4G1IA

Structure of the prgh periplasmic domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
189
Chain Sequence
ELDSLLGQRFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Refined Model of the Prototypical Salmonella SPI-1 T3SS Basal Body Reveals the Molecular Basis for Its Assembly.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Cell invasion
molecule keywords Protein prgH
total genus 70
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4g1iA02
3GR1A 4G1IA 4ALZA 3GR0A
chains in the Genus database with same CATH superfamily
4L2ZA 4UUXA 4GMKA 4CLSA 2KJWA 1Z2LA 2WONA 3MECA 1JJCB 4CO0A 3KLHB 3HDSA 4RUCA 4ER8A 3PZPA 1X9SA 4N7TA 4J9NA 1AXQA 4JP8A 1U1KA 3Q22A 2ROEA 5E3QA 4AQYJ 4B9NA 4DN0A 3AF5A 4LFBC 2CQCA 1SJFA 2WSFC 1HWKA 4IFYB 1F9EB 1HKAA 1S97A 4JI5J 2OPRB 2HZVA 3HKZD 4IG3A 2OO4A 1GX6A 3IG1B 3A8JA 4LBIA 1FTCA 4E8UA 5KT4A 1RWVB 2MJNA 2JDJA 4O0NA 4X64F 1U09A 2RQKA 1AT1B 2RRBA 4DXLA 5KFQA 2MLXA 2WBMA 3OPKA 1FFWB 1R0BG 3PCOB 1HNVA 3RJMB 3T6BA 2B7CB 3OJSA 3THVA 4V19J 2HFNA 4RNNA 4A8YA 5IQ6A 2X3DA 3DM2A 4NMXA 2JEFA 3D1HA 3AJ2A 3AXMA 3OXGA 5AXKA 2KM8C 2QVZX 1FRHA 2AU0A 3W9HA 4NXMF 4QWDA 3DYAA 4BHQA 4DOZA 1NK0A 4F50A 1XS3A 2FVPA 4PABA 3I07A 1X5PA 3W63A 4CYUA 2BKOA 2JOQA 2XQCA 4OZ3A 4HPVA 5DDQC 1TKZA 1TUVA 2WVCA 2VF3A 3H5SA 1QE1B 1AFIA 2IC3A 2YNHB 3M6XA 2ZBRA 2R7WA 1IBKF 1PJ5A 3ITHB 1Q7YT 3PEHA 4Y3CA 1N88A 2HLUA 5HBMA 2EBGA 4DR5F 2HNZA 4DV7C 3SQGB 5DDRC 2G2ZA 1GNKA 2QE5A 3ILOA 4DV7J 2DGTA 1M5KC 1EGAA 3MR3A 3BGUA 4F36A 2JJ4D 4IH5A 4DV3F 2XR1A 2KG1A 5HMYA 3TAQA 4DCJB 4UT4A 3FBFA 3PX4A 1T9WA 4HH1A 4QCLA 2YCBA 4PUGA 4NYOA 3J7AN 4DG9A 3VV2B 1D9DA 3AF6A 2RQ4A 2VHGA 3QO9B 4AUKA 1RT6A 3RU0A 3WZ0A 3GPCA 2HBZB 3ITHA 1ZS6A 2YKMA 2CJQA 4WWSA 5MAOA 1IBLJ 1R0CB 2K7JA 4OHWA 2DGVA 4I7FB 2V50A 4ZP9A 4ZVEA 1VEHA 3H98A 3GV5B 2Z2MA 5CZXA 5HAOA 1P27B 1PJ6A 2FIUA 4G1IA 4DFJA 1KSPA 2GX8A 2EWHA 1NXIA 3PFEA 1LV5A 4DR3C 2MCQA 4JI6C 1B0VA 1T9XA 3NCPA 2VPWB 3R9LA 4Q5VA 2QL5B 1KLMA 2ABYA 2HGLA 5GMKa 5JUMA 1NKBA 1H2VZ 2C3YA 4KE5A 3CPWR 3P5BP 4OYOA 2LEBA 3O2IA 2RU3A 3TUPA 3AD7C 2AYEA 3DHVA 2CQ3A 2E44A 2HBQB 3KXDA 3ZZOA 4O44A 4YMEA 5IC4B 2CRLA 1NJYA 3NNAA 4K4SA 3IEVA 1B64A 3A8IA 1S4FA 3C6UA 4H4KC 2BJDA 2R8JA 2R7SA 1IKWB 5U47A 1YBTA 1RAFB 3DMJB 3KUHA 1SKWA 4KYZA 4ELUA 2UXBF 2P20A 3CCWA 2FJDB 1IKYB 2YNGA 5ETMA 2HAFA 1NDLA 3CGIA 2MEWA 2O66A 5ETKA 4H4OB 1XBWA 2WB4A 5DGAA 2QA2A 3CC2S 1PG3A 2PA8D 3GE9A 2GNKA 2J5AA 3PJ9A 4J90A 4OHZA 4RNFA 4URGA 4DR1J 5LT5A 3UCZP 4YY3F 3HHEA 3M8WA 4YR0A 2NREA 3C19A 2E7XA 4NWBA 2RF2B 2B8QA 2BW2A 2YWWA 4R25A 2FHMA 4WU3A 1VQMS 4EZ9A 1N6QA 3IN5A 4JI7J 2LQ5A 2L41A 1RKIA 2BJ9A 4M5DB 2UUAJ 4KPYA 2UV8A 7FD1A 1R8PA 1YBAA 4CCHA 4W92B 4LFBF 4DCSA 3BN4A 1CULB 4Q2MA 1SC3B 5I42A 1VQ7S 2ADCA 2EPIA 2XZTB 5FD1A 2DXFA 3TR3A 4CTAB 3T5HA 1DAXA 1IUJA 4K7QA 4DUZJ 3C3LA 3BSOA 4LF8F 1HBNA 3PNIA 2DHXA 3GIRA 1CC7A 2LP4A 5B7WA 2QMXA 2VFTA 4ECZA 1TK8A 3BO2A 1CG2A 3EGZA 3V2UC 3JAMU 3MPWA 5FDLB 1NB7A 1UEVA 3LWLA 4LSLB 1C4CA 3O44A 4IQMA 3GQCA 3W9IA 2EFOA 3JSBA 4LVOP 5L46A 1GXLA 3HI9A 1I51B 3AAWB 1WC4A 2CQ4A 1URRA 4MK9A 4DFPA 4RVOA 4B3MC 3QMQA 4DCTA 3ISNC 1DTTB 3FNNA 3LGMA 4NLPA 3CW9A 2M7SA 1F9HA 4LF6J 2JH3A 3OVBA 5C5JA 1DTTA 2AP6A 3PR5B 4DFMA 2GIQA 1JJHA 4ZPCA 1XN9A 2EFVA 2C2EA 4WZMA 1JOSA 2MKKA 5BSTA 4JYAJ 3CULA 2KI2A 2VONA 3QSYB 1IQZA 3MPVA 9ATCB 3H7HB 5A76A 1HNXC 3D1QA 2W01A 3CD0A 3GLJA 5HQMA 2MB0B 1O8BA 2GAGC 1RCOB 1YJVA 4KFBB 4DR4J 1RG9A 3QT7A 3QNWB 3MI7X 2KM8B 2EFPA 2WTFA 1UVJA 5CYMB 3C6TB 2C3MA 4XPEA 3K5OA 4DV0F 1D3WA 2WRMA 4HKQA 5IV4A 3JTPA 2R2RA 4M8LA 2IDEA 2N82B 4X4PA 4IRKA 1URNA 1CS4B 4YHHC 4ISBA 2C3PA 4F0KA 1VDHA 3TX0A 1SCJB 1ML8A 2XYHB 4GC6A 2GJ2A 2G2YA 3KLEA 5I42B 3EDRB 2L9WA 2JNJA 4BWMA 4QIWD 1K9MT 3BYPA 1RT4A 5ETPA 3C15B 2DHAA 4OYWA 2DO4A 5K14A 4X4RA 3C46A 3PV8A 4K50A 5J2PA 2HQCA 2V7BA 1RADB 3GCWP 4Z37A 1EARA 4PYDA 1KQKA 5KTQA 4C8OA 2HHHC 4QIEA 4PWWA 4KHPJ 4OYZA 2CPFA 5ITHA 2RF2A 4PQUA 1NH7A 2FPHX 2VU5A 1REVA 1UWAA 4L3NA 5ETOA 1DLOB 4QR2A 3PW7A 3LAMA 2ZHOA 2FHJA 5IWAJ 4R1LA 3EZUA 3HPOA 1Q0NA 4Z7YA 3N5FA 3W60A 3KK1A 5BYRA 3EQ6A 3QYYA 2IRXA 1VQPS 4EEYA 2ZNYA 3KLVA 2X1BA 4HTIA 4RM3A 1BE4A 2YNFA 2OAUA 1UETA 1LFWA 2XWXA 1T02A 2HRYA 2OEMA 1F9FA 4R5PB 5EX0A 2AQ4A 3MCNA 2CFXA 4OYBA 1O9TA 3SIPB 1M6XA 2CNNB 3TO8A 1U1LA 3GTYX 5IM0A 3DLGB 2H4WB 1K1QA 2EC2A 2R7QA 3BGFA 3B7WA 3TZZA 5KFWA 5ETTA 1VQSA 2UUBC 4LR9A 3GIIA 5HROB 4QPXA 2B51A 1YRXA 1NCLA 4M94A 1C1CA 3FBCA 3PACA 4NZ7A 4AXJA 2WD9A 2CNOB 2E7WA 2CA9A 2F7VA 4O4GB 4X4QA 2AEJA 4P2FA 4PR6A 4F4YA 2AGQA 4B9SA 1O93A 2QSWA 2HBYB 2Z2LA 2DNZA 3BB5A 2PFDA 1NO8A 3CIMA 3QWUA 4LRAA 4MKBA 3OUYA 1UVIA 2AJ4A 5E7QA 2CXCA 4GKKC 1RT6B 4GVBA 4HHHA 3S8SA 2XNRA 3KUGA 1MMDA 3NEKA 4PG7A 4QZVB 1PAEX 5LXRA 4ZCLA 2Z8QA 2I8EA 3ZZYA 4ED0A 2R8KA 3FK4A 3BDPA 4GXQA 2VBWA 2BJEA 4Q8EA 4OI1A 3PO5A 2BKPA 2HSEB 3G8QA 3NGSA 4NEZA 4YDDB 5ADZA 2ASLA 3SQGA 3NCQA 1H2UX 1K47A 2RHQB 3HULA 3QGIA 1NKCA 1R89A 1TUGB 3OT9A 5LMUJ 1WCJA 2BJ1A 2BANA 2HWHA 4J9VA 2CPZA 1IKYA 3MCMA 1NUEA 4PG8A 4CLPA 4B3RF 1WC1A 2C1EB 3GV7B 3C5EA 2IVMA 1TKZB 4G6VB 3HVRA 2HHHF 1LQLA 4PUIA 4EMDA 2DH9A 3QFWA 4CYUB 1FJGJ 2DR9A 2Z57B 2UVWA 1FWKA 4HYKA 2EK6A 1AYEA 1RWNB 2ASYA 2CQ0A 1RHRB 2FUG9 2MZRA 3O3LA 1X4EA 4M63A 3R5AA 1VQ5S 4HT5A 3B82A 1FK9A 3MEKA 2WCXA 4IDKA 5HMXA 4WK3A 2XB2D 2GVZB 1MWQA 4HHJA 2FJEB 3KG0A 5KG7A 3GIKA 2YKMB 2AV5A 4C97A 1IKVB 3AXKA 2HG4A 2P9CA 2ZH6A 3TANA 2ZH9A 3CC4S 2I6WA 4UOGA 2OTLS 4FUQA 2AYMA 1L3UA 9RUBA 2HRTA 2OPRA 3CJ2A 5KFMA 2ZUAA 3CSKA 2F3JA 2P6TA 3M2VB 4RBTA 4Y2MA 5B0FA 2XSFA 3EVMA 5IT9U 4NLYA 2XNQA 2R7XA 1ZM9A 2WSEC 4DV2C 1JNRB 1B4SA 1X0PA 2FYXA 1PU1A 1S4EA 4DQQA 4K4UA 1Q8BA 2LCWA 3QGGA 4ZN3A 1IM4A 3PHTA 3KLHA 2G0IA 1F1BB 1HNIB 2E5IA 5IT9Y 1RHUB 3TI0A 4NRUA 4WS9A 5BSWA 3TEHB 4DI6A 1Q95G 2MYFA 2ZVIA 2KZMA 2JZ5A 3OHBA 4UOFA 4DR2F 3E7WA 2OGUA 1WEXA 3A3OB 3RGIA 1U1OA 5IFIA 3CW8X 1WG1A 2HHVA 2ROPA 1FVQA 1S7IA 3EWGA 3FZ2A 3MFHA 1NSPA 5GAGI 4DPYA 5HROA 4Q8FA 2FZKB 3PESA 3W1YC 4D3GA 4FZVA 5K8OA 4PZVA 2YWGA 2IM2A 3RB4A 4RO0A 3M8SA 2Q66A 2M5HA 1RSCA 2BJ3A 3K5NA 2LU2A 3DN9A 3D67A 5DS7A 2AW0A 2EKYA 2BZ2A 2ZOGA 4WE1A 3J80U 2FC8A 2DBBA 3ZO7A 3EYZA 5GADU 3OV7A 3UW1A 3EXYA 3OSPA 2E1CA 2VFVA 2DYAA 4ITSA 1BMQB 1G1XA 5GVQA 2IIHA 2PT7G 1U49A 1N0VC 2V4RA 2P9EA 2XMKA 2Y1LB 2DXEA 2H5JB 2C2ZB 5M2PA 4XPCA 2KL8A 2PIIA 1WKLA 1KOOA 1RWPB 3NWGA 3C8YA 2HHQA 1HD1A 3MM6B 2HHWA 2NQPA 4WZQA 4KGXB 3QFHA 3IBWA 1NM2A 3FFIA 3JTOA 4ZITA 2DIVA 3B4DA 2M8DB 2Q1LA 1XNRJ 2QW0X 3ULHA 2FJXA 5DV9A 1Z4UA 3ETCA 2B9WA 1VQ8S 1UVLA 2NXUA 5BJRA 4I9FA 1M5PC 1RAEB 1VRTB 1FFSB 1XJWB 2CWXA 3OFGA 2WOMB 4HEA9 3C15A 3HHLD 2HVDA 4AD6A 2VUGA 3PO4A 1VQNS 3CMQA 4DZ6A 1LCIA 2ZBQA 1V26A 1BHNA 3UD5A 4NLXA 1MW7A 3C14B 3C14A 2B5JB 4PXEA 3MEGA 3SQOP 3GR0A 2MQOA 2VASA 2WZ1A 1N52B 4WKRA 1GEHA 5KFLA 2CQGA 3SO4A 1YJ9S 3EGWB 4FYXB 4OV1A 1S9EA 2H5EA 2H65B 3F44A 4X62J 5CYMA 5J1EA 1VRTA 5KFCA 4RMNA 2ZD1B 2ASJA 4X62C 2CJYB 3GJTB 1O0PA 1M1HA 4K4WA 2LEPA 2HQ3A 4KFBA 5GADI 4PROC 1RTHB 3P3DA 4U8YA 1IR2A 2ZC4A 2ZFHA 2QLFB 1Q8LA 1P6TA 2YX7A 3FUYA 4PPZA 4RW4A 5IFMA 2R8HA 3Q8UA 2V8HA 4LFAC 1FUGA 4YB6A 3ZZPA 1UFWA 4D56A 2CPDA 2RVJA 5ETNA 5DLGA 2VG5B 3I87A 2BV3A 1M1KT 1RLDA 3P6YC 2D9OA 1J5EC 2HZCA 4UTGA 4L76A 4DX5A 5LMNJ 3NNHA 1RHKB 1NHVA 1S6OA 2HQFA 3RAXA 1OQ3A 1QAYA 1HIYA 5IT4A 4TQRA 4A4JA 3KTQA 4MIAA 5M2UA 2ALYB 3AHPA 4KV8B 4AL6A 3TZWA 4F3OA 3WIVA 1QVFR 2KZFA 4D4GA 4UQGA 2GHWA 1FJEB 4HDGA 4OZ0A 3TWZA 3ZTQA 3BQ2A 2MXYA 2EI5A 4K59A 3OL6A 4QYZK 2WSCC 4OHXA 3I5AA 6FD1A 2D1RA 1LWFB 2F4FA 3IEUA 4RUAA 1YRTA 4JI5C 2DR6A 1GPMA 2IAJA 4IRCA 1RHMB 1CEZA 3T5JA 3NGTA 2CJAA 1MWZA 1RLCL 1Y11A 1Y3JA 2G2OA 2ZZTA 2WW4A 1U8WA 4LF4F 4U7UK 5HLFB 4C4WA 2A2CA 4EYHB 3T5KA 3HHLB 1T3NA 2IVYA 4DG1A 4ZMMA 3Q8RB 1HW9A 1S1XA 2FHKA 1V9OA 1C4AA 3MAQA 4M5DA 4ZVPB 4FYWB 1IVZA 1SC6A 4I2QB 2HVZA 2XYGB 3IWNC 2ILZA 2YPYA 1N6QB 1T94A 3IM8A 2MQMA 3NBPA 4ZJLA 3X1LB 4PUHA 3GJQB 2FHJD 3PG9A 1PC4A 5LSRA 2GS8A 2EGTA 2LDYA 4OJ3A 3HZGA 3FMBA 1OYDA 3D4JA 1VCTA 3DRRB 4C0HA 1RU2A 3UEBA 2NLWA 2Q6BA 4JI2J 3VWSA 1UL3A 2BJ7A 4Y6IA 1KFDA 4WYLA 4KO0B 2NCLA 1IKVA 4X64C 5KOWA 4CRJA 3BYRA 2ASBA 3MR7A 4DR1F 3OTOJ 3GONA 1X4GA 2FC9A 5ETLA 1XMOC 4B3RC 4IDKB 1FFGB 3HMJG 4JV0A 5KFUA 2EFNA 3ZFVA 5J1NA 2N4CA 4JI3C 2O1PA 3P5TL 2VQEC 3MR2A 3DLBA 3CJKB 2ZM6F 4F4XA 1ZA1B 3O1LA 2VQEF 4DL3A 4FNIA 2BKNA 1KVIA 5AE2A 4KTVA 1SL2A 2Y8YA 2XS7A 1AUDA 1KWMA 3PIPQ 5HSPA 2FY1A 3L95X 3LNVA 2PEHA 2OPPA 2JFDA 2UU9F 2N3OA 2UU9J 4TXSA 5LSLA 3RBDA 2Z2YB 3R6LB 3ZZ0A 3NRBA 3QRRA 2UU9C 1NEEA 4I6AA 4OJHA 1LXJA 3I6PA 3NOGA 4I7FA 3U1LA 1HNXF 3DAYA 4ZPVR 2VPYB 5B0CA 1FD2A 2APOA 2MKJA 3DDKA 4JBCA 3VGUA 1CJKB 1S1WA 3HHDA 3M9NB 2V68A 3GZ7A 3OFFA 4PYAA 5KT6A 1U1NA 2GJFA 2MKSA 5HVGA 1NZ8A 2GIFA 1N5YB 3DRRA 3OHAA 2P6SA 1VQ4S 5HVFA 1R8HA 1OJ4A 3N4WA 4CO1A 1HA1A 3LGNA 3D1OA 3T1HF 4LFCF 2XS5A 3M8QB 3DLEB 4LF4C 3Q8PB 1SL1A 2FLLA 2YWCA 3QIPA 3IC1A 2DT9A 1WG5A 2AZ3A 3ZC4A 1HWLA 4ZKAA 2M88A 3M30B 2VFRA 4IO9Q 1HHQA 1Q8KA 5L1LA 2DPIA 1AUSL 1W2IA 2HURA 1LK5A 1RA7A 3HHLA 3R5BA 2CNLB 4DV3J 3PKMA 2J8AA 1IN0A 3N79A 3PEJA 4I2PB 5DG9A 5CCMA 3CCZA 4AXIA 2VA3A 1NSKL 5KFVA 2ATWA 1IR1A 3FCVA 4ZLLA 3BSNA 1R8BA 1VQLS 1EIYB 3L8CA 2KFYA 1RT3B 1UTAA 1WHWA 2D74B 4ZLNA 2Y4OA 3BR8A 1VJWA 1S12A 1PBAA 2M3DA 2XZWA 3O6QA 4USJC 4EFAC 1NU4A 1HQ2A 1FJ7A 2MSTA 3O8WA 1V25A 3BSCA 4ZVTB 2X1AA 1IBCB 4JI4J 4C11A 4CLZA 1JNZB 2F8MA 3D6TB 4FUTA 1RAJA 3DLGA 4X4SA 4TN2A 2D1TA 2VBYA 1UWBB 2KTQA 1L3SA 3TUIC 1Q4RA 1QUPA 2E5LC 3QLHB 5LM7E 4DSIA 2PEBA 5G0RB 4ID5B 5D15A 1ROFA 4L72B 4NXMC 1T9VA 1BGXT 3AB4B 4KH0B 1WUUA 4DR3J 2UXCC 4IG3B 3NGKA 3KK1B 2JRSA 2W2MP 4RBVA 4G1QA 5IWAF 2VG5A 5CD4H 3DCAA 2XHWA 2ZVSA 1VQYA 4LJMA 2ZH5A 1OSCA 4NXNJ 1Y00A 1EKSA 4FYDA 2EK1A 4IZ6A 1H72C 4KHPF 2KYXA 4OI0A 3H5XA 4KT0C 1ZPVA 4USUA 5GMEA 1OY9A 5H9FJ 4DX7A 2V0NA 5B09A 1O92A 3ZZUA 1NPPA 2YKAA 5KFDA 3TQ1A 4LF7J 1V60A 1OO0B 4GKKF 2KXHA 2ZKUA 4EBDA 5B0EA 4DV6C 3T9NA 1PILA 4TU7A 1TFWA 2V4JB 1EHWA 4G37A 1N36C 3VQTA 1Y5NB 2BACA 4MYUA 1VC5A 1VI7A 1B99A 3KLEB 4DUZF 1TK5A 5F3TA 2E9ZA 2B5JA 1ZM4A 4PHTA 4MIBA 3ZNJ1 2KVIA 3GG0A 4M5NA 2PDAA 5L38A 4DV3C 4LQ9A 4WIQA 5F8HA 3B78A 5D78A 3M05A 2BJ8A 2IBKA 2HAIA 3ZZRA 4X62F 4ZOSA 1U1MA 2VDHA 3C6TA 3NS5A 1SJ3P 4ZPBA 3HT0A 3CCMS 4LF4J 1B7FA 4WXOA 1NH8A 2I2YA 1W25A 1X4DA 2OMOA 1OY8A 4UOHA 1U25A 2W9AA 1GX5A 5E3AA 3G71S 3V4IA 1TKXA 1UAWA 3IM9A 2DNGA 3IXQA 4MTPA 3CW2C 4ES1A 4DV4F 1DBDA 3QAUA 1VBXA 2UUAC 2ZM6C 2VG7B 1OPIA 2W2PP 2V2ZA 2WB1D 3E8OA 3LP2B 3MM6A 4LFAF 3MEEA 4JUZA 2G13A 1YQHA 3SV3A 4DR3F 1L3VA 4JI3F 4LQ3A 1EQ0A 2WBRA 4M5MA 2XCPA 2IM1A 3MEDB 4WP9A 1VBKA 1RJJA 3NOCA 4NEYA 3DDIA 2XMUA 3GFYA 4NZ6A 3ICLA 3EGNA 3US5A 1KLNA 1V3SA 2DNOA 2ZDOA 1T9UA 3ET6A 4DDFA 4ES3A 3HSDA 4DV5J 4J9KA 2R7UA 3NGUA 4KC5A 2Z4PA 3BGLA 4PKDB 5MLCV 2G1DA 1TL5A 3KLFB 2PN2A 4PPDA 4IOCQ 2P2MA 4ES2A 3PRDA 4RX6A 1NZAA 1Q8IA 4CO2A 3PJXA 4QYZJ 4ZK7M 1QSLA 3UQSA 2C28A 2YY3A 3LGHA 1WC6A 5DQGA 1HNZJ 2O01C 1KS2A 3VAHA 4H4MB 5K8PA 4JV5F 5L9NA 1F60B 4O3PA 1RTZA 4YHHF 4EBCA 4DN9A 3I9ZA 4OHVA 2ZC3A 3MD3A 1PG4A 2OIHA 1NMEB 2QJ3A 4C3LA 4CO5A 1VQOS 1BUXA 2AZ1A 2EKNA 1WDDA 2B8PA 3P8BB 1S1VA 1RA6A 2GO9A 2NXEA 3DRYA 4L3KA 5FLXY 1T03A 2GQ2A 3ENVA 2R2UA 3OLBA 2IFXA 3C2PA 4LF7C 5E3CA 1HI8A 3QATA 3OFHA 4ED4A 4RU2A 2CJBA 3V4MA 5H1SV 3RR8A 1JLBA 4KY3A 4DL0C 4H4OA 2FJAB 1YLXA 5A6PA 3CCES 1G7CB 2K2PA 3K0JA 3N9UC 4C7QA 1MU2B 3D0HE 2VZ9A 4DR5J 3KK2B 2JFKA 1RZMA 2DNLA 4MH8A 2XYPB 4C3MA 2P2BA 5A19A 4DUYJ 4NCAA 4K4XA 5T8SA 3I5BA 2NXCA 2Y0SD 1Q16B 3FVYA 3UDLA 5JVHQ 1U0HB 1VFJA 2ZZNA 2RUSA 3G6ES 2Q6CA 3CJ5A 5F8GA 2IY5B 1JLFA 3BZQA 5BUSA 4DV4C 1BQNB 2RE1A 2E0GA 2BDPA 1U24A 2LQJA 4NLUA 4CNYA 3KLGA 1NY8A 2QA1A 2PE8A 2JX2A 2A2DA 1WTFA 3HFZB 4DMZA 5BURA 1N48A 2K8GA 1RY2A 1CC8A 3Q8SB 3SV4A 2ERRA 1QJHA 1V6HA 4QR0A 4OJ1A 4CDIA 5CABA 3H0PA 4DQSA 2B9XA 4J91A 3AB2B 3DHXA 5KT2A 1S7HA 2R3VA 3PIOQ 1M5OC 2J7KA 4Y28C 3PYFA 4QPTA 4K4TA 1CBKA 3N0VA 4PQAA 1ZH5A 1K0VA 1UJ6A 2HKEA 1HMVA 4HLBA 3VZIA 1KVJA 1TFYA 2AIRB 2LECA 5B0AA 3FBEA 4I4BA 2AD9A 4DR2J 3OXFA 4DCOB 5IS2A 2IHR1 1U7LA 2QSFA 4C3KA 1N2FA 2B43A 3SMZA 4RZRA 3NMAA 4JV5C 1Y4ZB 2O5DA 2ASDA 4UUWA 2R8IA 4DV2J 4AQYF 2OSRA 1YJWS 1RBAA 2MMAB 4KKOB 1WF2A 3K6RA 4W4MA 5A2QD 3ILJA 2V9KA 3DOKB 3OJUA 2CNKB 2XBPA 3MOZA 2J6SA 4IUFA 5K8MA 1N32F 1XHJA 3LA0A 2KT5A 3JQMA 4KHRA 1N32C 3IWLA 2ADBA 3GILA 2VOPA 4ELTA 2RNEA 1R0AB 1FLOA 3Q0AA 1IWAA 2RKIA 5F8NA 1R3NA 3EVWA 2GVDA 2CG4A 5GAHU 4M5KA 1RYRA 4C98A 3DI6B 1VYAA 1RAGB 4YUDA 2F9DA 2A10A 2FDNA 2I1RA 4Y2CA 5I3UB 4J9SA 3B4MA 5D4NA 2ROGA 3EXCX 2VJUA 1M0SA 2ZKTA 3R44A 2E7VA 4LRBA 3SBMA 3WC2A 1XRCA 2ZE2B 5CH7B 4A46A 3UNYA 1UKUA 2G1HA 2WHOA 4F4WA 1L3TA 4QU7A 2F63A 4P75A 3PDNA 4XAKA 3R97A 1FEEA 4X4TA 3DM2B 3W8GA 3HZEA 1Y5IB 3P45B 4YHHJ 1JLCA 5D0HA 5BYQA 2AHOB 3GCXP 5HP1A 1HR0F 5D3GA 4DJBA 2GQCA 4K0KF 4QIGA 3E51A 1LW2B 2BYCA 2EG2A 1F0XA 3IWXA 1FRLA 2OP5A 3PR4A 2UUCJ 2YNFB 2YH0A 2YXLA 4BWJA 5DO2A 1D8YA 1UWDA 2Y4NA 3GKUA 1M6XC 1FVSA 2VPZB 4HDHA 5KFZA 5EN1A 5BSUA 2RS2A 3LANA 2LXFA 3CCUS 4ELVA 3IAS9 3OVAA 2IJRA 3H5YA 4EI2A 2DY9A 3PYDA 1RYSA 2HEKA 1DLOA 2IRUA 1REVB 1YBUA 3UVJB 4DBQA 4IR7A 2H1YA 1F3FA 1HBOA 1RWXB 3W5YA 4YP3A 1CJUB 2XGPA 4G36A 2IVFB 1KP6A 4ZIWA 4GC7A 2QO3A 4PWUA 2WONB 3MECB 4Y34A 3VTIA 1A9NB 4M5JA 3J7Z5 4MTNA 2YX1A 5J2PB 5LJ3Y 4UZCA 3D7SB 4B9UA 3ZZZA 2FLOA 4NLSA 3TARA 2E7GA 1EAYC 2DNNA 2DKOB 2Z30B 4URQU 2DCLA 1FDNA 1WF1A 4QW9A 1S6QB 1H73A 2XO6A 4PWDA 1SC4B 4ZCIA 1T05B 1FESA 3F0NA 3BBBA 2HFOA 2YKPA 3K8VA 4KB7A 3EDQB 2YKNB 4B02A 3TAMB 1YDLA 1RTDA 4JV2A 2NXJA 4YN3B 3WIUA 2B6AB 1FRJA 1BXNA 1S0OA 3OTCA 3RBEA 2IRYA 1FKPB 5FJ4A 4RPFA 2QX0A 3EZOA 1M90T 5IT0A 1UVNA 1UFLA 2BMBA 2PI4A 1MROB 1E6YB 3LP0A 4XDDA 3W65A 5A8KB 2IA6A 1HNWJ 1H7XA 1SJQA 1WHXA 3JTNA 4OFZA 4USIA 3G6YA 1SV5A 2MZ1A 2BX6A 1JJ2R 1SUQA 1HWIA 3FJ2A 1FTRA 4Y65A 2Z58B 2Y27A 4NA3A 3TQIA 1SQFA 4M95A 4LRCA 1A0OB 1XMOJ 4JYAF 2OPLA 3A4IA 3HHKA 3CCSS 3CXCR 2R8GA 3GG1A 5E41A 2ZJPQ 1NK6A 1HHTP 2WK4A 1QAJA 1S1TA 4NLWA 4ZHRB 4MMOA 1USPA 3K17A 3M9MB 2UVRA 4GVLA 1E6VA 3Q2TC 2CUYA 4P73A 5I3PA 2WP0C 3G2XA 2A6MA 5FLXD 3GYGA 1JB0C 3OL9A 5HK4A 4B3SJ 3BF4A 4FDFA 3MCOA 1RE1B 3BS9A 2JEIA 1KOHA 4M1KA 4O0IA 1JLEA 4J9RA 3M2UA 4PZPA 3K7RA 1N0UA 1X5SA 4R8UA 1NPKA 1RT2A 2XMJA 3H5UA 3W2VA 3SYZA 4A8WA 1WC5A 4I0WA 4E98A 3CCRS 1ZTTA 2DR8A 2RIJA 4RW8B 1U4BA 4J9OA 2X1FA 4YY3C 4QJVA 2QVYX 4C2MA 4X66J 4CZCA 3UWTA 2V63A 3R5DA 2KDOA 4IFVB 4P74A 3R7SB 1FKAF 1HYSB 4QQBA 4ZJQA 1ZYQA 4HR2A 3EMTA 6AT1B 2XULA 3GFHA 3VHQA 3VAKA 4D4IA 3R9XA 3A13A 4DL7A 1RWWB 1SQEA 2DB1A 3MM5B 2GIRA 2YVSA 3NG8A 3CJ3A 3NGRA 4RW7B 5H9EK 2J8SA 2WVEA 1GXUA 3SZ2A 4LF7F 3S82A 2RRAA 2K7KA 4DR4F 3LOUA 4USVA 4J9MA 4CM0A 1QTMA 1RUSA 2FHOB 5DG8A 4KSEB 2FJWA 2CPJA 3MXHP 4NOHA 2ZOMA 1LXNA 3OR2A 3G4SS 3J81j 4ED7A 2CADA 2MM9A 4LE5A 1UCNA 2BE9B 3I82A 5KFOA 3DMJA 2B0GA 4D3HA 1N8RT 2Y8WA 3RZAA 4I9GA 2UV8G 2EC0A 1HR0C 1L5UA 2OPSA 3DLKB 2VG6A 5BR8J 3MR5A 2DR7A 5D4LA 2OPQA 3R1HA 3KDOA 3CJTA 4ZJOA 4AT1B 3BO4A 2E9TA 3DFEA 3Q2SC 2UXCF 2HPUA 3U1NA 3DGPB 3TA0A 2EW9A 3NAHA 2IMWP 4QBUA 4F02A 3HFKA 3O2EA 2AKWB 1P1TA 3KLIB 1HW8A 3T5LA 1WSVA 3NCRA 3QT5A 1YHQS 1SVDA 2XI2A 4B08A 3H4BA 4PEOA 3MUVP 1SKSA 4OZ2A 3G96A 2RHSB 2F4VC 3N28A 5F0WA 3PX6A 3K5LA 2AX1A 4XIUA 1N4LA 2ZBCA 2UXCJ 1HBMB 3MM7A 1T5HX 2W9BB 2VQEJ 1S5ZA 1WDTA 2J9DE 1UEUA 2YWKA 4WIIA 1OWXA 5H9EJ 4LR8A 3FCCA 5K20B 1NDCA 5BR8F 1LWEA 3G82A 4NCGB 4LFBJ 2HK3A 4GRSA 4QU6A 2COLA 1UW4A 1N5SA 1PBUA 4UZBA 4ED8A 5M2RA 5I4MA 2A3JA 2YQ0A 4LBPA 4WPAA 4WKYA 4ED6A 1XMQJ 5F3ZA 2ZH7A 4N76A 1TH5A 2DNYA 4L73A 1HPZA 3M32A 4OX9J 3DOLB 4DR6J 4TY8B 2HNZB 2HS0A 3QT8A 4O3SA 3TUFA 2DH8A 3MMCB 3QGHA 2PMHA 1QY7A 3FSYA 4RWXA 1SJ4P 4P2XA 1DARA 3IRXA 4YY3J 3V6DA 4JI1F 1YJUA 4DEZA 1JLAB 1QE1A 1SIWB 3IRXB 4ETXA 3R7BB 3PM9A 3J7A1 3U27A 1N5QA 4QIVA 2FB0A 4ENOA 3CB4A 1SKUB 1Q81T 3POTB 2BE7D 3OXLA 4M5IA 2B4UA 3QRQA 1KTVA 4HT7A 3V81A 5BSMA 1FRXA 1VC0A 4IRDA 4JB8B 4ECQA 4GO5X 1TZ0A 2CPIA 2DY1A 2J7WA 4MKAA 1RWKB 2RT3A 4R0EA 3QT6A 4RW6B 5FIIA 4DL4A 1SQGA 3E01B 5HMWA 2DEJA 3NLCA 2DHGA 4DSFA 1PYSB 1YZ7A 1NK4A 4XO0A 1HBMA 2D3UA 2V8DA 3MM7B 4P7VA 4RWWA 2O67A 2PMZD 4CM2A 1TV6A 5LOQA 2A6OA 2N7CA 2K1RA 3M8YA 4WFAQ 2BR0A 2J0QD 1HHSA 1R43A 1TL1B 2XSJA 3ZTPA 1T9YA 5T7LB 2F4VJ 3UX3A 4DHVA 1U6BA 3D6MB 5D4OA 1XNQC 2AJFE 1MNEA 2MZSA 1FNOA 1QUVA 1HQEA 2NYHA 3BGRA 4KGMA 5A2QY 1TL3A 4U7UD 1S99A 4IFYA 3DLPX 3DGPA 3NWRA 3CJSA 3W5XA 2QA4S 2W24A 3ZZTA 4OYAA 5DDPC 3ZTRA 3N01A 5DQHA 1D8ZA 4TYAA 3KYLA 2SXLA 1EETB 1VC6A 1OS5A 4EYIB 2CPYA 4TYBA 3FBBA 4BDPA 3N6LA 4RKUC 5T14A 1SI9A 4NRTA 1NK5A 3D9BA 2VH7A 5KYVA 4NA1A 2OD4A 1DTQB 1TVRA 4TY9A 3C66A 4KBIA 3SSSA 1TR0A 5D0EA 1X5OA 3KJVA 4V19X 5ETSA 1S10A 3PBKA 2FZGB 4NI2B 1YIJS 2FJBB 3I9V9 1KTQA 1C0UA 1DY3A 3M2RA 4WP8A 2ONFA 3NYQA 5E7OB 2C2NA 3MMAB 3K2YA 5L39A 1NHUA 3UCUP 2P8IA 2ZHBA 4TNOA 1VQ9S 4A8OA 3H2LA 1VK8A 1MXAA 2BQUA 3MM9B 2E1PA 2J76E 1Y0HA 2GGPB 2Q3PA 1RDRA 7FDRA 5DGBA 1ZETA 1MSWD 1K1SA 4DR1C 3L7PA 4KQZA 4LVNP 4Y2KA 1X9MA 1QLNA 2CXEA 2RQCA 2V69A 4DWIA 1LW0A 4B9TA 3BJYA 1FI4A 1CJVB 3L9ZA 1MMLA 3NS6A 3JYTB 1X4BA 2QA4G 2X1GA 3FEXB 2E5LJ 5K85A 5ETVA 1KFSA 3HVWA 4ZLPA 4LF6F 4W90B 2OEJA 3VNSA 1U45A 4IOAQ 2RMLA 4OZ5A 4DQIA 3KMSA 3LPEA 2ATLA 1SPBP 1K0TA 2AT1B 1UEKA 3HSJA 4YB1P 3G87A 3KJQB 1XNQJ 3R2CJ 5T8TA 2OUGA 5KFFA 3LH2S 2HS3A 2Y3YA 1L3KA 2VODA 4IO1A 3RUBL 1HQUA 4F0HA 3DNCA 4O3NA 2DD8S 2KHCA 4P2MA 3MD1A 4WTYA 3A8KA 1TKDA 3BBFA 4H54A 4N8NA 2C22A 2C42A 2OPLB 4WCEQ 3I96A 1HBUA 5RUBA 2XY6A 2CWKA 4U9RA 2LKZA 3R3TA 2HRUA 1JLGB 1TL7A 3D5MA 4DU7A 4LSZB 4DUZC 1HNZF 5KG6A 4F26A 4F4ZA 4JI3J 2E8CA 1P4EA 3I5CA 3MF5A 5DZ7A 2HS4A 1ACMB 2R42A 2FVSA 1LW0B 5DETA 4LF5C 1RAOA 1B70B 3BH7B 5C2GA 4LF5J 4O3RA 2KKHA 3T1YF 4PUOB 4ILMA 4JI7F 3DRSB 2G4BA 2QLXA 1VLYA 2GCFA 2M8HA 4J5OA 1KNZA 2L9DA 4CT9A 3UZ0A 2MHNA 1QDUB 1RK8A 1YZ6A 3LO3A 2XLJA 1RHJB 2Y1JA 3G7SA 4DR4C 4HI1A 2YQ3A 4K8RA 1RTJB 4LR7A 1B7YB 4IR1A 3I4HX 2D27A 1UJ4A 5HQ8A 2BOAA 1KONA 1N32J 4KJIA 4WFBQ 4DV6J 4KTTA 2KO1A 1P8GA 3CJRA 1D0EA 4M5GA 1UZDA 1VRUA 1ULTA 2FLPA 3RV2A 1N5VA 4HACA 3MMBB 4IR9A 2XC9A 1Y10A 2KN4A 2W7AA 4GKKJ 2CDQA 3SCKE 4RUHA 1QSSA 4XX2A 2MGZA 2KVQE 3VVUA 4EO8A 2HHXA 2E8FA 5EX3A 2JWNA 1HBOB 3SCLE 4F3MA 4TU8A 4GKJJ 1ZOTA 4TQSA 2UUCF 4K0KC 2HMIB 5GAHI 3EPGA 4NDNA 1M5VC 2K3KA 3VNRA 1FA0A 1DQAA 4USMA 3IRWP 3RB3A 4OI3A 4OMFG 2FGOA 2PROA 4NLGA 3W66A 2JVOA 3HD2A 3VVTA 5IWAC 2F4VF 1TL1A 1ZAWA 2XSJB 4U95A 2K1RB 1TMMA 3A1YG 3S7RA 1FWPA 1AW0A 5DG7A 1S6PB 5SUHA 1HI1A 2RH3A 2Q43A 4ECSA 5D3GB 1FJGC 4MFBB 3KKFA 1B3TA 5A8RA 2V8PA 2B4VA 5E0OA 3I0SB 4MIWA 3K5PA 3BKUA 2KG0A 5AXNA 1T0TV 2CPEA 2VJVA 5F8JA 5BSRA 2JLFA 3CIZA 3DKDA 1LEOA 1TTHB 2CQ2A 5CYQB 4DUYF 1CSJA 1VLOA 3TRGA 1V5VA 5C24B 4CQ1A 2LDIA 3POTA 5ETQA 2VQFJ 3PRBA 3U1MA 2X3GA 5EHHA 2C3OA 2MMYA 3AOCA 4UQTA 3TNVA 3MURP 5LMUF 1HARA 2C3UA 4PXCA 3KHGA 4ATNA 1R0AA 1NKEA 4OI2A 1PYTA 5LXYA 4KRWA 3TJ8A 3I55S 1RT1A 1ULRA 1F5CA 2UUTA 4LSNA 4JI0F 1T8EA 2VA2A 3LALA 5KT3A 2MTLA 1GFWB 4M5HA 4OZJA 1YTYA 2I5JA 3P49B 1K8AT 2HBRB 2CJKA 4DG8A 4KKOA 4CT8A 1N36F 2CYYA 1S57A 1XQIA 1KHWA 2A0FB 4RNHA 3VF0B 3TP2A 3QZ8A 2VBXA 5CYQA 4CH1A 4ODJA 4OQJA 2XO7A 4IG0B 2RU9A 2YKQA 2F8HA 3DRXA 2Y1IA 4WFXA 5KFTA 2I38A 3NPDA 1LNQA 1RWMB 4F4AA 1UP1A 3D2WA 1IM6A 3I31A 2E29A 3ONQA 4QYRA 1HMVB 2R2SA 2VDIA 3TW0A 3G6XA 2V6AA 3N6MA 3W61A 4I64A 2H54B 4ICLB 3H42A 2Z56B 2B7BB 1HI0P 1GXTA 3JSMB 4DLGA 3HVTB 3HO1A 3IS9B 1LWXA 2UUCC 4CP5A 5ETRA 3JQKA 3KLIA 4C48A 4JI5F 4D57A 4ZCKA 3HKWA 2HHHJ 3RB6A 3BBCA 3TQEA 2Y9HA 4YEAA 4C9DA 3OD2A 5HL7Q 2HMIA 2OPQB 1FRIA 1RISA 3HF5A 4I68A 4PAAA 3Q24A 4UY8T 2CJ9A 3ILIA 2VG6B 4BCAA 5C7PA 4AQYC 3A25A 2ZH4A 1NDKA 2J9CA 3IO1A 2D28C 2FLNA 2VOOA 3BQ1A 2DPLA 4YR3A 3BEGB 3MMBA 4B3TC 3H8YA 3JXOA 1DTQA 3NXZA 4FBTA 3BDEA 3OBIA 4JOUA 1VRUB 1CJTA 2HNYB 4KHMA 3THPA 2IDLA 4DR2C 4NLRA 2ZWOA 1WHYA 2P2FA 5IZHA 1R7IA 1SXLA 2LQ9A 4J9UE 4FVMA 4URSA 3EZ5A 5D8HB 5H9FK 1D09B 2OFGX 3D28A 3MTJA 1SKRA 3UO0A 1IJFB 2IYIA 3IGVA 4I6YA 1VQKS 4FXDA 1P4EC 5A8WA 1RP5A 1AROP 3CDAA 3G8TA 1X31C 3PHEA 2AYGA 5AJ3J 2D1QA 4JV5J 3RG2A 1SB6A 5EDWA 4KGZB 1NBEB 4OV6A 1PO6A 5KFGA 5D0GA 5JXSA 5D6GA 1I94J 1VS3A 3LAKA 4GXRA 3PW4A 1C0TB 2DNHA 3I0RB 3AJ1A 2XY5A 1U2CA 3MPUB 4YS2A 4LF8C 1TMJA 2UVVA 1QAXA 1G4CA 2EG1A 3AA9A 3HXMA 4FF1A 4O3QA 1R8AA 5KEIA 2QN6B 3OTBA 2IMOA 3B6BA 3LQVA 3VAFA 1U02A 1RKJA 2LXIA 2RQMA 4ID8A 4EO6A 3AD9C 3D3BJ 3QGPA 3J80Y 3RRGA 1USPB 2YWBA 2DRDA 2RRNA 1TKTB 3FSXA 5HN0A 2E66A 2KXFA 1RT5A 2NUHA 4DU8A 4B9LA 1J5OB 1FDDA 3ENQA 1WACA 1G6BA 3L3CA 2BQ3A 5L9XA 1J5EJ 1ZPWX 3MWBA 2CVIA 5C42B 5LMNC 3F41A 4Q0BB 2V2VA 4MK7A 4DV0C 2PSZA 2Q79A 3D6HB 2W2QP 4QWBA 1ELOA 3AJDA 4BC7A 2XM3A 3MR6A 4DUYC 2D9PA 3A3NB 2KDNA 4DPXA 4ZVGA 4E0DA 5D77A 1C0TA 1R31A 4W98A 3LP0B 5A8KA 1HNWF 2QFJA 3LP2A 4MYTA 2DRBA 1KQSR 4RNMA 2RDIA 5J2NB 3R2DJ 3T1YC 4Q7AA 3OVSA 2W2OP 1SC1B 1YG0A 2FTRA 3EICA 4FBUA 4OYXA 1UPMB 3W2WB 3R7NB 2D1CA 3V4IB 4X65C 2B6AA 2D1SA 5A0YB 5A0YA 2XI3A 1IBMF 2ZJQQ 3IR6B 2QFIA 2XHCA 2HWIA 4ZVUB 4MT1A 2HFVA 2N3LA 4XTTA 3VZHA 2UUAF 4OX9C 4DR6C 2P2QA 3PFOA 3C16A 4IH7A 5JVGQ 3KJFB 5C25A 1PSDA 1XR6A 3PYEA 4MKYA 5DRKA 3KJVB 3J81Y 4FS1A 1K73T 5J2MA 3MOJB 2DTJA 2D7SA 3CC7S 4B3SF 5KG2A 2BXJA 4NPOA 4FKYA 4DPOA 4F67A 3KFWX 3NYRA 4XK8C 1RHQB 3BKFA 3MTKA 2XG8A 1J5OA 4RVNA 1LWCA 2DVIA 2JL9A 2PT0A 2VPXB 2BRLA 2D41A 2ZDPA 3IAM9 3J80D 2L08A 4DSKA 3HD1A 2PN6A 1Z1ZA 3UI3A 3IFEA 4YQWA 3AH6A 5KT7A 1K0RA 2NZCA 2JMPA 4AL5A 1WEZA 4A8QA 4TPSB 1Q1KA 3IA0A 1HQEB 3BGRB 3BREA 1YITS 4JI4C 3PW5A 5JMNA 2IJFA 1QVGR 4JI4F 3IS9A 3TVYA 4UY85 3BR9A 5CZVA 3I0RA 4ID5A 2MHEA 3QLHA 4Y00A 2YWHA 3IGNA 2QYCA 3FQKA 1RAHB 1XK8A 4DFKA 1W7WA 1GAOA 1PC5A 1RT7A 2AJ1A 1S6UA 3IBCB 4JI8J 2DISA 2HW3A 5AE3A 8AT1B 2CG8A 3DOMA 2A18A 4PXDA 4CNZA 2EXUA 1B0PA 3DLLQ 1GQEA 3A26A 3MPYA 1I6JA 3K57A 1UKKA 1CPZA 1DRZA 2QMWA 2YWFA 5EWEA 2HQDA 2BJOA 1RT3A 3IPLA 2XZDB 5DZ6A 2CQIA 3HT3A 2DNRA 4EWTA 2KT3A 1A6LA 2F9JA 2RKIB 8ATCB 2XMTA 4I2PA 2AYAA 2E8EA 2HLTA 3MM8A 4QWCA 1JLAA 2OEKA 2W1BA 3PY8A 2OFHX 2ZZMA 2LFVA 3DRPB 2KZZA 1P1LA 2XEXA 2Z2ZA 3JSYA 3M30A 3MMCA 2MSSA 1KQGB 3WDOA 1NB2A 1TP7A 4IOBA 3BQ0A 3VAIA 1NJXA 3CMAS 2MJUA 5A1IA 1LQ9A 5C24A 1U1QA 3DLEA 5G4DA 1BQMA 2YNIA 1NK7A 1APSA 1BWEA 5H9UA 1EKRA 3G86A 4NLVA 4CO3A 1C1BA 1XNRC 1HNXJ 2VC1A 4C0BA 4CLKA 4ILRA 5CXTA 2NZ4A 4RJVA 3IMLA 3W62A 4PQUB 1RWOB 3G82B 4NCGA 3RW7A 4AYBD 2QC3A 2RDJA 1QSYA 1HD0A 5GAGU 4C8KA 3MHYA 2V5HG 3CCJS 3QRPA 1KHVA 3HSGA 2C2MB 3KMQA 3UNGC 1OMSA 2ZBIA 2W9BA 5T41A 2KB2A 1T95A 3TYTA 2C2KB 5HVHA 2W9CB 2W9CA 2AEMA 4DQRA 2XTJP 1BC6A 4DUTA 4QOTA 3EERA 4DV1C 3D6FB 4JI6F 4FYYB 2UP1A 3MUMP 5KFXA 2AWZA 4OZLA 2KU7A 1KRPA 3OTOC 1XERA 3FEYB 2YX4A 2HWTA 4DL2A 3OTOF 3QPIA 3CDUA 1O90A 5HJXA 1P7LA 2CVEA 5BR8C 1NNDA 1F5BA 4OI6A 3M1VB 4G1PA 4I1TA 3P4UB 1LKZA 1A7GE 2YKOA 3S6EA 2HVEA 1BQMB 1BQNA 1OYEA 2YNIB 1VIOA 2JHEA 4GKJF 1S1UA 2KYZA 2I5JB 2L3MA 2LQ8A 4ZPTR 3T19A 4LFCC 1HNWC 3UR0A 1N33F 2OBVA 1IBLC 1U8SA 3UD4P 1MDFA 1WOOA 4ANEA 1OPZA 2WVDA 1W26A 2QLBB 1TL4A 5GAEU 2AJ2A 1VHFA 3J7YU 2CIMA 4B3RJ 3MM8B 4BC9A 4B3TF 3MAAB 2E5GA 3FCWA 2F1FA 1MU2A 1DFDA 1NDPA 2R2TA 1IBMC 1XR7A 1H7WA 2VC0A 4QR1A 4USKA 2B9EA 2WVBA 1X5TA 1PCAA 5KFPA 5J2QB 3KK3B 4CLYA 1EJ7L 1Q5VA 4DR7C 2Y1RI 1S0NA 2IA0A 5DQIA 4FVCA 1MLAA 4NMLA 4DR7J 4RW7A 1QWIA 1JIHA 3UR3C 2J9DA 3D0IE 3VGTA 3GJSB 1DQ8A 2BW7A 4NZ0A 3NBPB 5KFSA 4NYPA 3DRSA 2W4CA 4CLTA 2CU6A 1XR5A 4R1MA 1S9FA 5A8RB 1S76D 2V8VA 4MFBA 4P72A 3Q8VA 2W4DA 4ZVQB 1XRBA 1KEKA 4KPCA 3M8PA 2W8LA 2NPFA 4ZVOB 1UA1A 3LW5C 2ACYA 4RW8A 1YJTA 3FEZA 2VKZG 3W8PA 3HFVA 4J7CA 2JC0A 1JLGA 1TL7B 1GT8A 2DGUA 2HGNA 2LVWA 1OIAA 3H20A 1NSAA 3GSDA 3PXGa 3OR1A 3IMQJ 1F2HA 2CQHA 3K8WA 2GMJA 3KJNB 3M2UB 3NAIA 4WFZA 3TA2A 1WKKA 2IAJB 4LT6A 5L1KA 4X4OA 4DV1J 2NSCA 1TAUA 3UX2A 2C2OB 1F2GA 1KQFB 1WI6A 4Z2XA 1HQUB 2IM0A 3Q8YA 2E5JA 1MN9A 4HH0A 1TU0B 4NE9C 1S1TB 2DGSA 3QWPA 1LWCB 5K8FA 1XTZA 4KHPC 1VK3A 2GJIA 4NCBA 1SBRA 2RILA 1M5HA 4WFYA 3M7VA 4DV1F 5EWFA 1JKHA 2RJZA 1DZ5A 1FXLA 2BABA 5J2MB 3LNOA 2H3EB 1U2RA 4FXVA 1FKOB 2VB6A 4RW9B 5E3PA 4HL9A 1MD9A 1FE4A 4BSZA 2W4PA 1HL6A 3M6WA 4E2FB 2GO8A 3DLHA 3SDEB 4JI1J 2RUGA 2DJWA 1KKHA 1X4AA 1FXRA 2DR5A 4LUBA 3CDEA 4R0MA 3JS9A 2XWYA 2UXDF 1PJ7A 2A1BA 3OTDA 1X60A 3QSIA 4Z7CA 4WTOB 2UXDC 2GQQA 1HWJA 1JK9B 1ZBTA 1ZAVA 1FCAA 1M5SA 2Z0GA 3Q89A 2GGPA 4P71A 2QYGA 2ZD1A 3RAMA 3TAMA 3W2WA 4EU0A 1ZZNA 1WG4A 2HQGA 2P2CB 4C6AA 2C2RA 1RACB 2RSQA 4OLOA 4Y2IA 5J2NA 1U48A 1HNZC 5KG3A 2EEYA 2QL9B 4TLQA 4DL6A 5K8NA 1JQGA 1NHKL 1JXVA 3VGSA 3ZXWA 1FKOA 4RW9A 1XNRF 1MXBA 2QV6A 3TDEA 5KFAA 2Z51A 4DCVA 2BQRA 4A8SA 4LF6C 4Q0BA 1JKHB 1AFJA 4ZDNA 2NUUG 2WOMA 3CQ2A 5KYTA 3L09A 4NXNC 2MDAA 4OYCA 2BEFA 2QG9B 4RUBA 4DPTA 3UOWA 1R6VA 1RT5B 2E5HA 2MZTA 1WH9A 4JYAC 4ED1A 1QM9A 1H6KX 3I08A 2PO4A 3PVXA 2AJQA 3HVAA 5F0UA 3D3CJ 1XNQF 4WV3A 4K0KJ 3TVKA 1I5OB 4F3QA 1HWUA 3RAQA 2FJVA 2M5OA 1S72S 5D4PA 3A9UA 3OR1B 2KT2A 5FDLA 3BN7A 1FXDA 1ZAXA 1U0SA 4OX6A 1SH2A 1HH2P 2E5LF 5T7LA 3FDSA 3UDEA 2GHPA 4FP9A 3JYTA 1BQXA 2HFZA 3UPFA 3X3UA 1LW2A 1P9QC 3EE3A 1N56A 5IC6B 2PD1A 2RAQA 2HNDB 2R7VA 4ED5A 2R4FA 2E9RX 4CIOA 1FHTA 1H3DA 1FX2A 1GMVA 1REGX 2OLWA 2QVXX 2H48B 4C11B 1WTBA 4OXIA 3E01A 1ZM3A 1VOMA 4DZDA 1I1GA 1X9WA 2OKQA 2V9WA 4JI7C 4CLWA 2V4QA 2CZVC 3T6JA 2VSQA 3MM9A 1X7VA 4U5YD 2M0GB 1VLAA 1T9TA 3AFGA 4EZ6A 1AZSB 2BM0A 3KG4A 4DR7F 2IM3A 3H2TA 2DEIA 4ZS6A 2DPJA 1VBYA 3KK3A 2R9LA 3T41A 4FPRA 3GWCA 3TA1A 5J2QA 3GB0A 2V2KA 4DLEA 1Q82T 3EGVA 4MH4A 2BRKA 3GYXB 5CHCB 4X4NA 3KXWA 3HK2A 1WSRA 1NK8A 4IKAA 2QL7B 1S1UB 3M32B 1HPZB 3K58A 2KZ0A 4USHA 3CUNA 2B4PA 3G9CA 2UUBJ 4S0MA 5KFEA 4LF9C 3GFXA 3W7BA 4LRFA 4WU2A 1T5DX 1XMBA 3A8EA 4GO7X 4DSLA 2JLEA 3SCJE 4TKTA 2M9KA 3VALA 1N5YA 3VAJA 4RL1A 1B0TA 2MZJA 3FGVA 1ZTWA 1U1PA 1S1WB 1S0VA 2V34A 3JSMA 1GMWD 1N34C 1W2BR 1CVJA 5KAKA 2YBVA 4EK2A 3DU6A 3RBXA 4MAKA 2G0JA 4NX9A 3TR5A 3BSAA 1RAAB 3IP0A 4JV1A 3ADAC 4OYIA 4Q44A 2W7OA 3RRKA 3FZBA 2OPPB 1WOPA 1FJGF 4L7IA 5IT9D 1SIZA 3CJEA 2ALZA 4RU9A 2DNMA 4NLQA 4DCPB 4IG0A 2P02A 1H0HB 1Q78A 1VQ6S 1JWWA 4M5LA 4FYVB 2HQIA 3PRVA 1ZM2A 3Q86A 4DX6A 3KLGB 4ANDA 4DF8A 1X4CA 2M70A 4ECUA 3CJKA 2ZUGA 2ZM6J 4FF4A 2KFZA 2DHMA 3ZTSA 2C2DA 3H25A 1FNMA 3KG1A 2OPSB 1VHIA 2GHVC 4YDXA 1DURA 1RGVA 1WC0A 5HQLA 1HLWA 2FY8A 4LSNB 3ZTOA 3K5MA 3O5TB 1YX2A 3PW0A 1N33C 3H2VE 3QZ7A 3J81D 3TUZC 1S49A 3V6DB 4KO0A 4I67A 4QWAA 3L7UA 3OR2B 4JI8C 1WI8A 3MPDA 5DM7Q 3BO3A 2OH2A 4OX9F 5AE1A 4DR6F 1IXKA 2H5IB 3R27A 3T1HJ 1VR6A 1T3OA 4X65J 1QAIA 4JI0J 1AZSA 1QTNB 4ECVA 2EFQA 4UW2A 1YVFA 3CCQS 4RR5A 5DDOC 5KT5A 3MM5A 4IYQA 1VMBA 4FN5A 4U96A 3E2EA 2BH1X 2VFSA 3AQOA 1S1VB 3DOMB 4I2QA 4GVBB 4JI8F 1FRMA 3UN3A 4OYMA 2VQFF 4K4ZA 5GAEI 1HYSA 1RT7B 2FVCA 4P7TA 2FVRA 1JX4A 1RABB 1AMUA 2HNDA 3OUYB 1S6PA 3ENWA 4X66F 3GIMA 3V6KA 4OX8A 4PG6A 5CAAA 2EBEA 1GTEA 1M1GA 2DITA 4AE5A 4YFUA 4Y2AA 2ZEJA 3HLUA 4NASA 4FNHA 4ECWA 1RT2B 3W2VB 2NSBA 3FQLA 3QJPA 1FEHA 3R5JB 1SH3A 1VGYA 4KAIA 3AOAA 1OSDA 4J9QA 5HJYA 3RYLA 1DQ9A 3U7JA 3D66A 2JEJA 3E7XA 1PA4A 3KHRA 5BSVA 3BGOP 1YKWA 4ZHRA 2HHSA 3A4TA 3QBCA 3DLKA 1QD1A 2HIYA 1K44A 3VCDA 4N56A 1FNXH 1JXLA 2QEXS 4B3MF 3FCEA 4K0BA 1Q7LB 4LFAJ 4F4KA 2PGCA 2UZAA 1MN7A 3ET6B 4HACB 4P9SA 5JJBA 2VFUA 2AEFA 4JI2C 2JLGA 1FERA 1SUQB 3LTOA 1G3OA 1H98A 2F8EX 4ZJZA 5C25B 3TUJC 3NY0A 3C16B 1JJ4A 4PCQA 4P2SA 4BBYA 1MROA 1RTJA 1NLKL 2VG7A 1FO1A 2DGQA 2GAHC 3T3FA 3DGVA 2V8GA 3TEGA 1I94F 3OQ2A 8RUCA 1TK0A 2D69A 3CJ4A 3B54A 4G3IA 1R6YA 4JI0C 3LPYA 5KFJA 2NS1B 5AJ3F 2OI2A 4DV6F 1O51A 2YKNA 5GTDA 1TUWA 2GV1A 4RLQA 4HTJA 4DV0J 3M6VA 2P2JA 1RT4B 3GMGA 5LJ5Y 3CJQA 1UVMA 3SDEA 4PWDB 1RBOB 2M4MA 3MEGB 1H74A 1SL0A 3Q23A 1V3RA 2IBOA 3QJJA 1G2EA 4L4QA 2MKCA 3GU0A 2IYGA 5F41A 4R8UB 5EWGA 2OHDA 6FDRA 3T1YJ 1JLEB 3H4DA 1T7PA 2OJ3A 2BUNA 4NXNF 1N34F 2W7PA 1KVKA 3S01A 5HMZA 2XLKA 1F3VA 2H9ZA 1E6VB 1V3ZA 4HVZA 1TKTA 1N54B 4A8XA 1CJUA 4U6PA 4WXWA 4EUVA 1KC8T 3NI2A 3FFIB 3GYNA 2V94A 3QAEA 3PYGA 1U47A 5HATA 4ECXA 2HHTA 2HZAA 2ZH2A 1Q86T 2UXBJ 3CD5A 5KG4A 1WELA 4G1QB 1SJ1A 2POKA 2IJNA 2M52A 1FJCA 1WF3A 4RLEA 1Q53A 2CPHA 3VGVA 5LMNF 3N2QA 2ATCB 4DX8H 2RDDA 4K4YA 5FLXU 2J0XA 2MKHA 2VICA 3V6HA 3AODA 3PTWA 4FPIA 3M8PB 4ZIVA 3CD6S 4ZPWR 4U8VA 4ECRA 4ZPAA 4WE1B 1YI2S 4X4UA 2MZQA 3CEDA 5LSOA 4LREA 3ETOA 4ZVSB 1Y9OA 5CQGA 1NYEA 4U7CA 2VIHA 1RTDB 3WHIA 2L9NA 5A8WB 4Q43A 2J6UA 1IQTA 3PROC 1SJRA 4OHYA 1D9FA 3KUEA 1HBNB 2L48A 2N7YA 2YTCA 3A3PB 3ENAA 1JXEA 4RBUA 3V5RA 3G8SA 2CQ1A 4ANCA 4G65A 1RWUA 4CTAA 5F9LA 1RBLA 1FDBA 2LLZA 2RD5C 2W25A 3M2RB 3F73A 1TAQA 1V5IB 2GVDB 2ILYA 1CJTB 1J2VA 1UJ5A 2HNYA 1CULA 3GJRB 3H90A 2MLZA 3N6NA 3MAAA 3T9ZA 5BXIA 4P10A 1TVRB 3J7ZT 4F2RA 2B3TB 4OL8A 4YOEA 4C8LA 2OTJS 4KGVB 4F25A 4C8NA 1UMJA 4ZVRB 3UN5A 2CY1A 1HNIA 3SI8A 2J6TA 3FRZA 3MUTP 1X0FA 3TX8A 4WF9Q 1YJNS 4RLFA 3RBZA 1WC3A 2EVZA 2VV5A 4NOZA 1EQMA 3UVJA 1P9YA 4NLOA 1D9AA 2LYVA 2OMLA 3M1VA 2LU1A 4N77A 4PRFA 5F9NA 3GPAA 1TL3B 1XMQC 1OQ6A 4CH0S 2M5YA 3KNGA 4CI0B 1RQ0A 3J81U 2DH7A 1S59A 2BBEA 4B17A 4CWBA 3G6VA 3CDBA 3SCIE 4A8KA 3HVTA 3VAGA 2YNGB 1HFEL 2J9EA 4A47A 5HO4A 3OL8A 2FQQB 3UFCX 1MG7A 2HVHA 1IKWA 1TV6B 4KR0B 2WW8A 3C6UB 4ZP7A 3CCVS 1YJ7A 2XMWA 5HP1B 1PG5B 1UVKA 3BV8A 2GA7A 3HHLC 4TU9A 2PMWA 2G0CA 3MCSA 5GMDA 4Q45A 4A8FA 4RW6A 4LF1A 4L75A 3ZNUA 2ZE2A 3MFIA 1VISA 5J1PA 1KLMB 1ZA2B 3V6JA 4K4VA 3NNCA 1C1BB 4TLRA 5EGYA 1KBRA 5I3UA 3V81B 1I94C 3CJ0A 2CZ9A 1JLFB 2XMMA 2PA3A 2V2QA 3DI6A 4C0OC 2DCUB 1NAQA 5DJBA 4O3OA 2DNQA 4X64J 1KN6A 3RTVA 1L2FA 1QM4A 5JRHA 4DCUA 1RT1B 2JVRA 2MLYA 3DRPA 4AFFA 1Y3KA 2UUWA 2CDRB 1AA1B 3TOQA 4X84A 3DC2A 3R6GB 4R0JA 4DV7F 2BANB 3AOBA 3GFZA 3UCGA 2BVZA 3DOKA 3DXSX 5HI7A 3CQ3A 1NRKA 2ZWPA 3DOLA 3W64A 4OIXA 1JLBB 5L1IA 2YWEA 4Q2LA 3MDFA 2CZ4A 5KG0A 4A48A 2E1MC 5B0DA 5B0GA 4CLUA 4DV2F 5B0BA 4ECTA 4KTQA 2R7TA 1U6FA 3DLJA 2CAJA 1WORA 4ZP8A 4ZP6A 4DS4A 3LAXA 3RRHA 4BLGA 4FS2A 1C2PA 3AT1B 4B3SC 2X51A 1WD6A 2W8KA 2P9GA 1ICEB 3I0SA 3JAMY 1T03B 5KFBA 4FF2A 3MMJA 2DYJA 3R9WA 2AX0A 4MJKA 2QZ8A 2FZCB 2H4YB 1S1XB 2CQBA 4ZN1A 3KOAA 1CQNA 4NXMJ 4DG1B 4B9VA 2IC3B 2V67A 2YNHA 4N8OA 5A2QU 3EX7B 2F65A 4DPUA 1MXCA 3HM9A 4O4GA 1BD6A 2Y0BB 1GK8A 5KFNA 1CLFA 4CLLA 4X66C 5AT1B 2XMAA 4DSEA 4ECYA 1PIEA 3TJ9A 1C1CB 2QT7A 4JI6J 4H4MA 5KG1A 1FX4A 2DNKA 2J0SD 2NXNA 2UVUA 4DF4A 2HGMA 3MGJA 1WEYA 2ZBPA 4LRDA 5E3RA 2QMUB 3LWMA 2MQ8A 5LL6d 4MK8A 2PFFB 1MMNA 4ZA1A 5D0RA 5F8IA 2K06A 2O3DA 3FC9A 5IM0B 2MGZB 1U0HA 1IB8A 1SH0A 1Q5YA 2MQPA 1FRKA 2P5VA 1XRAA 1HNVB 1X8DA 4WP3A 2VBZA 1EB0A 4N47A 3KK2A 2HFUA 2NCKL 3Q8QB 2VKRA 5CCLA 3FSIA 4P52A 2ACMA 1BWVA 2BA9A 1U26A 2HIQA 2LXUA 3BPSP 3D54A 3MEEB 4CO4A 3LGXA 1MWYA 3D0GE 4F8RA 2GC8A 5LCIA 4ZLJA 2DXDA 1Q79A 2AYBA 2HHPA 4PG5A 4OYPA 1S79A 2QLWA 4DV4J 4WK1A 2JEGA 4ED3A 1DHMA 1WKJA 4X4VA 2DIUA 1FWLA 2PC6A 3DXBA 3Q83A 3NP5A 4LIRA 1O6XA 1YSJA 2UXDJ 1ZB9A 2OELA 3M8ZA 4PUOA 5J1EB 3TZYA 2KFNA 3VQSA 4IFVA 4FF3A 1S9EB 3RG6A 1RTIA 2B9YA 4OJGA 1KR4A 3GIJA 4ED2A 2NYIA 2DGXA 4WYWA 3TJAA 4PXBA 2B56A 3S1TA 4MKVA 3M9OB 4EATA 3BH6B 3CF5Q 1IBMJ 2J7UA 4EBEA 3EVOA 1CS4A 4LF9F 4ETZA 4QIFA 3E3XA 2ZJRQ 4OX7A 1UW9A 1BY9A 1HBUB 3I32A 4ZVFA 5C42A 5CD4A 1NJZA 4OZ1A 3L4BC 1IR0A 3JAMD 2QGFB 1KD1T 3RW6A 2CQPA 1R8CA 1RB0A 3DHWC 2ZH8A 1NJWA 2OD6A 4P6QA 2FGCA 2XY7A 3KHLA 3R1LA 4DS5A 2CJXB 5KFIA 4DV5F 3DDNA 1RCXB 2MY7A 3MAHA 2XCAA 2YH1A 4F04B 2RS8A 2CKWA 2VD3A 4CH7A 5CYJA 2ZH1A 1J5EF 4JM1A 4ZCMA 3IR7B 3K89A 4N5SA 4LMZA 3BM7A 2BM1A 1Y7PA 3HCXA 4HI2A 3MEDA 2LMIA 4QWEA 1KKGA 5G0RA 3SEOA 2DHHA 1E6YA 3W5ZA 4ALZA 1ZZFA 3B8HA 3DU5A 5THWA 3U02A 4DPWA 3GV8B 2XS2A 1FE0A 3QJLA 1UWBA 3SFUA 2VZEA 1I3OB 4GKJC 4KGKA 2GZOA 4IH6A 1GH8A 2JC1A 4LSLA 3FMWA 3ILLA 3CMES 3CCTA 3UDVA 2YQ1A 1VRQC 3TZXA 3SXLA 1EZZB 1XIQA 1T05A 2MQNA 4V1Ak 1TQLA 3AD8C 3ETMA 3JB9k 4RM2A 5KG5A 4DL5A 1XWLA 3CNQP 1C0UB 5IQQA 3PKYA 2FD2A 2E1AA 2U1AA 1ITPA 5KFHA 4BS2A 4B3TJ 3PJWA 1Z2ZA 4K5RA 1IWGA 1UPPA 1BLUA 4XDCA 5KFYA 3VAMA 1JLQA 5E2QA 2HHUA 3THTA 4X2BA 2MQLA 1VIXA 2W2NP 2XMVA 3CD7A 3WC0A 4JI1C 3QIPB 5K9FA 1EETA 4Y0FA 4C8YA 2QTWA 1S48A 4ERDA 2K3IA 1YWXA 1EX8A 3M8QA 3KHHA 5A1GA 3H2UB 4LFCJ 4FTFA 2JNVA 1XMQF 1S9GA 1JMTA 1VJQA 3UE2A 3GP9A 3OW2R 2QLJB 3M2VA 4B3MJ 3EM1A 1RI7A 3HHNB 5KOXA 3CE8A 1UFKA 2F5GA 3M6UA 2I9SA 1VBZA 2AF6A 4OLPA 5AXMA 4NYZA 4WBFA 3M8RA 4F7VA 2AGPA 1WJ9A 3LP1B 4ICLA 2QRRA 2KHDA 2ZNZA 2GVZA 5I3QA 1RXOB 1FK9B 1JLCB 1GTHA 4O44B 3H40A 3VR1A 3IR5B 2YPZA 3CCLS 4O23A 2DO0A 1NSQA 2HK2A 4FXWA 4B3OB 1LOUA 3LF0A 1X4FA 2CQDA 3NS7B 1EP4B 2MKYA 2XGQA 4I6WA 1Y5LB 3BKTA 3AQPA 3F56A 4J37A 3NMRA 5CA5A 3FKBA 1PGZA 1NK9A 3CDWA 3HX9A 4OI4A 3ELHA 1D1UA 1DJ0A 2DRAA 3UN2A 5IXUA 3EPIA 3EUNA 1FDAA 2DNPA 3NL0A 1MKYA 5LMUC 3M4XA 2KXNB 4ZVHA 2H51B 1WHVA 1PKUA 4HHUA 4NLDA 1FF2A 1MDBA 3CTRA 4DR5C 3P96A 4X65F 4N41A 4NLTA 3KWMA 3QO9A 2J0WA 1OY6A 5K5MA 5B08A 4WFNQ 4TY8A 2ZITA 2D3OR 4DSJA 3FRYA 1IJEB 3OFEA 2KH9A 2D3O1 1X4HA 5HANA 3T1HC 2LEAA 2ZOFA 3K59A 2MPUA 1RAIB 4UF4A 3FCHA 5E5NA 1LWEB 3SSRA 1H38A 1YRUA 3WBZA 4K5SA 4CLFA 3OSNA 1YJRA 3JSRA 5IOLA 2FVQA 1CJKA 3PW2A 1KDNA 2DGOA 2GW8A 4PG4A 5BYSA 5HBMB 5L1JA 3J7YI 2VQFC 1WWHA 3KNAA 3SSQA 2KJVA 1XEZA 4ILLA 4DV5C 3QQCD 5KFKA 2HJGA 4AL7A 2KRBA 3SFGA 4LF2A 4I69A 3HSZA 3R5GA 3CO9A 1CQMA 2B4OA 1GMWA 3DYAB 5L8RC 4IQXA 4EGLA 4KIAA 1YGYA 2NPIA 1TELA 4C8MA 1WNEA 1EP4A 1J27A 3CQ1A 2M2BA 2MKIA 1S77D 4B3OA 1S0MA 3MZIA 4A8MP 2UXBC 1U6ZA 2QIFA 4K2JA 2GMLA 2JSXA 2CPXA 2KRRA 4R5PA 3NGDA 1IBLF 2HYIB 2UUBF 3LUSA 3LP1A 1XC9A 2DGWA 4USWA 3HJFA 3CJ8A 1N36J 4JI2F 4LIWA 2D7VA 3CO0P 1LK7A 1WOSA 2U2FA 3H59A 3IG1A 3W9JA 2F40A 2DK2A 5AXLA 2GMHA 4B9MA 1RU1A 1AB8A 1S9GB 2MY8A 5F8MA 1U1RA 2WVFA 1PAUB 4OZNA 4O4RA 2AGOA 3VNQA 4RW4B 3W3SA 5A6WA 1F5AA 3WX4A 4FKXA 4QW8A 2G9OA 5DM6Q 1IBKC 1ZB8A 1JLQB 1IKXB 1PYOB 3D68A 3R5CA 4L6V3 5K14B 3CVKA 1IBKJ 5F8LA 3GR1A 5EUHA 2AJ0A 5HLFA 3ISND 3CT9A 3A12A 1UA0A 5SZTA 3WQPA 5DLFA 2AMCB 2WAQD 3UD3P 3OTEA 3PX0A 5C2CA 4J9LA 4GS5A 1U2FA 1N33J 2HVIA 1LFPA 4I56A 4F0MA 2OSQA 1LWFA 2BE2A 2ZHAA 4RNOA 3N5BA 3R8YA 1N5TA 3N54B 4LBHA 4U67Q 3KLFA 3T1AA 3RR7A 2QL8A 2RB7A 1O5JA 2MQQA 1XMOF 5IV3A 3KDNA 4YB7A 4KV8A 1NJIT 1H2TZ 2ZH3A 2DHSA 4USTA 3CWJA 4KH1B 1SV5B 4H4KA 2EFGA 2LA6A 4YB5A 4NL5A 2N4DA 3RB0A 3A9VA 3WX8A 3I56S 5E33A 1CJVA 1BA3A 4LF8J 3BPDA 2XLIA 4K2XA 1T11A 3QIDA 5KFRA 3ISZA 1HR0J 2LQBA 1TKXB 4L74A 1FKPA 1FD8A 4WJBA 4LF9J 2X7IA 2R7OA 3TAPA 1RTHA 3HJVA 2BOPA 3AA8A 2R7RA 1GMUA 3I4PA 3LUYA 2BE2B 3L7OA 3UDCA 3OL7A 4UOCA 4ZPDA 2PI5A 2I0XA 1N34J 2VL1A 3TVZA 1F6TA 3MMAA 1NPRA 5BUQA 3OLAA 4NA2A 1S6QA 7AT1B 2NR0A 4DQPA 4TVAB 2D3ZA 4NI2A 4J9PA 2HFSA 2GFFA 3JQJA 3AY0A 1UZHA 4LF5F 4YR2A 3HP6A 4F2SA 2LA4A 4C8ZA 3IBFB 2E1RA 1WF0A 1R27B 1FT8A 2V4JA 1RTIB 1YK9A 1IKXA 3EJMA 3GSIA 3NKYA 2IPOB
chains in the Genus database with same CATH topology
4L2ZA 4UUXA 4GMKA 2KJWA 1Z2LA 2WONA 3MECA 3KLHB 4CO0A 3PZPA 3HDSA 4RUCA 1X9SA 4J9NA 1AXQA 1U1KA 3Q22A 2ROEA 5E3QA 4B9NA 3AF5A 4DN0A 4LFBC 2CQCA 1SJFA 2WSFC 1HWKA 4IFYB 1S97A 2OPRB 3HKZD 4IG3A 2OO4A 1GX6A 3IG1B 4X64F 3LWLA 1FTCA 4E8UA 5KT4A 2MJNA 2JDJA 1U09A 2RQKA 2RRBA 5KFQA 2WBMA 3OPKA 3T6BA 1HNVA 3OJSA 2B7CB 3THVA 4V19J 2HFNA 4RNNA 4A8YA 5IQ6A 3DM2A 2JEFA 3D1HA 3AJ2A 3OXGA 5AXKA 2KM8C 2QVZX 1FRHA 2AU0A 4NXMF 4QWDA 3DYAA 4BHQA 4DOZA 1NK0A 4F50A 2FVPA 3I07A 1X5PA 2JOQA 4HPVA 5DDQC 1TKZA 1TUVA 3H5SA 1QE1B 1AFIA 2IC3A 2YNHB 3M6XA 1IBKF 2R7WA 3ITHB 1Q7YT 3PEHA 4Y3CA 1N88A 2HLUA 5HBMA 2EBGA 4DR5F 2HNZA 4DV7C 3SQGB 5DDRC 2QE5A 1GNKA 1M5KC 1EGAA 2DGTA 3MR3A 3BGUA 2XR1A 2JJ4D 4IH5A 4DV3F 3TAQA 5HMYA 4D57A 3PX4A 2YCBA 4HH1A 4QCLA 4NYOA 4DG9A 1D9DA 3AF6A 2RQ4A 3QO9B 4AUKA 1RT6A 3RU0A 3WZ0A 3GPCA 3ITHA 2YKMA 2CJQA 5MAOA 2K7JA 4OHWA 2DGVA 4I7FB 4ZP9A 4ZVEA 3H98A 3GV5B 2Z2MA 5CZXA 1P27B 2FIUA 4G1IA 4DFJA 1KSPA 2GX8A 2EWHA 3PFEA 1LV5A 4DR3C 4JI6C 1B0VA 3NCPA 2VPWB 4Q5VA 1NKBA 5F8JA 1KLMA 2ABYA 2HGLA 5GMKa 5JUMA 1H2VZ 2C3YA 4KE5A 3CPWR 2LEBA 3O2IA 2RU3A 2AYEA 3DHVA 2CQ3A 2E44A 3NNAA 3ZZOA 4O44A 4YMEA 1NJYA 2CRLA 4K4SA 3IEVA 1B64A 1S4FA 3C6UA 4H4KC 2BJDA 2R8JA 2R7SA 1IKWB 5U47A 1SKWA 3DMJB 4ELUA 2UXBF 2P20A 3CCWA 2FJDB 1IKYB 2YNGA 3CGIA 2O66A 4H4OB 1XBWA 2WB4A 5DGAA 2QA2A 3CC2S 1PG3A 2PA8D 3GE9A 2GNKA 2J5AA 4OHZA 4RNFA 4URGA 3UCZP 5LT5A 4YY3F 3HHEA 4YR0A 2NREA 2E7XA 4NWBA 2RF2B 4WU3A 2BW2A 1VQMS 4R25A 2FHMA 4EZ9A 4PQUB 1N6QA 3IN5A 2LQ5A 2L41A 1RKIA 4M5DB 2UV8A 7FD1A 1R8PA 1YBAA 4CCHA 4W92B 4LFBF 4DCSA 3BN4A 4Q2MA 5I42A 1VQ7S 2ADCA 2EPIA 5FD1A 4CTAB 3T5HA 1DAXA 1IUJA 3C3LA 3BSOA 4LF8F 1HBNA 3PNIA 2DHXA 1CC7A 5B7WA 2QMXA 2VFTA 4ECZA 1TK8A 3BO2A 1CG2A 3EGZA 3V2UC 3MPWA 1NB7A 1UEVA 4LSLB 1C4CA 3O44A 4IQMA 3GQCA 2EFOA 3JSBA 4LVOP 1GXLA 3HI9A 3AAWB 4RVOA 2CQ4A 1URRA 4MK9A 4DFPA 4B3MC 3QMQA 4DCTA 3ISNC 1DTTB 3FNNA 3LGMA 4NLPA 3CW9A 2M7SA 2JH3A 3OVBA 5C5JA 1DTTA 2AP6A 3PR5B 4DFMA 2GIQA 1JJHA 4ZPCA 1XN9A 2EFVA 2C2EA 4WZMA 1JOSA 2MKKA 5BSTA 3CULA 2KI2A 2VONA 1IQZA 3MPVA 1HNXC 3D1QA 3CD0A 2MB0B 1O8BA 1YJVA 4KFBB 1RG9A 2WTFA 3MI7X 2KM8B 2EFPA 1UVJA 5CYMB 3C6TB 2C3MA 4XPEA 3K5OA 4DV0F 1D3WA 2WRMA 4HKQA 3JTPA 2R2RA 4M8LA 2N82B 1URNA 4X4PA 4IRKA 4YHHC 4ISBA 2C3PA 1ML8A 4GC6A 2GJ2A 3KLEA 5I42B 1K9MT 2L9WA 4BWMA 4QIWD 1RT4A 2DHAA 5K14A 2DO4A 4X4RA 3C46A 4K50A 3PV8A 5J2PA 2V7BA 4Z37A 1KQKA 5KTQA 2HHHC 4C8OA 4QIEA 5ITHA 2CPFA 2RF2A 4PQUA 1NH7A 2FPHX 1REVA 4L3NA 1DLOB 4QR2A 3PW7A 3LAMA 2ZHOA 2FHJA 4R1LA 3EZUA 3HPOA 3KK1A 3N5FA 5BYRA 3QYYA 2IRXA 1VQPS 4EEYA 2ZNYA 3KLVA 2X1BA 4HTIA 4RM3A 2YNFA 2OAUA 1UETA 1LFWA 2XWXA 1T02A 2HRYA 4R5PB 1F9FA 2AQ4A 5EX0A 2CFXA 3TO8A 1U1LA 5IM0A 3DLGB 1K1QA 3BGFA 2R7QA 3B7WA 5KFWA 1VQSA 2UUBC 3GIIA 5HROB 4QPXA 2B51A 1YRXA 4M94A 1C1CA 3PACA 4NZ7A 4AXJA 2WD9A 2E7WA 2F7VA 4O4GB 4X4QA 4F4YA 2AGQA 4PR6A 4B9SA 1O93A 2QSWA 2Z2LA 3BB5A 2DNZA 5EHHA 3CIMA 1NO8A 3QWUA 4MKBA 3OUYA 1UVIA 5E7QA 4GKKC 2AJ4A 2CXCA 1RT6B 3S8SA 2XNRA 1MMDA 4PG7A 4QZVB 5LXRA 4ZCLA 2Z8QA 2I8EA 3ZZYA 4ED0A 2R8KA 3BDPA 4GXQA 2VBWA 2BJEA 4Q8EA 4OI1A 3PO5A 5ADZA 3G8QA 4YDDB 2ASLA 3SQGA 3NCQA 1H2UX 3QGIA 1NKCA 1R89A 2BANA 2HWHA 2CPZA 1IKYA 4PG8A 4B3RF 3GV7B 3C5EA 2IVMA 1TKZB 4G6VB 3HVRA 2HHHF 1LQLA 2DH9A 2DR9A 2UVWA 4HYKA 2EK6A 2CQ0A 2ASYA 2FUG9 2MZRA 3O3LA 1X4EA 4M63A 3R5AA 1VQ5S 4HT5A 3B82A 1FK9A 3MEKA 2WCXA 4IDKA 5HMXA 4WK3A 2XB2D 4HHJA 2FJEB 3KG0A 5KG7A 3GIKA 2YKMB 2AV5A 4C97A 1IKVB 2ZH6A 2HG4A 2P9CA 3TANA 3CC4S 2ZH9A 2OTLS 4FUQA 2AYMA 1L3UA 2OPRA 3CJ2A 5KFMA 3CSKA 3M2VB 2F3JA 2P6TA 4RBTA 4Y2MA 5B0FA 2XSFA 4NLYA 2XNQA 4DV2C 1ZM9A 2WSEC 1JNRB 1X0PA 4DQQA 4K4UA 1Q8BA 2LCWA 3QGGA 1IM4A 3KLHA 1HNIB 2E5IA 5IT9Y 3TI0A 4NRUA 5BSWA 2MYFA 2KZMA 2JZ5A 3OHBA 4DR2F 3E7WA 1WEXA 1U1OA 5IFIA 3CW8X 1WG1A 2HHVA 2ROPA 1FVQA 3FZ2A 3MFHA 5GAGI 5HROA 4Q8FA 3PESA 4D3GA 4FZVA 5K8OA 2YWGA 2IM2A 3RB4A 2Q66A 3M8SA 3K5NA 2LU2A 3DN9A 5DS7A 2AW0A 2EKYA 2BZ2A 2ZOGA 4WE1A 3EYZA 2FC8A 2DBBA 3OSPA 5GADU 3OV7A 1G1XA 3EXYA 4PHTA 2E1CA 2VFVA 4ITSA 5GVQA 2PT7G 1U49A 1N0VC 2V4RA 2P9EA 2XMKA 4XPCA 5M2PA 2PIIA 1KOOA 3NWGA 3C8YA 2HHQA 1HD1A 3MM6B 2HHWA 2NQPA 4WZQA 3IBWA 2M8DB 3FFIA 3JTOA 2DIVA 3B4DA 2Q1LA 3ULHA 2FJXA 5DV9A 1Z4UA 2B9WA 1VQ8S 1UVLA 2NXUA 5BJRA 4I9FA 1M5PC 1VRTB 3OFGA 2WOMB 3HHLD 2VUGA 3PO4A 1VQNS 1LCIA 1V26A 4NLXA 1MW7A 4PXEA 2ZH5A 2B5JB 2MQOA 3MEGA 3V6JA 3GR0A 4WKRA 2VASA 1N52B 5KFLA 2CQGA 3SO4A 1YJ9S 3EGWB 4OV1A 1S9EA 2H5EA 3F44A 5CYMA 5J1EA 1VRTA 5KFCA 4RMNA 2ZD1B 2ASJA 4X62C 1O0PA 4K4WA 2LEPA 2HQ3A 4KFBA 5GADI 4PROC 1RTHB 3P3DA 2ZFHA 2ZC4A 4RW4A 2YX7A 1Q8LA 1P6TA 5IFMA 3KYLA 4PPZA 1HNZF 2R8HA 4LFAC 2V8HA 1FUGA 4YB6A 3ZZPA 1UFWA 4D56A 2CPDA 2RVJA 5DLGA 2VG5B 3I87A 2BV3A 1M1KT 3P6YC 2D9OA 1J5EC 2HZCA 3NNHA 1NHVA 1S6OA 3RAXA 1OQ3A 1QAYA 5IT4A 3KTQA 4TQRA 4A4JA 4MIAA 5M2UA 3AHPA 1QVFR 4KV8B 4AL6A 4F3OA 2KZFA 4D4GA 4UQGA 2GHWA 1FJEB 4HDGA 4OZ0A 3BQ2A 2MXYA 2EI5A 4K59A 3OL6A 2WSCC 4OHXA 3I5AA 6FD1A 2D1RA 1LWFB 3IEUA 4RUAA 1YRTA 4JI5C 1GPMA 2IAJA 4IRCA 1CEZA 3T5JA 2CJAA 1MWZA 1Y3JA 4LF4F 4U7UK 5HLFB 4C4WA 2A2CA 4EYHB 3T5KA 3HHLB 1T3NA 2IVYA 4DG1A 3Q8RB 1HW9A 1S1XA 2FHKA 1V9OA 1C4AA 3MAQA 4M5DA 1SC6A 4I2QB 2HVZA 3IWNC 2ILZA 1N6QB 1T94A 2MQMA 3NBPA 3X1LB 5LSRA 2FHJD 2EGTA 1PC4A 2LDYA 4OJ3A 3HZGA 3FMBA 3DRRB 4C0HA 2NLWA 2Q6BA 3VWSA 1UL3A 4Y6IA 1KFDA 4WYLA 4KO0B 4X64C 1IKVA 5KOWA 2ASBA 4DR1F 4B3RC 1X4GA 2FC9A 1XMOC 4IDKB 3HMJG 4JV0A 5KFUA 2EFNA 3ZFVA 5J1NA 2N4CA 4JI3C 2O1PA 3P5TL 2VQEC 3MR2A 3DLBA 3CJKB 2ZM6F 4F4XA 2VQEF 3O1LA 4DL3A 4FNIA 4KTVA 5AE2A 1SL2A 2XS7A 1AUDA 2FY1A 3PIPQ 3L95X 3LNVA 2PEHA 2OPPA 2JFDA 2UU9F 2N3OA 4TXSA 5LSLA 3RBDA 3ZZ0A 3NRBA 2UU9C 1NEEA 4I6AA 4OJHA 1LXJA 3I6PA 4I7FA 3U1LA 1HNXF 3DAYA 4ZPVR 2VPYB 5B0CA 1FD2A 2APOA 3DDKA 2MKJA 4JBCA 3M9NB 1KVIA 1S1WA 3HHDA 3GZ7A 3OFFA 5KT6A 2MKSA 1N5YB 3DRRA 3OHAA 2P6SA 1VQ4S 1R8HA 3N4WA 4CO1A 1HA1A 3LGNA 3D1OA 3T1HF 4LFCF 2XS5A 3M8QB 3DLEB 4LF4C 3Q8PB 1SL1A 2FLLA 2YWCA 3QIPA 3IC1A 2DT9A 1WG5A 3ZC4A 1HWLA 4ZKAA 2M88A 3M30B 2VFRA 4IO9Q 5L1LA 2DPIA 1W2IA 1LK5A 1RA7A 3HHLA 3R5BA 3PKMA 2J8AA 1IN0A 3N79A 3PEJA 4I2PB 5DG9A 5CCMA 3CCZA 4AXIA 2VA3A 5KFVA 2ATWA