4G1IA

Structure of the prgh periplasmic domain
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
189
Chain Sequence
ELDSLLGQRFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein prgH
publication title A Refined Model of the Prototypical Salmonella SPI-1 T3SS Basal Body Reveals the Molecular Basis for Its Assembly.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Cell invasion
total genus 70
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA03
3.30.70.1780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1iA01
3.30.300.170 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4g1iA02
3GR0A 4ALZA 4G1IA 3GR1A
chains in the Genus database with same CATH superfamily
4H4KA 3SYZA 2F1FA 3EE3A 5EWFA 1A7GE 3TDEA 4I2PB 1XMOC 2DGTA 4IR9A 2JC0A 3ZZTA 3IFEA 3ISNC 2NQPA 2CU6A 1YG0A 2P5VA 2HPUA 3L3CA 1NY8A 2K1RB 2LEAA 5FDLB 2IPOB 1F9FA 4NA2A 4RLFA 2M4MA 2VDIA 3B8HA 3KHHA 5B0AA 4ZJOA 4MTPA 1NJZA 4C3LA 2F7VA 4RNOA 2NXUA 4GO7X 1UEVA 3W9HA 1YBAA 2PMWA 3VHQA 4LVOP 2CVEA 4JI4C 2I5JA 3DFEA 2CJBA 4DPWA 5IZHA 5THWA 2AJ0A 3RTVA 2V2KA 3SSQA 1VQPS 3OL8A 1FDBA 1CJVB 4KPYA 1HNZF 3R9XA 2CQIA 4DV1F 2UUCF 1P6TA 3N2QA 1SL2A 3HLUA 1VS3A 1FVSA 1ZM9A 2EKNA 3JQJA 4DV2C 2MMAB 5CYJA 4FPIA 1VOMA 2AJ2A 5HVGA 1X9MA 1M0SA 5L1IA 2ZOMA 4X65J 4QU6A 1S5ZA 2CQHA 1WHVA 2YKQA 4IFVA 2Z8QA 1NDKA 1S1TA 4DSKA 5KAKA 3F0NA 5D4LA 3MXHP 1ICEB 2UXCJ 5C42A 2HAFA 1U1NA 3SV4A 4OYPA 4LR9A 1B0PA 4W4MA 4U8VA 1VQSA 5HQLA 3LP2B 4M5LA 3T5KA 2HRYA 4JI6C 1HNWC 3D68A 5LCIA 4MH4A 2HBQB 2L9WA 2XCAA 4FYXB 1WUUA 1XRAA 4NRUA 5ETQA 1PU1A 3IR7B 2ACMA 1RTDA 4B9UA 2OAUA 1RT7A 3T1YJ 4RUHA 1X5PA 3MOZA 2XB2D 2P9CA 4ZJQA 2V94A 2VBXA 3QZ8A 3EERA 4DR1J 2X3GA 3OTOF 4O0NA 1LW2A 1B3TA 4C8YA 4I7FA 3HHKA 3HVTA 4CO1A 2LP4A 4RBUA 2KT5A 3ZTQA 1KHVA 5KG4A 2CPJA 2VG6B 3IXQA 2Z2MA 4NLVA 5DDOC 3OXFA 1YJVA 4WFNQ 2HHHJ 4DG1A 2DB1A 2DGVA 4ERDA 3M32B 3TAMA 4BC7A 1CJKA 1JLEB 2WW8A 3NY0A 2CQGA 4B08A 3X3UA 3JAMY 2AT1B 2BABA 2FHJA 2ZHBA 4B3SC 4Q2LA 1T95A 1TELA 4Q0BB 1KOHA 4OLPA 5D4PA 4FF3A 1GEHA 2ZH8A 4IYQA 3OV7A 4L72B 1GQEA 5D6GA 3VQTA 1RHJB 1WHYA 2V8HA 2XQCA 4F4YA 1NK5A 4OL8A 4JV1A 1T7PA 3Q86A 4X84A 1U0SA 2I8EA 2YPYA 4LFCJ 1KNZA 4NXMF 3QT7A 1FXLA 1HARA 1S7HA 1SCJB 3BSOA 2GX8A 1USPB 2MCQA 5AJ3F 4H4OA 2ILYA 4HH1A 4ZVSB 4HHUA 4Q8EA 3FGVA 1O92A 1GX5A 4NPOA 2Q3PA 5BSTA 4L7IA 1WEYA 4OI1A 4F4ZA 3M6XA 3BS9A 4UY85 3IS9B 1RLDA 3L7UA 2UUCC 1ZPWX 4B3MF 5DLFA 1FEHA 4HR2A 1VQ5S 1NH7A 4PEOA 4DJBA 2RB7A 2YWWA 2F3JA 2L9NA 3OR1A 4I6AA 3UO0A 1P4EC 3W62A 2XNRA 2XCPA 1RABB 3HHLA 3A4IA 3CCVS 1OMSA 1C2PA 4CLUA 4WS9A 4M5DA 1YJTA 4WZQA 2G0CA 2CJQA 3FEZA 2MLZA 2GIFA 2XSFA 4DFMA 1U8WA 2I2YA 1P1TA 1U26A 1YX2A 1S6PA 1VRQC 4IG0A 1AFJA 1TP7A 2ZBRA 1RHKB 4IFYA 3FQLA 3VWSA 1FXRA 2DEJA 1XMOJ 3KG0A 2VODA 3K2YA 5C5JA 2EK1A 3WC2A 4DPUA 1J5OA 5HVFA 3NNHA 3QO9A 2NS1B 5CYQA 3OTOC 2B4VA 1PC5A 2KFNA 1WD6A 1I51B 2XMVA 1EETA 3TUIC 3OUYB 2GAHC 1B70B 3P3DA 1NUEA 2N7YA 3C6TB 1KTQA 2IAJA 2JWNA 1Q7YT 4PG8A 4ELVA 1S1WA 1YI2S 3GWCA 1RWVB 2YWHA 1M5HA 4IR7A 2X51A 4KGKA 4JI4J 1KLMB 1TK8A 5LXYA 4DL6A 1DFDA 4URGA 2GGPB 3ETMA 1X4CA 2KH9A 4B9MA 2CJAA 3LUYA 1R0CB 2G9OA 1RWWB 1B0VA 4PPDA 4DV2J 5KG3A 2Z58B 3DLEB 4JI3F 4WTOB 2RQ4A 1S1VA 4NXMC 5A6WA 3HT3A 3MM8A 5CD4A 4H4MB 2WOMA 2AIRB 4R8UB 3TOQA 2B9EA 2FJXA 4K4WA 3EXYA 3NYQA 1F0XA 2YKAA 4DCPB 4O44A 1SC1B 1EQMA 2QA2A 1HNWJ 4JI6J 5ITHA 4P6QA 4KB7A 2HFZA 2IDLA 5LSLA 2OSRA 2BQRA 2P8IA 3H42A 1NK7A 4B3MC 3RBZA 1VQMS 1HW8A 5BXIA 1S79A 2ZEJA 3DRSB 3QIPA 1Q78A 4QPTA 3T1AA 4A8QA 3MEKA 1M5SA 4TU8A 2VG5B 2RS2A 2DGUA 1UVJA 2ZC3A 1N5QA 1HWLA 1BWVA 1WC3A 3MM5A 5IFIA 2DRDA 2R7RA 3D6MB 5J2MB 3O8WA 2QW0X 4HH0A 3A3NB 4KTVA 4Y0FA 3EQ6A 1UVLA 1MMNA 3FBFA 3AAWB 4PG4A 4DV5F 3GPCA 3J7A1 2KVIA 2HJGA 4MH8A 2YNIB 4B3SJ 2R8KA 3ETCA 1TTHB 3A8IA 2E1AA 1S0MA 3EGVA 1VIXA 2E7WA 2ZKTA 3KJVB 2A18A 3M05A 5IQQA 2Z57B 4YB1P 2B6AA 5A1GA 5F8NA 1ITPA 2CFXA 1FKOB 1TKZB 3MMBA 3FCVA 3FMWA 2ZH5A 1HQUA 5CQGA 1VR6A 2VJUA 4LF8C 3MCOA 2H5JB 4IH6A 2RAQA 2QLFB 3MR5A 4N56A 5IC6B 4F67A 1K9MT 3R3TA 2YBVA 2KT2A 1PAEX 2RU3A 2F40A 1X5OA 1G1XA 2W8LA 3G8SA 1LWCA 1BQNA 2V4JA 2PI5A 2FJBB 5DDQC 4J9VA 3C15A 2FQQB 5A6PA 2UUWA 1FWKA 2UUCJ 2CNKB 2CPYA 5KFQA 5J2PA 1R0AB 2NXEA 2K7JA 2ZJRQ 1UCNA 2PFDA 2JX2A 2M9KA 4ED4A 1EQ0A 1D1UA 3NGRA 1RSCA 2DNLA 2ZVSA 4M5NA 1MROA 3QYYA 2YY3A 4DV6J 1M1GA 2W2MP 2POKA 4LBHA 1NLKL 1T11A 4HVZA 3DOMA 1C0UB 3MR6A 4N8NA 3P96A 4KHRA 1LNQA 2DXDA 3H25A 2G0JA 2ZH2A 2DGSA 2OPSA 4TY8A 4WTYA 1LEOA 3B7WA 4OZ5A 4CDIA 4KBIA 2FVPA 1ULRA 3MM7B 1JLQA 2NYHA 4FPRA 1LQ9A 3LP1A 1SPBP 5H9FJ 2AYEA 1WHXA 3H7HB 1HBUA 2A2DA 2LDIA 4CYUB 4FNHA 3VQSA 2GQQA 4JI7F 4BCAA 2DR5A 2B9XA 1FKPB 2XHWA 3U7JA 1C1BA 4BBYA 4D4GA 1U7LA 3PW7A 2VOPA 3PG9A 3DRYA 2BZ2A 4DZDA 1VLAA 1TL3B 3DGPA 5BSRA 3SO4A 2RE1A 1NAQA 3S1TA 3PXGa 1RT1A 2YWFA 4HT7A 3KXDA 1HNVB 2DCUB 4O3QA 3OFGA 1G6BA 4P72A 4D4IA 1VBXA 2ZH9A 2HHTA 5D0RA 1RCOB 1S4FA 1P9YA 1IBCB 2H65B 3PDNA 4HTJA 4DQQA 3FCHA 1DY3A 3UDCA 2DRBA 1W25A 2HVDA 2SXLA 3P5BP 2AWZA 2DYJA 1LFPA 1UFLA 4RKUC 4FF2A 1EKRA 4J5OA 3THTA 1RP5A 2A6OA 3MCMA 4URQU 5T7LA 4G37A 2DHSA 3VGSA 4G3IA 4KH0B 3J81j 4NXMJ 1T9XA 1SJRA 1RY2A 5F8JA 1U02A 3SXLA 4CO5A 2IM3A 1KS2A 4CQ1A 4Z2XA 2E1MC 4Y3CA 2BOAA 3NS7B 3LUSA 4HKQA 2Z30B 3AD7C 1PC4A 5C24B 3BO2A 5K8FA 4NI2B 3CIMA 2KZZA 1UVIA 3M2UA 1TAQA 1RDRA 4RW6B 1Z1ZA 4B3MJ 4JI5F 3O2IA 2K3IA 3LNVA 2D3UA 2H4WB 5A8RA 4M94A 2V9WA 4ID5A 1IB8A 2ROPA 3LP0B 2H5EA 1HR0C 5HI7A 2ASDA 1MDFA 2X7IA 2AV5A 3TUJC 2B8PA 2MYFA 5ETKA 3TEGA 3VNQA 3MR2A 3N6NA 5IXUA 2J8SA 3OFEA 5B0FA 3DLKA 3H2LA 3A3OB 5LXRA 4DR4F 1AXQA 3KDOA 4KH1B 1TH5A 3Q8RB 4P10A 2XSJA 1SUQB 1HI8A 1RAOA 1K1SA 4C97A 3R1LA 4DX7A 3J80Y 4QWEA 2DH8A 4QWAA 5A8KB 5KFJA 1C0TB 4Y2IA 1AA1B 3MPYA 1P1LA 1FTRA 4WFAQ 4JI7C 4PRFA 3PZPA 1DQ8A 4DV7F 3DM2A 2R2RA 4QYZK 3ISZA 3IM9A 1Q8IA 4HI2A 3MAAA 2EFQA 2NCLA 2E7XA 2IFXA 3TEHB 3KNGA 3IGNA 4C0BA 2UVUA 2R2TA 4LF8J 3D1HA 4ZCLA 3DDKA 4M5MA 2E29A 4KGZB 5GAEI 3HI9A 2WK4A 4RLQA 4ZOSA 4AYBD 2IJNA 2UVRA 4ELUA 1JJHA 1QE1B 4C0OC 1O8BA 5KG2A 1I94F 4KSEB 2Q66A 3JAMU 2AJ4A 1TKTA 2RSQA 4DX8H 3C19A 4KHPF 1S57A 3GSIA 8AT1B 2HQDA 3T6BA 2KXFA 5DGBA 3RB4A 3QWUA 3PNIA 2IVFB 3G6YA 2GO9A 2NPFA 2WZ1A 3M30B 2GCFA 2W4PA 4ILLA 1LXJA 4DU7A 3NGUA 3BR9A 2BJ3A 4ZA1A 3FKBA 2D1CA 1FE0A 5JXSA 5T14A 1OJ4A 3GG0A 2P2JA 4LF6C 2CVIA 2D27A 4DCTA 1CBKA 2FZCB 1BY9A 3I9V9 7FD1A 4JI8C 3W63A 1PGZA 3CC7S 1BQXA 5I3UB 3AJ2A 2JJ4D 3RV2A 4CH7A 3QT5A 2R2UA 3GTYX 2WTFA 1VK3A 2F9DA 3UCGA 4DDFA 4L73A 4DV0F 3ICLA 1MKYA 1F3VA 1EIYB 1AB8A 3CW8X 1RWPB 3CW2C 4P7TA 2ZD1A 3KLVA 2JEGA 1M5OC 4CLFA 3UVJA 1S0VA 3FCEA 1HI1A 5CCLA 1M5VC 2DIUA 4DUZF 3V6HA 2UXBF 1DTTB 2ILZA 1BLUA 4RPFA 5HQMA 1YZ7A 3UN3A 2Y27A 2C3OA 2GAGC 3OPKA 3KK3A 3KHRA 4HDGA 1UFWA 2XI3A 1WKJA 3RB6A 5BJRA 1ZA1B 2D1QA 1RE1B 4GKJC 5ETOA 2BM1A 5L39A 4RU9A 4YY3F 1KRPA 4DR2C 4RW7B 3QJJA 2DY9A 5LT5A 3E01B 4I69A 2MHEA 4ECVA 2GO8A 3EUNA 3PRBA 2CXCA 1VHFA 4OI6A 4WBFA 2AMCB 4IH7A 5KFSA 2PA3A 3TX8A 2HAIA 4ZP8A 1Y3KA 4FBTA 2OPLB 3G6XA 2W25A 4WFZA 4DCVA 3Q83A 4MYTA 5HO4A 3DRRB 1Y7PA 4OMFG 5J2NB 3PR4A 2W9AA 3DLGB 5G4DA 2GHPA 4ZVRB 3W1YC 4ED6A 1N4LA 1RAEB 1U25A 3OTEA 1HMVB 4KV8B 4NASA 1E6VB 1WKLA 2O01C 1TV6B 2DITA 1NSQA 5HROB 1HR0J 3CT9A 4OYCA 2PEBA 4MMOA 2ZE2A 3KUGA 4ID8A 4XX2A 4RVNA 1PBUA 3DKDA 1Y4ZB 4OZ2A 2QG9B 4DOZA 3BQ1A 2HS3A 4DCSA 2VJVA 4NE9C 4KTQA 2KL8A 3JXOA 4K2XA 1RHRB 2XC9A 2VPZB 3HM9A 3GIKA 3KK1B 3IEUA 2QMUB 5D8HB 3FDSA 4IG3B 1RU2A 1PYSB 2HNDA 3MM9A 3CDBA 4I56A 1B7FA 3GLJA 2GMJA 1GT8A 1XN9A 2OLWA 4K8RA 1X7VA 3ENVA 4WK1A 1WNEA 7AT1B 2MZJA 3R5CA 4GVBB 4DV0C 3W64A 4JI7J 1RZMA 5LMNC 2AZ1A 2B51A 3H20A 2HFOA 2HKEA 1R8HA 5HMWA 3KLEA 1HQEB 5DV9A 1TZ0A 3GP9A 1RT5B 4LMZA 4ZVOB 1X31C 5KT6A 1GTHA 3PIOQ 1J5EF 1MN7A 2UXBC 3K0JA 3QRRA 4QIVA 4R5PA 5F41A 4JV2A 5KFNA 1W7WA 8RUCA 2GHVC 4ED7A 1CJUA 1DZ5A 3UCZP 3H4BA 1O6XA 2CPDA 2J0QD 3WHIA 1SV5A 3UD3P 1RWXB 2PGCA 2G4BA 3MEDB 1GFWB 4B9NA 2J8AA 4DFPA 5CHCB 4P52A 3VAIA 2V7BA 3F44A 2R7OA 3IWNC 1NKBA 2MQ8A 1UA0A 4N7TA 2CAJA 1S0NA 1PG5B 3T5JA 3K17A 4DR3F 2RUSA 2V8PA 3HHNB 1F5BA 1WEZA 2E66A 3CD5A 3CVKA 1E6YB 4JI1F 4M1KA 2J0WA 2EFOA 2QT7A 3CCJS 4LF6J 3GFZA 5ADZA 4OHYA 4A8OA 2F5GA 2MZQA 3MAQA 5IM0B 5EN1A 2WCXA 4LSZB 4JI8J 3U1NA 3JTPA 4C4WA 3TZZA 2F8MA 4F36A 4X64F 1WTBA 3UOWA 5DDPC 4RU2A 5B7WA 2BKPA 4OYMA 3HD1A 2IYGA 4HHJA 3CJRA 1FDNA 4HPVA 4YUDA 1LXNA 3C3LA 5AXKA 2GJFA 5JUMA 2CZVC 4LF4F 3O3LA 3NGTA 5JVGQ 4OI4A 2ABYA 2LMIA 1XC9A 1T05A 1U0HA 4LRCA 5AXLA 5C7PA 1U09A 1BWEA 2Y0SD 4UZBA 4KC5A 3RAXA 2ZH6A 1WORA 3HSJA 1IBMF 2CQ0A 2H48B 3A12A 4O3OA 3GJTB 3PACA 4QIFA 4EUVA 2FLOA 4OX9C 3TARA 3SQGA 2QSFA 1NDCA 2OFHX 3PRVA 3U02A 4GKJJ 3EYZA 2BMBA 4H4KC 4ZPAA 1UKKA 2O66A 4LIWA 4ECUA 1VBZA 5E3QA 4QR2A 4DR2J 4OHXA 2HQFA 2MQPA 3PX4A 2PO4A 4S0MA 3RUBL 3POTB 3RRHA 2H51B 3KJFB 2YKMB 1J5EC 3C14A 1HYSA 3DN9A 2GFFA 5D4OA 4CLWA 4R1LA 1Q8BA 5HBMB 3F56A 3ZC4A 4DLGA 1NSPA 2IC3A 1U1QA 1NCLA 2Y8WA 4C6AA 1VMBA 1HBNA 2DR9A 3TJ9A 5KFLA 2BJ1A 4I6WA 5JMNA 4OYOA 2AYGA 5IWAF 4MK7A 3LAKA 1OYDA 4PWDB 4ANCA 2GMHA 3EGNA 2F4FA 1AMUA 1S6QA 2YKOA 2OD6A 2BANB 4PG5A 3MUVP 2VQFF 2CNNB 1NK9A 4HYKA 3PFOA 1T3NA 3M2RB 3I4PA 2HGMA 3WX4A 1WDTA 1QVFR 1C1CB 2VSQA 2YNGA 3UX3A 2M8DB 3NNCA 1QM9A 5K9FA 4URSA 3VAFA 5I42B 3CCTA 3VZIA 4B3TF 3SCIE 4O3RA 4JI1C 3TQEA 2MJNA 2KJVA 2H4YB 1RT4A 2GQ2A 2XYPB 4CP5A 2IJFA 3AHPA 4F0HA 2XYHB 1AFIA 2DHMA 4M5JA 3C5EA 4DL7A 1JLCB 1VBYA 2CZ4A 2KHCA 3NGKA 3I0SB 4IOAQ 2DNQA 4NYZA 3MEGB 1HI0P 3DYAB 1UTAA 3UWTA 4RWWA 4DV0J 4LF2A 3W60A 4LF7F 4C8KA 2QA1A 5F8HA 5LMNJ 3Q8PB 2W9BA 2C1EB 1PBAA 3WC0A 4MT1A 1LWEA 2EBEA 2VQEC 3UCUP 4WF9Q 3EZUA 1RT2A 4Q7AA 5F8IA 3FVYA 1IVZA 3G2XA 4RM2A 4I9GA 4OFZA 2OP5A 2CXEA 2HSEB 1CEZA 3PJXA 2UXBJ 4CO0A 1NK6A 3CMES 1CULB 4OX7A 3NEKA 5GMEA 1MU2A 3BKUA 1FNMA 1WHWA 2ZUAA 2V67A 3QAUA 2DH7A 3BR8A 4NLUA 3V6DA 3NGDA 3HK2A 4F8RA 2EW9A 4IKAA 2QL9B 3OXGA 1PO6A 3J80U 4ZP7A 4NXNC 4CI0B 2IM1A 4OYXA 2C2NA 2RS8A 1B64A 3Q0AA 1S9GA 4USVA 1Q81T 2KG1A 3N9UC 3HSZA 1JQGA 4MKVA 3ILIA 3FBBA 3OTDA 1KBRA 2APOA 4LF5F 2M8HA 3RG2A 4G1IA 3JB9k 1ZTTA 2NUHA 5IT9D 1FRIA 2XGQA 1EX8A 1FA0A 2VFRA 1N5YB 4KY3A 3HFZB 4PZPA 4AXIA 4KFBA 1UEUA 5DDRC 3W7BA 3C6UB 4LE5A 2DHGA 5HANA 1WEXA 3VGUA 1XMBA 4CLZA 1MD9A 3ET6A 2VQFC 4F2SA 3QT8A 4YN3B 1N34C 4RW9A 1NHKL 1FWLA 3PV8A 4FUQA 4L2ZA 4RR5A 4O4GB 3MAHA 2EC0A 3EXCX 3QAEA 3DMJA 1RISA 3O2EA 3OFHA 1R6VA 1X8DA 2HLTA 4UOHA 4M5GA 3HHLC 4EZ9A 4JM1A 1ZOTA 3BGFA 1FDAA 3V5RA 1FKAF 2UU9C 2HZVA 3M8PA 2V2VA 2QE5A 4EWTA 1WH9A 2D1TA 4DSEA 2R8HA 3HVAA 2YNFA 4W90B 3ZTSA 4CRJA 3DAYA 1F2HA 4OX9J 3GV7B 4EO6A 3KXWA 4GKKJ 2YKPA 7FDRA 4LF7C 1A6LA 2ZDPA 4J9RA 1H6KX 5FLXD 1BA3A 4ICLA 3DRPB 2B7BB 3BKTA 1WF3A 4R25A 2DGXA 4CTAB 3CDUA 5I4MA 1VLOA 2FVSA 1M6XA 4PXCA 4ATNA 1RTJA 1J5EJ 2Y1RI 3VALA 5KT5A 1F5AA 1H2TZ 3AF5A 1YLXA 1NB2A 1M90T 2UP1A 3PCOB 1U49A 4G1QB 2FGOA 1QSLA 5HAOA 4DXLA 2RQMA 1KC8T 3R5BA 1Q79A 5C2CA 1VEHA 3N5BA 2CNLB 4DCUA 2RF2A 5D0GA 1MNEA 5L46A 3A1YG 4OIXA 5KFUA 2PI4A 1FWPA 2EKYA 5U47A 3MF5A 3QGPA 2FJWA 2W4DA 2RDJA 5HQ8A 5CABA 9RUBA 2ZWOA 4ZHRA 3SI8A 4USKA 1Y3JA 2HZCA 2VZEA 3JTOA 2V50A 3NWGA 3BGUA 3AOCA 3ZZUA 2N7CA 2RNEA 2GC8A 2ZH7A 4K0KF 4ANEA 1OPZA 4CNZA 2RD5C 3M7VA 3DU6A 1N0UA 3H40A 4JI1J 1F6TA 3MM7A 1Y5NB 4F7VA 2HFVA 2HFUA 4C3KA 3BKFA 3G82B 5J1NA 1BD6A 3Q2SC 3CC4S 2KZMA 4J91A 1NJXA 4ZVUB 1JWWA 5KG7A 2J76E 3FK4A 3BDEA 1AUDA 3U1LA 3I56S 3OL7A 2Q43A 4ZPCA 4FUTA 3LWLA 2P02A 3HF5A 2JH3A 2OEKA 1WWHA 1REGX 2ZBCA 3MM6A 1KSPA 3BH6B 3VCDA 4ANDA 3RRGA 2XNQA 2CWKA 3H2TA 3A4TA 1U1OA 2R7SA 4LF9F 1S76D 2VQEJ 1U6FA 1JIHA 3ITHB 3CD0A 4ZIWA 1S1UA 3LF0A 5DG7A 3D6FB 1X4BA 3UEBA 1VI7A 2FIUA 3VAGA 1FUGA 3MD1A 1TQLA 3CTRA 2V4QA 1TL1B 1HL6A 1WC1A 5CAAA 5J1EA 2HBYB 3HP6A 2VBZA 3PM9A 3D66A 2ZM6F 1MMLA 5HVHA 4EI2A 1GAOA 4NXNJ 1R31A 4MKAA 3CC2S 2L41A 3EGWB 1WF0A 1WOPA 1PYOB 5K8PA 4FYDA 3K5NA 3I0RB 4I4BA 4DPOA 5JRHA 4R0EA 4JI2F 3QNWB 3FRYA 5KT3A 4Z7YA 2JL9A 2FLLA 2DHXA 2Z56B 4N8OA 4NI2A 1DTQA 4OI2A 5A8WA 2XS2A 1RAGB 2Q6BA 3AQOA 5DO2A 1JLBB 4I68A 3TRGA 2BDPA 4JV5C 2DO0A 2J6UA 2ASJA 2P2CB 1HNIB 1IWAA 4LUBA 1Q8LA 2B4OA 4TYAA 1F60B 2DRAA 3UPFA 1KKHA 1O9TA 2E9TA 4QR0A 4DWIA 2GVZB 2BJ7A 4WWSA 4L6V3 4F04B 5KEIA 3DI6B 2ALYB 2WVCA 5BUSA 2V2ZA 2PDAA 5G0RB 3CCLS 4OLOA 3AXMA 2VQFJ 2Z2LA 1X9WA 2DGQA 2H9ZA 4RNHA 1N34J 4XDCA 2BE7D 3THVA 2PMHA 2JLGA 3CE8A 3EPGA 2AHOB 4K0KC 1Y00A 3AOBA 4ZKAA 1LWFA 3OD2A 2RRBA 4WP9A 3R5JB 4L3NA 2RHQB 3KDNA 2WONA 2OPRB 5HL7Q 3QLHB 4IQMA 1TVRB 1C0TA 3T3FA 1IKWA 2UU9J 3J7AN 2EFNA 5CYMB 5KG6A 3V4IB 2QEXS 4USHA 2JC1A 2Z4PA 5CXTA 3D1QA 2FZKB 1N2FA 3LAMA 2MSTA 1FD2A 4OYBA 1NB7A 1HW9A 5LMUF 3DC2A 3ZZ0A 3JTNA 4LF7J 2N3OA 2YX7A 3ZNUA 5D3GB 4LF9C 4LRFA 2DEIA 4HACA 2VKZG 1UKUA 1WCJA 2A10A 4P2SA 2ZFHA 4TKTA 3NYRA 2UXCF 3NMAA 2DPLA 4EZ6A 2QX0A 5M2RA 2IMOA 1FK9B 3EPIA 5HP1B 2R8GA 2E7GA 4EBCA 5KFDA 4ES1A 4C3MA 3FSXA 1VQYA 2IIHA 3J81D 1VIOA 3T5HA 1LW0A 4N47A 3TW0A 1TL7B 3I08A 2MHNA 2HK2A 2KM8C 2OPQB 1IR1A 1IKYB 4GC6A 1HWUA 3SV3A 4K4TA 3DOKB 4JI2C 4DR1F 2NCKL 4AL7A 4IR1A 3B4MA 2J6SA 1R8CA 2ZC4A 3NRBA 4NWBA 1BQMA 4ZVTB 3ZXWA 2HHHF 2QO3A 1S72S 1PSDA 3UNYA 2MZRA 1EKSA 1SJ3P 2B8QA 2OPPA 1HD1A 3UX2A 3BREA 3CJKB 3MMAB 4F4KA 4C48A 3TR3A 2UXDC 3KHLA 1HHSA 1NHVA 4RUCA 4DHVA 2QRRA 5I3PA 4DR7C 2J6TA 1DURA 3ILJA 3KLFA 1DQAA 4F25A 1JLFB 4ZLPA 3PW2A 2UZAA 3JSRA 2IDEA 3KOAA 1D8YA 2AW0A 3MDFA 3D28A 1LKZA 1IBKC 2R7VA 4PUOB 4LBPA 1WDDA 2VC1A 3GJRB 2V34A 4JOUA 4FDFA 3EJMA 4EO8A 3HJFA 3FRZA 4LQ3A 1XMQJ 1CQNA 2U2FA 4LSLB 4IDKA 4TPSB 3RW6A 3DHVA 5B0EA 5LMUC 2DNRA 4L4QA 2P20A 3RBXA 2E5LJ 1P9QC 4M5KA 2JFDA 2IVMA 1WSVA 2RKIA 1WC0A 2E7VA 3IEVA 4QW9A 3CCWA 3LGMA 3FEXB 2ZVIA 2JFKA 5A0YA 4ZMMA 2HNYB 4CZCA 4YOEA 2HGNA 5A2QD 2RH3A 3LGNA 3E7WA 1RHMB 4OJGA 1K8AT 1TKXA 5IV3A 3KMSA 5DG9A 4JV5J 1RA6A 3D6TB 4PQUB 3IPLA 2ZH4A 2BX6A 4O4RA 1N5SA 4I9FA 4XPCA 4DV3F 4Q8FA 3VAHA 1EP4B 3I5AA 2DNHA 2AQ4A 3GZ7A 2FLPA 2YQ0A 3NBPA 1KD1T 1XMOF 2F8EX 1Q82T 4YB7A 1S12A 1YRXA 4E98A 3I87A 3PR5B 2VDHA 1KR4A 2CADA 3OJUA 4YR0A 2OO4A 4GVLA 1C4CA 5K20B 1VRUB 5ETVA 4WP3A 2DR7A 1WC5A 4A8XA 3DOLB 2D41A 2QV6A 1N0VC 2MTLA 2DNOA 3IAM9 1NMEB 2W1BA 1R3NA 4X62J 3AY0A 2Y1IA 3H5XA 1JNRB 1D8ZA 4NLRA 3FZBA 4X4OA 4JI4F 1X5SA 3SSSA 2CPHA 3D5MA 2MMYA 3V81A 3ZZZA 3ZNJ1 2BH1X 1HWJA 3KLIB 1RTZA 3VVTA 2CY1A 5J2QA 4LJMA 1TAUA 5DZ7A 2I5JB 1XRCA 2VPXB 3BGOP 1VDHA 5CH7B 1FT8A 4WE1A 3HVRA 4LF9J 1IQTA 2XBPA 1J2VA 4P73A 4DL2A 4WFXA 5KFEA 3ZZPA 4E2FB 3N28A 1IM6A 1TUWA 1EZZB 1HPZA 4HTIA 1CG2A 3GFXA 2Z51A 4NLYA 5KFVA 1LK7A 2E8EA 4IFVB 2AF6A 1HNWF 4JI6F 2FTRA 3BGRA 4NZ6A 4ILRA 2LXFA 5B0CA 4OJHA 3KTQA 4DCOB 5C42B 3B82A 3ADAC 2BW2A 4NYPA 1HWIA 3K5PA 4KGXB 3PEJA 2CIMA 4IRKA 1HQ2A 4QIEA 2YH0A 4P2XA 2IBKA 1RAAB 4ZPWR 4JI2J 4DI6A 1XIQA 3W66A 2HRUA 4FVCA 2OBVA 1RTDB 4PUGA 1RT7B 2WVBA 3FC9A 2YKNA 4RM3A 3HVWA 2YWKA 2XLIA 3CEDA 4X66F 5GAHU 2BW7A 5H9UA 4I7FB 2V4RA 3K5LA 3PO4A 4DV3C 4Y2AA 1VK8A 3M1VA 4UUWA 1N52B 3PBKA 1SIZA 2UXDJ 3HDSA 4U6PA 1V26A 3FQKA 4DG1B 4B3SF 1U8SA 4PWWA 3NL0A 3BPDA 4NEZA 2Y0BB 3TAMB 3GIMA 3GYNA 4DR7J 4FXDA 1CJKB 4IO1A 3UD5A 3IBFB 3P4UB 2XMMA 3A26A 2DISA 3M6UA 1REVA 1T5HX 4FYVB 4OZ0A 1N32F 3UDEA 4LIRA 1OWXA 3OSPA 2HZAA 4YDDB 4RL1A 2ZKUA 3LTOA 2YQ1A 5T41A 2DBBA 1RKJA 1IBKJ 1UJ6A 2H5IB 4YB6A 4O23A 3H8YA 1XERA 3KK2A 1IBLC 4U96A 4O3PA 2X1AA 4OYAA 3BBCA 4ZN1A 3K8WA 2XWYA 2FJDB 2WVDA 4H4OB 5LMUJ 3KJNB 4QOTA 4DUYF 2RU9A 2NPIA 2AX1A 2NUUG 4G6VB 4DQSA 1NKCA 1FX4A 1WOOA 2BYCA 4NCGA 1JJCB 4BLGA 3N79A 2I0XA 4W98A 2J9EA 2VOOA 4TNOA 2X1GA 2PFFB 5CA5A 1IM4A 4QR1A 3PJWA 4ETZA 3NG8A 3D1OA 3AQPA 1LFWA 3S01A 2R7XA 3TP2A 3A13A 3OR1B 4RVOA 5A19A 3IP0A 2BRLA 5KT2A 4DV6F 2LKZA 3HHLB 2A3JA 2DGOA 1S0OA 4DS4A 3DHWC 2LDYA 2V8GA 3FCCA 4M5DB 3PY8A 3M2RA 2E1CA 1WKKA 2MKHA 3TWZA 2R4FA 3E8OA 1KHWA 3IRXB 2IMWP 1Q95G 5I42A 5L9XA 3MECA 1S6PB 4WXOA 3TUPA 4IG0B 4EBDA 3G4SS 4LFBF 3HKZD 1VQ6S 1PILA 4IFYB 4F3MA 2CUYA 2FPHX 3K59A 4V19X 5JJBA 1D9FA 4ZK7M 1KLNA 3FNNA 1VJWA 1J5OB 1DAXA 4RW8A 1SXLA 4X66C 2FUG9 3QO9B 5CYQB 4Q5VA 2AJQA 1WF1A 1FRXA 5KT7A 1FI4A 3H0PA 2IHR1 3CW9A 2DJWA 4K7QA 5C25A 4EGLA 2HHQA 2BEFA 3EZ5A 4WYLA 2IAJB 4MKYA 1S1WB 2W9CA 1GNKA 2OIHA 5AE1A 5H9EJ 1F1BB 2QLXA 1WG1A 4KKOA 4ECTA 1FEEA 1RWUA 3EDRB 2HLUA 5HSPA 2LLZA 1CULA 2BQ3A 1N32C 1IKVA 1F9EB 4KAIA 1FFWB 3KWMA 5L1JA 5DETA 4WXWA 2QMXA 4UOCA 2PMZD 4XIUA 5LJ3Y 3JSYA 5ETNA 4PAAA 2VONA 2E8FA 4KGVB 2HG4A 2QTWA 5HK4A 4M8LA 1BXNA 1S1VB 4IZ6A 3NS5A 4EU0A 2WOMB 3PTWA 4CH1A 3M8QA 3TYTA 5I3QA 1ZBTA 4DUYC 2ZOFA 3ZZYA 3IR6B 4OHZA 1EAYC 4DPTA 4ZVHA 4X4PA 5E0OA 1SKSA 3LW5C 4O44B 1H98A 2X1BA 1IJEB 3BM7A 3AF6A 3IMLA 2F9JA 4ZPDA 2BJ8A 2XY7A 4ZCMA 3P45B 2D3OR 4FYYB 2P2BA 2AEJA 3MR7A 2P9GA 3DDIA 5E2QA 2J9DE 2ZBPA 4GXRA 2W2NP 3GJSB 4NLOA 3QIPB 1PJ7A 3OTBA 1JJ2R 1MXAA 2XTJP 2HHUA 4USWA 4DV6C 1FHTA 4EMDA 3F73A 2HS4A 1XNQC 5GAEU 5CZXA 2V68A 5B0BA 3MM5B 2MQOA 4M5HA 3O1LA 4DV3J 4NZ0A 1X4HA 1QVGR 1UVMA 2R3VA 2AJ1A 2VH7A 2JHEA 3DRXA 2BE2A 1RK8A 2UVWA 2YX4A 4LR8A 4WJBA 4HHHA 2CWXA 3IG1A 1JLGA 1UWBA 3QFHA 1T03A 1CQMA 4B3OA 4LFBC 4Y00A 5KFOA 3V2UC 3NWRA 1RT6B 1RUSA 3QT6A 2XG8A 2VU5A 1V5IB 4F0MA 4ZLLA 4BDPA 1QWIA 1H0HB 1RWKB 4RWXA 1UPPA 4NYOA 1FRJA 1B4SA 2EFGA 3QBCA 4PPZA 2B6AB 4K5RA 4FKXA 4NMXA 5IQ6A 4LF8F 4ZP9A 3C16A 1OQ6A 1ZM2A 4ZJZA 2KO1A 3MMBB 3GSDA 1IBLJ 4LRBA 1QTNB 3PFEA 1FJEB 3G8QA 1QDUB 3MGJA 1RTHA 1S9FA 2W01A 4K4XA 2YX1A 3GU0A 1MDBA 2LCWA 4NOZA 1LWCB 1BQNB 4ZS6A 4YHHJ 2VICA 2MLYA 4FNIA 3AOAA 4ISBA 4G36A 4FKYA 2RMLA 2V4JB 2LQ9A 4DMZA 1NPPA 1FTCA 4LR7A 3C15B 1FERA 3GCXP 4KQZA 2NREA 5J2PB 1H38A 2BKNA 2G0IA 2KN4A 1N6QA 1M1KT 1FRKA 3NP5A 3L8CA 1MROB 3CD7A 1LOUA 1AZSB 4A8KA 1MW7A 2ZDOA 2AGPA 3BV8A 5HN0A 3UQSA 1YVFA 1ZM3A 4LFAC 1RWNB 2K3KA 4IH5A 3DOMB 1HHQA 1JB0C 1QM4A 1OSDA 4J9PA 1UJ5A 3CXCR 2JVOA 2OPSB 4TY8B 3CDWA 1MMDA 2XZDB 1JLQB 1T9WA 4AUKA 3LP1B 4NDNA 1YJWS 1MWQA 1H73A 3RB3A 1HBUB 1NJYA 4HLBA 2MKIA 3TAPA 3FJ2A 4HL9A 1VQ7S 4X66J 4OI3A 4KPCA 1C1BB 2J7UA 2QN6B 3GG1A 1BMQB 2J9DA 3U27A 3WIVA 4N76A 2EWHA 3VNSA 2DNMA 3QSIA 1JKHA 3JYTA 5GMKa 3DGPB 1RT1B 2LXUA 3OTCA 1L3KA 2BVZA 1XJWB 4V1Ak 5KFYA 2Y4OA 4Z7CA 3J81Y 3SCJE 4ECQA 2VFTA 3I6PA 2AYBA 3LPEA 2KM8B 1RHQB 2C28A 2MZ1A 3UI3A 1U6ZA 1VC0A 1R8BA 1NJIT 3UR0A 1N32J 5B0DA 4JV0A 4I2QA 3T9ZA 1KP6A 1UWAA 3R1HA 2O5DA 1PA4A 4Q2MA 2HMIA 2PN6A 3QIDA 3OXLA 4MFBA 3FFIA 3JSMA 4E0DA 1SC6A 3PYEA 3A3PB 3RB0A 3FSIA 3OVBA 3Q22A 1MLAA 2FJEB 5ETLA 4AE5A 3VV2B 1GMVA 1MSWD 2QL7B 3GMGA 1S6UA 1KONA 1U1RA 1Y9OA 4DUYJ 2EC2A 5EDWA 4PYAA 4DL4A 5DZ6A 3E3XA 4O3NA 1ZZFA 2CZ9A 5BSVA 1Q53A 1JLBA 2FLNA 4NMLA 1R7IA 2XM3A 1N36F 2VG7A 4J90A 1HR0F 4NLWA 4DF8A 1K0TA 1CVJA 1O51A 1OS5A 3GCWP 1KDNA 2ATLA 2GVZA 2RQKA 3D0HE 3HFVA 2V0NA 2F65A 3DI6A 5A8RB 2VIHA 2HHWA 4ID5B 3KFWX 2ZZNA 1FXDA 5G0RA 3MEEA 1YRUA 2GIRA 4C8NA 1WC6A 2PE8A 1B0TA 4F4AA 1XNQJ 5K14B 3DLBA 3DLKB 4O3SA 1S9EB 1IWGA 2YNHA 1T9UA 2VBWA 1XR6A 2JMPA 4K4SA 1WTFA 2XSJB 4BWMA 1EGAA 1OY6A 8ATCB 4PCQA 2GJ2A 3IAS9 4AL5A 4LFBJ 4PQAA 3EVWA 3RG6A 1OO0B 3H5YA 4DEZA 3HXMA 5A2QY 5E3AA 2MGZA 2EI5A 1I3OB 4CLYA 3DM2B 1RA7A 3AH6A 5E3CA 3MAAB 1UW9A 2JEIA 3CJ0A 2E1PA 3GB0A 1IXKA 2B5JA 5DQGA 1MN9A 2KJWA 4DR5C 2MKJA 1QAIA 2N4DA 4DQRA 1UWDA 4B9VA 2Y1JA 3U1MA 1U48A 3SIPB 2Q79A 3VGVA 2BQUA 1JXVA 2LECA 5KG1A 1N5TA 2D1RA 1S77D 2QFIA 1SQEA 2QIFA 3CPWR 4USMA 1UVKA 5BUQA 3BSNA 1ZYQA 2F4VC 4USIA 4CM0A 2FD2A 1TKTB 2DHAA 4CLKA 1NSAA 2IRXA 1TKDA 3HSDA 1S1XA 4PKDB 2J0XA 5F9NA 3G7SA 4EK2A 4P75A 4X4VA 4LSNA 5KG5A 1YIJS 3HZEA 3WZ0A 3LO3A 2XS5A 4LF6F 1A9NB 1CS4A 3BN4A 3SDEA 1GX6A 1NK4A 1RTIA 4ALZA 4EFAC 2MSSA 4B9LA 1D3WA 4A8MP 3DOKA 1V60A 1ZAXA 2OKQA 4JI8F 1DLOB 4ED0A 1D0EA 2L9DA 5DQIA 1NZAA 2M0GB 3QWPA 1QUVA 4LFAJ 1XWLA 4RNNA 1DJ0A 1NJWA 1N36C 1P8GA 1H3DA 2OFGX 2OMOA 1EB0A 3H98A 1NRKA 2WHOA 3LQVA 5DQHA 2OI2A 2ZHAA 1JLAA 4JBCA 4P2MA 3BYPA 2CJYB 4YS2A 4JI0J 1FJ7A 3DLLQ 2FHKA 3CJKA 1NK8A 1VCTA 2U1AA 4DN0A 2GW8A 3KLGA 2DXFA 2CQPA 1XQIA 3MMCA 3W2VA 3K57A 3P8BB 1ZH5A 4DL5A 2ZD1B 1GH8A 4J9LA 1FO1A 2UUTA 4WIQA 3UVJB 3IN5A 4P2FA 1JOSA 1Q16B 2OTLS 6FDRA 4UF4A 2HHPA 5IT0A 2HVZA 3VR1A 2BR0A 1YHQS 2HQGA 3PIPQ 4GKJF 1D09B 3PESA 2ASBA 4ILMA 2P2FA 1GPMA 2E5GA 4D3GA 4QU7A 1RJJA 4DR2F 1SC4B 3SQOP 1QJHA 2DXEA 2Y8YA 4PUIA 3BB5A 5EUHA 2J0SD 3R7NB 2QLWA 3RBDA 1H72C 3Q8YA 4PROC 4USJC 2FB0A 4UZCA 1O0PA 5M2UA 3CQ3A 2B3TB 4UOFA 4RLEA 4K4YA 2NZCA 1NPRA 2Q6CA 3J80D 2P9EA 2OGUA 3TI0A 3M8YA 1LV5A 2YH1A 5RUBA 2NSBA 1AT1B 4H54A 1XR7A 1NEEA 3L7OA 3VAJA 4ZPTR 4DSLA 1NYEA 4K59A 5IFMA 3K58A 2BACA 2G2OA 2W4CA 4PQUA 2MZTA 1HD0A 3EM1A 4ZJLA 1Y5LB 2HYIB 2QLBB 1QAJA 3C8YA 4RW4A 4DPXA 3N4WA 1DQ9A 5HLFA 2XYGB 1S97A 4DLEA 2WRMA 2XI2A 2LEPA 2ZE2B 4OYIA 3BF4A 1V9OA 2IYIA 5KFFA 1VC5A 3ENQA 1L3UA 3H5SA 4L75A 3OR2A 3ILLA 4PXBA 3H90A 4Q43A 3QRQA 4XTTA 3G6VA 1VC6A 2CRLA 4U5YD 5ETPA 1SL0A 1VRUA 4KJIA 3EVOA 5B0GA 5GMDA 4WPAA 3RYLA 3TVKA 2OEJA 3HHEA 3MFIA 3DOLA 1FX2A 2LQ8A 4WKYA 5BSUA 2KYXA 2HNDB 3ZTRA 2GHWA 3MM9B 5LMNF 1SJFA 2QGFB 4P7VA 4L3KA 1ROFA 3QSYB 3HZGA 2FZGB 5EGYA 4K5SA 3IA0A 5K8OA 4RUAA 5KOWA 2RT3A 2XZWA 1NDPA 3MR3A 1UW4A 2KZFA 5DJBA 2YWGA 3KLIA 3T1HF 3OL9A 2IBOA 3TZWA 3KLEB 4C11A 1HBOA 2CQCA 1S48A 2BV3A 1KEKA 1M1HA 2CPEA 1YBTA 2I6WA 2ADCA 4QBUA 2KI2A 3L7PA 3A9VA 1KQFB 3W65A 4R5PB 2L3MA 4DR5J 3E7XA 2DY1A 1IQZA 4F4WA 1V6HA 5HMXA 3M2VA 1T9YA 3F41A 4I6YA 2LQ5A 2DPIA 5D77A 1VQKS 1CJUB 2XY6A 3MHYA 1PJ6A 2DNGA 3VNRA 2G2YA 2E8CA 3QRPA 1PJ5A 1SV5B 3J7YU 2F4VJ 2ONFA 4NCBA 4U7CA 2WBMA 2B4UA 2PA8D 1K1QA 1UEKA 4PUHA 2HNZA 3VGTA 3D3CJ 1Z2ZA 5HMYA 3JQMA 3NS6A 1IJFB 1X9SA 5HMZA 1RT3A 3O5TB 4L76A 3GQCA 2B7CB 4F02A 5FD1A 3TA2A 5FJ4A 4ER8A 3TJ8A 2W24A 3ZFVA 4ZPVR 3HSGA 2JDJA 3GKUA 1OIAA 2OHDA 2EK6A 4AQYF 5BYSA 1N36J 2VF3A 4JYAJ 1ULTA 2UUAF 1UJ4A 2HEKA 3M9MB 1LCIA 3J7Z5 2W2OP 5ETSA 4I2PA 1UVNA 2RQCA 1TR0A 2QL5B 4ZN3A 4Y2MA 4J9NA 5K8NA 3NOCA 3I5BA 1JMTA 4A4JA 2CG4A 5DLGA 3GJQB 1T05B 1U0HB 2K1RA 3R9WA 5FDLA 3D2WA 2PN2A 3UW1A 3LGHA 3BYRA 1I6JA 1VQNS 1T94A 4DFJA 2HHSA 4OX9F 3C46A 3PHEA 2V2QA 4GKKF 4ECSA 4ZITA 1WACA 3MFHA 5ETRA 2VC0A 3T41A 2JOQA 9ATCB 2O67A 2MQQA 4EBEA 3NMRA 3SQGB 3AJ1A 4CO2A 2UUBF 2RILA 4PZVA 3K89A 3T1HC 2NYIA 1CJVA 1U24A 4YMEA 3G96A 4KO0B 1X0FA 3OJSA 3M9OB 3IM8A 3ZTOA 4C2MA 3C14B 2J7WA 1HYSB 2QA4S 3AA8A 2FDNA 4UUXA 2PSZA 5F0WA 1HNZC 1PG4A 3I96A 2HBRB 1IN0A 4DV1C 1Q1KA 2QVYX 5KYTA 3PW5A 4K50A 4MJKA 2IC3B 3W2WB 2LQBA 2DNPA 4QYZJ 1CC7A 5H9FK 2H54B 3J81U 1HBNB 3R6LB 2MM9A 2AEFA 3X1LB 3IWLA 1NDLA 3LP2A 3UD4P 1S6QB 4X4RA 3H5UA 3K5MA 2COLA 2HQCA 4D57A 2FVCA 2DPJA 4ZDNA 3IRXA 3EDQB 3P5TL 2XO7A 1YTYA 2YNGB 3LGXA 2XMWA 2XMKA 2J5AA 2HQIA 2D74B 1X4DA 2KTQA 4C7QA 2GNKA 1NBEB 4OHVA 3CJ5A 4NLQA 3UFCX 5GADI 4MIWA 5E7OB 4AQYC 4IRCA 5F8MA 2JZ5A 3CJ3A 1SB6A 1RT4B 2VG6A 3WIUA 3DLHA 5GVQA 4PG7A 4K2JA 4USTA 1SC3B 2CJKA 3LAXA 2UUAC 2YCBA 3M32A 4F0KA 1SKWA 2ZOGA 2XLJA 1JLEA 2VQEF 4ZCKA 4EYIB 3M4XA 1TL4A 3WX8A 4DS5A 1KQGB 1VHIA 2I9SA 2AYMA 2W9BB 4Q0BA 3CCUS 1LWEB 2V69A 2XULA 3PKYA 3G6ES 1RT2B 2MPUA 5AT1B 4KR0B 5L1KA 5KFHA 1W26A 2IJRA 4FP9A 3CGIA 3DXBA 2J7KA 4GKKC 1MU2B 2MKSA 4NXNF 2XO6A 3D0IE 3HULA 3V6KA 1RGVA 1USPA 3V6DB 5LL6d 3N6LA 3CQ1A 4BSZA 3PROC 2UUBC 1VJQA 3FUYA 3R2CJ 4TVAB 1Y5IB 4ZVPB 1S9GB 3W9IA 3ULHA 1YGYA 2VBYA 1QTMA 5A2QU 3IS9A 3OHAA 1RCXB 2ZITA 4QYRA 4UW2A 1MWYA 1GK8A 1FLOA 5KFTA 1RWOB 4TYBA 4ZPBA 2BJEA 2HQ3A 1FFSB 1L5UA 3MUTP 4DL3A 1RQ0A 2HFSA 4FYWB 2JSXA 4KFBB 1WSRA 2CKWA 1K0RA 4YDXA 1U2FA 3OSNA 1FJGF 5L38A 3M6VA 3Q8VA 3G8TA 2ZJQQ 4OJ3A 1G4CA 2D3ZA 2QZ8A 2GVDB 2DO4A 1N34F 2UV8A 2ATWA 3UDLA 1Z4UA 2BJ9A 2QYCA 3ET6B 3KNAA 2NZ4A 4I67A 3QPIA 1RYRA 4KTTA 4RJVA 2BUNA 1CJTB 2ADBA 2C2ZB 4RW9B 3LWMA 3GFHA 4UOGA 4JUZA 4NLSA 3L95X 1KQKA 2UU9F 3DMJB 4M63A 2R7UA 5EX3A 5E5NA 2Z2YB 4RO0A 2ZJPQ 3K5OA 1P7LA 2Q1LA 2WW4A 1RT6A 1UETA 1YQHA 2QVZX 4G1PA 3OUYA 3M8WA 5EWEA 1DBDA 2JEJA 3ENAA 4UQGA 4GMKA 2AEMA 3CD6S 3M8PB 1RBLA 1WELA 3MMJA 1RWMB 1RYSA 1R6YA 3C6TA 2QYGA 1RHUB 2YNFB 4ED5A 4HI1A 5CZVA 3PHTA 5M2PA 3FBCA 2KFYA 1KLMA 2W2QP 2EPIA 3W3SA 4ICLB 5GAHI 3MCSA 3T1HJ 1W2BR 2W7PA 3B4DA 1N88A 2GGPA 4NLTA 2MKYA 2NR0A 2JLFA 5AE2A 4MK8A 1FJCA 3IBCB 1Q5VA 3GE9A 5EHHA 1RTJB 3LOUA 3GPAA 3EX7B 1HNXF 2VA2A 5K5MA 1HNZJ 4OZ1A 3DLEA 4DV1J 2ALZA 1HH2P 3CB4A 1RAFB 4H4MA 3CO0P 4R8UA 4HDHA 1RI7A 2B43A 2P6SA 4JI3C 1DHMA 1R43A 2RF2B 3HMJG 3MOJB 2W8KA 3TZYA 5KFCA 4LBIA 2WB4A 2C22A 2C2DA 3AD9C 3JS9A 1AZSA 1F9HA 4ZHRB 1RBOB 3K8VA 2OH2A 1PG3A 2GA7A 5KFAA 1S10A 4CLSA 5BSMA 1UA1A 2C2EA 3PO5A 4TLQA 3GV5B 1OY9A 3DRSA 2E5IA 5D78A 1BC6A 3CNQP 4DX5A 2FGCA 1YJUA 3HFKA 2VG5A 3BQ2A 4KE5A 1VLYA 2FHOB 4IQXA 1FJGC 5C2GA 5DS7A 2IA0A 3IRWP 4AQYJ 3AFGA 4X4NA 3FCWA 3QFWA 4MIBA 4ZCIA 3WDOA 3OTOJ 5J2MA 2UUAJ 4OQJA 3NLCA 3TVYA 2ZUGA 2FYXA 3RR8A 3GYGA 4PYDA 5BR8F 4J37A 2AGOA 3MM6B 2F63A 5HATA 1K73T 2YNIA 2QL8A 3GR0A 5GAGU 1SH2A 2C3MA 1OPIA 3ISND 5KFKA 1EHWA 3TVZA 3KJVA 2N4CA 2MKCA 1WOSA 1ZETA 4DV5C 3TJAA 1S1UB 3OL6A 1G7CB 3GYXB 3KLHB 1XMQF 2CJXB 2CDRB 2RHSB 4FN5A 4DQPA 3I07A 2MDAA 1SVDA 2XMTA 5LM7E 4B9SA 1FKOA 1TKZA 2M5YA 3I5CA 4R1MA 3R7BB 2K06A 2XMAA 2M5OA 2E5LF 2DH9A 4DR6F 5J1EB 4Q45A 1CSJA 1U1KA 3BSCA 1SI9A 4CLLA 2CQBA 2PD1A 4GS5A 1T5DX 1M5KC 2UUBJ 3HT0A 1ZA2B 3HHDA 4YR2A 2BOPA 3OLBA 1T9TA 4U9RA 2HGLA 5AJ3J 4WCEQ 3H2UB 2LU2A 2KHDA 3LH2S 1SKRA 4JV5F 3PW4A 2O3DA 3US5A 4DZ6A 2AJFE 2BA9A 2VA3A 5F3TA 3CCQS 3NI2A 1R0AA 1B99A 1HNXC 3CMAS 5AXMA 1DTQB 2B9YA 3S8SA 5A8WB 2ZH1A 4YR3A 3N01A 4L74A 2R7WA 1RAIB 2I1RA 4C98A 2CPFA 4LRAA 5F8LA 3O44A 3W8GA 3HX9A 4NZ7A 2KDNA 1F3FA 1N5VA 3TNVA 2XMJA 1JNZB 3BBBA 2P2QA 4NLXA 1U47A 1C0UA 1UP1A 5K14A 4GXQA 2FY1A 1C4AA 1R27B 3SZ2A 2CA9A 1S9EA 4TXSA 3LPYA 5BSWA 1AUSL 3LANA 3R27A 2C2OB 2ASYA 1LWFB 4X62F 4CYUA 2PC6A 3BBFA 2ZHOA 2YPZA 2HIQA 3VAMA 5IOLA 1FKPA 2ASLA 4C8OA 4ED3A 2WONB 3Q24A 2PEHA 4TU7A 2BXJA 5IT4A 2W7AA 1IKWB 3CWJA 4CM2A 1QLNA 1TMJA 3RW7A 3C2PA 2DVIA 2Y1LB 1TL3A 1HBMB 4Y65A 1QUPA 3WQPA 1HNVA 4U8YA 3UDVA 5BR8C 2LYVA 4QQBA 1PAUB 2HS0A 5E3RA 1L2FA 3QGGA 4XPEA 2V8DA 3Q2TC 4DUTA 2WP0C 2QLJB 1YITS 4HACB 2PT0A 2E5JA 2L48A 4ZVFA 4HEA9 1XMQC 4LVNP 3G86A 3CJ8A 4TY9A 1KTVA 3R5DA 3A8JA 2QMWA 1AW0A 1BE4A 4UQTA 2YWEA 2ERRA 2E5LC 2DIVA 3MTJA 4DR6C 4X4UA 2D9OA 2JRSA 5HJYA 4F2RA 1KVIA 1XEZA 1N48A 4JI3J 2FHMA 3FEYB 3TR5A 1N33F 1LW0B 2YWBA 2FJAB 5C24A 2NXNA 4DBQA 4GRSA 1WI6A 1JK9B 4ZLNA 4A47A 1XS3A 1DLOA 3RRKA 1DARA 2MY8A 4RW6A 4EEYA 1AYEA 1N56A 2OUGA 1ZZNA 3UNGC 1ML8A 2K8GA 2VUGA 1ZAVA 3QATA 3TA0A 3PEHA 4DPYA 2ZH3A 1H7XA 2D3O1 2EG1A 2G13A 4QWDA 3LP0A 1IR0A 4M5IA 4UTGA 4JI5C 2D9PA 4CO3A 4JB8B 1RAHB 1BQMB 4O0IA 3HCXA 5KYVA 2UXDF 2EEYA 3OVSA 4A8FA 1JXLA 1FRMA 1TU0B 3NNAA 1FJGJ 3MZIA 5CCMA 1D9DA 3D0GE 4DR7F 2OPPB 5DG8A 2JLEA 1WG4A 5EX0A 2RJZA 1SUQA 1QAXA 4C0HA 4GO5X 2AKWB 3VAKA 4ZLJA 1K47A 4DR4C 2AU0A 1TFYA 5A1IA 3KLFB 1R89A 2YTCA 4PWUA 5A8KA 2VV5A 1IBKF 4DQIA 1H74A 2MQNA 1V3SA 5KTQA 4X62C 2QJ3A 2H1YA 5BURA 3KYLA 4M95A 4DV5J 3T19A 4FBUA 2GMLA 4OXIA 4AFFA 2IM2A 2P6TA 1SH0A 3LALA 3M8SA 4DV7C 2MEWA 2E9RX 2VFVA 2KFZA 4NLGA 4B17A 2HURA 5KFXA 2PIIA 4IDKB 2C42A 4J9OA 3AB4B 5L9NA 3QJPA 1GMWD 5DM6Q 1FCAA 4HT5A 4W92B 1KVKA 3LNOA 1QE1A 2MZSA 2RKIB 1X5TA 1VRTB 1F2GA 3CCZA 5A0YB 3GV8B 3RBEA 4F3OA 4CIOA 1S59A 2R7TA 1UZHA 4KIAA 1I94C 1TKXB 1HNXJ 5SZTA 3BDPA 1T3OA 3JSBA 4DV4F 1F5CA 4KHPC 4ITSA 2VPWB 3BEGB 3M30A 1PCAA 4OZLA 4TN2A 3DXSX 2WAQD 2WBRA 2UV8G 2D28C 4JP8A 1R8AA 4ELTA 1NH8A 2KYZA 1N33C 3D7SB 3D3BJ 4KRWA 1LQLA 1ZAWA 3CIZA 3W8PA 3NBPB 1VGYA 4U7UK 2Y3YA 5I3UA 4WYWA 2ZZTA 3QMQA 4LQ9A 2YVSA 1RU1A 1TUVA 2AX0A 4MAKA 1SJ4P 3RAQA 1FNOA 3I82A 3PVXA 1AROP 1X4EA 4XAKA 4RX6A 3DLPX 4OZ3A 3M8ZA 2C2MB 1YZ6A 2V5HG 3WBZA 3PW0A 3H59A 3H4DA 4IUFA 5ETMA 3L4BC 1YJ9S 3UN5A 3ILOA 1VQ8S 1DTTA 1FF2A 2RIJA 3R97A 3V81B 1JXEA 4DU8A 5FIIA 3CJQA 5BR8J 5J2QB 3CO9A 4DUZC 1GTEA 3H2VE 1U1MA 4TLRA 4V19J 2Z2ZA 1O90A 4WE1B 1EARA 1SQFA 4DCJB 1UPMB 2CPZA 4BS2A 4DL0C 2LVWA 2DNZA 3CJ2A 4RW7A 1Y10A 3I31A 1RLCL 2AZ3A 2P2MA 4X4TA 3E01A 4RZRA 4LF1A 4YY3C 1HPZB 4BC9A 2IVYA 4DF4A 4NCAA 1YJNS 4U67Q 2C3UA 4DR6J 2BJDA 4CT8A 3BGRB 1BHNA 4XDDA 2OPLA 5E3PA 1HWKA 3NPDA 2BBEA 3DRRA 2GIQA 5J2NA 3MD3A 1IKXB 3DLGA 1KN6A 3CJ4A 4Y2KA 2CJ9A 2KZ0A 1Y11A 5K8MA 1I5OB 4RBTA 4ES3A 1HMVA 4KV8A 2DNKA 4CLPA 1YRTA 1TUGB 1E6VA 1O93A 3EWGA 3R7SB 1TV6A 2BJOA 4DG8A 4ODJA 3MPWA 4DV4C 4D3HA 5HROA 2YKNB 1V3RA 4JI5J 3RZAA 4C8MA 1QY7A 1VYAA 4KGMA 3VF0B 3B78A 1GXUA 2A0FB 3W5YA 2AGQA 1VQ4S 3M1VB 4WFBQ 5E7QA 3NKYA 3IO1A 4OV6A 1XHJA 3KK1A 3MWBA 4ES2A 1L3SA 1G2EA 4IG3A 3CCES 1FD8A 1JX4A 2H3EB 4DR4J 1Z2LA 1YWXA 2LXIA 2F8HA 2W7OA 4NX9A 4GVBA 1REVB 1BUXA 3RGIA 3BZQA 4FF4A 1IBLF 4C8LA 3E2EA 1VISA 1YK9A 4PABA 1HQEA 5MAOA 3N54B 4NA1A 2D1SA 1RT5A 3UE2A 2HHXA 3PX6A 3TX0A 4DV7J 1P4EA 3KK2B 2CPXA 4OV1A 2CQ4A 2WB1D 5IC4B 3GIJA 1ZTWA 3VTIA 5AXNA 1XRBA 4YHHF 4KO0A 2XY5A 4WP8A 3VZHA 3SEOA 4QIWD 5DM7Q 2CQDA 2VPYB 4QIGA 3N6MA 4FXWA 4NCGB 3IBWA 3NOGA 3W2WA 1B7YB 2GS8A 4AL6A 2WSFC 5KOXA 4B02A 4BWJA 4YFUA 3MEDA 4N41A 3B54A 1NXIA 3W5XA 4OYWA 1ACMB 3D67A 1NSKL 1S1TB 3MUMP 1I94J 2X3DA 3BQ0A 1SH3A 3OFFA 1HHTP 4CCHA 4F4XA 4ED8A 2HWHA 3I9ZA 4KHPJ 2JNJA 2OELA 2HBZB 2HW3A 4BHQA 1SJQA 4WK3A 3P6YC 3R6GB 3EGZA 1YBUA 1RADB 2M7SA 4FTFA 1E6YA 2E1RA 3BO3A 2GJIA 4DR3C 3RJMB 1VQOS 2RDIA 4KYZA 1N33J 3IMQJ 3THPA 4FS2A 3CUNA 3R8YA 4I1TA 5IM0A 2MKKA 5HJXA 1KFDA 1GXTA 3MECB 1S7IA 2LA6A 1GMWA 2B9WA 3RAMA 1O5JA 1L3VA 3R44A 2FY8A 5LSRA 4DN9A 1PYTA 1LW2B 1ZPVA 3OLAA 4Z37A 1WF2A 4NA3A 3HVTB 2EFVA 5LOQA 1NK0A 2ZWPA 4X64C 1S4EA 3BO4A 4RW8B 3CDEA 1RG9A 2DD8S 4C9DA 2YXLA 3W5ZA 1GXLA 1VFJA 2ZNZA 3D4JA 4X4SA 2EVZA 1RBAA 4Y34A 3OHBA 1U4BA 5C25B 3NAHA 4A8YA 4LF4C 1OYEA 2EGTA 1TL5A 4OZNA 1MWZA 3I55S 2W9CB 2R42A 4FZVA 4ECYA 2CPIA 2E5HA 4DUZJ 5AE3A 2Z0GA 4KKOB 5SUHA 1IBMC 4NLPA 1OQ3A 5LSOA 2XLKA 5IT9Y 3QGIA 1Q4RA 4EYHB 1IKVB 3OVAA 4QW8A 2MJUA 2M52A 1W2IA 1SQGA 3POTA 3A9UA 4YY3J 2YKMA 1Q8KA 2ZNYA 1G3OA 2RUGA 3OQ2A 5E33A 5HBMA 3N0VA 4YHHC 3L9ZA 3M9NB 3M8QB 1R8PA 3CJTA 2XWXA 4LREA 1H2UX 2B4PA 2DTJA 3ZZRA 2BRKA 3FSYA 4OHWA 2CNOB 3D9BA 2RRAA 2KRRA 3Q8UA 4AXJA 1T8EA 1APSA 3DLJA 4TU9A 4PWDA 3PYGA 4F26A 2BANA 5F8GA 3FBEA 1PKUA 2VASA 3NXZA 2ZZMA 2GVDA 1XNQF 5IWAC 1UAWA 1NKEA 4DV4J 2ATCB 3JQKA 1C1CA 1Y0HA 4Q44A 4DX6A 1X4GA 2ACYA 1CJTA 1I1GA 1XNRF 3J7YI 4QCLA 1K0VA 1ZB9A 5FLXY 1WC4A 2ZBQA 3G71S 3KHGA 3KKFA 2BE2B 4NL5A 2QA4G 4B3TC 3HPOA 1NHUA 1IUJA 3IG1B 3OW2R 1TK0A 1JLCA 1JLGB 1UWBB 1T03B 4B3OB 3I0SA 1Q0NA 3MEGA 3PKMA 4IOBA 4NEYA 4MIAA 3DYAA 3MPVA 1EETB 3CQ2A 5CD4H 3TO8A 4J9KA 2DR6A 1M5PC 2QFJA 3V6JA 2MY7A 1UL3A 2G1DA 2DYAA 4CO4A 3C16B 5ETTA 3S7RA 1SIWB 2FJVA 2JNVA 3KUHA 2D7VA 1XK8A 4C8ZA 1H7WA 4QZVB 1QAYA 4B9TA 2VB6A 1SKUB 3AB2B 2B0GA 3KJQB 4PXEA 2DT9A 4A8WA 4WZMA 1V25A 3R5GA 5EWGA 5KFPA 2RVJA 2R8JA 1RTHB 2DHHA 3K6RA 4ECZA 3JAMD 1RAJA 3PYFA 3MM8B 2VL1A 2C2KB 3ZZOA 2V9KA 2RDDA 4ZP6A 2FVQA 2K7KA 1N6QB 4Y2CA 4OX8A 2DK2A 2DNYA 3TQ1A 4LFAF 3G87A 3M6WA 4WKRA 1FRLA 6AT1B 2MQLA 1N5YA 2HHVA 1PIEA 1S49A 1NPKA 4J9MA 1YJ7A 4DR3J 1UMJA 1WI8A 4AD6A 4LF5C 2Y9HA 4G65A 2G2ZA 1GMUA 3C6UA 1KKGA 4JI0F 4TQRA 2HWIA 5B09A 1SBRA 2HVHA 2HIYA 1DRZA 4K4VA 2IA6A 2A1BA 3HD2A 1NO8A 3IR5B 2BM0A 2EBGA 2NLWA 2PT7G 3HKWA 2XS7A 4CT9A 1R0BG 3CCSS 1SJ1A 4X4QA 5KFGA 1J27A 3MTKA 2XR1A 3LA0A 2WD9A 4ZVQB 2KDOA 4LRDA 4O4GA 2IM0A 4X64J 4EATA 3MURP 2W2PP 3BGLA 1YKWA 2IRUA 1FE4A 2VFUA 3DDNA 4YP3A 3UZ0A 1XNRC 2HWTA 2G1HA 4DSJA 1JKHB 3JYTB 1NM2A 5F3ZA 1FVQA 4ENOA 4LF4J 1YDLA 4RBVA 2WSCC 4N5SA 2NXCA 3KLHA 3S6EA 3J7ZT 3SCKE 5KFRA 1XBWA 4NRTA 1VQLS 3GIIA 1IBMJ 1L3TA 5KG0A 3IGVA 4I2QB 2KKHA 4IO9Q 2Y4NA 1XR5A 2CDQA 3MPDA 3DRPA 4OJ1A 2LU1A 2HMIB 1RXOB 2OSQA 5KFIA 1HQUB 4U7UD 2L08A 4MFBB 3FFIB 5E41A 4CTAA 3JSMB 3CSKA 4WV3A 3C66A 4XO0A 1OSCA 4QPXA 2R2SA 1RKIA 3AJDA 4E8UA 1T02A 1ZB8A 1HLWA 1Q7LB 1FNXH 1NU4A 4CH0S 4D56A 4RNFA 3K7RA 4ZVEA 2GV1A 2CQ1A 1KFSA 2KU7A 1VQ9S 4B3RF 4NOHA 1ZM4A 3AODA 4G1QA 1X60A 3G9CA 3R2DJ 1N8RT 1D9AA 2XGPA 3I32A 5JVHQ 2K2PA 4J7CA 3HJVA 4MK9A 4R0MA 3M8RA 5T8SA 2VG7B 4FS1A 1YSJA 3NCQA 2J9CA 1H2VZ 3CMQA 4MKBA 3IC1A 4YB5A 5IWAJ 1X0PA 2B56A 4OX6A 5K85A 2M2BA 4Y6IA 3T5LA 4UY8T 3MEEB 3KUEA 3TZXA 3KG4A 3RR7A 1YJRA 4UT4A 3SFUA 4WU2A 4FF1A 4IRDA 4LT6A 4ECRA 3ONQA 4A48A 5GTDA 2LA4A 5J1PA 4RUBA 1TFWA 2XMUA 2LFVA 2YNHB 4NLDA 2EG2A 1MXCA 3EMTA 2MLXA 2RRNA 2HK3A 2HVEA 3G82A 2M88A 1WG5A 4JI0C 3NAIA 1U1LA 3R5AA 3S82A 1UFKA 1URRA 2QC3A 4B3TJ 3BN7A 4I0WA 3E51A 4TQSA 4ED2A 4A46A 1HA1A 3BJYA 5A76A 5KFMA 3NCPA 1HBMA 2NSCA 4F3QA 3AD8C 2MGZB 3PRDA 1RB0A 2LEBA 2AYAA 2N82B 3ITHA 2EXUA 3EICA 4DR5F 2X1FA 2B5JB 1FDDA 1CC8A 1TL1A 2XZTB 4ED1A 2YWCA 3W61A 3D54A 2DR8A 3NCRA 3W9JA 2A6MA 1P27B 2C2RA 4X65F 2F4VF 2BKOA 2M5HA 2XHCA 4PR6A 3DNCA 1BGXT 3V4MA 3OT9A 4Y28C 4F50A 2HVIA 3A25A 5T7LB 2QSWA 1TMMA 3PX0A 4OYZA 2KT3A 2OTJS 1S99A 1S1XB 2ZM6C 3KG1A 2C3YA 3I0RA 3SSRA 3GR1A 4LSNB 2E9ZA 4J9SA 3HO1A 3DHXA 3QJLA 1CS4B 3ZO7A 1FFGB 1V3ZA 3SDEB 3VVUA 4K0BA 1KVJA 1RTIB 3T1YF 3AXKA 2KG0A 4OZJA 3BH7B 3PYDA 4B3RC 3M2UB 1HNIA 4QWCA 1Q86T 4QWBA 4JYAF 4KHMA 2QVXX 3DGVA 4LF5J 2MXYA 2M70A 3TQIA 1N54B 2KB2A 4X2BA 4I64A 5H1SV 2GZOA 2ROEA 4PXDA 3Q8QB 2DGWA 4CLTA 4RNMA 1M6XC 3TUZC 1JJ4A 4ECXA 1JLAB 3AA9A 5D4NA 3B6BA 3SCLE 1KOOA 4RMNA 2FVRA 3UN2A 1S6OA 1LK5A 3KLGB 1K44A 2UVVA 3MMCB 3W2VB 4P9SA 5F0UA 4J9QA 3Q8SB 2VKRA 3MPUB 2JVRA 1XNRJ 2OPRA 2KRBA 3QLHA 1TVRA 2FC8A 2CQ2A 1A0OB 4PG6A 5KFBA 3DU5A 3EVMA 4ETXA 5KFZA 3DCAA 5CYMA 4PHTA 2DKOB 3V4IA 4LFCF 3ZTPA 1FESA 5BYQA 1HFEL 4YQWA 3GILA 2WVEA 2LQJA 1UZDA 1WJ9A 3RU0A 2MB0B 3QZ7A 4DSFA 5D3GA 1MG7A 5KFWA 1EJ7L 3ENWA 3N5FA 2D69A 1QD1A 5DGAA 1VBKA 3UR3C 2AD9A 2N3LA 5F9LA 5GADU 1KWMA 1VRTA 5D15A 1CPZA 3D6HB 3T9NA 2OMLA 3QQCD 4J9UE 4N77A 2NXJA 1ELOA 4X65C 1FK9A 1IR2A 4DFKA 3AT1B 2IRYA 3KMQA 1LWXA 5HP1A 3QGHA 4A8SA 5GAGI 1OY8A 2R8IA 4CNYA 1XTZA 3SBMA 1X4AA 2UXCC 5BYRA 5L1LA 1RACB 4KT0C 3SFGA 4K4UA 1TL7A 1U2RA 3A8EA 4WU3A 2FHJD 3L09A 4RW4B 3OBIA 4GC7A 2OPQA 4OI0A 1IKYA 4YEAA 5IT9U 5HLFB 1SL1A 1T9VA 3T1YC 3CJSA 5LJ5Y 4DR1C 5H9EK 3OR2B 4JYAC 1URNA 4K0KJ 3BPSP 3CJEA 3I4HX 4ZVGA 3SMZA 5DRKA 2YQ3A 3MCNA 2EFPA 4CWBA 3NGSA 3GONA 1FRHA 3MMAA 5B08A 5KT4A 2V63A 2HHHC 3ELHA 4P74A 3T6JA 2FC9A 3IWXA 3BSAA 3CDAA 2PROA 3TA1A 1HIYA 1U2CA 2ZBIA 2WVFA 2HFNA 2D7SA 2V8VA 2IY5B 1JLFA 5IV4A 2A2CA 4WIIA 2M3DA 4USUA 2E0GA 3CF5Q 3FMBA 1NZ8A 4R0JA 2ROGA 5MLCV 2KVQE 1HBOB 4C11B 3CCMS 3HHLD 3CULA 3P49B 4PUOA 2CYYA 3KK3B 3FZ2A 1KQSR 2WSEC 2DCLA 4U95A 4DV2F 2E44A 4FVMA 3TAQA 4LFCC 3O6QA 5FLXU 3A8KA 2GQCA 2OEMA 1ZS6A 4WFYA 2VFSA 2OD4A 2CG8A 3TUFA 1U1PA 4DSIA 4LSLA 4QJVA 3M2VB 4MTNA 4K4ZA 1Q5YA 2KXHA 2R9LA 2MQMA 2V6AA 4IOCQ 3GFYA 1TK5A 4DG9A 2I38A 6FD1A 4ZIVA 2O1PA 2AP6A 1U6BA 2HRTA 1QSSA 1CLFA 2ZM6J 2HNYA 5D0EA 2DNNA 2HNZB 1X4FA 1U45A 4AT1B 1IKXA 1QSYA 1RT3B 1MXBA 2C3PA 3PJ9A 2VZ9A 4MYUA 2CQ3A 3GIRA 2BE9B 5D0HA 2XEXA 4FXVA 2VHGA 4B3RJ 3TANA 3CCRS 2JEFA 1NNDA 1T0TV 1V5VA 3R9LA 3Q23A 2VD3A 3EZOA 3Q89A 4ECWA 5L8RC 1EP4A 3ETOA 2R7QA 2KXNB 5T8TA 4P71A 1HKAA 5IS2A 4XK8C 3MI7X 2OJ3A
chains in the Genus database with same CATH topology
3LP1B 4H4KA 3D0GE 2F1FA 3SYZA 4DR7F 5EWFA 4NDNA 2OPPB 1A7GE 1YJWS 5DG8A 3TDEA 2JLEA 4I2PB 1WG4A 3RB3A 5EX0A 1HBUB 1NJYA 1XMOC 4HLBA 1RT4A 2GQ2A 2RJZA 2MKIA 2DGTA 4IR9A 2JC0A 3ZZTA 3TAPA 3FJ2A 1SUQA 1QAXA 4HL9A 2IJFA 3AHPA 3IFEA 4C0HA 4GO5X 3ISNC 1VQ7S 1AFIA 2NQPA 4OI3A 3VAKA 3C5EA 4DL7A 1JLCB 1C1BB 1YG0A 2J7UA 3GG1A 2P5VA 4N76A 2J9DA 3U27A 1VBYA 2HPUA 2EWHA 3L3CA 3VNSA 2CZ4A 2DNMA 2KHCA 4DR4C 3NGKA 2K1RB 3I0SB 2AU0A 1TFYA 2LEAA 4IOAQ 5A1IA 5FDLB 3KLFB 1JKHA 3JYTA 2DNQA 4NYZA 3MEGB 1R89A 2YTCA 1F9FA 4NA2A 4RLFA 4PWUA 5A8KA 5GMKa 1HI0P 3DYAB 2VV5A 1IBKF 2M4MA 3B8HA 4RWWA 3UWTA 4DQIA 2MQNA 1V3SA 3KHHA 4LF7F 5B0AA 5KTQA 4X62C 4C8KA 2QA1A 1RT1B 5F8HA 2LXUA 3OTCA 1L3KA 2BVZA 5KFYA 4MTPA 3Q8PB 2W9BA 1NJZA 3WC0A 2Y4OA 4C3LA 1LWEA 2F7VA 4RNOA 5BURA 2EBEA 3KYLA 2NXUA 3J81Y 4M95A 3SCJE 3UCUP 4WF9Q 2VQEC 3EZUA 1RT2A 3T19A 4GO7X 4Q7AA 5F8IA 4FBUA 1UEVA 3FVYA 4ECQA 4RM2A 2GMLA 2VFTA 1YBAA 3I6PA 4I9GA 4OXIA 4AFFA 2IM2A 2P6TA 2AYBA 4OFZA 2OP5A 1SH0A 3LALA 4LVOP 2CVEA 3M8SA 4DV7C 2KM8B 2C28A 1CEZA 4JI4C 2I5JA 2MZ1A 3PJXA 3UI3A 1U6ZA 1VC0A 3DFEA 1R8BA 2CJBA 4CO0A 3UR0A 1NJIT 5B0DA 1NK6A 2E9RX 2VFVA 4JV0A 4I2QA 5IZHA 3T9ZA 5THWA 2AJ0A 3CMES 3RTVA 3R1HA 2O5DA 4OX7A 2KFZA 2V2KA 4NLGA 1PA4A 3SSQA 1VQPS 3OL8A 4Q2MA 1FDBA 2HMIA 1MU2A 4B17A 5KFXA 4KPYA 1HNZF 3R9XA 1FNMA 2PN6A 2CQIA 2PIIA 4IDKB 3QIDA 3OXLA 1WHWA 4MFBA 3FFIA 2C42A 3JSMA 3AB4B 4J9OA 1SC6A 4DV1F 4E0DA 5L9NA 3RB0A 3QJPA 3QAUA 2DH7A 5DM6Q 3BR8A 3FSIA 4NLUA 3V6DA 3OVBA 3NGDA 2UUCF 3HK2A 1FCAA 4HT5A 3Q22A 4F8RA 1P6TA 2EW9A 2BDPA 4IKAA 4W92B 3N2QA 1SL2A 2FJEB 1VS3A 3HLUA 3OXGA 1FVSA 1QE1A 1ZM9A 4AE5A 1PO6A 4DV2C 1MSWD 4ZP7A 5CYJA 2MZSA 2RKIB 1VOMA 1X5TA 4NXNC 4CI0B 1VRTB 2IM1A 3GMGA 2RS8A 1M0SA 1X9MA 1S6UA 1KONA 5L1IA 3CCZA 1F2GA 1U1RA 1B64A 2ZOMA 4QU6A 5A0YB 2CQHA 3Q0AA 1S9GA 1WHVA 2YKQA 4IFVA 3GV8B 2Z8QA 3RBEA 1Y9OA 4F3OA 1S1TA 4CIOA 1Q81T 4DSKA 5EDWA 2KG1A 2R7TA 3N9UC 4DL4A 5KAKA 4KIAA 1I94C 5D4LA 3MXHP 1TKXB 3E3XA 4O3NA 1ZZFA 5C42A 5BSVA 1Q53A 3OTDA 5SZTA 3BDPA 1T3OA 1JLBA 1U1NA 3JSBA 3SV4A 1B0PA 4DV4F 1F5CA 1VQSA 4KHPC 2APOA 2FLNA 4ITSA 4NMLA 2VPWB 4LF5F 1R7IA 3LP2B 1N36F 2M8HA 3BEGB 3T5KA 2HRYA 2VG7A 3RG2A 4G1IA 3JB9k 4JI6C 3M30A 1ZTTA 1HNWC 2NUHA 5IT9D 1FRIA 1HR0F 4NLWA 4DF8A 4MH4A 1K0TA 4OZLA 2XGQA 4TN2A 3DXSX 1CVJA 1O51A 2L9WA 1FA0A 1OS5A 2WAQD 2VFRA 1N5YB 2XCAA 4PZPA 2ATLA 2WBRA 4AXIA 4KFBA 1XRAA 2RQKA 2UV8G 2D28C 4NRUA 1R8AA 3D0HE 4ELTA 2V0NA 3DI6A 5A8RB 1UEUA 1NH8A 2HHWA 2KYZA 5DDRC 1N33C 4ID5B 3IR7B 3W7BA 3C6UB 4LE5A 4KRWA 1LQLA 1RTDA 1ZAWA 3KFWX 4B9UA 2ZZNA 1FXDA 2DHGA 2OAUA 1RT7A 3MEEA 5G0RA 1WEXA 3CIZA 1YRUA 4RUHA 3NBPB 1X5PA 2GIRA 3MOZA 2XB2D 2P9CA 1VGYA 4U7UK 1XMBA 4C8NA 2V94A 2VBXA 3QZ8A 3EERA 1MD9A 2PE8A 5I3UA 5E7QA 1B0TA 2X3GA 4WYWA 3QMQA 4LQ9A 2VQFC 3OTOF 5K14B 1LW2A 4F2SA 2YVSA 3DLBA 4C8YA 4I7FA 3HHKA 3DLKB 4O3SA 1S9EB 1TUVA 3HVTA 1N34C 2AX0A 2YNHA 4CO1A 4RBUA 2KT5A 4RW9A 1KHVA 4MAKA 5KG4A 1SJ4P 2VBWA 1XR6A 2JMPA 2CPJA 3PV8A 2VG6B 3IXQA 4K4SA 3RAQA 1WTFA 4FUQA 4L2ZA 1FNOA 2Z2MA 4NLVA 2XSJB 5DDOC 3I82A 3OXFA 4O4GB 4BWMA 3PVXA 1AROP 1X4EA 2HW3A 1EGAA 1YJVA 3MAHA 4XAKA 4RX6A 2EC0A 4PCQA 4WFNQ 4DG1A 3EXCX 3QAEA 3DMJA 1RISA 2DB1A 2DGVA 4ERDA 2GJ2A 3OFHA 3M32B 3DLPX 1X8DA 3IAS9 3TAMA 4BC7A 2HLTA 4AL5A 1JLEB 2V5HG 2WW8A 3WBZA 3PW0A 3HHLC 4EZ9A 4JM1A 2CQGA 4B08A 3X3UA 4PQAA 1ZOTA 3H59A 3JAMY 3BGFA 3H4DA 1FDAA 4IUFA 1OO0B 2BABA 3H5YA 3V5RA 1YJ9S 4DEZA 1FKAF 2UU9C 2FHJA 2ZHBA 3HXMA 4B3SC 4Q2LA 1T95A 5A2QY 5E3AA 1VQ8S 4Q0BB 1KOHA 3M8PA 2MGZA 4OLPA 2EI5A 1DTTA 5D4PA 2QE5A 1FF2A 2RIJA 4FF3A 3DM2B 4EWTA 1RA7A 3AH6A 3V81B 1WH9A 2D1TA 1JXEA 2ZH8A 4DSEA 5FIIA 2R8HA 3HVAA 2YNFA 4IYQA 3OV7A 4L72B 5E3CA 1GQEA 5D6GA 3VQTA 4W90B 3DAYA 5J2QB 3CO9A 4DUZC 1GTEA 3H2VE 2JEIA 3CJ0A 1U1MA 4TLRA 3GV7B 1WHYA 4EO6A 3KXWA 4V19J 2V8HA 4F4YA 3GB0A 1IXKA 2YKPA 7FDRA 4LF7C 1A6LA 2B5JA 1NK5A 4OL8A 4JV1A 2ZDPA 5DQGA 4J9RA 1T7PA 1H6KX 2KJWA 5FLXD 1BA3A 1O90A 4WE1B 4X84A 2I8EA 4ICLA 3DRPB 2B7BB 4DR5C 1KNZA 2MKJA 1QAIA 2N4DA 4NXMF 2CPZA 4DQRA 1FXLA 1WF3A 1HARA 1S7HA 4B9VA 4R25A 3BSOA 4BS2A 2Y1JA 2DGXA 3U1MA 1U48A 4DL0C 4CTAB 2LVWA 2Q79A 2DNZA 3CJ2A 4RW7A 2GX8A 3CDUA 3I31A 2BQUA 2LECA 1USPB 5AJ3F 4H4OA 2ILYA 5KG1A 1N5TA 2P2MA 5I4MA 2D1RA 4HH1A 1S77D 2FVSA 4X4TA 3E01A 4RZRA 4PXCA 4ATNA 1RTJA 1SQEA 2QIFA 3CPWR 1HPZB 4Q8EA 4YY3C 4BC9A 1UVKA 2Y1RI 2IVYA 5BUQA 3VALA 5KT5A 3BSNA 4DF4A 1ZYQA 4NCAA 3FGVA 1F5AA 1H2TZ 2F4VC 4USIA 1O92A 1GX5A 1YJNS 4NPOA 2FD2A 4U67Q 2Q3PA 3AF5A 2C3UA 5BSTA 1TKTB 4L7IA 1WEYA 2BJDA 4OI1A 4F4ZA 2DHAA 1M90T 3M6XA 2IRXA 4CT8A 3OTOC 2UP1A 3BS9A 1TKDA 1S1XA 4UY85 4PKDB 3IS9B 3BGRB 4XDDA 1U49A 2OPLA 2J0XA 4G1QB 5F9NA 2UUCC 2FGOA 5E3PA 1ZPWX 4B3MF 3G7SA 5DLFA 1FEHA 1HWKA 1QSLA 1VQ5S 4LSNA 4X4VA 3NPDA 2BBEA 2RQMA 1NH7A 5KG5A 3R5BA 1Q79A 4DJBA 2RB7A 1YIJS 3HZEA 1KC8T 3WZ0A 3LO3A 3DRRA 3N5BA 4DCUA 2RF2A 2F3JA 2XS5A 2L9NA 3OR1A 1MNEA 4LF6F 2GIQA 5J2NA 1A9NB 3A1YG 3MD3A 4I6AA 1IKXB 3DLGA 3BN4A 4OIXA 1KN6A 3SDEA 1GX6A 5KFUA 2XNRA 1NK4A 2PI4A 1RTIA 4ALZA 2EKYA 3CJ4A 2MSSA 3MF5A 3QGPA 4Y2KA 2W4DA 5U47A 2CJ9A 4EFAC 2RDJA 2FJWA 3HHLA 1D3WA 4A8MP 3DOKA 3A4IA 1ZAXA 5K8MA 3CCVS 4ZHRA 1C2PA 2OKQA 3SI8A 4RBTA 4JI8F 1DLOB 1Y3JA 2HZCA 4ES3A 1HMVA 4M5DA 2VZEA 3JTOA 4KV8A 4WS9A 4ED0A 1D0EA 2L9DA 5DQIA 2DNKA 1NZAA 1YJTA 1YRTA 2M0GB 3NWGA 3BGUA 1E6VA 4WZQA 1O93A 2G0CA 3ZZUA 1TV6A 3QWPA 2BJOA 2N7CA 4DG8A 1QUVA 2CJQA 2RNEA 3FEZA 4ODJA 2GC8A 3MPWA 2ZH7A 4DV4C 4K0KF 2XSFA 4D3HA 1OPZA 4DFMA 5HROA 1XWLA 4CNZA 4RNNA 1DJ0A 1NJWA 1N36C 2RD5C 2YKNB 1V3RA 1P8GA 2I2YA 1P1TA 1H3DA 2OFGX 1U26A 2OMOA 3DU6A 3H98A 1S6PA 1N0UA 1NRKA 3RZAA 2WHOA 3LQVA 4C8MA 5DQHA 1QY7A 3H40A 3MM7A 4IG0A 1Y5NB 4KGMA 3VF0B 2ZHAA 1AFJA 3B78A 1GXUA 1JLAA 4JBCA 1TP7A 4C3KA 1FJ7A 3DLLQ 2FHKA 2AGQA 1VQ4S 3CJKA 1NK8A 4IFYA 3FQLA 5J1NA 3VWSA 1FXRA 1BD6A 3M1VB 3Q2SC 2U1AA 4WFBQ 4DN0A 3NKYA 3IO1A 3KG0A 3CC4S 2KZMA 2GW8A 1NJXA 2VODA 3KLGA 3KK1A 2CQPA 1JWWA 3MWBA 4ES2A 3K2YA 2J76E 5C5JA 3MMCA 3W2VA 5KG7A 1L3SA 2EK1A 3WC2A 3BDEA 1AUDA 1G2EA 3K57A 4IG3A 3CCES 1FD8A 1J5OA 3U1LA 1JX4A 3NNHA 1ZH5A 3QO9A 2NS1B 5CYQA 3OL7A 2Q43A 4ZPCA 3I56S 4DL5A 4FUTA 2B4VA 2ZD1B 3LWLA 4J9LA 1GH8A