3R9WA

Crystal structure of era in complex with mggdpnp and nucleotides 1506-1542 of 16s ribosomal rna
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords GTPase Era
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 101
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3r9wA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9wA01
3CZPA 1G8HA 2V6JA 3BRWD 3NHBA 4F7WA 4LUCA 4BLQA 3VR3A 4LJ5A 1HEIA 2XEXA 4NMMA 1KAGA 5EE1A 1CU1A 2XTNA 5CJ2A 2PMKA 4KO8A 2IWHA 4GKJC 2J41A 2OT3B 4XOIA 3ZVNA 2REXB 3FMPB 4O25A 4TL8A 1KI6A 3AGPA 3N5CA 721PA 4MA4A 4Q5IA 2CMKA 4ZKEA 3FGNA 2GVZC 4F93B 3MLEA 1OXXK 3NBYC 3MAAC 1VTKA 3QNUA 4UNSA 2FEOA 2LKDA 2IS4A 1ZC3A 4DHEA 1KI6B 2YJTD 3M4YA 1LS6A 1KK3A 3DDCA 5LD2B 4K8OA 1T0HB 4URVR 2D74A 2PZFA 3B8HA 2WPDD 4Z1MD 1N0VC 4JKIA 3GJ4A 2FU5C 1QHYA 2E9SA 3KKMA 4AG6A 1W4BA 4P32A 4BRUA 1XTIA 1ZRHA 3RS7A 2V9PA 1U8ZA 3B9QA 4NONA 1IOZA 2W6IA 2XR1A 2ZI6A 4FMDF 4LV8B 5KOYA 2VSFA 5TV2A 3Q5DA 2QG6A 2R44A 2ZS8A 4DLTA 3EIQA 3VKGA 4HEJA 3K8YA 2ERYA 5EXTA 2FWRA 2OCBA 1WB9A 1E2IA 4HZUA 2ZI4A 3BFVA 1CR0A 3QPVA 4BZQA 4JI6C 1KJWA 4NH0A 3VFDA 1KJYA 4LCBA 3UATA 2HCJB 4KODA 4FD2A 1Y3AA 4JSTA 2PX3A 1TTTA 1E9DA 2BMJA 4PC6A 5CK5A 2VO1A 3WMEA 1SVSA 1PA4A 2MSEB 3CF6R 4G01B 2WTUA 1LTQA 1T6NA 4FWTA 2X77A 2WHXA 1F3OA 1OFHA 3K0EA 4DLZA 3GLFA 1X8JA 1HNZC 2A30A 3IILA 2ZVQX 1K8RA 1J5EC 1BH2A 1GSIA 1PJRA 4HDQB 1W5SA 3CF0A 2W6JD 5UKDA 4Q1EA 5LMUC 4PQYA 3QJYA 3BORA 4OQFA 2OV2A 4TMXA 5KPJA 5KHOC 1EWQA 1BMFD 3CF2A 4N3NA 3GLFB 2CL0X 4XTRA 2YWGA 1DARA 4DV5C 1NKTA 3HJNA 3IBYA 2IYLD 4LY6A 4LBVA 2QEQA 3VR1A 3UANA 4TMWA 5DN6D 2X1VA 2GTPA 4UJ5A 4JBYA 2D2FA 3BE4A 4RD0A 1ML8A 2LCFA 1KY2A 3D6TB 1Z63A 2GJ9A 2KI5A 1Z83A 2PCJA 2Q6TA 1L4YA 3GD7A 2ZVPX 4RKFA 3AB3A 2E8EA 2DWOA 4DV2C 4KI0A 3IBGA 1CR1A 2NIPA 2RGNA 3FPAA 2ZRFA 3KFXA 3I4LA 2J1LA 3CNOA 3U6KA 3O8BA 3WHKA 4Z1MA 4YXWD 2WPDA 1LY1A 4TQAA 5FPKA 3P1JA 5TY0A 4DLRA 3MJRA 2RKOA 1P4SA 1G3QA 2XXAA 2IYVA 2ZQ5A 4GZMA 2ZJZA 4KLZA 3IKJA 5B2ZA 5KSOA 3REGA 3GCGA 3GFPA 3EZ7A 1XPRA 4G5SA 3H1TA 5H68A 1IXSB 2P5TB 2QPAA 4RSGA 2XZLA 3GLFE 4Y0AA 4AKHA 3DZ8A 4IHQA 4P33A 4C0BA 1G5PA 4CEHB 3UMRA 1QHNA 4Q7MB 1D9XA 4L9SA 3VR4A 2F1IA 4PC3A 4C0LA 2JLZA 2NQ2C 1G5RA 4GMDA 2K5UA 2WIBA 3KKQA 2JLVA 2CJWB 1AK2A 2FJUA 3EW9A 3JZAA 2BEJA 3EX7C 1GVNB 4XD7D 2J0QA 4ACBA 4DCSA 1Q44A 1NVVQ 4E5UA 3EZ2A 3RSOA 1RYHA 1PUIA 4D4MA 4P31A 3LDAA 1KJZA 2KBEA 2FX3A 4B3CA 1KZGB 3EERA 2JLYA 3BJIC 1ZNYA 2JIZD 4RZXA 2W6JA 2IYWA 2BOVA 3T12A 1AGPA 3ASZA 5TDHA 1BMFA 3H84A 5DISB 3SOPA 2ZROA 4IDHA 1PVOA 2BMEA 2UUCC 1KI3A 4TLEA 5D3MA 2XITA 5DYIA 3ZQJA 1OXTA 4M53A 1GL9B 2X19A 2OUKA 5DN6A 4ZDWA 1GL6A 3MCAA 4A8JB 5K8TA 1C9KA 3BGWA 1GFIA 1MO6A 3EXAA 3Q3JB 1CJUC 4F92B 2VBCA 1OV4A 5D3MB 3BB3A 2P65A 2JATA 1IAQA 4ARZB 1CIPA 1U0JA 3AVUA 2NOAA 3JVUA 1QHGA 1JPJA 2NZJA 4YXWA 3TMKA 1TX4B 3K70B 1R0WA 1ZJ6A 2WWWA 3RRNA 4S35A 1NY5A 2ZAMA 2ZYVX 3CX8A 1N3BA 4AKEA 1OH6A 2VSXA 3IO3A 5BN5A 2Q21A 3QKSA 4E09A 2J59A 1KAOA 1G17A 1NP6A 1W36D 5TXGA 4HAZA 4QBHA 4DSUA 4AK9A 2GK6A 4JS0A 2P6NA 4OHZA 4A6XA 3VR5A 4A15A 4CT4B 2ONFA 1G19A 1YZNA 3EIHA 2FN4A 3SYKA 4B75A 3T1TA 4U02A 3QKSB 4PC7A 3DL0A 1OLOA 1KO7A 4Q1AA 5FPYA 1WF3A 3D8BA 4IEIA 5G41A 3SNHA 3WXMA 4KV9A 3U7FB 4HLUA 1II0A 1E0KA 4LFAC 4XD7A 2QTVB 5SZKB 4PHFA 3REFA 1OYYA 3CZQA 4ZDKA 2A5GA 4GNKA 4M1TA 4EAQA 4AG5A 4DSTA 2OLKA 1KNXA 2EFGA 4IDOA 3SDZA 2F43B 1HUQA 1O3YA 1XEXA 2PMDA 3JZMA 2FMXA 2JIZA 1E96A 4DB2A 5K8UA 2ZRCA 1VMAA 5B57C 4BLOA 2DPXA 4ZIRA 1U2RA 3U3RA 4WW0A 3UXMA 4BFSA 4JLMA 3PUXA 2CCJA 2QP4A 1FMLA 2WJGA 4YY3C 1E4VA 3DHWC 1EX6A 2CEAA 5FR2A 1M34E 1LQLA 4DLYA 1DBSA 4Q9LA 4JBWA 2CXCA 3PG5A 3R7WA 3H86A 1W47A 4D4LA 2EFHB 2G77B 3E1SA 4LHVA 3QBVA 1E9CA 2AWOA 3ZGXA 1FTSA 4Z8YA 4D81A 2NMVA 5GJBA 2DWQA 1USPA 1D2NA 4QGGA 2VP0A 4QBFA 4TYQA 2FDCA 2CVHA 3LBIA 3TH5A 1TL7C 3N2EA 1DELA 4HAVA 5DH9A 3R7WB 2C78A 2GBLA 3SE0A 4DZZA 2O52A 2EWWA 1LF0A 2C9CA 3ND9A 2FOLA 2YC2C 2IUUA 1W0KD 2YV5A 4FCTA 1CKEA 4Q66C 4GOKA 2GETA 3X1ZA 3LY5A 4WOPA 1NMYA 1G6OA 4TN1A 4L9WA 1COWD 5KO2A 4MITA 3RS3A 2O8FA 2BKUA 4AD8A 5JHGB 1YKSA 4QJ4A 1E1QD 3BB1A 4TYNA 4ESVA 2C9OA 1GUAA 4DVGA 3AF4A 4ILEA 5D3QA 2ZRDA 2RHMA 1TQDA 4H1UA 4O2RA 1II9A 3PENA 2CBZA 3PFIA 1W36B 4KITB 1DO2A 5JJIA 4TMKA 2A9KA 2QGNA 4JYCA 3HU3A 2ZETA 4BEBA 5JI2E 3QY0A 3R9IA 4JVLA 1E32A 1GRRA 2IHBA 3C5HA 2YWFA 4M4SA 3RVBA 1GP2A 1FL9A 4DCVA 1DAHA 1KI9A 3C8UA 3GLGB 1MABA 4LF7C 1IBKC 4DRZA 2JJ8A 2WM9B 2CHQA 1PLJA 4IOLA 2ZREA 1P2TA 4D80A 1ZIPA 2HF9A 2QMUA 4GRAA 2XZPA 2VP5A 4UNQA 2ZSDA 3SQXA 2F3TA 2XTMA 3K09C 1EWRA 3QXCA 1GILA 3RS5A 1VG1A 5J4YA 1A2BA 2QTHA 2X8AA 1QDEA 2Q0HA 2VF8A 4II7A 4M9ZA 4NYMR 2WSSD 3B60A 4B43A 2ORWA 1Z6AA 2A5JA 2Y8EA 1VECA 2A5FA 4R2IA 2GZHA 1OH8A 3B6EA 4Q21A 3J81k 2FZLA 3A1VA 1P62B 5B64A 1OXSC 4KYUA 2IUTA 2BJWA 1W0KA 1GWNA 4HDOB 1E9EA 4LGMA 2ATXA 3AVVA 3GLGE 2H5EA 1QVAA 5A2QD 1K0RA 4QHYA 2YZ2A 4PPNA 4CT5A 3J81D 4YMVA 5DI3A 2QRZA 2DFNA 1COWA 4LPSA 3WBJA 1P61B 2ODEA 4B3GA 1E1QA 4DR5C 3LQRA 4FMDB 4F4CA 2XOKD 4TL6A 1NBMD 4OX9C 2W83A 3W9YA 1FX0A 1ETUA 3RRMA 1AKYA 3E70C 2W00A 4OI1A 2O8DA 1OB2A 5IT9D 4BFYA 1CRQA 2ZE6A 4R9UC 4DLWA 4A6PA 1JAHA 2TMKA 3P26A 4EIWA 5LPNA 2WKQA 2XNDD 2FPLA 4I81A 2OPLB 4LF4C 1XDBA 1XP8A 1EG7A 2JLXA 5FPTA 1QWIA 4PHHA 1J99A 4IEEA 5CDFA 4B2PA 4POAA 1FQKA 4KCGA 3ZVMA 4LX0A 2PT5A 5C2JB 2WWHA 5FBWB 4HUQA 3CO5A 1XFAA 2DYJA 4HB2A 4UNRA 2IYYA 2GDJA 2JASA 5FH9A 1E9BA 3VX3A 4DV3C 2XB4A 3MUFA 4U00A 3K0AA 3LRPA 2BMDA 1Z06A 2F6RA 4Q4LA 2C5LA 1ZVQA 1P2VA 2NG1A 3AP1A 4TLAA 2GEDA 4HZIA 4MYCA 4P4SB 4DB4A 2ZJBA 3CWZA 4EJSC 4QHSA 3K0AB 1TEXA 2WSSA 2V6IA 4LHXA 4FWIB 4M9SA 4X8LA 1XEWX 5A0FA 2DCUA 2PBRA 3VMFA 4X65C 1RRGA 2BM0A 4C0QC 2H1LA 2WKPA 1WE2A 2J45A 3IQWA 4B3FX 1AIPA 2QE7D 1IN4A 2OAQ1 5FOTA 4C0SA 4RCYA 2OEPA 4UXJA 1W44A 2ZI3A 2DFKB 2ONKA 4V0LA 4EPXA 2J5XA 2P5SA 3U5ZB 1Z08A 4B6EA 2N46A 3PEYA 2H16A 4ASUD 5G3YA 4RD6A 1AZTA 1IN6A 1NJGA 4JLKA 1N0UA 4Q9HA 5CITA 5CDFE 5H1YA 5FBRB 2IYTA 1SVLA 4XSGA 3WNBA 3QXJA 5CK4A 3SYLA 4HDCA 2XOKA 3NTUA 1NBMA 3T61A 2BBOA 1E2DA 2JGNA 3ZD7A 3U61B 3LA6A 1C1YA 4LV6A 4B73A 4KVAA 2VHCA 3NIBA 2QZ4A 2VRWA 4W5HA 1Z5ZA 3WYGA 1PZNA 1S3SA 4OHWA 3DEFA 4YQFA 1DVRA 1E9AA 5EJEA 2FE4A 2VHJA 2XNDA 4Q4AA 2O8BA 3GEEA 1N5LA 2VF7A 3FMIA 2VQFC 2IYXA 2ZI9A 1F2TA 2ZR0A 1XZQA 2JCSA 3H0KA 1S96A 1XPOA 3SJBA 621PA 3W8NA 2QMOA 2REBA 2XTZA 2GXQA 1SXJB 4YMSA 4K46A 3RWMB 4DEXA 3CB4A 3G0HA 4GBMA 4KFRA 2HT6A 4DLUA 1F2TB 8OHMA 5JS7A 2IS6A 1MO5A 2AXNA 1S0UA 2ZJOA 1Q22A 1N6KA 3AH8A 4HI0E 4IW3B 4JYBA 3SQWA 1Z0FA 2ZRPA 2ZU6A 1BIFA 3AEZA 2J0SA 1E69A 4NP6A 2ODWA 1R8SA 2ZS7A 4GP6A 2R6FA 4RZ2A 5BXQC 1FMJA 2CL7X 4A2PA 1Z0DA 2D06A 4BLTA 5BR8C 3AVXA 2VP4A 3UG7A 5AWFC 4XH9B 2ZE8A 3WYFA 4I4LA 1DO0A 1T3LA 3PJRA 1AJEA 3TUJC 1HE8B 1NBME 1I94C 1VCMA 1IBRA 2IF2A 2QE7A 3KJEA 2GESA 2PCLA 4ZI3A 3THYB 4ITRC 3KJGA 4IFBA 4KHZA 4CGZA 1OXVA 4B3MC 3ADKA 3F8TA 4ASUA 2P6RA 2O8CA 1HH4A 3HU2A 4XJXA 4LF5C 3QKRA 1A4RA 3VAAA 5AUOB 1RRPA 1XXHA 1E2LA 4OJQA 2BVNA 4Q00A 2OBLA 1QG2A 3GQBA 2GZAA 3QKUA 3OF5A 2OE2A 4NPHA 4OK6A 3ASYA 1JECA 3RYTC 2O5VA 5HKKD 1CF4A 3SEAA 2HCBA 2GZDA 4A92A 4NOZA 1M7GA 4PQRA 4URUR 4B74A 2JMPA 1FNMA 3QVUA 4CVNA 4RCZA 4M1YA 4GOXA 1UADA 5HR5A 1N6NA 5JS8A 3SS8A 3C5CA 4H1VA 4LFCC 1LV7A 4I1SA 4B47A 3I62A 3NEYA 3R8FA 1MO3A 4C2UA 1ZUNB 2QM8A 1E98A 4WZBE 4EFNA 1J70A 1XRJA 2ATWA 1AGRA 4HAXA 4ZDJA 4DCUA 1EFUA 2OBMA 4FMBB 4E03A 3GLIA 4L15A 1KMHB 3TVDA 3C16C 4ABYA 3AVTA 3DOEA 1WDTA 2ORVA 2X2EA 1Z0IA 3FMOB 4HAYA 4JIMA 5BYJA 2GVDC 2OO7A 4G0NA 1YHNA 4DJTA 3U2QA 4UKDA 4B2IA 1Q3TA 2YWHA 5F9FA 2AFHE 1CEEA 2OFXA 4BLPA 4BLSA 2F3RA 2IT1A 2ZXUA 2D62A 3I3SR 1T0JB 2GXAA 5AJVB 3I8SA 4JSYA 1OSNA 3RANA 4NKRA 4B6FA 3M6AA 5FPSA 3U3JA 2CL6X 1XXHE 2ZRNA 3OHMA 1N6PA 2DBYA 1N6IA 4KLNA 4NHOA 4KSCA 4TLBA 3AV0B 1UKVY 4C0AC 5A5GA 4ZI2A 2CK3D 1ODFA 2O8EA 2E1RA 4NL4H 2ZRAA 3IHWA 5IF9A 1E6CA 5CB8A 3K0CA 1XNQC 3PEUA 3L8YA 4LHYA 3CNLA 2RGNC 1ZU4A 3HYRA 1UPTA 2RGDA 1L2FA 3DVLA 2OAP1 4O3MA 1YR8A 2FA9A 2Z0MA 2O8EB 5L8VA 1X1SA 3DM9B 1DAMA 1NSFA 2VSOA 2QSZA 1DOAA 1FP6A 4US1R 5E4FA 2WMNB 1UKYA 5C1BA 1KSGA 5HCNA 4AURA 1G3IA 3I92A 2YOGA 5L3QB 1RZ3A 2DR3A 1JNYA 5HKKA 4PANA 1T3SA 2QP9X 3GLIE 1WRBA 2FFAA 1YRBA 1OH5A 5JSZB 1G3MA 4UJ3A 3KQKA 1OYWA 1ZP6A 2EU8A 1L4UA 3CRRA 4LJ4A 2QBYB 3V4FA 3W5JA 2ZJAA 1OF1A 4JLOA 3B9PA 2YINC 2VHQA 2BHRA 2QN6A 3KKNA 4MRPA 4Q7KA 1VG0B 4D82A 1VHTA 5KSZA 2Z83A 3IIMA 1G41A 3A4LA 1I2DA 3ZVLA 3GLHA 1E4YA 1R0XA 1W4CA 2EFCB 2IA5A 2KBFA 4URZR 5KDOA 1XTJA 4QJ5A 3AF5A 1LNZA 2IEZA 3X1XA 1SHKA 2MSDB 4FI3C 4BZPA 4TTQA 1TAGA 2Q9CA 1XEWY 2ZRHA 4HAUA 2D3WA 3GLHB 4L8GA 3PQCA 3CIOA 1YJ5A 1Q1EA 2IYSA 1KDTA 2CVFA 3VHXA 3ZS9A 2JJ2D 2YWEA 3ZQ6A 3ICEA 4NYJQ 1BKDR 2UKDA 1B0UA 1FOEB 2QNRA 1VCNA 4C30A 5FI1B 2CK3A 3K70C 2B92A 4BPBA 2UZ3A 4R98A 1Z3IX 4IOJA 2JLRA 4M1MA 3PUYA 1YZKA 2OLJA 4F38A 2ZIAA 1P73A 3GJ7A 3W34A 4ZKDA 5AJXA 1NVWQ 1E2EA 1ZU5A 2SHKA 3OZXA 2ZM5A 4M1SA 3FHTA 3FTQA 3QPUA 2HT1A 1G4UR 4XWKA 1UKKA 1U81A 3AVWA 2ZEJA 4LF6C 2IUSA 4JLDA 4DCTA 4OYHA 2CLDX 4RD2A 2ASBA 1W4RA 3IPXA 4I1OA 2GRJA 1M74A 1XU4A 1HE1C 2OFOA 2W2TA 3OE7D 4PPGA 3GLHE 1HQCA 4LJ7A 3QPWA 4BRWA 4OQMA 2I3BA 2RHDA 2A78A 4LI0A 2BV3A 4HB4A 4MKHA 4DBLC 2PL3A 3MWJA 4AYTA 5KNBA 1OB5A 4IOMA 3LLMA 3LX8A 2IXFA 2IYRA 3P4XA 2QMHA 1HYQA 4LPKA 1FFHA 1ZM2A 4EPRA 3KUCA 1UDWA 4HLCA 1ZNWA 2WMOB 3MFYA 2ZJ2A 1D9ZA 3PIRA 3K9GA 4JL6A 1KMQA 1ZIOA 4HLUC 2QORA 4JVSB 2AX4A 4ZCMA 1DAGA 3K70D 1HURA 4G3XA 3B13B 2R65A 4CRWB 4PTLA 1Z0KA 3LBNA 2O0HA 3DO6A 4DUGD 1GKYA 4A36A 5AUNB 1CR4A 3QUSA 4QOSA 1DG3A 3LFUA 1R4AA 4M22A 4Q47A 3TSOA 4O2LA 4KJZA 4C0JA 5CLQA 4ZCLA 4CEHA 3THOA 1ZUIA 1KNQA 4PZYA 1HNWC 1NN3A 4AYWA 1K6MA 2GAOA 1U0HC 1MT0A 2CJWA 2JJ2A 2R2AA 1XCPA 2IHYA 2HF8A 4TWZA 2LKCA 4O0MA 1XTKA 3ZH9B 1XD9A 2JJ1D 2GNOA 4TTPA 5FPHA 1AA9A 3VR2A 5JWOA 5B30A 1WQ1R 2P2LA 2XAUA 3Q8XB 4NYIR 3FHCB 1R5BA 1O87A 1XNRC 3S1AB 1XJ0A 3WY9A 1N2FA 2RCNA 1VCIA 4BWYA 2ANCA 4FMCF 3TUIC 1M7BA 2BIFA 1UDXA 3BH7A 1GM5A 2DB3A 3IUYA 3HPQA 2ECKA 4CDGA 5KDDA 5FBVB 4QBIA 4FCVA 2VTKA 2AN9A 3DKVA 1KI1A 1XMQC 2GBLC 3CONA 2HEIA 1DAFA 1KDOA 4QGFA 3TKLA 1GDDA 1ZCAA 2FPMA 2QQ0A 2N42A 5GADl 1Q1QA 4JT2A 1E9FA 2OHFA 2XZOA 3BH6A 5KNDA 1MOZA 2GJAA 3T1QA 1G8YA 3TGPA 2QT0A 1P72A 1XJCA 3OE7A 2G3YA 2DFTA 4A8JA 5KSYA 4PAQA 1W36C 4X8HA 3D7MA 3KQLA 3MGCA 4HATA 1JXOA 2LWIA 1JR3D 4NU0A 4GFDA 5JI3E 4H9GA 4QG7A 1G3RA 1MRNA 3WHLA 1K5DA 1ONBA 4ARZA 1AS2A 1LS1A 4MRNA 2IYZA 3HWSA 1CR2A 1GTVA 2YNMA 3NVAA 4M21A 5KSPA 1CBUA 1G20E 3NH6A 5HZHA 4K0KC 4Q9IA 3IDQA 3RHFA 4A2QA 4MGYR 3QOFA 3BXZA 3NC0C 2Z4RA 4KVGA 2JA1A 2N1BA 1HTWA 2C2HA 4DUGA 1QHHA 1ZYUA 1Q3HA 4DDVA 3IQXA 1XMVA 3A36A 4M9QA 3LVRE 1E0SA 1U8YA 1UAAA 5G3ZA 2VEDA 2ZTSA 4Y0VA 5FOVA 1CXZA 2VYFA 1ZNXA 2R6AA 3HYTA 3Q5EA 2RGGA 3FMFA 4L5BA 4IDNA 4Q19A 1QHHB 4MH4A 221PA 3KX2A 4M0LA 4B33A 3EPJA 4LJ6A 1QZXA 5K8LA 2B8TA 5DHFA 1PV4A 4RD1A 2FFQA 1EFCA 1A82A 2JJ1A 3K1JA 4TMZA 4DC9A 5EP3A 2B7CA 4MYTA 2ZRBA 1QHXA 1XCGB 1FNNA 2NO9A 3A4NA 3EZ9A 2BDTA 3ZZ0A 2VP9A 4B3RC 1NLFA 1ESNA 2GXSA 5LBIA 3Q7PA 2QMEA 2WJHA 1X8KA 3VHLB 1P9RA 2F43A 5SZHB 1NVUQ 3L8ZA 4KU4A 4QC2A 3R8CA 4N0DA 2B8WA 3T1OA 4GDFA 4W5WA 1R6BX 3IPYA 5DE3A 2GJSA 4F4IA 1EFTA 4XTCS 1VYTA 2ZJ8A 1VG8A 1ZW6A 2HYDA 2AWNA 1VYUA 1DPFA 2GHIA 3A1UA 3F0TA 4LBYA 4C7OB 1MRSA 5SZIA 4AY2A 4D25A 5GJCA 2A5YB 4TMVA 4R71A 2AR7A 2WWIA 3NC1C 3I07A 3HR8A 1DEKA 4ZCIA 5KTYA 4QL3A 1HA3A 1Q1BA 5ANRB 1N5IA 2BJVA 5C46F 1W4AA 1JR3A 4A82A 2OM2A 1PLKA 3W6NA 3NXSA 3QF7A 1IN8A 2V54A 2E87A 3N2IA 2HLDD 2ORIA 1ANKA 3SC3A 4DSOA 5P21A 1UBFA 5TB5A 3ZLJA 1W46A 5F9HA 4IXNA 3EZ6A 4QFMA 1Z47A 4DV4C 4U7DA 2UVQA 3AF6A 4V03A 1T8TA 4Q4JB 5AJZA 1NMZA 2JLSA 4PAOA 5EE5B 4Z8XA 1AN0A 3MJHA 4JLVA 3K0FB 1QHIA 2G0TA 1X8LA 3QENA 3TRFA 3VKHA 1F5NA 3KJIA 1CLUA 1P2SA 1UBEA 4I1VA 3I5YA 2PEZA 1NRJB 1WBDA 4MRSA 3PCRB 2OZEA 5JMTA 2ZSFA 4YDHB 2J0VA 3TR0A 3EG5A 3HPRA 4KFSA 4X8OA 5F3WB 3EC2A 1QVRA 1RJ9B 5JJLA 3EIEA 2X2FA 2BBWA 2ZRLA 3K53A 1OIVA 1TUEA 4JI8C 3L0PA 3MWYW 3C15C 1NF3A 4GI7A 3NWJA 2ZS9A 4JBXA 2CLSA 1UJ2A 2GF0A 2Q9AA 3GLGA 3GKUA 4YDSA 2V4ZA 4WAUA 3U3KA 3RNLA 3FKQA 3SJZA 2D7VA 4TL9A 1JR3E 2XGJA 4PHTA 1QG4A 1P2UA 3CKLA 4RJLA 1EFHA 4KHPC 1Y63A 2ZYUX 4XVQA 3NG1A 2WWXA 4XX2A 1KO8A 3T34A 2ZRJA 2E7GA 1KOFA 2EYQA 2PT7A 4EPVA 5DNYB 2AD5A 3A1WA 2F1RA 4A4DA 1F2UA 1GZSA 1LF5A 3H2YA 2G6BA 2ZRKA 4EKDA 1N6OA 5JZVA 2IX3A 4XWAA 3P4YA 3U7HB 1TU3A 4B3TC 3CW2A 5J4LA 1VIAA 4OQXA 521PA 2ANBA 2G88A 3JVVA 3CR7A 2HUPA 421PA 3AVYA 1G1MA 2HLDA 1F2UB 5JWHA 4A9AA 3U60B 5EE9A 2FGJA 4TZ0A 1GNRA 1XMOC 3QG5A 1KSHA 1FZQA 1NSTA 1XCMA 3GEHA 1AKEA 2V55B 2P6UA 3NKVA 5J5CA 1KSFX 4QBGB 4BE7B 1P60A 2FFHA 2PLRA 2REOA 5CIQA 2P67A 4LZZA 3CLVA 3MD0A 1M7HA 2GKSA 5DLQC 2HHHC 3KXLA 1NY6A 4JI3C 3N70A 2F4VC 4QGAA 5E7IA 3UWOA 2F9LA 5JWRA 4J0QA 1A5TA 4L16A 4AYXA 3PEWA 2DHRA 4MQBA 1G16A 3F3YA 2H57A 1SKQA 3LWNA 2J0UA 2QL8A 3FE2A 4M1KA 3RS0A 2OPLA 4FXPA 3LNCA 3ZZTA 2EW1A 4AKIA 2KWIA 1BYUA 5L3SA 3L0SA 2GF9A 3PUZA 1EK0A 1ZM3A 1E3MA 1SGWA 2A5DA 1N6RA 2F7SA 2W2VA 4I99A 2J0UB 1IY2A 2B6HA 3V00A 4BUJA 2QTFA 1DAEA 1P9WA 1UBGA 1HR0C 3CH5A 3Q72A 3VX4A 1HH2P 1SXJD 1MKYA 4DUYC 5L3SB 1XD8A 3IIKA 4LF8C 4RY2A 4LJAA 3B1YA 4HSEA 3ETLA 3QE0A 4AI6A 3IEUA 4JL8A 2QRNA 2OG2A 2WVJA 1GNQA 3OEED 4P4SA 4Q1BA 4JI5C 2DWPA 1LVGA 2QA5A 4PC2A 1OE0A 1J8YF 4LSGA 2EYUA 3TW4A 4Q4HA 5EZ5A 5J4VA 2GAAA 4P4UA 1G7CA 3VU9B 2ATVA 3QG1A 1HQYE 3FHOA 3ZZUA 3EASA 2BBTA 4QNMA 3EC1A 1GKIA 3FFBA 5BYKA 2J9RA 3SZRA 4XVUA 5FL7A 3UG6A 4PSVA 1U9IA 2E8FA 4DR6C 4Q4HB 1HT1E 2PT7G 1IXRC 1WP9A 1N5KA 2CCGA 3CJEA 5FUYA 3A6PC 2WWYA 3C4JA 1J8MF 1FUKA 3FVQA 2PZEA 3AKDA 5BWMA 2C95A 5IWAC 4YMUA 3MMPA 2V8OA 3W8RA 1GAJA 3BIFA 4P3YA 2D4HA 4JI4C 3LQQA 5JSZA 4MKIA 1W48A 4TQ9A 2DYKA 3KUDA 2QAGB 2A3RA 3OIWA 4Q1CA 4G5QA 3THWB 3A37A 3M1IA 3U7GA 1E9SA 3V9PA 1TF5A 1NYEA 4NXNC 3LAWA 1ZBDA 4W7SA 1ZD9A 4NZYA 1P7CA 1JQJC 4PR0A 1NIPA 1CJKC 1ZCBA 3X1YA 1XTSA 3DM5A 1KKLA 1SKYB 1VG9B 1XJQA 1IBLC 5IT5A 2EWVA 4CEJB 1L8QA 4UNPA 2IXGA 4Q03A 2MSCB 1IM2A 1SXJA 1BYIA 4FMCB 5CM8B 4A1FA 1OFIA 1IJFA 3U3OA 3SU8A 3QEOA 4KXFB 2PJZA 3CPHA 1NVXQ 3K0CC 1Z0AA 5EQTA 3AF3A 2FPKA 3OEHD 4MKFA 1DAKA 2BJOA 5JRZA 1RYFA 1UM8A 4PO1A 1US8A 4GP7A 2C04A 4BLRA 1KZ7B 4RFSB 3OEEA 1N0WA 1U98A 2P0EA 2QUZA 2UXDC 1AS3A 2VQEC 5CYOA 3O8CA 2BWJA 4A0FA 1JXMA 1XTRA 1NNEA 2AD1A 3AUYA 1T3HA 4DXAA 5GVRA 1NG1A 1US8B 3TSZA 4KAXA 4OBEA 1OJLA 4IJMA 4X66C 5KUTA 3L0OA 1W7AA 2BEKA 1PLLA 4DIDA 4ERNA 1CS4C 3THYA 5JEEA 2C9YA 2WBLC 4LYFA 2HXYA 3LH5A 2V1XA 5LD2C 1IQPA 2VP6A 1TU4A 4KSBA 5E95A 1TF7A 3B1ZA 2YKGA 4RZ3A 1S1MA 1XEFA 3WYAA 4FINA 2PN2A 4N0EA 3CH4B 3U44B 4GZLA 5FTNA 1KHTA 4LOAA 4JZKA 1WH9A 3GFOA 3KXIA 1FUUA 5HE8A 4DKXA 2G1JA 3PUVA 4TMTA 2QGZA 1AZSC 2WOOA 2XNSA 5EZ6B 3UPUA 3U4QB 3TJZA 3ZJYA 5HZKA 1RRCA 4B71A 5C4MA 5HTKA 5FTMA 2H8KA 5DGXA 2E8CA 1Z6XA 5DI9A 1E2HA 4QHTA 1SXJE 2J7KA 3GJ0A 3WMGA 2I4IA 4URWR 3WP0A 5C18A 4DSNA 4KFTA 1N5JA 4F91B 2GILA 6Q21A 1Z22A 3I72A 1KY3A 3OESA 3R9WA 1AQYA 1YZQA 2R6CA 2V3CC 2QQEA 1E2QA 3BH0A 4PQFA 4JV5C 2AXPA 3B1XA 4NYMQ 4DT1A 1EFRD 3RDPA 4A2WA 2DY1A 2CE2X 2IBMA 4HAWA 1KI8A 1KMHA 3L0IB 1E0AA 1SVKA 3ZVRA 2QPTA 1G64A 1Q12A 3NHAA 5DYGA 3PR1A 3GJXC 4BFZA 2QENA 4M9XA 1IXZA 3OEHA 3EA5A 3GEIA 3OFND 5FFMA 4DT1B 4LYAA 5AJYA 1Q0UA 5M04A 1RVDA 3AKEA 1BS1A 3DOFA 2EQBA 1JJ7A 2CHVA 1YR6A 5CJPA 4WZ6A 3AKCA 3GP8A 3WRXC 1VHLA 3T1VA 1TEVA 4M1OA 2RMKA 4OHVA 2ZR7A 5FTKA 3KJHA 4LF9C 5FTLA 3OIUA 2W2XA 5BW8A 3DKPA 2VHUA 1NVVR 3SHWA 1OH7A 2WZQA 3QF4B 2WJVA 4MKGA 4B34A 3EWAA 3P27A 3LXXA 4C0KA 1F6BA 3O47A 3B1VA 1LB1B 1TUIA 1I2MA 4DCNA 1Z2AA 5FL3A 3KDSE 4B48A 3ADBA 3X1WA 1G9XA 1NJFA 4DV1C 3GMTA 4QNRA 2RGXA 3IGFA 4RD3A 1V43A 2CNWD 3TQCA 2NTYC 3MWKA 5L3QA 4MGIR 1BOFA 1RRFA 1YE8A 4BFUA 1ZM7A 4D0GA 4HLDA 2KZFA 2EFDB 2D7DA 1T5LA 1U0LA 2L0XA 3AF1A 5FOWA 1GIAA 4YMWA 1NLYA 2R6GA 4PAMA 1V5WA 3SHFA 1RW4A 2QBYA 2JDID 2WAXA 3LW7A 4B3SC 3TVTA 4AQYC 5CB6A 1G5TA 2J46A 1KYIA 3B1WA 4M1WA 1JAIA 4K81B 5B58C 3TR5A 1ZM9A 4IVPA 2AL7A 5KDLA 5JHHB 1WXQA 1RFLA 1FQJA 3L2OB 1EFRA 1KK2A 1XMIA 1VCOA 3NBFA 3D31A 4TQUS 3EPLA 3BAFA 2ZUBA 1KDPA 3KTAB 2RB4A 3X1DA 4LFBC 2WIAA 4CF7A 4BZXA 1W5TA 2YCBA 3K0SA 1GITA 3RRYA 3LXRA 1N36C 4G5OA 4JL5A 3MSXA 5H8WA 3OFNA 3FFAA 2HDNB 3UMFA 1TQ2A 4X62C 1YZGA 4TTRA 2OSBA 4MTNA 1E2JA 1WA5A 3IEVA 2VL7A 5DHAA 1G8FA 1Z6TA 1G291 3C41J 4RZUA 4B35A 2BC9A 4BECA 3TLXA 4QM7A 4KBGA 1M8PA 2WWGA 1H8HD 1TMKA 2GCPA 1UBCA 2KSQA 4ON9A 5H70A 1H65A 1VPLA 4A8JC 3EWSA 1G18A 5L3VA 1XF9A 1F60A 4TYYA 1NKSA 5EXSA 1OPXA 1OIXA 2PJRA 2WOJA 1U94A 5E3HA 3DPUA 4NCJA 5BQ5A 2QROA 2QI9C 4D0NA 3ZD6A 4PPQA 1VLAA 4CW7A 3GFTA 4D0LB 2G9NA 2VHTA 3CRVA 2C99A 2V7QD 5EE0A 1KDRA 1RPZA 3RS2A 4RD4A 2NO0A 4TT3D 2PH1A 3KB1A 2YOFA 1IBMC 1JB1A 1GKUB 1J90A 2QPOA 3W5IA 4DV6C 2CNWA 1XZPA 1NL3A 1JALA 1YZLA 3EAQA 4JJZA 1X3SA 4A0HA 3LVQE 5JECA 1TQ6A 3SFZA 4P0TA 1SULA 2QAJA 4G5RA 3Q85A 2CLCX 1BO6A 2OCYC 4FN5A 4TYWA 2CY1A 1XMSA 1RE0A 2VQSA 4BGDA 4ZPXA 5J4KA 4L4UA 4JI7C 2JDIA 3R20A 1T8UA 4EUNA 1OFUX 3QIAA 2FSFA 4WA7A 2Z6VA 2ZU0C 4Q02A 1S4QA 4OKSA 3VR6A 4HZUB 3TK1A 1G6HA 1G3UA 3NH9A 3D3QA 4Z51A 4ZDIA 1E2FA 1YR9A 2VPPA 3L43A 1EX7A 2C77A 3AKYA 5E7JA 1SVWA 3NDPA 3H4MA 3T15A 5LMNC 2AFIE 1XWIA 1D5CA 4EDHA 3B7GA 3HR7A 3BK7A 1SVMA 4G5GA 5CLLA 5K8IA 1QBKC 2F1JA 3CRW1 2OBNA 1IHUA 3EA0A 1S8FA 4TLCA 5CYPA 4EPTA 3TNFA 1W49A 5IRCD 4Q18A 3C7KA 4TLDA 4WVFA 4TSFD 1Q1ZA 2R8RA 2AK3A 1W2GA 1H8HA 1R7RA 1GRQA 5DO9A 1YVDA 4EPWA 4OI2A 4YLGA 2HJVA 1JBKA 2YYZA 2XJ4A 1GL7A 3S1AA 3CRMA 1QRAA 4RVCA 2YC4C 4QM6A 1XMJA 1VDZA 1LFDB 3QXHA 3ADCA 2FNAA 2ZE5A 2EGTA 1C4OA 5FBQB 1G7SA 4BQSA 3CWQA 1N32C 2ZRIA 2NO6A 5EE3A 3J80D 3KXKA 4QGHA 1FTNA 2V7QA 2FH5B 4R2HA 3QQ5A 2ONJA 5AUQA 4NBSA 4TT3A 1XB2A 2RGEA 3SJCA 4PHGA 4DR4C 3RC8A 2CHGA 1E79D 1YRAA 4D26A 3ZIAD 1Z07A 1E2PA 1TPZA 2ZR9A 2FG5A 3EARA 1KGDA 4PSKA 1WMSA 3PITA 4IDQA 4Q48A 1G7RA 1TF2A 1ZAKA 2YVUA 1N34C 2HYIC 1HT2E 2XXAB 1S1CA 3PXGA 3ICQB 1UEJA 1S9HA 4NXMC 3AVQA 3SFVA 2AKYA 1E2MA 1R10A 2G1KA 2RGCA 1FP7A 3OIYA 3SI7A 1KO1A 1I4DD 4RKEA 3SN6A 3VQTA 3A8TA 3RS4A 3WNCA 3OIVA 4NE2A 2JLQA 5JEDA 1UF9A 4WXPA 1VIYA 2WJJA 4IKEA 5EUMA 4KFUA 3Q7QA 3TAHA 5JCZA 3W90A 2IC5A 4JYAC 2B7BA 1P6XA 1Z6GA 2NPIA 1CULC 4X64C 3BWDD 2NGRA 1X6VA 5BN4A 5JJKA 1XTQA 4GT1A 4MUBA 5JCPA 5BN3A 2YHSA 2ZYTX 1ZC4A 5J40A 3I1FA 1JEEA 3PVSA 4N1AA 3WMFA 1Z6YA 1XBTA 3AUXA 3FWYA 4V0NA 1P75A 5FTJA 3SR0A 4EPYA 3K9LA 4TSFA 3LO5A 3VTKA 1N33C 2GEUA 5LB2A 3SBEA 4Q9KA 1Q21A 3VKWA 2ZSBA 3FYHA 3AF2A 4LC1A 1H8ED 4YONB 3UIEA 2ZAOA 2CXXA 1GOTA 3CRQA 4B76A 3AGQA 1E1RD 4MUAA 3BOSA 1UEIA 2NO7A 4EFMA 2XX3A 2Z4SA 3SBDA 1YZTA 1IJEA 4NCHA 5FBLB 1ZB8A 3QKTA 3RABA 2QU8A 5ELXA 2EVWX 1R0YA 1VYVA 2ZRGA 2XSZD 4Q7LA 3TUZC 1OFTA 4LWZA 5FOSA 4I1UA 4EQ6A 4LJ9A 2WWFA 4CYMA 5AUPB 1SVOA 4LHZA 1XX6A 1S3GA 2IXEA 3CUEF 3KQUA 4D4JA 4DR2C 1ZNZA 4C7OA 4MGKR 4PXAA 1I4TD 3B82A 4UQOA 3FOZA 1E79A 3DMNA 4EQ6B 3GPLA 1M6NA 5E7MA 4D6PA 2O0JA 2QSYA 3HP1A 3ZIAA 2AHOA 1KIMA 3T5DA 2VIIA 1CRPA 3MRSA 1W2HA 4HB3A 4XSHA 1IY0A 1T5IA 2Z5FA 3E2IA 4V0MA 2UXCC 2BCJQ 3CX6A 3GJ5A 4DLXA 3PEVA 4YMTA 4Q7JB 2OESA 5JFGA 1CJTC 1E99A 2HJGA 1I4LD 1N6HA 3QEJA 1EXMA 1ZD1A 2R9VA 2AKAB 3KZ1E 4LYHA 4MYHA 4BFWA 1JI0A 3AF0A 3QXXA 4WXRA 3ZYCA 1K5GA 3FKSD 3RLFA 1J2JA 5JLJA 2J3EA 3CNNA 4MDFA 2BMFA 1YR7A 2QL6A 5AJWA 3LD9A 3RC3A 3SJAA 2FEMA 1G21E 2J87A 4Q4JA 3U7EB 4JT4A 3BC1A 3TE6A 2OCAA 3K0FA 2QT1A 4B3XA 4DV0C 1IY1A 1U99A 2JEOA 1KI2A 3I8XA 4LJ8A 4XIGS 5LB4A 2WJIA 2QP3A 5JBQA 4KYIB 1GRNA 4OK3A 4GSYA 1XEXB 2KJQA 1RJ9A 2OXRA 4GMXA 3KKOA 5CIWA 1GG2A 5KNCA 3ZS8A 2IYQA 1KKMA 4Q1DA 4UNNA 1OIWA 3K9HA 4V02A 4DDTA 1H8EA 4ZIRB 1CTQA 2F1HA 3Q9LA 1E1RA 1MO4A 3MG9A 1D6JA 1JR6A 2NO1A 4QXAA 2WSMA 1D2MA 1X1RA 4PFSA 4B44A 5IDVA 3T1YC 3THXA 3LUSA 4V0ME 2XSZA 3P20A 4PSAA 2FSIA 5DSZA 1OHHD 1S2MA 1D2EA 2PEYA 3KL4A 2GJ8A 2ZSEA 1YZUA 1U9IC 2B21A 3ND8A 1USPB 1ESMA 121PA 1U8AA 5HPYB 3THXB 2W0MA 1KSJA 3LLUA 3WRYC 4DV7C 2QAGC 1R5OA 4URYR 2OCPA 4NCKA 1T9HA 1SHZA 4MH0R 4R7ZA 1Z0JA 4TYPA 1KI7A 3IO5A 5JRJA 3CM0A 2YOHA 2IWRA 2ZYWX 4Q9JA 4WIAA 4V0OA 1UFQA 1VKJA 5DIFA 2ZRMA 4JVMA 3RAPR 4M2LA 3IIJA 1ZMXA 3TBKA 4ZV4A 3ECCA 4PX9A 3TSWA 2D7CA 3FDIA 3MWLA 1A1VA 4A0GA 1N6LA 2F9MA 3M0EA 4JI0C 821PA 1DE0A 2O8FB 3FKSA 2OXCA 4OK5A 4B3DA 1JOSA 1A7JA 5FR1A 5G40A 1B23P 4BEJA 2GCNA 2BM1A 4DR7C 1GNPA 1TNDA 1YU9A 1OT3A 2FZ4A 2H18A 4JMPA 4W9MC 4NYIQ 3LV8A 2PZGA 2ZM6C 2RH5A 5FL7D 1S9DA 2VA8A 2FFBA 4QRHA 1FPMA 4KBFA 1IN7A 3A1SA 2WKRA 4OJKA 3JAMD 1HNXC 4YHHC 4XVRA 3RWOA 1SXJC 2Q3HA 3RRZA 1NG9A 2FV8A 1Z2CA 5L3RA 3QXSA 3BB4A 2RGAA 1MABB 5KYKA 1SVIA 1ZD8A 4DR1C 4IFEA 4PO9A 2IK8A 4JI2C 3K9NA 3PV0A 1AS0A 4NTZA 4D2IA 3V4RA 1A2KC 4IVQA 4UXHA 5F98A 1ZM4A 4LYJA 3TAUA 5J4HA 1D8TA 4Q01A 5GJWC 4IRUB 4NCIA 2WJYA 1MV5A 1DAIA 1P5ZB 4DUZC 1M1YE 4AIIA 4WBSA 1CP2A 1YQTA 2ZI7A 2ZSAA 2Q3FA 4MRVA 3AP2A 1OHHA 4FCWA 4DWJA 1P9NA 3AVPA 5HE9A 3ADDA 1W0JD 4G1UC 2WAYA 2NPFA 1DS6A 4AC9A 2QM7A 2FGKA 1T4GA 2V1UA 4JLAA 1IN5A 2P3SA 1QF9A 2G83A 4NDZA 4BFTA 3X2SA 3W6PA 4Z54A 3TW8B 5FOXA 4YC7A 2H92A 4GKKC 1JJVA 2UZIR 3NEJA 3T35A 4RFVA 3VU9A 2ZE7A 4MGZR 4US2R 5DI3B 3T5GA 3KKPA 2F55A 3CPJB 3BERA 3RSLA 4IOKA 4E07A 3A58B 3GJ8A 4LDJA 3U3MA 1FX0B 3T1HC 4OI0A 2ERXA 2O8DB 1L7VC 4GOJA 4D4KA 1QHSA 4DLSA 2UUBC 1KK1A 2I1QA 1PUJA 4U5XA 4W5JA 3W3ZB 2IW3A 3AP3A 4OI4A 1ELOA 1N2CE 3BFKA 1MH1A 1JPNA 3C14C 3KB2A 3AVOA 1N25A 1ZINA 4X8MA 2QAGA 2QY9A 1KO4A 2R6DA 3THWA 2W58A 4HUTA 4HUQB 3B5JA 3E5HA 1E9RA 2D2EA 4M8NE 4PO8A 1G8PA 2ASEA 2GEVA 2E5LC 5CM9C 4LJYA 1NN0A 4IVRA 4C9BA 2ZPTX 2WV9A 4OQLA 2JLUA 1E2NA 1OXUA 2MMCA 4LBWA 3BBPA 3QI2A 4JI1C 2IYUA 3NDBB 4US0R 5IHPA 4JKYA 4JLJA 4BASA 1KTVA 1DG1G 5EXPA 3UWKA 4LK2A 4MYUA 1XPUA 3BD9A 4CEJA 4DDUA 3DZDA 4F4JA 2A2ZA 3CX7A 1MR3F 1R5NA 4JLNA 3U6BA 4ESHA 1JEDA 4BSZA 2ZUCA 4OQNA 4A0RA 3OAAD 5EP2A 3R9XA 2ZANA 3CBQA 3P32A 1SZPA 5HCIA 1KKGA 1NI3A 1W0JA 5C4GB 2GA8A 1TADA 3DMDA 2XB2A 1AQUA 3I73A 4PPFA 2O0KA 3EPHA 4RFSA 4LRWA 4CEIA 3IHLA 1UKEA 2ZITA 3SYNA 2FSHA 3W3AA 1NN1A 1Z8FA 1II8A 2G0NA 2CE7A 3K09A 2H7VA 4CEIB 3O8RA 1WCV1 4NYJR 2GWHA 2EFEB 2DFLA 2PX0A 3VNVA 5AK0A 2UUAC 3G82C 4UXIA 4PC1A 3UK6A 3KQHA 2XJ9A 1G4AE 3NBXX 1II8B 4HB0A 1RC8A 2FF7A 1SQ5A 4C3ZA 4URXR 1FJGC 1W1WA 3CPEA 2FSGA 4DDWA 1ZB9A 1G7TA 5IK2D 3U44A 3WP1B 3CR8A 3WBKA 1AM4D 5EP4A 1KI4A 1CJMA 1M2OB 1SKYE 4Q4AB 2UXBC 2O8BB 4NCNA 3GJ3A 3B2EA 4CZ2A 5LDDC 5EUQB 5A4JA 3U4QA 3A4MA 4FIDA 2J7PD 5GJVC 1X86B 1IONA 4B32A 1E94E 1U90A 3FB4A 1OW3B 4GPTA 2WICA 2ODBA 1UKZA 2ZUDA 1TQ4A 3L82B 3LW8A 4Q1FA 5FUXA 4BFVA 2C03A 1JQLB 2Q3MA 3ONWA 4WZAE 3BFXA 4PZZA 4LC0A 1OKKD 1FW6A 4C2TA 4DR3C 2UU9C 5FUVA 2IS2A 3EPKA 3ZDQA 1DADA 1XNJA 4B3BA 3EZFA 4MRRA 2GXUA 3WNDA 1G8GA 4HLQB 5TMPA 3KQNA 1EESA 2RGBA 2VLIA 3UKDA 2NZ8A 3OAAA 1R2QA 3F5FA 2VP2A 2VH5R 2CDNA 1ZUHA 1KO5A 1T91A 1NN5A 3GJ6A 4OHYA 4HYYA 4TZ6A 1RIFA 3KFVA 2C96A 3BS4A 3B78A 5SZJA 2ZI5A 2PLFA 5FI0B 5FOUA 1E2GA 1NMXA 2GK7A 4P4TA 5FLXD 1HY3A 4DIEA 2H17A 2BKEA 3W6OA 2O8CB 2W0SA 5TVKA 2OFWA 4EJSA 2RAPA 3QKRB 2IEYA 5F2EA 1P3JA 1XXHB 4E22A 1WBBA 3QF4A 3HDTA 2C8VA 1R0ZA 3G5UA 4V0KA 3T06B 5EXXA 3LX5A 2ZJYA 4PZLA 2IL1A 1NLZA 5KU1A 3AQ4A 2R62A 4JVNA 2AK2A 4LHWA 2BBSA 4EJSB 4MDEA 3PUWA 5J47A 5IK2A 2HV8A 2CCKA 2ZJ5A 1RKBA 4JLBA 5TARA 2I1VB 3TIFA 5GVSA 4ACAA 3VNUA 1NIJA 3AM1A 2IF0A 1E2KA 4BFXA 1HV8A 4QKQA 4CIDA 2J7PA 4TL7A 4ZO4A 3UMSA 4S2EA 1DTSA 4JLPA 3QVVA 4JJKA 3I32A 3QBTA 5EP1A 5AR1A 2MMGA 4DEYA 4OHXA 1J7KA 3O8DA 4FW9A 2Z43A 1L2TA 2GCOA 2W6ID 3HU1A 3LBHA 3GLIB 4IDPA 2GJKA 1KK0A 1Q57A 4EFLA 5FUWA 4GL2A 1Q20A 1R8QA 1Z28A 4DLVA 3A1TA 2IS1A 1OKKA 3QSYA 2KB0A 4OL0A 4B2LA 4IXMA 1XD2A 1EGAA 3NBZC 5G53C 3TQFA 4C4PA 2JLWA 4QJ3A 2GCOB 1LW7A 5KPDA 3I61A 3OTOC 4LBZA 3KTAA 2HXSA 4AKGA 2OILA 3B85A 4AWXA 2KE5A 1XD2B 2Q9BA 3I5XA 4C0HA 1E0JA 2BCGY 1CJVC 1F48A 4LV5B 4XWOA 2C98A 2JAQA 2A7QA 1Z29A 2ODNA
chains in the Genus database with same CATH superfamily
3HLKA 3CZPA 3A4VA 3BRWD 4QOHA 2B37A 2ZAYA 4GLFA 4K9OA 4Q0MA 2HSJA 3ZWKA 1RZRA 2JEZA 2VBFA 4QBKA 3IPAA 3VR3A 4DABA 1HYGA 3T7IA 2O8NA 1SCKA 2QD1A 5DGTA 1CU1A 5CJ2A 1K8QA 2DKNA 3NHMA 2OT3B 2J41A 2IWHA 3JQEA 1Y8RA 4B6JA 5HS4A 1DKMA 4IJKA 4TL8A 3GD5A 2YZKA 1PZEA 3AGPA 2B1RA 4Q5IA 3GJRA 1VE3A 4TV8F 1U3VA 1SRRA 4H7JA 3ZDXB 3WSWA 1KZ4A 4OMCA 4BIMA 3F3MA 1Y3IA 3ZS8A 1U1FA 2FSPA 2IEAA 4XB6B 2X8LA 4OSPA 5GOZA 5B1IA 1KEUA 1XTPA 2YJ6A 4MB6A 5LXTB 4X66B 4H16A 4DHEA 2IS4A 1WAMA 5L3ZA 3ZCQA 1C0PA 1V9SA 1K8ZB 1VB3A 2GX6A 3CA8A 4K8OA 5JISA 3CSUA 1R0BA 3MUNA 5JYBA 2KYRA 2D74A 3LK7A 2YY7A 5K6TA 3V7WA 4AUEA 2NXNA 3H1AA 3D8TA 2NUTA 3ZOZA 1N0VC 1WABA 1T2UA 4BB5A 1RQ7A 2FU5C 2E9SA 4AG6A 4BRUA 3LGXA 1RXEA 4Y1RB 2HX1A 3ISTA 3C2QA 4BCAA 1U8ZA 5EWLA 4GH5A 3ETOA 2HO4A 2O2DA 1IOZA 1VXOA 2QQFA 3N2YA 2XR1A 2Y4NA 2Z56A 4X3CA 5H9VA 4LV8B 3E7XA 3TIGA 5KOYA 4YUYA 4EB6B 1N0HA 2AUNA 4CL2A 3NO4A 1MB2A 4BO7A 5THKA 1EVJA 3CN9A 3K8YA 1GZUA 4YO7A 3D1JA 2HLHA 1OAKA 1V25A 2Y1EA 3JD2A 4X1KB 3VPGA 3ZCSA 2P9GA 3LX6A 4CMAA 1KJWA 1UFVA 5T8KA 3VFDA 3NPAA 1KJYA 3EXIA 4N76A 1YIOA 4P86A 3ILHA 3BJZA 4KODA 4C5AA 6LDHA 1JPUA 1Y3AA 1C3OA 2B6NA 2I33A 3KD3A 3H04A 3KZKA 4HH1A 4JSTA 2PX3A 4ND3A 2IYFA 5JNLA 4LRTB 1QM5A 1GPH1 3JQDA 2DLNA 2VO1A 5CDHA 1PA4A 1RR6A 4LFCB 1EFAA 2IEGA 1KDVA 3K0EA 1OFHA 4NVRA 4DLZA 4ER0A 3GLFA 4PY2A 1NQUA 1X8JA 2PXAA 1ACMA 1GZ5A 2ZVQX 4L3OA 3L18A 4HDQB 5DTMA 4X6YA 2W6JD 3ET4A 5F5NA 4D9MA 4QOGA 4FHEA 1UC9A 1BMFD 3BE5A 4N3NA 3RROA 4MUJA 4J0DA 2CL0X 3JATA 1S3FA 4TM8A 2GYUA 4J16A 3HJNA 1X1EA 3IBYA 1S3IA 4I7EA 2IYLD 3FOBA 1SCUA 4LBVA 2XCIA 4KQIA 1YQXA 2K6GA 4Z9FA 3SXUA 3V5NA 2EL9A 1HTBA 2GTPA 3DD1A 4TKZA 3BE4A 1GQ2A 4R1SA 1UK7A 2Z2XA 3RJ5A 4IHAA 2GJ9A 3WLOA 3JS5A 3AB3A 1LGYA 3ZLTA 2DWOA 4KI0A 4Z2AA 1O9GA 3LKDA 4FUQA 4YJDA 2YH2A 2POCA 3CNOA 3PUHA 1WPXA 1JDJA 4Z1MA 1SUIA 4X41A 3D6NB 3AWDA 3LT0A 1J8QA 1WW2A 1ZIYA 2DERA 3MC1A 1G3QA 1V8DA 4WE3A 1YU6A 2ECPA 2MTBA 4R1LA 2DHEA 1O08A 1WW3A 3AO0B 4X5OA 5ALJA 4DNOA 2XXAA 2ZQ5A 2ZJZA 1W6RA 5JAZA 2R48A 1BGWA 1JDUA 1U2TA 2HIHA 3EZ7A 3GCGA 3GFPA 1H9AA 3H1TA 3KXDA 4G5SA 4N9QA 2VOEA 3IOEA 2HZBA 4I50A 4E30A 3LYLA 4RSGA 3VNQA 1LC0A 2C8LA 4PG4A 2OV4A 4Y0AA 2XZLA 2BKXA 1C7QA 1ABEA 4E15A 5AVQA 1G5PA 3R0XA 4C3OB 1Z5NA 4XPIA 2FRDC 3OX4A 4GMDA 4CM7A 4B3SB 4FYWA 3A3KA 3KKQA 1I33A 2CJWB 3UNXA 3VVLA 5JZOA 3QMWA 1QOPB 3AX6A 4MPPA 5CZVA 2O2YA 3EX7C 4QOJA 2DQZA 1GVNB 2ZQYA 3AUSA 2VK2A 1AXEA 3JU3A 3EZ2A 4E5UA 1AO3A 1ND5A 3IULA 5HK8A 3TTXA 1XYVA 3ZHCA 4RZIA 1JH9A 1JQ3A 3WLTA 2Z2JA 2P1DA 3RTGA 3EERA 3LP5A 1J39A 4EENA 1C1DA 3BJIC 1ZNYA 4GYYA 3K8QA 1UAGA 4NFSA 4RZXA 1N36B 2IYWA 2BOVA 5ALKA 2J32A 2YFHA 2A57A 3CY6A 3N7AA 3PDJA 1GPJA 3ASZA 3QV2A 4W7IA 2H6EA 4YALA 2DZDA 3SHOA 3U48A 4X62B 4IV8A 4IDHA 2CLFB 1JHAA 1W5BA 4IF4A 4TLEA 2DT8A 1PFGA 2I62A 1RNLA 2OZKA 3OTIA 5HKBA 1L6RA 1OXTA 2EFJA 1OLUB 2H00A 3BXGA 3A3YA 3PLRA 4ZRMA 4EZEA 3CQ3A 1NRWA 5EEGA 2FN9A 1SWVA 2V6FA 1OAOC 2ZYSA 4V3BA 5DN6A 3SICE 3MCAA 3U3DA 1VE5A 4DN6A 4E94A 1C9KA 4PLTA 5EGSA 3BGWA 4F92B 3N8IA 3SSOA 3PKIA 5IJ0B 4RTSA 7MHTA 4TMFA 1PGJA 2HB6A 4PEVA 5L45A 1R8XA 1V8PA 2JATA 1Z5VA 2PD6A 4QFBA 1N5OX 3U4CA 1IAQA 3WGLA 3C6QA 5ICCA 3AVUA 5F4ZA 1ZK4A 1GKLA 1JPJA 4YXWA 4BAZA 3ZVKA 5JYDA 1TX4B 3HRKA 4HSGA 2WWWA 3E05A 4C20A 3E8MA 1BHJA 3EXHB 4WXHA 3RC7A 2ZYVX 3CX8A 2XF2A 2P0AA 3B51X 2VSXA 4OP3A 2Q21A 2G67A 3QKSA 3ZDFA 2VF5X 2J59A 4PYLA 4E13A 4KLRA 3DP7A 4G65A 5GWXA 1G17A 4UBIA 3SDBA 1W36D 5JMPA 1BS2A 4D3XA 4DSUA 1ITZA 4OHZA 1PO7A 2P6OA 2Q5HA 1DJNA 4KYVA 3ZY5A 4A15A 2ONFA 1G19A 1O96A 1YZNA 4D9JA 4IHKA 4ETNA 3NJ8A 3ZNNA 4ND8A 2FQYA 4YROA 3VZSA 3DL0A 1TYEB 1KO7A 3NM5A 2PLNA 4P3KA 3D8BA 2NVWA 2PTGA 3FZNA 3F1LA 3SNHA 1PNTA 3FJ1A 4HLUA 3DH0A 1QVWA 2J4FA 2SNIE 4IMJB 4NC9A 2GHQA 1P1IA 1H2ZA 2G4CA 2YRWA 3T3EA 4RORA 2QTVB 3HE3A 5SZKB 4EHBA 1OYYA 1EWTA 1I2CA 2A5GA 2B3TA 4FKMA 5JO0A 1F4LA 4P92A 5J1TB 1RT9A 1XEXA 2PMDA 4IY1A 4K9DA 3RC9A 5BMVF 4QU0A 3Q8KA 4C87A 4GPIB 5EIEA 3JQQA 1VMAA 2O14A 3HKBB 1QK5A 1YVPA 2DPXA 4DSZA 4WW0A 3GA7A 1PFWA 3OOEA 4JLMA 3VOAA 1FU8A 2JFHA 5AFSA 2X7XA 3DT9A 2R8OA 3WWYA 4MP6A 4YWJA 4YDQA 2IHJA 1GTZA 4WACA 3COSA 5K4AA 5HOEA 1MB3A 1KBOA 1XDZA 5GTDA 1Z7EA 4G81A 2X0JA 5ALZA 2SICE 2AE1A 4JBWA 2CXCA 1DJLA 4XGIA 1P3DA 2MSLA 1JTVA 1NSYA 2V7EA 2YUTA 3H86A 1I7LA 1W47A 2EFHB 4G5XA 3E1SA 4AY4A 5DM70 1E9CA 3LZCA 3ZGXA 2H5JA 1BCSB 4DCMA 1E89A 2NMVA 3OOSA 1XZDA 2M1ZA 4H7PA 2CD9A 4BV2A 1UT8A 4CTKA 4DBLE 1U1EA 4QBFA 5KBYA 3DXYA 2FDCA 2CVHA 1RQNA 3LBIA 4G5YA 4JP3A 5DH9A 3SE0A 5TNXA 4KQXA 1P45A 3GUVA 3MWEB 4QDUA 4PCVA 2FOLA 4M6WA 2LDBA 1QP0A 3JSXA 4AM8A 3T4UA 1CKEA 1MORA 4FK8A 3WK7A 4X7PA 4FFBA 3EAGA 4DR4B 2Y6UA 1NFFA 2LVBA 3X1ZA 5BXYA 4PS0A 2HO5A 4FDUA 4R3UC 5JSUA 2A9OA 3LY5A 1OYOA 2P35A 4WOPA 3W2TA 1MBZA 2CZQA 3MPOA 1COWD 2VUTA 2W2KA 1PJTA 2IDKA 2RBEA 2XDAA 2BKUA 5TEWA 3RS3A 3WLSA 2O8FA 1N34B 3PI6A 3CLRD 1DWQA 2FWAA 3G9XA 4RHEA 4ZQGA 3SF8A 3UTDA 5CDTA 3LZ6A 1Z2NX 3CNHA 3SIWA 3BA6A 5HP4A 1LI7A 2VPWA 4PFJA 5JJIA 1IQUA 1NAHA 2D1YA 4RANA 4A5SA 4JD5A 4JYCA 2J07A 1W85B 4BEBA 3Q0TA 1BG6A 1UIMA 1KF0A 4HY3A 3QY0A 1WUHS 4J9VA 4K3UA 2JGRA 5KNBH 4MX8A 3RVBA 2ZJFA 3C5HA 5BSRA 1SJ9A 4M4SA 3W5AA 1FL9A 4DCVA 1OUMA 5KJ1A 1DAHA 2B4KA 1ZN9A 2D5CA 3C3YA 3CINA 4ZODA 4B7ZA 3GDGA 2P2QA 2YXBA 5KQRA 2P7IA 3ENZA 3O1HB 1Y33E 1FJHA 2C94A 5COAA 3O3CA 1CUXA 4YRDA 3GELA 3OM9A 4ZEOA 3TE7A 1TFRA 2GN2A 1KYZA 4D4GA 4MP3A 3GT0A 2QK4A 1CY2A 1NDUA 2XUGA 4H31A 2ZREA 1P39A 4BNDA 1O6GA 2HF9A 3J7AC 2QMUA 4GRAA 5K3DA 4DA6A 2RH4A 2XZPA 1Q0ZA 1YA4A 4P7FA 4XUCA 4ZARA 1NA5A 2F3TA 3EFOB 1EWRA 3KZXA 3QXCA 3RS5A 1VG1A 3PCXA 2QTHA 3NKLA 5H59A 2Q0HA 4NYMR 4B43A 3UT0A 2RARA 2W11A 1SCBA 2ORWA 3O38A 4J07A 1J7JA 2HTEA 1FFEA 1CY4A 1VP9A 4R2IA 3BQNB 3F7OA 5CP8A 4DDKA 5FTKA 4ZVPA 3J81k 4IQGA 1XCOA 1JH8A 4MV5A 3CZCA 3TLGB 2C3UA 2XUJA 4ZO7A 1IOVA 3HXTA 5B64A 1ZVVA 4KYUA 4ZV7A 4TUYF 4UQLA 4LGMA 3AVVA 1E9EA 3IE0A 4HNRA 4BWFB 1L5HB 2WEKA 1SFRA 3D59A 3DCIA 4IKOA 4PPNA 3IALA 2XNKA 2DAPA 2WD7A 4CT5A 4QU9A 4B6PA 5DI3A 2WD9A 2WHPA 5E4YA 3GJZA 4KIUA 2ODEA 1FVFA 1DAPA 1CUAA 2QMYA 1E1QA 2I54A 2XHZA 4NS1A 3G2QA 4I4TA 3QX9A 1Y3FE 3F6SA 5HEKA 4OX9C 2W83A 3TZEA 2M98A 3E3AA 3W9YA 1ETUA 3GRKA 5ES3A 1PF7E 2JB9A 3E70C 2W00A 1W2WB 4OI1A 3PFCA 1YRYE 2XECA 4LGVA 5IT9D 4QJIA 4BFYA 3ANXA 4ZRDA 3RUFA 1ZQ9A 2DVMA 4DLWA 2YJZA 3O93A 5LKAA 2H9AA 3DG9A 4ALJA 3OY7A 1GXSB 3KQSA 1QFSA 3ZEIA 2OPLB 1NJ5A 1XDBA 3GLKA 2P2MA 4WUTA 1APBA 1J99A 2WJWA 3NC4A 4IEEA 3DHVA 4MV8A 4IQ8A 4OL9A 3QPDA 4POAA 5AW3A 2X8JA 3E61A 3WGTA 3ZVMA 2R2GA 2YHBA 2IV2X 5C2JB 5I51A 4MHTA 3K2QA 4HUQA 4LZWA 4LX8A 1PWZA 3CO5A 4L6IA 1XPJA 2PMFA 2IYYA 1MJGM 4LOHA 3TSAA 1EM8A 1XQYA 2FPSA 2FW9A 2XB4A 3MUFA 4U00A 3K0AA 3JY6A 1IQRA 3AL0C 3G2HA 1FUEA 3NHLA 4AZSA 1OT5A 1Z06A 3I28A 2VAWA 3AP1A 3SM3A 2FUG6 2JI8A 5F33A 1FDRA 4KW7A 4I9UA 4UDOA 3L40A 4HGOA 5F9MA 5G0UA 4MYCA 2R7NA 3ZHXA 3N8HA 2ZJBA 3CWZA 3FF1A 4QHSA 2JCXA 3WGHA 5JNRA 4DB4A 4GBED 4MEBA 1ZJ4A 5EC8A 3E22B 2FMTA 1XC7A 4QBTA 4X8LA 2C3PA 4URFA 4YXFA 5A0FA 4F1WA 5ETJA 2NZUG 1Z7YA 3GLVA 4YJFA 2D5IA 1U0OC 3PQ6A 5A9TA 4C0QC 5IKPA 4XPZA 4C4TA 1KAQA 3TFOA 2ZSKA 3G2JA 4X3PA 1NP7A 2J45A 4JY7A 4B3FX 2YY6A 3ILVA 4CQJA 2VUHB 1AIPA 4NEGA 3RVJA 2O6HA 2FTKE 4RCYA 3VDRA 1PKXA 1EVIA 2OEPA 1Q7RA 4UXJA 2OXFA 1GFZA 1FXUA 1L4LA 1Z08A 1W73A 2GDZA 2N46A 5K3FB 5L4LA 2AG0A 3KOXA 3KPYA 1MU0A 1NULA 2XVAA 3EJWA 1AZTA 5LWQA 1L4NA 4BBZA 3J81A 3VPAA 3K30A 4KHPB 4EHNA 2MDTA 2O2CA 3R0IA 4XSGA 1QIEA 3QXJA 3Q88A 1L8XA 2P2GA 4HPXB 1T36A 4M89A 3WNBA 3DBRA 2IIVA 2B2NA 1NBMA 1PFVA 2C4UA 3LWZA 3NTUA 2H2HA 1KYVA 3PGLA 3WYBA 3U61B 1QHEA 1C1YA 3LA6A 4B73A 4F7DA 4EG4A 3ANNA 1YQ9A 2H2DA 4A8TA 1X7ZA 2VRWA 4W5HA 2SCUA 5JQGB 1I9CA 2IH2A 2Z6UA 1TJPB 1PNVA 2XNDA 4Q4AA 4C7XA 2O8BA 2VJAA 2XUOA 3DV0A 2XOXA 3QEBZ 1H9CA 2VF7A 3D9QX 3P2JA 1OBHA 3PPVA 2HRQA 1XMOB 4RH0A 2ZI9A 1B93A 5T67A 2IXAA 3H2SA 4KQ1A 1QV9A 3O92A 4KSYA 1S96A 3IRUA 1L1QA 1XPOA 1DEXA 5CDYA 3FNRA 4X60A 1U2GA 5DNAA 1EFPB 4BV3A 3CB4A 1QXSA 3E8SA 4DLUA 4BC7A 2XDQA 3PFKA 4KFRA 1EP9A 1F2TB 8OHMA 3BTUA 5F1PA 3OQIA 1MO5A 3LKZA 1CS0B 1Q22A 5FV7A 2G71A 4IW3B 4FHFA 3L1KA 2Q6LA 1PV2A 1LPNA 2W2PA 1EP1B 1ZMBA 4NFYA 4XIFA 3A2NA 4AJNA 4C43A 5LOVF 2CNOA 2ODWA 1Y3CE 2AS0A 2G09A 2R6FA 2ZS7A 1IQ0A 4G5HA 3RC2A 2CL7X 3B3AA 2D06A 3ZY2A 1DCKA 1NV9A 4A2PA 3ZY6A 2VP4A 2C5GA 1W76A 1XKQA 3G5TA 3EMBA 3GPDG 1DQPA 1T3LA 3L0ZA 1L5NA 1YJ7A 4OXYA 5BSUA 5FYDA 5F76A 1RI4A 3MUOA 3ETHA 3EB9A 1MGPA 2HMUA 2C00A 2WTXA 2XVYA 5FBZA 4WK6A 5CFMA 2GRAA 2PCLA 4ZI3A 4GI2A 5HRAA 5MDHA 3GEDA 3R6DA 1BWSA 1H3FA 1MJNA 3P2KA 3PR3A 2XBLA 4MQEA 1PGOA 3RI3A 3ADKA 3K5PA 2OFFA 3UJCA 4YAGA 2O8CA 1HH4A 4XJXA 2Y0PA 3LTNC 3C8DA 1M6XA 2JA2A 3BMOB 4M37A 2WAMA 1VMKA 4KMSA 1E2LA 4UHFA 4AMYA 4H3SA 2AFHB 3GQBA 1OLXB 1HDXA 1UBUS 4BDTA 4KAFA 2DLCX 3ASYA 2UVDA 2P11A 3LIIA 2V5AA 3NDIA 1VSUA 4V0QA 1IWPB 3SEAA 3UZ0A 2GZDA 3V4ZA 4A92A 3RYFA 5L6MB 3TQIA 3A14A 3N58A 2TMDA 1RHUA 3FF4A 3HA2A 4NJMA 3MJCA 2B82A 1BQ3A 4EGSA 1MJHA 4RCZA 3BGVA 4J2TA 2MCFA 3OLCX 4R8MA 1OX4A 1N6NA 5T8KC 1MIOA 4B47A 2I91A 4X20B 1CQWA 4NAVA 1C7ZA 3TB4A 3R8FA 2Y0EA 4C2UA 2QM8A 3UUWA 3GR0A 4DMUB 3RRBA 1QNFA 1HMPA 2WU3A 3KEMA 2QTAA 1IHXA 1ATZA 2ATWA 1I24A 4IS3A 5E1BA 5HIIA 4J4HA 4G9GA 4W4TA 4LZNA 1FXSA 1ZD5A 2OBMA 2E1PA 1Y7HA 3GDFA 4E03A 4D3ZA 1KVTA 2GK3A 4L15A 1RE1A 5BMVB 4YRNA 2NYVA 5KVAA 3C16C 1OTXA 1JWAB 2C3OA 2FKNA 1GDTA 1IHYA 2ORVA 2QX6A 5BYJA 3EGOA 3FMOB 3DMHA 1EE2A 4G0NA 1YHNA 3MWGA 4EB8A 2BGUA 4ID9A 4LRUA 3DF9A 4PX2A 2V9CA 2OZVA 3PICA 1TUBA 4OUDA 1TKRA 5HUQA 4ZVVA 4MRMB 4ETMA 1X42A 4MP8A 4L3VA 3GT3A 3KHSA 4J16C 2ACKA 4GBGA 3VVBA 3M33A 4NATA 4AF7A 1DBWA 2G82A 2CL6X 3C5VA 3ZI7A 4BFVA 4QUKA 4CN8A 4ZMRA 3GDWA 1N6PA 1ZH4A 2WP8J 4HGZA 1N6IA 5FO1A 3V8MA 2Z09A 4ZI5A 3QUTA 2FPUA 4KSCA 3AV0B 4A03A 3GFRA 5A5GA 4YV2A 4MLCA 1MA0A 1ODFA 3LHKA 5IVPA 2ZRAA 5IF9A 5CB8A 1S7GA 4RNCA 3L8YA 3RVRA 4IHJA 3CN7A 3FWHA 5A5VA 1JT9A 2R7MA 1UPTA 3E9QA 3VU1A 4O3MA 3HY6A 1JZQA 3RSHA 4X6XA 1B1AA 2O8EB 3ISVA 1ZZGA 3U49A 5E4FA 1DAMA 4LRSB 1DFGA 2QSZA 1IZ0A 2YYAA 4ALMA 3D5EA 4QDOA 3GY0A 3HB1A 5AK4A 1UFOA 5HCNA 4ZYYA 3TG2A 2A3NA 1QE0A 4YP7A 5JG7A 3RIYA 3AONB 4U7WA 1PR2A 3WFIA 5HKKA 3OO0A 2QP9X 2QVZX 2IU0A 3V46A 2FSVA 1E7RA 4I5FA 1YRBA 1F0YA 4FONA 3RF7A 1NU6A 1G3MA 4UJ3A 1KQNA 3AG6A 3CZ5A 4FGWA 2VI5A 2IRWA 2CVOA 2UUAB 2ODPA 4OLHA 4DXDA 3CTMA 4D97A 2QBYB 3V4FA 4WCFB 3LE8A 3CEPB 3W5JA 4F5ZA 2J6IA 2I9KA 1IL0A 4LTMA 1LRKA 3UCEA 1XLWA 5EL0A 3ZK8A 1BEUB 3IE1A 2BHRA 3DE4X 3K94A 3VZQA 3RYCB 4LXQA 1DC4A 4Q7KA 1VHTA 1UOOA 3G0OA 4XQEA 3IP1A 3LLSA 2RK3A 1QCYA 2VYVD 1LK5A 1I2DA 1CETA 1NUTA 3IKVA 4RXMA 1U7HA 5DLEA 2IA5A 3Q10A 3LNVA 2H4JA 4D9HA 5LCIA 1XTJA 4UTNA 1LNZA 2ID7A 2IEZA 3ZTWA 3ZG6A 2VPYA 3C6MA 4FI3C 4KTTE 3LUGA 4ZHQA 3K6RA 3OM0A 4WS9A 2NM0A 5BORA 4UD6A 3KSAC 1FFYA 2MSKA 1SXIA 3NANA 3OU7A 1HETA 4AF8A 1PWEA 1RLTA 1UMCA 2B5WA 4HAUA 4IIEA 3V42A 2I6TA 4BJ3A 1YJ5A 3G5LA 1KDTA 3N0VA 2FR8C 2JJ2D 3ZS9A 3DYVA 5L53A 3KYCB 2C5FA 2J9FA 1ZY2A 2GYYA 1ZOSA 1LUAA 2ZLBA 5DLDA 4KE8A 3ZQ6A 4B9EA 4KQMA 1FS6A 1UMDA 3TLAA 2PUBA 2UKDA 5IW8A 1ZCFA 2C1XA 4OTZA 2QNRA 2IE0A 4F6CA 3T5MA 1WB5A 2QSUA 3JASB 2V59A 3WYEA 4MKRA 2PUEA 2ZCVA 2KPOA 2X4DA 4EW2A 3HBAA 4M1MA 1YCGA 4YPOA 4JXKA 4CLRA 3N8NA 5G4LA 4DC1A 3FCEA 4QXMA 5I4CA 2P69A 3OCXA 4G0YA 2O7NA 3RIHA 2R8BA 4TUYB 5E9WA 3FHTA 1FTGA 4BQQA 2DR0A 2AR9A 3HN6A 3JZFA 4RLFA 4OREX 5F2KA 2HT1A 4ZOBA 3CEJA 2O4CA 3EUEA 5IJ9A 3PYMA 4DCTA 3USZA 3FIUA 1CZHA 1DRKA 1PJ2A 1W4RA 3KSDO 5ENVA 1GU0A 5KNDD 3I8OA 1XU4A 1KP3A 1KVUA 1M1UA 2O2GA 2QLNA 2GPSA 4P54A 2OXEA 3Q3CA 3MERA 3K2BA 2D2IA 4XD7D 1RYYA 3CQ1A 3C48A 3GLHE 4B5LA 1LH0A 5AO9A 3UFXA 2OBVA 3O2EA 1GG9A 1FYDA 1HRKA 3B2QA 3PE6A 4NSNA 1X1CA 4RV9A 3X44A 4AYTA 2AJLI 3UJAA 1WMEA 1OB5A 3QHQA 3LLMA 3P4XA 3PVZA 1I2ZA 3R3HA 4HLCA 1LZLA 4JL6A 2WMOB 3RTCA 3U5ZB 2C20A 4FC7A 2ZVJA 3IX7A 4L5AA 1MNQA 1ZIOA 4HLUC 5DBIA 4QNNA 3MS4A 4U0KA 1XQXA 1E4OA 2ACEA 5DOVA 3ZLBA 3G9UA 3B13B 3T9AA 2BJHA 3I9JA 2JGAA 3FVRA 1EUCB 3E3LA 3OLXA 4GZ3A 1J23A 4MTCA 3DO6A 2C0PA 1KXZA 5ICFA 1VL0A 4L78A 5JFTA 1CR4A 1WCIA 1SG0A 4WK2B 5EKTA 2H65A 4QUBA 5KX5A 2Q6KA 2Y76A 3B6JA 3OQHA 4RF4A 5TQ2A 5TLSA 1A7AA 2E0IA 2C4HA 3OHPA 4XX1A 2GBCA 5EY5B 5KTMA 4O4IF 1XE3A 2NPOA 3IBTA 4ZCLA 5C4IA 5CDSA 1ZUIA 4AYWA 1HNWC 1QANA 2BEUB 1E1CB 3IH5A 4RF2A 4YQZA 4BNWA 4LJRA 2GAOA 3ZX5A 4V2UA 4Z9AA 4IIJB 5J2UF 1Q1AA 2HF8A 3TFWA 3EDMA 3G2NA 4O0MA 1XTKA 3Q1LA 2JJ1D 3FNEA 1DC3A 2RAVA 3ZH9B 4DLBA 3TX6A 3K2IA 3RTEA 2EWMA 4FHDA 5B30A 4HN4B 2I2DA 2Z3ZA 4NYIR 4CV2A 1XNRC 1ULHA 3IBFA 1G20B 1N4DA 2QD2A 4XJVA 3E7DA 2H2FA 2XQIA 2IUEA 5AKEA 5KTSA 3H3JA 2ANCA 2N47A 3K1ZA 4FMCF 2WG1A 2WIDA 3BH7A 5TT0A 3ZNPA 3OX2A 4O4HF 2DB3A 2IZOA 1PEYA 3HPQA 2Q4RA 3KT6A 1H1DA 3CO0S 4QBIA 5H7XA 5FBVB 4Q3CA 5DNWA 4BJ5A 2J6HA 3DKVA 4OB6A 4KFCA 5JAMA 3UAWA 4YRSA 2FPMA 1DI0A 1P44A 5AP9A 3TFQA 1E3LA 1ZO8A 1E9FA 3GRPA 4TZTA 2OHFA 3T0IA 3T5TA 4PCLA 3KQMA 4E14A 4DA4A 3QVKA 4DVJA 1XHLA 3SF0A 2ZYHA 4XX0B 3T1QA 3WQQA 4ZEMA 1AXGA 1G8YA 3K4HA 2BAGA 2V7TA 3FNBA 4NOKA 4GKJB 3TGPA 1LW6E 3OE7A 1XJCA 4YCJA 2G3YA 5DHQA 1M1ZA 2RHGB 1D3AA 1NXXA 2AB0A 1U4SA 2QPLA 5HX7A 3MGCA 5JJBA 3TI7A 2OMEA 1JHZA 3HZHA 4EF5A 1JVNA 4ROTA 2QU7A 5BW4A 2IHNA 4GFDA 1AX9A 1U8XX 1Y9DA 4H9GA 1G3RA 3KQVA 3H2HA 3C7TA 2V7VA 3WHLA 1JDNA 5JATA 1AS2A 1LS1A 2XQFA 2C8JA 2IYZA 4EO7A 1M0TA 3HWSA 1TTQB 4N9WA 2QV0A 3QBJA 1ZDMA 1O4WA 1WOYA 4RY8A 5AKGA 2A67A 3NC0C 4KVGA 4NBVA 2N1BA 1HTWA 1YKFA 5GONA 1QHHA 1V8ZA 3FTNA 3ELUA 4BIIA 4EEZA 5CHEA 1VJ5A 3A36A 4HXYA 5GZ3A 2D6FA 3HUTA 3LVRE 3IMKA 2GERA 4FP9A 4F3RA 3CYFA 2QE6A 3H1EA 1UAAA 3DAGA 1IBMB 1EYZA 1FTWA 1O6CA 1VXRA 1TO1E 2ZTSA 1ADJA 5FOVA 2R6AA 3BFJA 3HYTA 3TD6A 9GPBA 2PROA 1QQTA 4Q3KA 5I9SA 3TDNA 5BN3B 3AEKA 221PA 4B33A 2DUNA 4LJ6A 2VWPA 5K8LA 2Q5QA 3P9IA 5ALMA 5FIUA 3DMTA 3E03A 3NOOA 5LOVB 5EP3A 2Q45A 4AY5A 1SHJA 4MYTA 2JKVA 5CNIA 5C8XA 3J80A 3Q7PA 2F59A 3VHLB 1ZVKA 5TE9A 3QVTA 4F5DA 4QC2A 3R8CA 4PYRA 4R2LA 1VL1A 1A77A 4N0DA 1E18A 2IUFA 1EG2A 1CEYA 4IXDA 3CEHA 1FNSA 2AEEA 1EFTA 3KSMA 4UHJA 1AXRA 4UEKA 2GTHA 2HYDA 2UZ1B 2X86A 3K2EA 4MS3A 4RE6A 3DWIA 1SBHA 2VDLB 4D25A 2YMLA 2D28C 3IOBA 2AG5A 2A5YB 3DMRA 4C22A 4TMVA 3EGEA 2P1ZA 1ZBQA 2GM5A 3SKYA 5JO9A 3ZNOA 2X4LA 5KTYA 1UPXA 4R41A 1SA0A 3GFBA 1Q1BA 3AFMA 4FGLA 5ANRB 1N5IA 2BJVA 2BP7A 3VYSB 1LC3A 1K27A 1DXOA 1JR3A 1PLKA 4UW9A 2PGDA 4IR7A 1ULSA 2GEBA 2G1UA 2ZOSA 4X9XA 1U0SY 2HRZA 4DG9A 5EZYA 3ANLA 2HLDD 1SBNE 4IX1A 4CL8A 3NB0A 4N54A 1XELA 3A9VA 2CL5A 4LTNA 1EJ2A 3RRXA 4MIYA 3TIIA 1RLMA 4LOKA 2H4HA 3R77A 4OBBA 4RA6B 4J9UE 2N0SA 4DV4C 3P2IA 4I2NA 3PUJA 3SIXA 1CEXA 3AF6A 3BRCA 3L41A 1LPMA 1T8TA 2P4UA 3OO1A 4F3YA 1I3NA 3GUZA 3IV6A 3OF2A 5MN5A 5AKJA 1ZISA 2E37A 3GEGA 3M4JA 1UWCA 3GXBA 4HH0A 3BDIA 1QBGA 3A04A 2D0OB 4IRMA 4LZJA 3IP9A 1DHRA 1QHIA 5EE5B 3T9FA 5JD6A 1CLUA 1F06A 2HPVA 3L4SO 2I7CA 4V1CA 2O06A 1NRJB 3IT2A 4IJQA 1AUPA 3F2IA 4KXXA 4FZJA 3NT2A 1EQUA 2MU1A 3PCRB 5JMTA 4CLDA 1GPBA 4H7IA 3TR0A 1H2RS 4EYQA 4X8OA 2Z9BA 3EC2A 2CKDA 2J30A 2ZB7A 3RVNA 4MVJI 3BKWA 4FD3A 2W8BB 1DTWA 4NBUA 4GD3Q 3JYOA 2X2FA 1SXPA 2BBWA 1C7RA 4JI8C 1DHTA 1EK6A 1G8AA 3GIDA 4GI7A 5E0KB 3NWJA 1I7NA 1UJ2A 1NW7A 2QT9A 2YIJA 4R69A 4HAIA 2GF0A 2Q9AA 3KAKA 1H5QA 5EHGA 5FOQA 1E8DA 3EVGA 4ZALA 1KTIA 2V4ZA 3O0TA 4WAUA 3T7TA 1NE2A 1E92A 2BM8A 4HMPA 5DM1A 1JW9B 4RUKA 2X9VA 5EA2A 2FR0A 1SCJA 5G1PA 1QG4A 3VYTB 3ZGNA 2V97A 1P2UA 5IFKA 3SG0A 2V7PA 3MWDB 1EFHA 3PTAA 4L27A 1R12A 3AERB 3GZNA 5TGTA 1QH8A 2RJOA 4XVQA 3PEEA 2QWXA 4P34A 2WWXA 2W7TA 2J5BA 4JYAB 13PKA 3KQQA 3T5PA 2XVXA 5INTA 5DNYB 5CG2A 3WGYA 1JI3A 3W9BA 2YZMA 4R0NA 4A4DA 1F2UA 4O4JA 3H2YA 2E4YA 2G6BA 3QELB 5ALGA 3WJAA 2YIMA 5JZVA 3R40A 3TLBA 2IH5A 1J0DA 1V45E 4Y8VA 3MHPA 1K63A 2W4IA 2CXSA 3GRVA 3LUDA 1TU3A 5CX1B 3U7HB 4KDCA 3ZLVA 4DNPA 5J4LA 1VIAA 1FMFA 1WEKA 2ANBA 1Z6PA 2G88A 3JAWB 1NLMA 2BMAA 2HUPA 3KALA 1A72A 421PA 4PG8A 3AXSA 5JWHA 5EE9A 3AJ9A 1XMXA 3MBKA 4D8WA 3GRYA 4W1RA 2PUWA 2V55B 2X23A 4ZQCB 5T41A 1O6ZA 2A0WA 4WCVA 4OEHA 3RV3A 5MGNA 4BCDA 2WK1A 3BIJA 2P67A 4BRZA 3TGWA 3DB1A 3N2ZB 2D8AA 3TLYA 2PRKA 2QL9A 1M7HA 1CDZA 2HU5A 2VATA 3AUKA 4C7VA 2FX2A 4B4DA 2HHHC 2C58A 2PJUA 3FFXA 3LDHA 1T25A 3BIOA 4E51A 5LYJB 4DR2B 2EG5A 2F9LA 3MXOA 2L19A 4J0QA 3KYDB 3PRYA 4ZT4A 2H3EA 3MQFA 4L16A 3NNSA 4PCAA 1ZJYA 4EAAA 1U2GC 3A4TA 3IJ5A 4EY8A 2QLTA 5B2FA 5J5VA 3WL6A 2VJQA 3UKOA 4Y6PA 4ISBA 4FB5A 3NTLA 2J0UA 3FE2A 4M1KA 3NXKA 4ADSG 1R37A 1UZNA 2A8YA 3E7FA 2D0PB 2LV8A 2EW1A 4BS9A 3IR7A 1ODLA 4AKIA 4OJTA 1WCWA 2HQBA 2X15A 4RJKA 1Y3DE 1ZM3A 3DE7X 4WSOA 3I9NA 2A5DA 3SMQA 2W2VA 3MIIA 4O2BA 3D8SA 4ER3A 3LAXA 3PCTA 3MTDA 1NBAA 5BQOA 2AMJA 4K6OA 4K88A 2Q29A 2QTFA 4NDNA 1UPBA 2C2ZA 3Q72A 3IAUA 1GG8A 1HH2P 4DUYC 1MKYA 2P2DA 5L3SB 1KA9H 3CFYA 1XD8A 1GGVA 3ASUA 4LF8C 4NFLA 5DYTA 1BD4A 4RTQA 5C8VA 5K4HA 3AFOA 4HD8A 3VPDA 1K92A 1RKUA 3B1YA 1QX4A 5ADHA 3JAKB 2RIRA 2OG2A 3O2QB 2VSQA 1DP4A 1M5RA 1GNQA 2QLLA 1AD2A