G2JA 1MC8A 1CXZA 5DYNA 1G3OA 1PYSB 2JFYA 3VSEA 3LVFO 4CYUA 4MVJP 1UBNA 3HM2A 3FEYB 4YFUA 4N8EA 2E5JA 1FP4A 1HBJA 2YMMA 1HNXC 1JDPA 3HDTA 1OQ3A 3PD1A 3W2EA 1XNQF 1X0FA 3JQMA 2EZ9A 4F72A 3UVJA 3VTFA 4GLBA 3NKFA 5IVKA 3W7VA 3OZAA 5BNWA 5KNCD 2XG8A 4DR5C 5KFKA 3QAUA 4JI5C 4Y0AA 2FW0A 3FTDA 3EISA 2QAGA 1TMGE 2HUPA 4GF5A 3PC7A 2VG5B 4HGZA 1RT3A 3JX9A 3EVBA 1U1MA 4B3HA 4OSOA 3EDQB 4GP6A 2PO4A 3L6OO 2RI0A 3SSRA 4PBRA 1YKGA 2OHHA 1UPUA 2WF5A 4KSCA 1QE3A 1E0JA 3KB1A 4E8UA 3DUWA 3HNRA 4TSFA 3OT1B 5CA1B 1EETB 2PGAA 4IFIA 1MV8A 1U0GA 3O9VA 4PBSA 4EELA 2Q66A 4CG2A 1NV9A 2NN3C 3JYHA 1Q0SA 1JYEA 1CZLA 3GNLA 1NJYA 1R7RA 3TB4A 3DOLB 3HB0A 1XF1A 3PYMA 3ECSA 5DEIA 4WA7A 1SKBA 2HSEA 5BMOA 3WP1B 4DWJA 3TKYA 2Q5FA 3I6PA 2P79A 3RBZA 1FKOB 1Z6AA 3FVTA 3CCJS 3R3YA 3QBEA 3KKZA 3P6YC 4ED3A 4Z86A 4FFLA 1H9BA 2SHKA 1H6AA 1O6BA 4MJXA 5KG6A 1P2UA 1R88A 1AYEA 2FZKB 2J3JA 4C0XA 4PTLA 4EGFA 3P9KA 5DH9A 2HK9A 4ISBA 4NXMF 3MPWA 2XCTB 1HLDA 2VG7A 3WZMA 5K0TA 4E98A 4XGKA 1IB8A 3QA3E 3RFXA 2H2AA 4A7PA 2BEWA 4LIWA 2QVLA 4EKNB 2YKNB 4UVIA 3B3FA 1T9GS 4DOMA 3S2EA 4XJSA 3POTB 4CLPA 3OFSA 2OL4A 1LWXA 2DGDA 3FSIA 4PAWA 2VTBB 4ZQFA 5CT8A 1VGVA 4CO1A 5AW5A 5MAOA 2FUNB 1OXUA 1HQDA 2HLHA 1K2WA 2BFMA 1O4WA 1GPNA 1EXNA 3MILA 1ZAKA 2QRMA 1M34A 4WOCA 4UTOA 3N8HA 5K8MA 2IYRA 3B3QA 3UK0A 1I13A 2W2LD 3DB2A 2FEOA 4AJLA 3NHKA 4JR2A 4GPIB 1DQPA 3VTIA 1ZRNA 2GCFA 2CXEA 2WVBA 2PX8A 1GPUA 3MAGA 3SFTA 1OI7A 2AQ4A 2AG8A 1WKVA 3TZQA 2KDNA 3VPBA 2IYWA 4ZIRB 2BEJA 3I96A 4IQXA 4DUYB 1D07A 1OHHD 2FHMA 2IY7A 3FBGA 1JJAA 3A3OB 1HMPA 1XXHE 5IDWA 1OY8A 1U8FO 3A12A 4DW8A 3SGLA 1A2QA 4JI6C 3R74A 3W7BA 2AYMA 2C4HA 5EP3A 2IE0A 3TWZA 4JOSA 2VODA 1G16A 4GUDA 1WNFA 3WDSA 2IXDA 3DRSA 2XVAA 5DNEA 1JLGB 4P6VF 3EGZA 2WWTA 1TTHA 2WF9A 2QI9F 4ZK6A 1HBMA 2WTEA 4DR5F 4DQ0A 2Z2YA 5TT1A 3VFDA 4DV6J 4IH1A 1U6IA 2RAPA 4HAYA 3QG1A 2EFGA 2Y8WA 5EMMA 2H8KA 4BCDA 5T6BA 2RHCA 1BU8A 2ZYGA 3WIVA 4X1YB 2MHEA 2DH7A 1SCUB 3SXPA 2BFWA 3BSWA 3I05A 3PTLA 4GOJA 4QD3A 1TAGA 4W82A 1F2TB 3CGGA 4Z9FA 1RPZA 1IN0A 3WLLA 4YRIA 3L92A 1AGYA 1N4LA 3U1MA 3VR0A 3OFHA 2V5AA 1OF1A 2IEYA 1RACA 1IWPB 2YIVX 4IVPA 3VR4D 4D8YA 5EPOA 1J5OB 1BE8A 3SIWA 5JD5A 3DE3X 3EN0A 2FSFA 3DDKA 4RTJA 4OX6A 3V6DA 4LZWA 4MVJM 5TMBA 4YJFA 4JB2A 2VDRB 4CYMA 4HDCA 1NKEA 2IIBA 1Q0UA 3QKTA 5CNJA 4V03A 1G8AA 3TLCA 5JADA 1HNZB 2ZB8A 3W62A 1ZK0A 2WJAA 4LDNA 1OROA 3BXHA 3OEHD 2RGXA 1L3TA 1LQLA 2RGBA 1KFKB 1GA4A 2Q3PA 1R4ZA 2VJYA 1Q8BA 4QLAA 5BOSB 1WDKA 2O8VA 4PRKA 4QQ8A 2ZDPA 1U45A 4MCJA 4HJXA 4EUEA 4LZZA 5J4HA 5KFGA 2XI2A 4QYWA 4B0OA 1ZN2A 3S40A 1WC1A 5KFPA 4RGBA 5HVFA 1T5HX 5T4FA 3PJ9A 3FAZA 3DWFA 3TVKA 1U8EA 3GPCA 3I0SB 1PK7A 2VK4A 3BR9A 1DJQA 2ZKIA 4DQPA 4Q02A 2JS7A 4YRNA 3G2IA 2KM8B 1OJ7A 3QFCA 2PUGA 2Z3VA 3VWSA 4ZVQA 2WOMB 1Q1BA 4WWHA 1P2TA 2WWGA 2RGDA 3E35A 4DR7C 2AUMA 3RBEA 1KI2A 1UT8A 3KPYA 5LA6A 3GARA 4M0CA 2GTIA 3G3EA 3W9JA 2IYVA 1H85A 3H0EA 1P73A 5D6NA 4LV8B 4P81A 1JLGA 1FVOA 2L18A 3PQ5A 2NPOA 1WDTA 2J31A 5IDVA 2O1SA 3O75A 2VSYA 2V55B 1NM5A 4B3SJ 2R3VA 1JR6A 5AJXA 2B1RA 5IUNC 5LZ7A 2QLMA 4EHBA 3VR5A 4N7RA 3H8JA 2QYSA 1L4MA 3EUAA 4CFSA 3LX8A 4OJ1A 4RW8A 4FP9A 3V33A 2DPLA 3FCWA 4C2AA 4ICLA 2BF4A 3TLZA 1ESMA 3PLAE 3GJTB 1PYOA 2KHCA 1XAJA 3BQ2A 1AH2A 1GL7A 1JFFA 3D6UA 4ZI3A 4OQJA 2A88A 2F59A 1AHNA 3RJZA 5HIMA 5LDGA 1U0OC 4XUCA 4JV2A 3HCPA 3PXAA 5KYUA 1QU3A 3FSGD 3H6GA 4DG1B 1TTQB 3BL8A 2HFZA 1KZ9A 2QPOA 1TL3A 1IZZA 5BT8A 2APOA 3GAFA 3G0GA 3AETA 3LI2A 3BD8A 2MDAA 5FDLA 3DFZA 4Q5VA 3VZHA 1V8OA 3GEGA 5E7MA 1U0HB 2LQJA 1HZZA 4XPIA 4H6VA 1S1VB 3NT2A 4LF4B 1OWXA 5GGYA 3QZ7A 4WY5A 4YRZA 3FZBA 1XCJA 1VL6A 5K4GA 3PUZA 2MZJA 1ZBDA 1HI1A 3LHSA 3II6X 4PQFA 4TTAA 1P1BA 2V7QA 1BMFA 4NR0A 5SY9A 1XPOA 1KOJA 5KFUA 2XS7A 3VNQA 1X38A 5EE0A 1E99A 1BS9A 3HPQA 2IYAA 1KJ9A 2AN9A 4LVNA 1G20A 3GRCA 1J0AA 4HKTA 1R8SA 4R7GA 5LYJB 2Q5OA 1O6ZA 3ZWYA 5K8PA 2P7IA 1EE2A 3R8YA 4MWOA 3CT6A 1FYXA 4NBUA 5CYMA 5HTKA 4LXGA 4QWAA 2QP9X 4R0NA 2IDLA 5K03A 5BN5B 3QIAA 2EIHA 1RAGB 2RH9B 3MMXA 2F00A 1HDRA 3ZPXA 1GWNA 4YAUA 3AFMA 3RC7A 2WM8A 1YK1A 3MGGA 4UEQA 2C7RA 3ROQA 4JLMA 3KK1A 4PQRA 5DHQA 3K70D 5IT9Y 1YNSA 1KMMA 5BYRA 1GA1A 1O0SA 1KQSR 2LKZA 4FEGA 5BUCA 5EEHA 1KJ8A 2ZROA 2VF3A 2IKSA 3R6GA 5C1OA 1AKYA 3G8BA 3MPYA 1S9GB 1PSDA 1KKLA 1QYIA 3NPMA 2PZLA 3NO4A 1AQ6A 1CJTB 2QA2A 2GMHA 3AOAA 4YACA 4CO2A 1FJEB 2GBGA 1E6UA 3H5VA 4KXQA 3IQDB 3MWDA 2VBFA 2J9FA 1TKZA 3RROA 3MCAA 1Z0JA 1I94F 2VTEA 3RR2A 2GAFA 4FE4A 2UUBB 2QYCA 3WLQA 3CCQS 2IYEA 1XL1A 4LK3A 4WCFB 3W8DA 4KVZA 1C0UB 3A14A 1Z8DA 1BQ3A 3J7AN 1TYEB 3L40A 5AM0A 2ON6A 3L2OB 3NS6A 3TJRA 4FX2A 2UXBB 4BB6A 3H5XA 4O4GA 2WZCA 3MT8A 4IHJA 2QW8A 1W94A 1TL4A 3LVQE 4WOPA 3V8BA 4LF6B 2QRRA 2LV8A 4QG3A 3W3AH 4HR2A 2H16A 2JJYA 5A05A 1GNKA 2X3YA 3KL4A 2Q29A 4EYIB 3N7TA 4W6QA 3UMBA 2PNJA 1C2TA 3UZUA 3LYUA 1RLUA 5FA5A 2GH1A 3QEAZ 3GUVA 1FFGB 2IYNA 2VF8A 1WHSA 5DZ7A 1DCTA 1A4IA 3MERA 2XNDD 5IEBA 2OV1A 3D68A 3OPNA 4O3QA 2OMKA 4L07A 3HGQA 2C8JA 3C5CA 4GPTA 4UOZA 3RFFA 2PGCA 1OZFA 1V11B 1RHRB 4R2LA 4YDSA 3D3QA 3V7FA 4DDFA 1NSTA 5DWVA 2ZAGA 2Z43A 1J8DA 5AJZA 1I10A 2CHQA 2A5YB 3CNOA 5E3PA 4IINA 5IZCC 2PEHA 3CD0A 2PM8A 2YVKA 3REGA 1NF2A 4N48A 1JAIA 4LHWA 4RZRA 3W34A 3FPEA 4CH1A 2IU6A 1NI4A 4MYUA 2P9ZA 3GH3A 2GCIA 1Y9EA 4WACA 3NNHA 2MMYA 2YYAA 1P9LA 5FOWA 3H5NA 1RI1A 3TO5A 4L5AA 2GKGA 4ROSA 4DCJB 1GNSA 1GA6A 1TL7A 4C7QA 5BR7A 2FJUA 3BC1A 2O8BB 2Y2VA 4NABA 5MFZA 2B30A 4IPTA 4QUBA 2GXAA 5EWFA 2BHTA 1G4HA 4X3PA 3P20A 1KI6A 2Z1NA 3I6IA 1GAQA 1N2BA 5EZ5A 3V4ZA 2CG4A 3Q23A 1ZH5A 2FZ4A 1Q21A 4LF4F 1X9IA 3NEPX 3ZE8A 1P6UA 2MYTA 4DR4C 4PR0A 4DLZA 5D5QA 1A50B 4L02A 1DFIA 3T1HC 3MUVP 1C0UA 2IXTA 3FDJA 3GYXB 3LGAA 4KOEC 3MD3A 2OV2A 3I6QA 2XWQA 1MPXA 2QY6A 1LK0A 3LO5A 521PA 5LSAA 3K6JA 2B92A 1JIQA 4KW7A 3ZO7A 2MJUA 3X1KA 2PROA 2FB0A 4BS2A 3PCRB 3NAHA 2CLLB 1DTWB 4I50A 1GEGA 5DBIA 3NUGA 4DSZA 3KMQA 5CJPA 3QGMA 2HURA 3QVOA 1I7NA 3MJFA 3W2WB 3OF2A 1IHOA 2HBZB 1NX6A 4WKRA 1TT5B 1HQUB 4ZRDA 3KJVB 2Y1CA 1JXAA 3A0UA 2C57A 2E4WA 3KOAA 2ZYIA 2BQUA 1POXA 3B2QA 3CNHA 3H2TA 4EPYA 5M04A 4C07A 1WSWA 4L73A 4DBLE 2V2KA 3UYLA 5EIOA 4M46A 1AGNA 2DRIA 3LMKA 3FFBA 4M83A 2PMCA 4NOJA 1OBCA 5AIBA 2VLIA 2UUCB 1UW4A 1C7FA 1ZJZA 5L95A 2B4OA 2OECA 3R5GA 4DQVA 3HO1A 2VP9A 1EUCB 2O0KA 1S3SA 3I2YX 3R0XA 3GLHA 5JRHA 2Z2ZA 4A6DA 2GJ4A 4IG3B 3C3JA 2UVRA 1L4KA 4FGSA 3ZNOA 2EWMA 4TLEA 2XB2D 1B93A 1G1AA 1PLKA 2FZKA 2R6HA 1O6FA 1WXEA 1M6VB 3D6JA 5D4OA 3RUHA 1RT9A 5FBKA 1GL6A 3M3PA 2AN4A 2ZATA 1B8VA 1U2DA 4PLHA 3TIFA 1JWAB 3A4IA 2OXIA 5CX1B 1KI6B 1QCZA 1NKCA 4D9NA 4JODA 4QL3A 1DLOA 1DTSA 1MD9A 3OLVA 1A9SA 4CMCA 4GX2A 3LPNA 4G01B 5HR5A 2IY8A 4BGUA 4TL8A 4UBLA 3KE8A 1YZHA 3JXOA 1N25A 3EEFA 1EFTA 3W9HA 2GPBA 2H0RA 3I6YA 3L9ZA 3I58A 4QYTA 5JEEA 4DQLA 2XD9A 4WX2B 4Q21A 1W2GA 4H3VA 3HDSA 4E03A 5A2QD 4MQMA 1Q53A 4HQFA 4B3TF 1RJGA 1WD6A 2RKWA 4PFQA 1VYTA 2D2FA 4X00A 3PEHA 4ZVUB 1JTFA 4RA9B 3KOOA 1RUSA 1W8IA 1NSFA 3GJYA 3UYKA 1K1SA 1RT2B 4B32A 1N6OA 4PZAA 3FVYA 1IU9A 3DNMA 2Y77A 2YZ2A 1I5EA 4H4CA 4HHHA 3P9PA 1JMVA 5LMNC 2X14A 2VPZA 1XCGB 1MXCA 1P2SA 3MDFA 1ISFA 4IJWA 1J2VA 3CCWA 1NM5C 3OBIA 1RTHA 1EBBA 2JI6A 1XZBA 1ZH8A 3MPVA 3QT7A 1T4CB 2IGBA 2WOMA 1I4TD 2II6A 2OO3A 3A4MA 1B76A 1P81A 3Q5GA 5A1IA 4FQ7A 2B0GA 1LA2A 3I82A 3M2VB 4LHSA 4BVKA 2G7ZA 2O59A 3TQOA 5A02A 1U63A 2VIHA 1A7KA 3UWDA 4S04A 4GBMA 5HFAA 1ZGGA 4M95A 3GW8A 1QHXA 4IWNA 1CG2A 4Y9DA 3CCCA 3FCAA 4AZVA 3A2NA 1UOPA 1IONA 1L7QA 2GZAA 3ABSB 3O3LA 3SF8A 1E69A 1VYHA 2C0PA 2JFOA 2FZVA 1RAAA 3FRZA 4LRSB 3MM8A 4UZCA 4RPLA 3BILA 2OUIA 1JJ7A 2QMOA 4J9UE 4DFDA 3FE2A 2PH7A 2JLCA 5CH5A 4RX6A 4IMIB 2HA5A 5C8XA 4CI0B 2C2BA 1MSWD 3NFYA 2AFIA 2V67A 2Y9HA 2I6QA 2E7XA 5J2NA 4OI0A 4U63A 4KE5A 4OQPA 4C14A 3SNKA 4AN0A 4RAOA 4QIVA 1RT1A 3RVBA 4EJ0A 2I29A 2XB8A 3VSBA 3PHIA 3ND8A 4QDUA 4E70A 1YVFA 2AX3A 2Q2VA 4DU7A 4B3JA 3L4BA 1Z26A 3LCRA 4K4WA 1UPXA 1WEKA 2KFYA 1VQPS 5K9FA 1GT8A 1YL6A 3NTQA 4BO4A 4IY1A 1LK7A 3V3TA 3KHUA 3CLTD 5IMSA 3D8UA 5IYZA 2QZ9A 1WUTA 5AFSA 2HRQA 3FCHA 4B46A 2PZJA 1R8PA 3M3DA 5TMPA 2V7BA 1S59A 3HBLA 3F67A 1JSLA 2H9ZA 1ADYA 5LNK6 4UU8A 3AM5A 4ND3A 3BFKA 3JQGA 1E6MA 2VK1A 3HCEA 4BVLA 5KNBA 2VCEA 2EHDA 5I7HA 3H1PA 1QBKC 2Q3DA 2H2WA 4WNAB 3T5MA 1N8NA 3QUCA 1DIBA 1LEHA 1T29A 4DE5A 3IN5A 1FQJA 1BXGA 2C82A 2EKDA 2L3MA 5JH7A 3R3HA 4NLSA 3VA7A 1KK2A 2Y3YA 3QFHA 5CURA 2VT6A 3H7IA 1O96A 1VKRA 4MTPA 2OP0A 2BFBB 1L8AA 1RE1A 5LZ9A 3KDPA 3HFGA 1EGAA 4ZOCA 3MJEA 4F11A 4PNHA 3HUUA 3T5DA 1Q92A 1NG1A 4FYYA 5HQ3B 5CB4F 3W8EA 1H2YA 4G0YA 1MMNA 4DSTA 5DASA 3TZKA 2MTBA 5F9LA 1U6FA 4YMHA 1PWEA 4C0AC 1SXPA 2F4VB 2Z83A 1LI7A 2M32A 4S0ZA 2TS1A 3UG7A 4IIBA 4H7KA 2X2PA 4WVLA 1XMQB 3OM1A 4DV7J 1RTIA 1T2EA 2PO7A 3ESQA 4BMZA 4I4BA 4CMHA 2H08A 1TZJA 4Q9IA 2YHIB 4X1YA 2PIAA 4D8XA 1T6XA 1TU4A 4RTQA 3CCES 3C0KA 4R8MA 3PKYA 4OGKA 2VL1A 3OL6A 3CNLA 3H9EO 2O3DA 1MKYA 3CTRA 4TMVA 3ZK9A 1N2ZA 4JI7F 3AJAA 4L74A 2NR0A 1MQ9A 3U3DA 4B7AA 1L7PA 4ZU6X 1DWQA 3AVPA 4KSEB 4DHWA 1RYHA 4LY3A 1UZAA 1WV1A 3V1UA 1IPEA 2OEKA 5KFMA 3TLEA 1KI9A 3QVSA 3SS7X 5IAKA 3G2HA 4LI3X 4W8HA 1OQAA 2RJOA 4IQFA 2IS6A 2ZQ5A 4J0HA 1DBWA 2VJQA 4NLYA 5IT9U 3EPPA 4TYQA 1EWYA 3COSA 2HS0A 1AIPA 2VDOB 5LB4A 1P4JA 1L0BA 2R8OA 2CHUA 1RWNB 2EJUA 1XR3A 2P3OA 2QAGC 4DRXA 3N05A 3MWBA 1KMCA 3CZRA 1KSJA 3T5TA 1N2FA 5CNIA 1H2FA 3HHLB 1S10A 4GO1A 1TQLA 5C8ZA 4PNEA 8ADHA 1YRUA 3KDAA 3BE4A 3LHDA 4RJ2A 3V8QA 3MOIA 3A3PB 2CLSA 4G37A 3GFTA 4FYWA 2OGWA 3VPFA 4DM7A 1ISPA 5C5IA 5DCWA 4HT5A 3SC2B 3C19A 5FA8A 1GCOA 3IESA 2O1PA 5A06A 3OD1A 1F2UA 4N82A 1H0HA 2FJ0A 1F3FA 3UAXA 1E3EA 1E2HA 3TM4A 1NJSA 3AKYA 4O4HB 4N54A 1RJWA 4NZ9A 1SXJA 4PYOA 1QJ4A 5HQLA 4DJAA 3L7MA 2I0XA 1VLLA 1TF2A 3MF4A 5I42A 3EXIA 4ZPAA 4XIGS 3MPOA 4R1PA 2P9HA 1L6IA 1NVGA 1OXVA 1IKWA 1CJVA 4Q1FA 4FMDB 3PC2A 2HD4A 2VQFJ 3KXDA 1NM2A 5B0GA 1ZICA 5T7LB 3VC2A 1PJ8A 1TQ8A 3MMJA 1QIMA 3ZWCA 3KTQA 2ZZKA 1VG0B 4CL8A 2YDXA 3JRWA 2F55A 1ILEA 4HTFB 3FSJX 2Z0MA 3H86A 1E4YA 3KK0A 5BSEA 4G1UC 5JDCA 4CIBA 4YHHB 2OR3A 3V8NA 2H51B 1TMKA 1U7UA 3WZLA 1RXWA 1GGVA 4NI2A 3ANYB 3DB1A 1S1WA 4ER6A 3G9XA 2GF9A 3KTAA 2QM3A 3IVXA 3ROMA 3H4IA 5BSTA 2ACMA 1TMOA 3DE7X 3JWHA 1U9IA 4Y2AA 2P2LA 3DE2X 4YREA 3GGSA 3OQNA 3IEVA 3AFHA 1ZSNA 1W0CA 4ZV7A 1SBZA 4QO8A 1BQXA 3VVCA 3ER6A 5BSWA 2AWNA 1AZTA 3Q5EA 2P9TA 1NZDA 1ZIDA 4FLFA 3WB2A 5EWJA 1HKUA 4DRXB 5TF0A 5KJ1A 2DPYA 1TK9A 1RR6A 4LYYA 2PUJA 3D6NB 3F5SA 4H59A 3B12A 3ENKA 4YX9A 2PIDA 1ZUNA 4I19A 3G5LA 1U5CA 2QM7A 3RVSA 4OJQA 2JFWA 1YZTA 2HF9A 2Q4OA 2HHHC 3I4CA 2G4CA 1T25A 3KC2A 2GAOA 3ULKA 3THWB 3VVMA 2MPUA 2CXTA 4CUJA 5BN5A 3IE0A 4RD0A 4DBZA 4BDTA 2GUWA 3VTZA 1RWOA 1TL5A 2Q9BA 2R7MA 1NK5A 3RU9A 1GGFA 5AVVA 1OPRA 3O1JC 4LYDA 4KFBB 4H1TA 3QO9A 3FUWA 2VHUA 4NLPA 1DU4A 2P9FA 1I6KA 2X3UA 4XDZA 2NZ8A 3DCNA 1HHSA 3CX8A 1WWHA 3ZW8A 1LSUA 4EB6B 1E2MA 3HYLA 1XB2A 1VRQC 3KUUA 2J1LA 1HQ2A 1HWUA 1CJMA 3PXEA 3QKRA 2Q8QA 3RI3A 1X4BA 7REQB 1MJGA 1E8NA 3RWOA 1LPOA 2PR2A 3K9FC 4JJ4A 1RHMB 5HK8A 3RVMA 2BJHA 1JKIA 1K75A 1K4KA 2BBTA 2YH0A 4NRUA 3A2MA 3K70B 4CI9A 4KO0B 3D7RA 2H1YA 5DM4A 1KI3A 2IPAB 4PC7A 4ZDJA 4TQ9A 4HB4A 5TDHA 3NCHA 2GXUA 4RW6A 3WNZA 2W9XA 3T3FA 5FBZA 3R3SA 2NU6B 1B70B 4WINA 2HWTA 5J40A 1RJDA 2B8JA 5DDRC 3ZC3A 1PQYA 5FNVB 4USWA 3UTDA 3FCYA 2FP4B 3THVA 4XDDA 2Y6VA 4RZUA 1IKXA 3NQ41 2CVFA 1PTKA 5HIKA 3RNOA 4WE1A 4I4CA 4L1KA 4YP5A 5FA6A 1Q12A 3RQSA 5FL3A 1OKKD 3NORA 3GRPA 1OH7A 3SCZA 2FYXA 1RRVA 2JEFA 4XASA 1EVIA 1Z2DA 1ONPA 4P0QB 1P4RA 1AW0A 3AQOA 2VDIA 4YI3A 4MQLA 5K14A 1RYYA 3OTQA 4CMGA 3L1KA 1EDZA 4TQGA 2WAAA 2QUAA 2VHCA 1G5FA 3CCVS 1OIXA 2OUKA 3TXYA 4J4TA 3TQSA 1BX1A 3WYEA 1KKHA 4BQFA 4B0PA 1RYZA 1XEXB 1JDBC 1Z15A 4X5OA 4TYBA 1T3ZA 3AT1A 3U0BA 2CDQA 3HDQA 2HM7A 3VV2A 4BQEA 3GJ6A 1V1JA 3NBMA 3D1JA 2HZVA 3A3KA 3R0VA 5TSDA 1UJNA 2BD0A 1V5FA 4GZ5A 4XQ0A 1Y6JA 4HGYA 1WMAA 4JNKA 2E4YA 3IV6A 2O4CA 3PQFA 4FEYA 3CVOA 2BGJA 4UATA 4P53A 3BYZA 4FYMA 1C3JA 2IC3A 1FP6A 3DVQX 2MKJA 3SC3A 3Q10A 1UINA 2B5VA 5DJ5A 1YS2X 3UCGA 4FZ5A 2KG1A 1W8DA 2FVRA 4QEKA 4GI3A 3ZZTA 3HR7A 3N6MA 5DLYA 3TP2A 2BUAA 4JP1A 5I3CA 5HKKA 3BUSA 4MUJA 5B64A 5BSHA 4L7IA 1F8UA 1W96A 2O8FA 1GVHA 2WPDA 1E1CB 2WFLB 3VR3D 4BX8A 1J5EC 4I8DA 4LZAA 2BKUA 1R4NA 3LNVA 3KLEB 3D3JA 4F9FA 4FKZA 1LXCA 3RSSA 5JRDS 3RM3A 4C6HA 3FNRA 3UUEA 2CK3A 1B0TA 1RXUA 2W22A 3BXFA 2P65A 4CIXA 5KFDA 4YUYA 1U9IC 4I46A 5EUHA 4I68A 1E61A 1USGA 2A6MA 3DBHA 4BBYA 3CR3C 3JQ8B 1W75A 3NBUA 4D8VA 3PUYA 2H1SA 1D4AA 2O48X 3GAZA 2E9SA 2QUBA 1MTZA 4MKAA 2YZKA 5KSWB 2I4IA 1ML4A 4HGQA 3EXYA 1UQTA 1ODJA 4UQPA 3IXLA 3VR6D 2FWAA 2NUTA 4MO9A 3GFRA 3IBCA 4Y2MA 1R12A 3KB2A 3RAGA 1M83A 4PHGA 1YQGA 4Q0MA 3HI4A 1R5JA 2XMMA 1S79A 2YNIA 5K0ZA 4JGGA 5F8JA 2ZH2A 3GIRA 1U3GA 1MB2A 4G4IA 4Z99A 3BK2A 1M73E 3KETA 3ZJVA 4HPXB 4EHHA 2NREA 1CB0A 3KLBA 1Y1PA 4ZZ0A 2R6CA 3WGLA 1HQYE 2QZ4A 4HRAA 3DFFA 4REMA 1ST2A 3PKMA 3EF3A 3INRA 4RMJA 4URZR 3UI3A 4C0QC 1NXSA 4PEOA 4LSWA 4P9SA 4LIPD 4JNCA 1C81A 2FHOB 4KGDA 5TNXA 1ULBA 5D85A 4NA3A 4KQMA 2CZGA 1GAJA 2FP3A 3QEMB 1AOXA 4DJTA 4HZIA 3LBYA 1II8B 3D4JA 4JM1A 3IAHA 5KWVA 3M8ZA 4KR0A 3TZCA 4GM0A 3F74A 5A9TA 1Z6GA 3G6VA 3Q15C 1TTHB 1N3LA 1NJ1A 2PUAA 1BXNA 3ABQB 1QY7A 5B08A 4PWDB 3SX2A 2XLIA 4J9LA 1D1PA 4H4MA 5LQRA 1RTIB 1WF3A 1SEVA 3ZNPA 4M87A 1RRFA 3R3JA 4N3NA 3WNDA 4FBMA 3QVWA 1YJQA 4NJMB 3WG9A 4C2TA 3KIPA 3R1IA 3D3WA 2XYGB 1SPBP 4ME6A 5CCEA 1SCJA 1U0SY 2H1WA 2HFOA 4JT4A 4R84A 4NA2A 1SC9A 4GD3Q 4GKVA 5HRUA 1Y80A 2GN8A 1PSWA 5BUZA 5DBHX 3R5JA 3SKXA 4K1LA 2QAJA 3NX4A 5F9NA 4M0MA 1SHUX 3E9MA 3QJPA 2NXNA 1O77A 4C20A 3GOHA 1IY0A 2XNSA 2J4FA 3AETB 4M5JA 4B4UA 2P2YA 4YIHA 2R8KA 3F73A 3U7IA 1FQOA 1JIHA 4TWIA 2L19A 3AHGA 4P31A 2GFQA 3VKWA 2B9XA 4D6YA 1MU2B 1M66A 3PPIA 2A84A 2DHGA 3ISND 2DLDA 4P3NA 1OXSC 4ZVTB 1ZH2A 4ZVTA 3MTBA 2R86A 1NP7A 3W0LB 5EJFA 1FU7A 4L4RA 4K3UA 3U1NA 5JUWA 2JGKA 4I2VA 2I3GA 2MZQA 2CNWD 4JI7B 3L4BC 5H16A 3GMTA 3FFWA 4E1BA 1DJPA 1Q3TA 4NXMC 4DUZB 3O1IC 1YR2A 1OXMA 1XZPA 2AMCB 4C4YA 3JAKA 3C1UA 2J3MA 4GG1A 5AXLA 4UMDA 3FMWA 2XY6A 1R3NA 1YRXA 4ZVQB 4R16A 3NL0A 2R2GA 5DGHA 3P0EA 2W25A 2FY8A 2RE8A 5ETPA 4ZMRA 2D06A 5JAQA 4N76A 3DR5A 3MLBA 4BFSA 3CIFA 1X7ZA 4YUVA 2AC7A 4PXEA 2CDBA 4AY2A 2R6ZA 1X8KA 5DO2A 4H3KB 1I3LA 1QCCA 4DMMA 3I9V1 4DDKA 3VH1A 3AR3A 4PHCA 1F5SA 4NZNA 1UKVY 1PCAA 3X1ZA 3MM5B 4DL5A 4NKRA 2PMWA 1NSQA 5IM5A 2A9KA 1UOOA 5JEDA 5KOHB 4WFBQ 1R0AA 2EBUA 3LH5A 4V0NA 4EIWA 1PU2A 4WQMA 1H2VZ 4B8ZA 4YRLA 4DR7F 4MKFA 4J37A 1E8DA 2B94A 4F3NA 4K4SA 1SJFA 2PBRA 2CT8A 1DOAA 2JAQA 4NCNA 4TVKA 2MYFA 3U4AA 5JXJA 2FMHA 3ZVLA 5JYEA 4YDDB 1P17A 2OEJA 4IGKA 4M5GA 2PQ0A 2ZSEA 1VQ7S 3E58A 2DPXA 4XEHA 8ATCA 1U5BA 4DF3A 3CJ3A 1U98A 2EQ5A 3TCKA 4QJ5A 4JEHA 4Y6PA 1PAEX 4HWSA 2EJBA 1FK9A 4Y2YA 2FVCA 1RISA 1TQ4A 4EZ9A 1E7WA 1HO3A 2C4UA 2VJKA 1LNZA 4K4VA 3T41A 3BG5A 4RV4A 1V6SA 3EXHB 2BMEA 1YJXA 2A9VA 1XQIA 2CBXA 2DFDA 3F4KA 4NU0A 2G67A 4M94A 2C98A 2FMIA 2IZOA 4F93B 5C4GB 1UZDA 3FDXA 3DZFA 2BV3A 5COQA 2WQ6A 4DT1B 1KMHB 2VONA 4PS1A 3NAMA 4CPDA 4MAFA 4F12A 3KR0A 4HYYA 5DLQC 2ZJ3A 4OQQA 4I1UA 1SXLA 4MGZR 4B8YA 5A7GA 1S6YA 5U1PA 3A26A 3IP9A 5EUQB 3Q8WA 2NTJA 4RCZA 1OX6A 4D9IA 4EZIA 1J00A 1KAMA 3LFHA 1B4SA 4LBZA 3DNFA 3B7PA 4X7MA 2RARA 3QZUA 2AGVA 2C5HA 3GJRB 4AXXA 1TE2A 2LDYA 9LDTA 2G2ZA 3ETEA 5G41A 1TJ5A 2VJPA 1FSFA 3HYTA 3CJRA 1JLKA 1HMYA 3FPSA 4F8YA 3HPRA 3LRTA 5IMBA 1JF8A 1KEPA 3H5TA 1DGQA 1NNI1 1S2GA 3FVQA 3K96A 3IAM6 3VKGA 2PZMA 4X4OA 4O02B 3P27A 2GPJA 3BJMA 3L4JA 4N0EA 3H42A 3WK4A 4J2TA 5IOLA 1G5RA 1OPZA 1UVKA 2NU7A 3TZWA 3OPYB 2CXPA 4OMDA 4JI4J 3N3AC 1YZLA 3WQPA 3EVOA 5LU8A 1FRKA 1CIVA 1V9OA 5BNZA 1SOAA 4MIOA 2IBSA 1ENZA 3PR2B 5SYMA 2FFBA 3FFXA 2D5CA 5JCJD 2XOKA 4IFEA 1SU4A 3HCBA 1B14A 3LS2A 5IJ0B 2V50A 3H5SA 1IEVA 5HJ7A 3HBFA 5EC8A 3W8PA 4I14A 2WSBA 2JL9A 1WSBA 4JA2A 2FFAA 1VR6A 2J08A 5B58C 1MO3A 2KXHA 2QTBA 1NUTA 3FJ2A 3PWTA 3ZX5A 1E0AA 4R0VA 3ZJYA 1UBTS 3KCNA 3KG2A 4LFAF 2XZDB 3KKEA 1QR2A 4I9HA 2JLWA 5LZ8A 1SB9A 4F4YA 3R5DA 3UJ6A 5KFNA 3TQFA 4KN8A 3DCIA 2B25A 3VGTA 2XUQA 3GSDA 2P6PA 1OAOA 2X0FA 4BV2A 1SVKA 3NCQA 1AUPA 3TD9A 2B3TA 5LQCA 2P62A 4N3GA 4GRDA 1CDEA 1FWKA 5FNVF 2VSOA 1CF9A 2DNPA 1BG6A 3URMA 2PXAA 1N0VC 1VLZA 4M5DB 3C74A 1FKPB 5AM1A 3B4MA 3V8RA 1Y9ZA 3NWEA 1SBHA 3JWIA 3ANSA 3HL4A 4J16C 5A4JA 3PRJA 1N8TA 2YMLA 1WPQA 2H65B 5AI6A 3IC5A 3MM7A 5I5EA 2ZU0C 2RGUA 2EKYA 5AWFC 5K51A 5G4KB 3L6CA 1SEPA 2BHRA 2HJSA 3EVTA 2VAMA 1SZDA 1SH2A 4NG5A 1JTVA 2CXUA 1A7UA 5FYQA 1DADA 2ZWIA 4DL7A 3VTKA 1E62A 4MV6A 1FEEA 3WYDA 3FVVA 2I6UA 4YALA 3PXUA 2HF7A 1L1QA 5KDOA 1KEEB 4HGOA 5LFAA 2OPRB 4E5PA 5HATA 3JWEA 3W6UA 2WFLA 1Q77A 5GIOE 4L95C 4R9NA 1DIAA 1T9VA 4URHA 2L9WA 2I9PA 1I30A 2W6QA 2VUGA 4WN9A 1XFDA 2B5OA 1CQJA 4UM8B 3UEBA 5FTJA 4C4AA 3OCZA 1SCDA 1XXLA 1N32C 3PXBA 4D7AA 2B8TA 1E2IA 3DXFA 4DFMA 3OVBA 4ZZ2A 3CR7A 3DXYA 4EI8A 2G1JA 3N6XA 1DEHA 5DBEX 1WX1A 3K9QO 1AROP 2H57A 4ZOSA 5FYDA 3I8OA 2WKWA 2WJGA 2D5BA 4XEUA 1A5SB 2V6FA 2YXDA 2P3SA 3T3EA 5CD4A 1P5FA 1DE0A 3HKEA 4X4UA 1FDSA 1VKJA 2DHDA 2ZE7A 5EIWA 1SBIA 1NDKA 3CLHA 4QX6A 2XOXA 4RA9A 1ZUWA 1T3HA 3WNBA 4DYDA 3P3DA 3LXXA 2VOPA 4HZGA 2BH9A 2ZIGA 3H5UA 2VQ6A 3IEXA 2BY4A 3T34A 5J4KA 1QV9A 2ZSHA 5CXXA 1YJRA 1P29A 2HN9A 3IS9B 2DXEA 4AL7A 3M2UB 1QGUB 2HCBA 4OHXA 1M5OC 1NNEA 1EFCA 3U39A 5BMVA 4HNAB 2RHHA 4HQLA 4D6PA 4BQNA 2WK1A 3KM0A 1WC3A 4OHOA 1VLAA 1HDOA 2Q41A 5AKYA 3DMRA 3T6JA 5BWLA 1LFWA 3QKSB 4COOA 1XQYA 2WTUA 4I67A 1QHHA 3WX0A 5DDPC 5IU6A 4X85A 3U7FB 3TVYA 1OSCA 4A27A 1HQEA 5JH7F 3MI7X 3NEAA 1V8PA 3NIBA 3OOEA 3I31A 4FOLA 2CQ3A 5AJWA 5JJBA 1F1BA 3FNBA 1ABEA 3PACA 3FOBA 5D7BA 1FSPA 1GL9B 4HBZA 1T2UA 4OO3A 4FGUA 3KK2A 3KT3A 2NMVA 3BBCA 2F3SA 3TYXA 4M1TA 4F9GA 2KMLA 4MV1A 3OI7A 4ZO7A 1N0HA 4KU4A 5JBQA 3NAQA 1WHYA 2YKNA 2VQEC 3KK3B 1DAPA 4OM8A 1TTTA 2QXYA 3DP7A 4YRMA 2P40A 3VR4H 1PBNA 3W5XA 1KAGA 2GDJA 3QWIA 1CV2A 3LM8A 3U9SA 4IH9A 3AB4B 2ATCA 2PWAA 2PJUA 3CN7A 4PCAA 5AO9A 1RXCA 2DFTA 4OKSA 5GQSA 2C9ZA 3MCOA 3ZVRA 2CLEB 5HF8A 4Q00A 3SX4A 4WKPA 5E7IA 3KJXA 3GGOA 1FMCA 5GJWC 5ENVA 5A62A 3K4PA 3ZWPA 1G9XA 2O1WA 5E7QA 2GSDA 1EM6A 2Z2MA 2O9JA 1TMYA 1ZI6A 4YGYA 4HXYA 3WIOA 1SN7A 5JD6A 1MORA 1W581 5CYJA 2X58A 2FEAA 4FNGA 3UPUA 5EE9A 3EDQA 3ENNA 1O2DA 3ET5A 4H4DA 1NQTA 1XRQA 2R25B 4IMJB 4FCTA 3F7MA 5EWMA 3PHLA 3UBMA 4BX3A