4G1IA

Structure of the prgh periplasmic domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
189
Chain Sequence
ELDSLLGQRFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Protein prgH
publication title A Refined Model of the Prototypical Salmonella SPI-1 T3SS Basal Body Reveals the Molecular Basis for Its Assembly.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 70
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4g1iA02
4G1IA 3GR0A 4ALZA 3GR1A
chains in the Genus database with same CATH superfamily
2R7QA 4X66J 4PCQA 2V5HG 4DUTA 1C1CA 2L08A 1V3SA 4CLPA 3LF0A 2HQDA 5I3UA 4ZVRB 3LGXA 1N34C 3D6HB 1NB7A 4LF4J 5EWFA 1DLOB 3DLJA 2XM3A 4YY3F 4ELUA 3BGRA 4L3KA 3QYYA 5CABA 4JI6J 5FLXD 3KJNB 1NU4A 1Q4RA 4CO0A 3UCZP 5HVFA 3BZQA 5BR8C 5I3PA 2BW7A 3KMSA 1DRZA 5T14A 2DR8A 2KHCA 2N7CA 3IRXB 1KD1T 3C2PA 5K14A 2BACA 3TRGA 4DUYC 4A8KA 3MM5A 1LW0A 3BBBA 3TX8A 5IWAJ 3MM6B 3JQKA 5D0GA 2FDNA 1SH0A 2JLGA 3L09A 1TK8A 2M5OA 1R8BA 4YN3B 3QATA 4QWAA 3HVTA 4KV8A 4KR0B 3G6VA 3CVKA 2P2QA 1UFLA 2DK2A 3JQJA 5K8OA 1VLYA 3GILA 3G9CA 3EQ6A 2PD1A 1HBOB 1D09B 2KYZA 2CXCA 3IEUA 2QLFB 3CJQA 2KZFA 4DV1F 2HIYA 2VOPA 4U7UD 1MLAA 1LFPA 3UQSA 3R5CA 1HBMB 1L2FA 1RHKB 1VK3A 3WBZA 5A8WA 2V4JB 3L4BC 5ETMA 2WSFC 1FVQA 1X60A 3JYTB 4CLUA 1MG7A 3NGRA 2C42A 1QM9A 1WACA 1I5OB 1UZHA 5HI7A 1ZTTA 1QJHA 1V5VA 1VQ7S 3CSKA 5H9EK 2AYEA 4DV0F 2DO0A 4PR6A 4L76A 3W2WB 3LUSA 4DLGA 4P74A 1FA0A 1LXJA 1BC6A 1EKSA 4CQ1A 2CZ9A 1PAUB 3E2EA 3MM7B 5DG7A 4V19X 4DCJB 2JEGA 1GEHA 4LR9A 4I67A 5E0OA 2R7RA 2VQFJ 1Y3KA 3KOAA 1U1QA 3UOWA 3AQOA 2DPLA 3OXFA 3I0RB 2F40A 1KQGB 3IS9A 3LANA 2P2JA 3BQ2A 2POKA 1REVB 4ICLA 4ELVA 3OR2B 4YMEA 3DCAA 1VQMS 1JOSA 1NHVA 1UCNA 4M5JA 3HDSA 3KHGA 1WI8A 2RH3A 3OL6A 4CIOA 2C3MA 2EXUA 1AZSB 1IR2A 1WKJA 2DNOA 3D9BA 4DV4F 4FUQA 1UZDA 4OHWA 1WTBA 2FHJD 1XMOF 5C42A 3T1HJ 4Q44A 3TZZA 1KNZA 1NZAA 3PYDA 1NDKA 2MZJA 2JVOA 3IEVA 3NGKA 2P9GA 1PC4A 2V94A 4O0NA 4ECUA 2RDJA 3KNAA 2HVZA 2M9KA 3MEEB 2VG6B 1SJ1A 4XPEA 1OYEA 3FFIB 4ZJZA 1S10A 4O0IA 1N34F 1VQSA 4U8VA 2ZNYA 1FX2A 2GVDA 2C3PA 3PESA 1P1LA 5ETRA 2HHPA 4LF5C 4ED8A 3R6GB 1Q8IA 3MOZA 1VQ4S 2ZH5A 1MROB 4R0EA 1AROP 2QA1A 1JXVA 2FY8A 3MMAB 4ZLPA 3AJDA 4ZPDA 3AH6A 4LSNB 2QN6B 3MCNA 5L1IA 5THWA 3MTJA 5BR8F 2HAFA 1S12A 1TKDA 4MKYA 4I6AA 4GKKC 5ETNA 1RT4A 2VDIA 3IGNA 1H72C 2RJZA 4Q7AA 1D9DA 1FFGB 3M2RB 3FQKA 2OO4A 4EBEA 3SV4A 1FTCA 3CIZA 4DUYF 2OMLA 5KFRA 3PFOA 4MIWA 4KO0A 5LJ3Y 2VD3A 1YJTA 2IJRA 2KM8B 4OHYA 3KUHA 3RAMA 4Y2KA 4XO0A 3GTYX 4DUZC 3HKZD 2GJIA 1PGZA 1RLCL 1KWMA 2UVUA 3KLEA 3H5SA 3TUIC 3ETCA 1O93A 2MEWA 5E7OB 4H4MA 4HEA9 4PQUB 3TO8A 3IXQA 1DBDA 1SV5B 1CQNA 3PRDA 4IKAA 2HVIA 4B17A 1KN6A 3MEDB 2CQ2A 3HLUA 3B8HA 3W9IA 3RBDA 5GTDA 1AYEA 1U8SA 4IDKB 3ULHA 4K59A 4X65J 1UPPA 3P96A 3SZ2A 1NK9A 4HDGA 2BR0A 4PKDB 5IQQA 2BBEA 3M8WA 5A6PA 3PYEA 1HNIB 2YQ1A 1CC8A 2YKMB 3IO1A 2XTJP 1FX4A 3ITHA 1RAEB 1RYSA 3MFHA 3BPDA 2BZ2A 2Y27A 4ZHRB 1AFIA 4AXJA 5FD1A 3IWNC 5U47A 3BEGB 4HYKA 4D56A 4KFBB 3LPYA 1JXEA 1FE0A 2U1AA 3A12A 4ED1A 4PG8A 1X4EA 5GAHI 1IKYA 2GJFA 2XY5A 2CPDA 3CW9A 4LRCA 3Q8PB 1TTHB 1X9WA 1CS4B 2FQQB 3CD6S 2F7VA 1TUVA 3DMJB 4M5DA 1NKCA 2ZOMA 5HMXA 4DR5J 3OLAA 1VQ5S 2P2MA 1C1BB 4M63A 5HMZA 4ZPTR 2CG8A 3BR9A 5GMKa 2OPLB 4BC9A 3OTOC 1YJ9S 3JSMB 3R44A 3FSXA 4DV3J 2ZBIA 1X9MA 4HDHA 1Q81T 2HK2A 2LXFA 4X4VA 1RT6A 2IDEA 1LW2A 2CIMA 4NZ0A 2ACMA 1SJ3P 2H5IB 5IT9D 2Z58B 4RW7B 1UA0A 3TR5A 4OI3A 4GO7X 5HROB 1VC6A 2D3UA 4BDPA 1JWWA 3A8KA 4IFVB 4OX7A 1NK5A 2PA8D 3RB4A 1MU2A 2HVHA 2NPFA 2DKOB 2CQ4A 3VAJA 2DEJA 4DV5J 2PFDA 2DGXA 5IQ6A 3KLIA 4CH7A 2D69A 4KY3A 4LF5F 4K5RA 2MQQA 2QYGA 2DISA 4OJ3A 2HG4A 1UEKA 4N8OA 2DY9A 2XCPA 3KLHA 1XWLA 3PKMA 1SL2A 4GKKF 4TU9A 4NA1A 4UY8T 1HYSB 3DLHA 5CH7B 1RTHB 2XLIA 2W9AA 3MWBA 3CGIA 2ASLA 1U1NA 3TAMB 1U1RA 2SXLA 4B9SA 2EG2A 5B0CA 2VA3A 2GIQA 1FRIA 3OR1B 3V4IA 2ZBQA 4I1TA 3B4MA 1KHVA 5JMNA 1XMBA 4J9MA 2LDYA 5J2MA 2Z56B 1JLEA 2D9OA 2A0FB 4DUZF 1KTVA 5HQMA 3TJ8A 2IA0A 1YJNS 1FXDA 1RA7A 4B9VA 2PMWA 3LGNA 3PR5B 2BANA 2IM3A 2MZRA 2CNLB 2C2DA 2VG5B 2J76E 3NXZA 3SQGB 3W5ZA 5IT9Y 1R3NA 4LFCJ 4WK3A 3RW7A 3VAGA 3W9JA 3EXYA 3DYAB 1NDCA 1NM2A 5IZHA 3UEBA 2E9RX 4PXBA 4P6QA 3PIOQ 2HS3A 3ZZYA 2AP6A 2W4CA 5FLXU 1RQ0A 4OHZA 5ETTA 2D3O1 1YRXA 4OFZA 4PHTA 3NLCA 2OPPA 1KKGA 3T6BA 2GO8A 2W8LA 4IG0B 5ETQA 3DI6B 4XTTA 1S1XB 2ZHBA 2BDPA 4NXMJ 3QGHA 5DM6Q 2N3OA 4TU7A 1U1MA 3Q24A 2DYJA 2FJAB 2R8IA 2IAJA 1OQ6A 3SI8A 1N36J 3NL0A 1N5SA 2VPXB 3H5XA 3T19A 2HRYA 3KJVB 2UVWA 2AD9A 4USUA 4XIUA 3PDNA 2D3OR 4EZ9A 2CPFA 2OLWA 4O3SA 3HHLC 1D0EA 2CPEA 4I9GA 3NGTA 3HF5A 1NPPA 1Q8KA 1C1CB 4OL8A 2ZOGA 1T9TA 3NKYA 2AT1B 4N47A 1R27B 5I3UB 3FBCA 3BB5A 1VIOA 3CCMS 1RA6A 3GFHA 1NSPA 4XDDA 2AU0A 1UL3A 2OP5A 4UT4A 1XNRJ 3BGRB 3I0SA 4RVNA 3C14B 1S76D 3R7NB 3BN7A 1Y4ZB 2EVZA 4YB5A 2DNRA 3W63A 4DJBA 2GZOA 3CCLS 3A13A 1RTJA 2QRRA 4U7UK 3HD2A 5D78A 1IQZA 2AV5A 1Q8BA 1Q5VA 2R2UA 2I2YA 5JVHQ 4DSJA 4LIWA 2HFZA 5H9EJ 1RT5A 1S0MA 1WI6A 2BVZA 1P9QC 1S77D 1XNQJ 2ZBPA 4TN2A 1L3KA 5K14B 3RR7A 1KLNA 4W92B 4A8OA 4DV3C 3MM5B 3D6TB 4KGVB 1LW0B 3M8QA 3CULA 2LMIA 1T9WA 4PG5A 2GW8A 2AEMA 2BRKA 1HR0C 4QQBA 2MLZA 2Y9HA 1MWQA 3HVTB 4KV8B 2RS2A 4MK9A 4PUHA 5I42B 2RU3A 2JJ4D 2BJOA 1EAYC 2EKYA 1S6QA 1XJWB 2IRYA 1K1QA 2Y1RI 3HHLA 1FNXH 1RAOA 4QIWD 1NAQA 3QAEA 3TDEA 2C2RA 5A8WB 3PW7A 3GU0A 2MQLA 3EJMA 5DLGA 2VONA 2ZKTA 1IVZA 1N8RT 4UQTA 3NCPA 2I5JB 3Q8UA 4PQAA 3R5AA 3CCTA 3VVTA 4YUDA 4NMXA 5JVGQ 3CJRA 2KYXA 1FRMA 2NCLA 4X4SA 2YNHA 1U1PA 3QJJA 2BJ7A 4IOAQ 2XO6A 3HI9A 1D3WA 4P2FA 3AXKA 4CO5A 1MWYA 1PA4A 1VQNS 2LEAA 4DR7J 1V5IB 3FGVA 1H0HB 2A2DA 3O2IA 3SDEA 2A18A 2I8EA 2GX8A 1OMSA 1F3FA 4QOTA 1VRUA 4PPDA 3QMQA 5LCIA 4O3RA 3G87A 5L1LA 1FNMA 2BW2A 2UV8G 1Q78A 1NH7A 2M70A 5BSUA 2KKHA 4CTAA 2AJ0A 3IS9B 3UN3A 4CLLA 4ICLB 2E1CA 2DGVA 4C8YA 2G2OA 4IRCA 1C0TA 3POTB 3VV2B 2G2YA 2XS5A 2UUAJ 4CDIA 3K5LA 3FCEA 2Q6CA 5KFWA 4NXNC 2JVRA 2YQ0A 3TQEA 3CF5Q 5ETSA 4M5IA 1SIZA 2ZUGA 5H9UA 1SL1A 3JB9k 1VBZA 2KHDA 5DDQC 3OSNA 2YKPA 1P27B 1IBKC 3DRSA 1ZYQA 2F8EX 4WZMA 1RABB 2M8HA 2KH9A 4WTYA 3B54A 3A8JA 4CH1A 3H2TA 1D9FA 4CZCA 1XTZA 1CLFA 1RKJA 4EYHB 1OY6A 2ZE2A 4UOFA 2IVFB 2GVDB 4FYXB 1NKBA 1KFDA 3DGPA 4ZKAA 4UUWA 4C9DA 2NUHA 4RR5A 4NXMC 2Z4PA 1KC8T 2B9WA 4NWBA 3ZZPA 5K8NA 5EHHA 4DL5A 2BM1A 1MN9A 2UUTA 2QGFB 4AQYC 5C25A 2H4YB 4ZCKA 3GFXA 4F0MA 1RT4B 3BYPA 3AD9C 2NSBA 1VRTA 4DV3F 3TEGA 1FWPA 2MYFA 4USTA 2EFVA 3CJKA 4GC7A 3PHEA 2JNJA 4F50A 4KO0B 2MDAA 1HR0F 2VPZB 5KG0A 1EJ7L 3GYXB 3T6JA 4BHQA 1WG4A 2IY5B 4UOHA 4WYWA 3CJ5A 2E0GA 1N0VC 3KLEB 1U0SA 3KMQA 2ZH7A 3RBXA 2E7XA 1J5OA 4H4MB 3JQMA 5IV4A 3OBIA 5LSLA 3GV8B 5IC4B 3G96A 4DV5F 4CWBA 2WTFA 1NK4A 3AF5A 4R0JA 2DR6A 3CCUS 3PCOB 4RM3A 5G4DA 3FKBA 1IM4A 1HD1A 2PSZA 5E3CA 4ZS6A 1O5JA 3BJYA 1WF3A 3H7HB 3ONQA 3B4DA 2R7TA 4K4ZA 1JB0C 4HT7A 1HL6A 2EFGA 3J80Y 1HPZA 5IT9U 2DNYA 3MPYA 3L7PA 3ITHB 4F8RA 3GONA 3R5DA 1JLBA 4K0KJ 2OHDA 2VF3A 3TANA 2Q79A 4KTTA 3ICLA 1ZPVA 1SJ4P 4OI4A 3L9ZA 4UTGA 1LK7A 1SQFA 3A9VA 4DQPA 5ITHA 2V63A 2UXDC 2IM1A 3W65A 4A46A 4DSEA 4ELTA 2FTRA 1H2TZ 1RCXB 1YG0A 2GQQA 2MQPA 2Z51A 1IKYB 4NLPA 3EE3A 5D77A 4RL1A 4BLGA 2DEIA 2ZDPA 1RAHB 3LNOA 4C8KA 5ADZA 4M5DB 3V6DA 4RLQA 1YQHA 2OSRA 1BE4A 2AJ2A 2CNNB 1NDPA 1U2CA 3GMGA 2EFNA 4CRJA 4WU2A 1KR4A 2FZGB 4YFUA 2O5DA 2NZ4A 2B51A 4ILLA 1TAQA 2A2CA 1E6YA 3GPAA 1JKHA 1SKSA 3IRWP 3DDIA 2NXEA 1RHJB 1A0OB 1PIEA 3WC0A 1RT6B 3D5MA 3DRRA 4PUOA 1LW2B 3I5BA 3GCWP 2QA4S 1IBKF 5CXTA 4RKUC 2O66A 5DZ6A 2M88A 2YH0A 4UW2A 3U7JA 2ZZMA 1HNZJ 4F3QA 1NK0A 2IDLA 2VG7A 4NYOA 1IWGA 1OY9A 2QA2A 3FC9A 2VPWB 3CCQS 4RUHA 3KLIB 4FXVA 4ZP6A 3H2LA 4X4QA 2V2VA 2IMOA 1EQMA 1S7HA 1TV6A 4NXMF 3TA1A 2DHHA 4DPYA 4M94A 4MH4A 4FBUA 3A3OB 2HW3A 4A48A 2WAQD 2KI2A 1WF2A 3DDKA 3PVXA 2F1FA 1F3VA 2DCUB 2V68A 4FN5A 1FKOA 4TY9A 3KLHB 4HACA 2B4OA 4RW4A 5A8RA 2C3OA 5HLFA 3UR0A 2VJUA 1K1SA 2CJAA 4F3MA 3PKYA 2VBXA 1SBRA 4CYUA 1GMWA 1UWDA 2DCLA 1X8DA 2GHWA 3TUFA 5IFMA 2KVQE 3V4IB 2MKJA 2HBZB 3L8CA 1SQGA 2MZQA 4IRKA 2JEIA 3PBKA 4ZMMA 3PYFA 2F4VJ 4YHHC 5J2MB 1JLEB 3D3BJ 1RYRA 1X5OA 4ZLJA 2XZWA 1BY9A 2CQBA 3E8OA 2QMXA 1DY3A 4L73A 1S97A 3VAFA 2HBQB 4GKJJ 4J9RA 3KXDA 2H48B 1RACB 4MKAA 4EFAC 2YWHA 2BANB 5KFJA 4ZVHA 4FPRA 2PROA 1FXRA 3QNWB 3VGVA 3N6LA 5E3PA 1FJGC 1NCLA 2FJDB 1CEZA 2ZKUA 1KVIA 4PRFA 2ASYA 4RNMA 2WHOA 4NLWA 2HQIA 1NB2A 4WZQA 3R2CJ 2GAHC 3S6EA 4MIBA 1X4HA 1NPKA 2JMPA 3UD3P 3OJUA 2BABA 5F8HA 2VFTA 4NZ6A 5KT2A 3TJAA 1RWXB 2OPPB 4GVBA 4R1MA 2FVCA 2EW9A 1CG2A 2RMLA 1S9FA 4D3HA 1KEKA 1KONA 1RWPB 4N7TA 3NNCA 1JJCB 3JS9A 1HLWA 4JI1J 3HZEA 4FVCA 2P8IA 2GQCA 4LVNP 4KE5A 1SJQA 1SJRA 1M5KC 3T1AA 2GNKA 2IAJB 3TA0A 3HSZA 5BSMA 2LQ8A 4USJC 2FJEB 1M1KT 3PACA 3M6VA 3KG4A 1S0OA 1N54B 1S49A 3W66A 3SFUA 1C2PA 2ZM6C 4OIXA 2I38A 4DV7J 1QSYA 3TX0A 3I0SB 1TFYA 5IOLA 1QTMA 2J6TA 4QZVB 2RU9A 1IBMC 4RW8A 2R4FA 1TKXA 1B0VA 3F0NA 3U1MA 1RTJB 2JFDA 1HI8A 3VGSA 2B7BB 5RUBA 2MKSA 3PV8A 4OZLA 4IG3A 1R31A 1RT5B 2LLZA 4YR0A 4USHA 4FNIA 2QL8A 1UP1A 2AX1A 4ES3A 4NPOA 2J7KA 2YWCA 4FP9A 1D8YA 2MHNA 1FUGA 3M8QB 2BUNA 1RTDA 1EB0A 3N9UC 2GCFA 5J2NA 3S01A 3F44A 4ETZA 5D8HB 2JC1A 2XLJA 2OD6A 2OMOA 4JOUA 2RB7A 4ZN3A 5L39A 3Q83A 2CQDA 2BJEA 2BJ8A 3NMAA 2HSEB 1U1OA 2E5LJ 2MTLA 1ITPA 2IFXA 3DRPA 1S6QB 3EYZA 4DQQA 2H65B 3HHLB 1F2GA 1VBKA 3D67A 2V4QA 2GJ2A 5KG7A 3W64A 3N0VA 1KFSA 3HT3A 5IS2A 2QE5A 3EZUA 3QFWA 4FYYB 4RO0A 1FRXA 4YHHF 1Q86T 1TVRA 1Q16B 2W4DA 2HHSA 3BKUA 2QFIA 2VBWA 3L7UA 3V81A 3QGGA 3NG8A 4I6YA 5DETA 7FDRA 1VQOS 3J80U 4C0OC 4U96A 2VDHA 4TY8A 1U4BA 3Q22A 2EGTA 1I3OB 1N4LA 3H2VE 3Q8SB 1MXBA 1HKAA 3KJQB 1WD6A 4JI3C 4G6VB 1FJGF 3G4SS 2UUCC 3SDEB 2QLJB 1YJUA 4ZVGA 1JNRB 2E7VA 1VRUB 2DD8S 4MFBA 4I7FA 4ECVA 2UZAA 4LVOP 2CPJA 3SSSA 2IYIA 4CT8A 1NJXA 2JEJA 2Y0SD 4CTAB 1Y3JA 4DEZA 4B3RJ 3EGWB 3OTBA 2M3DA 1B64A 3A1YG 2KB2A 1C0TB 4DCVA 5DDRC 1ICEB 3W8PA 5AXKA 2RQKA 3G82A 3UCUP 2VHGA 1FWLA 1T5DX 3UW1A 3ZTOA 3NS5A 3H90A 5DDPC 3PR4A 4OYAA 2UUWA 4CM2A 2OTLS 2CFXA 1U25A 2MB0B 2HS0A 2DR5A 2QO3A 2ZITA 4Y00A 1SJFA 3Q0AA 2F8MA 2BKOA 3BH7B 3DRSB 3R97A 1UKKA 1MWZA 3DHVA 2VU5A 2VPYB 3NGUA 1GX5A 1EGAA 4V19J 1Y5LB 4NLDA 2MJNA 3UDLA 2R42A 5HQ8A 3IWXA 3ZC4A 1P9YA 2MMAB 1RB0A 1XC9A 2OBVA 3G6ES 2FC9A 2ZM6F 2NSCA 4OQJA 1Y5NB 3DGPB 4JI1C 2X3DA 1VIXA 3D6MB 4JI8J 2H1YA 5KT6A 3SCKE 2RQMA 4F4ZA 1VR6A 1IBMF 1LKZA 1O90A 3IR5B 2R7OA 2BE2A 3M8ZA 2XY6A 3MR3A 1T3OA 5C25B 4LF9C 1GH8A 1U6ZA 1USPA 4RNNA 1M1GA 4ECSA 4G65A 1VRTB 4DV6J 1ZM3A 4B3MJ 2Y8YA 2H51B 2ZJRQ 3CJKB 2J0WA 2HQFA 2LA6A 2QG9B 2DNZA 2LFVA 4LREA 4DV7C 1WG5A 1BQMA 2DPJA 4X64C 1R8PA 2W9BA 2VFVA 4DCUA 4J9KA 4C6AA 3PRVA 1WG1A 4DR4C 2HHUA 4ZJOA 1ULRA 4W90B 2O01C 4PEOA 4DZDA 3RJMB 1J5OB 4B3OA 4OXIA 2EK6A 4ITSA 2QLWA 5IFIA 1WHYA 1UEVA 4C48A 8ATCB 2E1AA 4TYBA 1TUWA 3IAS9 4MIAA 2MZSA 3G86A 1N33J 2EI5A 4NCBA 4OYWA 1OSDA 2EFOA 5C24A 4JV1A 1HNWJ 2R8HA 4OMFG 1JLBB 1ZAVA 4G3IA 3QPIA 2PO4A 3PTWA 5KFEA 3KKFA 3OVSA 1BHNA 5DQHA 6FDRA 3EPIA 3G2XA 4JI3F 3NGSA 5B0BA 3BH6B 1QE1A 2ZUAA 2UUCF 2AYMA 1OPZA 4Y34A 4QIEA 3GIIA 1UFWA 5BJRA 2YBVA 2W01A 2W25A 4DL3A 3M8PA 3UZ0A 2RNEA 5L8RC 4JV2A 1VQLS 3IR6B 2OD4A 4J9LA 4I6WA 3V6DB 4KHPJ 2DHGA 2XI2A 5A1GA 3BSOA 1Q8LA 2PGCA 3NP5A 4FS1A 1TKZA 4YR3A 4UQGA 4JI2C 2C2ZB 1E6YB 2JFKA 3K59A 2WONA 3HD1A 1IBLJ 3ISND 4MK8A 5KYVA 2FHJA 2BQRA 3NWRA 3DRRB 3P4UB 4PUOB 1MMNA 2CPZA 1RUSA 1TFWA 3OFEA 2ROPA 3E51A 1XR7A 2V67A 1J5EC 5H9FK 2WB1D 1R0BG 1WHWA 1HQUA 4B3SJ 3MMBA 4OYOA 4ETXA 1S72S 2FB0A 2VG7B 2EC2A 4NEYA 4OX9C 4QWEA 4OJHA 1UVKA 1NPRA 5KFKA 4JYAJ 3MUMP 2QLXA 2G4BA 3MM8A 2OUGA 4JI1F 1QWIA 2MQ8A 1RBOB 2GFFA 2HNYA 2LU1A 2AQ4A 1TV6B 4ED0A 3K7RA 4H4OA 1WC4A 2J9CA 1VGYA 2DH7A 2V8HA 2IPOB 2XWXA 2ZVIA 2ASBA 4LF9F 2OPQA 3PJWA 1FKOB 1IJEB 4HACB 4P75A 1RHMB 4RW4B 1S79A 5A8RB 2BJ3A 2ZH1A 5HLFB 4LQ9A 1GNKA 2IVYA 2LVWA 5JXSA 1TL5A 4TLQA 4ZPAA 4ZLLA 4CYUB 2IJNA 5KFMA 3D4JA 3DLGA 2W2QP 3GSIA 3MPWA 2L3MA 4DV7F 4F0HA 1EP4A 4X64F 3T9NA 1KP6A 3BPSP 1DQAA 5K20B 3WDOA 4DR4F 1VJWA 2YNFB 3VQTA 5K9FA 4TU8A 1WDTA 2HBRB 9RUBA 4HI2A 1NKEA 2HHXA 3D54A 3UNGC 3BO4A 1RE1B 3QSIA 1U1LA 1QVGR 4A8YA 2ZJQQ 5M2UA 5KFZA 2MKIA 2M8DB 4YY3J 1KVKA 1R0CB 3KFWX 2CPYA 4Q2LA 2J8AA 5HSPA 2VOOA 1SI9A 4LF7C 3C5EA 4F4XA 4IR7A 4DV2C 2EBGA 3J7YI 2GMJA 5LMNC 1N48A 1WC3A 2NUUG 3QT6A 2IC3A 4QCLA 1NHKL 5B0FA 3IC1A 2NCKL 2N7YA 2W2PP 1F1BB 3VHQA 2CPHA 1JQGA 3DLEA 1S6OA 3FEYB 4GVBB 1DURA 1CQMA 3R5GA 1JLFA 3B6BA 1XR6A 1KRPA 4QIVA 2KJVA 4DQRA 2APOA 3G8TA 4OZ1A 2OGUA 1WEYA 2KT5A 2PI5A 2R2SA 2KRBA 4DV1J 3E7WA 5F0UA 4I68A 3EZOA 3PRBA 2KDNA 2ZD1A 3LQVA 3DFEA 4JI2F 1RXOB 2EWHA 3W2VA 2FGOA 1B7FA 4DX8H 2WOMA 1S57A 4RW9A 3CCWA 2W4PA 4NYZA 2HFVA 2QSFA 2RKIA 1AUSL 2Z2YB 4K2XA 4NRTA 1RT7A 2XQCA 1RBAA 1WDDA 2DNQA 3FBFA 3ZZTA 2BXJA 1J5EF 2WP0C 4DV0J 1Q7YT 1DARA 4EI2A 2DITA 4RW8B 2DR7A 3DGVA 1TKXB 1TU0B 4RUCA 3BQ0A 1VK8A 4Z7YA 2FJWA 2B8PA 1GMWD 4L2ZA 1O9TA 2CJKA 2YX4A 4OX9F 2FVPA 2E9ZA 4IG3B 1NK7A 3D3CJ 3RZAA 3AB2B 1BWEA 9ATCB 4KTVA 2QVZX 5ETKA 4ZPBA 4I9FA 2HNZB 3EDQB 5F8NA 1UVJA 1H6KX 4CLTA 1VI7A 2J7UA 1XR5A 3TZWA 2IVMA 2UV8A 1RTDB 5GAGU 1IWAA 3LAKA 5J2NB 5IXUA 1BGXT 4A8QA 3OPKA 3B7WA 4OJGA 1FDDA 1RT3A 1B3TA 4DFKA 1LV5A 1T9UA 2H5EA 1SC6A 3DRPB 1XMOJ 5F9LA 2QV6A 5D6GA 1KOOA 1FCAA 5KFNA 5F8JA 4JM1A 1MDFA 4WJBA 2LCWA 1MW7A 1RISA 4L72B 3BQ1A 1JIHA 2GA7A 3FSIA 2CJ9A 4DR2C 5KYTA 3TUZC 1TVRB 3W9HA 1VCTA 2QYCA 3V81B 4I69A 1N32J 2PDAA 1HIYA 3FBBA 2AZ3A 2HWTA 3NYQA 4GO5X 4TY8B 3OSPA 3TVZA 2L9WA 1N2FA 4ZIVA 4OZ0A 2QMWA 1Q7LB 3KG0A 5D4PA 3WHIA 3N54B 4LF7F 1S4FA 3G71S 3QSYB 2DRDA 2N4DA 5DG8A 1Z4UA 4LF6C 1SUQA 3TR3A 4DV2F 5BR8J 3DRYA 4PWDA 1F9FA 1RWNB 2XR1A 4PYDA 4DQSA 4I7FB 2E5JA 5LMNF 5I4MA 1LEOA 1S1UA 5LOQA 4WKYA 2XS7A 4ECYA 4C8ZA 5KG3A 3US5A 1K0RA 4DUYJ 1YI2S 5DQGA 3PY8A 1HNXC 3I9ZA 2DHXA 2WVBA 3CXCR 4NASA 2OH2A 2FPHX 3M8YA 3G82B 1URRA 4KHRA 4B9LA 5D15A 5JRHA 1U47A 2P5VA 3DOLA 2HGMA 3CWJA 1FDNA 2LEPA 1HWLA 2FVRA 2XMWA 3AT1B 1IB8A 3RGIA 2N3LA 1U49A 4L6V3 2ATWA 5KFVA 1HI0P 4OZ2A 1J2VA 1Y00A 2KT3A 3HP6A 5CZXA 2I6WA 3UNYA 3MECA 5KFAA 4OX8A 2NXUA 5AT1B 1HBUA 3ETOA 4IR1A 4IQXA 1M6XC 1S59A 1X4GA 3W61A 1QDUB 1UVNA 3L95X 5LSOA 4KYZA 1SKRA 2FJBB 4AT1B 5BUQA 2EK1A 4YEAA 1VC5A 4GS5A 2XS2A 3RBZA 3UD5A 2PEHA 2BE2B 3OHBA 2X51A 1TL7A 3OQ2A 3MURP 5ETPA 1L3UA 1USPB 4B9MA 4MKBA 4WF9Q 1RG9A 2ZHOA 3UFCX 5E5NA 1FE4A 2XGPA 1FNOA 3OXGA 3LGHA 3EM1A 2J0QD 2JNVA 4X62C 1RK8A 4WU3A 4HH0A 1YBAA 5FJ4A 3U1NA 2ZWPA 2NYIA 3HVRA 1BQMB 2W9BB 1NSKL 3VAHA 1M5SA 5KT3A 4ZJQA 2G0JA 3TP2A 5KFPA 2Z2LA 5DG9A 4ZPCA 3JTNA 4I64A 3ZO7A 2C2EA 4OHVA 1LWCA 2WW8A 3HHNB 1NEEA 2MSSA 3TAQA 4B3OB 1UETA 2B9XA 1FEEA 2BM0A 2Q43A 3H40A 4G37A 4XX2A 1YBTA 2D1CA 4QBUA 2DT9A 3AY0A 4ZPVR 3VAIA 2CYYA 2YWGA 3QIPA 3QQCD 1RADB 1M6XA 4DR2F 3JSYA 1HD0A 2YX7A 4P7VA 2XSJA 1UW9A 5C24B 4K2JA 3GJQB 1IKWA 1YJVA 5A76A 3AA9A 5H9FJ 2LQ9A 4LF5J 2GS8A 3O44A 2UP1A 4EYIB 3SCLE 1QE1B 3UR3C 2F8HA 4LF6F 2K3IA 2YY3A 3RB6A 3GFZA 1FVSA 1ZM4A 5F3TA 4WBFA 2E1PA 1ZAXA 2HWHA 3TARA 4OZ5A 2YWFA 4YS2A 5LXYA 3M8PB 3EICA 3HMJG 4P71A 1YGYA 2R2RA 3PNIA 1HNXF 1T05A 1RWWB 1KDNA 4HR2A 3BDEA 3GWCA 1N32C 5D3GA 2V9KA 3W5YA 2G1HA 2BKPA 1TKZB 1S0VA 5E7QA 4AD6A 2MKCA 1X31C 4LR7A 1Q95G 4X4OA 2KT2A 3UX2A 4DUZJ 3ZFVA 5KFSA 2W9CA 2WONB 1B99A 4K4SA 1N6QA 2VC1A 3VCDA 1ROFA 4EU0A 2HHQA 3LNVA 1R8CA 3CCJS 3DXBA 5KT4A 2MCQA 2IRUA 1HQUB 3K5NA 4HHUA 2HFSA 2DNHA 3FMWA 1CPZA 2ZH9A 4WIQA 2QL9B 4LF8C 1TL1A 3J7YU 3CDUA 2ONFA 2AEFA 3MM8B 3W7BA 2FIUA 4XAKA 3SXLA 3ENQA 4DFPA 4OYMA 4CCHA 2HNYB 1YJ7A 2MY7A 1GXTA 1MXAA 3ZZOA 4H4OB 2Z0GA 4J37A 4CO1A 2P2BA 3UVJA 5KG2A 1VEHA 1LWXA 4TYAA 4QYZK 4B08A 2WBRA 2OPQB 3OL9A 3TVKA 5CD4H 4WYLA 1PYTA 3IBCB 2MQMA 2OPRA 2G2ZA 5EWEA 1BXNA 4X62F 1TL4A 3HCXA 3T1YC 3DLGB 3S7RA 1X0FA 4JI4C 3MM9A 1R89A 4NCGA 2L9DA 2JL9A 3CW8X 3PO4A 2JLFA 2ZHAA 1UA1A 2Y4NA 4N5SA 2MGZA 4FYDA 3OTOJ 4QU7A 3UWTA 3JAMY 5HQLA 1RAGB 3SO4A 2ZH8A 2HK3A 4ECRA 1U0HA 3UN5A 2CZ4A 3HPOA 3HHKA 4IQMA 4U8YA 4KGXB 1WH9A 2XBPA 5MLCV 2MZ1A 4ISBA 1NXIA 2V50A 1JK9B 2RDIA 5LJ5Y 3X3UA 2LKZA 1N5YB 2QFJA 1WEZA 4E0DA 2QTWA 2QA4G 2B9YA 5HJXA 1L3VA 5E3QA 2E7WA 3BBCA 2H54B 4WFAQ 3J81Y 4LR8A 3H98A 1Q53A 3A3NB 1A6LA 1P6TA 1Q5YA 1K8AT 2D9PA 3NCRA 3RAQA 4EATA 1S1TA 1YRTA 4E2FB 2MY8A 1EKRA 3BDPA 3EDRB 1KKHA 2PT7G 4CO3A 4FBTA 1MSWD 1XS3A 2D28C 5AXMA 4XPCA 2HHWA 1JLFB 2AW0A 2CU6A 2D7SA 3BN4A 2CA9A 1RCOB 2UUBC 3EGVA 2DGWA 3PROC 4DCTA 3HK2A 1NZ8A 1YZ6A 3ZZRA 5KFFA 3QT8A 5J1EA 1P8GA 4QWDA 3BF4A 3C6UA 2DNGA 1SQEA 1N32F 1IJFB 4I56A 1WUUA 4OYBA 4DL6A 4KT0C 2KL8A 2ZD1B 1CJTA 2E8EA 1FWKA 2F65A 1GK8A 2HVDA 1UWBA 3W2VB 4YB6A 4C97A 3FRZA 2XMTA 3NBPA 5D4LA 2WOMB 2JZ5A 4RW9B 3Q89A 3K5OA 1I94J 2U2FA 3TAPA 4PXCA 3A26A 3QBCA 2RKIB 4NL5A 1RT7B 3RG6A 2BX6A 5HK4A 4GC6A 3EWGA 4HH1A 2QIFA 4RBUA 4LQ3A 5GADU 1T9VA 2J6SA 3LH2S 3K17A 4FXDA 4PZVA 1DLOA 4HTJA 1ZZFA 3D66A 3R27A 4LRFA 4LF8F 2J7WA 3I96A 4HPVA 1V26A 4USVA 4B3TC 2VIHA 5DZ7A 4QW9A 3UX3A 1YRUA 4ED6A 2RT3A 1LQLA 4NLTA 1YX2A 2B4VA 1ZH5A 1C0UA 2W24A 1S9GA 2C2NA 4GMKA 4Q8EA 3FQLA 4JI7C 3I32A 3GZ7A 4PWWA 3PM9A 1PC5A 1U26A 4OYZA 1SL0A 2HPUA 3IN5A 1TL3A 5A2QD 1RT3B 4NDNA 1SB6A 2QVYX 1RSCA 3QAUA 3MMJA 2IBOA 5D4NA 3FJ2A 4CLZA 3BBFA 4P72A 3T1YF 2LXIA 4JI4F 3AODA 4O3PA 2HAIA 3MMCA 3I9V9 2ZNZA 1ZB9A 2DR9A 5KG4A 3CJSA 3CD7A 3MZIA 2ZOFA 1PG5B 4HVZA 1VBYA 3DRXA 4RU9A 4Z37A 3GV5B 4L3NA 3PX0A 1ZB8A 2WW4A 4DR1C 3D68A 3FZBA 5BYRA 3OVAA 2ABYA 2ADBA 3AXMA 4EBCA 4DSFA 2GGPA 5HO4A 4F7VA 4WFZA 3V2UC 4HLBA 3UE2A 1NSQA 1WC1A 3T5KA 1Q79A 1SUQB 2V2ZA 2HHVA 3ENVA 2DHAA 1H73A 1X7VA 2P20A 4PWDB 5CYMA 2FUG9 4F2SA 2BRLA 3WX8A 5KFQA 3MCSA 2LDIA 1S1UB 1DTQA 1RZMA 3M6UA 3Q86A 4UOCA 5AJ3F 1KOHA 1Y0HA 1HR0J 3H42A 1OJ4A 3NGDA 2UUBF 1G4CA 5DS7A 4X4UA 3GKUA 2HZCA 5KG6A 1SXLA 3IP0A 3DOLB 1Y5IB 3R1LA 2M5YA 1XERA 1WHVA 3A4TA 1AT1B 3ENAA 2FJVA 5BSVA 2LU2A 5A2QY 4N77A 2JDJA 2AJ4A 3FNNA 2VICA 3N2QA 3FUYA 4ALZA 2QW0X 1O8BA 3FEZA 4O3OA 3EERA 1SVDA 4F0KA 3V6KA 2E5IA 3MECB 3D6FB 3LAMA 3N5BA 4J9PA 2NYHA 4KAIA 4I2PA 2KDOA 4URSA 1HBUB 1HARA 2KXNB 5SZTA 2VZEA 4WV3A 1ZZNA 4IFYA 1FEHA 2NZCA 5FDLA 3PFEA 3K57A 4ZOSA 1EETA 1ZM9A 4O3QA 4Y65A 3U1LA 2F3JA 3HXMA 1HWJA 3ISZA 4C0HA 1R43A 3M30A 1NJWA 1IKVA 3M9NB 1BUXA 2Q1LA 4BS2A 3AOBA 1TL7B 2DO4A 2R7XA 2BJ9A 2XYGB 3RRGA 1BQNA 3NS7B 5IT0A 4B3TF 3ET6A 2MKHA 1HWKA 4OV6A 4CO4A 3NOCA 3MF5A 3MAAA 1V25A 5ETLA 1I94C 4D4GA 2QVXX 4PXDA 3CC7S 2V7BA 5K8FA 3C6TA 1T8EA 4JI7F 1ELOA 2CJBA 1PO6A 3D2WA 2HQCA 4NXNJ 2M52A 3KHHA 2MKKA 1TH5A 2D1QA 4KPYA 1LWCB 3FSYA 4CM0A 2AYBA 2ALZA 1DZ5A 1ULTA 2HZAA 1IBKJ 2HHTA 2DH8A 4N41A 1O92A 3KHRA 4ANEA 1FKPA 3OFHA 2XYPB 1YHQS 2Y1JA 4X84A 3RTVA 3CUNA 3VNSA 4IYQA 4HT5A 2E1MC 2Y8WA 3QIPB 4E98A 2W1BA 2XSJB 2Q66A 5L1JA 2LQBA 2X7IA 2OI2A 1IKWB 4DR1F 4G1QA 3KLFA 3FK4A 3NPDA 2A3JA 2H3EB 4K50A 1NNDA 1FRJA 5KTQA 4YB1P 3GIJA 2KXFA 1B0PA 1FK9A 4R5PA 2WVCA 4IH5A 4P2SA 4ED7A 4AQYJ 1YTYA 3DAYA 2FVQA 4DCSA 1G1XA 1ZBTA 3H25A 4YP3A 2V6AA 3OTOF 3BO2A 3G8QA 2W7AA 1AMUA 1T05B 4QYZJ 3THVA 3M9OB 5D3GB 2F9JA 4K4VA 2VL1A 4QPTA 1AW0A 1VYAA 3LGMA 3W60A 2Y0BB 3Q8VA 4EBDA 2RS8A 2VFUA 2W9CB 2V2KA 1U1KA 1F9HA 2QLBB 3VZIA 3SSQA 2Y1LB 2Z30B 4C3MA 1N6QB 3OTEA 3ZTQA 4E8UA 1F5AA 2OPLA 2XO7A 4PZPA 1AXQA 2AGOA 2IJFA 2QJ3A 3MD3A 5AE3A 1RU1A 4DL4A 4ZJLA 2ATCB 5F0WA 8AT1B 4WP3A 2KG0A 5F8IA 1N88A 4DL2A 3T5HA 2MQNA 4C3KA 4UY85 1TL1B 1GT8A 2KN4A 3LOUA 4M5KA 3BR8A 3DN9A 1CVJA 2FHKA 4P7TA 2B43A 4RU2A 3D0HE 2AJ1A 3KDOA 2AMCB 2XNQA 3Q2SC 1HHTP 3GSDA 2HVEA 2B5JA 4C8LA 2MPUA 4KKOA 3RRKA 3HVAA 3CMQA 1Q0NA 2ZBRA 4NOZA 2M0GB 3H59A 3UVJB 2IIHA 5IM0A 2XMKA 1JNZB 3VTIA 4NLXA 7FD1A 1MDBA 4U95A 2UXDJ 2D1RA 3T5LA 1S99A 5JJBA 3CMES 1T9XA 2K2PA 5CAAA 4EEYA 1I1GA 3PG9A 1T94A 4G1PA 4FTFA 1OWXA 3UPFA 2OPRB 2OIHA 4WP8A 4Q43A 1RGVA 2RAQA 2ADCA 3P3DA 5C5JA 2AKWB 2HNDA 1IM6A 1U8WA 4DSIA 1I94F 2WVDA 3MM9B 4NCGB 3IM9A 3GYGA 1QY7A 1RTHA 2F4FA 2D3ZA 2MGZB 2RQCA 2VKRA 3FVYA 4J9SA 2GHPA 3DLBA 5GVQA 2B9EA 2VQEC 4CLSA 1U0HB 1U24A 1RP5A 3K2YA 3LALA 2WBMA 3NAIA 1SC4B 3K58A 3MCOA 3ISNC 3KK2A 4JUZA 4K5SA 3QT5A 5KFUA 4F36A 2OJ3A 4KGZB 3KTQA 1HNVA 4ZVSB 4ERDA 3E3XA 4F4YA 2R9LA 5GAEI 4ES2A 2VBYA 3CTRA 3NWGA 4ZCIA 2ZFHA 4DR6C 2HHHC 2VH7A 5DGBA 2B7CB 2R3VA 1S1TB 1WC0A 1BQXA 3SQGA 4Z7CA 1DHMA 1U2FA 3TNVA 1TQLA 4OYXA 3V4MA 1VLAA 3CJ2A 5C42B 3ZTSA 4IOCQ 2Z2MA 3R5BA 4WP9A 3SYZA 2UU9C 4P73A 2PIIA 3WQPA 4LBIA 4PABA 2K1RA 1S6PA 3J80D 4O4GA 1XMQC 4B02A 1OIAA 2UXBC 4KSEB 1UVMA 3IBFB 5J1EB 2HJGA 5AE2A 4ED2A 1N5TA 1K73T 3C6UB 3O8WA 3HHEA 4FXWA 5CA5A 3W3SA 4ZPWR 5A2QU 4X4NA 1CJTB 4NCAA 2XB2D 5DRKA 5BSWA 5D4OA 2E5HA 4DV4C 3UDVA 2JH3A 4YHHJ 2CXEA 1WKKA 1UWBB 1HQEA 3OTCA 4Q2MA 2YVSA 3RG2A 3NBPB 2PT0A 2JRSA 1RDRA 1C4AA 1K44A 1RWKB 1GMUA 3S1TA 4AYBD 1OO0B 5E3AA 3R2DJ 2ZH2A 3O6QA 3TQ1A 2OPSA 4YDDB 3GE9A 5IC6B 1FJGJ 5GAHU 3RYLA 3K5PA 1TKTA 4B9TA 4V1Ak 2AZ1A 4DPOA 3RV2A 5LSRA 5DGAA 4MK7A 2IYGA 4RBVA 4KBIA 3HVWA 3OL8A 1AFJA 2CADA 3C14A 2EEYA 4NLSA 3SSRA 2XG8A 4O44A 4A4JA 1H74A 4RUAA 5DLFA 4JI0C 3BGUA 2DNPA 1LWFA 2ZC3A 3HJFA 1C0UB 8RUCA 1S9GB 3F56A 4DR3C 4QIGA 1VHFA 2UXCC 4F04B 1TL3B 2BYCA 1ZETA 4F02A 1F2HA 3U27A 4FF3A 2DH9A 4BWJA 2R8GA 1VQPS 2F9DA 1CSJA 1T9YA 2CY1A 2HWIA 3G8SA 4IH7A 3BV8A 3MMCB 3AFGA 3ZZZA 3P45B 3OV7A 3A9UA 5I42A 4O4RA 3DHXA 2VZ9A 4NLUA 3ZNJ1 4LRBA 5LMUJ 4RWWA 1KLMA 4RJVA 2VQEF 4LSLA 1QUVA 4NLQA 1VQKS 4JI5C 5AXLA 2MSTA 2RRNA 1FDAA 2ZM6J 4JV5C 3CJ8A 4R1LA 6AT1B 2YKNA 3QRQA 4CLWA 4AE5A 4ZP8A 4DFJA 4DDFA 2I5JA 1IBMJ 2GGPB 3FBEA 2KXHA 4WFNQ 1A7GE 2CQHA 4QR0A 1JX4A 2FC8A 4AUKA 5K85A 2CVEA 4NI2A 2O3DA 4C0BA 5CYMB 1FD2A 3GJRB 2JLEA 3NAHA 2VKZG 5KFTA 3RR8A 4DR6F 1S1VA 2HHHF 1K0TA 1DTQB 1XQIA 3JSBA 4NXNF 4U9RA 4DPUA 2DXEA 1TMMA 2V34A 3N6NA 1RTIA 4QJVA 1YDLA 2CQ1A 2XY7A 3OTDA 1SCJB 1QAYA 5FLXY 2UU9F 2N4CA 3TZXA 2MMYA 2R7WA 1PG4A 1XMQF 1MN7A 2UXBF 1DTTA 2AEJA 2KFNA 2E8FA 4TNOA 3POTA 3PHTA 3JXOA 1H98A 4UZBA 1MU2B 3WIVA 2YTCA 3TOQA 2MLYA 5J2QA 4R25A 4XK8C 4PAAA 1WTFA 4JP8A 2BOPA 3FCVA 4FKYA 2B0GA 2CPIA 3T5JA 5T41A 3HSDA 3HFKA 3VGUA 2ROEA 4I2PB 1YBUA 2DXFA 1N5VA 4AQYF 4IFYB 2PA3A 1UKUA 5FDLB 3KWMA 4EWTA 1EETB 2DNKA 4DX5A 4JBCA 4DXLA 4JI3J 4R8UA 5KFYA 2QL5B 3I4PA 4RLEA 2MKYA 3RB0A 2UUCJ 4ZIWA 3CC2S 4RW6A 3M30B 2ZWOA 3GV7B 2C22A 4TQSA 3AD7C 1IKVB 4LFAC 3CIMA 4JV0A 3THPA 2DNNA 5IT4A 3ELHA 3RBEA 4CNZA 1BQNB 1T5HX 4OI2A 2CQIA 3ET6B 3M1VA 1RHUB 4Q5VA 4JI0F 4L4QA 3ILOA 2BE7D 2BQUA 1YVFA 3MAAB 4CNYA 4N8NA 1JXLA 3OHAA 1Y9OA 4DR3F 3C6TB 3AJ1A 3KUGA 3HFVA 3QT7A 4ZCMA 4ILMA 3O5TB 2UXCF 1TELA 4EUVA 3RRHA 4X66C 2B8QA 2I9SA 3CJTA 1R7IA 3ENWA 1PJ7A 2V8VA 2OSQA 4LF4C 5HATA 1NH8A 4IO1A 3MUVP 1FKPB 1UAWA 1SC1B 1RT2A 4JI6C 1ZAWA 4EZ6A 4HKQA 2YXLA 2RILA 2HRUA 4RVOA 4OYIA 3HKWA 3UDCA 4LMZA 4PG4A 4ZVQB 4O3NA 4EMDA 4KH1B 4JI5F 1G6BA 1UJ4A 3BSNA 1T02A 3HSGA 4JV5F 2UXDF 2BJDA 3L3CA 1FD8A 1FRHA 4G1QB 1Y10A 1NJIT 3QGIA 3KLFB 1OS5A 4C2MA 2GQ2A 3J7A1 2AWZA 2KG1A 2XMVA 1CJVA 5IWAC 1RI7A 4KH0B 4ZVEA 5HL7Q 2GV1A 1FK9B 4R5PB 5GMDA 1YSJA 4LF9J 2OEKA 3C66A 3KK1A 4USWA 3MFIA 5J1NA 1BLUA 2V69A 1X4DA 3RU0A 2YWBA 4YQWA 5E41A 3NNHA 1O51A 3LTOA 4L7IA 5LMUC 1KHWA 2D7VA 2KZ0A 4S0MA 4WK1A 2EFPA 4WWSA 2VFSA 3GIRA 1H3DA 3VF0B 4X64J 4J9UE 2PEBA 5A8KA 4K4YA 3NCQA 4IH6A 4DR4J 2JHEA 2KZZA 2DXDA 3OT9A 1M5PC 3HSJA 5D0RA 1CBKA 1PJ6A 2NR0A 1HHSA 5B08A 1Z2LA 2XCAA 3CO0P 2YWWA 5A19A 5L38A 2X1GA 4I0WA 3A8EA 2GC8A 4HTIA 1HHQA 3T3FA 2WK4A 2GIFA 2D1TA 2V8DA 2CQPA 5BXIA 1X5TA 1R0AA 1NYEA 3OUYA 1U6FA 1T11A 5GAEU 3FMBA 3EVWA 3Q8QB 1FXLA 2VQFC 3DLLQ 4PPZA 2B5JB 4KKOB 4RNHA 3KNGA 2FYXA 3DHWC 4GRSA 5IM0B 4QPXA 3WZ0A 5KFXA 2WD9A 4LE5A 4LFAF 2V0NA 1VQYA 2CWXA 1F9EB 1F6TA 2VODA 3R7SB 2E29A 5CHCB 3WX4A 3TQIA 1JLGA 4KHMA 3M2VA 3T1HC 2DHMA 4WCEQ 2MM9A 2HNDB 1FDBA 4KRWA 4DN0A 2CJYB 5LXRA 3M6WA 3Q8RB 3I56S 5EGYA 2XHWA 1F5CA 2BE9B 4EO8A 5LT5A 3CJ4A 3OL7A 5A1IA 5C7PA 2YNHB 1IKXA 4NX9A 4JI2J 3CW2C 3DKDA 4X66F 4IOBA 2K8GA 2V2QA 1FT8A 5EN1A 4ECXA 4UOGA 1UTAA 1NO8A 5KFIA 3OD2A 3GPCA 3RUBL 2OAUA 3VR1A 2M2BA 4LF4F 5ETOA 1V60A 4ED3A 4RM2A 4Y0FA 3FZ2A 3I5CA 1TR0A 2VA2A 3CQ2A 3KK2B 4RBTA 1J5EJ 3VWSA 3ADAC 4JI6F 2R8JA 5B0DA 1HNVB 4F4KA 3PJ9A 2HFUA 3EX7B 2CNKB 3KG1A 4OX9J 1QAXA 2Y4OA 4EGLA 3TW0A 2JX2A 2IM0A 3UDEA 3GYNA 1B4SA 2HBYB 1P4EC 4OHXA 2V4RA 5IWAF 1CJUA 4KGKA 4Q45A 2M4MA 5I3QA 3BYRA 1PJ5A 5B0EA 4FS2A 4A47A 1VQ6S 3H2UB 2HFOA 2CVIA 3CMAS 5E33A 1X5SA 2K1RB 3BO3A 4CT9A 1S6PB 3C15A 4O4GB 2VJVA 4DOZA 2RIJA 5HN0A 3IR7B 2RRBA 5E3RA 5KFGA 2KRRA 5LMUF 1WOSA 1PSDA 1RWOB 4FKXA 1Q1KA 3LUYA 4NZ7A 1NSAA 3KDNA 2ZE2B 2CNOB 2FLPA 2XMJA 3ILIA 1XRCA 4MT1A 1JJHA 2B3TB 2NXCA 4X65C 4LBPA 1HQEB 3GIKA 3I82A 3M2UA 3GR1A 1JJ4A 1T7PA 3CDAA 4HI1A 3PX4A 2IHR1 1UFKA 4TPSB 2X1FA 1S4EA 3DU5A 1MNEA 2O67A 2OPSB 4PXEA 3T9ZA 1BA3A 2RUGA 3X1LB 3DU6A 4LF7J 1TKTB 2EC0A 5CYQA 1M1HA 4DV2J 4WFYA 5KT7A 2Q6BA 4OZJA 5DM7Q 1P4EA 2VASA 5LMNJ 2XC9A 5HMYA 2VQFF 1HWUA 2P9EA 4O44B 1GXLA 5BSRA 5C2GA 4NLVA 3CD5A 4NLOA 4L75A 4PUGA 1LWFB 4DR5C 3Q8YA 4P9SA 4N56A 3R1HA 5HVGA 3I4HX 2CKWA 3IMQJ 1HMVA 2A6OA 1GTHA 1VRQC 4DN9A 4FZVA 1FRKA 4C4WA 1TZ0A 4OZNA 3N28A 3T1HF 2DNMA 4LF2A 1VFJA 3IFEA 3WC2A 5KEIA 3K6RA 1HPZB 4KB7A 3W62A 4QWBA 4TKTA 1AUDA 5J2PA 4RNFA 3UD4P 3EMTA 3K5MA 4DG1A 5EUHA 3M9MB 3CQ3A 1ZM2A 1TMJA 1KLMB 4LSLB 1L3TA 5H1SV 1EQ0A 4ZLNA 5AE1A 5CCMA 4RX6A 4DV5C 4B9NA 4CLKA 1VJQA 1M5VC 2YKNB 5T7LA 4IUFA 2ALYB 2GVZA 2QC3A 3CJ3A 2P2CB 3VGTA 4ZVPB 2BJ1A 3W8GA 3O1LA 1M0SA 3IM8A 3JTOA 4ILRA 3NEKA 4NI2B 5B0GA 4DHVA 4MJKA 2RDDA 4C11A 4DSLA 5D0EA 2YKQA 3A4IA 1S1VB 3BSCA 4DBQA 3CCZA 1KS2A 2ZVSA 2NXJA 4A8SA 1JKHB 1VLOA 5L9XA 2H9ZA 1XK8A 4FUTA 1RTIB 4YB7A 2GHVC 3NYRA 3C46A 4U5YD 3DOMA 1FKAF 3EGZA 1K47A 1QUPA 1REGX 2IMWP 1KQKA 3CCES 2RHSB 2QSWA 2FZKB 2RF2A 2OKQA 4KC5A 2CDQA 1IUJA 1DTTB 4KQZA 4X2BA 2LXUA 2CRLA 4J9OA 4DLEA 2PC6A 4P2MA 3GFYA 4WE1A 3PYGA 2YWEA 3KLVA 3C16A 3LWMA 3EVOA 2WB4A 5CCLA 5J2QB 2P9CA 5KFLA 4Q0BA 3PEHA 1YIJS 2HLUA 4X65F 1I51B 4DR2J 1RAAB 4YDXA 4LFCC 2H5JB 3MGJA 2W7OA 4KIAA 4CO2A 3DLKA 3LP1A 4Z2XA 1B70B 4DU8A 3PW0A 2G9OA 4ER8A 2WSCC 3BKTA 1NY8A 1E6VA 4W4MA 4XDCA 3LP0A 3MR5A 1S6UA 3G6YA 5B09A 2YQ3A 4R8UB 3A3PB 4J9NA 2FLOA 4LF6J 1UJ5A 4RW6B 1J27A 4ZITA 2LEBA 3NNAA 2FHOB 2CZVC 1V9OA 4GXRA 5T8SA 2WSEC 2E1RA 2PE8A 3M1VB 3VVUA 1ACMB 4FNHA 1NLKL 1N36C 3J7ZT 1WEXA 3HX9A 1HNXJ 2NQPA 4DR5F 4M5HA 3O2EA 3H0PA 2FJXA 4IZ6A 1TK5A 2DRAA 3AHPA 3KHLA 5KFHA 2HMIA 5B7WA 3TYTA 3J81j 1VOMA 4X4RA 4AL6A 1N56A 1JLAA 1G3OA 3ZXWA 3HT0A 4HL9A 4F3OA 2P2FA 4P2XA 4ZVTB 3GG1A 1NK6A 2UVRA 1HFEL 4DSKA 1GPMA 3A25A 2R2TA 1XNRC 2B6AA 1RT2B 2ZJPQ 1U7LA 1S48A 2MXYA 1UVLA 3M32A 4JB8B 2HLTA 3H4BA 2E7GA 4F26A 4ATNA 1DJ0A 2Q3PA 1CJKA 5CQGA 3IAM9 2VBZA 3I31A 1XRAA 2DIUA 4CP5A 4NEZA 2QL7B 4GVLA 1RTZA 1YZ7A 3N01A 1ZA2B 4LUBA 1XNQC 1GQEA 1W25A 4CLYA 3CCVS 4H4KC 3SFGA 1ZTWA 5K8PA 5BSTA 4K8RA 3MDFA 4C8MA 4PROC 3Q2TC 2IRXA 3T41A 1PCAA 1CJVB 2DJWA 3R6LB 3AAWB 4N76A 3LAXA 1ZS6A 4C3LA 3D1OA 1T95A 2PN6A 2XEXA 3PO5A 3M7VA 2XSFA 1DQ8A 2A1BA 3KK1B 3K89A 4BCAA 2OTJS 4A8FA 4ANDA 5JUMA 4HHHA 3VAMA 1N0UA 3W1YC 3FCCA 4MAKA 4X62J 1JLQA 3MPVA 3BKFA 2AYAA 3F73A 2YWKA 2RQ4A 3ETMA 2CJQA 4BSZA 2CQ3A 4WIIA 4DI6A 2PFFB 5A8KB 1WC6A 2IBKA 3PXGa 1YLXA 1XEZA 3TA2A 1HH2P 1OPIA 2ZEJA 4GXQA 1KQFB 2CG4A 2HIQA 2RE1A 4DPXA 4J9VA 4PUIA 4ECQA 1UVIA 2W2MP 2KZMA 1EARA 3CJ0A 5MAOA 1SC3B 2EFQA 3AJ2A 5K8MA 1YJWS 5G0RA 3GLJA 1UJ6A 4DR7C 4I2QA 2YNIA 1RKIA 4FF1A 4Y2MA 3AOAA 1MMLA 3VZHA 3CNQP 2R7SA 4LFCF 4A8XA 3H4DA 4H4KA 1R0AB 2VB6A 2B56A 3BGOP 3TUJC 1S1WA 3OUYB 2VV5A 4I4BA 2D41A 5KG1A 2DGOA 5CYJA 2HQ3A 4LJMA 1WELA 1BD6A 4BC7A 1Z2ZA 4G1IA 2P02A 2B4UA 4URGA 2L41A 4DPWA 2UUAC 3LW5C 2ZH3A 3G6XA 4J90A 3I6PA 3J7Z5 3CC4S 3LP2A 1SH2A 4F4AA 1JLGB 5EDWA 4WXOA 3M2VB 3D0GE 1N36F 4BBYA 1VC0A 2GIRA 1EIYB 4OLOA 1P1TA 3LA0A 2A10A 2CQGA 3JSRA 2DB1A 4NE9C 2C2MB 3CT9A 1IKXB 3PW2A 2ZDOA 1X5PA 5L9NA 1XN9A 4MYTA 5KG5A 2LECA 2YKAA 4QR2A 4UF4A 1L5UA 5FIIA 3IG1A 5F8MA 2XZDB 1K0VA 2WVFA 3HHDA 4MFBB 3KYLA 1XNRF 3PJXA 2AJFE 1KQSR 1GXUA 4Y2IA 2V8GA 2YNFA 5J1PA 2HZVA 1RJJA 1DQ9A 3R9XA 1R6YA 2VFRA 3QO9A 4DS4A 2HKEA 2WCXA 3THTA 2YCBA 3R7BB 1VS3A 3IA0A 2R8KA 3PZPA 4LF8J 3CCSS 1XNQF 3SMZA 2DGUA 1SIWB 4BWMA 3P6YC 2J9EA 4OJ1A 2OFGX 2GAGC 3FCWA 4LRDA 1GFWB 3CO9A 3QFHA 1CJUB 1O0PA 2AGPA 4RLFA 1W26A 4DCOB 4RMNA 1TUGB 1H7WA 4M5MA 4QU6A 4LFBJ 4ECTA 4ID5A 3MI7X 2W8KA 3D1QA 5SUHA 2F63A 1QD1A 3C15B 3E7XA 1PG3A 3CDBA 4OI1A 3H5YA 2C2KB 1SH3A 1U2RA 2KVIA 3I55S 1XHJA 4Y28C 3T1YJ 4JI4J 3BGLA 3MEKA 2DVIA 3GIMA 4OZ3A 1AB8A 1KTQA 2HRTA 2PN2A 1HW8A 2HEKA 2C28A 3I08A 2DY1A 3PW4A 1TK0A 5KOWA 3M2UB 3KUEA 5BYQA 3MCMA 1U48A 1W7WA 4K0KC 2CDRB 4DX6A 1B0TA 1Q82T 2XYHB 4F25A 1Z1ZA 4WFBQ 4DR7F 3NY0A 1RWMB 3QJLA 3SIPB 1M5HA 1U09A 3G7SA 2YNGA 3C19A 1LNQA 3E01A 5CYQB 3UN2A 2JEFA 2QMUB 2WRMA 1RHRB 3GQCA 3CDWA 1TP7A 3TJ9A 3QWUA 3TUPA 4FYVB 4K0BA 5HP1A 4DL7A 1K9MT 1UMJA 2HFNA 1CULA 5AJ3J 4RWXA 2KTQA 3GB0A 1IQTA 3D28A 4RPFA 3ILJA 3CCRS 1BMQB 4ZN1A 2UUAF 1Y7PA 4DF4A 5CD4A 2UUBJ 2HNZA 1HMVB 4EO6A 3P5BP 1C4CA 4WFXA 2K7KA 1QAIA 2E9TA 2RD5C 3GCXP 2KFYA 1H2VZ 1EZZB 2ASJA 1XBWA 4PG7A 4A8WA 1FJ7A 2DPIA 3EUNA 3CQ1A 3V6JA 5DQIA 5J2PB 2HURA 4OLPA 1NHUA 1FF2A 1WF1A 4DG1B 3MEGA 1HNZC 2VC0A 2PMHA 2ACYA 4CLFA 3S82A 1U45A 5HMWA 4U7CA 1WOOA 5KOXA 2ILYA 3DOKA 2J6UA 2XHCA 3NRBA 4QWCA 2FY1A 4DL0C 1WC5A 5T7LB 2HQGA 4YR2A 2GVZB 3OFGA 3HO1A 4NA3A 1G2EA 5K5MA 3HM9A 5T8TA 4W98A 2ZZNA 1JJ2R 4WKRA 2DIVA 3JAMD 5KAKA 1WWHA 3M8RA 1FHTA 3MAHA 5BURA 2BQ3A 4C11B 1PYSB 3CEDA 5D0HA 3CE8A 3V6HA 4ZK7M 2DBBA 4B3TJ 2AF6A 1Y11A 4OYPA 1PBUA 2ZC4A 1YK9A 3O3LA 1T03A 1OYDA 5LL6d 3DOMB 1O6XA 1GMVA 4ODJA 5HVHA 4NA2A 1R8HA 5A0YA 4JI7J 4Y6IA 2X1BA 2F4VC 1PYOB 3KLGA 3J81D 3QGPA 2RF2B 3MXHP 2J9DE 2CQCA 4DPTA 5GAGI 1RT1A 2CWKA 3R9WA 3MMBB 4GKJC 3R9LA 3MPUB 5HANA 4MH8A 4RNOA 2NPIA 3VNRA 2A6MA 4WE1B 2DTJA 1WSVA 3C16B 2XMUA 2YX1A 4C7QA 2J9DA 3ZZ0A 1URNA 2Y3YA 4Q0BB 4Y3CA 2XNRA 1FFWB 4YOEA 3K0JA 3Q23A 1HA1A 3DLKB 2JWNA 1HBNA 3LP1B 4LFBC 4K0KF 3EXCX 4M1KA 3QJPA 1D8ZA 1FI4A 4DR1J 1E6VB 4Y2AA 2JOQA 2CPXA 3LP0B 5C2CA 3FCHA 2HGLA 3KK3A 1X9SA 2DRBA 4OI0A 1FTRA 4MKVA 4EK2A 4D4IA 4M8LA 5DDOC 1JMTA 1LCIA 1LXNA 1EP4B 3QZ7A 2ASDA 2IA6A 4AL7A 4DMZA 3H20A 2MJUA 3HHLD 1QSLA 2UVVA 2E5GA 4ZP7A 3P8BB 1PU1A 3MR6A 2HMIB 2RVJA 1YITS 3TI0A 2RHQB 2YH1A 3RB3A 1GAOA 1JLAB 2VSQA 4DWIA 4QYRA 1RAJA 3TZYA 1SKUB 2FZCB 1IXKA 3DM2A 4LSZB 1UPMB 4ZVOB 2J0SD 3I87A 4NOHA 2KJWA 2DGTA 4ZVFA 5HBMA 3SCJE 1RBLA 2XI3A 4WS9A 2B6AB 2LP4A 3OFFA 2IC3B 3VQSA 1MKYA 2O1PA 1HNZF 3M32B 1VISA 4U6PA 1WJ9A 5IV3A 1UEUA 4Y2CA 2N82B 1CJKB 1G7CB 3DLEB 1KBRA 1PBAA 2FLNA 1XRBA 1WORA 1LWEA 1ZPWX 3V5RA 4A8MP 2BEFA 5LM7E 3UCGA 2BOAA 4MTPA 1S9EA 3BM7A 2I1RA 1GX6A 2OEJA 4KJIA 4K4TA 4WPAA 4RUBA 1X4AA 5KFCA 2NLWA 4C98A 1QLNA 3QLHA 2F5GA 1OSCA 4AXIA 1EX8A 4L74A 1ZA1B 4ECZA 2KO1A 1U6BA 5B0AA 3GJSB 2E8CA 2E5LC 1N5QA 4NRUA 1WNEA 4HHJA 5DJBA 3U02A 3VNQA 2JSXA 3PX6A 2C3YA 3QIDA 2WVEA 4ZCLA 1JLQB 3SCIE 1F5BA 2B4PA 2AYGA 3CPWR 1JLCA 4LBHA 3D1HA 2F4VF 4ENOA 1IR1A 4D57A 4M5GA 2EPIA 1TAUA 2XGQA 5L1KA 1H38A 4GKJF 4OYCA 3GR0A 3BSAA 3B78A 4J7CA 5DO2A 2NXNA 4USIA 3JTPA 3NMRA 3N6MA 1LFWA 5G0RB 5F8LA 2AIRB 4I2QB 2YNIB 1U02A 5DV9A 2ERRA 2FHMA 1SPBP 3ZZUA 1L3SA 4C8OA 4D3GA 1S1WB 2CUYA 4DS5A 2PI4A 4LFBF 3MOJB 1OY8A 4ZP9A 3IRXA 2Z57B 4O23A 1PAEX 3TVYA 4ZVUB 3LO3A 3GJTB 2HGNA 3IBWA 1R6VA 1MD9A 3C8YA 4B3RC 1NK8A 1HI1A 3MM6A 2H4WB 1I6JA 3K8VA 1F60B 4TLRA 3MD1A 2PMZD 3DDNA 5M2PA 1BWVA 3OJSA 1FLOA 2L48A 3LP2B 1F0XA 3M4XA 4USKA 2K06A 2FGCA 2J8SA 3PIPQ 2M5HA 1HBOA 1DAXA 2X3GA 2ZH4A 4DQIA 4F2RA 3TEHB 1HBMA 3MPDA 4OI6A 2MQOA 2FD2A 2D1SA 4DU7A 2V4JA 4NLRA 1VBXA 1VQ9S 1S0NA 1X4FA 3JYTA 2JC0A 3QRRA 4P10A 1QTNB 1ML8A 2W2OP 1T3NA 3IG1B 1VHIA 3AQPA 1GTEA 2DYAA 2J5AA 3DC2A 3GP9A 1S5ZA 4JI8C 3W2WA 4R0MA 6FD1A 4TXSA 4QW8A 2BKNA 4ANCA 2DGSA 4PWUA 4WXWA 3QO9B 1FJEB 3OVBA 3MM7A 2AJQA 2BH1X 3F41A 2CJXB 1APSA 5AXNA 1N5YA 1RAIB 1MMDA 4NMLA 3A8IA 1LOUA 4DV6C 3I0RA 4B3MC 4ECWA 3PW5A 1QAJA 2L9NA 1REVA 2XULA 3AD8C 1NJYA 3NS6A 3OR2A 3AA8A 1HQ2A 2XZTB 4PYAA 2CQ0A 3RW6A 4MYUA 2ZZTA 3HJVA 4ID5B 1XIQA 2VUGA 3SV3A 2XMMA 2ATLA 3N4WA 2E5LF 1AZSA 2KM8C 3NOGA 4TQRA 2XWYA 3MR2A 4KPCA 3R5JB 2BA9A 4M5LA 2KU7A 2D74B 1PKUA 1NUEA 2LYVA 2LQ5A 2YPZA 1D9AA 2GMHA 1RWUA 1VMBA 2WZ1A 3MEEA 2VG6A 2AHOB 4F67A 4QIFA 4URQU 2W7PA 1N52B 5EX3A 1N33C 3FFIA 2XMAA 2VQEJ 3NI2A 1YWXA 3IWLA 1HNWC 2YPYA 3HZGA 4DFMA 2OFHX 1RHQB 4KTQA 4K4UA 3SBMA 2BV3A 2XLKA 4LT6A 2EKNA 3BS9A 4OX6A 1MROA 2C1EB 1QM4A 2QX0A 3MMAA 3B82A 3CB4A 5BYSA 5F8GA 1RY2A 1VDHA 4LSNA 2YNGB 3E01B 1NMEB 3LWLA 3R3TA 3VAKA 5EWGA 1KVJA 1LK5A 4DZ6A 3RAXA 3J7AN 1EHWA 2RSQA 4DR6J 2HHHJ 3QRPA 3M2RA 5HP1B 2AX0A 2I0XA 2COLA 3P5TL 5E2QA 3JAMU 4KHPC 4B3RF 1CULB 4QR1A 1W2IA 2Y1IA 2K3KA 5KFBA 5F41A 3EPGA 4RZRA 2LQJA 1WSRA 1H7XA 4J9QA 2UU9J 2Z8QA 4K4WA 1A9NB 4FVMA 4F4WA 3H8YA 5CZVA 2G0CA 1IBLC 1T0TV 1XMQJ 2NS1B 2UXBJ 3EGNA 3LPEA 1WOPA 4PQUA 2C2OB 4TVAB 1M90T 2MHEA 1SV5A 3J81U 1UWAA 1YJRA 3N79A 3CDEA 1W2BR 2D27A 3OXLA 3MEDA 4AFFA 4B3SC 3MEGB 4DV4J 4IDKA 3M05A 4FPIA 1QVFR 2K7JA 4PG6A 1RWVB 5M2RA 1HNIA 2YKMA 4JYAC 3DOKB 4J5OA 2QT7A 3KJFB 4ZHRA 3N5FA 1D1UA 4JI8F 1FJCA 1WHXA 2GMLA 1B7YB 4KFBA 5L46A 1N34J 4X4TA 4LF1A 3FDSA 1R8AA 2G0IA 2G1DA 1V3ZA 1AA1B 2E66A 4MTNA 1QSSA 4H54A 1HWIA 2C3UA 5GADI 2GO9A 3L7OA 5ETVA 3KXWA 4FF4A 1YKWA 3MUTP 1CS4A 1KSPA 4DV6F 4B3MF 2CAJA 1X0PA 4JI0J 3DMJA 3EZ5A 3FRYA 2ZBCA 1C1BA 4LRAA 1T03B 1RU2A 2BMBA 4IRDA 2QZ8A 2E44A 3PEJA 4ED4A 2QEXS 2G13A 4DR3J 5A0YB 2AGQA 1X4CA 3M8SA 3I07A 1NDLA 3KLGB 3JSMA 4C8NA 2UXCJ 4NLGA 1FERA 4DX7A 3SEOA 7AT1B 3TWZA 4ID8A 2OELA 1RT1B 3IGVA 2W2NP 3DLPX 3C3LA 1S7IA 4YY3C 1CC7A 4RW7A 3W5XA 4ZA1A 1HW9A 2M7SA 5HROA 3UO0A 3MTKA 4IFVA 3P49B 1IBCB 2HYIB 2R7VA 3BGFA 3WIUA 1N33F 1MXCA 5KFDA 4USMA 4K7QA 1HNWF 1X4BA 3MHYA 1HBNB 1V3RA 4JI5J 3ZTRA 3ILLA 4JV5J 1VQ8S 4M5NA 4DG9A 4DF8A 3DXSX 3I5AA 4ED5A 3EVMA 2V8PA 3S8SA 4NYPA 3ZNUA 4AL5A 4ZDNA 2X1AA 3HULA 5HAOA 3KK3B 1FESA 3ZTPA 2LA4A 4ES1A 4OV1A 1IN0A 2DGQA 2P6SA 4U67Q 4DCPB 3OW2R 5EX0A 3HFZB 1IR0A 3K8WA 2MZTA 1HYSA 2ZH6A 3TAMA 2HS4A 4UUXA 3QZ8A 2ILZA 4KHPF 3FEXB 3OR1A 4CI0B 4DV1C 2P6TA 3H5UA 2Z2ZA 2FVSA 5KT5A 3GG0A 5KFOA 2V9WA 1RAFB 1NJZA 4P52A 1IBLF 2YKOA 4K4XA 3D0IE 1OQ3A 3CJEA 1WF0A 3DM2B 5BUSA 5GMEA 1M5OC 4LIRA 1RLDA 5HBMB 2MLXA 4DV0C 4X4PA 3D7SB 4NLYA 3QWPA 2VG5A 1NBEB 4B3SF 1LQ9A 4M95A 1SKWA 4J91A 2RUSA 4UZCA 3IPLA 2R7UA 4WTOB 1FRLA 1PILA 4MMOA 4JYAF 2DNLA 3DYAA 4FF2A 1LWEB 1FO1A 1V6HA 1S9EB 4IR9A 4Q8FA 2KFZA 1DFDA 2ROGA 2EG1A 4G36A 4FYWB 2NREA 1WCJA 3MR7A 4CH0S 4DG8A 2OEMA 3AF6A 3QLHB 4KGMA 5F9NA 4IG0A 3AOCA 1ZOTA 4LFAJ 3UI3A 3DI6A 3BREA 1S1XA 1P7LA 2DHSA 4B9UA 5HJYA 1UW4A 1WKLA 3CD0A 3MAQA 3IMLA 3SQOP 2IM2A 1XMOC 3M6XA 1H2UX 3VALA 2FLLA 4IO9Q 3R8YA 2RRAA 5F3ZA 5A6WA 3OLBA 3KJVA 2EBEA 4GKKJ 1JLCB 3DNCA 1NRKA 3AB4B 1FFSB 2J0XA 4FDFA
chains in the Genus database with same CATH topology
2R7QA 3HT3A 5IS2A 2QE5A 2FJVA 5BSVA 3EZUA 2LU2A 3GG1A 4PCQA 1NK6A 2UVRA 1HFEL 2V5HG 5A2QY 1FRXA 1C1CA 4YHHF 2L08A 4DSKA 1V3SA 1GPMA 4N77A 2JDJA 2AJ4A 3FNNA 2R2TA 3LF0A 5I3UA 1Q86T 3N2QA 3LGXA 1N34C 1TVRA 1XNRC 4ALZA 1Q16B 2QW0X 1O8BA 2B6AA 2W4DA 1NB7A 2HHSA 3FEZA 5EWFA 4O3OA 1RT2B 2VBWA 3EERA 1DLOB 3DLJA 3QGGA 3V81A 2ZJPQ 3V6KA 1U7LA 3NG8A 2E5IA 1S48A 4I6YA 2MXYA 5DETA 4YY3F 4ELUA 7FDRA 1UVLA 3BGRA 1VQOS 3MECB 3M32A 4C0OC 4TY8A 1U4BA 3LAMA 3N5BA 4J9PA 2HLTA 3H4BA 2E7GA 3QYYA 4F26A 3Q22A 4KAIA 4ATNA 2EGTA 4I2PA 2KDOA 4URSA 1DJ0A 2Q3PA 1HBUB 1N4LA 1HARA 3H2VE 5CQGA 3Q8SB 5FLXD 2KXNB 3IAM9 5SZTA 2VBZA 1MXBA 3I31A 1XRAA 1NU4A 2VZEA 1Q4RA 4WV3A 1ZZNA 2DIUA 4IFYA 1FEHA 1WD6A 4JI3C 4G6VB 5FDLA 3PFEA 4CO0A 3K57A 3UCZP 1FJGF 3BZQA 4ZOSA 3N01A 5BR8C 3G4SS 1EETA 1ZM9A 5I3PA 4LUBA 1XNQC 1GQEA 4O3QA 3KMSA 2UUCC 1W25A 3SDEB 3CCVS 4Y65A 1DRZA 1YJUA 4H4KC 4ZVGA 3U1LA 3SFGA 1ZTWA 2F3JA 1JNRB 5T14A 5K8PA 5BSTA 3HXMA 1HWJA 3MDFA 4C8MA 1VRUB 2DD8S 2KHCA 4MFBA 2DR8A 2N7CA 3IRXB 1KD1T 3ISZA 4I7FA 4C0HA 1R43A 2IRXA 5K14A 2BACA 3C2PA 3Q2TC 2DJWA 3M30A 1NJWA 4ECVA 1IKVA 3AAWB 3TRGA 3M9NB 4N76A 4A8KA 3MM5A 4C3LA 3LAXA 4DUYC 3D1OA 2UZAA 4LVOP 2Q1LA 2CPJA 1T95A 4BS2A 1LW0A 2PN6A 2DO4A 2R7XA 2XEXA 3TX8A 3SSSA 3PO5A 3RRGA 1BQNA 3MM6B 2IYIA 5IT0A 2XSFA 4CT8A 1DQ8A 1NJXA 2A1BA 2JEJA 4B3TF 3KK1B 2Y0SD 2MKHA 4CTAB 1HWKA 1Y3JA 2FDNA 4CO4A 4DEZA 3EGWB 3OTBA 4BCAA 1SH0A 3MF5A 2JLGA 2OTJS 2M3DA 4A8FA 1B64A 3L09A 3A1YG 5JUMA 2KB2A 1TK8A 1C0TB 1R8BA 3VAMA 1N0UA 1V25A 4QWAA 4DCVA 3HVTA 4KV8A 5DDRC 4KR0B 3G6VA 3CVKA 5AXKA 1I94C 2RQKA 3FCCA 4MAKA 2P2QA 1UFLA 2QVXX 4D4GA 2DK2A 3UCUP 4PXDA 5K8OA 3CC7S 1T5DX 3UW1A 2V7BA 5K8FA 3C6TA 1T8EA 3NS5A 4JI7F 1VLYA 1JLQA 3MPVA 3GILA 1ELOA 5DDPC 2AYAA 3PR4A 3G9CA 2CJBA 3F73A 3EQ6A 2UUWA 2YWKA 2RQ4A 2PD1A 1HBOB 3D2WA 1PO6A 2KYZA 2OTLS 2CXCA 3IEUA 2CJQA 2CFXA 2KZFA 4BSZA 1U25A 2CQ3A 2M52A 3KHHA 4DV1F 2MB0B 2VOPA 2MKKA 4WIIA 1LFPA 2PFFB 2D1QA 3UQSA 3R5CA 1HBMB 1L2FA 4KPYA 5A8KB 2IBKA 2HS0A 3PXGa 2QO3A 2DR5A 2ZITA 1XEZA 3WBZA 1VK3A 1LWCB 3TA2A 5A8WA 3FSYA 4Y00A 3Q0AA 1SJFA 2F8MA 2V4JB 2AYBA 3DRSB 1HH2P 1OPIA 2ALZA 2WSFC 1UKKA 1MWZA 3DHVA 4GXQA 1KQFB 2VPYB 1FVQA 2CG4A 1DZ5A 1ULTA 2HIQA 3JYTB 2HHTA 2DH8A 2RE1A 4N41A 1GX5A 1O92A 1EGAA 4ECQA 3KHRA 1UVIA 1FKPA 2KZMA 4V19J 1Y5LB 4NLDA 3OFHA 2MJNA 3CJ0A 5MAOA 1YHQS 2Y1JA 4X84A 3UDLA 2EFQA 2C42A 5HQ8A 3RTVA 1QM9A 3CUNA 3IWXA 3VNSA 1WACA 4IYQA 3ZC4A 3AJ2A 5HI7A 5K8MA 1ZTTA 4HT5A 1QJHA 2E1MC 1YJWS 5G0RA 1VQ7S 3QIPB 3CSKA 4E98A 1XC9A 1UJ6A 2OBVA 4DR7C 4I2QA 2FC9A 2ZM6F 2NSCA 3G6ES 2AYEA 2YNIA 4DV0F 2DO0A 1RKIA 4PR6A 4OQJA 2XSJB 2Q66A 4FF1A 5L1JA 2LQBA 1Y5NB 4Y2MA 3W2WB 3LUSA 1MMLA 3VZHA 2R7SA 4JI1C 4DLGA 4LFCF 4A8XA 1IKWB 3H4DA 4H4KA 1R0AB 1VIXA 1FA0A 2VB6A 5KT6A 2B56A 4DR1F 1LXJA 3SCKE 2RQMA 4F4ZA 1IBMF 3TUJC 1S1WA 1BC6A 3OUYB 2VV5A 4G1QA 4CQ1A 3KLFA 4I4BA 2D41A 3E2EA 1LKZA 1O90A 3NPDA 3MM7B 2A3JA 3IR5B 5DG7A 5KG1A 4V19X 2R7OA 2DGOA 2BE2A 2JEGA 4K50A 1NNDA 1FRJA 5KTQA 2XY6A 4I67A 5CYJA 3MR3A 2HQ3A 4YB1P 1T3OA 5C25B 4LF9C 5E0OA 4LJMA 1WELA 3GIJA 2R7RA 2KXFA 1Y3KA 1BD6A 3KOAA 1B0PA 1U1QA 1GH8A 3AQOA 3UOWA 1U6ZA 1FK9A 4BC7A 4R5PA 2DPLA 3OXFA 4IH5A 4P2SA 1Z2ZA 3I0RB 4ED7A 1USPA 4RNNA 2F40A 4G1IA 1YTYA 2P02A 2B4UA 4URGA 1KQGB 3DAYA 2L41A 2FVQA 4ECSA 4DCSA 3IS9A 1G1XA 3LANA 2P2JA 1ZBTA 3H25A 2UUAC 3BQ2A 1VRTB 2POKA 3LW5C 1REVB 4ICLA 1ZM3A 2ZH3A 4YP3A 3G6XA 4ELVA 3OR2B 4YMEA 3OTOF 3DCAA 2ZJRQ 1VQMS 1JOSA 3I6PA 3CJKB 1NHVA 3BO2A 3G8QA 2J0WA 2W7AA 2LA6A 3J7Z5 3CC4S 3LP2A 1AMUA 3HDSA 1SH2A 1WI8A 2DNZA 3KHGA 2RH3A 3OL6A 1T05B 4QYZJ 3THVA 3M9OB 4CIOA 2C3MA 4DV7C 1JLGB 1WG5A 5EDWA 4WXOA 1BQMA 3M2VB 2DPJA 4X64C 1R8PA 2DNOA 3D0GE 2W9BA 1N36F 4BBYA 2VFVA 1VC0A 5D3GB 2F9JA 2GIRA 4DV4F 4DCUA 4FUQA 4OHWA 4J9KA 1WTBA 4K4VA 2VL1A 2FHJD 1XMOF 4OLOA 4QPTA 1WG1A 5C42A 1P1TA 4DR4C 4Q44A 1AW0A 2HHUA 1KNZA 1NZAA 3LGMA 2A10A 2CQGA 1ULRA 2MZJA 4W90B 2JVOA 4EBDA 2O01C 3JSRA 2RS8A 2DB1A 3IEVA 3NGKA 2VFUA 2W9CB 2V2KA 2P9GA 1U1KA 1PC4A 3CT9A 1IKXB 3PW2A 2ZDOA 4PROC 2V94A 3VZIA 3SSQA 1J5OB 4B3OA 4C3MA 4ECUA 1N6QB 4OXIA 1X5PA 2EK6A 3OTEA 1XN9A 5L9NA 2RDJA 4MYTA 3KNAA 2HVZA 5KG5A 2M9KA 4E8UA 1F5AA 3MEEB 4ITSA 2LECA 2QLWA 2YKAA 4QR2A 2VG6B 2OPLA 1SJ1A 1L5UA 5IFIA 2XO7A 4XPEA 4PZPA 5FIIA 1AXQA 3IG1A 1WHYA 3FFIB 1UEVA 2AGOA 5F8MA 2IJFA 4ZJZA 2E1AA 3MD3A 4TYBA 1K0VA 3HHDA 5AE3A 1S10A 3IAS9 4O0IA 4MIAA 1N34F 4MFBB 2MZSA 3KYLA 1XNRF 3PJXA 1VQSA 2AJFE 3G86A 1KQSR 2ZNYA 2EI5A 4DL4A 4NCBA 1GXUA 2C3PA 4Y2IA 3PESA 1P1LA 1OSDA 2V8GA 2EFOA 2YNFA 5J1PA 5F0WA 5C24A 4JV1A 2HHPA 2R8HA 4LF5C 4ED8A 1RJJA 4OMFG 1DQ9A 1Q8IA 2KG0A 3R9XA 1JLBB 3MOZA 1ZAVA 1VQ4S 3QPIA 4G3IA 5F8IA 2PO4A 1N88A 4DL2A 3T5HA 1R6YA 2MQNA 3KKFA 5KFEA 4C3KA 2ZH5A 1MROB 4R0EA 1AROP 3OVSA 4UY85 1TL1B 2QA1A 2VFRA 3QO9A 5DQHA 1GT8A 2WCXA 3MMAB 2KN4A 3LOUA 3THTA 3BR8A 3DN9A 3AH6A 4ZPDA 4ZLPA 6FDRA 1CVJA 3EPIA 2YCBA 4LSNB 2FHKA 4JI3F 5B0BA 5L1IA 5THWA 4P7TA 2B43A 1VS3A 4RU2A 3MTJA 3D0HE 2AJ1A 3IA0A 5BR8F 3PZPA 2R8KA 1QE1A 3CCSS 2XNQA 3Q2SC 1HHTP 3GSDA 1XNQF 2B5JA 4C8LA 1TKDA 3SMZA 2MPUA 4KKOA 2DGUA 3RRKA 4I6AA 2UUCF 4MKYA 1SIWB 4BWMA 3HVAA 4GKKC 2AYMA 3P6YC 1OPZA 2J9EA 4OJ1A 4Y34A 1RT4A 2OFGX 4QIEA 4NOZA 2M0GB 3IGNA 2RJZA 3H59A 4Q7AA 3GIIA 5IM0A 3CO9A 2XMKA 1JNZB 1D9DA 1UFWA 3VTIA 3M2RB 5BJRA 3FQKA 2OO4A 4NLXA 7FD1A 4EBEA 1MDBA 2W25A 1O0PA 1FTCA 3CIZA 3SV4A 4DL3A 4DUYF 2AGPA 3T5LA 2D1RA 4RLFA 1S99A 2OMLA 5JJBA 4RMNA 3CMES 2K2PA 5KFRA 1H7WA 3PFOA 4EEYA 1I1GA 4QU6A 3M8PA 1T94A 4G1PA 4FTFA 4MIWA 3UZ0A 2RNEA 4ECTA 1OWXA 4KO0A 5L8RC 5LJ3Y 4JV2A 2VD3A 1YJTA 4ID5A 3UPFA 2OPRB 1VQLS 2OIHA 3IR6B 3MI7X 4Q43A 1RGVA 2OD4A 2KM8B 2W8KA 4J9LA 4OHYA 3D1QA 4I6WA 3V6DB 2ADCA 5SUHA 2DHGA 2XI2A 3P3DA 5A1GA 3E7XA 5C5JA 1PG3A 2HNDA 3CDBA 3RAMA 4Y2KA 4XO0A 4OI1A 3H5YA 3BSOA 1Q8LA 2PGCA 3NP5A 4FS1A 1TKZA 4DSIA 1SH3A 4DUZC 3HKZD 2GJIA 1U2RA 3MM9B 1PGZA 1I94F 4NCGB 2KVIA 3I55S 4YR3A 4UQGA 4Y28C 4JI2C 1QY7A 1E6YB 1RTHA 2UVUA 3KLEA 2JFKA 3H5SA 3TUIC 3BGLA 3K59A 3MEKA 2D3ZA 1O93A 2WONA 3ETCA 2MGZB 2DVIA 2RQCA 2VKRA 3FVYA 3ISND 5E7OB 2GHPA 4J9SA 4H4MA 4HEA9 3GIMA 4MK8A 4PQUB 3DLBA 5KYVA 1KTQA 2FHJA 3TO8A 2BQRA 3IXQA 1DBDA