4G1IA

Structure of the prgh periplasmic domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
189
Chain Sequence
ELDSLLGQRFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Refined Model of the Prototypical Salmonella SPI-1 T3SS Basal Body Reveals the Molecular Basis for Its Assembly.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Cell invasion
molecule keywords Protein prgH
total genus 70
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4g1iA02
4G1IA 3GR1A 3GR0A 4ALZA
chains in the Genus database with same CATH superfamily
3S1TA 1U49A 5A2QD 3FEXB 2JLGA 4DS5A 1MWZA 1F60B 1O90A 3GE9A 1IM4A 3GPCA 2WAQD 1CULA 3OFHA 2DGUA 1MMDA 1X9WA 2ATLA 2OTLS 2RF2B 4WTOB 2R4FA 2YBVA 3BPDA 2MMAB 2QV6A 4B3MF 3TA1A 3W7BA 2H3EB 3DLKA 5D4PA 2PIIA 1Z1ZA 2VFUA 2HQIA 3VAKA 4ZCMA 4O4RA 3TQEA 4J9LA 4Y0FA 1EIYB 3TI0A 1ZTTA 1HBMB 3ZNUA 4MH4A 2M7SA 3LP0B 3LAKA 3MUVP 2VJVA 3GG1A 2AYEA 2QLJB 2VOPA 4ZVTB 3MM5B 4FBTA 1G6BA 1D3WA 2V8PA 2HGLA 3FBCA 1HR0J 2ZDOA 3HSJA 1DFDA 2EGTA 3ADAC 4KH0B 5A2QU 4ZVEA 4B02A 3BBCA 2Y0BB 3EVMA 4I2QA 1WC6A 4DL0C 3DLEB 2ZOFA 2PA8D 4GC6A 2X3DA 3ISND 1IN0A 4FNHA 5LMUJ 2ASLA 1IKYA 5MLCV 4DR3C 1RTZA 2PEBA 4DR3F 4LJMA 2ERRA 4HKQA 2KZMA 1NRKA 3GFZA 3MMCB 2JEJA 1X60A 4XDDA 3JSRA 3HXMA 1TAUA 1FLOA 1UFKA 2IM0A 4KTTA 2IHR1 1CQNA 2CIMA 4K0KC 4C98A 3H98A 3VAIA 2HQ3A 4P2FA 3J7ZT 3PNIA 3KDNA 4ZCLA 2ZNYA 5E3PA 3VQTA 3W64A 4B3TJ 1F2HA 2DH8A 3D7SB 3RGIA 2W7PA 3UD3P 1TK0A 5FD1A 4K4TA 4DR7C 1S9GA 2FDNA 4BC9A 1CQMA 1OSCA 4F3MA 3M2UB 2HKEA 4C2MA 3OTOJ 1RT7B 3GJTB 1YITS 1R0AB 5B0FA 1JMTA 4KC5A 1LNQA 1TVRB 3FCHA 8ATCB 1SKSA 3C6UB 2E8EA 4F25A 4A8MP 1VQLS 2OAUA 2HFNA 3QSIA 4Y2KA 5LCIA 3K7RA 4GO7X 1JLCB 4ECVA 3BH6B 2DRDA 2G2YA 4MAKA 5KFYA 4E8UA 3Q23A 3BO3A 1NJXA 4C3MA 3PX6A 2XS7A 3C19A 2R2SA 4D3GA 3H90A 4O3RA 4JV5J 2F40A 3LF0A 1LXNA 3M8WA 5KG1A 3W2VA 1VJWA 3VTIA 4URGA 5CD4A 2YY3A 2YKMA 2E5LJ 2IM1A 4NYZA 4ISBA 1S49A 3GV8B 3V81B 4IO1A 6FDRA 1GH8A 1GTEA 3DRRB 2D1QA 1N33C 2YWHA 2GVDB 4URSA 2E5LF 5M2RA 2I5JB 2FLLA 1YDLA 2YX7A 2KFNA 2E1PA 2FVPA 3PRBA 4GRSA 2HHUA 1B70B 3N6MA 2Y4OA 2APOA 2GMHA 4NLDA 1QJHA 5HATA 4BS2A 2COLA 1F1BB 3HM9A 1SQGA 2C2ZB 3MEKA 1N33F 1RP5A 1Q1KA 2E5HA 4R8UB 3UPFA 2PT0A 1FO1A 5L1KA 4IDKB 4PKDB 3FRZA 3HD2A 1VQ7S 2GHWA 3KJQB 3W9HA 3CTRA 4PZVA 4OJHA 3V2UC 3TO8A 3MM5A 1OIAA 4IQMA 4JV2A 3PESA 5D3GB 4NZ0A 2ZZTA 1VRTA 1WDDA 2PO4A 2CQIA 4DX8H 2AGQA 1C2PA 4M1KA 2X7IA 3IP0A 5ETSA 2FY8A 2YWFA 4MIAA 3SDEA 3ZZOA 4ZLNA 4TU7A 2VQEF 1YRTA 4I9FA 3IEUA 3FQLA 4UZBA 2D1TA 3SEOA 4RLFA 3IA0A 4OI2A 3H2TA 1FI4A 3HZEA 1JLBB 4OYXA 1RHQB 3QRPA 1YWXA 2QW0X 5GVQA 3CJ3A 4K0BA 4LRDA 1UZHA 2JFDA 1WF0A 1WORA 1YG0A 2I1RA 1D9AA 3OR1A 3CCVS 2DGXA 2JLFA 2W2NP 3EDRB 3HULA 2KRRA 2V9KA 2ZVSA 3IBCB 1S1TB 5FDLB 5T7LA 4JI3C 3US5A 4MKYA 3G82A 2F3JA 3L7PA 1WDTA 2DIVA 2MKHA 1UMJA 1FKPA 2BOAA 1EX8A 1HR0C 2HVEA 3M8ZA 5A0YA 3HFKA 4WWSA 1XR7A 3NXZA 2VOOA 4QYZK 4RL1A 4F0MA 4G37A 4DV0F 3CO0P 1NAQA 3RZAA 1LWEB 5AXNA 1HYSB 2MTLA 4RVOA 4IH6A 1RSCA 3MR2A 4D56A 4RO0A 3F41A 1BD6A 5KFZA 1YJ9S 1Y3JA 3R97A 4A8OA 3N79A 3TRGA 4ZHRB 4TNOA 2AJ2A 3MGJA 5LMNF 4K4WA 5J2QB 1S10A 3KLGB 2YKNA 2QLFB 4KFBB 3VGUA 4DPTA 1P4EA 5JVHQ 1C0UA 1FD2A 2BH1X 2DNHA 5FLXY 1RA7A 2Z2YB 3R3TA 3SSSA 1H3DA 4CWBA 4AT1B 4ZLJA 5KFWA 3HHEA 3NNCA 4LSLB 3AXMA 3ZTQA 3TZZA 5H9FK 4OV1A 2HHHF 2MQPA 3VAGA 1HHTP 4DR1C 3LGNA 4XIUA 2EFQA 4LF8J 1MWYA 1NH7A 2OH2A 1W2BR 2OBVA 2EFOA 1IBCB 5DM7Q 2AEFA 3LW5C 4X65C 3M8RA 4OYOA 2GNKA 2OKQA 1SC1B 5D4NA 5D0HA 3DXBA 4UT4A 4WPAA 5HN0A 2DR5A 1UW4A 2CDRB 4IOCQ 4OL8A 3NYQA 3K5NA 2C2DA 2ZHAA 2PN6A 2CNLB 1IKWA 2X3GA 3QFHA 1D0EA 3HO1A 1RUSA 4RBTA 1JLBA 2V69A 3UNGC 2OPRB 1J5EF 1GMVA 2MEWA 2DXFA 4ZLLA 5D4LA 4FF1A 2P5VA 3Q22A 1ZS6A 2MLZA 4DV1F 4EYHB 3CSKA 3BGFA 1SJ3P 1VBZA 3SDEB 3P49B 4YY3C 2L9WA 1N54B 2HRUA 3UDLA 3PW2A 2WP0C 2ZM6C 4P74A 4I67A 3ILIA 4KB7A 4RUAA 1P9YA 2POKA 4I7FB 1Q8LA 4ZVRB 4DBQA 1IBMJ 3C8YA 1VLAA 5E3AA 3L8CA 2OPSA 3X3UA 4EEYA 1U8SA 2DGVA 4KBIA 1T7PA 1U02A 2IAJA 3HD1A 5AE1A 1V9OA 4J9VA 2BQ3A 5D77A 4CM2A 1JJCB 2BE2B 4IR1A 2E66A 2B4UA 2NCLA 3GONA 3W63A 3ZO7A 4C97A 5T41A 1OPIA 2W2MP 3GQCA 1ZYQA 2UXBJ 4A48A 2ZE2A 4KFBA 3EPGA 2HQDA 3TUJC 2WK4A 2UVUA 1QAYA 2KN4A 2R7VA 2OTJS 2DHGA 2QL9B 1MROA 3KWMA 1X9MA 4ELTA 1R43A 3H25A 4W92B 2BJDA 2HBYB 3IS9B 3OHBA 3M30B 1OQ3A 2XMKA 4I69A 4XPEA 3DGPA 1VGYA 1SKWA 1GXTA 1I3OB 3HP6A 2DYAA 4NI2A 4Y65A 2QVXX 2ZH8A 3MFIA 3FBFA 1XMOC 2GIFA 4NA2A 1U2CA 1XNQJ 4HI2A 3VAJA 4HPVA 2RUGA 2JWNA 2F8HA 2BYCA 3MEGA 2DXEA 4P73A 1N2FA 5CD4H 2UUCF 4LFCJ 5C25B 5CYJA 1NK0A 1OY8A 3CJRA 2F4VC 1XMOF 2CPIA 2MGZA 4NLOA 4ZK7M 2MY8A 2CJXB 5JVGQ 1N36F 2MKKA 1S4FA 1Q8BA 2V8VA 5EUHA 4Z7YA 5K8OA 5KG0A 2DEIA 1RHRB 1OQ6A 2EC0A 2JMPA 1TKXB 2ZBPA 2MHEA 2C28A 2QFIA 3QJJA 3OBIA 3EVOA 4YFUA 3BO2A 3L7UA 3I0RA 1CJVB 2HAFA 2VG7B 2K8GA 3KUHA 5E2QA 3Q0AA 1YQHA 2CFXA 2CQDA 2K3KA 5J2NB 1YTYA 2QEXS 3MR5A 4DV7J 1VHIA 1NDKA 3A3PB 4OX6A 2CA9A 2HNYA 1QVGR 4AL7A 2HZVA 5KEIA 2ZZNA 3KG0A 4PABA 4FYDA 4J9RA 3MCMA 3H5UA 4HTJA 1U1RA 2CZ4A 1T3NA 2FZGB 3GV7B 3E7XA 2AZ3A 3OVAA 1MD9A 1P7LA 5DZ6A 1VIXA 3M32A 3OHAA 2HAIA 3KXDA 1NXIA 2M52A 2BANB 2ZH3A 4A8SA 4DPYA 2DPJA 4EZ6A 2HWHA 3ETOA 1U1KA 2XS5A 4F0KA 2OHDA 3H2UB 3ICLA 2W4CA 5L8RC 4CM0A 3PKYA 2ZBRA 2QA4G 2J6TA 1YIJS 2ROGA 1T9XA 5HK4A 4LFAJ 4CT9A 5IWAC 2ZITA 4JOUA 5T8SA 1ZM3A 3FBBA 2QSFA 2ASJA 3W8GA 1T95A 2E7VA 3SCKE 1J5EJ 1AA1B 1Q78A 3W1YC 1JJ4A 2LQ8A 4D4IA 3J81D 1CC7A 3AODA 3BN4A 4BCAA 2DXDA 4R1MA 3I82A 4ED6A 4OHYA 2BJOA 4ZJZA 4TVAB 1KVIA 1TUVA 2RDIA 3DLGA 4JI0F 5ETKA 4DUZC 5CAAA 2W9CA 4X62F 3KYLA 1Q82T 2W8KA 1S1VA 3H8YA 4O3OA 1EHWA 3TJ8A 3SSRA 4DR4J 2VV5A 3QIPB 1GT8A 3PM9A 1ULRA 3R5CA 4LF5F 3C6UA 3DGPB 1PU1A 3A26A 2YNGB 2FB0A 4PXEA 2BW7A 1JLGA 1I1GA 1IJFB 1NHVA 2IVMA 1RCXB 3KOAA 2AWZA 4OFZA 4ZVGA 4OIXA 1D8ZA 1P8GA 5HO4A 5HROB 3CC2S 1PJ6A 4USVA 3K6RA 2E9ZA 2E8FA 3PO5A 2ROPA 2YWEA 1VQ6S 2V6AA 4K5SA 2MLYA 1FJGJ 2PFFB 2CZVC 3AD8C 5D4OA 1YSJA 1X5TA 4DCPB 1CC8A 1OPZA 4EK2A 5IV4A 4X66F 1WELA 3CUNA 3HHLC 2BRLA 2LEBA 5E3CA 5K8FA 5A76A 4B3SC 3C14B 4KH1B 2KXHA 1KKHA 1EGAA 4NLSA 3MDFA 5BR8F 4USIA 2ILYA 4DI6A 1FESA 4ZKAA 5KFHA 2XMUA 2V9WA 1ACMB 2C2NA 4NRTA 1RAGB 3K0JA 1WH9A 1U2FA 4XTTA 5LXRA 4TY9A 3DHXA 1RBAA 5L1IA 5J2MA 1QAIA 4RNMA 1VISA 1VDHA 4IOBA 4ITSA 2JHEA 3EZOA 3FZBA 1KQGB 4HLBA 4ECTA 4USUA 2LCWA 2GVZB 1IBMC 3DM2A 2NYIA 2WVEA 3F56A 3AFGA 4RX6A 5IXUA 2W8LA 1AZSA 2HSEB 2EEYA 3CCJS 3SO4A 4UOCA 2YQ0A 2NXJA 3D28A 5KOWA 4JYAJ 5HMYA 4PRFA 4D4GA 4DZDA 2O1PA 5KFSA 5KFNA 2UUCC 2D7VA 2VASA 4AD6A 4HL9A 1V3ZA 4PYDA 1C1CA 4B3SJ 4LFCC 2LECA 4MIWA 1AW0A 2RKIA 3A13A 3DN9A 3QIDA 1TELA 2DBBA 4OZ0A 1YJTA 1XMQJ 1QAJA 3WIVA 2LQBA 5GAHI 2XLKA 5A8KB 2ZH5A 3A8IA 1L5UA 4QOTA 2RF2A 4WJBA 4ANDA 4OI4A 5DLGA 1U1NA 2DGWA 3MAAB 1LWFA 4LSNB 3NGTA 3TARA 2HWIA 5AXLA 1AUDA 2M8DB 5BUSA 2LXFA 2UUCJ 4LFCF 1L3VA 2UUAF 3MURP 3M8QB 4TXSA 2EC2A 4TLRA 3PV8A 4KO0A 3N9UC 4JI2F 1KLNA 4JI0J 3AOCA 4PG6A 3QSYB 1IR2A 4ID5B 2UXBC 3D1OA 4MIBA 3UNYA 5J2QA 4ECUA 4NCBA 3AB4B 5LJ5Y 3DOKA 1N6QB 3ILJA 3QATA 4LBHA 2ADBA 3IM8A 2OUGA 3MR7A 4C7QA 4TLQA 5KFLA 1QSLA 1HPZB 4DV5J 1FKPB 4WF9Q 1LWEA 5K9FA 5I3QA 2HURA 3TUZC 1HYSA 4IH7A 4WYLA 2FTRA 3B6BA 4I64A 2AJ0A 5I3PA 5J1EB 4Q44A 3QGHA 1RWPB 4KRWA 3CD7A 2KJWA 5FLXU 3GKUA 4B3TC 4O3NA 3N5BA 2MY7A 4L76A 4QR1A 1LEOA 4HH1A 3PZPA 4JI1F 5DJBA 2X1BA 2R2RA 2KI2A 5ITHA 1XJWB 3OR1B 3NEKA 4I6AA 1CVJA 4HYKA 3R7SB 4WKYA 5H9UA 3KLHA 5M2UA 1DRZA 2L9DA 1R0CB 2A1BA 5EX3A 3M8YA 1KEKA 1QUVA 1JWWA 2B7BB 5BSUA 3RAMA 4ED0A 2HJGA 3KLVA 3NCRA 4EI2A 1BWVA 1Q0NA 4KE5A 3U27A 1NHKL 4JI4C 2GVZA 3KNGA 1CJKA 3I4PA 5A2QY 2XY7A 2LQJA 3SCJE 1HWIA 1JLEB 1UWAA 4KGZB 3TNVA 2ZM6F 3R5DA 4RWXA 4U8YA 2IJFA 3BF4A 2RS8A 3ENAA 1DAXA 4FPIA 4OZNA 1ZPWX 1WC1A 4RBUA 1Q95G 1RT2B 3D0HE 5E33A 4CLFA 1VFJA 5IWAJ 5AJ3J 1M6XA 4O4GB 1T94A 2MZTA 1H2UX 3QGGA 5LM7E 3BQ1A 2D28C 4LF5C 2MPUA 3QZ7A 2HMIB 2AF6A 3EICA 2BJ7A 1S6QB 3JXOA 3Q8YA 4X4RA 1NJWA 1DQ9A 3Q8PB 1M1KT 4IKAA 1HI1A 2ZH7A 1OO0B 4CP5A 1R8BA 3AHPA 4FF3A 1IBKF 1FUGA 2XULA 2FJAB 4ZDNA 5T14A 1Q7LB 2QLWA 4P72A 2XHWA 1Q8KA 2NXCA 3G6XA 4DV2F 1E6YA 2C3YA 2WBMA 3CCES 1U45A 2OPLA 2DGQA 1URRA 2FVQA 1S0VA 2WTFA 2CQPA 4DR5J 4JI3F 1ZZFA 2H54B 2MGZB 3FBEA 4O44B 1FE0A 3CDWA 3IBFB 4UW2A 2C2EA 1U1OA 4NASA 2VC1A 3DRPB 4QPTA 3K5PA 3QQCD 1RBLA 2QGFB 1DBDA 1TK8A 4JI3J 2CPHA 2CNKB 3W5ZA 4RW8A 2RUSA 3UVJA 1Q5YA 1RT7A 1H74A 3KLFA 1YJRA 2B56A 2BABA 2EFGA 3CNQP 4M5IA 3T6BA 3TVKA 3UCGA 2QE5A 4DOZA 1S6UA 5AE3A 1Q53A 2QX0A 3K5MA 3M2VA 2QT7A 1CJUA 3TAQA 1EAYC 1ITPA 1IVZA 4DR6C 4ZIVA 5IM0A 2GC8A 3M30A 3O2IA 1K1QA 1DY3A 1F9EB 4NYOA 4RWWA 3MM8B 5BJRA 5HL7Q 4WFNQ 3AF6A 5E3QA 3FCEA 4LQ9A 5A8WB 1S6QA 2UUAC 3KG1A 3L3CA 1Q86T 4B3RC 4DV6C 4AQYF 1U0HB 3H42A 1ZTWA 1XMOJ 1S9GB 2KJVA 5IQ6A 3CMES 3HJFA 3FEYB 2O5DA 1LWCA 3S6EA 3RAQA 2RU3A 1D8YA 3IM9A 2YCBA 4RW7B 1RWXB 2HZCA 2V2VA 4Q2LA 4XK8C 2Z0GA 4LT6A 4JM1A 1EKSA 1RTIB 2YNIB 1KOOA 2LXUA 2NSCA 4QYRA 2DGTA 1JK9B 3MEDB 4I2QB 3CVKA 3VWSA 2Z51A 1KOHA 2DO0A 5CYQB 1NK4A 4B9NA 2UXCF 5A8RA 3LWMA 2XNRA 1JXLA 3QJPA 1EQ0A 2H9ZA 2DNOA 1SJFA 1IKYB 4NXMF 1ELOA 1JJ2R 1CJVA 5HBMA 2BKPA 1FNMA 4QPXA 1NPRA 3VF0B 2J8AA 3HKWA 2KL8A 4ZVFA 1HQEA 2ZJRQ 1N33J 1SI9A 2LQ5A 2QA1A 1FFWB 2J0WA 1ZM2A 3HFVA 3QMQA 4KY3A 5IM0B 3SYZA 3UQSA 4DCVA 2YNHA 1BE4A 1NJIT 3K8VA 3KLEA 3DLKB 3BSOA 3NWRA 4RU2A 5HQMA 3MI7X 5AE2A 3WIUA 3IR6B 4N8OA 2R7WA 1CS4A 1M5VC 1O92A 4DWIA 4LR9A 1XK8A 2GAGC 4BBYA 2DHMA 1X0PA 3NGSA 1CULB 4U95A 3R6LB 4WFBQ 4FTFA 2F4FA 4OX7A 2HVZA 1M5SA 2B9EA 3DDKA 2CVIA 3M2VB 3LNVA 1UVNA 2Y1RI 3CIZA 4YHHJ 2VQEJ 2HBZB 3PW0A 3HFZB 1N88A 4KR0B 4D57A 3CJ0A 4WU2A 3S7RA 1WHVA 1YGYA 2J9DE 3KLFB 1RTHB 2VG5B 4ECZA 4OZJA 4OHWA 7FDRA 2A6MA 2OD6A 2MSTA 1SH0A 1KS2A 2ZBQA 3IAS9 1S6PA 1FRIA 3BN7A 1Q79A 3B4DA 3CT9A 5D15A 2CJ9A 2XZWA 3HHKA 3NS7B 4N8NA 3Q8UA 4RW4B 3PEHA 5C5JA 4ED3A 1RBOB 3OVSA 5F9NA 5A6WA 4GVBA 1TK5A 1XN9A 4CLTA 5A0YB 3EZ5A 1FX2A 3GCWP 1TH5A 3I9ZA 3L4BC 4K4XA 3KUEA 3QJLA 2MLXA 4B3TF 2HHPA 2QLXA 2DNKA 4IQXA 1HL6A 2QL7B 1BHNA 1YK9A 2HBRB 3EGVA 2XI2A 3GB0A 4FKXA 4K59A 4TU9A 3MAAA 1LQ9A 4LSNA 4ENOA 1Z2LA 2IMOA 2D41A 4M5JA 2E5IA 2P2BA 3BR9A 3GSDA 4EWTA 1UWBB 4ZJQA 5KT3A 4RMNA 1Y5LB 2R42A 3G71S 4OX9F 1BQXA 2MKIA 1C1CB 4I2PB 3UR0A 3SXLA 4G1QA 5IFMA 4BWMA 1SIWB 2V0NA 1SJ1A 3PHTA 4KKOB 3E01A 2ASBA 2OEMA 3BR8A 4ILRA 4LRCA 3V4MA 1ZM4A 2OLWA 2RQMA 5I4MA 2M5YA 3EXCX 2RQKA 1T9YA 4LSZB 3AA9A 2UUTA 5CYQA 1XNRJ 4RZRA 1S9EB 3W9IA 1S57A 2OD4A 3Q86A 1T02A 1KFDA 3GFXA 3QBCA 4X4UA 5KFOA 1UWDA 3TR3A 4B9VA 3X1LB 2KHCA 2MQLA 5C42B 1PAEX 1XR6A 1IBLC 2C3MA 4USJC 3HJVA 3PROC 4NCAA 4DU7A 1LXJA 3M8PA 1FFGB 2LA4A 3CJKA 1J27A 2Y1JA 2VG6B 1P9QC 2DNLA 2R7XA 2LDIA 1WCJA 1G7CB 2QN6B 2XZDB 3NGUA 1EQMA 3RUBL 2R7TA 1IWAA 3EGNA 1N8RT 3PYFA 2QL5B 2DD8S 4JI8J 4YEAA 2IBKA 3TZXA 2GJ2A 3D0IE 4KT0C 2MZ1A 2GGPB 3TX0A 2BR0A 4CNYA 2FJXA 2XG8A 3T1AA 6FD1A 1F2GA 4RM2A 5JRHA 2XCPA 1A0OB 1AT1B 1RB0A 5E3RA 3K5LA 2E1CA 3CCUS 1WKLA 2UUWA 4UQTA 2A10A 3QWPA 3MR6A 1NK9A 1RTHA 2KDOA 2VG5A 2DNNA 3IGVA 4FS1A 1XRCA 3BDPA 1S4EA 2VKZG 1B99A 1TUGB 1FVSA 4OI6A 4DV4F 3T1HJ 5I3UA 1ZPVA 2DNZA 2B4VA 4IUFA 5J2PA 1RWNB 2UUAJ 3JAMD 2DO4A 1H7WA 3LPYA 1SL2A 5B0AA 3SV4A 2I2YA 2CJQA 4HR2A 3SZ2A 2IVFB 1NY8A 5KYTA 5C24B 4JYAC 1X5PA 3ZZYA 2HNZA 5KFKA 3Q8QB 3A25A 1U6FA 2FUG9 2VDIA 2PMHA 2LU1A 3FCWA 4RUHA 1CSJA 2QRRA 2MQQA 4LQ3A 4LF4J 2AV5A 3DRSB 4DU8A 4PUIA 3JTNA 4YQWA 3ILOA 3M6XA 2AU0A 4DCSA 2HQGA 2C2MB 3NNAA 4F4WA 2JDJA 4OZ1A 1LW2A 2Q66A 3DNCA 2P2FA 3D6TB 5K8NA 4V19J 3AAWB 3LWLA 2QVZX 1CS4B 2KO1A 1VLYA 2UP1A 3DKDA 4IR9A 3N2QA 4GKJC 4M5NA 4DG9A 2H4WB 1X4DA 1JLQA 4TYAA 4CDIA 4P52A 4UTGA 2F1FA 2A2DA 2CNNB 4NYPA 3ZZZA 3G8TA 4CYUB 5E7OB 5ETMA 3T1YC 4ALZA 3HHLA 2C2RA 3PYDA 2B8PA 2VB6A 2AYGA 2G0JA 2MKSA 2BQRA 2HHQA 4Q2MA 4O0NA 3J7YU 1MMLA 2R8KA 2IVYA 3SIPB 1WHXA 2HFZA 2FGOA 2IJRA 3IR7B 2ZH6A 3OTOC 4IFVB 4OHZA 4GC7A 3IRXB 4ECWA 3DLPX 1HMVB 2IJNA 2M2BA 1S59A 3OL8A 4DUYJ 4F3OA 4NXNF 3KMQA 3EERA 1ZZNA 4L75A 5IFIA 5A19A 3GLJA 4WU3A 5IOLA 5CCLA 4DUYF 4NXNJ 3CQ1A 4LF7C 1T9WA 2QTWA 3BBFA 5G0RA 1MU2B 1S12A 2NS1B 2L48A 3HSDA 3ONQA 4Y6IA 4J9KA 2OIHA 4FUTA 2QO3A 5A8WA 4R5PA 2VA2A 2ZEJA 3NCPA 1ZETA 3RV2A 3T6JA 2MJUA 3BQ0A 1PO6A 4K4UA 1KBRA 1FRKA 1QD1A 3NGRA 4MTPA 4NMLA 4ZPBA 4J9QA 2DT9A 1RY2A 1H72C 1WKJA 1B7YB 3AJDA 4WP8A 2R7SA 3AA8A 3GWCA 3W2WB 1B64A 1JIHA 1B0PA 3DMJA 3MM6A 4DV6J 5F8NA 4RW8B 1P1LA 2GX8A 1JLGB 1UJ5A 2WBRA 3EUNA 1B3TA 3J7A1 3Q8VA 1UVMA 3ISZA 4JV5F 1H7XA 5KT6A 5IC4B 4EATA 1SC3B 2FJVA 4DSLA 3MECA 1RZMA 3A8JA 3I4HX 2F65A 3PXGa 3OFEA 4P6QA 5HVGA 1VQ9S 5LJ3Y 1RWMB 2DNRA 1O9TA 2ZHBA 3UZ0A 4WK1A 3BB5A 4WFXA 3VR1A 4Q5VA 1RTDA 4DV0C 4DLEA 4XX2A 3DLLQ 4JI7J 2IM2A 4UF4A 4N41A 2QVYX 2HFOA 5D0RA 3TUFA 1GPMA 4HHUA 3DXSX 1RAOA 1TKTA 2OO4A 2HMIA 4M5KA 3S8SA 4DSFA 3RBEA 3P96A 4LVNP 5KT5A 1UFWA 2W01A 3PR4A 2NPFA 1B0VA 4K4YA 4DSJA 2XYPB 1KTVA 3GIKA 4UY85 1MN7A 5FIIA 1GXLA 1S7IA 1JLFA 1BQNB 1G3OA 3I87A 3OTEA 1APSA 2I6WA 3V6DB 2FLPA 1MG7A 5F8IA 2YWWA 2B9XA 3TP2A 2I8EA 5CYMB 4ZP9A 1RAAB 5C2GA 2MQOA 2ACYA 3HHLB 5DDQC 1GXUA 2E1AA 4ES1A 4DCJB 3HMJG 2XLIA 2E8CA 2BJ8A 5ETQA 3PBKA 2M88A 4PQAA 1FXLA 4DCUA 1YRUA 3EXYA 4TYBA 1RCOB 3CCZA 3DOMB 4MK9A 5GMKa 2XM3A 1T03A 3CD6S 3O2EA 2B5JB 1QM4A 1WWHA 3VAFA 2MJNA 4PPZA 1RT5B 1CJKB 1YZ6A 4DCTA 1RYRA 3ITHA 1T9UA 3NBPB 4DEZA 3VALA 3LP0A 4NLVA 4ECQA 1E6VB 2IA6A 4AL5A 4DG1A 4JP8A 4AQYC 2OFGX 7AT1B 5SUHA 2KH9A 3SQGB 4DV4C 3SV3A 1CPZA 3FNNA 1U8WA 1UTAA 1SUQB 2MQNA 3B82A 2KG0A 3NMAA 4QWCA 1RDRA 2FLNA 2DCLA 3MHYA 2V8HA 4KAIA 3LP2B 2P20A 2OPQB 3DRXA 2DIUA 3CMAS 3R27A 2DVIA 4JI4J 2GIRA 5HQLA 2R9LA 3R9LA 1HA1A 1REVA 3ET6B 4WE1A 3OT9A 1SXLA 4WS9A 2B4PA 2R8HA 4ZP6A 2ZWPA 2E7GA 3BKUA 2ZD1B 1X0FA 1GEHA 3MPYA 2GO9A 1WC3A 5GAEU 4V1Ak 2Y27A 3T19A 5DM6Q 1F5AA 1R6YA 1X4FA 1T8EA 3D5MA 1S1XB 1SVDA 2J5AA 5MAOA 3R2DJ 1JNZB 2V5HG 2XYHB 4MK8A 5B0CA 2YNFA 3M7VA 4K5RA 4CO2A 2VJUA 4QU6A 2CNOB 2H5EA 1NK6A 2WRMA 3MOJB 5BR8C 1HPZA 3A4TA 1DLOB 3HZGA 2BBEA 2KRBA 2LQ9A 3CCTA 3L09A 4IO9Q 1Y00A 5BR8J 1S6OA 1JJHA 1CEZA 4J9MA 4ZJOA 2RDJA 3CIMA 5L1JA 4ELUA 2HHTA 2UXDC 5KG3A 3M6VA 5DZ7A 2JC0A 4NA1A 4QIFA 2BVZA 3PW7A 4NLXA 2UXCJ 1WF3A 1YJWS 1HNXJ 1FXRA 1HBUB 2H5IB 1MNEA 4JUZA 1JLAB 4ZPAA 4FF4A 4BLGA 2BZ2A 4G3IA 5FDLA 1U1QA 4F8RA 2CG8A 2BE2A 2BEFA 1NMEB 1OS5A 1WOPA 3MCNA 3PFOA 4DUZF 3GJSB 2UVRA 3ET6A 4A8WA 3THPA 4RNFA 2UU9J 4DL3A 1E6VA 1XS3A 2JFKA 3SQOP 1RAEB 4YR3A 4IRCA 4QU7A 1RT5A 3NY0A 3MCOA 2Y8YA 1ZB8A 3VNRA 2J7KA 1ZA2B 4FBUA 2XEXA 1NDPA 3DOMA 4L3NA 4JI5J 2HVIA 2DYJA 2KFZA 1RA6A 1WD6A 1AZSB 5BXIA 3OL9A 5EWFA 3Q8SB 4JI7C 4JI7F 5U47A 3QAEA 2YVSA 3FSYA 2DY1A 1FDNA 4S0MA 5F0WA 5AT1B 1NSKL 4X66C 1UWBA 2VF3A 3LA0A 4NLUA 3DC2A 4OYIA 5DQIA 3MFHA 4OLOA 1YI2S 3NKYA 4ZVSB 2HLTA 4PYAA 4ED4A 2HS0A 3SCIE 3W3SA 2PROA 1HLWA 4RLQA 1PCAA 1IKXA 1DURA 3FC9A 1TKDA 4LRAA 4MYUA 1L3TA 1V5IB 2C1EB 1SQFA 2JVOA 2JVRA 4I4BA 5KFUA 1U6BA 1T5HX 3I0SA 2JNVA 5F8HA 2FY1A 2XYGB 4GKJF 4RJVA 2M4MA 4IRDA 2HFUA 2QZ8A 3D6HB 3MWBA 2YKPA 5LSLA 2F4VF 4JI6F 2XI3A 1PC5A 1HD1A 3UD4P 3GPAA 1IUJA 2VBZA 2D1CA 4LIWA 3R7NB 3RR7A 4B3OB 1ZB9A 5CABA 4E2FB 3QRQA 1FRJA 4R25A 3PJWA 1HBNA 4I56A 4P9SA 4DL7A 2VH7A 4DV0J 1MN9A 2WCXA 1S9FA 3T5KA 1FTRA 2VBYA 3OUYB 4ETZA 3CJSA 3D6MB 3DOLB 4TY8B 2VONA 2VIHA 2IDLA 2VODA 4QZVB 3ZZRA 5JUMA 3PEJA 5BUQA 2NXEA 3GIMA 1SL0A 3N5FA 2DITA 4HDGA 2ALZA 1U24A 3MMJA 4C0BA 4C8LA 1LOUA 3R44A 5EX0A 4RNOA 2VFVA 3IRWP 1U4BA 5F41A 4NXMJ 4AUKA 2BW2A 1BC6A 4DG8A 1M6XC 1WF2A 2RRNA 1HHQA 3NGKA 4P71A 4UZCA 1VQ4S 4NLGA 5BSVA 2FVCA 3MMBA 1IR1A 1J5OA 3I0SB 3IPLA 4HH0A 1R6VA 1PIEA 2E9TA 5AXMA 3O8WA 1X4HA 2E5GA 2LMIA 3AJ2A 4H4MB 3TWZA 3CXCR 3FDSA 4P2XA 3J7Z5 1M5OC 2EKNA 3UO0A 4X62J 2HS4A 5GTDA 4DUZJ 1HMVA 3MMCA 2B8QA 1RE1B 1CBKA 4FVCA 4WCEQ 3FFIB 2CPZA 4DX7A 3U1NA 2KDNA 1R8CA 1U25A 2FHOB 2AGOA 3OXLA 1IKXB 1T0TV 2V50A 3VZIA 4Z2XA 3NNHA 1PG4A 1V26A 1KHVA 4ZPWR 1HNIA 2G0IA 3UDVA 2OFHX 1U1PA 3IRXA 3ZTOA 2XC9A 1RABB 2ZWOA 4HACA 4CYUA 1RHMB 4H4KC 4F67A 1JLQB 3A8KA 1I51B 1RK8A 2ZOGA 5HMWA 3LTOA 2G2OA 2RHQB 3D3BJ 3CCRS 3JTPA 1HARA 1VQ5S 4L2ZA 4OZ5A 1LW0A 1MW7A 1Q7YT 1RAFB 1REGX 3CD5A 1S5ZA 3N6LA 3QYYA 2WHOA 1HQ2A 5D0GA 3A8EA 5KFRA 5KAKA 2M0GB 2YKOA 1FEEA 2EK6A 1HBUA 4NX9A 1S99A 4D3HA 1J5OB 4DXLA 4CO1A 4IOAQ 4CLWA 3BSNA 2ZDPA 1XNQC 4GKJJ 3TJ9A 2VD3A 4DV2J 2C3UA 1FNOA 4USTA 2QG9B 5HVHA 3CDEA 2NREA 1FXDA 5JMNA 3BS9A 3V81A 2CXEA 4JI4F 4X65J 1S0OA 4UUXA 5B0BA 1G1XA 3VV2B 3NOCA 2CQ4A 2K1RB 4MT1A 1NK5A 1UJ6A 2QA2A 2D1SA 3DHVA 3KK2B 4LF8C 2XMJA 1LK7A 4ZHRA 4U8VA 4QCLA 1YZ7A 3E2EA 4LF7F 3DOLA 3EJMA 2EI5A 3H2VE 4OI3A 4Y2AA 3MM6B 3KJFB 5KFTA 1KFSA 2UVWA 1DTQB 2ZE2B 3SFGA 3MAHA 3T5JA 2FZCB 3D1HA 1I6JA 2DRAA 5CQGA 1HNWC 1FKOB 1IBLJ 1MROB 3HSGA 4DMZA 5IT4A 1Y11A 4LFBJ 3AF5A 4X62C 3E7WA 3IS9A 2JRSA 3HLUA 2GV1A 4O4GA 1FKAF 1VOMA 5B0GA 4GKKJ 5B7WA 3OXFA 2NQPA 3TQIA 1FRXA 5C2CA 4AL6A 4DQRA 3LP2A 3IG1A 4U7UK 2XSFA 1FDAA 5DQGA 2N82B 2XMWA 2MXYA 3J80D 5EHHA 3T1YF 3DLBA 4DR7F 1FD8A 1KC8T 3C5EA 4DX6A 4RLEA 2VDHA 2CDQA 4L72B 3RG6A 3AOAA 3IFEA 3T1YJ 4JI2J 4LF9F 3NBPA 1MXCA 2R3VA 2OPPB 2IAJB 2MZQA 2QFJA 4L3KA 1TFWA 2HRYA 1FWPA 1S0MA 2HZAA 1FK9A 1GQEA 2BMBA 1TL5A 2VL1A 3FSXA 3TQ1A 1SUQA 2F5GA 2UXBF 1RAJA 3CDUA 5HAOA 4JV0A 3ZNJ1 2GCFA 4F26A 1VC5A 4JV1A 4DR2J 5HP1A 2C22A 1S76D 3NYRA 2B6AB 2UV8G 1OYEA 4N77A 4ZJLA 2VBWA 2XTJP 3D54A 5RUBA 5K8PA 2R8IA 2QA4S 4PAAA 5GMEA 3P5TL 1SL1A 2DJWA 3BGLA 2HFVA 4L73A 3RB4A 4I2PA 2MMYA 3QO9B 2P2QA 2RILA 1WHWA 3HX9A 4LF4C 3FQKA 2M3DA 2Q6BA 1TL7B 3J80U 3PRVA 3HSZA 4K4SA 2YWCA 3EYZA 4DN0A 5B09A 4MJKA 5CYMA 3E01B 1WHYA 3ENQA 4A4JA 3CJ5A 4HT7A 4K8RA 1UL3A 1SH3A 1HI0P 3U7JA 4F7VA 3CCLS 3IG1B 1RJJA 2ZUAA 4KHPC 2DR9A 4M5MA 1AUSL 4DSKA 4LMZA 1LFPA 2LDYA 3G86A 4KHPJ 2GVDA 1UA0A 1X4AA 1Y7PA 1D09B 2L9NA 1ZAWA 1VK8A 1ULTA 2AJ4A 3AOBA 1S0NA 3QWUA 3TDEA 2VPZB 2KTQA 2DR7A 2E7WA 3NRBA 2FVRA 1PJ7A 5HQ8A 3EPIA 2X1AA 3CPWR 3RW6A 2YH1A 3LUYA 3RRHA 3H0PA 1USPA 4C3KA 4OQJA 4Y3CA 4B9TA 4C9DA 2QIFA 1NUEA 5BURA 2QMWA 5GAGI 2HHXA 2Z4PA 3PG9A 4JI5C 2DHAA 2V94A 1IBMF 4NE9C 3QT7A 4ED7A 3SI8A 3OR2B 4EZ9A 1VRQC 3NS6A 1R7IA 3SFUA 2CU6A 3A9VA 5BSMA 1S1VB 4C11B 5CZXA 1FJGF 2EBEA 5LXYA 1T3OA 3KLIA 2D1RA 2WZ1A 1UEKA 2Q1LA 4JV5C 3POTA 1M5HA 4X4VA 3KLEB 3H59A 4A8FA 2UVVA 1ZH5A 1LCIA 4X2BA 5HLFA 1U6ZA 3W9JA 5KFEA 1YRXA 1RGVA 4YN3B 2XGPA 1FNXH 3SCLE 3CULA 3EE3A 3GMGA 3GU0A 4H4OB 5CH7B 1PJ5A 1K0VA 5DDOC 2Y1IA 1H98A 2B43A 4OYCA 4WFAQ 2RQ4A 2IA0A 1TMJA 2N7YA 4RW6A 2RDDA 4ED8A 2F7VA 3AY0A 4Q7AA 4CTAA 3J81j 4QJVA 2YWBA 2UZAA 2DGOA 4QQBA 1DTTB 1RHUB 4QIWD 3ZZPA 1VMBA 4DQQA 1S72S 1OSDA 2V67A 1PGZA 4TPSB 1TL1A 3R5AA 1F0XA 4KSEB 5DDPC 2ZZMA 3RRKA 2Q6CA 1UA1A 4IFVA 1FA0A 4DJBA 2E5JA 2VSQA 3G7SA 3CJTA 2U1AA 3MR3A 4U67Q 5L46A 3LP1A 1U26A 4K7QA 4NEYA 4F2RA 4WIQA 2ZM6J 2DY9A 2VFSA 5KG2A 1RT6A 1F9FA 4LFBF 1RTIA 2YNIA 5BYRA 3WC2A 3DCAA 4OYPA 2IBOA 4DFMA 1SCJB 1FVQA 2GQ2A 4ID8A 2GFFA 4DQIA 4PEOA 1V3SA 4EMDA 2AZ1A 2W4DA 4AXIA 1RWUA 1ZM9A 1L3KA 3LPEA 4DF4A 2K06A 4F0HA 4DL5A 4WZQA 4O3QA 4U9RA 2E1RA 2HG4A 1HIYA 1M5PC 3BZQA 2ZJPQ 2MQ8A 5IQQA 2IC3A 3OR2A 2VQEC 3GR0A 1FJEB 1WG4A 2GS8A 1KRPA 1WC5A 1IJEB 4KPCA 4JI8F 3MPUB 3KXWA 3QIPA 2I5JA 5DO2A 1BQMA 2PMWA 3VZHA 2KM8C 1TP7A 4LR7A 1UFLA 2GZOA 4F04B 4EUVA 3EGZA 3P6YC 4ERDA 2B51A 3WC0A 3TUIC 1S48A 3UCUP 2CQ1A 3W2VB 4USHA 2KG1A 3ELHA 1T9TA 1F3VA 4LIRA 2QJ3A 4U7UD 4PPDA 4PXBA 2OMLA 3OLBA 2AMCB 1NKEA 4CLSA 1N0VC 3R9WA 2A18A 4PG8A 1R0AA 2GAHC 2E44A 1H38A 4K4VA 4O44A 3LUSA 5T8TA 1X7VA 4J9SA 1TVRA 1T9VA 2YTCA 3EX7B 3OL6A 3NG8A 4DCOB 4KGMA 4FDFA 1PYOB 4EBDA 3IAM9 1VIOA 3GCXP 3CCMS 1O5JA 4BHQA 2VQFF 4DR3J 2BANA 5JXSA 4AE5A 2J9DA 1FRMA 4GMKA 3P4UB 3M9OB 4LF4F 4ANEA 2KHDA 5CHCB 3JTOA 3R5JB 4ES2A 2RU9A 4X4OA 2AJQA 3LP1B 1UPMB 2KZZA 4NLPA 3T1HC 1HNZJ 4MK7A 5LSOA 1FHTA 4WP3A 5LOQA 3OSNA 2V34A 3P8BB 2YX1A 2BDPA 3LNOA 4ECRA 9RUBA 2AD9A 3KJVB 4KHPF 1RWKB 2GHPA 3RB0A 1F5BA 3WZ0A 4H4MA 4HT5A 5F0UA 3KLHB 3OSPA 3IO1A 2OELA 4G6VB 4QIEA 4O3SA 4FYXB 1NNDA 1QDUB 4RW7A 2HBQB 4DV3F 3PW4A 4X84A 1HBMA 1N5QA 3D9BA 4M95A 3AQOA 4C11A 3B4MA 1TL3B 3WBZA 3OQ2A 1KD1T 2ZH9A 1YVFA 4FF2A 1GNKA 3MAQA 3D4JA 3OV7A 3R1LA 4DR2C 2OPLB 2P9EA 5J1EA 2VHGA 4LFAF 2JNJA 1Y5IB 4QIGA 4ZPDA 3HI9A 2D3OR 2HVDA 2XWYA 4NLWA 4OX9J 4IFYA 1SQEA 2DNYA 2PC6A 4URQU 3K89A 1U09A 1BWEA 3IEVA 2HNZB 3D3CJ 3ZZTA 3BGRB 4Y2IA 4KJIA 2KZFA 2WSCC 5G4DA 4DV6F 2RHSB 2PN2A 1SV5A 3M2RB 1P1TA 4PWDB 4LR8A 1N34F 4W90B 4NOZA 5KT4A 1WEXA 4NLYA 1C1BB 3C66A 2CWXA 2IM3A 4XAKA 4CLZA 1HQUB 4TY8A 4KHMA 4YOEA 3EWGA 2FJWA 3MTKA 4DV5C 1IKVB 3OTCA 4X64J 1UP1A 2FHKA 2HHHJ 3C2PA 4DN9A 1PG3A 4LFBC 4RM3A 3UEBA 3I56S 1E6YB 4KO0B 4LF2A 3RB6A 4ER8A 1XNQF 1GFWB 1BMQB 2VBXA 2X51A 2SXLA 3QNWB 3TR5A 1R3NA 4IG0A 2WOMB 3UX3A 1S1WA 3FMBA 3F73A 2B0GA 1QSSA 2CQ3A 1NSPA 3CW2C 1RACB 1R8HA 2KYXA 2ZC4A 2RD5C 5KG7A 1VQNS 1QY7A 4K0KF 1XNRC 3ZTSA 2F8MA 4NRUA 4ES3A 5KT2A 2UUBC 2PGCA 2CPFA 1HWKA 4Y2MA 1XBWA 1YJVA 2HS3A 4DHVA 2GO8A 2IIHA 2M9KA 1WTBA 2QLBB 2Z30B 2AGPA 3GYXB 1RT2A 2XLJA 4ODJA 1HQEB 4JI0C 2AX1A 3VGVA 2HIQA 4QYZJ 3DGVA 2HHSA 1KN6A 3WX4A 1UVJA 5K14A 2ACMA 2V68A 3TA2A 1H2TZ 2KVQE 2MYFA 3Q24A 1F6TA 2VICA 3JB9k 1VQPS 4ELVA 4NZ7A 4DLGA 4YR2A 4F4KA 1I94J 4BWJA 2B3TB 1VQMS 3QGPA 2P2CB 3MEDA 3PIOQ 2DH7A 3W8PA 3M8SA 3F44A 3UW1A 5F8LA 4LF7J 1NZAA 4ZVOB 1Q4RA 5IT9U 4P2SA 3BSCA 1FK9B 1AROP 2LP4A 1FJGC 3MMAA 1LWCB 4X64F 5F8MA 4C8OA 3HHDA 4LUBA 2RS2A 4GKKC 2BOPA 5IT9Y 2J0XA 2W25A 4LSLA 4RBVA 3GR1A 2CPDA 3T3FA 3UOWA 3PYGA 1OY9A 2V4RA 2Y1LB 2HWTA 2LEAA 3IBWA 4A8XA 2J0QD 3L7OA 4X4TA 4EO6A 5EWGA 1G4CA 3HCXA 3MMBB 2XCAA 4PG4A 3C6TA 4DV7F 2BJ3A 4DR4F 1R27B 2XWXA 3BM7A 4EGLA 4RW9A 4IZ6A 1W25A 2ADCA 1HQUA 3DI6A 1MMNA 2D9PA 1RISA 2OEJA 1I5OB 3D68A 3MECB 2EG2A 1J2VA 1PC4A 5HSPA 4OYAA 4RUCA 4NPOA 5KFQA 2UXDF 2KXFA 2BJ9A 2PSZA 4CNZA 5IT9D 4DX5A 3BGUA 4F4ZA 2ASDA 1PG5B 3GJQB 4EBCA 2ZHOA 3FK4A 1T05A 1RT4B 2PE8A 1SB6A 4PCQA 1NKCA 2P2JA 4DV2C 2NCKL 3VNQA 4M5DA 3WHIA 4B3RJ 1RLDA 2E29A 4G1IA 2GJFA 4AFFA 2W2QP 4NLQA 2CRLA 1GMUA 4USKA 1NHUA 4N7TA 5CA5A 3WX8A 5DLFA 2CZ9A 3SSQA 2JEIA 4B3RF 1ROFA 4DDFA 1O51A 3B7WA 3I08A 2H5JB 5HANA 3HKZD 5ETLA 5IS2A 2XMAA 2BJ1A 2YQ1A 1VBKA 3T5HA 1HWUA 2LFVA 2M5HA 2CYYA 3BV8A 3M2UA 2FC9A 2H1YA 1HNWF 1VS3A 3M32B 1HNVA 2HNDA 1V25A 2CQ0A 4RKUC 2DH9A 1YKWA 4FZVA 1R8AA 4C6AA 4ECYA 4F2SA 4NCGA 3VGSA 5I42B 4J90A 1JLEA 3KK1A 4ZPTR 5KFIA 2R7UA 1VI7A 4TQSA 1FRHA 2VQFJ 1WEZA 2R8GA 1RT6B 1X4EA 1VRUA 5J2NA 2P8IA 5KG4A 4NOHA 4WBFA 3TJAA 1CG2A 1HNIB 4DPWA 2O01C 5GAGU 4C0HA 4YUDA 3OLAA 1X9SA 4BDPA 2RQCA 4C8NA 2LEPA 2R2UA 2Q3PA 3BEGB 4HACB 1G2EA 1YBUA 5D8HB 4LF1A 2PFDA 2RRAA 4B3MJ 2ABYA 1CJTA 1TZ0A 2RJZA 1RHKB 2E7XA 3AH6A 3FFIA 3LGHA 2JJ4D 4HDHA 2EKYA 4F36A 4TQRA 3NLCA 1LQLA 2P6TA 1RYSA 5ETPA 4LF5J 1EJ7L 2Y8WA 4RW6B 2U2FA 3BSAA 1OWXA 2ZNZA 4DV1J 4CCHA 4JI1C 4M94A 3EZUA 2VG7A 2JX2A 3H5XA 4PR6A 3JQJA 2QMUB 1JLAA 3DU5A 4WFYA 1LFWA 4H4OA 1LW2B 2N3LA 5ETOA 3MM8A 5C7PA 1I94F 4O0IA 4Q8FA 2IRUA 5F8JA 1PSDA 1TV6A 1N32C 5HLFB 1KWMA 1TL4A 3JQKA 4OV6A 4U5YD 1B0TA 2Z2MA 3OPKA 1PAUB 1X4GA 4I6WA 4JBCA 4CRJA 4PG7A 3OL7A 4MTNA 3PX0A 5KFJA 1T05B 1YLXA 4YB6A 2ONFA 3VNSA 4G36A 2E9RX 4NXNC 1DJ0A 4GVLA 6AT1B 1OY6A 2RE1A 3HVTB 1NB2A 3UFCX 1K47A 1F9HA 2YNGA 3UN2A 4FXDA 2HIYA 1UKUA 5KG5A 2DEJA 1N32F 2MKCA 2IC3B 4K2JA 3JSYA 2D7SA 4M5DB 1QWIA 1PKUA 1U2RA 2G1DA 4P7TA 1D1UA 4NDNA 1V6HA 5K8MA 1EARA 1UVLA 3M1VA 3J80Y 2XR1A 4YDXA 4TU8A 3Q8RB 3EMTA 2WSFC 1N5YA 2AEJA 4N5SA 3EQ6A 4RVNA 3VHQA 4Q0BB 5LT5A 3MEEA 3DLHA 4X4PA 2W4PA 2WSEC 2W9BA 2J6UA 3R5GA 1WJ9A 4MKBA 4ZMMA 3UCZP 2PDAA 4ZPVR 4X66J 1GMWD 1Y4ZB 2BRKA 4ZVPB 3KHRA 4DR2F 1U1LA 5KOXA 1QTNB 4ANCA 1FWLA 3Q89A 5KFAA 1BA3A 4M5LA 4QR0A 4X4QA 1V3RA 3OXGA 2BQUA 1UVKA 1MDBA 1XHJA 1EP4B 2JEFA 3S82A 3R9XA 2HQCA 2MM9A 1DQ8A 3ZZ0A 3MF5A 4RPFA 2DHSA 3GYNA 1H2VZ 3E3XA 3TOQA 4JI6J 1XR5A 2CKWA 1R89A 3IN5A 4CZCA 1QE1A 1NK8A 4DR1J 3DM2B 3B78A 3UR3C 3PKMA 1HD0A 3NMRA 4OI0A 3GIJA 2C2KB 5KFPA 5ETTA 2FYXA 1L3UA 1FT8A 4DV4J 2ROEA 1LV5A 4UQGA 5J2MB 4YB1P 3A3OB 3H7HB 1MWQA 3MOZA 1TKZA 2AIRB 1WUUA 2CAJA 5L1LA 5K85A 4CI0B 4A8YA 2G1HA 5ETVA 2DRBA 2DCUB 4IH5A 1RKJA 1WF1A 3PYEA 4QWEA 2J7WA 2JC1A 3NL0A 1VC6A 3UD5A 1IWGA 2FHJA 3DRYA 2QYCA 1XMQF 2I0XA 1RXOB 3M1VB 1UAWA 5L9NA 2XMTA 1UETA 4CQ1A 1RTJB 4ZCKA 3FRYA 4NEZA 4DS4A 4DZ6A 4B3SF 1DZ5A 1XNRF 4EO8A 4OHXA 5K5MA 4X4SA 3N01A 4J37A 4NI2B 1N5YB 1KSPA 1AFJA 4WE1B 3MUMP 2LVWA 2FJEB 3MD1A 2XZTB 3GSIA 3OW2R 4JYAF 4C8ZA 4R0JA 2QL8A 2ZFHA 2KT3A 2HHHC 4J91A 1DHMA 2W7OA 1FRLA 2YKNB 3BGRA 3J81Y 2NLWA 4ED5A 3EDQB 4FXVA 1X5SA 3TEHB 2A0FB 3KHHA 2VPXB 4CLLA 1VC0A 2D27A 2H65B 3M8QA 3D2WA 5L39A 4MFBA 1U7LA 3CD0A 5KFDA 1R8PA 3WQPA 3PHEA 2MKYA 3AD7C 2MZSA 1FE4A 3W60A 3M8PB 5IWAF 3ZZUA 4EFAC 1RT3A 1LWFB 2D3ZA 3V4IA 5F3ZA 4ICLA 3ZC4A 2KU7A 3MPVA 2OPQA 3E8OA 2O66A 4TN2A 4IFYB 2V2QA 5KFMA 1K44A 4LF9J 3QLHA 3P3DA 1NM2A 2AW0A 2RT3A 4ILMA 5DG7A 2HHVA 3CW8X 1TKZB 2QYGA 1X4BA 5F8GA 2FHMA 3MMAB 9ATCB 4WIIA 1TMMA 1WSRA 1ZAXA 4E98A 2WB1D 3CO9A 4ZIWA 5GADI 2G0CA 3J81U 3KK3B 2DR8A 4ETXA 2CQ2A 3W61A 2V4JA 4J7CA 2ZH1A 3PW5A 1VRTB 5HJYA 1NPPA 2GQCA 3LGXA 2XBPA 1RT1A 4FPRA 1QE1B 4PUOB 4WZMA 3AD9C 2HGNA 5KTQA 3M6WA 3MUTP 2XMVA 1JNRB 3ZXWA 3KTQA 3RAXA 2MZJA 1YJUA 3K8WA 3T9ZA 5GADU 2VA3A 2RAQA 1EB0A 4U6PA 5HJXA 2FJBB 4CH1A 4AQYJ 4DUYC 1KVKA 2CJKA 1BQNA 1UZDA 2YWGA 2W1BA 4LFAC 1K9MT 4JI1J 3R7BB 4DV1C 2MQMA 1LWXA 1FEHA 4WYWA 5B0DA 5J1PA 3EVWA 5L9XA 4C8YA 1TR0A 1XIQA 3DHWC 4EYIB 3I0RB 4LREA 3ENVA 4KGKA 4U96A 3QZ8A 3CCQS 2AP6A 3TAPA 2HPUA 2HYIB 1N0UA 2L08A 2CJYB 3BH7B 1UVIA 1N34C 2Y3YA 1DTQA 1CJUB 1KONA 4XPCA 4B9LA 4F50A 2P9CA 3DAYA 2YPZA 3NAHA 2BXJA 4UUWA 1SIZA 4MYTA 1P6TA 2MHNA 2MKJA 3D66A 4ZVHA 4WFZA 4F4XA 4Y00A 3DFEA 3JYTB 2A2CA 1GTHA 4C48A 1NO8A 3OTBA 1H73A 4PWDA 4B9UA 2DPLA 4YB5A 1JB0C 4X4NA 3MTJA 4Y2CA 3NI2A 1RLCL 3O1LA 5B08A 2OEKA 1SC4B 2F8EX 2E1MC 3DI6B 1XERA 3DLGB 4XDCA 1D9DA 3PO4A 2NZ4A 1PYSB 2Z2ZA 2Z8QA 4QW8A 1IB8A 4A8QA 3KFWX 1Y3KA 2FC8A 2BACA 1LW0B 4OI1A 1VQ8S 2V7BA 4YS2A 1RADB 4MMOA 4NL5A 2AYBA 1MKYA 3KNAA 1QM9A 3AXKA 3TZWA 5HBMB 4UOFA 1UW9A 4RW9B 3BGOP 1Q5VA 2ZKUA 5AXKA 2HQFA 4DPUA 3TZYA 4N56A 2XS2A 2VZEA 4R5PB 3C6TB 1A7GE 3P45B 3CJKB 1LKZA 2YPYA 4KGXB 2J6SA 1L2FA 4F4YA 3I9V9 1RI7A 4P2MA 3JAMU 1MU2A 2G2ZA 3RG2A 4NLRA 4PG5A 4QW9A 4N76A 3ETCA 2W7AA 1OYDA 5BSTA 4DFKA 1MXBA 2N4DA 4P7VA 2I38A 1BUXA 2A3JA 1RT1B 2Y0SD 2HNYB 1NDCA 3MZIA 4PUOA 3A9UA 1M90T 2X1FA 4DR6F 2PI4A 2QSWA 3A4IA 1AFIA 1AXQA 1C4AA 3H4BA 3QT8A 4ECXA 3Q83A 2IMWP 3HHNB 3QRRA 4NCGB 1FX4A 2C3PA 4YMEA 5I42A 4K50A 4IDKA 5DDRC 3LAXA 4MKAA 2NUHA 2K2PA 5CCMA 4OX8A 3NOGA 1XC9A 3FSIA 4L7IA 1K73T 4DR5C 5FLXD 4FS2A 3KUGA 2IYGA 3W62A 2M70A 4DPOA 2W9AA 4M8LA 3Q2TC 4GS5A 1OMSA 4OMFG 3OTDA 2YX4A 4CO0A 3R1HA 4B9MA 4YY3J 1X8DA 3OVBA 2G9OA 3C16A 2B7CB 5DS7A 5AJ3F 1XTZA 1FF2A 1QUPA 2DTJA 3DRSA 3PACA 4A47A 4NA3A 3MEGB 2WW4A 3J7AN 1M0SA 3MM9B 1NZ8A 3IWLA 5HMZA 3IWNC 2JZ5A 3THTA 2DPIA 2PT7G 3CW9A 3V6HA 3KJNB 4WK3A 5K20B 3G8QA 2CPEA 2GJIA 3GJRB 3TAMB 1URNA 2CQGA 3DOKB 1O6XA 5D6GA 1FTCA 1N6QA 3H40A 1IKVA 4PQUA 1AMUA 3G6ES 3AQPA 2BUNA 2CJAA 1TAQA 1WOSA 2N4CA 2OGUA 3PDNA 2LA6A 3IGNA 3LQVA 3N6NA 4HI1A 4ZCIA 3AB2B 2R8JA 3TUPA 2NXNA 1M1GA 2BA9A 3M05A 2HK2A 2Q43A 4WXWA 1N36J 1B7FA 1H0HB 2BM0A 1R31A 3G87A 1EZZB 3RTVA 2XHCA 5H1SV 2YQ3A 4P75A 3FZ2A 2L3MA 2VKRA 4W4MA 3K5OA 3SBMA 1YJNS 2EK1A 1HW9A 1EETB 2CPXA 3GIIA 1VR6A 1WI8A 4ZN1A 2KKHA 1TL7A 5E5NA 1RKIA 5LMUF 3UE2A 2LLZA 5KYVA 5LMNC 2BE7D 1U48A 3SQGA 2EBGA 1Z4UA 3MM7B 4A46A 4HEA9 4QBUA 1HWLA 5LMNJ 5J1NA 3UWTA 3GTYX 2ZKTA 2R2TA 3IC1A 2KZ0A 1KNZA 1S9EA 4C0OC 1O0PA 1YBAA 2R7OA 2B5JA 5A1IA 3H20A 2RMLA 3HHLD 1NDLA 3W5YA 1V60A 2D9OA 4Z37A 1WACA 1T03B 4PXCA 4GXQA 1WOOA 2FZKB 2JL9A 2BJEA 3TA0A 3KMSA 4ZLPA 3HVAA 1EP4A 3PJ9A 1PYTA 1NSQA 4L6V3 5KFVA 2I9SA 4YR0A 2KXNB 4BC7A 3OTOF 3CCWA 2FJDB 2BKOA 4NZ6A 4I6YA 3OJUA 4OYMA 3RBZA 3BPSP 4R0EA 1NPKA 2NZCA 3H4DA 2VUGA 4DL2A 3S01A 3POTB 1PILA 2CPJA 2LU2A 2VZ9A 3MEEB 4OZ2A 3BBBA 4ZS6A 3C3LA 2LYVA 2E0GA 4DV3C 4JI2C 1RAHB 1K1SA 1FKOA 1HHSA 2DNQA 4PWWA 2GHVC 1C0UB 1O93A 4RNHA 4J9PA 1VEHA 1S79A 3VVUA 4DSEA 5ETRA 3MM9A 1KDNA 2K1RA 4CH7A 2J8SA 2NR0A 2LKZA 3PIPQ 4RUBA 2KB2A 1P27B 3TX8A 2HHWA 2EFPA 2Z57B 3I5CA 3TAMA 1TQLA 3DRPA 3U1MA 3UI3A 1IQTA 1M5KC 3HVTA 3C16B 4PQUB 3GYGA 1Y5NB 4Y28C 4J5OA 1REVB 1GAOA 2V2KA 2W24A 1PBUA 1RTJA 2H51B 3KG4A 5JJBA 4K2XA 4AYBD 2EXUA 1FWKA 3HF5A 4Q0BA 1VQYA 1BQMB 3C15B 1S7HA 3PCOB 1HWJA 3PR5B 3UN3A 1WNEA 3NGDA 1X5OA 1KKGA 2R7RA 2E5LC 2XY6A 5D78A 1TL3A 5ETNA 2XSJB 1HNXF 3FCCA 3ITHB 1NH8A 2BKNA 3MCSA 3KK3A 2BX6A 3A3NB 2UV8A 1N4LA 4LF6C 1IXKA 3BREA 4YHHC 1XEZA 4C4WA 2WONB 4DUTA 2FVSA 2RKIB 1RHJB 3JAMY 3CMQA 3BKTA 1N34J 3JSMB 2OI2A 1VK3A 3CJ4A 3FKBA 3LAMA 1O8BA 4FXWA 2N7CA 2FD2A 1GMWA 3BO4A 1JQGA 1N5TA 3PJXA 2RIJA 2V4QA 1AB8A 3HVWA 5A8RB 1QLNA 4DFJA 1RU1A 3EM1A 3IXQA 4MKVA 5HP1B 5D3GA 2EPIA 2PMZD 1U0HA 1N56A 2W2OP 1C0TA 2Y9HA 2DR6A 3K17A 4DFPA 1KLMA 2GA7A 2OJ3A 2OPPA 1NJYA 3BJYA 4HTIA 5SZTA 4LBPA 2GMLA 1HNWJ 5EGYA 1MXAA 4PZPA 2ZC3A 4KGVB 1W2IA 3VAMA 2KM8B 2HGMA 5KFGA 4CTAB 4K0KJ 3IMQJ 3CWJA 3NAIA 4J9UE 4KTQA 1RTDB 2J9EA 4DR6J 2WB4A 5LSRA 1A9NB 3KKFA 3RBXA 5M2PA 2FGCA 1K0RA 3HPOA 2NXUA 3RR8A 4KPYA 1FFSB 3CE8A 3MXHP 5KFBA 2ILZA 3ILLA 1QVFR 5LMUC 3G9CA 4L74A 1N32J 1VLOA 3T41A 3CJEA 4DR1F 2AJ1A 4LF8F 4OZLA 3DRRA 2EFVA 4YDDB 2P02A 3N0VA 3FGVA 1DQAA 2KVIA 3C15A 3KLIB 2A6OA 3OUYA 4ILLA 3DDNA 2FHJD 2XMMA 3W2WA 4R0MA 2XGQA 3H2LA 4FP9A 3GG0A 1WKKA 3JS9A 2MSSA 2JOQA 5BSWA 5BYQA 3IR5B 3TVZA 2Z2LA 4B3MC 3UVJB 1HR0F 2PI5A 1YJ7A 2DK2A 2AX0A 1Q81T 4B3OA 1NBEB 3JYTA 1MSWD 4G65A 4FYWB 2HRTA 3O6QA 3M9MB 3I5BA 4WP9A 4EBEA 2WVBA 3H5SA 3M6UA 5G0RB 1JXEA 5HMXA 2CQCA 2UU9F 4FUQA 3JQMA 4USMA 4OYZA 1BY9A 1CJTB 1SH2A 2OP5A 3FMWA 5IC6B 1W7WA 4JI5F 2AYAA 3OFGA 4UY8T 1C0TB 3I96A 2ZH2A 1S77D 4KQZA 5CXTA 3P5BP 2PA3A 4ZN3A 3UDEA 5DRKA 2ZBCA 1UPPA 4I7FA 5GAHU 1R0BG 5EDWA 3G96A 1KVJA 3K58A 2P9GA 4IG3A 4QWBA 2XQCA 2VG6A 1KTQA 3CJ2A 4W98A 1PA4A 1XRBA 2PD1A 3FEZA 4PXDA 3I6PA 1QSYA 2KT5A 2PEHA 3DLEA 4H54A 5KG6A 5DG9A 4L4QA 5LL6d 1N52B 1DTTA 4FVMA 3C46A 2HLUA 3B54A 1A6LA 3HT3A 1ML8A 4LF9C 4RU9A 2M5OA 3MPWA 1HNVB 2HNDB 2UXDJ 4DPXA 1OJ4A 3BKFA 4FNIA 1UCNA 5BYSA 1NJZA 2FQQB 2CUYA 4NXMC 4PUHA 2HEKA 3A1YG 4OJ1A 4PHTA 4I0WA 4KKOA 1T5DX 1NCLA 3A12A 3ULHA 5A1GA 2CQHA 4MFBB 2YXLA 2ZVIA 3WDOA 3IWXA 3CQ3A 2GMJA 1SBRA 2AEMA 2IDEA 2AT1B 2KFYA 2W9BB 4IRKA 4U7CA 1RT3B 4AXJA 1WC0A 3D67A 4OHVA 3CCSS 2XY5A 1FDDA 3EGWB 1KR4A 2LXIA 5HI7A 3D0GE 1B4SA 2CADA 3L95X 2NYHA 2WVFA 3LOUA 3I55S 3THVA 3DYAB 4A8KA 2FIUA 5H9EJ 2F63A 2AJFE 2Z58B 3QGIA 5J2PB 3D6FB 4ECSA 2UXCC 1S1XA 2VC0A 2YH0A 1WG1A 3F0NA 3RW7A 1S1UB 4WXOA 1QAXA 3DYAA 2YNFB 3V5RA 5KFCA 1JKHB 2B9WA 7FD1A 3KK2A 4N47A 2AQ4A 1HBOB 1WC4A 1N5VA 2J9CA 2P6SA 3LH2S 4M63A 3M9NB 3CF5Q 1TUWA 2EW9A 1VBXA 4PUGA 1S6PB 5KFXA 1RQ0A 4OYBA 1BLUA 5IZHA 2N3OA 3CEDA 2GGPA 2DNMA 4MH8A 3FJ2A 4HVZA 4Q43A 1JOSA 2MCQA 4OJGA 3CQ2A 2V63A 2ASYA 5E0OA 1GX6A 1IBKC 2F9JA 4LVOP 2CJBA 4CO4A 2K7JA 3G82B 3CGIA 4QIVA 4ZVQB 2L41A 1VJQA 1Q16B 2VFTA 3CC4S 4QWDA 2FLOA 4WKRA 3KHGA 4CO3A 4V19X 4DR4C 1NYEA 4Q45A 1ZOTA 3W5XA 1U1MA 4WTYA 1SJ4P 1SJQA 1X4CA 1PBAA 2DKOB 2DISA 2ZUGA 4I1TA 3GV5B 1M1HA 4XO0A 3KHLA 3QO9A 4PROC 3V6KA 5H9EK 3RJMB 4JI6C 4ZP8A 1KP6A 2IYIA 3GILA 1S97A 2OMOA 5IT0A 2B6AA 3FVYA 1HI8A 3PTWA 1NKBA 1NSAA 3LO3A 2IFXA 2OSQA 2O67A 4CLYA 1HW8A 2VFRA 4IYQA 5THWA 1LK5A 2M8HA 3NS5A 3RU0A 3U1LA 1N48A 3J7YI 1SPBP 2C3OA 2YKAA 4ED1A 4C3LA 1XMQC 2BM1A 1JXVA 3KK1B 1X31C 4FYVB 5K14B 8RUCA 3HVRA 4OLPA 4B9SA 3C14A 3M4XA 5FJ4A 1CLFA 2JH3A 2ATCB 3CDAA 3UN5A 3ENWA 4ZVUB 2WOMA 1ZAVA 2D69A 2HVHA 2EWHA 3G2XA 2MZRA 4ZP7A 4K4ZA 1RG9A 3NPDA 3FCVA 3QT5A 5HROA 2WD9A 4ATNA 1SKRA 2ATWA 3PRDA 5H9FJ 4RW4A 3ETMA 2P2MA 4OXIA 1C1BA 2G13A 1GK8A 3QFWA 1RU2A 3O3LA 4TKTA 5C25A 2D74B 4UOHA 1SKUB 5DQHA 1IQZA 4DR5F 2NPIA 3RYLA 2JEGA 4DQSA 3MPDA 2YKMB 3LGMA 1WSVA 1WI6A 3SMZA 4LE5A 5ADZA 2V8DA 1XWLA 2WW8A 2C42A 5HVFA 3KLGA 1JKHA 2DHXA 3E51A 1S1UA 3D1QA 2AYMA 1YBTA 1JLCA 3G4SS 2DNGA 2H48B 3QPIA 2F9DA 1KHWA 2CG4A 2EFNA 3TANA 4DQPA 4RR5A 1HBNB 1VHFA 1HNZF 2J0SD 3CDBA 4DL4A 4P10A 2GQQA 1ZBTA 1RWVB 4DL6A 2KYZA 4LRBA 3GZ7A 2R7QA 4CLUA 1VQOS 4F02A 1BXNA 4PWUA 5DGBA 3DMJB 3NWGA 5EWEA 1UEVA 2YNHB 3ISNC 1JX4A 3PFEA 4ZA1A 2BV3A 5A6PA 2XB2D 2W9CB 3R2CJ 1TV6B 2B9YA 2ZOMA 1HNZC 2V2ZA 4NLTA 5BSRA 2RSQA 1F5CA 1WEYA 4G1PA 4O3PA 2D3O1 2IRXA 5D0EA 1S1TA 1KQSR 2MB0B 2CQBA 3L9ZA 3T1HF 3DU6A 2XO7A 4LBIA 2Q79A 4KTVA 1SC6A 3K57A 2YWKA 4EU0A 2IY5B 3GFYA 4Y34A 4DG1B 2QC3A 4FN5A 1KLMB 4KHRA 1FJ7A 4YY3F 4RNNA 3FUYA 1KQKA 4CO5A 2J7UA 1Y9OA 3GIRA 4USWA 4C8KA 4LF6J 3JSBA 4DV7C 2VQFC 3AJ1A 4X65F 5F3TA 4YB7A 1J5EC 2H4YB 3JSMA 1TL1B 2Z56B 3CB4A 4Q8EA 4GKKF 3W65A 3HDSA 1HKAA 3NP5A 2J76E 1GX5A 1NK7A 3N4WA 2DB1A 1Z2ZA 2EVZA 2VPYB 1Y0HA 2B4OA 2RRBA 3DLJA 1UJ4A 4R8UA 5E41A 3BQ2A 2X1GA 4H4KA 1HFEL 1VCTA 3DDIA 1DARA 2WONA 3BYPA 1VQKS 1JLFB 4DV3J 1FCAA 3I5AA 3UX2A 4NMXA 1RWWB 2CY1A 1VRUB 3QT6A 2RNEA 3VVTA 2AHOB 1N5SA 3RBDA 2F4VJ 1TKTB 5KT7A 3MD3A 4QR2A 3G6VA 1Y10A 4F4AA 4I9GA 1XRAA 4B08A 5IV3A 4BSZA 2XO6A 1TKXA 2HFSA 1SJRA 2ALYB 2K7KA 4J9NA 2HW3A 2AKWB 2WVDA 4OZ3A 2DHHA 5C24A 2UU9C 5GMDA 3TVYA 3W66A 4IG0B 4ICLB 2XSJA 3ZTRA 2ZJQQ 4DR7J 1HH2P 3PY8A 1MDFA 3T9NA 3RRGA 3O44A 4FYYB 3R6GB 3ZFVA 2RH3A 4NWBA 2HK3A 4CLPA 1U0SA 5I3UB 1MLAA 2DNPA 4LF6F 1FDBA 1V5VA 2WVCA 1IBLF 5DV9A 2NUUG 4CLKA 1RT4A 5CZVA 1VBYA 2FPHX 5DG8A 3HT0A 3Q2SC 1KQFB 2CPYA 1DLOA 4ZOSA 4B17A 4CIOA 4J9OA 2ZD1A 5DGAA 3TYTA 3G6YA 1K8AT 3NCQA 1YX2A 4HHHA 4QWAA 2O3DA 1WG5A 3O5TB 4LRFA 1H6KX 4KV8A 1YHQS 1QTMA 2CXCA 4R1LA 1P4EC 2GIQA 3I32A 1Q8IA 1IBKJ 1HNXC 1F3FA 1UEUA 3KDOA 5L38A 4C8MA 3TEGA 4JB8B 1L3SA 1ICEB 2EG1A 5T7LB 4I68A 4DV5F 3H5YA 2KT2A 2XNQA 3IMLA 2G4BA 4WV3A 3BDEA 4YHHF 3OJSA 1AYEA 3PVXA 3BYRA 5C42A 1UKKA 1NLKL 3T5LA 5EN1A 3CJQA 2Y4NA 2OPRA 1I94C 5A8KA 3B8HA 3VQSA 3RB3A 1K0TA 2OPSB 2YKQA 3K2YA 3MM7A 3I31A 2V4JB 2W2PP 2UUBF 2DGSA 4O23A 1EKRA 2MDAA 3PX4A 2ZBIA 2V8GA 1RAIB 3LANA 4UOGA 3KJVA 4HHJA 2RB7A 8AT1B 4KYZA 3TW0A 2JSXA 5DETA 1TU0B 2D3UA 4IR7A 1IR0A 3AT1B 4E0DA 3VAHA 1WTFA 2CVEA 2GW8A 3QLHB 4IG3B 4KIAA 1U47A 3N28A 3CC7S 4DSIA 1N36C 2IRYA 4GO5X 3CJ8A 4Z7CA 1VQSA 3V4IB 1IKWB 3LALA 2K3IA 4F3QA 2BE9B 3GFHA 4ZPCA 2OSRA 2JLEA 5GAEI 4OYWA 3QAUA 3V6DA 3G8SA 2ZH4A 2CWKA 3R8YA 3N54B 1NB7A 4G1QB 4YP3A 1BGXT 1NEEA 3OD2A 3UDCA 4X64C 4OJ3A 1EETA 3GP9A 4ED2A 1TFYA 1C4CA 2QMXA 4KV8B 2VU5A 4GVBB 1XMBA 3VCDA 4M5GA 4GXRA 1FJCA 4CT8A 5KFFA 1ZA1B 4FKYA 3M2RA 1SV5B 4DF8A 1NU4A 1S1WB 4M5HA 3K59A 5F9LA 3V6JA 3R5BA 1IM6A 3I07A 4ID5A 2VPWB 3U02A 1HBOA 3VGTA 5B0EA 1D9FA 2C2OB 4ZITA 2NSBA 1XQIA 1FERA 1T11A 2RVJA 3ZTPA 2UUBJ 4JI8C 1USPB 1W26A 1RWOB 1TTHB 1VYAA 2IPOB 3HK2A 5E7QA 4CH0S 4OX9C 3OFFA
chains in the Genus database with same CATH topology
3S1TA 1U49A 5A2QD 3FEXB 2JLGA 4DS5A 1MWZA 1F60B 1O90A 3GE9A 1IM4A 3GPCA 2WAQD 3OFHA 2DGUA 1MMDA 1X9WA 2OTLS 2RF2B 2R4FA 2QV6A 4B3MF 3TA1A 3W7BA 3DLKA 5D4PA 2PIIA 1Z1ZA 2VFUA 2HQIA 3VAKA 4ZCMA 4O4RA 4J9LA 4Y0FA 3TI0A 1ZTTA 1HBMB 4MH4A 2M7SA 3LP0B 3LAKA 3MUVP 2VOPA 3GG1A 2AYEA 4FBTA 3MM5B 1G6BA 1D3WA 2HGLA 1DFDA 2ZDOA 2EGTA 4ZVEA 4B02A 4I2QA 4DL0C 3DLEB 2ZOFA 2PA8D 4GC6A 3ISND 4FNHA 1IN0A 2ASLA 1IKYA 5MLCV 4DR3C 4DR3F 4LJMA 2ERRA 4HKQA 2KZMA 1NRKA 3GFZA 3MMCB 2JEJA 4XDDA 3JSRA 3HXMA 1TAUA 4KTTA 2IM0A 2IHR1 1CQNA 2CIMA 4K0KC 4C98A 3H98A 3VAIA 2HQ3A 3J7ZT 3PNIA 4ZCLA 2ZNYA 5E3PA 3VQTA 2DH8A 2W7PA 3UD3P 1TK0A 5FD1A 4K4TA 4DR7C 1S9GA 2FDNA 4BC9A 1CQMA 1OSCA 4F3MA 3M2UB 4C2MA 3KK3B 1YITS 1RT7B 1R0AB 5B0FA 1JMTA 4KC5A 1SKSA 1TVRB 3FCHA 2E8EA 3C6UB 4F25A 4A8MP 2OAUA 2HFNA 4Y2KA 3K7RA 4GO7X 1JLCB 4ECVA 5KFYA 4U5YD 4E8UA 4MAKA 3BO3A 3Q23A 2XS7A 1NJXA 4C3MA 3PX6A 2R2SA 4D3GA 4O3RA 2F40A 3LF0A 1LXNA 5KG1A 3W2VA 3VTIA 1VJWA 4URGA 2YY3A 2YKMA 2IM1A 4NYZA 4ISBA 1S49A 3GV8B 3V81B 4IO1A 6FDRA 1GH8A 1GTEA 3DRRB 2D1QA 1N33C 2YWHA 4URSA 2E5LF 5M2RA 2I5JB 2FLLA 2YX7A 2KFNA 2FVPA 3PRBA 2HHUA 3N6MA 2Y4OA 2APOA 2GMHA 4NLDA 1QJHA 4BS2A 2COLA 3HM9A 3MEKA 1N33F 1RP5A 1Q1KA 2E5HA 4R8UB 3UPFA 2PT0A 1FO1A 5L1KA 4IDKB 4PKDB 3FRZA 1VQ7S 2GHWA 3CTRA 4OJHA 3V2UC 3TO8A 3MM5A 1OIAA 4IQMA 4JV2A 3PESA 5D3GB 4NZ0A 1VRTA 2PO4A 2CQIA 4DX8H 2AGQA 1C2PA 4M1KA 3SDEA 3ZZOA 2YWFA 4MIAA 2VQEF 4I9FA 4TU7A 1YRTA 3IEUA 3FQLA 2D1TA 3SEOA 4RLFA 3IA0A 4OI2A 3H2TA 3HZEA 1JLBB 1YWXA 4K0BA 5GVQA 3CJ3A 2JFDA 1WF0A 1YG0A 2I1RA 1D9AA 3OR1A 2HVHA 2DGXA 2JLFA 2KRRA 2V9KA 2ZVSA 5FDLB 1S1TB 5T7LA 4JI3C 3US5A 4MKYA 2F3JA 3L7PA 2DIVA 2MKHA 1UMJA 1FKPA 1HR0C 5A0YA 3HFKA 1XR7A 2VOOA 4G37A 4DV0F 1NAQA 3RZAA 1LWEB 5AXNA 1HYSB 4RVOA 4IH6A 3MR2A 4D56A 3F41A 1BD6A 5KFZA 1YJ9S 1Y3JA 4A8OA 3N79A 3TRGA 4ZHRB 4TNOA 5LMNF 3MGJA 4K4WA 5J2QB 1S10A 3KLGB 2YKNA 4KFBB 5JVHQ 1C0UA 1FD2A 2BH1X 2DNHA 5FLXY 1RA7A 3R3TA 3SSSA 1H3DA 5KFWA 3HHEA 3NNCA 4LSLB 4OV1A 2HHHF 2MQPA 3VAGA 1HHTP 4DR1C 3LGNA 4XIUA 2EFQA 1MWYA 1NH7A 2OH2A 1W2BR 2OBVA 2EFOA 5DM7Q 3LW5C 4X65C 3M8RA 2GNKA 2OKQA 5D4NA 3DXBA 2DR5A 5HN0A 1UW4A 4IOCQ 4OL8A 3NYQA 3K5NA 2C2DA 2ZHAA 2PN6A 2X3GA 1IKWA 1D0EA 3HO1A 4RBTA 1JLBA 3UNGC 1J5EF 2OPRB 5D4LA 4FF1A 2P5VA 3Q22A 4DV1F 1SJ3P 4EYHB 3CSKA 3BGFA 1VBZA 3P49B 3SDEB 4YY3C 2L9WA 1N54B 2HRUA 3UDLA 3PW2A 2WP0C 2ZM6C 4I67A 4KB7A 4RUAA 2POKA 4I7FB 1Q8LA 4DBQA 1VLAA 3L8CA 3C8YA 5E3AA 2OPSA 3X3UA 4EEYA 1U8SA 2DGVA 4KBIA 1T7PA 2IAJA 5AE1A 2BQ3A 1V9OA 1XRAA 5D77A 4IR1A 2BE2B 2E66A 2B4UA 4C97A 5T41A 1OPIA 1ZYQA 3GQCA 4A48A 2ZE2A 4KFBA 3EPGA 3TUJC 2WK4A 2UVUA 1QAYA 2KN4A 2R7VA 2DHGA 4ELTA 1MROA 3KWMA 1X9MA 1R43A 3H25A 4W92B 2BJDA 3OHBA 3IS9B 3M30B 1OQ3A 2XMKA 4I69A 4XPEA 3DGPA 1VGYA 1SKWA 1GXTA 3HP6A 4Y65A 2QVXX 2ZH8A 3MFIA 1XMOC 4NA2A 4HI2A 3VAJA 4HPVA 2RUGA 2JWNA 2F8HA 2BYCA 3MEGA 1N2FA 5CD4H 2UUCF 5C25B 5CYJA 1NK0A 2F4VC 1XMOF 2CPIA 2MGZA 4NLOA 4ZK7M 2MY8A 5JVGQ 1N36F 2MKKA 1S4FA 1Q8BA 2V8VA 5EUHA 5K8OA 5KG0A 1OQ6A 2EC0A 2JMPA 1TKXB 2MHEA 2C28A 3QJJA 3OBIA 4YFUA 3BO2A 3I0RA 2BJOA 2VG7B 2K8GA 3Q0AA 5E2QA 4IRCA 1YQHA 2CFXA 2CQDA 2K3KA 5J2NB 1YTYA 2QEXS 3MR5A 4OX6A 1QVGR 2HNYA 4AL7A 5KEIA 2ZZNA 3KG0A 4FYDA 4J9RA 1U1RA 3H5UA 4HTJA 1T3NA 2CZ4A 3GV7B 3E7XA 3OVAA 1MD9A 1P7LA 1VIXA 3M32A 3OHAA 2HAIA 2ZH3A 2M52A 4A8SA 2BANB 2DPJA 2MB0B 4EZ6A 2HWHA 3ETOA 1U1KA 2XS5A 3PKYA 5L8RC 3H2UB 3ICLA 2W4CA 2J6TA 2QA4G 5IWAC 1YIJS 2ROGA 4CT9A 2ZITA 4JOUA 5T8SA 1ZM3A 2QSFA 2ASJA 1T95A 1JJ4A 3SCKE 4D4IA 1Q78A 4JI5C 3J81D 1CC7A 3BN4A 4BCAA 4R1MA 3I82A 4ED6A 4OHYA 4ZJZA 1KVIA 1TUVA 2RDIA 3DLGA 4JI0F 4DUZC 2W9CA 4X62F 3KYLA 1Q82T 2W8KA 1S1VA 3H8YA 4O3OA 3SSRA 2VV5A 3QIPB 1GT8A 3PM9A 1ULRA 3R5CA 4LF5F 3C6UA 2YNGB 2FB0A 4PXEA 1JLGA 1I1GA 1IJFB 1NHVA 2IVMA 3KOAA 2AWZA 4OFZA 4ZVGA 4OIXA 1D8ZA 1P8GA 5HO4A 5HROB 3CC2S 1NYEA 2E9ZA 2E8FA 3PO5A 2ROPA 2YWEA 1VQ6S 4K5SA 2PFFB 2CZVC 5D4OA 4X66F 1YSJA 1X5TA 1CC8A 1OPZA 1WELA 3CUNA 3HHLC 2BRLA 2LEBA 5E3CA 5K8FA 2KXHA 1EGAA 4NLSA 3MDFA 5BR8F 4USIA 2ILYA 4ZKAA 1FESA 2V9WA 5KFHA 2XMUA 3K0JA 4NRTA 1WH9A 1U2FA 5LXRA 4TY9A 3DHXA 5L1IA 5J2MA 1QAIA 4RNMA 4IOBA 4ITSA 2JHEA 4HLBA 3FZBA 1KQGB 4ECTA 2LCWA 1IBMC 3DM2A 2NYIA 3F56A 4RX6A 2W8LA 3CCJS 5IXUA 3SO4A 4UOCA 3D28A 5KOWA 2UUCC 5HMYA 4PRFA 4D4GA 2O1PA 5KFSA 5KFNA 2D7VA 2VASA 4HL9A 1V3ZA 1C1CA 4LFCC 2LECA 4MIWA 1AW0A 2RKIA 3DN9A 3QIDA 4OZ0A 1QAJA 2DBBA 1YJTA 2XLKA 5GAHI 2LQBA 5A8KB 2ZH5A 1L5UA 4QOTA 2RF2A 4WJBA 4OI4A 5DLGA 1U1NA 2DGWA 4LSNB 1LWFA 2FLNA 3TARA 1AUDA 2HWIA 5AXLA 2M8DB 5BUSA 2LXFA 4LFCF 1L3VA 2UUAF 3MURP 3M8QB 4TXSA 4TLRA 3PV8A 4KO0A 3N9UC 4JI2F 1KLNA 4PG6A 4ID5B 2UXBC 3D1OA 4MIBA 5J2QA 4ECUA 4NCBA 3AB4B 5LJ5Y 3DOKA 1N6QB 2ADBA 4C7QA 4TLQA 5KFLA 1QSLA 1HPZB 1FKPB 4WF9Q 1LWEA 5K9FA 5I3QA 3TUZC 1HYSA 2QW0X 4IH7A 4WYLA 2FTRA 4I64A 5I3PA 2AJ0A 5J1EB 4Q44A 2ATLA 3QGHA 4KRWA 3GKUA 3CD7A 2KJWA 4B3TC 4O3NA 3N5BA 2MY7A 4QR1A 4HH1A 4JI1F 5DJBA 2X1BA 2R2RA 2KI2A 5ITHA 3OR1B 4I6AA 1CVJA 4HYKA 4WKYA 5H9UA 3KLHA 5M2UA 1DRZA 2L9DA 2A1BA 5EX3A 1KEKA 1QUVA 1JWWA 2B7BB 5BSUA 3RAMA 4ED0A 2HJGA 3KLVA 3NCRA 3U27A 4KE5A 4JI4C 3KNGA 3I4PA 5A2QY 2XY7A 2LQJA 3SCJE 1HWIA 1JLEB 2ZM6F 3TNVA 3R5DA 4RWXA 2IJFA 3BF4A 2RS8A 4OZNA 1DAXA 4RBUA 1ZPWX 1RT2B 3D0HE 5E33A 1VFJA 4O4GB 1T94A 2MZTA 1H2UX 3QGGA 3BQ1A 2D28C 4LF5C 2MPUA 3QZ7A 2HMIB 2AF6A 4X4RA 1NJWA 1S6QB 1M1KT 4EZ9A 1T5HX 2Y27A 1DQ9A 3Q8PB 4IKAA 1HI1A 2ZH7A 1OO0B 1R8BA 3AHPA 4FF3A 1FUGA 2XULA 2FJAB 4ZDNA 5T14A 1Q7LB 2QLWA 3G6XA 2XHWA 4DV2F 1U45A 1E6YA 2C3YA 2WBMA 3CCES 2OPLA 2DGQA 1URRA 2FVQA 1S0VA 2WTFA 2CQPA 4JI3F 1ZZFA 2MGZB 4O44B 1FE0A 3CDWA 2C2EA 4UW2A 1U1OA 2VC1A 3DRPB 4QPTA 3K5PA 1TK8A 1DBDA 2CPHA 4RW8A 1RT7A 3KLFA 1YJRA 2B56A 2BABA 2EFGA 3T6BA 3TVKA 5AE3A 3UCGA 2QE5A 4DOZA 1S6UA 1Q53A 3K5MA 3M2VA 2QT7A 3TAQA 4DR6C 5IM0A 2GC8A 3M30A 3O2IA 1K1QA 5BJRA 4NYOA 4RWWA 3MM8B 5HL7Q 4WFNQ 3AF6A 5E3QA 3FCEA 4LQ9A 5A8WB 1S6QA 2UUAC 3KG1A 3L3CA 1Q86T 4B3RC 4DV6C 4AQYF 1ZTWA 1S9GB 2KJVA 5IQ6A 3CMES 3HJFA 3FEYB 2O5DA 1LWCA 3S6EA 3RAQA 2RU3A 1D8YA 2YCBA 4RW7B 2HZCA 4Q2LA 4XK8C 2Z0GA 4LT6A 1RTIB 2YNIB 1KOOA 2LXUA 2NSCA 4QYRA 2DGTA 1JK9B 3MEDB