4G1IA

Structure of the prgh periplasmic domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
189
Chain Sequence
ELDSLLGQRFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein prgH
publication title A Refined Model of the Prototypical Salmonella SPI-1 T3SS Basal Body Reveals the Molecular Basis for Its Assembly.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Cell invasion
total genus 70
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4g1iA02
4G1IA 4ALZA 3GR0A 3GR1A
chains in the Genus database with same CATH superfamily
2IC3B 5GADI 3MR3A 3LGHA 1HIYA 2XM3A 1KR4A 2ZH3A 1IXKA 4LF5J 4FPIA 4RR5A 2N3OA 4KKOB 2UU9J 1QTNB 3VNRA 2B4UA 5LMUF 3MEGA 1G1XA 4HPVA 3GJRB 4FTFA 1MMDA 4BS2A 1GXUA 2HVHA 1YKWA 3T1HF 2XMVA 3QJJA 3CSKA 4BDPA 3W66A 2FVRA 3CCJS 3M2RB 3PRBA 4JV1A 1Q86T 4YMEA 4B9UA 2XMMA 4C7QA 5LMNC 3KLGB 4RPFA 3RR8A 5H1SV 2BJ1A 3NP5A 2B4OA 2H5JB 3HD2A 4BLGA 5FLXU 1JIHA 1IR0A 1GMVA 4JI2C 1X0PA 5H9UA 3GCWP 2XSJA 3TUFA 4ILLA 1HBNB 1RAIB 3QAEA 5AXKA 1ICEB 3E7XA 1XR6A 2AQ4A 4DV4J 1LW0B 1P8GA 2FLLA 5C42A 2F7VA 1B64A 8ATCB 2I8EA 3CE8A 1HWUA 2QVYX 1M1KT 3CC7S 2D28C 5DM7Q 1PAEX 1EARA 1RT4A 3CJ4A 2Z57B 1XTZA 4NMLA 4NA2A 1HQEA 1U48A 3MTKA 3H4BA 1WSVA 3I0RA 3FZ2A 5J2NA 1BQMA 4MK7A 4R0MA 2C2MB 4XX2A 3ENWA 3SQGA 3MPVA 4RWWA 3VAHA 9RUBA 1GT8A 4DSKA 3LNVA 2BA9A 4TY9A 1OPIA 1PO6A 1JLBA 2IA6A 3NPDA 4K0BA 1FERA 1S57A 2GCFA 1AW0A 2QLJB 1KONA 1OWXA 1JXEA 2YWHA 1X4CA 4X4RA 3EWGA 3W8GA 5HVGA 3L7UA 2C2KB 4MH8A 1HYSA 2DR9A 2IAJA 2JLFA 4QWAA 2AW0A 2GHWA 1VQ5S 2QV6A 5C5JA 1S48A 2GVZA 2UV8G 1BHNA 1XBWA 2PMZD 4K4ZA 2UUTA 3F56A 1TFWA 1YJUA 4KKOA 2IHR1 5DLGA 3R9WA 1VC6A 1ZETA 1FJGC 1X9WA 3FCVA 2HHTA 1CC7A 2IRYA 4DSFA 3VAJA 3M2RA 3NGKA 1S4EA 1LWXA 4IYQA 3A3PB 1JKHB 4WFXA 2R2RA 2Z8QA 2OP5A 1RT5B 4FNHA 3H59A 2MJUA 3BB5A 4B3TC 5F8JA 4JV0A 1VQ9S 2OEMA 3R5GA 1VBXA 2COLA 1NO8A 4DBQA 1HBNA 1U1QA 4N8OA 1B0VA 3QT8A 3CJ5A 4B3SF 2KDOA 3OPKA 2G4BA 1N8RT 2E1MC 1RSCA 3LP2B 3ET6A 3THVA 1N0UA 2C3UA 1Y5LB 5CYMB 4IO9Q 2QA2A 2ZOGA 1UEUA 2W2OP 4N7TA 5DDQC 1KLNA 1HWLA 5MLCV 4WZQA 2E5JA 2KM8B 5BXIA 3QLHA 1VQYA 1FDBA 3TQEA 4OHZA 1M5KC 2HRTA 2IJRA 4YN3B 3DMJB 5D0RA 2ZUGA 1JX4A 3HT0A 4C0BA 1V3ZA 4FZVA 3M1VA 1RHKB 2NXJA 4B02A 2ZH5A 5KG6A 3TJ9A 1K73T 4ECVA 3SCKE 1F1BB 2GV1A 3PACA 3GR0A 1XK8A 3J81j 1VC5A 2FZCB 3JQJA 2AGQA 2E8FA 1OQ3A 1HBOB 5GAEU 3CDAA 3BH7B 1VI7A 4NZ7A 2PO4A 1CBKA 3PBKA 2VQFC 4NLYA 2ASJA 1HW8A 4K8RA 3V6JA 4FS2A 2AV5A 2E1PA 2NYIA 4J9NA 2RJZA 4QYZK 1D09B 3NAIA 1BD6A 3PR5B 4X66J 2VQFJ 2V2ZA 2EFVA 2C2EA 1SVDA 4ZLLA 2YWEA 1SL2A 3NYRA 1KBRA 3N54B 4LBPA 1P27B 3G87A 2OHDA 2V6AA 3D0GE 2DXDA 2DVIA 3IR5B 2DPJA 1C2PA 2MHNA 2X51A 2DCLA 3M9NB 4IG0B 3L9ZA 4R1LA 2P2BA 2CKWA 3CC4S 3UFCX 4H4OB 1E6YB 1RT5A 1MSWD 3C14A 5L38A 1NJZA 1IKYB 3AD8C 1SJQA 3EQ6A 3MI7X 4X62F 2E7VA 4HYKA 3N6MA 2A6OA 2K2PA 4K4SA 1OJ4A 3LP2A 1BQXA 4EYIB 1N5YB 1MMNA 3ILOA 2HFUA 3TR5A 3A12A 1NPRA 2E5HA 3PYFA 1JJCB 1HARA 4OYXA 4RNHA 2MTLA 5JMNA 2K7JA 1WDTA 3FCCA 4LSZB 1EKSA 3R7SB 3VNSA 3RBEA 1OQ6A 2M4MA 1H74A 3SFGA 4O3SA 4OYAA 4KHPJ 1UEVA 4X4VA 4GXQA 1PBAA 3KHRA 4NDNA 1Y5NB 1PJ5A 1SBRA 1SKWA 1GAOA 3US5A 4B17A 4OZ1A 3CJEA 1OMSA 1X4EA 3GFYA 2H3EB 3HHEA 4K2JA 1RTJA 2GAGC 2KJWA 4ZOSA 3UD5A 5LXRA 5G4DA 2JMPA 4ZHRB 1UEKA 1T95A 3NMAA 3CULA 2CQ0A 1HQUB 1HBOA 1GXLA 1RJJA 3FBCA 4MMOA 2F40A 5LSLA 3JAMD 2VASA 1WHXA 1S0NA 3DLJA 3BGOP 1WC0A 1T05A 1L3KA 3Q83A 3HVAA 2V2VA 4EATA 1VBYA 1N88A 3SSRA 4UT4A 4Z7CA 1G2EA 4USTA 5MAOA 2OGUA 4LQ3A 1X4AA 3KK3B 5AE1A 2XR1A 5KFYA 4ED7A 2HRUA 1W7WA 1LK5A 3J7Z5 4MKYA 4JI0J 4CLWA 2MEWA 2BJOA 2F4VJ 4YB6A 3MMCA 5CABA 2FVQA 2WONB 2C3MA 3HKZD 2KU7A 3ZZOA 5GAGI 5ETQA 5KFGA 1TL1B 3A4TA 3OL7A 4H4OA 1E6YA 4MK9A 4OYOA 2Y9HA 2QFIA 2VL1A 2M9KA 4HHHA 1TKDA 4PG7A 1IKYA 2NREA 3AB4B 3DRSB 4LRAA 1U1KA 1N48A 3KLFB 3OL6A 5F3TA 3UWTA 3V6DB 4NE9C 4HTJA 4GO7X 2QMUB 3R5CA 5HN0A 1PC4A 2B7BB 1YJNS 3H7HB 5KG3A 2HGNA 1Q7LB 2PA3A 3DFEA 1T9YA 3GYNA 1RG9A 1NJXA 2VJUA 1AT1B 5KFLA 3P5TL 3I5BA 2XQCA 2D74B 2V4QA 5L46A 4Q7AA 3T9ZA 2LA4A 2HZVA 2UVVA 1Q95G 4IO1A 2MQQA 1VS3A 1Y00A 2DNKA 2JSXA 2JEFA 1X8DA 2CPFA 3LUSA 4DX7A 1VQKS 3GYGA 4GKJF 4H4MA 3DOLA 4UQTA 1LNQA 2XLJA 3QZ8A 4AL6A 5HQLA 2J0WA 3S8SA 2XGQA 1U09A 1YJTA 4X65J 4J9MA 1CC8A 4ZHRA 2VG7B 1FFWB 3ENQA 4BC9A 3M8ZA 1JLAB 3LP0A 1U7LA 4O3PA 2FZKB 2BOPA 4HI1A 3HK2A 1EETB 3MGJA 1UVJA 2ZD1B 2UP1A 4KY3A 1TK0A 3OVSA 4U9RA 1S0VA 3SV3A 5I3PA 2QYCA 1MNEA 1N6QA 4DPXA 4DCVA 3KK3A 2I1RA 1T9VA 2UUBF 2KTQA 4MKVA 2P9GA 3MPWA 1XMQC 2ZH1A 3QSIA 1ZZFA 4CO5A 3BSNA 4BWMA 1GEHA 4DJBA 2WONA 5KFZA 3K8WA 2YNIA 1Y7PA 3RAMA 1V6HA 1VIOA 3JSRA 4DL5A 2UXBC 4EUVA 5IS2A 3QFHA 3QBCA 4OHWA 5HP1B 3FBFA 1Q8IA 5L8RC 1BMQB 4M5GA 1LEOA 1RLDA 5L39A 5KFHA 4AQYF 4DR2F 3CF5Q 3QT6A 4Q5VA 3DRSA 4PUHA 4DG9A 2UXBJ 3KLFA 2R7RA 2JZ5A 3CTRA 3V6DA 5KT3A 4PZPA 2HGMA 2MLZA 3LF0A 1DTQB 2GZOA 1XR5A 2CDQA 1QUPA 3A4IA 2XSFA 4OL8A 3I5CA 4DR4F 4RLQA 3O2EA 3FZBA 1U1MA 5T41A 4F4KA 4Y2AA 1W26A 5CXTA 2JEGA 2HQCA 2KXFA 3MEDB 4WF9Q 2POKA 3OHAA 4ISBA 4N56A 4TXSA 3CEDA 1KQGB 3ZZPA 3CDEA 2OD6A 2UUCF 1XR7A 2L48A 1PC5A 3BEGB 4N8NA 3GV7B 4ECXA 1VHFA 2DB1A 1PJ6A 2L41A 4IUFA 1KNZA 4G3IA 4LF8F 5T8TA 5B0DA 3RAQA 3A8EA 2VG7A 1UW4A 2OFHX 2QEXS 4LF4J 2YCBA 4DV5C 5L9XA 2VG5B 3PNIA 1JLEB 3IAS9 5KG1A 4ZVGA 1JLAA 3CQ2A 1HBUB 3L8CA 4ZCLA 4FF3A 1SC3B 1EETA 2IVYA 5BURA 2ZD1A 2FJVA 4DV5J 2LDYA 2DR5A 1RB0A 3N9UC 5DETA 1AZSB 1NK9A 4ECYA 3TA0A 2YKNA 5ETRA 2W2QP 3M8QB 2BW7A 3UCZP 2JVRA 5HQ8A 1H2TZ 5IQQA 3MCOA 2KXHA 3F0NA 4J9VA 2CFXA 4HT7A 2HQDA 1ULRA 5B0GA 3I55S 3DHVA 3CCVS 4QBUA 1VLAA 1KVKA 3KKFA 3NRBA 3JSYA 2ALZA 1TZ0A 1RWNB 1CEZA 2BVZA 2HHHJ 3UI3A 4CO0A 2N82B 4LE5A 1P1TA 4WIIA 2E7WA 2VF3A 3K8VA 3AA8A 2VDHA 1DQAA 1IVZA 3CD6S 2XY5A 4OX7A 3ENVA 1URRA 3W64A 4YB7A 4RBTA 3KG0A 5LMUJ 3N2QA 2RUSA 1YRXA 1HKAA 3AJ2A 2E5LC 3I9ZA 1DTQA 1NY8A 2J5AA 1FJCA 3R6LB 2CG8A 2D1SA 3NYQA 4OZ3A 2B5JB 1WG1A 4DCTA 3WC2A 5F9LA 2J7UA 2E5LJ 5AXNA 3D3CJ 4EYHB 5I3QA 3LNOA 3MEDA 4R5PB 4B9LA 1YRTA 4BHQA 4F3QA 3MXHP 2DGOA 1SL1A 3HVWA 1RAFB 2UUAC 2YNGB 2PD1A 2D1CA 4OHXA 1X5TA 3R7NB 2ZNZA 1K1SA 4DR1C 3GQCA 2OKQA 3TA2A 2RU3A 4M94A 4FBTA 3KOAA 2ZITA 2IYIA 1FEHA 3OTOC 4DI6A 4DPYA 2LA6A 1QVGR 2R8KA 8RUCA 2RQCA 2BABA 5JVGQ 2VG5A 1W2BR 2PDAA 5A8KA 1JLEA 3PYEA 5FJ4A 4TY8B 4AUKA 3G7SA 3NMRA 4B9NA 1IJFB 3MMBB 4KGMA 1TQLA 3T1YF 2EC2A 1ZB8A 1VHIA 4M5KA 4TQSA 3H2UB 2HHVA 4ZLJA 3LP1B 1AZSA 4Q2MA 2XLKA 1I94C 1S9GA 1EIYB 1DBDA 3OVAA 3I4HX 2AIRB 4P10A 3EVOA 1RAHB 4C8NA 2ZVIA 4OZNA 2YNHB 1C0UB 1CJUB 4ERDA 3D4JA 4QIFA 2J6SA 2GGPB 2KYZA 4ES3A 3CJ2A 1S77D 2EFOA 2IJNA 2XS2A 4LRFA 5BSWA 2MQNA 2JH3A 2VDIA 5GADU 3CW8X 4WBFA 1NJYA 4DL3A 2QGFB 2LXIA 2IVMA 2ZC4A 5DDPC 5M2UA 3VAKA 4LFBF 5AXMA 4XDCA 3NOCA 3WIVA 3LW5C 2IRUA 5IFMA 2KI2A 2DO0A 3FVYA 2VD3A 1H73A 3RB0A 2B5JA 2WSEC 1YG0A 2AYEA 1MG7A 2U1AA 1TR0A 3M6UA 4P7TA 3H25A 3CQ3A 4DX5A 3GG1A 2Y0BB 3KNGA 4R5PA 4K0KC 4DUTA 4JI6C 4B3RC 4ATNA 2P5VA 4RUBA 3AJDA 1P6TA 1XNQF 2CWKA 3SEOA 3H4DA 4P2XA 2ZKUA 4JI3C 2F65A 2HBYB 3KUEA 4B3SJ 2LFVA 4ETZA 2HIYA 2FQQB 2HFZA 4JI6J 2GHPA 3PHEA 1VLOA 2UXCC 1DURA 3IP0A 5DLFA 2F1FA 1BWEA 4K4XA 4K4UA 5IWAC 2YX1A 2ZZNA 3KK1B 4PXEA 4TY8A 2UXCJ 3MMBA 2AGPA 1UWDA 1QUVA 2KDNA 2I9SA 1RWXB 1YJVA 4QQBA 3EDRB 1FKAF 1X5OA 3LP1A 3B8HA 1KWMA 3UVJB 3LO3A 4ER8A 3IWXA 2KFYA 3H42A 5HJXA 3HLUA 4K4TA 2YNHA 3TUJC 3BF4A 1ML8A 5JRHA 4C11A 3L09A 3PW0A 1UA1A 2RKIB 4JI1C 2GGPA 2EFPA 3FUYA 4UOFA 5EDWA 1S59A 4DUZC 2E8EA 3J7A1 1Q1KA 4DDFA 3NS6A 2R7UA 5JUMA 1U0SA 4P75A 3DLKB 2ZM6F 2P6TA 2VICA 3CCMS 1U1OA 4IQMA 2R7OA 4ZP6A 2DNMA 2AYGA 2Y1RI 1MMLA 1A7GE 3OL8A 1TL7A 3VAIA 4U7CA 2JWNA 1SCJB 1UZHA 1JWWA 1S6UA 3IEVA 1TL5A 3UZ0A 1RT6B 3GONA 3DOMB 4LUBA 1NHUA 3FRYA 4W90B 1PILA 4OFZA 2RF2B 5DG7A 1RWOB 1AUSL 4IR1A 3AQPA 2XMWA 2R9LA 5HJYA 2JRSA 2BJDA 5GTDA 4HHUA 5J2MA 5KFAA 3QRQA 4GO5X 2LQ9A 4A8WA 3P5BP 3TEGA 3OXFA 2WBRA 1B99A 4KT0C 4NYZA 4X62J 3DDIA 4NCBA 4OIXA 3VZHA 4UUWA 2CQ4A 4OHYA 2A1BA 5B7WA 3FQKA 3L7OA 3NLCA 2NXUA 2NPIA 4U8VA 1HNWF 2B0GA 2NXCA 4PXDA 5HBMB 3B6BA 1LW2B 1IKVB 2DNLA 2DGQA 4LF6F 4RNFA 2MY7A 4DR3C 3V2UC 3T19A 3AOAA 2L9WA 1R8AA 3KK1A 4NWBA 3QWUA 1N33C 4J90A 2ASBA 4LT6A 1N5TA 2MQ8A 4ZCMA 2P2CB 5KFIA 3S1TA 3CD0A 1NHKL 2Y8WA 1UAWA 4ZLPA 2F9JA 3MOZA 1USPB 4NEZA 2W7AA 1N33J 4I6YA 1IBCB 2CQ2A 4F04B 5DQIA 3UVJA 3MM8B 1VQLS 4ID8A 2HYIB 4TQRA 4QPTA 1IBMF 5DO2A 1QAJA 3ETOA 3KG4A 3SXLA 2APOA 2DTJA 1VJQA 1RWVB 2EKYA 3QGIA 4KB7A 2RKIA 4KFBB 4LFCC 3QWPA 4FXVA 2ZOFA 2JL9A 3RBXA 1AROP 4HTIA 1KTQA 2NPFA 3RRGA 2V94A 2HBZB 3UX2A 1M0SA 1OO0B 3DGVA 4OI1A 4LFAC 4X4PA 4LFCJ 2OBVA 2BQ3A 2IM3A 2Z2ZA 4CYUB 4JB8B 3TO8A 5B08A 4LF7F 2DT9A 1B7FA 2ZNYA 3DHXA 4I4BA 2DYAA 4RBVA 3VF0B 4WK3A 3DOMA 4RW6B 1HNVB 3V6KA 1SJ4P 1T7PA 1ROFA 1RKIA 5LT5A 3RG2A 1TUVA 1EP4B 4L2ZA 4LIRA 1MU2B 3PO5A 4NYOA 1NK7A 2Z56B 3UNGC 1PBUA 2ATCB 3EICA 3EGNA 1QAYA 4C2MA 2UVRA 1Z1ZA 2Y0SD 1SQEA 3K58A 3MCNA 2B6AA 2MLYA 4EEYA 1JLQB 3SIPB 1VQOS 3J80Y 2PT0A 4S0MA 2BOAA 3VGVA 2AP6A 5E7QA 3FQLA 2J9DE 3Q8RB 1O51A 1LW2A 4QOTA 2KG0A 3MMJA 3C66A 4Y2CA 2GVDA 2W25A 5E3CA 1P9QC 2ONFA 4C48A 4YQWA 3SMZA 2YX7A 3VCDA 2D3O1 4YY3F 2DH7A 2CJYB 2KKHA 1L2FA 1X4HA 1R3NA 1K44A 4IR9A 2DEJA 4DCJB 4JI7F 2H9ZA 3N01A 2ZJQQ 1ZAVA 1BGXT 1HR0C 1TAUA 3T5KA 3EJMA 5KFNA 4GKJJ 4DFMA 3E8OA 2RMLA 3Q8YA 3PG9A 2DIUA 1Q8LA 3DYAB 2YKMB 2MQPA 3CJKB 5E3PA 2YWKA 1USPA 3OHBA 1AXQA 1T9WA 1U2FA 2C2NA 2M7SA 2C3OA 4JI4C 1HR0J 3MM8A 3D6FB 2R3VA 4A8OA 4L3KA 5JXSA 4Y34A 3CJ8A 5KOXA 2JX2A 4CH1A 2YWCA 4IH5A 2EFNA 1R27B 2VFVA 1U26A 5KTQA 1S0OA 1SXLA 2DRAA 2GIRA 1K9MT 1GQEA 1QD1A 1S7HA 4RNMA 1UMJA 4LF9C 5BUSA 1D9AA 2DCUB 4N5SA 2DNOA 1DY3A 3MZIA 1Q0NA 4LRBA 2OEKA 5AJ3F 4LJMA 5U47A 1SKUB 2UXDC 4F4XA 1WUUA 1L3VA 4XK8C 3R7BB 5F8IA 5CZXA 1TL3A 4C8MA 3D9BA 2UUBJ 2I38A 4HT5A 2HHPA 3BREA 1X9MA 4PYAA 3OTEA 3LANA 5G0RB 4ZJZA 3RR7A 4RW6A 2Q6CA 4WU3A 2OPSA 3GV5B 3M8WA 2DGSA 2VB6A 4PQAA 1EP4A 3C15A 1R89A 4OYPA 1HHTP 5GAGU 4QCLA 3CO0P 3DRRA 3SO4A 1K1QA 5HVHA 1KVIA 2XG8A 1NPPA 3MR6A 3DDNA 4CO4A 2V63A 3G6YA 4DLGA 1RWWB 4I6WA 1CJKB 1L5UA 2CADA 4DR2J 4DV0C 2W1BA 1LKZA 2OUGA 4LREA 2NCLA 1WTBA 2YXLA 3R2DJ 4F3OA 2HAIA 4DV6C 1JLQA 2JNVA 4WP9A 4YS2A 4WWSA 4Q0BA 4TLQA 4IOAQ 2OD4A 3EZ5A 2MHEA 4DV0J 4MK8A 3OR2B 3PJWA 1F60B 3NCPA 4AL7A 5C24A 4DR4J 2HIQA 4DV6J 4DV1C 2BXJA 1SUQB 3IN5A 2B4PA 2EC0A 4JYAF 5BR8F 4HKQA 1AB8A 2QL9B 1DFDA 1BXNA 2WCXA 4DQPA 4DQQA 2FJWA 2J6TA 2UUCJ 3FMBA 4J9RA 1YX2A 4DV2F 1RADB 3NCRA 4QIGA 1C4CA 2QN6B 4F4YA 2HQ3A 4K2XA 3MMAB 1JB0C 4N47A 3DYAA 1XEZA 2YKMA 3CCRS 1NEEA 3CJKA 1NCLA 3BSOA 1N56A 1CULB 3DLHA 1HNZC 1NXIA 3GV8B 2M5YA 5EX3A 1NKCA 4OJHA 3KLHB 1NSQA 3TRGA 3OR1B 2B9WA 1T11A 3H8YA 3H5YA 5KG4A 3R5JB 4C8LA 2E9TA 4EO8A 1HNZJ 3G6VA 4N76A 2BBEA 4EMDA 5CAAA 4LBHA 3M8SA 2Y1LB 3GE9A 3WC0A 3ZNUA 1PG3A 1SC1B 5D4OA 2IFXA 1NUEA 1JOSA 4H4KC 1RQ0A 1XNRF 1VIXA 4ICLB 3W2VA 3CPWR 2DGVA 3FDSA 5CQGA 2FHMA 1JLGB 3PDNA 2CPIA 4EBEA 3M6VA 1YIJS 3GB0A 4M5DB 1SIZA 4P73A 3OT9A 1KKHA 1RHJB 2XY6A 1MROB 3CT9A 1AUDA 2YPZA 3BS9A 1U02A 1NM2A 1FTRA 2C2DA 3FBEA 4TU8A 2ZBIA 3GFZA 1RWPB 1S6PB 4WFZA 3PY8A 1U6FA 5L1LA 1IKXA 3ZO7A 2CPHA 2R7TA 3RW6A 1PYOB 2YX4A 4DV3C 2AD9A 2GQ2A 3DKDA 4J9PA 3TUIC 3D6HB 3U1NA 1V3SA 5D15A 4TNOA 5ETLA 4DZDA 2EFQA 4IOBA 4AD6A 1Z2LA 2FLPA 2ZH7A 2H65B 4DMZA 1F9HA 1CS4B 3RB6A 2OI2A 3NBPA 4NCAA 5ITHA 4R25A 1R8HA 3PIPQ 1SUQA 1VEHA 1FKPB 2K06A 3NGDA 1IM6A 5HLFB 4AXJA 1NDKA 2CDRB 3PW5A 4GVBB 4FUTA 3M7VA 1F3FA 4W4MA 3PRVA 4PYDA 1AFJA 1HBMB 4JV5F 3RBZA 2P02A 2PGCA 3FSIA 1VQNS 2JFDA 3GTYX 2YBVA 3KLHA 1Q79A 3S6EA 3MUVP 1FRMA 2H4YB 2AWZA 4USUA 3OR1A 4DR6F 2YWBA 2ZHBA 1H6KX 1CQMA 1PSDA 2MPUA 3TDEA 2D1QA 4NZ6A 1RA7A 1UVNA 1UETA 2BEFA 3IWNC 2D7VA 3HI9A 5E0OA 3EPIA 4RVNA 3A13A 4Y2IA 1RUSA 3ZZUA 4GKKC 2F9DA 2OPLB 3UCGA 4CLUA 1QJHA 3KMSA 1FWPA 4ICLA 2W01A 4RW9B 3CXCR 4YHHF 4O3RA 1FESA 1TKZA 1Q5YA 2OLWA 1KQSR 4X4UA 5K14A 2V9KA 1N5VA 1FO1A 2DHHA 4G37A 4WJBA 4M5DA 4EGLA 3BO4A 1WC1A 2V8DA 3ISND 3R97A 3D7SB 4OX9F 1FUGA 2L9NA 1MROA 4QU6A 2ZJPQ 3MM9B 5H9FJ 4F7VA 2AJ0A 3RUBL 3R1HA 3KLIB 2C22A 3FSYA 2DY1A 2EK6A 3X1LB 1S6PA 3D68A 2BW2A 1B4SA 1LQ9A 3JTPA 4F36A 1NK0A 4OJ1A 4OI0A 2NS1B 4KHRA 2FPHX 4C97A 2ZC3A 3IG1B 3VGTA 2F63A 1G4CA 2C1EB 3DM2A 2PI4A 3G96A 3UCUP 1FKOA 4LFBJ 1KQKA 4OZ2A 3QIPB 1RHMB 1S1TB 5A2QU 1R31A 1KLMB 4UOHA 1IR2A 1SIWB 3UNYA 1I1GA 1N32C 5BJRA 4ZPWR 4V19X 3HCXA 1T8EA 4CNZA 1FEEA 1FKPA 1MDBA 2D7SA 1XNQJ 5IFIA 1S6QA 1UWBB 3ZTQA 5C7PA 4J91A 3Q8QB 3EZUA 4URQU 4IRCA 3D1QA 2FZGB 2NSBA 1X60A 1RU1A 2Z2LA 1HBMA 2D41A 1C1BB 4O4GB 1VK8A 2GW8A 3IFEA 4MIWA 3VQSA 4ZDNA 1CG2A 1QVFR 2EKNA 3CO9A 4L72B 4DG8A 2GS8A 4ANCA 2XGPA 2Q1LA 5IT0A 1OY9A 3B82A 4M63A 2YH1A 2CPYA 4ZCIA 3ZTRA 3OJUA 3TARA 2VPXB 2BJ3A 1YQHA 4FYXB 2IMOA 1ZPWX 2MKJA 1N52B 1S5ZA 3DDKA 2J0XA 4AFFA 4UUXA 5IC4B 3M6XA 2OPLA 4IG3A 3VAFA 3POTB 2GQQA 1D9DA 3UDVA 3QGPA 3IBWA 3KXDA 1BQNB 4WTOB 4NXNC 2KH9A 1UCNA 1K8AT 4UY85 2NUUG 3BPDA 3HJVA 5KAKA 3DN9A 2ZH6A 1B70B 4PRFA 4K4WA 2DNPA 1YK9A 4RU9A 2RS8A 4NXNJ 3E51A 4FYDA 3BO3A 2V50A 2B3TB 3MDFA 4DWIA 3EXYA 3HHKA 3IRXB 3MM6B 2ZM6J 4NI2B 3K17A 2I2YA 4JI8C 2YPYA 3QFWA 3KLIA 3TX0A 1N36C 1VQ4S 1P7LA 2FC9A 4IDKB 2WZ1A 2HHQA 1TVRB 1VRTB 1YJWS 2MB0B 3I08A 3IG1A 4JI8J 1HWKA 2FJAB 1PA4A 1N36J 1FWLA 3BGFA 2PROA 1Y5IB 1VFJA 3EGZA 3MR7A 1S1TA 4HVZA 1RABB 2OIHA 2BJ9A 3J7AN 5K20B 2B7CB 4YDDB 2Y4NA 2C42A 1OYDA 1REVB 1RGVA 4NRTA 2I5JB 4FNIA 2ZE2B 5HI7A 2LCWA 1UWBA 3PV8A 2WB1D 4JI5F 2F4FA 3KLVA 3IO1A 4E0DA 2QL8A 4U96A 4WYWA 3JQMA 1HNWJ 2QMXA 3KJQB 1OYEA 5KFSA 4CDIA 2DH9A 1QSLA 4QWBA 2CRLA 1ACMB 4DQSA 4O4GA 2HG4A 4A8XA 4P6QA 3UDEA 3I6PA 3MPUB 4J9LA 4DR5F 3NEKA 3T6BA 2MZSA 2R8JA 3FC9A 1XN9A 3ISNC 1RAGB 2WSFC 2QL7B 3N28A 4F2RA 1QE1A 3MF5A 4NXMF 3H5UA 1XJWB 2E0GA 1AA1B 2B9EA 3EZOA 2HHWA 3C5EA 5EX0A 2EBEA 4DN0A 2W9BB 4F26A 3QJPA 2XHWA 2BJ7A 4BSZA 1BWVA 4LSLB 5F0WA 3POTA 3DU6A 5J2PB 1RBOB 3G6ES 2QMWA 4X64C 3V4IB 3NS7B 2DXFA 5B0BA 3BO2A 3PROC 4YDXA 3BDEA 1N54B 1KFSA 2IA0A 4HACA 1KTVA 4DG1B 3HF5A 3CCUS 5C25B 5J1PA 1NNDA 2KVQE 5HMYA 1ZS6A 2CNKB 2NXNA 4A8YA 3IRXA 4RUAA 2BANB 4NI2A 1IBLC 2E1CA 1U47A 3MEKA 2G2YA 4TYBA 3I0SB 5E3RA 2PEBA 2A3JA 3ETCA 4USWA 1J5EC 2R2UA 1XMOF 4IDKA 1F5AA 1RBLA 3MPYA 2DPLA 5F3ZA 1TVRA 1VRTA 4B3MC 1KVJA 2O1PA 3AH6A 2AEFA 2D3OR 4ED2A 4CLSA 7FDRA 1J5EJ 4YR3A 3Q8SB 4A8FA 3VV2B 5F8LA 3MEEB 5A0YA 4RMNA 3MD1A 1H2VZ 3BR8A 3IAM9 1LXJA 4CLLA 1EQ0A 4DUYF 2DHXA 1FDAA 3W1YC 4HL9A 4RUCA 2AKWB 2XMKA 2VC0A 2QO3A 3RJMB 3A8JA 5KT7A 4OYCA 1CJTB 3DGPB 3PXGa 2IIHA 2D1RA 2RU9A 1GFWB 4OYBA 3K6RA 2ZZTA 1Y3KA 4PUOA 3MCSA 3HDSA 3EERA 1TK8A 2AX0A 1TKXB 3ZTOA 1SKSA 3I31A 3ZZTA 2VZEA 4FYVB 1TAQA 3E01A 5FD1A 4YY3J 3Q0AA 2PSZA 1O93A 5K5MA 4DL4A 4JI7J 2VJVA 3QO9A 2XMTA 2QJ3A 2PE8A 1WF0A 3SSSA 2W9BA 3CCLS 1FCAA 3C16A 4LSLA 2CVEA 3MTJA 3N6LA 5J2PA 5GMDA 2NQPA 3V4IA 3KMQA 2HAFA 4U67Q 1CJVB 3CIMA 3G86A 3IM9A 2MY8A 4ZCKA 2RNEA 4L4QA 4D3GA 1NB7A 2IRXA 4FF1A 4C6AA 5D6GA 4N41A 1WDDA 1I51B 4HDHA 4DEZA 4LF5C 3P45B 5C25A 1KC8T 1FRLA 3TAMB 1WJ9A 2J9CA 3AJ1A 1SJ1A 2BANA 2DRDA 5AJ3J 5CYQA 3I0SA 2M2BA 3EGVA 3N0VA 4PG4A 5GVQA 1B0TA 2HS4A 3H40A 3TQ1A 2RILA 2G2OA 3IBCB 5C2GA 3GIIA 2CJBA 4G1IA 2LEBA 4WZMA 4RW4A 4WIQA 2OMLA 2P8IA 5EGYA 2O66A 2BM1A 3ILLA 2VUGA 3MEEA 1I3OB 4PXCA 2CPEA 1UWAA 3IS9A 4DV4C 3C6TA 1Y10A 2HNZB 3A8KA 4X4TA 1KHVA 1T9UA 2MKKA 3MM5B 3ZTPA 1F3VA 3ZZYA 2HVDA 2E1RA 3D6MB 3NI2A 2OPPB 2FJDB 4I64A 1CJTA 3DGPA 4EWTA 2QLFB 4PWDB 3AXMA 1R0AB 1C0TB 2P2FA 2P2JA 2AX1A 2R2TA 1NSAA 3B4MA 4CLKA 2UU9F 2K1RB 2AYAA 2Y8YA 4X84A 5GMEA 1SB6A 2HZAA 1TKXA 2WD9A 5CH7B 3CJ3A 3J7YI 1XHJA 4JBCA 2AEMA 3TNVA 2ERRA 4LSNB 4CLTA 1NBEB 5IT4A 4Y6IA 1RLCL 2QX0A 5KFXA 4JYAJ 5KYVA 4M5HA 5BR8J 2Z0GA 4I56A 1O5JA 3FEYB 3TVYA 2E29A 2WK4A 4KV8B 3KJFB 4G1PA 3MAAA 3D54A 4WPAA 3O5TB 2P2MA 5F9NA 2VOOA 4DV2J 2CZVC 4TU9A 3PW7A 5ETMA 1YZ7A 3BKFA 2ZBPA 1RISA 4J5OA 3QSYB 5L9NA 3LQVA 3FRZA 5LMNF 4ED3A 3EE3A 3GIKA 1WF2A 3MD3A 4ZVSB 2J7WA 1XS3A 2ASDA 3BQ0A 4JI2F 5IXUA 3I32A 3PKYA 5KFWA 3T5LA 3W2WA 3JXOA 3W9IA 4ED8A 5IT9Y 2WAQD 3TAMA 5KFBA 5DS7A 1JLCA 3V6HA 4UQGA 4TVAB 2IC3A 3CCSS 1UJ4A 1RT1B 4L3NA 3TAPA 3NNHA 1BC6A 2G0JA 4O3OA 1XNRJ 5KFKA 1FD8A 1QSYA 2W9CB 3AF6A 3G6XA 2JC0A 3T6JA 1WOSA 5B0CA 1S1VB 2H5IB 3DRPB 2OPQB 1NDCA 1YBUA 1T0TV 2YY3A 4ECUA 1BUXA 2QA1A 5H9EJ 4CTAB 4ECQA 3KLGA 2BJ8A 1TL4A 3MOJB 4USHA 1SL0A 4MIBA 3GSDA 3G82B 1VRUB 1FDNA 4TU7A 2K8GA 2HNZA 3CQ1A 4ZJOA 2XWXA 2PN2A 1ZM3A 1SH3A 3T3FA 3GILA 2HK3A 3G8SA 1D9FA 3D0HE 4RNOA 2MKIA 1LW0A 3GU0A 2PN6A 5IC6B 1M1GA 4PWDA 4UW2A 1R0AA 1C0TA 1SC4B 2HW3A 1WC6A 4B9TA 4NL5A 3H2VE 5FDLB 3UOWA 1SI9A 2K1RA 1JXVA 2ATWA 3IM8A 2G13A 4LSNA 2H1YA 4D4GA 4DSLA 4ECWA 2CUYA 3MM7B 2K3KA 2ZBRA 4O3NA 2V9WA 1S9FA 1RZMA 4L6V3 3BQ2A 4WFAQ 5CA5A 2DO4A 1Y0HA 1FJGF 3VNQA 2V2KA 1IQTA 4L74A 2O67A 2PFDA 3FJ2A 4USMA 1FJ7A 3BV8A 1JNZB 4K7QA 5DRKA 3RU0A 3C46A 3IR6B 1NPKA 3EM1A 3CMES 5KT2A 2FGOA 4WFNQ 2VC1A 4ED0A 1NMEB 4URSA 4B3TF 1JNRB 1UPMB 2WB4A 2BJEA 4UOCA 4DR6J 2KJVA 1PJ7A 4ED4A 1FRJA 3JQKA 4X66C 4FKYA 2CWXA 2B8PA 2ILYA 5HROB 7AT1B 2VKZG 2J0QD 1ITPA 1KFDA 4ZVPB 4DV7J 1RT1A 1WWHA 3WDOA 1R6VA 5KEIA 1PCAA 3O1LA 3HX9A 2XBPA 2LU2A 2MLXA 2W7OA 1FJEB 1S1VA 2EFGA 4YHHJ 2DXEA 4OZLA 3N6NA 2OPQA 2QLBB 5BYSA 2XB2D 2QG9B 4K4YA 5A1GA 3DXBA 1JKHA 3OL9A 2MKCA 4CTAA 2M5OA 4MIAA 3F44A 1O0PA 3L4BC 4USIA 3T41A 3IMQJ 3HMJG 2QTWA 3TOQA 1HFEL 4X2BA 5HVFA 1M1HA 3NXZA 2HLTA 4MFBB 4DPUA 3CB4A 1YJ7A 3SQOP 2Z30B 4LMZA 4DFKA 1HLWA 2BE9B 2BX6A 2H5EA 3ITHB 3M30B 2J9DA 5CYMA 1N2FA 4KHPC 4DU8A 1Q8BA 1YRUA 2VQFF 4LVOP 4K50A 3OLBA 2X7IA 4DQRA 3C6UB 2GQCA 3TP2A 4ECSA 2DGTA 3AB2B 2G0CA 3E2EA 2HVIA 3DMJA 3MM7A 5A1IA 4DZ6A 1SKRA 1WG4A 4KPCA 2CQ1A 2BV3A 3Q86A 1FNXH 3L7PA 3FMWA 5FIIA 3QT5A 4J7CA 3U27A 4ZPDA 2K7KA 1NJWA 2VPYB 1VBKA 4RM2A 4CLYA 2D1TA 4QWDA 5A8RB 4KH1B 4HH1A 3HZEA 2R7XA 2X1AA 2D9OA 2KB2A 2FVCA 4WTYA 2HQFA 2R8GA 3S82A 5I42B 2KYXA 2R7SA 4C9DA 5HROA 1H98A 5J1EB 1NK8A 4JI0C 4ES1A 2ZDOA 4O23A 3TWZA 2F4VC 1NKBA 4IQXA 1GX6A 5E3AA 2BQRA 2IMWP 2BYCA 5HQMA 2RQKA 3AA9A 1YHQS 3NGRA 1VC0A 3R44A 1LWEB 4ZVUB 1N34C 1VQ8S 1NAQA 1VBZA 3OLAA 3KHLA 3HD1A 4QR2A 1R8PA 2R7WA 4F0MA 1IUJA 2CVIA 4IG0A 4A8SA 1FE4A 1WOOA 4QIVA 4EBDA 1N34J 1I6JA 2H54B 1SC6A 3OQ2A 3A3OB 2D27A 2RH3A 2AMCB 1WD6A 1VYAA 2LYVA 3NCQA 1PG4A 2G1DA 3T5HA 3MCMA 4CI0B 1SH2A 5I4MA 2UVUA 4DFPA 4LRDA 3PHTA 1N5YA 3ITHA 3M30A 1RTDB 1R0CB 1EKRA 1F9FA 5LJ3Y 2VV5A 5D8HB 2DD8S 2VA3A 1FNOA 2DR7A 4A8QA 4YEAA 4W92B 3CMAS 2G9OA 3HSDA 3A1YG 5CZVA 1RCXB 4X65C 3FKBA 3L95X 5L1KA 2CZ4A 4OYWA 4DSIA 1QM4A 1WI6A 4I0WA 2BZ2A 2SXLA 2O3DA 1G7CB 3GPCA 2XMAA 2VSQA 3M2VB 4CT8A 1Y11A 4C8KA 4ILMA 2RQMA 3O6QA 1FDDA 5A8RA 3LH2S 5KFRA 4ECTA 2RRBA 2XO6A 2LXUA 3RG6A 1HQUA 4NRUA 4ZMMA 3RB4A 3G4SS 4OX6A 2E5IA 3BH6B 1Q78A 5CCMA 2VKRA 2AZ3A 4LR9A 2QSFA 2NUHA 4DR5J 3AD7C 5F8MA 2H51B 1UZDA 1D3WA 2OH2A 2YNFB 4NXMJ 5J1EA 1M5PC 2BDPA 4DR7C 4KTVA 2MYFA 2KFNA 3GJQB 1REGX 5D0HA 2V8VA 3RYLA 1K0TA 4PG8A 1FWKA 3LAKA 4OI3A 2WVCA 2W4CA 3RV2A 4DR7J 8AT1B 4U7UK 5BSMA 2HK2A 3G2XA 2W8KA 4L73A 1SJFA 4GRSA 3CJTA 1P1LA 1BY9A 1TL1A 3HM9A 3NY0A 4PEOA 4DPWA 5IQ6A 3HJFA 2KZMA 2CU6A 3CMQA 3PKMA 2LQ5A 2ZHOA 1U2CA 3M4XA 1MWZA 1XMBA 1XMOJ 5D3GB 2XZTB 2VQEC 1U8SA 4CO2A 1R6YA 1WF1A 4R0JA 2DHGA 2RHSB 3FEXB 2JNJA 4CIOA 2VQEJ 2R2SA 4C0OC 1FFGB 5E3QA 4EZ6A 3TZZA 2EW9A 1IBKJ 2DISA 3AY0A 1LK7A 1XMQF 1S10A 4LRCA 5JVHQ 1K47A 2BE2B 4PPDA 4LF4C 2NCKL 2LMIA 3M2VA 3KK2B 2EG2A 3KHHA 4WU2A 1RWKB 1V3RA 4KGKA 5DG8A 2UXBF 1Q4RA 1IWGA 2C28A 2RAQA 3MEGB 1HNXC 2DK2A 3UN2A 4DX6A 2RB7A 4ES2A 3GIRA 2QIFA 2XS5A 3U7JA 1VR6A 3PW4A 1ZB9A 3BJYA 1PGZA 3HHDA 3KTQA 1RTIB 2Z2MA 3CIZA 4RJVA 4BC7A 1DZ5A 1HNXJ 1FK9B 1ZM2A 2YNFA 1C1CB 3HO1A 2V34A 1DJ0A 2D69A 3FCHA 3X3UA 4NLTA 4M5JA 2FD2A 3OTDA 1RCOB 1RU2A 3OFFA 2DNZA 4TYAA 5BSRA 1NB2A 2HHHC 4HR2A 2AYMA 5C42B 3KDNA 4AL5A 3ISZA 1S99A 3A3NB 3EGWB 1U45A 1U6ZA 3J81D 4KTTA 3SSQA 2UUWA 3KYLA 2JOQA 2BQUA 4ALZA 3OTCA 2E5GA 4UY8T 4WXWA 5LSOA 5LMUC 5HP1A 4RW7B 1RTZA 2AJ1A 3ZZZA 1IB8A 5BUQA 4URGA 3MUTP 2FY8A 2WW8A 5E7OB 5LOQA 2FGCA 2YQ3A 3A9VA 1WORA 5D3GA 1FVSA 4Y2KA 3SQGB 4Q43A 4DV5F 2U2FA 4BWJA 2W8LA 3CJQA 3T1HJ 1LOUA 3VVUA 3UO0A 4DFJA 4ECZA 4ECRA 3QRRA 2MZ1A 4WFBQ 4OYIA 5DM6Q 3KUHA 4CM2A 3TVKA 4UTGA 2ZBQA 1QY7A 3AODA 4KYZA 5LSRA 1R0BG 3N5BA 4FXWA 5D78A 2FVPA 5DZ7A 1YGYA 3JS9A 2V8HA 2KZFA 3SCLE 1BLUA 2MQLA 2V67A 3CD7A 4MH4A 4CQ1A 4L7IA 4I7FB 1EAYC 1D8ZA 3P96A 4JP8A 3DLBA 5SZTA 5BYRA 2E9ZA 1GK8A 2OSRA 1YVFA 1C4AA 3MFIA 5IT9U 2XZDB 4KIAA 4DF4A 2BE2A 2GVZB 2CZ9A 4GC6A 2E44A 2R4FA 2GIFA 3KK2A 1KKGA 1U4BA 3ZXWA 2HWHA 3QQCD 2VPZB 1IR1A 5HATA 3R8YA 3PCOB 1RAJA 3VR1A 2XC9A 3HVTB 5KFPA 1TFYA 1QM9A 1UFWA 1RTIA 2HFSA 5AE2A 1HBUA 9ATCB 2ZOMA 3GCXP 3K5NA 1FK9A 4ZVRB 1C1CA 3RB3A 2E5LF 1FRKA 3J80D 3EUNA 1NK6A 4UOGA 1S1UB 3T5JA 1S9EB 3M8QA 4MTPA 4Y2MA 5LMNJ 2BUNA 3K59A 1W2IA 2B56A 3VAGA 1RXOB 3ET6B 4ZN3A 1RYRA 3LGMA 4JI2J 3PVXA 3C19A 2XO7A 4NLGA 4DCUA 4L75A 2D9PA 2EBGA 2UUAF 3PIOQ 2HFNA 4USKA 2JC1A 4NPOA 3AAWB 4OJ3A 3QLHB 4DR1F 5F8NA 1S72S 4WP3A 4QYRA 3TJAA 3TX8A 3R6GB 4RW7A 2MZTA 4IFYB 3ILJA 3CWJA 1MLAA 2XCAA 5ETSA 1W25A 4LBIA 3QGHA 3TQIA 3OTOF 3M1VB 1X9SA 2NLWA 2LQBA 3GFHA 1ZPVA 1O92A 3GR1A 3PZPA 5B09A 2YKAA 2KVIA 3FGVA 3OFGA 3UN5A 3D66A 3IXQA 4K5SA 4MKAA 2QSWA 3H2TA 4PUGA 5KFFA 3SI8A 2MQOA 4OXIA 4NLQA 2CQPA 4HLBA 2BACA 4F3MA 2B9XA 4I2QB 4P2MA 4B3SC 4PR6A 4X4QA 4OI2A 1I94F 2JDJA 2PI5A 4QW8A 1RA6A 3UR0A 2FUG9 4I7FA 2IBOA 3ENAA 1RE1B 2YNGA 4M5LA 4F02A 3ELHA 1VQPS 3EPGA 2WVEA 1VOMA 2FY1A 1IWAA 2A2CA 3K5LA 2LEPA 2KT2A 3BBCA 1MKYA 3DHWC 1BA3A 2A6MA 4G65A 4CM0A 4Q44A 3HT3A 3PEHA 4CNYA 2MSTA 2GO8A 2ZVSA 4P2FA 2DGUA 1NK5A 2XS7A 3J7YU 3R5BA 1TP7A 4KGVB 3HVTA 2WRMA 1ELOA 4QPXA 4ID5B 2WVFA 2OELA 1U1NA 3NWRA 1X4DA 1FJGJ 2V4JB 4IR7A 3BYPA 4P74A 3HZGA 1ZA1B 4DSEA 2X1FA 3BZQA 5A2QY 3C14B 5KFQA 2VHGA 4FP9A 4IH7A 1WH9A 2HNDB 3AXKA 1S1UA 1S9EA 1GTHA 3VGUA 3CD5A 1U0HB 1C0UA 3HKWA 1CJUA 3DRYA 3VGSA 2M0GB 4B3TJ 1FXRA 4K0KF 4JI6F 4B3RF 3TZYA 1FI4A 3M6WA 1WC5A 4G36A 3E7WA 4NA3A 2HQGA 2DNNA 4JI3F 4R0EA 4ZVFA 4P7VA 1LQLA 4I69A 5JJBA 3VALA 3O2IA 4IFYA 5F0UA 3W65A 2UXCF 3PESA 5FLXD 3DNCA 3W60A 2ZWPA 2E1AA 4NMXA 4PWUA 3PFEA 2E7GA 5IWAF 4K4VA 5CD4A 4ETXA 1RTJB 1X5PA 1VGYA 2XULA 5D0GA 3K5PA 1VJWA 2M5HA 4QJVA 4X62C 5DG9A 4I2QA 1NDLA 2C2OB 1YZ6A 3QYYA 1A0OB 4X4SA 1KSPA 2HFVA 3H90A 2CPXA 4GXRA 3CW9A 1T05B 4QIWD 3Q8VA 2OPRB 2VODA 4DX8H 2CY1A 2JLEA 4JI1F 1LWCB 1HQ2A 4DUZF 2Y4OA 4NASA 1Q5VA 3PM9A 5CHCB 3CCES 1OSDA 3Q2TC 3UPFA 3BYRA 4C3KA 3NS5A 1M5HA 3DLEB 1X4GA 1RHQB 3IWLA 2ILZA 3MMCB 4NX9A 1SQGA 3JSBA 3G8QA 1L3TA 4ELUA 1N0VC 3L3CA 3UE2A 1DLOB 2VBWA 2X1BA 2YKOA 1YITS 4ID5A 1VLYA 3NOGA 1T03B 4B9MA 5F8GA 1Q53A 2RDIA 2V4JA 1S4FA 2RS2A 2GA7A 2IPOB 4OZ0A 2LXFA 3WX4A 2HNDA 3CGIA 2ATLA 3PX0A 1TKTB 5ETPA 3S7RA 3RAXA 3R2CJ 3A26A 1U0HA 3BKTA 3W7BA 1Q81T 2YWFA 4RKUC 4P71A 4NOZA 4DF8A 1N5SA 2O01C 1J2VA 1NLKL 4KTQA 2J7KA 3DLKA 4EFAC 1SH0A 4ZIWA 4PABA 2DNYA 2CA9A 2GHVC 3OTBA 2ABYA 3BSAA 1XQIA 1RT7B 3M05A 4A8KA 2IM2A 3JTNA 5LL6d 4H4MB 1UTAA 1RT6A 4DR3F 3DOLB 4I6AA 3KJNB 4F4ZA 1IKWB 4RL1A 1LXNA 3AD9C 4IH6A 2RF2A 4GC7A 5BYQA 1N33F 1GXTA 2NXEA 1X4FA 1Y3JA 1TMMA 1UPPA 2CQIA 2N4CA 2W9AA 3I87A 2CQDA 3KHGA 2OTLS 1PYTA 2OMOA 2E9RX 4LF1A 3LP0B 3N79A 5GAHI 3HHLD 3VWSA 1YDLA 2OPRA 2R42A 4MJKA 1AFIA 4G1QB 3CJ0A 1LWFB 2XNRA 1LWCA 1XRAA 4LFCF 4WK1A 1EZZB 3NNAA 1N6QB 2HWTA 4Z2XA 1LV5A 5HANA 2ASYA 1FHTA 5HBMA 2KXNB 3KLEB 1IKVA 1OY6A 2ACYA 2D3UA 3DLEA 4O4RA 3OSNA 3TUZC 4LFAF 4GKJC 2N7CA 3K89A 1NYEA 1N4LA 1DLOA 3QPIA 1HD0A 2YNIB 4HH0A 5H9FK 4WFYA 1T03A 4K59A 4P9SA 4WKYA 4CH7A 4EO6A 4TLRA 2OFGX 2UV8A 2M52A 3DRXA 3PYGA 1S1WB 3NL0A 2PEHA 2AEJA 2KL8A 3ZC4A 1RTHB 2CQ3A 1TKTA 4ZPAA 3TJ8A 2Z51A 2X3DA 1KDNA 1TK5A 3HULA 1F0XA 2HLUA 4KE5A 5DV9A 4KFBA 3HSJA 4FUQA 2KN4A 1WF3A 4PROC 2UUBC 1NDPA 3G9CA 2FLNA 4TPSB 5HSPA 2Z58B 2V68A 3G8TA 1KD1T 4YFUA 5IZHA 4CYUA 2WP0C 3IC1A 4D4IA 1GX5A 3M9MB 4DXLA 2XMJA 4DQIA 4IKAA 3QATA 4HDGA 1RT7A 3K7RA 4C3LA 2XZWA 4FVCA 5EHHA 5BSVA 3SDEB 1T02A 1HNVA 2FDNA 4ZVHA 1IKWA 4WS9A 4Y3CA 2CXEA 5CD4H 3QAUA 4C4WA 4RBUA 1RYSA 1YSJA 4OMFG 3TA1A 4J9OA 2NZ4A 1HR0F 3I07A 4AQYC 4DR2C 4LIWA 1MU2A 5GMKa 4DN9A 1WHWA 3UQSA 3THTA 4C8OA 5HL7Q 1N5QA 3MWBA 4DCOB 4JI4F 1U6BA 4AQYJ 2DNHA 2HNYB 1X31C 2RHQB 4NLSA 3IEUA 1YJRA 1FXDA 3A8IA 1V26A 4NLUA 4OZ5A 4DR4C 3RGIA 1U24A 2A18A 4G1QA 2ROEA 5ETOA 1ZTWA 1LWFA 1WI8A 3ICLA 1V9OA 5KFMA 1JLFB 2YKNB 2IJFA 3EVMA 4LF9F 2QW0X 2GAHC 1H72C 4IRDA 1ZM4A 3KLEA 3DLGB 3AOBA 2UUCC 1ZA2B 2UXDF 3TR3A 4EBCA 4OJGA 5B0AA 1YBTA 1RT2B 3V5RA 2VFTA 4LF8C 1RAEB 4ZVQB 4R1MA 3DC2A 2MKYA 4F50A 3MR2A 3TANA 1S76D 2O5DA 4NZ0A 4WCEQ 1XMQJ 2IY5B 1ZBTA 4RU2A 1UKUA 3WZ0A 3S01A 1MWQA 4LF8J 1VQSA 5D77A 2DGXA 1S1WA 3GWCA 1ZAXA 4TN2A 3RBDA 4ODJA 4A48A 4DS4A 1DARA 5K8MA 2CNLB 1VMBA 1RTHA 2XYPB 3BGLA 2A2DA 2DNRA 1UKKA 3BGRB 1EB0A 4ENOA 2MZQA 2W2MP 1HPZB 2DR6A 2PA8D 4MTNA 2AJ2A 3LOUA 2XYGB 4Q2LA 2GMLA 4DV0F 2DHAA 4YUDA 5K8PA 1G6BA 3R5DA 4DV6F 3C3LA 1HD1A 3NAHA 2VBYA 4M8LA 4QW9A 4QYZJ 2L08A 5THWA 3A9UA 5DDRC 1FT8A 1RK8A 2FIUA 3HSGA 1U1LA 3HHLC 2C3PA 2M88A 5KFVA 1KN6A 1T9TA 5G0RA 4PZVA 4DV1F 4U6PA 2QFJA 3CCZA 4WE1B 3SDEA 3NGUA 3PYDA 2WHOA 3LGNA 3UEBA 3J7ZT 2DGWA 2CJAA 5HK4A 4RNNA 2KT3A 1HNIB 2WW4A 4C98A 2IVFB 2A10A 1X4BA 2CJ9A 4OI4A 2BMBA 4QWCA 1QDUB 5A8KB 4ZVOB 4XAKA 1HNZF 1SV5B 1CJKA 1TH5A 2EEYA 1MWYA 2HNYA 1GMUA 3ZTSA 2E8CA 1ZM9A 5KT6A 3TZWA 4PXBA 1SPBP 2HRYA 2HJGA 4RW8B 1VQ6S 3UX3A 2ASLA 1JLFA 2AJFE 1S9GB 3P3DA 1TU0B 2YKPA 1VQMS 2AHOB 3OR2A 2C2RA 1FNMA 5L1JA 2DIVA 4DLEA 2FHOB 3LGXA 3DLGA 1V60A 4QR0A 2MKHA 1RWUA 4DL0C 5DJBA 2B43A 1PYSB 2BM0A 1NRKA 3D1HA 1RT2A 1PAUB 3IMLA 4DCSA 3PRDA 5KYTA 2Q43A 2KRBA 3EVWA 1QLNA 1ZH5A 2C3YA 3H2LA 1CQNA 5ETKA 1KRPA 3QNWB 4AE5A 2P2QA 3MMAA 3O44A 1KS2A 5EUHA 1NSPA 2CNOB 1OPZA 2OJ3A 1CULA 3MFHA 2V2QA 1Y9OA 1B3TA 2GJIA 4IZ6A 1U8WA 2FHJD 4XO0A 2V0NA 5CYJA 3EYZA 3T1YC 2ZH4A 5EWEA 2LQJA 3BGRA 3AQOA 1KHWA 4G6VB 5KFUA 1HPZA 3GIJA 1Q82T 5AE3A 2LLZA 3F41A 3EX7B 4ZVTB 3FCEA 5J2QB 3GJSB 5CCLA 2MXYA 1O8BA 2JLGA 4QU7A 2F5GA 3T1YJ 4DHVA 4DV3F 3PEJA 5F8HA 2HVEA 4A4JA 4FYYB 3N5FA 1UVMA 3JAMY 5I3UB 4YR0A 1M5SA 1DQ9A 4M1KA 1S7IA 2KHCA 2BRKA 3SFUA 4ZP8A 2EVZA 1JLGA 2LQ8A 1WELA 1KOHA 4F25A 4F8RA 3RW7A 2CJKA 3U1LA 4WE1A 5D4PA 2MGZB 2VFUA 3RZAA 3FEZA 4NLXA 3IGNA 2UUAJ 4EZ9A 3WBZA 1HNIA 5KFCA 1AYEA 1FD2A 4ZP9A 2ZWOA 3O3LA 1S79A 4DR1J 3D3BJ 4LFBC 4YB5A 2CQBA 2EGTA 4FS1A 5T14A 1SV5A 2KHDA 1GH8A 2CPJA 2BKNA 3MR5A 4O3QA 3OTOJ 3O8WA 3CCWA 2YKQA 5D0EA 3CCTA 2EK1A 4RW8A 4QR1A 3I96A 4V1Ak 1A6LA 4Z37A 5KG2A 1Q16B 1S12A 1XNQC 2EWHA 3D67A 1CS4A 4C11B 3CDWA 4GKKF 4CO1A 1WEXA 3KUGA 2Q6BA 4OLOA 1I94J 2XWYA 1GPMA 4DPOA 1UVKA 1LCIA 1NZ8A 1A9NB 3HHLB 4NLOA 3ADAC 5HLFA 1T3NA 1FRIA 3KWMA 4GVBA 3MECB 4RM3A 1T94A 2PFFB 1UFLA 4QWEA 1O9TA 3D1OA 3BSCA 3OXGA 3E3XA 4BCAA 4C3MA 1TL7B 1VRQC 1YI2S 4OHVA 3ILIA 3JTOA 2A0FB 1SQFA 1RT3B 4KH0B 2ZFHA 3T9NA 4KHMA 4F4AA 3LPEA 1FF2A 2QA4S 5LXYA 5A6PA 2F3JA 2VBXA 2YQ1A 5J2QA 5K8NA 1SJ3P 4KBIA 2DR8A 3ETMA 3GFXA 1NU4A 1OIAA 1WACA 5J2MB 4B08A 4NOHA 3SCJE 2IDLA 3PX6A 5I3UA 4JM1A 1ZTTA 4RW9A 4I9FA 2IM1A 2KT5A 1N32F 2DPIA 5A6WA 3OV7A 3DAYA 3DOKB 2ZM6C 4J9SA 2FVSA 4K0KJ 4B3RJ 2MGZA 3OSPA 2N7YA 3TEHB 3GJTB 2W4PA 3UN3A 4A47A 4XDDA 1WHVA 5J1NA 3MM9A 4JI3J 2FTRA 3EXCX 3R9XA 4I9GA 1VCTA 4PKDB 3SCIE 4L76A 5DGAA 4C8ZA 2NR0A 3W61A 5LJ5Y 3IGVA 3P49B 2CG4A 3R5AA 4KSEB 4DL7A 1X0FA 3KDOA 1M6XC 1OSCA 3UW1A 2CYYA 2DHSA 5IWAJ 1WC3A 2Q66A 1AMUA 2KZ0A 1TTHB 4U8YA 3QIPA 2BH1X 4RLEA 4LF2A 4RWXA 1KLMA 1UVIA 5IT9D 3B78A 4F67A 2GX8A 4KGZB 5HMXA 4RZRA 3HP6A 4QZVB 2D3ZA 1NJIT 4H4KA 4C8YA 4PG6A 1HNWC 1WOPA 4NXNF 2MZRA 4B9SA 3BGUA 3HHLA 1WKJA 1NH8A 2HS3A 3GMGA 3MECA 4JI1J 1T5DX 4LF6C 1QAIA 3OVBA 3CC2S 4DUZJ 2LP4A 1F9EB 2VU5A 1UW9A 4IOCQ 4HI2A 1C1BA 2ALYB 5A19A 2HZCA 2KO1A 4HHJA 2ZHAA 1R8BA 2HHSA 1RT3A 4JI8F 4UF4A 5KG7A 4LF6J 4F2SA 2VZ9A 4WXOA 3LAMA 2QYGA 1N36F 1UA0A 4RVOA 1WKLA 4FN5A 4E2FB 3WX8A 3BN4A 2WOMB 5H9EK 4PWWA 5EN1A 1G3OA 3QRPA 2ADCA 1IBMC 4LQ9A 2RE1A 3PX4A 2MM9A 2MMYA 4CCHA 3NGSA 1J27A 3I5AA 3C8YA 1NK4A 3W5YA 3BQ1A 1BQNA 2GIQA 3QZ7A 1IBMJ 2JFKA 4U5YD 2B6AB 1P9YA 2ZH8A 1PKUA 1M90T 3DOKA 1S6OA 1RDRA 3SYZA 4PQUB 2G0IA 1VK3A 1MD9A 1RP5A 4IRKA 3TAQA 4MKBA 4LF7C 3Q24A 2LDIA 3MM6A 3TYTA 2VH7A 2PMHA 2GVDB 3BKUA 5D4LA 3M8YA 2DBBA 2IBKA 4RO0A 4V19J 4OV6A 1O90A 4LF7J 2CNNB 3J81Y 2VPWB 1ZAWA 3KFWX 3LALA 3H0PA 4CZCA 1EJ7L 4DR3J 2OEJA 1B7YB 1DAXA 3QT7A 4NLPA 1FX2A 1WCJA 2HKEA 3IR7B 1MW7A 3B7WA 6FDRA 2RT3A 5E41A 5K8FA 4R8UB 1TMJA 1FLOA 1REVA 1YBAA 3GPAA 1XRCA 3CDBA 4KPYA 2I5JA 2ZE2A 4X64F 1XERA 3ZZRA 1TELA 2V7BA 1NHVA 2R8IA 4M5NA 3ONQA 2AU0A 3PO4A 1FXLA 1JXLA 3KJVB 2F8MA 4OX8A 1RAAB 1Z2ZA 5RUBA 1RKJA 2DHMA 2XI2A 2WTFA 3NKYA 3DLPX 1H3DA 2NYHA 4YY3C 1TL3B 2FC8A 5SUHA 1R8CA 4JI7C 1IBLF 1T9XA 2L3MA 4FF4A 4DL2A 4LFAJ 3LAXA 4OZJA 4WKRA 2OPSB 4UZBA 1L3SA 2VFSA 1J5EF 1Y4ZB 2HSEB 3W8PA 2WOMA 2PC6A 4RUHA 2VBZA 4B3MF 3C15B 3FBBA 3TZXA 5EWGA 3CNQP 1E6VB 4XIUA 3UDCA 5HMZA 1IJEB 3DRRB 3EMTA 1JJHA 1YTYA 5LM7E 1OS5A 2FJEB 3U02A 3NWGA 1PG5B 2CAJA 2PMWA 4USVA 4ZP7A 1WSRA 4E8UA 1WEYA 4Y28C 1MXCA 1DRZA 2GO9A 4P2SA 4FXDA 2OO4A 4ELTA 3P4UB 2CPZA 4O0NA 2KZZA 4MYTA 3M8PB 3C2PA 2ZKTA 4Q0BB 1HH2P 4DG1A 4PQUA 2IYGA 4Q8FA 2RQ4A 4ANEA 1IN0A 2B9YA 4M95A 5C24B 1NSKL 1OY8A 1JJ4A 1D0EA 2B51A 2DJWA 2EPIA 4KRWA 2B4VA 3OD2A 1HW9A 3GLJA 1QWIA 1GMWD 2AZ1A 5F41A 2XEXA 4Q45A 1K0VA 3TUPA 4I1TA 1Q8KA 2YVSA 1UJ5A 2QRRA 4JUZA 4ZJQA 4LVNP 2G1HA 2J8AA 2FLOA 3W9JA 3D0IE 4CLZA 4YP3A 2VA2A 1NH7A 2N3LA 3P8BB 4O44B 5IM0B 3PW2A 2GC8A 3M9OB 4B3OB 4D56A 2P6SA 4R8UA 1RI7A 4JI4J 2ZDPA 2AJQA 5GAHU 1CSJA 4I2PB 1HI8A 2HBQB 3KJVA 4AXIA 3LWMA 3CDUA 4ZPTR 3I56S 2YTCA 2DYJA 3GSIA 4LF5F 3MHYA 2M70A 3W2VB 4JYAC 5BR8C 1U49A 3B4DA 4LF9J 3F73A 1RAOA 2ACMA 2LVWA 2I0XA 2J76E 3HXMA 2DKOB 3LUYA 4DL6A 5KFTA 4FDFA 2UXDJ 3K2YA 4DV2C 5K9FA 2ADBA 4YOEA 4NLDA 4J9QA 2ZH9A 2ROPA 2Z4PA 4QIEA 3TI0A 2E7XA 1BE4A 2ZH2A 5E2QA 1KEKA 1H0HB 1RY2A 1E6VA 5HMWA 1M6XA 2MQMA 3JYTB 2GMHA 2DEIA 2HS0A 2BRLA 2HWIA 2HMIB 3M2UB 1HI0P 1IKXB 5LCIA 4DV4F 1CJVA 2W24A 4ZJLA 1UFKA 3BBFA 2FHJA 4IFVB 1TUGB 1NZAA 1HHSA 2V4RA 2YQ0A 4TKTA 1V25A 4XPEA 3G71S 3M8PA 4I68A 3A25A 2CQHA 1S1XB 3CCQS 1XNRC 3HVRA 2UZAA 4OI6A 1XWLA 1WG5A 3NBPB 4KQZA 1FE0A 4CH0S 2HURA 2FJBB 1LFWA 2M8HA 1QTMA 2XNQA 5A8WB 3AF5A 1Q7YT 3W62A 2QL5B 3QMQA 5DZ6A 4ITSA 1MDFA 3MAQA 4DV1J 3B54A 3LA0A 3WIUA 5IV3A 3VTIA 3BDPA 2CJQA 1HHQA 4XPCA 5GAEI 5FLXY 1WNEA 1GNKA 3BPSP 5B0EA 4O44A 5IM0A 4CWBA 1MXAA 1ZYQA 4B3OA 2QZ8A 3MURP 4GVLA 1JJ2R 3QGGA 3JB9k 3NNCA 3BBBA 4X4NA 2P20A 3MM5A 1GTEA 4JV2A 3W5XA 4GMKA 1WEZA 2QLWA 1KOOA 1T5HX 1FRXA 1HI1A 4I2PA 2OPPA 2FHKA 1HA1A 3KNAA 4NYPA 3Q8UA 3OBIA 2YWWA 3Q2SC 2MMAB 1I5OB 4I67A 4XTTA 2VFRA 2RDDA 4ED1A 3JAMU 1FX4A 2NZCA 5HAOA 4ZKAA 4PCQA 2HHUA 3GG0A 4NEYA 1TKZB 1URNA 2MKSA 1WHYA 1CLFA 3VHQA 5K14B 1K0RA 4ZK7M 4FPRA 4KGXB 2QVZX 1PIEA 3MPDA 1HMVB 4JV5C 3AHPA 2RUGA 1DQ8A 4KV8A 4JOUA 2LU1A 3T1AA 2GNKA 4DU7A 3HPOA 1CVJA 3D5MA 3JYTA 5E33A 1EGAA 2LEAA 2F8HA 4JV5J 4DR6C 5KT4A 2HMIA 4KC5A 3M2UA 4CRJA 2HFOA 3DLLQ 2Q3PA 1MXBA 4IFVA 3DM2B 1FKOB 5KOWA 2HHXA 4DV7C 4USJC 4CLPA 3PFOA 4NCGB 1IQZA 4EK2A 1U25A 2DRBA 3CJSA 4ZVEA 3WQPA 1S1XA 4ANDA 2HPUA 1EX8A 3GP9A 4DV3J 2AGOA 1MN7A 5AXLA 3R1LA 4YHHC 2HVZA 1B0PA 4PPZA 3M8RA 2QVXX 5A8WA 2H4WB 4W98A 3D6TB 3IPLA 3QJLA 1WKKA 2CIMA 2W9CA 1S6QB 4OX9C 2VONA 4LR8A 1DHMA 2Y1IA 2UVWA 1QAXA 3DRPA 3DI6B 5KG5A 4PHTA 3DU5A 3OFHA 3UR3C 1WTFA 2MSSA 4ZPVR 5E5NA 3GYXB 2VG6B 1RACB 1JMTA 4OX9J 2XCPA 3OUYB 2V8PA 1EHWA 2QE5A 2VIHA 3V81B 4Y00A 4DS5A 3OFEA 4A46A 3G82A 1VRUA 2WVBA 4D3HA 1H7WA 2E66A 2KRRA 1YJ9S 1KQFB 3R27A 2Y3YA 4J37A 4NA1A 4YR2A 1P4EC 3PR4A 1D1UA 1JK9B 2P9CA 4DV7F 4NLVA 2CQCA 4Z7YA 1L3UA 4WYLA 2JHEA 4N77A 2K3IA 3ZZ0A 2M8DB 4IG3B 4X66F 4HEA9 3TW0A 4X4OA 5FDLA 2BE7D 2L9DA 4ILRA 1SJRA 4NLRA 3TVZA 3H5SA 3CUNA 5AT1B 1DTTB 4F0KA 3JSMB 4FF2A 4GKKJ 1S49A 4EI2A 3N4WA 1ZZNA 4FYWB 4DSJA 3W9HA 1HMVA 4AT1B 2OAUA 1R43A 1V5IB 3CJRA 1F6TA 3RRKA 3I82A 2AJ4A 4CO3A 1S0MA 2QA4G 5ADZA 5IV4A 3V4MA 4DPTA 3K0JA 4ZLNA 2JEJA 3VZIA 5DQHA 3UD4P 2QLXA 4FVMA 1Z4UA 3D2WA 2RIJA 5KG0A 4PAAA 2MCQA 4DOZA 3DXSX 2HGLA 1LFPA 4NCGA 3ZNJ1 1UVLA 4MYUA 3R9LA 4YB1P 3LTOA 2I6WA 4M5MA 3D28A 3THPA 1RHUB 4KHPF 2Y1JA 2J6UA 2QT7A 1XC9A 3AOCA 2H48B 2W2PP 1XIQA 4U95A 5KFJA 3PTWA 1N32J 4P52A 5L1IA 6FD1A 3IRWP 1X7VA 2FYXA 3SBMA 2RD5C 3DI6A 2KG1A 1S97A 5M2RA 3H20A 4KR0B 2JEIA 4KJIA 2VG6A 2BKOA 1VISA 3OUYA 3HFKA 4ZA1A 1U1RA 3V81A 3OJSA 3M32B 3I4PA 4KAIA 2HBRB 2XTJP 2R7VA 2LECA 3CW2C 4J9KA 1PU1A 5T8SA 3I9V9 1H7XA 2YH0A 3DCAA 4MFBA 4BBYA 1XRBA 2JVOA 1QE1B 4J9UE 4CT9A 1UP1A 3U1MA 1FVQA 3EDQB 3W3SA 1KP6A 4FBUA 3MAHA 3MUMP 4C0HA 4B9VA 2W2NP 5T7LB 1R7IA 3C6UA 4JI0F 3K57A 2FB0A 1DTTA 5BSUA 1D8YA 3JSMA 2F4VF 4JI5C 2YWGA 4ZN1A 2RSQA 5DQGA 4HACB 2WSCC 3W5ZA 2QC3A 1N34F 4JI5J 4CP5A 3KG1A 1QSSA 4P72A 2PT7G 3FK4A 1TUWA 2W4DA 2OTJS 2J9EA 4DR5C 2ZBCA 2VOPA 4KO0B 4MAKA 2CJXB 4NXMC 3J81U 2CQGA 1RWMB 3QIDA 5I42A 2V8GA 2X1GA 3H98A 2W7PA 2V69A 1CPZA 1O6XA 1F5BA 2DY9A 5A0YB 4PG5A 1NKEA 4ZITA 3OXLA 2CXCA 2HEKA 3FCWA 2EI5A 3NG8A 3RRHA 2M3DA 2NSCA 3FSXA 1FTCA 1X5SA 4E98A 3FFIB 1ZOTA 4OQJA 2GMJA 6AT1B 1LWEA 2EG1A 3VAMA 3Q8PB 2AF6A 2XI3A 2CPDA 5ETNA 1UL3A 5KT5A 4PUOB 5D4NA 1U2RA 4X65F 2R8HA 4F0HA 3PJ9A 2ZJRQ 2X3GA 2DNQA 2LKZA 1RBAA 1EQMA 1XMOC 2HQIA 2GJ2A 5K85A 3WHIA 2G2ZA 5B0FA 5A2QD 1H38A 3M32A 1VQ7S 4M5IA 2V5HG 4RLFA 2XLIA 5KFDA 2Q79A 3E01B 4ZPCA 1GMWA 3LPYA 2ROGA 3GIMA 1UJ6A 3QO9B 2IM0A 3BR9A 2GJFA 3R3TA 3AT1B 1RTDA 4DUYC 3C16B 4DCPB 1IBKC 2BR0A 1HL6A 5T7LA 4ZPBA 2DNGA 4WP8A 3LWLA 4OYZA 3PJXA 5A76A 2DITA 4DR7F 4DUYJ 2ZZMA 4OYMA 5HO4A 2ZEJA 4FKXA 1WC4A 3UDLA 1IM4A 1APSA 2AYBA 1F2GA 1TV6B 4X64J 2EXUA 2P9EA 3J80U 1MN9A 3HHNB 3OW2R 1J5OB 2RDJA 2DH8A 2OSQA 3HFZB 1U1PA 5KFOA 4RX6A 4OLPA 4LR7A 2WVDA 1M5OC 5KFEA 5CYQB 3GZ7A 3FNNA 2J0SD 3P6YC 3ULHA 1F5CA 1FA0A 4ELVA 3K5MA 4Y65A 4KO0A 1FRHA 5IOLA 2KFZA 3Q89A 4K5RA 2Y27A 1IBLJ 2XY7A 2XHCA 3IA0A 1VDHA 1ULTA 4AYBD 4U7UD 4GS5A 2JJ4D 1RHRB 3W63A 4RW4B 1F2HA 2RVJA 3IBFB 2RRNA 7FD1A 3KXWA 1H2UX 2VQEF 4B3MJ 5BSTA 1P4EA 3VQTA 5M2PA 3IS9B 4UZCA 3C6TB 4Q8EA 3RTVA 4ED5A 2MDAA 3H5XA 2R7QA 1IBKF 2XSJB 4F4WA 3CVKA 5EWFA 3FFIA 2Z2YB 3NGTA 2BKPA 2F8EX 2B8QA 5DDOC 3UD3P 4H54A 3SV4A 2C2ZB 4MT1A 3AFGA 5DGBA 5K8OA 5C2CA 1RT4B 3VVTA 2IDEA 1HQEB 4LF4F 4O0IA 3T1HC 3Q23A 3I0RB 3K5OA 5J2NB 4A8MP 1BQMB 4CLFA 2PIIA 1T3OA 1YLXA 2XYHB 5ETVA 2J8SA 1JQGA 1HNXF 3GKUA 2MZJA 3MAAB 3BN7A 4Y0FA 3ZFVA 4ZS6A 4OV1A 4ED6A 1HWJA 1JLBB 4PUIA 2RRAA 5ETTA 3HFVA 3SZ2A 1HWIA 2WBMA 4NLWA 2AT1B 2GFFA 1M5VC 1FFSB 2N4DA 2FJXA 2XMUA 2ZUAA 3Q22A 1HYSB 4WV3A 4EU0A 2IAJB 3W2WB 1TV6A 1V5VA 2UU9C 3HSZA 1YWXA 2KM8C 4ZIVA 2HHHF 4D57A 2MJNA 3BM7A 1JLCB 1J5OA
chains in the Genus database with same CATH topology
2IC3B 4EEYA 2KB2A 1JLQB 5GADI 3MR3A 2FVCA 4LFBC 4YB5A 4WTYA 2CQBA 1VQOS 2EGTA 3J80Y 2PT0A 2R8GA 4FS1A 1KR4A 2ZH3A 3S82A 1IXKA 5I42B 2KYXA 5T14A 1SV5A 2N3OA 2KHDA 1GH8A 4KKOB 2AP6A 2R7SA 5E7QA 2CPJA 3FQLA 2J9DE 3Q8RB 3VNRA 3MR5A 1O51A 4O3QA 1LW2A 2B4UA 3O8WA 3MEGA 5LMUF 5HROA 4C9DA 1G1XA 3CCWA 4HPVA 4FTFA 1H98A 1MMDA 5J1EB 1NK8A 4QOTA 4JI0C 4BS2A 2YKQA 4ES1A 2KG0A 3MMJA 3C66A 1GXUA 4Y2CA 2HVHA 2W25A 3CCTA 2ZDOA 5E3CA 3T1HF 4O23A 1P9QC 2EK1A 4RW8A 2ONFA 2F4VC 4YQWA 2XMVA 3SMZA 2YX7A 4QR1A 3QJJA 3I96A 3VCDA 3CSKA 1NKBA 1A6LA 4Z37A 4BDPA 2FVRA 4YY3F 2DH7A 2KKHA 3M2RB 3CCJS 1L2FA 4IQXA 3PRBA 1X4HA 5KG2A 4JV1A 1GX6A 1Q16B 5E3AA 4YMEA 2BQRA 1Q86T 2IMWP 4B9UA 1R3NA 2BYCA 1YHQS 2RQKA 3AA9A 4IR9A 4JI7F 2H9ZA 2XMMA 3N01A 4C7QA 1XNQC 2EWHA 1VC0A 3KLGB 5LMNC 2ZJQQ 1ZAVA 1BGXT 1HR0C 3R44A 1LWEB 1TAUA 3RR8A 5H1SV 3T5KA 4C11B 3NP5A 5KFNA 3CDWA 2B4OA 4DFMA 3E8OA 2RMLA 1N34C 4GKKF 4CO1A 1VQ8S 2DIUA 1NAQA 1WEXA 1VBZA 1Q8LA 3OLAA 3KHLA 2Q6BA 1JIHA 1IR0A 3DYAB 1R8PA 2XWYA 4OLOA 2YKMB 4QR2A 1X0PA 2R7WA 4JI2C 1IUJA 2MQPA 2CVIA 3CJKB 5E3PA 1GPMA 5H9UA 2YWKA 1USPA 4DPOA 3OHBA 1UVKA 1LCIA 1AXQA 1U2FA 2XSJA 4IG0A 3TUFA 4ILLA 1HBNB 2C3OA 2M7SA 3QAEA 5AXKA 1A9NB 4JI4C 3MM8A 3HHLB 4A8SA 1FE4A 4NLOA 4A8OA 3E7XA 1XR6A 5HLFA 5JXSA 2AQ4A 1FRIA 1T3NA 3KWMA 4Y34A 1LW0B 1P8GA 3MECB 2FLLA 4QIVA 4EBDA 1I6JA 4RM3A 5KOXA 1SC6A 3OQ2A 1T94A 5C42A 2RH3A 2F7VA 2PFFB 1UFLA 2JX2A 1WD6A 4CH1A 1B64A 2YWCA 4IH5A 2EFNA 2LYVA 1R27B 3NCQA 4QWEA 2VFVA 2I8EA 3CE8A 3D1OA 1U26A 2G1DA 3BSCA 1O9TA 3T5HA 3OXGA 1PG4A 3E3XA 5KTQA 4BCAA 4CI0B 1SH2A 1S0OA 1SXLA 1HWUA 4C3MA 2QVYX 2DRAA 2GIRA 5I4MA 2UVUA 4DFPA 1K9MT 1M1KT 3CC7S 2D28C 1GQEA 1YI2S 5DM7Q 1S7HA 4OHVA 4RNMA 1UMJA 3JTOA 4LF9C 1RT4A 1RT3B 5BUSA 3CJ4A 1D9AA 2DCUB 1XTZA 2ZFHA 4NMLA 4NA2A 4N5SA 1HQEA 2DNOA 3MZIA 5AJ3F 3T9NA 1N5YA 3ITHA 4KHMA 3M30A 4LJMA 5U47A 1RTDB 2UXDC 4F4XA 1U48A 3MTKA 1L3VA 3H4BA 1FF2A 3I0RA 4XK8C 2QA4S 1F9FA 5LXYA 5LJ3Y 3FZ2A 2VV5A 5A6PA 5J2NA 1BQMA 2F3JA 4MK7A 5D8HB 4R0MA 2VBXA 5F8IA 5J2QA 5CZXA 1TL3A 5K8NA 4C8MA 2DD8S 1SJ3P 4KBIA 2I38A 2VA3A 4XX2A 1FNOA 4HT5A 3ENWA 2DR8A 2HHPA 3SQGA 3GFXA 1NU4A 1OIAA 3BREA 1X9MA 2DR7A 1WACA 3LANA 3OTEA 5J2MB 3MPVA 5G0RB 4ZJZA 4RWWA 3RR7A 3VAHA 4A8QA 4B08A 4RW6A 4YEAA 4W92B 2Q6CA 4NOHA 1GT8A 4WU3A 4DSKA 3LNVA 3SCJE 2OPSA 3PX6A 2BA9A 5I3UA 3GV5B 4JM1A 3CMAS 1ZTTA 4TY9A 1OPIA 1PO6A 2G9OA 2DGSA 2VB6A 3A1YG 4PQAA 1JLBA 5CZVA 4RW9A 2IA6A 3NPDA 4I9FA 2IM1A 4K0BA 4X65C 1EP4A 2KT5A 1N32F 1R89A 2DPIA 1FERA 5A6WA 1HHTP 3OV7A 5GAGU 3L95X 5L1KA 2CZ4A 2GCFA 4DSIA 4QCLA 1AW0A 1QM4A 1WI6A 3DAYA 1KONA 4I0WA 3DOKB 2BZ2A 1OWXA 2ZM6C 3DRRA 2SXLA 4J9SA 2O3DA 3SO4A 2FVSA 1K1QA 1JXEA 2YWHA 1X4CA 1KVIA 1G7CB 4X4RA 3GPCA 2XG8A 3MR6A 2VSQA 3DDNA 4CO4A 3M2VB 4CT8A 2MGZA 3G6YA 4DLGA 4MH8A 3OSPA 1HYSA 2DR9A 4I6WA 2N7YA 1L5UA 4C8KA 4ILMA 2W4PA 4A47A 4XDDA 1WHVA 2IAJA 2RQMA 2JLFA 3O6QA 5J1NA 4QWAA 1FDDA 2AW0A 3MM9A 2FTRA 5A8RA 4DV0C 3LH2S 5KFRA 1LKZA 4ECTA 2GHWA 2RRBA 2LXUA 3EXCX 1HQUA 1VQ5S 2QV6A 3R9XA 4I9GA 1WTBA 4PKDB 4NRUA 3SCIE 5C5JA 4ZMMA 4F3OA 3RB4A 5DGAA 2HAIA 3G4SS 4DV6C 1S48A 4C8ZA 1JLQA 2UV8G 4OX6A 2E5IA 1Q78A 5CCMA 2NR0A 1XBWA 2VKRA 2PMZD 4K4ZA 5LJ5Y 4Q0BA 3IGVA 4TLQA 2UUTA 2QSFA 2NUHA 3F56A 4IOAQ 1TFWA 2OD4A 3EZ5A 3P49B 1YJUA 2MHEA 4MK8A 3OR2B 4KKOA 2IHR1 5F8MA 3PJWA 5DLGA 2CG4A 3R5AA 3R9WA 4KSEB 1F60B 1D3WA 4DL7A 3NCPA 4AL7A 1X0FA 1VC6A 2OH2A 5C24A 2YNFB 1ZETA 1OSCA 2HIQA 5J1EA 3UW1A 1FJGC 1ZH5A 2CYYA 2DHSA 1X9WA 1M5PC 2HHTA 4DV1C 2BXJA 2BDPA 1CC7A 1SUQB 3IN5A 2Q66A 4KTVA 1AMUA 4DR7C 2MYFA 2B4PA 2EC0A 2IRYA 2KFNA 4JYAF 5BR8F 4HKQA 3QIPA 2BH1X 4DSFA 3VAJA 3M2RA 4RLEA 2V8VA 3NGKA 1DFDA 3RYLA 2WCXA 4DQPA 4RWXA 1K0TA 1KLMA 1UVIA 4IYQA 5IT9D 4DQQA 1JKHB 4WFXA 2R2RA 2FJWA 4PG8A 2Z8QA 3B78A 4F67A 2J6TA 3LAKA 4OI3A 3FMBA 4J9RA 2OP5A 1RT5B 2GX8A 2W4CA 4FNHA 3RV2A 4DV2F 3H59A 3NCRA 4QIGA 5HMXA 4RZRA 3HP6A 4QZVB 1C4CA 2MJUA 3BB5A 2HQ3A 4K2XA 4F4YA 3MMAB 4B3TC 1JB0C 2D3ZA 4N47A 5F8JA 4JV0A 1NJIT 1VQ9S 4U7UK 3DYAA 1XEZA 5BSMA 2YKMA 4H4KA 4C8YA 2W8KA 1NEEA 3CCRS 3CJKA 1VBXA 2COLA 4PG6A 3BSOA 1SJFA 1HNWC 1N56A 4NXNF 1NO8A 2MZRA 4DBQA 3DLHA 4B9SA 3GV8B 1HNZC 1HBNA 2M5YA 3BGUA 4N8OA 1B0VA 1U1QA 3HHLA 5EX3A 1NKCA 4OJHA 3CJ5A 4B3SF 1P1LA 1NH8A 1BY9A 2KDOA 3KLHB 1TL1A 2HS3A 3OPKA 2G4BA 3HM9A 3TRGA 1N8RT 2E1MC 3GMGA 3MECA 3LP2B 3THVA 1N0UA 1T5DX 3OR1B 4LF6C 2B9WA 2C3UA 3H8YA 1QAIA 1Y5LB 3OVBA 3CC2S 5IQ6A 5CYMB 3H5YA 3HJFA 4IO9Q 5KG4A 2KZMA 3PKMA 4C8LA 2E9TA 2QA2A 4IOCQ 2ZOGA 4EO8A 4HI2A 2LQ5A 1C1BA 1UEUA 2ZHOA 3G6VA 4N76A 2BBEA 5DDQC 1KLNA 3M4XA 1MWZA 5A19A 1XMBA 1HWLA 5MLCV 2HZCA 2KO1A 4HHJA 2E5JA 2KM8B 3M8SA 5D3GB 2ZHAA 4WZQA 1R8BA 3QLHA 2HHSA 1RT3A 3GE9A 1VQYA 4JI8F 3WC0A 5KG7A 1U8SA 2VQEC 4CO2A 1FDBA 4OHZA 4F2SA 1M5KC 1R6YA 2VZ9A 4WXOA 1PG3A 3LAMA 1N36F 1UA0A 1WF1A 5D4OA 4RVOA 2IFXA 4R0JA 1JOSA 3DMJB 4FN5A 4H4KC 1RQ0A 1XNRF 1VIXA 4ICLB 3W2VA 3BN4A 2ZUGA 2DHGA 2WOMB 3CPWR 3FEXB 1JX4A 2DGVA 4C0BA 5EN1A 3FDSA 1V3ZA 4FZVA 3M1VA 4CIOA 5CQGA 2FHMA 1G3OA 4B02A 2ZH5A 1JLGB 2R2SA 4C0OC 5KG6A 3PDNA 4LQ9A 2ADCA 1IBMC 2RE1A 3PX4A 5E3QA 2CPIA 1K73T 4EZ6A 4EBEA 3M6VA 4ECVA 3SCKE 2GV1A 1YIJS 3GB0A 3PACA 2MMYA 3GR0A 1XK8A 4CCHA 4M5DB 1SIZA 2EW9A 1VC5A 2DISA 3I5AA 3C8YA 1NK4A 3BQ1A 2XY6A 3AY0A 1MROB 3CT9A 1AUDA 3BS9A 1BQNA 2GIQA 1LK7A 3QZ7A 2JFKA 1FTRA 2C2DA 4U5YD 2B6AB 2AGQA 1XMQF 2E8FA 1OQ3A 1HBOB 1S10A 2ZH8A 1M90T 4TU8A 5GAEU 3DOKA 5JVHQ 2BE2B 4PPDA 4LF4C 1S6OA 1RDRA 2ZBIA 3GFZA 3CDAA 1S6PB 2LMIA 3M2VA 3KK2B 2EG2A 1VI7A 4WFZA 3SYZA 3PY8A 3KHHA 4PQUB 1U6FA 4WU2A 5L1LA 1IKXA 4NZ7A 1VK3A 1V3RA 2CPHA 2R7TA 3RW6A 4KGKA 1MD9A 2PO4A 1RP5A 4IRKA 3TAQA 5DG8A 3PBKA 4MKBA 4NLYA 2UXBF 2VQFC 4LF7C 1Q4RA 2C28A 3MEGB 3Q24A 2YX4A 2LDIA 1HNXC 3MM6A 2DK2A 3TYTA 2ASJA 2VH7A 4DV3C 2PMHA 2AD9A 1HW8A 2GQ2A 3V6JA 2RB7A 4FS2A 4ES2A 2AV5A 5D4LA 2DBBA 2QIFA 4J9PA 3TUIC 2XS5A 3U7JA 2IBKA 2NYIA 3PW4A 1ZB9A 3BJYA 2RJZA 3HHDA 3U1NA 4J9NA 1RTIB 2Z2MA 1PGZA 1V3SA 3KTQA 4V19J 4TNOA 3CIZA 3NAIA 1BD6A 3PR5B 1O90A 4BC7A 2EFQA 4IOBA 2EFVA 1DZ5A 1Z2LA 3J81Y 2VPWB 2C2EA 2FLPA 1ZAWA 2YWEA 4DMZA 2ZH7A 1FK9B 1SL2A 3NYRA 3KFWX 3LALA 1ZM2A 4CZCA 3RB6A 2YNFA 1C1CB 3NBPA 3N54B