3R9WA

Crystal structure of era in complex with mggdpnp and nucleotides 1506-1542 of 16s ribosomal rna
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase Era
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 101
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3r9wA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9wA01
4DUZC 1EFHA 4TYYA 4TYWA 2HYDA 3REFA 3DMNA 3UWKA 4NYIQ 4Q01A 3UANA 4DCVA 3PR1A 4BLOA 3M4YA 2A7QA 2AK3A 2YV5A 4WA7A 3IPYA 1HH4A 5BYKA 1CTQA 1XD2A 3OIVA 1CR2A 1P2SA 4KLZA 4RZXA 1W36D 1A2BA 3KXIA 2K5UA 4HDQB 4GT1A 4OK6A 3QKRA 3MCAA 5F98A 5FBLB 1S3GA 1ZM3A 4LV5B 2VP0A 4DSOA 4Z51A 4CGZA 2YOFA 1FMJA 2QSYA 3ETLA 3PG5A 2G83A 4B47A 2AD5A 2ZYVX 2O8BA 2F9LA 2XNDA 2ZSDA 5JBQA 4FMBB 2CJWA 4Q1FA 2ODEA 1HNZC 3OFND 1XJQA 5CYPA 1YZGA 5HR5A 4C3ZA 3I72A 4Q4HB 2ZIAA 2NO6A 5TVKA 4D4MA 1GKYA 2NZJA 3MWYW 3K70B 1W0JA 4OKSA 2EW1A 3C4JA 2QNRA 3GLIE 1KMQA 4JKIA 2QGZA 4RD0A 2H7VA 4LGMA 1NMZA 3R7WA 4C0QC 1E94E 2ZS9A 4IOLA 1ZP6A 4QNRA 1X86B 5H70A 3U2QA 5DNYB 1Z2CA 4M8NE 2ZRMA 1Y63A 5F9HA 1GFIA 1G7SA 3B1WA 4IEEA 1J2JA 2B6HA 2RGAA 1NI3A 4TMVA 5FPHA 3J81k 4DV3C 2I3BA 2PN2A 4F4JA 4Q1AA 4PSKA 4URYR 2GZAA 3CZPA 3NH6A 5B64A 4D82A 2OAQ1 3TRFA 5K8IA 3SJCA 1XNRC 5EE9A 4ZIRB 4BEBA 4DCTA 1XZQA 3CRVA 3AGQA 3IDQA 5IDVA 1OFHA 4PPQA 3PUYA 4DHEA 4KFRA 2ZR0A 4O2RA 5AJXA 4KFTA 2W6IA 3KL4A 3FVQA 4WAUA 2F1RA 2KI5A 5DSZA 2JDIA 2ZAOA 3FHCB 3KB1A 5HKKA 4IDQA 4V02A 1ZD9A 2FV8A 3AP2A 2F3TA 4LOAA 2NOAA 4Q4HA 3NIBA 4HI0E 3IEUA 3A58B 4ZCIA 4NU0A 5FPKA 4UNNA 4QG7A 1OFUX 4PSAA 4NPHA 2VSOA 3SN6A 1F6BA 2DB3A 3LQQA 2F7SA 4EQ6B 3UXMA 4JI2C 5J4HA 2I1QA 1F60A 3BJIC 1CR4A 5EUQB 2VP6A 5J4KA 3FMOB 4Q1DA 2QE7D 4AG5A 2OLJA 2UUAC 3OEED 3AKCA 4NZYA 2RKOA 4QBFA 4OBEA 1XPOA 3BB3A 2BIFA 1BS1A 2V1XA 2MSCB 1DG1G 4B35A 2WWIA 4XTRA 1Z6XA 2QM7A 2NIPA 5JEEA 2ZS7A 5H8WA 1J90A 3OE7A 4JLJA 3MG9A 3X1ZA 4B76A 1CIPA 1CJVC 3PENA 4ZIRA 1USPB 2NO0A 1G4AE 4EUNA 2WTUA 4OJQA 3HR7A 4YLGA 3NTUA 3LBIA 1XD8A 4Q1CA 1E1QD 4QM6A 3C15C 2XXAB 1HT2E 3W8NA 1A82A 1YZTA 1Q1EA 2QTFA 1UKKA 3AF6A 1FQKA 2WMOB 3SEAA 2IWHA 2WJIA 1JB1A 3BWDD 2CVFA 5EE5B 3VNUA 1EK0A 1R2QA 2JLYA 4IKEA 1DELA 4ZCLA 2WJJA 2GAAA 3KTAB 4US1R 1NMXA 4EQ6A 1EXMA 3SFZA 1G3QA 2OO7A 2OFOA 1I4LD 2V7QD 2I1VB 5GJVC 2DYKA 4LBYA 4R2HA 2FGJA 4A8JC 1IN6A 1ZVQA 2FSGA 1Z6TA 3B1XA 4HB4A 4OI1A 4ACBA 4PO8A 5L3RA 3FKQA 2KZFA 2KBEA 4O2LA 3JZMA 6Q21A 4DKXA 3U3RA 3TUZC 5EP4A 1P7CA 3T06B 2FFBA 5BN3A 1OYWA 4IVRA 3MD0A 4KI0A 3U60B 2ZJ5A 1P4SA 1PV4A 4BFVA 1NSFA 2RGNA 1USPA 3HP1A 3TH5A 1XTIA 2LCFA 1W46A 3MFYA 3K9HA 3QBVA 2Q9AA 4CRWB 4LJ7A 2C8VA 2YZ2A 3AF3A 3ZD6A 2XXAA 3CNOA 1HR0C 2J46A 2IUTA 2ZJYA 5IT9D 4LHYA 3VR5A 1NVVQ 4ZCMA 3EZFA 1BO6A 3LY5A 2VRWA 1KO5A 4GNKA 4MRPA 4F92B 1Q21A 1ZYUA 4A36A 2JLQA 4OJKA 4CYMA 4EPTA 1HA3A 1II0A 1JEDA 1E9SA 3WXMA 3KTAA 1JOSA 1E9RA 1KSFX 2JLSA 3IPXA 4P4TA 4UNQA 4Q9IA 1XEFA 2GF9A 1GUAA 1E2IA 3FKSA 1UKEA 1E2EA 1X1SA 2R6FA 3VQTA 4D0GA 3WYFA 3AQ4A 1V5WA 1JEEA 3AKYA 3QIAA 4A6XA 2GEVA 3PIRA 2PL3A 2IW3A 1XMOC 3H4MA 1UBEA 2AR7A 4LJYA 4MUAA 2DR3A 2JASA 4MGYR 1ZU5A 2ZR7A 3EAQA 1FPMA 4RD2A 4DLZA 1KNQA 4QFMA 3NC1C 4XWAA 4AWXA 4RSGA 5AUNB 1YVDA 2FG5A 4Q48A 1XX6A 2HT6A 3EWSA 5KO2A 2F4VC 2QU8A 1P5ZB 2GILA 1S9DA 1GZSA 1HE8B 1XTKA 3ASYA 1BOFA 4OQXA 1NBME 3UWOA 3RABA 4R98A 3SE0A 2A78A 4BFWA 4BASA 1XNJA 1PLKA 1G16A 1FQJA 2ZRCA 2ASBA 4Q1EA 2ZYTX 2BVNA 1FJGC 3EPKA 3AM1A 2WBLC 1E2JA 2VIIA 3ZZTA 1CP2A 3W6PA 4M9ZA 3L43A 3IGFA 3QOFA 3ZVMA 1NYEA 1KI6B 3ADDA 1A7JA 1HQCA 3LA6A 3T1QA 2JIZA 4WOPA 1D9ZA 2WWHA 1UF9A 1NVUQ 3FOZA 5JLJA 1KIMA 2W6JA 1C1YA 4JLPA 1UFQA 4YDHB 2KE5A 3A1WA 4NYJR 4URXR 5AK0A 4RJLA 1E2DA 3KJHA 4TSFD 4KJZA 5FI0B 1L2FA 3I8XA 4JI4C 5GVSA 1E2HA 4HAUA 1G6HA 2GBLA 5HZHA 2BJOA 3HU2A 4DV7C 3F8TA 4MA4A 4EFNA 4TMXA 3G0HA 1ZB9A 4KLNA 4LHWA 2BJWA 4X66C 2QORA 4HB3A 4Q9JA 4TZ0A 1IM2A 2D7DA 3KKPA 2PCLA 4LK2A 4K81B 3LX5A 5FH9A 4QJ3A 1D2NA 2WICA 4A15A 1KO8A 1T0HB 4DUYC 4NCJA 3VTKA 1P2UA 1YKSA 4ZKEA 4OI4A 4FXPA 4R9UC 3A1TA 1TUIA 3OAAA 2FSFA 1Z63A 3HU3A 3BB1A 3R9WA 2OFXA 1R5NA 1GILA 5C46F 1KZ7B 2ZXUA 1RJ9B 1KI6A 4AKHA 3CRW1 1KO1A 5HPYB 2KB0A 3SDZA 2IYSA 2V54A 4A2PA 3RRMA 3P32A 3PCRB 4GSYA 4W5JA 2HJGA 2J0VA 3EA0A 4A0HA 3QPVA 5D3QA 2GWHA 2Q6TA 2GJSA 2IUUA 1Q1QA 1CJMA 3ADKA 2Z4SA 3B82A 4XSGA 4TLAA 1TF5A 1RVDA 4GI7A 3SZRA 3W5JA 1T3HA 4QL3A 1IBLC 3CKLA 3Q8XB 2CCJA 4PAMA 1E0AA 2UXDC 1KKMA 1FNNA 1NVWQ 3OIYA 1VECA 4B6FA 3NH9A 1PA4A 1XPRA 2IYXA 1E0SA 1EWRA 3OEHD 4AK9A 3IIMA 2YJTD 2J0QA 1CXZA 1LW7A 2ATVA 2VP5A 1XF9A 1OLOA 1P2TA 2BMFA 2PMKA 3QVVA 1XMVA 3OFNA 3GFTA 4U02A 4LUCA 4PXAA 1N33C 3KDSE 4JI1C 1IN8A 4LJ4A 4FCTA 4AD8A 4CIDA 4FCVA 4BGDA 1RJ9A 4JI3C 2O5VA 2ZANA 1M6NA 2Q3MA 4PHTA 3IQWA 2D06A 5BN5A 2CL6X 2ZYWX 5FBQB 4C0KA 2J0SA 3H84A 3IILA 3L0SA 2GVZC 4B73A 4XIGS 1QHYA 1GNQA 1VIYA 2DFNA 2AWNA 3SU8A 3B8HA 4GMXA 1XTQA 4P33A 3K70C 5EJEA 5ANRB 3QE0A 1GKIA 1TNDA 2VHQA 3ZZ0A 1HY3A 1Y3AA 2C9OA 1IOZA 2UZ3A 3DDCA 4TMZA 2O8EB 1BMFD 2GHIA 1E3MA 3ONWA 5CJPA 1YZKA 3U3JA 1ESNA 1Z0FA 3NC0C 3B9PA 1XMSA 2JDID 1MRNA 3O47A 2UVQA 3DM9B 1ZM2A 3FDIA 5KOYA 1T91A 5KU1A 4Z8XA 4X62C 1K0RA 3KJEA 4G1UC 4RVCA 3GEEA 3K70D 5JMTA 3B1VA 2O0HA 5G3ZA 5J40A 2ZJ2A 3FTQA 4TL6A 1GNPA 4DLSA 1GAJA 5FOTA 3W3AA 5D3MB 1VPLA 2W58A 1T3SA 2ZQ5A 4TTQA 2XZOA 4A2WA 1AKYA 4LJ6A 1O3YA 2YKGA 1X8KA 3DEFA 4M9SA 4QJ4A 3B2EA 2FOLA 4DCSA 2CNWD 3K1JA 1WBDA 2IF0A 2QA5A 3E70C 4B2PA 1SVIA 2WZQA 4NMMA 4TWZA 2E8FA 1YR9A 2YOGA 2HV8A 2AKAB 5HE8A 4TMTA 1N6LA 2JCSA 2QTVB 5E7JA 2QE7A 4PC2A 2C9CA 3OEEA 4L15A 4D25A 1ZRHA 4TYQA 4YMVA 4I1SA 4PPNA 3TR5A 4NCKA 1W47A 3WP0A 2WM9B 3CRRA 3EWAA 2R6CA 1ZUIA 3ZQ6A 5AUOB 1FOEB 2O8EA 2IUSA 3QXCA 2ZRPA 4ACAA 1R10A 5IT5A 4EJSB 1L8QA 4EPVA 4CF7A 1ONBA 1E1QA 2HCJB 1CR0A 2OHFA 5FFMA 4I4LA 3W34A 1M1YE 1N32C 3SBDA 3I62A 4D0NA 2CLDX 4JI7C 2AFIE 2P5SA 3TIFA 2RGNC 2HUPA 3TSOA 1RRFA 4I1OA 3CZQA 3U44B 4RY2A 3J81D 4OQMA 1ZNWA 5D3MA 2A3RA 4IVPA 2DFTA 2DWPA 3RWOA 1UKZA 1TF2A 2QP3A 4MITA 1AQUA 5M04A 2QUZA 1HH2P 1CKEA 2V7QA 2YHSA 4RD4A 4MRSA 4URUR 3RS5A 4A0GA 4B48A 1G17A 2IYTA 2Z83A 4LBZA 4D0LB 2CE2X 1QG4A 2CLCX 2QAGB 1LFDB 1E2NA 3MWJA 1WE2A 1XMIA 4JBXA 2FN4A 3K53A 3EIHA 5EP2A 1E2QA 3TQFA 2GJAA 2ZJOA 1LS6A 1JI0A 3D31A 5J4LA 2AKYA 3F3YA 2CVHA 2PT7G 4DLXA 3FB4A 4BE7B 3QSYA 2OV2A 1NN5A 2W00A 4KBGA 3M6AA 4LJ8A 3TGPA 1XEWX 3RC8A 1OFIA 1Q3HA 3SJBA 2QI9C 2ZRHA 3D3QA 1YZUA 2WKRA 4KYUA 3TVTA 4EJSA 2O8FB 4LSGA 4A8JA 4KYIB 1D5CA 4LBWA 4GOJA 1Q12A 1BKDR 3AUYA 3EPLA 1DO0A 2UZIR 3U44A 4H1UA 2CHQA 5DI9A 2VO1A 3P4YA 4FCWA 1H8ED 4JSYA 1LVGA 1Z0AA 5BW8A 5JSZB 3VMFA 4DLVA 3UK6A 2ERXA 2QMEA 2KWIA 1VG8A 4AYXA 1W1WA 4DSUA 2B92A 2ZVQX 4OX9C 4FMCF 4JJKA 2CXCA 2O8DB 4C30A 3QPWA 3WP1B 2D2EA 3PUWA 1NRJB 2QAGA 2CHGA 1A2KC 2J45A 5JCZA 2QG6A 2QZ4A 4V0MA 1KKLA 4N0DA 4JVMA 3FE2A 1E1RD 2QAJA 3I32A 3IIKA 5FPTA 1YJ5A 5AJZA 2XZPA 4JLVA 4LF6C 1YHNA 4B6EA 2Q3FA 1WH9A 1Z8FA 3HU1A 4NL4H 3GJ0A 1NN3A 4WBSA 3A4NA 2A5FA 5CB6A 3U3MA 2WAXA 5CB8A 1RW4A 1AS2A 3MWKA 3KFXA 4X8HA 4B32A 4X8MA 1S1MA 4F4IA 2F1JA 1XCPA 3IUYA 2OBMA 4A0FA 1B23P 2GXUA 1E96A 5J5CA 2GCPA 2FZ4A 5B2ZA 3O8BA 2C9YA 1TF7A 2GBLC 4PHFA 3B9QA 3AVYA 2UU9C 1ZBDA 2PBRA 2YC2C 2ZRGA 3OIUA 3QXHA 2BKUA 1KJZA 2ATWA 2KJQA 2ZUBA 5JSZA 1ELOA 1NIJA 1Z0JA 1MRSA 2P3SA 2NMVA 3LDAA 2W6JD 2F55A 3I07A 1S9HA 2CCGA 1YZLA 1OSNA 1OXSC 2O8DA 1W5TA 3V00A 2CE7A 2NTYC 3OZXA 1OHHD 4POAA 3T15A 3X1XA 1N5LA 2TMKA 4Z1MD 3EZ9A 4NCNA 3PQCA 2VTKA 2QL6A 3CR7A 2BM1A 2IYLD 4MKHA 1HT1E 1ZM9A 1KSJA 2CCKA 3L2OB 4DLUA 4IHQA 3A1VA 1KY2A 4TSFA 1OH6A 2UUBC 3VR2A 1S4QA 4DDUA 1XJ0A 2W2TA 1SXJD 1CJUC 2CXXA 2ZE7A 3AP1A 4W5HA 2G1KA 3LBNA 1RRCA 1U0LA 2AWOA 4LCBA 2J0UB 5JCPA 1CRQA 1Z6GA 2HJVA 2H18A 2MSDB 2A5YB 3GJ3A 4E07A 4P4SB 4OI0A 4GOXA 2RGEA 5FPSA 5KPDA 5DGXA 5CLQA 1SKYE 3CH5A 5EUMA 4IFEA 4C2TA 4LFAC 1S8FA 5C4MA 5C2JB 1P60A 4QBIA 1XEWY 4B34A 3H0KA 3CPHA 4US2R 1R8SA 2PCJA 3RHFA 1JBKA 4HLUA 3GCGA 2PEYA 4EPYA 5EP1A 3CWZA 5CJ2A 5KHOC 4JYBA 1KDTA 3SHWA 2QQEA 3TNFA 2R6AA 1W5SA 4Q18A 3MAAC 2Q9CA 4NOZA 3D7MA 4RZUA 1II9A 4W7SA 2F9MA 2D62A 4FMDB 3Q72A 1KK3A 3FFAA 1G3RA 1UDXA 2I4IA 4RD1A 3FWYA 3KKOA 5CK5A 3K9GA 4XWKA 5FBVB 3LRPA 4HUTA 1FTNA 1NVXQ 3TUJC 3RWMB 1RRPA 1BH2A 3UKDA 1OXTA 3UATA 5CITA 3F5FA 3OF5A 2A30A 2FJUA 5J4YA 1AZTA 1CRPA 1XXHA 3TSZA 221PA 4H1VA 3LNCA 1G4UR 4QGHA 3VHXA 1Z28A 2NPIA 3CONA 4FMCB 1IQPA 1C4OA 2OXRA 2V8OA 4UXHA 2J0UA 2VPPA 1Z5ZA 3A8TA 4GOKA 1HNWC 4CEHB 4JLAA 4P4SA 5HCIA 4DIEA 2OG2A 3KJGA 4YMUA 3OEHA 3KQLA 2OAP1 1OB2A 1JXMA 4QGGA 1F2UB 5IK2D 1NG9A 3QI2A 1K5GA 3IQXA 1NLFA 1E2MA 2R2AA 2IC5A 3O8DA 5KUTA 4X8LA 2V9PA 2XSZD 2BC9A 1G21E 3CO5A 1E98A 1XU4A 3P26A 3DOFA 5LB2A 3RS2A 2XOKD 3VR4A 4V0ME 4KFUA 4XD7D 2XJ4A 3NKVA 2H92A 1DAMA 3C5CA 1CJKC 1FP7A 3THOA 2AN9A 2Z43A 2XTNA 4F91B 1BYUA 1KYIA 3OIWA 1ETUA 4Q1BA 4UJ3A 3PFIA 4HAVA 3U7GA 5FUYA 4MYUA 1BMFA 1N0WA 1YU9A 5DYIA 5KNDA 1QG2A 2E8EA 1KTVA 4PZYA 2X77A 4CEHA 3B7GA 1MABB 5FLXD 3X1DA 5JS7A 5KSPA 4DCUA 421PA 5FUWA 4IDHA 2ZI9A 3CW2A 1F2UA 3CB4A 4PPFA 4CEJB 1G5RA 2IWRA 4O3MA 1CU1A 4Z54A 5GADl 3UIEA 2QN6A 1OXXK 2IEYA 2D2FA 4W5WA 4P0TA 5FUXA 3K0AB 3SBEA 3RSLA 1OB5A 3A6PC 2DY1A 4MDFA 3VU9B 4YXWD 3ZD7A 5DH9A 4M9QA 4TQAA 5FTKA 3DMDA 4Q7JB 1TX4B 1G7RA 4UJ5A 1UBCA 2CNWA 2WJHA 2GJKA 2WWXA 1KHTA 3I61A 1Z6YA 4GKJC 2G3YA 4YC7A 2FZLA 4LJ5A 4HAYA 2P67A 1MO6A 3K0EA 1N6PA 4C0SA 2SHKA 3KQUA 3RRZA 4MQBA 1CULC 2FFQA 2RGBA 3SS8A 1WBBA 5JJLA 2CDNA 3T12A 1CLUA 2IS1A 1GRQA 1JR3D 2ZRFA 3R8CA 5FOSA 4DT1B 2G0NA 1FMLA 4H9GA 3CH4B 4G0NA 5AUPB 2BBOA 2WHXA 1R0ZA 2OPLB 3FPAA 2VYFA 4JLKA 3RDPA 4HAWA 2WJYA 1F48A 2VP2A 3GJ5A 3L8ZA 1MABA 4KITB 5GJBA 1LB1B 1K8RA 2ZI4A 3EERA 1O87A 3LBHA 4DDWA 4CEJA 1KDPA 1HQYE 1W4RA 4PZZA 2Q3HA 4DBLC 2GEUA 3GJ8A 2WWYA 3K0AA 3PEUA 3CIOA 4G5RA 3VU9A 4B3BA 2XR1A 2JGNA 2P5TB 2Z5FA 4EJSC 2GJ8A 3DZDA 5JS8A 4R71A 2J1LA 3RRYA 1JPJA 3PVSA 5SZIA 2E8CA 2ANCA 1U9IA 4WZBE 1E9AA 2ZJ8A 5FOUA 2IYZA 3TQCA 4JVLA 1Z08A 4E5UA 1XTSA 1ZIOA 2ZJAA 1XXHE 4BUJA 4EAQA 1W44A 2ANBA 2GVDC 2P65A 5CIWA 1FNMA 4PR0A 3UG6A 2HDNB 1M7GA 4DT1A 4IW3B 3BERA 5G41A 4ZI3A 1NP6A 2OPLA 4TYPA 3SOPA 1P9NA 3AEZA 4ERNA 1LF0A 2R65A 2FH5B 2RHDA 3DKPA 1PLLA 3NBZC 4KXFB 2QAGC 4GRAA 2GA8A 1IY0A 5DHFA 1VMAA 4I81A 4Q4JB 3QXJA 2QSZA 2KBFA 2O8CB 1M8PA 1UJ2A 3B60A 3U6BA 2RCNA 3EPJA 3SJAA 3AKEA 2G77B 4UNRA 3T1HC 1OH5A 1NN0A 4RZ3A 5AWFC 4M1SA 4C0HA 3GP8A 3BS4A 2ZRAA 2Y8EA 3CX7A 4WZAE 3VKWA 4HDCA 4E03A 1NJGA 2IS6A 1GWNA 4JIMA 4BFUA 3E5HA 4DLYA 2ZRBA 3P4XA 2ZROA 3PEVA 1H8EA 3E2IA 4O0MA 3SR0A 5K8TA 1P2VA 2WJVA 5E4FA 1KSHA 3QPUA 2ORWA 5C4GB 1R0YA 2E87A 3C16C 2Q21A 4MH0R 2QQ0A 4R7ZA 2ZAMA 2IYWA 3GEIA 2H8KA 2MMGA 1Z07A 4LY6A 2FMXA 4PQRA 3GLGB 2EVWX 5LD2B 2NG1A 4OI2A 1E4YA 3PXGA 3GFOA 3SQWA 1E1RA 2V3CC 4PC7A 2QL8A 2DCUA 2ATXA 4U5XA 2H16A 3I92A 5P21A 4ZKDA 3T1TA 1LV7A 1G8HA 5HCNA 1JR6A 4I1UA 3OESA 1SXJB 3LH5A 3T34A 3PEYA 1VKJA 2XNSA 5AJWA 1E0JA 1FTSA 4JKYA 3QENA 4CT4B 2J59A 1ZNXA 1GL6A 2PMDA 2X2EA 3WMEA 4ZDJA 3EX7C 1P9WA 4ASUD 4DV5C 1XEXB 4LC0A 1U0HC 4MGIR 4XJXA 2JLVA 3C5HA 4C7OB 1LTQA 2FSIA 1A5TA 5KDOA 1DE0A 1OJLA 5LBIA 2QROA 5BR8C 1Q20A 2ZREA 4LF4C 2QY9A 3AF1A 2H1LA 4NP6A 3IO5A 1JECA 4DZZA 3BFKA 3X2SA 1DAKA 2QENA 4YMTA 3T1VA 2GTPA 3ICEA 1KJYA 4MYHA 1KGDA 3ASZA 3DKVA 2OE2A 3IKJA 4U7DA 3PITA 2DWOA 4QC2A 1ZB8A 5AJVB 4ABYA 2CL7X 1OHHA 2WWGA 5EE1A 4Z1MA 1MKYA 4HLUC 3GLGA 2ZSAA 3W90A 2CY1A 3THYB 1P73A 4EKDA 3AVUA 3UMSA 1RPZA 1SVSA 1VYTA 3HYTA 1G5TA 1R4AA 2J5XA 1G64A 4XTCS 4BRWA 1SVOA 5L8VA 1SXJA 4MTNA 2J7PD 2E7GA 1Z6AA 4DDVA 1EGAA 1G291 1Q1BA 4A6PA 3EZ6A 1QHIA 1L4YA 3BB4A 1WDTA 3CBQA 4M2LA 4D4KA 4EFLA 5IHPA 1XJCA 4DR6C 1TQ2A 4V0OA 2ZPTX 2RGXA 3AVPA 1XEXA 1AA9A 3CJEA 3N5CA 3PJRA 4NTZA 4C7OA 2Q9BA 1JJVA 4C0BA 4JLDA 3LVQE 1QHGA 2EWWA 1XZPA 3EC2A 4FW9A 5GJWC 2VA8A 3GJ6A 4KHPC 4PO1A 3WHKA 4UXJA 4DR4C 1MH1A 4K0KC 1E9DA 1JQLB 2W0MA 4N1AA 1YRBA 5DISB 2BKEA 5EE0A 1XDBA 2FE4A 1J8YF 1X8LA 3LQRA 2GKSA 2C95A 1E32A 4QKQA 2CMKA 1WF3A 3RNLA 2WMNB 5FUVA 3FMIA 1I2MA 2PH1A 1RYHA 2J9RA 5EZ5A 2QGNA 3THYA 4JMPA 2PX3A 2HT1A 4EIWA 2IEZA 2V55B 3ECCA 5DN6D 4XVUA 1YRAA 4TL9A 4P4UA 1KNXA 4A1FA 1MO5A 1M34E 1N6HA 2IS2A 3LFUA 4AQYC 2IYUA 5LPNA 121PA 1XRJA 2YCBA 2UXCC 2J3EA 1E9EA 5EXTA 3EIEA 3IHLA 4EDHA 2IXFA 4HLCA 3EW9A 4TLEA 1N36C 1H8HA 3H86A 4XOIA 2PLRA 4QM7A 2P6RA 2ONFA 1KI1A 1NLYA 3LW7A 4US0R 1EX6A 5DO9A 5IK2A 1GIAA 5JEDA 4CW7A 4NYMR 4F4CA 1OKKD 1J8MF 1XD9A 4D6PA 1GVNB 2LKCA 1WP9A 1YQTA 3ND8A 2XSZA 3TUIC 1N5JA 5JRZA 1HYQA 2ZJBA 3AP3A 1WRBA 4MGZR 3RYTC 1Q22A 1R0XA 1P9RA 5FTNA 2REBA 1Z3IX 4Q7MB 2XOKA 2MMCA 1NY6A 1R5BA 5JWHA 5KSYA 3B85A 4CDGA 2QBYB 4Q7KA 1XCMA 2B8TA 1SZPA 4Q7LA 4XD7A 4AY2A 1D8TA 1W4BA 4LDJA 1IAQA 2VHUA 2ASEA 2XX3A 3G5UA 2H57A 4TLCA 4ZDWA 4BFYA 4ESHA 5FOXA 3T35A 2PZGA 4WZ6A 4NYJQ 4A9AA 1N25A 4ILEA 3KUDA 3WY9A 2UKDA 3FFBA 4JLBA 3TJZA 3WRXC 3C8UA 5L3SB 1RKBA 2IHBA 3QY0A 2J7KA 4M21A 3CPJB 3RSOA 3BE4A 4JVNA 2WV9A 1P6XA 4PSVA 3EG5A 1LNZA 3B1YA 1SQ5A 4PPGA 1JXOA 2ZEJA 4IFBA 4Q66C 1N6RA 2YC4C 1N3BA 1OXUA 2ZM6C 1LY1A 1XWIA 3ZLJA 2WOOA 1ZNYA 1ODFA 1FX0B 3BGWA 4KODA 1T0JB 2YWEA 4G5GA 5DYGA 4QRHA 3REGA 4DVGA 5C1BA 4B2IA 1YZNA 1OH7A 1NLZA 1KI2A 2FPKA 5DIFA 4IDNA 4YXWA 1YE8A 4OQFA 1L2TA 1WCV1 4OK5A 1KY3A 3GLGE 3R8FA 2ZU0C 3BFVA 3EARA 2QBYA 1TAGA 2NPFA 2EYUA 1QDEA 4GL2A 2WOJA 2BOVA 4LFCC 5TB5A 1G9XA 3I1FA 2OCBA 4MH4A 2W0SA 2WWWA 3LX8A 1GP2A 3GJ4A 4JL6A 4B43A 3QJYA 3CLVA 1GRRA 5JWOA 1ZCBA 4IOKA 1M74A 2DFKB 3LLUA 4S35A 1RIFA 3Q7PA 1M2OB 1JR3A 1U90A 4ZI2A 1U9IC 4BSZA 2VF8A 5L3SA 3NEYA 4NONA 5FBRB 2ZM5A 1US8B 1R7RA 4MDEA 3T61A 3ZS8A 3BH6A 3CX8A 2JLZA 3SYNA 1W4AA 2JLUA 5G53C 3W6NA 2IL1A 1SHKA 4OK3A 4AYWA 2XEXA 5HE9A 3L8YA 4XX2A 3I4LA 2QPAA 4PC1A 3AF2A 1T6NA 2ZUDA 3CRMA 2C03A 4D4LA 3L0OA 1FX0A 1E2KA 1OYYA 5KYKA 4IOJA 1QHHB 2CBZA 2P6UA 3WYAA 4J0QA 3QEOA 1DARA 5CIQA 4B3FX 4DLWA 2D7VA 2ODBA 1SVMA 3HPQA 2WWFA 4BLTA 1FUKA 4LZZA 3SC3A 2ERYA 3EC1A 3NEJA 3AB3A 2X2FA 4PFSA 4XWOA 3T1YC 1KO7A 2G1JA 2IBMA 5FTJA 2WIAA 3WMFA 2QEQA 3GD7A 5A0FA 3WNBA 3QG5A 1TPZA 2IF2A 3I8SA 1D2MA 1J99A 1DS6A 2Z0MA 2IYYA 2OSBA 4G5QA 3IBGA 2ECKA 2PX0A 3GLIB 3PUXA 3LUSA 2FEOA 2IT1A 1US8A 4QGAA 3LWNA 1G8GA 4LWZA 2BBTA 1HTWA 3ZQJA 2GXAA 2EFDB 1CBUA 1N2FA 2JLXA 4M9XA 4NE2A 4MKFA 2WSSD 4FMDF 2ODNA 4B3TC 2A2ZA 1P61B 5JWRA 1S0UA 2C2HA 4L9SA 1AZSC 5KTYA 2HYIC 3W3ZB 3WRYC 1J5EC 1OIVA 4JLOA 1G19A 1G3UA 2EFGA 3AKDA 5CDFA 1LQLA 2NQ2C 2YWGA 3MLEA 1UKYA 3Q9LA 5FBWB 5SZHB 1QHHA 1IJEA 1E69A 4PZLA 4JYCA 4TYNA 2YWHA 4PC3A 1ESMA 1U2RA 4LYAA 4NCHA 4IOMA 2N1BA 5KNBA 4G01B 3OHMA 1ZU4A 2VHCA 3SNHA 3LAWA 5TARA 2O52A 2C96A 4NYIR 2ONJA 5EXPA 2BM0A 4IDPA 1GG2A 4QBGB 1P3JA 2BV3A 3MRSA 4N3NA 3N70A 2ZJZA 1G7CA 2E1RA 1QVAA 1KI4A 3FYHA 4BLPA 3MJRA 2O8FA 2ZU6A 2OBLA 1U98A 4LI0A 4Q5IA 5KDLA 1DPFA 3DOEA 1COWD 1HURA 4JJZA 5FR1A 1BIFA 1W2HA 3AH8A 3CF2A 1ZC4A 1UPTA 2VBCA 2EQBA 1X6VA 2R9VA 4LRWA 4M1OA 4PAQA 3PUZA 5LD2C 3U3KA 1JQJC 2FNAA 1T9HA 1QZXA 3QKTA 2JLRA 3W8RA 3C14C 1QHXA 1R0WA 5JRJA 4QJ5A 5EZ6B 4W9MC 4Q9LA 1ZW6A 3N2EA 3RS7A 3C41J 1MR3F 1T4GA 4ASUA 2F1IA 4URVR 1H65A 1U8AA 3R9XA 1IY2A 3CF0A 3G82C 1G18A 1SXJC 3K9LA 4OQLA 3WNDA 4B75A 4D2IA 3DO6A 2ZRIA 1AS3A 2G88A 2HXYA 3BC1A 3QXSA 4UNPA 4LF5C 3BXZA 2HHHC 1N5IA 4DR2C 4I99A 4PTLA 5SZKB 4TQUS 3PV0A 2PJZA 1OV4A 3KX2A 4TLDA 4HAZA 4QNMA 1TQDA 2C78A 1G6OA 1G8PA 4OQNA 4OHWA 4C0AC 4V03A 2P2LA 4UNSA 2ZE6A 3AV0B 1ML8A 1YR6A 1KI8A 1OF1A 3TVDA 4JI0C 2L0XA 1IJFA 4QOSA 2KSQA 2ZYUX 2CL0X 2QMHA 4P3YA 4CEIB 2N46A 4RD6A 4UKDA 821PA 1GRNA 3MSXA 1LF5A 5H1YA 2GRJA 3H2YA 4TN1A 1X1RA 2D4HA 5FL3A 1NNEA 4KCGA 3MWLA 2J7PA 4BLRA 1CF4A 3U3OA 3CRQA 4V0KA 3ND9A 3VX4A 8OHMA 3DM5A 4TTPA 1AIPA 4C2UA 2EFCB 1N6OA 2E5LC 4IVQA 3RAPR 1KAGA 4DB2A 1D2EA 3A36A 1A1VA 4BWYA 2BBWA 1VHTA 2IX3A 1Z0IA 2QRNA 2HLDD 4PHGA 2VEDA 4QHTA 4V0LA 1J70A 2PEZA 2QP9X 1HNXC 1UADA 2ZETA 1N5KA 1I4DD 2OLKA 1FZQA 3TMKA 3HDTA 1DAIA 2O0JA 3P1JA 4YY3C 1PZNA 1JJ7A 2WAYA 3AVTA 1YR7A 3U5ZB 1MT0A 3IEVA 3RC3A 1AJEA 4M1YA 3R7WB 4RCYA 2O0KA 1EFCA 3NWJA 4LF8C 4LYHA 1OE0A 5L3QB 4GZLA 2CK3D 1UEJA 2VL7A 3B13B 5DN6A 4CEIA 5JECA 4UQOA 1AGRA 1N0VC 2EYQA 2WKPA 1AGPA 1H8HD 3SYKA 1E9FA 1XNQC 4Q21A 2ZI3A 2C98A 3GQBA 4QGFA 1G1MA 2PJRA 2NO9A 2GJ9A 1ZIPA 1TU4A 4DV2C 5CM8B 4DR1C 4Y0VA 5CDFE 4PO9A 1DG3A 4C0LA 3L82B 2YVUA 2ZUCA 3J80D 4B3SC 3CWQA 3QF7A 4HB0A 4Q19A 1KDRA 4FD2A 4E09A 4AKIA 2B7CA 4NH0A 2FGKA 521PA 4B74A 1Q0UA 2FX3A 2GF0A 4DV1C 2UXBC 1E0KA 2P6NA 2WPDA 3BOSA 2VHTA 2CEAA 4GFDA 1P62B 2QPOA 2BBSA 1U81A 2GEDA 2P0EA 3VR1A 2W2VA 2D3WA 4O25A 4Y0AA 3VHLB 1OKKA 2ZTSA 2BCJQ 3LW8A 4JL5A 2AXPA 5AJYA 1ZMXA 2F3RA 4D81A 5K8UA 3U6KA 3GMTA 2FDCA 4DXAA 1B0UA 4U00A 1G5PA 3TK1A 4XVRA 4IXNA 3QXXA 4YHHC 4LV6A 3TW4A 1R6BX 4X64C 4PHHA 1NL3A 4GKKC 4X8OA 4RCZA 5L3QA 4KSBA 5BYJA 2GESA 1KO4A 2WVJA 2XTZA 4E22A 1QBKC 1I94C 621PA 1EFRD 3KQHA 3I5XA 1OW3B 2CHVA 5GJCA 4D4JA 1SVKA 1Z2AA 4S2EA 2DPXA 4G5SA 4HZIA 3THXB 5IWAC 1S1CA 5K8LA 3TBKA 3VFDA 1NVVR 2YOHA 2FWRA 4LV8B 4ZO4A 1GSIA 1XBTA 5TMPA 2OEPA 4DRZA 5H68A 4BQSA 4BFXA 1XMJA 4YONB 3IIJA 3T1OA 1T5LA 4B3DA 3UG7A 2VQEC 1NF3A 4HDOB 2GXSA 2WSMA 5DLQC 1GL9B 2R8RA 2PT7A 2YWFA 2LKDA 4ZDIA 3B1ZA 4LJ9A 4YQFA 4JS0A 1GL7A 2BJVA 2FFAA 3IHWA 1SGWA 4OL0A 1GOTA 1NBMA 4NXMC 1RRGA 2E9SA 2RGDA 1J7KA 3F0TA 3FMFA 4HUQB 3AVOA 3EXAA 5B58C 1SHZA 1N0UA 4AI6A 4KU4A 3TAHA 2ZS8A 5CM9C 3L0PA 4EPXA 4LYJA 2G9NA 1ZNZA 4D80A 4EPRA 4JL8A 5SZJA 4PAOA 2FSHA 4HZUB 5EQTA 3ADCA 2RGCA 1KI9A 1WQ1R 2EU8A 4GP7A 3GJ7A 1CR1A 3EASA 4XVQA 5A5GA 2AL7A 3H1TA 1W7AA 3LV8A 4B3XA 1TQ6A 4M1KA 4DSTA 3K9NA 1KSGA 2XZLA 3KQKA 1G8YA 3THXA 3ICQB 1E9BA 2R62A 2RHMA 4M1MA 4PQYA 1JALA 4II7A 2AFHE 3KKNA 4M53A 2VLIA 2ORVA 1DAGA 1X8JA 2XJ9A 3P20A 2GK7A 1HV8A 1IN4A 721PA 4Q9KA 5CK4A 4WVFA 4OHZA 2IK8A 2ZI5A 1HE1C 4DLTA 5JJKA 1OPXA 2FU5C 3WNCA 4LHXA 3X1YA 1BYIA 3OTOC 2IS4A 3GJXC 1AM4D 2ZE5A 1E79D 3EA5A 1FUUA 3VAAA 3KFVA 3CR8A 3K0CC 2ZRNA 2QP4A 1XP8A 1G8FA 4RD3A 1DBSA 4KSCA 1T8UA 2JJ1D 1L4UA 5AR1A 4HUQA 5L3VA 4AIIA 3QF4B 3I5YA 2HF8A 2BEKA 1KDOA 4DV4C 1QHSA 1OH8A 4HLDA 3NDPA 3QUSA 3KKQA 2VP9A 1LS1A 3TAUA 1G41A 4DR3C 2JJ2D 2VQSA 5EXSA 1TU3A 5JI3E 1EFUA 4HZUA 4TTRA 1OIWA 3GLFB 4ON9A 3K09A 2XGJA 4DJTA 1HUQA 1V43A 1AKEA 1UM8A 1VCOA 3NDBB 1PUJA 1WXQA 3TW8B 1HEIA 1TEXA 5KPJA 4P31A 1II8B 2RB4A 1PLJA 4C4PA 4AC9A 2ZRLA 1MOZA 4ITRC 4RKFA 3U7EB 2EFHB 2WSSA 1XMQC 4DV6C 3A4MA 2B8WA 1Z29A 3NG1A 3VR3A 3DL0A 3W5IA 4DSNA 5J4VA 2QMOA 5B57C 5HTKA 3D8BA 1W4CA 1Z0KA 2D7CA 4LPSA 1ZM4A 4FINA 3BK7A 4A92A 4IJMA 1G3MA 4JLMA 3AUXA 4OHYA 1N6KA 4MYTA 3SYLA 4KV9A 4F38A 1IBKC 1U0JA 2ODWA 2OESA 3NBYC 5FL7D 4ESVA 2XB4A 2IYQA 1OT3A 3BH7A 5JI2E 2XTMA 1K6MA 3C7KA 1N6NA 3GFPA 5KDDA 5AUQA 1N34C 4YDSA 4ARZB 3EPHA 4DLRA 4DUGD 3LXXA 3QF4A 4P32A 2VQFC 1NKTA 1M7BA 1U99A 2CLSA 1E9CA 2ZI6A 2F1HA 3KZ1E 4MGKR 4BZQA 3KXKA 5F9FA 3SQXA 3BH0A 1XB2A 3QKUA 3GLFA 4HSEA 4DWJA 4D26A 2OCYC 4DR7C 1FFHA 4RKEA 3UMRA 2YNMA 4Q4JA 1II8A 1FL9A 2O8CA 3CF6R 1KI7A 2ZSFA 1COWA 3TSWA 1C9KA 5CYOA 1IN5A 1QRAA 3SI7A 1CJTC 2OILA 4G3XA 3WMGA 3ZH9B 4L4UA 4RFVA 1WMSA 1DTSA 1K5DA 1VG1A 1E2FA 2EFEB 4KBFA 1JPNA 4LYFA 4M0LA 4TT3D 3RANA 3S1AB 1QVRA 1WB9A 3QVUA 4K46A 1DO2A 1Z0DA 2W83A 1Q44A 4QBHA 4DCNA 4TL7A 5CLLA 4RZ2A 1S96A 4LJAA 3A37A 5IRCD 1IBRA 3LVRE 4WW0A 4ARZA 2OBNA 3N2IA 3NHBA 4L9WA 5JFGA 1JNYA 4JBWA 5E7MA 2JATA 2AD1A 2NZ8A 3Q3JB 2D74A 4URWR 2WJGA 1Z06A 2OZEA 3X1WA 5JHGB 1PVOA 3BBPA 1P72A 1RE0A 2ZSEA 3ZS9A 3B5JA 3M1IA 2EWVA 1PUIA 1G20E 2QM8A 2ZRDA 2ZSBA 4M1TA 2AHOA 1NJFA 2Z4RA 3LLMA 3ADBA 3U61B 4JI8C 3E1SA 2EGTA 3FGNA 3ZYCA 1AQYA 1RZ3A 3BORA 2A5GA 4OHVA 2BDTA 4BECA 2LWIA 1ZINA 3K0FB 1KOFA 4Q03A 1KMHB 3RS4A 2JA1A 3FHTA 1W36B 1ZC3A 4N0EA 4KVAA 1GTVA 3W9YA 4BLSA 3ZZUA 1U8YA 3DVLA 3QNUA 4TLBA 2FPLA 1QF9A 1ZM7A 4GDFA 1W0KD 1JAHA 3QQ5A 1XCGB 3S1AA 3A4LA 4FWIB 1L7VC 4NDZA 1D9XA 4TMKA 4IDOA 1T8TA 1IN7A 1E6CA 1GNRA 3DHWC 4DR5C 3Q85A 2UUCC 2YINC 2HLDA 1SKQA 2BMJA 3PUVA 4JSTA 3TLXA 4AKGA 4PQFA 1W49A 2BMDA 3ZIAD 3A1UA 1SULA 4F7WA 2VSFA 2QT1A 5F3WB 4YMSA 4AKEA 4Q4AB 1NN1A 4LFBC 1E99A 3W6OA 2NGRA 1EFTA 4TQ9A 2G6BA 2BCGY 2GXQA 1KZGB 3GKUA 1VCIA 3V4FA 4JVSB 4L8GA 4F93B 2CK3A 4KHZA 4ZV4A 4LHZA 1Q57A 2N42A 3RS3A 2WKQA 1EG7A 3K0FA 3WHLA 1KMHA 1GDDA 4B2LA 1FP6A 2WPDD 4DV0C 5A2QD 1VYVA 4Q47A 2XNDD 1EWQA 1D6JA 2OCAA 3BFXA 2YYZA 5TY0A 1X3SA 5EE3A 3ZVLA 1SVLA 1R5OA 2GCOB 1VLAA 1Z47A 3V9PA 4KFSA 4B33A 2RAPA 1ZD8A 3LXRA 2BHRA 2RMKA 1DAHA 4XSHA 1KAOA 1CEEA 1W0JD 2X19A 3AVQA 4G5OA 4HAXA 4QHYA 3JVVA 1GITA 5FOVA 4Q00A 1R8QA 4X65C 3FHOA 5BQ5A 4TZ6A 1TQ4A 1U94A 3DPUA 4NBSA 4UXIA 3GLFE 3RVBA 1UBFA 5JHHB 2QRZA 3GLHB 2VF7A 3SHFA 4C9BA 3U7HB 4Q4AA 4KVGA 1IXSB 5JZVA 2X1VA 3EZ7A 2BEJA 4QXAA 2J87A 4BFTA 2BMEA 4BZPA 3EIQA 3BRWD 2JAQA 2ZVPX 4JYAC 1QHNA 4OYHA 1GM5A 2GAOA 5GVRA 3WYGA 1EFRA 1AN0A 2IXEA 5G40A 4R2IA 1VHLA 5TDHA 3VX3A 4KO8A 5E7IA 3SFVA 2NO1A 4WXRA 1QWIA 2ZRKA 4JZKA 3GPLA 2OCPA 2V6JA 5LMNC 4A2QA 2W6ID 2GCOA 1AS0A 4BPBA 2JMPA 1RYFA 5FTLA 1N2CE 1XTRA 5HKKD 1Q1ZA 5DE3A 3ZDQA 4EFMA 2ZI7A 4JBYA 3BIFA 1NBMD 2VHJA 1SVWA 1VIAA 1RFLA 3CUEF 2RH5A 2W2XA 3EZ2A 1IY1A 2H17A 4HYYA 1U8ZA 1ZD1A 1ZJ6A 5LB4A 4FIDA 4OHXA 3B6EA 1A4RA 3ZJYA 2VSXA 3TE6A 4AURA 3VR6A 2OT3B 2JLWA 1IXZA 4NHOA 3VKHA 1NSTA 3JAMD 4EPWA 1SKYB 4HATA 1W48A 3GLHA 1F2TB 4WXPA 5E95A 4Q02A 5FI1B 2RGGA 3UPUA 1SXJE 2FPMA 4B71A 2QTHA 2REOA 4BFZA 3BAFA 4TL8A 1KK2A 4HEJA 4NCIA 4WIAA 1OIXA 1IXRC 4L5BA 2V6IA 4JV5C 1I4TD 2VH5R 1DVRA 2C5LA 3OE7D 1JAIA 3AF0A 1IONA 5E3HA 4A82A 2G0TA 1S2MA 4C0JA 3CM0A 3T5GA 2NO7A 2B21A 2A9KA 1T3LA 3MMPA 4ZPXA 1VDZA 3THWB 3LD9A 4Q9HA 1E2LA 3MJHA 1ZUHA 3K09C 4LF9C 4HLQB 2ZE8A 2AK2A 2FA9A 1CS4C 5KSOA 3Q7QA 1NIPA 4A8JB 4MYCA 1UDWA 4NXNC 2QT0A 4LBVA 1KI3A 4FWTA 1F5NA 2IHYA 4XH9B 4I1VA 4NYMQ 2FEMA 2F43B 3IO3A 2WIBA 2C99A 4MKIA 5TXGA 1E79A 4DIDA 3O8CA 2GNOA 3CNNA 4BLQA 2FFHA 3AF5A 4ZDKA 4LX0A 3AVXA 3Q5DA 3QG1A 4BRUA 2JJ1A 4URZR 1F2TA 4MUBA 4BFSA 3PEWA 5KSZA 1Q3TA 4M1WA 3KXLA 3HPRA 1YR8A 3QKSB 2C04A 2ORIA 4IRUB 1UEIA 3UMFA 3V4RA 2XAUA 2JJ2A 3LO5A 2HEIA 4GP6A 3DZ8A 4YMWA 4MKGA 4NKRA 3I73A 5A4JA 2R44A 1NMYA 1I2DA 2VP4A 3KUCA 4MRNA 5DHAA 3WBKA 2IYRA 5F2EA 4A0RA 4PC6A 3K0CA 2OFWA 1XPUA 3A1SA 3THWA 2GK6A 3QBTA 1TEVA 2DFLA 3FMPB 1UBGA 1UAAA 2HCBA 3K8YA 3NHAA 1E2PA 3I3SR 1G3IA 4GMDA 2IXGA 3BD9A 3GEHA 1S3SA 3NBFA 1M7HA 4LC1A 1Z22A 5FTMA 4CT5A 3RLFA 5C18A 3K0SA 4MRRA 2B7BA 4V0NA 1XFAA 5FL7A 4Z8YA 2ONKA 2F43A 3B78A 2X8AA 3MGCA 1E2GA 4GZMA 2Q0HA 3WBJA 4DB4A 1VTKA 3VNVA 3FKSD 2V1UA 4DEXA 2ZR9A 4LF7C 2R6DA 4LPKA 4M22A 2V4ZA 2GZDA 3TKLA 1EESA 4KAXA 4DUGA 3U4QB 3AVWA 4B3CA 3CPEA 2JJ8A 4QHSA 3NXSA 3SJZA 1VG9B 3NBXX 3QKSA 1NG1A 4FN5A 5DI3B 5LDDC 3GLIA 2FF7A 3T5DA 1VG0B 4JI6C 1OFTA 1XTJA 3JZAA 3AGPA 1TTTA 2GDJA 1AK2A 5HZKA 3HWSA 2IA5A 2DWQA 4B3RC 3KQNA 4BZXA 2AX4A 3NVAA 5IF9A 5KNCA 2F6RA 5ELXA 4Q4LA 4IEIA 4GPTA 4RFSB 2PZFA 2MSEB 4K8OA 3L0IB 2A5DA 2HF9A 5FOWA 2HXSA 4HB2A 4TMWA 4JI5C 3HYRA 1DAFA 4AG6A 2ZITA 1P75A 2H5EA 3M0EA 1NKSA 5UKDA 2DYJA 3JVUA 2GCNA 2IYVA 3CNLA 4TT3A 5BN4A 1MV5A 4PX9A 2PLFA 3GLHE 4A4DA 4DC9A 1TADA 1TUEA 3KB2A 3MUFA 1DEKA 2OXCA 4M4SA 5FPYA 2QMUA 4CZ2A 1VCMA 1FW6A 1JR3E 2JIZD 3U4QA 1Z83A 3IBYA 4CVNA 5J47A 1KK0A 1TMKA 1G7TA 1ZAKA 1KJWA 5FR2A 4B44A 1DAEA 2R6GA 2J41A 5DI3A 4JLNA 1DOAA 3D6TB 1E4VA 5EXXA 2AXNA 1T5IA 2GETA 1YZQA 1XD2B 2Z6VA 1KK1A 5B30A 1ZUNB 1ANKA 4JT4A 4FI3C 2GZHA 3TR0A 4B3MC 2PZEA 3P27A 1GKUB 4LHVA 3QKRB 2A5JA 2OUKA 3R20A 3Q5EA 1MO3A 1MO4A 3O8RA 3ZVNA 3HR8A 3RS0A 3AVVA 1IHUA 2OM2A 5G3YA 3KJIA 4RFSA 1XXHB 2PT5A 3ZGXA 5JJIA 1RC8A 2O8BB 1KKGA 1ZCAA 4DEYA 1WA5A 3CX6A 1F3OA 2CJWB 3U7FB 1NY5A 1OXVA 2BWJA 4B3GA 2XITA 5BXQC 1W0KA 2C77A 2DHRA 5EP3A 4BEJA 1DADA 1N6IA 4DDTA 4PANA 3R9IA 3KKMA 3AF4A 4L16A 4IXMA 3VKGA 1W36C 1EX7A 3OAAD 4JT2A 2DBYA 5TV2A 3RRNA 5LMUC 2XB2A 5BWMA 1W2GA 2QPTA 3HJNA 1VCNA 1VYUA 1TL7C 4MRVA 4AYTA 1PJRA 1IBMC 1UKVY 4GBMA 3ZVRA 3QEJA 2JEOA 2REXB 2ZRJA 3ZIAA
chains in the Genus database with same CATH superfamily
1MB4A 2G25A 4L4ZA 1D03A 1EFHA 3KTDA 3LF1A 3RK4A 2BPOA 4WEQA 2QAIA 3X2FA 4RV9A 5LQUA 1T29A 1GFZA 4YRBA 2YXNA 4EEKA 5EIBD 5A5EA 4PGHA 2JIOA 3M4YA 2QYSA 1G8AA 3AETB 3MMZA 5F76A 4EF5A 1HH4A 1XD2A 3OIVA 3BA1A 3P0FA 1VSBA 2D1FA 4KLZA 4PO3X 3FZYA 3KXIA 4LCEA 2K5UA 4HDQB 4MV6A 4WN9A 1X7DA 4E2FA 4YT2A 3KWFA 3OZEA 4Q93A 3A4IA 3Q3GE 2BFFA 5FBLB 1P0MA 2ZSUA 3RFTA 1ZM3A 1PT9A 1ZXXA 4KDEA 1WUHS 2YOFA 2Y77A 1UJ4A 1JU9A 2R6ZA 3ETLA 4IXTA 4B47A 4PY2A 1N33B 2AD5A 2OHOA 1H6BA 1QV9A 4IUYA 5A2QA 4DMMA 4FB5A 3MINA 2ZSDA 2H08A 5JBQA 4N48A 4MV9A 2O8BA 5T5QA 3R6GA 1KFCB 2EX4A 1Y4DE 5MN5A 1FS6A 1HNZC 1L4EA 1FLVA 1H2FA 1UZAA 2GD6A 4WHMA 4HNAA 4C3ZA 2D1SA 4Q4HB 2ZIAA 4TVBA 5GV7A 4WY2A 5BYBA 3QNMA 4PYIA 1T26A 2XKBA 3R5SA 2XCTB 4EY8A 1L5KA 4D8XA 4B9EA 5FADA 1TMYA 3ZXYA 1QYXA 4WQMA 3AFIA 4Y9TA 4L0QA 2O2DA 3L1VA 2Y9MB 1P9LA 1KA9H 3R7WA 4Q82A 3PROC 3ZK7A 5IX8A 2ZS9A 1ZP6A 3TG8A 5H70A 5DNYB 1Z2CA 3F2IA 4LY9A 2ZRMA 2PKEA 5D6NA 2IHVA 3BWEA 2WLTA 4IEEA 4MYSA 3WGTA 5EKUA 1DRUA 2RGAA 4RABA 1OXMA 2BFCA 2DECA 2G7MC 1S2DA 2XUIA 5T8SA 4EG3A 2PN2A 1ZK1A 5AT1A 4F4JA 4X62B 4URYR 2GZAA 3CZPA 1CUVA 3QPBA 2I4OA 3ETJA 3TRFA 2YY7A 1Y1LA 2X1HA 4EUFA 5HP4A 1XNRC 1H2HA 1PJQA 3PHHA 2P62A 4I5DA 1RZUA 4RQBA 3T4XA 2E6KA 1WDKA 2NZUG 3IDQA 5IDVA 1DBRA 3O9MA 1DIRA 3D3JA 1K63A 4U0KA 4U7HA 3T0IA 1CQIA 1V3UA 4O2RA 4E1VA 1ADCA 4KFTA 2AC7A 4F8EA 3QMWA 3NLLA 2D28C 2KI5A 1ODCA 2JDIA 1YA6A 3HXQA 4IDQA 4QU8A 2AQHA 1ZD9A 1MAVA 1BJTA 3LBAA 1VSTA 4KP7A 2P77A 2R8XA 5HOEA 3BRCA 2NOAA 1RE1A 3SS7X 1YF3A 3IEUA 2ILVA 4ZCIA 3CNHA 4NU0A 5FDFA 1XNQB 3FETA 3LG2A 4UNNA 3JYOA 1OFUX 4QG7A 3ZCUA 4NPHA 2VSOA 4ZO8A 1F6BA 1LBIA 2BFWA 2BTQB 5F21A 3SN6A 3Q6MA 4EQ6B 4MKZA 3ADDA 5C81A 1AA6A 3QIVA 2I1QA 2GK3A 4HH4A 1Z2EA 3BJIC 4RM3A 1CR4A 2CJFA 5D85A 3MT8A 5K2MA 3ZKWA 3KUUA 3NALA 4EFKA 2HPAA 2IFTA 5J4KA 3GJZA 1KHHA 4X0EA 1ZMTA 4G4SO 4NZYA 4DARA 1PNVA 2WHYA 5H3HA 3DFIA 3W2EA 2MYNA 2BIFA 3T7DA 4XTRA 3BGDA 4ETMA 1G4HA 2ZS7A 1JFSA 5H8WA 4UHDA 1KC3A 4YP6A 2E0GA 3MG9A 3X1ZA 4I2VA 1U2PA 3N2KA 3QEKA 3DL2A 3V8MA 1F8XA 5LCIA 2C2GA 3BSWA 2HSGA 3GRKA 4KDCA 3ZU5A 1Y3BE 4LE0A 1PI3A 2IE0A 4B4WA 4CKXA 4YLGA 4P7KA 4BIMA 2HIMA 2DKNA 1DU4A 4K3UA 4QM6A 3KC2A 3C15C 1U0GA 4QYIB 2XKKA 5EIFA 1UM9B 4OJYA 1A82A 2HRQA 2J3IA 3OCJA 1BS9A 2OHJA 5GIOE 3LUAA 2O20A 2OMEA 2JGFA 2WMOB 3QTTA 2RHBA 5TT0A 2IH2A 3L0YA 4CG2A 2YY5A 2WJIA 1M34B 4FS8A 3O92A 4M1ZA 3VNUA 4HRVA 3SZOA 3ILSA 1EK0A 2JLYA 1DELA 1NUAA 2OK7A 1Z4JA 4HR7A 3VOBA 4LJRA 4US1R 4AJ4A 4YQEA 4J1QA 1RQ2A 1QFZA 3WOHA 4RK5A 3SEZA 4E4TA 2IP4A 5CEJA 5FI3A 2GMWA 4I6EA 3BMXA 2B2NA 2PN1A 2FGJA 2IEDA 2QRLA 4H4CA 4JOQA 4YCCA 1TKBA 2NYAA 4CKWB 1F4LA 1W1UA 3E5NA 2E6UX 1XR3A 3L7IA 2CVOA 2X9GA 5JH7B 5BV1A 3HM9A 4DSAA 3BRSA 2KBEA 2NZ2A 3JZMA 3SKXA 4RHUA 3U4DA 6Q21A 5I9SA 1P7CA 5CTJA 3T06B 5C1DA 3WGIA 1V9SA 4KI0A 4WNAA 1YDHA 2IHKA 2QQFA 1P4SA 2ZJ5A 3MN1A 4P7BA 3THSA 3HP1A 1USPA 3WLRA 3SPXA 1JFFB 4UOQA 1XPRA 2LCFA 3GL9A 4DA0A 4TXLA 3IESA 3T5PA 3AIMA 1LLCA 3QBVA 2Q9AA 3STVA 4CRWB 2YZ2A 3BWYA 1HR0C 2WHRA 3F6SA 1NVVQ 3BZWA 3EZFA 1BO6A 3LUGA 2VRWA 1KO5A 5B1EA 1GSAA 1K3TA 1CQZA 1RRKA 3G2PA 4F92B 1P29A 3EBPA 5EZYA 4CL0A 3OJXA 2QUAA 3PWZA 2FRXA 3SEFA 4CYMA 4EPTA 3OA2A 4ER3A 1HA3A 1II0A 1X1BA 4UHFA 4YJ2F 5AKXA 4M49A 3KTAA 2CV1A 1DBWA 1KSFX 3CW8X 1JDUA 4AAYA 1NYRA 3ZK9A 1XEFA 3DW3X 3LHSA 3EDQA 1K8YB 1GUAA 1L6RA 3KELA 2DR0A 4KO2S 3M9XA 2HBRA 1Q17A 2GWRA 1O4VA 1UKEA 2WF9A 2R6FA 1X1SA 4TRJA 4HPWA 1QF7A 4ME6A 3WYFA 3HKDB 4B81A 1ECBA 4AY3A 2GH1A 2YL2A 6REQA 3AKYA 2EG9A 1Z4QA 1PJSA 3PIRA 4W9NC 2VPQA 3VNBA 3I3OA 5CA1B 2JGJA 3R4VA 5G1NA 1XK7A 4Y3UA 4AZ0A 4J0CA 3D2AA 1ZN7A 3H4MA 1FYXA 3L8HA 3GG2A 2IOFK 4LJYA 1FA9A 4MWEA 4JYZA 1EM6A 2HIHA 1JQ5A 1FP4A 1TUBB 2OV4A 4PUHA 3AJ8A 3WNVA 1EDDA 3OEYA 2GPSA 3EAQA 1TW3A 1Y34E 5GTDA 1C1HA 4FZ5A 1L7XA 1KNQA 1U7WA 1RCUA 4QFMA 2WV7A 3OE1A 4XWAA 1DNPA 1VJ0A 2WUWE 2HSZA 2QG9A 2Y93A 3OT4A 1XX6A 2HT6A 2IZ0A 3EWSA 4O2AA 3VNAA 4UTPA 3VNSA 1CUZA 1GZSA 1RKVA 5AM2A 4EUHA 2EOAA 4RPCA 3OTQA 2B4YA 1HDZA 4KR6A 3HZOA 2Z8YA 4Y0NA 4BP1A 1DKUA 2JFXA 4HF7A 4U6QA 4XYGA 3S2ZA 4MS1B 2ZZMA 4Q1EA 5EKDA 1E7YA 1P0QA 2WAAA 3JD3A 3AZPA 5I9LA 5FAXA 2YWDA 2P9JA 5TE9A 3W4IA 3AM1A 1VPTA 2GPAA 3I6ZA 3IBSA 2I6XA 4AN4A 2AFIB 3UW3A 3VVBA 3W6PA 1ORHA 2JKYA 3RRJA 5FJIA 3D6AA 4NH4A 1NYEA 3EEBA 2PGIA 3UA3A 1A7JA 1HQCA 3T1QA 3MRXA 5LSAA 4WOPA 2Q46A 4M6WB 1ZR4A 1KFEB 1NVUQ 2R47A 2QIPA 4F4DA 4NZZA 1NU6A 1W2WB 4ZJZA 2JHAA 1UFQA 1QKJA 2OXEA 4NCAA 5JNTA 2AMLA 5ES4B 3PNVA 4RJLA 3BQNB 4EKNB 2G9QA 1G63A 4XDZA 3I8XA 4RIFA 1WHTB 4JI4C 4HEQA 4NFYA 3GJTA 1E2HA 4HAUA 4J0KA 4KOAA 5T67A 3JQ7A 1G6HA 3V5NA 2G36A 4C7MA 3BWXA 2XQJA 3FPHA 4OVKA 2BJOA 3CMCO 4DV7C 3HBNA 4LFAB 4TMXA 1KFJB 2FK8A 3A9RA 4X66C 4TZ0A 2AMJA 2CLIB 2Z57A 1AF7A 1KDZA 2F90A 2Z9CA 1IM2A 3OI7A 3F7TA 1K06A 3UJ6A 2MINA 3HDJA 5AI9A 1E60A 2H0RA 4K81B 3WHIA 1A77A 4QJ3A 1QFSA 1OX5A 1T0HB 4KXWA 3GELA 4NCJA 4G1EB 5AHOA 3VTKA 1P2UA 1UXHA 1H4VB 1YKSA 4ARSA 4BMDA 3FPBA 4HXYA 4DMKA 1CS0B 1IB8A 2ZJ1A 4RJTA 2VCYA 4WFIA 4DA9A 1G9SA 3CLSD 1R18A 1DKPA 3DPIA 1PU1A 2BMVA 1T24A 3BB1A 2OFXA 3MLBA 5GINE 1WPXA 1RJ9B 3KVYA 1GA1A 1KO1A 4UMFA 2R6R1 2QD5A 2KB0A 3BMQA 5AVXA 2ZDQA 1L4MA 3RRMA 3HB1A 4F5EA 4ZHQF 2YN0A 1C3VA 4F86A 2R25B 4PLGA 1KR5A 2PT6A 2XRZA 2VAWA 4UEQA 3LNOA 4DPKA 5K0JA 1S3IA 4ERXA 4WOJA 4UQLA 1GGMA 2ZWPA 2GJSA 1GU1A 1PG0A 1JEAA 1Z4LA 3V32A 5IXSA 3PHIA 2JFNA 2Z4SA 4X5OA 3G68A 2WU8A 4GX0A 4LRYA 4COOA 4EMSA 1E3TA 4RSMA 1TF5A 4TLAA 4IHAA 2D5BA 4PBRA 3DMFA 1WXDA 4HMPA 1BDBA 3W5JA 3FAZA 3RIGA 4LSMA 3CKLA 4PAMA 1I2ZA 1XAJA 4Y30A 3FCOA 4KN5A 3TIXB 2XNKA 4BN4A 4DMCA 4MK4A 1I7QB 5BMVF 3LO8A 2VP5A 4DMGA 3FMGA 4BNMA 3DTTA 3IQGX 3KKKA 1I6KA 2BMFA 3HY3A 3IVAA 3H5WA 2PMKA 1VM6A 2HGZA 1EE2A 1LLQA 2ACEA 2GASA 4G9EA 4PX5A 2QVLA 5FT9A 3TD2A 3TYXA 3GJQA 2G4VA 4KUGA 3R0QA 3G8YA 2WMYA 2WG0A 3Q6NA 4J0EA 1J06A 1WSAA 3I42A 2ROQA 2ZPAA 4PXAA 3SVLA 4JI1C 1IN8A 3GHHA 4FCTA 1YA8A 1RI5A 3EPRA 1OX4B 2DXIA 3RVPA 1AUQA 2OTCA 4I19A 1JEYB 1R8YA 3N0WA 4HQLA 2I6SA 1M6NA 2Q3MA 3LX6A 4LCJA 3IQWA 1PG3A 2D06A 2CL6X 3MUEA 4BXOA 1JAZA 1SY7A 3H9UA 3O94A 3IILA 3W5HA 2FE1A 3OUTA 2GVZC 3DDNA 3LFTA 3SU8A 5M34A 1VIYA 2Y1GA 2AWNA 1NV8A 1TKRA 3RODA 1PR9A 5JZMA 2H85A 3WLHA 5ANRB 1L5YA 4QSMA 3REOA 3VC7A 2RE8A 3ZZ0A 2PL1A 5DOVA 2VVTA 5HS6A 3EQ6A 2BGTA 4WN3A 3OQ1A 5CZVA 2PRIA 1USVA 2C9OA 2PGJA 2UZ3A 1NXPA 3J7TA 3HS3A 4RACA 5A05A 3UTDA 2GHIA 4BC1A 1ZICA 1IWPB 1M2HA 4MV1A 3L4BA 3IKLA 3I9JA 1Z12A 1Z0FA 3QJGA 2F8SA 1XMSA 2JDID 5G0SA 3H8WA 3O47A 1E7QA 5JJBA 3L8CA 1ZM2A 3DM9B 2KS6A 4HWTA 5KOYA 4YDRA 2FTKE 1MB2A 4B85A 2ZIZA 1BCSB 3KJEA 3A9VA 3MC1A 5DTQA 3G7SA 4HFJA 5G3ZA 5LJIA 3TIIA 3M83A 5MF6A 2O7QA 4GE0A 4D41A 2VYNA 3FVWA 1GNPA 4O4HB 1GZ6A 2XTJA 4PSCA 4FBLA 3W3AA 4TL6A 5FOTA 4DLSA 1QG0A 2W58A 1M0EA 5JQGB 3AEUB 5EWJB 2PX8A 4JASB 2AI1A 2AEJA 4RJJA 7REQB 4D5EA 2E4WA 3B2EA 2UVPA 2FOLA 3CZAA 1XVTA 3PQ7A 2CNWD 3KOOA 5LQCA 2QR3A 2KW5A 2QA5A 2ZWOA 3KV1A 1F1BA 1NI4B 1NT4A 1JJAA 4CLHA 1AKUA 3ZZMA 4TWZA 1YR9A 4FEEA 1V8ZA 4RQTA 2AKAB 4WFKA 4HNSA 1ORDA 2UV8A 3WDLA 4H3KB 4C5AA 3ET4A 3KZKA 3K8ZA 3H5LA 2QE7A 5E7JA 3UK1A 3WOVA 4ALKA 2FW6A 3OEEA 3HUTA 4H7HA 4DNOA 3SM3A 1UAYA 3K9CA 1BMDA 2G80A 4JB0A 3G2JA 3KWLA 3UJDA 2VNAA 3W2GA 3WP0A 3GRRA 1DHRA 2R6CA 2RHLA 3C8MA 5HEKA 4P82A 4OGGA 1FJ2A 3ENZA 1JJFA 6ADHA 3QXCA 2QLMA 3IERA 4X44A 2ZRPA 2QTAA 4OB8A 5EPEA 1BEEA 3CNQS 3OPXA 1AMUA 1NYLA 4MI9A 1YIAA 4XSVA 4EJSB 1SG6A 1S2LA 1HGXA 2OHFA 3PGVA 1CVIA 1SIBE 4EY4A 1KP9A 2H4XA 5TEVA 4JI7C 3TJMA 5F52A 1TIPA 4NC9A 3PWTA 3TIFA 4PYQA 3TSOA 3OCZA 4FLMA 1E1YA 3CZQA 3B52X 3J81D 3G0BA 4FN4A 1PT8A 1ZNWA 3KSUA 4IJ5A 2OC4A 4RY2A 5D3MA 3V1NA 1ZD5A 2DFTA 2DWPA 2PUWA 3G8BA 3RWOA 1NP7A 1JG4A 1UKZA 4BOYA 1TF2A 1QP7A 4MITA 4HQ6A 3ED5A 4AL4A 2PANA 1AQUA 1HRDA 3KQMA 4JD5A 1PV1A 2YFQA 4C89A 5C8YB 1E8DA 4B48A 4EB6B 3CCCA 1G17A 4D0LB 2XVAA 3OTGA 1OTHA 4GPZA 4ZYVA 4PLPA 2WZBA 2CE2X 5GOTA 3PSAA 4JIGA 3SS9X 1O9HA 1QG4A 4IYRA 3E8XA 1E2NA 1WE2A 5B1DA 4JBXA 2QJTA 4XWTA 5F4BA 3OP1A 1IIRA 3T9DA 4DADA 3NUGA 1OQAA 4MUMA 2Q5LA 2AKYA 2YS6A 1P9OA 2PD4A 3M6VA 3WQQA 4BKPA 4C07A 2PM8A 3NIDB 3FB4A 3NTOA 5IYZF 2OV2A 2VPTA 1MXAA 4AZVA 4DLXA 4K6KA 3M6AA 4YCDA 2A4MA 3P2YA 1NXXA 2QI9C 2ZRHA 3FJYA 2UAGA 1KARA 2OBXA 3OSUA 4CTMA 1B6GA 1D5CA 1NNSA 5ITWA 5LL6P 5AHWA 4BN5A 5IT9A 1XAHA 3DHNA 3N59A 3AHCA 3OHPA 4I7EA 4Q6WA 5PGMA 1FLNA 1L4HA 1AURA 1UK8A 1XZEA 1Z38A 3ONDA 5LOVF 4FTFA 1MNQA 3U44A 2CHQA 1Q2XA 1HI9A 3WMWA 3X1MA 1E6LA 4BO0A 4CM9A 4QPPA 1H8ED 1Z0AA 5BW8A 3BXFA 2IEGA 1T1EA 3UJNA 1QFXA 4KNYA 5I51A 5IXJA 2ZB8A 1NVKA 2H6EA 2P4HX 3ROKA 3WYDA 2QMEA 5U9CA 1IH8A 4POOA 4DSUA 2GTHA 3BXPA 4I8IA 2C7PA 2WINI 2BAGA 3V1LA 4DJFC 3EBLA 4RY8A 4DIUA 1G21A 2O8DB 1QZZA 3JY6A 3QPWA 4C30A 2FAXA 3ZZ1A 4CUJA 1Z4OA 1NRJB 5ICGA 1Y8QA 3DVQX 1UDAA 1A2KC 3VJRA 4JJAA 1L8XA 2QG6A 4JN6B 3BPSA 2F3SA 2DP4E 1H2RS 1ST2A 3CEHA 3MMSA 2E18A 4YAEA 1E1RD 3I32A 3IIKA 2VZ8A 1YJ5A 4PE5B 4JLVA 1WTAA 4LF6C 3QE4A 1UZMA 1KP3A 4D3ZA 5ICEA 2DR2A 2AG1A 2FRVA 3HU1A 3FNGA 3GJ0A 1GL3A 2C82A 1X3LA 2DJIA 4XYBA 4WBSA 3VU8A 3A4NA 4OMFG 4BQRA 1RAIA 4LXUA 3VKUA 5CB6A 2GBFA 3RW9A 1P2GA 1RW4A 4X8HA 1O0SA 4IR7A 1B6SA 3ISJA 1S1MA 2J30A 3TZLA 3HBMA 1P2FA 3IUYA 4ZYZA 5JO0A 1R37A 5FI5A 3ABIA 1I0IA 1T25A 1E96A 5F1OA 5B2ZA 3H5OA 1JSRA 4TKZA 3O8BA 4K86A 4Z3DA 4CCYA 4O4IF 1R15A 2WB4A 4UBKA 3B9QA 5SYMA 2RHCA 5JCOC 3HN6A 2UU9C 1EBBA 4KXXA 3A3PA 4OG2A 1XMXA 2JFWA 1N2ZA 3L7KA 3U4AA 5JW6A 4TZTA 3GU3A 5JSZA 2KJQA 3QW2A 3FWKA 3HYLA 2AFHB 1KZ9A 1VSVA 2P3SA 3BL8A 4Z4CA 3LDAA 2WAOA 4XKJA 2O0LA 4PBSA 2RI1A 3ENVA 5DBIA 4TSRA 3ZHSA 4IDAA 2JHGA 1YU6A 3V00A 2HH9A 3OZXA 1JYSA 4DHWA 4POAA 4F06A 5FF9A 3EZ9A 1AKWA 5JVDB 4W1RA 3PQCA 3DV2A 4UATA 3NGLA 1RACA 2IYLD 1HT1E 1N2SA 2HIGA 3FJ1A 3IJ5A 4M76B 4MKHA 2BSQA 1KSJA 3P19A 3ROMA 2CCKA 4FW8A 4GX2A 3EFEA 4E15A 5BSRA 1KY2A 3KLBA 1JHVA 4A5OA 2C2ZA 3O83A 3DWGA 2JHCA 4QU5A 2JGLA 3N8HA 4CDRA 5DM0A 1GN8A 4EJFA 2C5AA 3W5VA 1WSBA 4CTJA 1JR2A 1RRCA 2A14A 1M9NA 1SC3A 3AY6A 2J0UB 3O0TA 5JCPA 5LNK1 1Z6GA 3HLYA 1NQTA 2HJVA 2H18A 2MSDB 1ZI6A 3CZ9A 5DNUA 5K0GA 4K0KB 2P8SA 4BAGA 4ZQEA 5JXWA 5HG0A 1O9TA 3T9AA 1SBCA 5JZOA 5LMCA 5KPDA 3PLAE 1SKYE 4IFEA 4FJ1A 4C2TA 4L57A 2FLVA 5WRFA 1P60A 2PO5A 5BN1A 1YQUA 2CXTA 2BRUA 2O2CA 4YJ3A 1VIMA 5BSVA 1Q95A 1QIEA 4A5SA 1HC7A 2PCJA 4B34A 2IU6A 2IEIA 3NRJA 5KI6A 1N2IA 4BO3A 1W5AA 4D46A 2JCGA 2ODAA 2QQEA 1JGTA 1I3LA 2IU4A 5DK6A 2OWEA 2E37A 3A6LA 2PAAA 1KWGA 2VG8A 2F9MA 1U31A 1FF9A 3ZWAA 2WYWA 4AQYB 4FOOA 1NVFA 4GQAA 3KKOA 4R69A 5K51A 3C85A 5DGHA 2I4TA 3V4PB 2VTDA 3QX3A 1ENYA 2FPUA 3PT5A 1C0KA 2ORYA 3LUPA 1RRPA 3F74A 3M6FA 4DYHA 1XTVA 1W88B 3K1YA 3BA6A 3JQAA 4L2IA 1WAMA 3F5FA 3A11A 4HVAA 3DONA 2Q7OE 2PU5A 3E8MA 1HZZC 3KPYA 5FYQA 4H31A 1YDGA 4N8EA 3KCQA 3FOFC 4QGHA 2QLJA 4DM3A 4KQJA 4NQZA 3G1WA 1IQPA 1C4OA 2V8OA 3GROA 3LF2A 1TDJA 4NNPA 4UXHA 3VBEA 4E0BA 1QAQA 4GOKA 4I3HA 1LPBB 3CA8A 1B0AA 5AXAA 1J2TA 4DIEA 2XTAA 2OG2A 4ETIA 2BE7A 3BXEA 3GI1A 4YMUA 2QI9F 3OEHA 3JAKB 1YWGO 2OAP1 4OHBA 3T7AA 3VGPA 4N7JA 1P8AA 2GCGA 3KQLA 2HNAA 5ESDA 2XIJA 2Q6OA 4GEKA 1VJCA 4XFJA 3ZI4A 4EHFA 1MDFA 1Z25A 3U3XA 4JFAA 4X8LA 2C2YA 1IE3A 1UEXC 4ED9A 2JIPA 1VZ3A 1G21E 1WB5A 2M98A 3CO5A 4I50A 4BJ6A 2SKCA 4YMGA 1XU4A 3P26A 1PFVA 4HHEA 4V3CA 4RNCA 4ZO6A 1DKNA 3JCZA 1F8GA 2WNSA 3L92A 3IR7A 2ECOA 4M3NA 5D86A 1S01A 3DF9A 3LWDA 3AETA 3OU2A 1ZMBA 4GUDA 4U2DA 2RIPA 2XJ4A 4XD7D 1RAGA 3L6UA 4L7QA 1QE0A 4TGLA 2R84A 4N5LA 3PFFA 5BVGA 4DLBA 3RQSA 5I7EA 4TXMA 3G8CA 1P39A 4QUEA 3UC5A 4O59O 2QSJA 4UEOA 2FYTA 3GT3A 1GCOA 3OIWA 4FOTA 5AW5A 1U3FA 1U2DC 4NFLA 4IQFA 4MHOA 4I9FA 5I7OA 5KVQA 4Q1BA 4UJ3A 3NBUA 2ZUEA 2C42A 5CHYA 1BMFA 5DYIA 1DI0A 4FGUA 4FKBA 3LP8A 1QG2A 5CD9A 2E8EA 4Q3NA 1KTVA 3I9NA 3TWOA 1ZJYA 2ZYHA 1GRVA 1B74A 1N57A 3FWHA 3IPCA 2YZGA 3DAYA 2LDBA 4DCUA 2Q6KA 3EQ8A 4I1PA 4TV8F 2EGHA 4CEJB 2QMZA 4QOIA 3RUIA 2PZBA 4PRLA 3DW1X 2J31A 4RBNA 4BQFA 2DHCA 3ZLVA 4W5RA 3AKZA 2C5FA 2X8JB 3HFRA 2D2FA 4P0TA 2NUBA 4M38A 3SSAA 1AQNA 1IAVA 4R7TA 2RJ3A 4M9QA 5L51A 4M9UA 2ODQA 2B1GA 4Q7JB 5CVCA 4JCCA 5AKZA 3L7JA 1ILEA 4YP5A 3RKRA 4RK1A 3RIMA 4K9NA 1OBHA 1SVUA 1E7WA 3I61A 4Z49A 3RTBA 3UWSA 3C7CB 2BZ0A 1WD5A 4HN9A 4NV0A 4Y6GB 4RW0A 2GNAA 3DT8A 4X45A 1ZQ1A 1O9GA 2CD9A 2WFMA 2O50A 1DCKA 4MQBA 3S5UA 3WI7A 1JZQA 4PFQA 2XB8A 1K2VN 2ZRFA 5L7TA 3LK7A 5FOSA 4AJJA 1GLNA 4ZV9A 4BBJA 1VP9A 1R0ZA 3U4HA 3U0VA 2WNIA 4QYTA 1JJBA 2AMVA 5L4LA 4QTUB 1F48A 1UPUA 2E5FA 5I7HA 1L5ZA 2EKBA 3SP1A 3STXA 5ADVA 1GDTA 2G8NA 2HJRA 2VTVA 4QD3A 3TOSA 4ZVPA 1LB1B 5KWSA 4X3OA 3WKCA 1K8RA 2ZI4A 1NM5A 2RJOA 4WCFC 3VH3A 3E58A 4ARBA 4MI1A 1WB4A 4ZXPA 2V6GA 1PD0A 1M76A 2BTQA 5FQOA 1V8DA 4QDXA 1MOQA 1UODA 2Q3HA 3GJ8A 3AJ9A 3ZWVA 1NUTA 1RPNA 3T5BA 2QS9A 3K0AA 4H1TA 3PEUA 2ZTHA 3CIOA 3VU9A 3WQHA 1Q1AA 3NRCA 3OOEA 1CQXA 4IJVA 3ZGZA 1THZA 3FCCA 3NOXA 3N58A 4G4JA 3UKOA 4R71A 3QVWA 3MJTA 3GBPA 3PFNA 3DA8A 3QI7A 4WZBE 1SVNA 1RLOA 2I7CA 1I1OA 4I36A 1RKUA 2TECE 2P20A 3CZ5A 5AI8A 1DT5A 4GOND 5KKNB 2PG3A 2A6PA 5JYBA 1FRNA 3LMKA 3OLCX 2OHXA 5EQJB 4JR0A 3UW1A 2IEBA 3M6IA 4U1RA 4WINA 3GGJA 4B3TB 4XWYA 3JARA 3IOBA 3GHYA 4I1RA 4DMUB 1XGKA 1UPAA 3UG6A 4DT1A 1H3NA 4ZODA 3RHZA 4QPJC 4IW3B 5AVWA 3BERA 2OPLA 1TM3E 1UOEA 2E4ZA 2YXPX 4A26A 3AEZA 5B5SA 3MBIA 3AHFA 1PLLA 3N6RA 2HSDA 4KXFB 2QAGC 1A4XA 4GRAA 5DP1A 5EZYB 1BVUA 2I1LA 3D0KA 5F3RA 3RC1A 4F1KA 1P44A 2XECA 4Q4JB 4L78A 3QELA 2QSZA 2KBFA 3FYUB 2QV7A 1ODLA 4JELA 5CG1A 1D6NA 1UJ2A 3B60A 3E1GA 4B87A 4Z9FA 1NPDA 3JAWB 3KYDA 2I7TA 2G77B 3IP8A 3L1UA 4UNRA 1OH5A 4W8OA 2ZULA 5AWFC 3IE1A 3GP8A 4HAIA 4MOWA 4EVQA 1GGKA 3CX7A 4KWCA 2I1WA 1BX1A 1E9VA 4BNTA 1CRLA 2ZWIA 3EXHA 1QMGA 4JIMA 4BFUA 2PV0A 1A8UA 3E2IA 3QEMB 4OYCA 3JTEA 5E1DA 3FNIA 1SOWA 3LKBA 3C16C 2JI8A 4R7ZA 1KOLA 1N2CB 1RYYA 1PL0A 3W9BA 4C7VA 4H7KA 2NU8A 1NFRA 2IKSA 4L3OA 4UHHA 3HUEA 1Z45A 5CFOA 1Y0BA 2FMXA 4RESA 4I9UA 4IFTA 4NVRA 3IFSA 2P6PA 2G9VA 1NMEA 4J43A 4DMFA 5BQFA 4NOKA 2Q1WA 1DRJA 3FX2A 4K9QA 5HGJA 1I6WA 4AM8A 1U1DA 2DQZA 2QL8A 4Z4IA 4X1YB 4ARAA 3ZWKA 4EITA 1C7IA 4ND8A 1NQOA 3O95A 2HK8A 3Q8MA 3OJFA 1BSVA 2OAEA 4D9IA 4JKYA 4LF5B 3GUZA 1QTIA 1HKUA 3QENA 4CT4B 4EM6A 1O0CA 1U1GA 2Q8PA 5BQOA 2P79A 2VXOA 1VE6A 4MQMA 3ABOB 4D8YA 3EX7C 1P9WA 4DLNA 3H65A 2X9VA 4XJXA 3ENNA 1GKLA 3C5HA 4MW5A 1OBCA 3U48A 4AQDA 1A5TA 1JHPA 3VI3B 2JBAA 4K0BA 2QJRA 4N5MA 1XQXA 3ZW8A 1D2HA 3E0XA 1E3MA 4TTIA 5BR8C 2ZREA 4NEQA 4LF4C 4WBNA 4ZQBA 1J39A 3ZE7A 4NP6A 3JYNA 4I9NA 1ZCZA 2AOTB 3SZ3A 2J6IA 1Z33A 5IAKA 2GTPA 3T41A 1IQUA 1KJYA 1M2JA 3GFQA 1YS9A 1JPUA 1W29A 4U7DA 1EFKA 1GQRA 2ARKA 2VI5A 3I64A 1U2QA 2DC1A 3PITA 4QC2A 3IE2A 4R5MA 1XZJA 2CL7X 2WWGA 1BN6A 3DQPA 4WPGA 4Z1MA 4D5GA 5TJHA 2ZSAA 4ENQA 1H6CA 2CY1A 4X63A 3RKSA 3SO4A 3THYB 1YUNA 1RPZA 4GPIB 1SVSA 5IWAB 1IOLA 2GTIA 3DE6X 1G5TA 1IEXA 1IPFA 3A4TA 1JHMA 2Z9DA 1QH1B 1SVOA 3K5PA 3KU4A 3NAQA 3PDIB 1ULAA 3T5AA 3BGOS 3JALA 3SR3A 3L04A 4IJWA 1G291 2JIRA 1F0KA 4EFLA 4UOEA 3BB4A 3ZGNA 3JZFA 1EWTA 1NSYA 4OP1A 1P7PA 2NTEA 3BQMB 4DKJA 4PUIA 2IPMA 3H18A 3CJEA 3N5CA 5KAMA 5AHKA 4NTZA 1SM4A 4DA4A 4C7OA 3EFOB 1JJVA 1P19A 2VDJA 4DAEA 3M33A 1PJCA 2WD8A 2ZUUA 1XZPA 2W6ZA 4KTTA 1P4EC 2AW3A 2VA8A 3GJ6A 4RF3A 4FOLA 4EQZA 3WHKA 4DR4C 1MH1A 5GIPE 1CR6A 2BKEA 1FFEA 4FDAA 4LF8B 2PRJA 1MP0A 2FE4A 3GB9A 5A3JA 3QVJA 2BKAA 4ARVA 3LQRA 2XQVA 4F9GA 5F7OA 1AUOA 4JM1A 1NRWA 3GCDA 5GV8A 3RSGA 4BYMA 5JAZA 5FUVA 2RK4A 4RZQA 1YB1A 3VA7A 2XUGA 4NMLA 2WRZA 5CCBA 2J9RA 4DR1B 4W1PA 5IF3A 3UZ0A 2QGNA 4I5GA 4WKOA 3R7BA 2LBPA 1KETA 3C3XA 2WC1A 4JITA 2HT1A 2IEZA 1FYWA 1QS0A 1A2QA 1Z2OX 3GVHA 3H05A 3I9OA 4AP6A 2G70A 1NR5A 2BFMA 1M34E 1QIJA 4GMGA 3ZYZA 2BLLA 2BZGA 5BV7A 4RL6A 2YCBA 3NBKA 2YHIB 4UTZA 1MW8X 1GCAA 1MMFB 1CX9B 1N8SA 4Z0NA 3ZGVA 2AG8A 2IXFA 2GPBA 4TLEA 3TB6A 2X9LA 4KWIA 1N36C 1H8HA 1SQ6A 3I6YA 3SM9A 1KVTA 3OCXA 5EMJA 4QM7A 3FCEA 1MAUA 4US0R 4Y7DA 1H4QA 1Q6ZA 4EEXA 1JEOA 2NSYA 1QF6A 1HDEA 1SBZA 2X0JA 4UARA 1XD9A 4D6PA 5JNRA 2QD3A 1GVNB 2LKCA 3CUTA 3E2MA 3TUIC 4C0WA 5T3UA 3T7SA 1HYQA 2ZK7A 3FCSB 3RYTC 4MGZR 4C3UA 3JXEA 3ZY5A 1R0XA 2VQ6A 2REBA 3PSHA 5JWHA 1NY6A 2HQ1A 2PY6A 1MG0A 2YX1A 4QICA 4CDGA 5LZ2A 3AB8A 3E3LA 2QBYB 3KIPA 1O8CA 2B8TA 4A27A 4DJJA 1SIWA 5TGTA 4AJNA 2XWSA 5G0VA 2VHUA 1NC1A 1ADGA 3HO8A 1WZIA 3M2PA 3NWPA 3OIDA 1TRKA 4UUQA 3WGLA 4EJMA 4ZYYA 2Z58A 1PK7A 4AFNA 1MAWA 4Z53A 1WX1A 3S1LA 3KUDA 3RC7A 2ZYAA 3OJ0A 1G8JA 3Q7IA 4JFRA 5F1PA 1SPBS 4M9RA 3VJLA 5TGDA 1RKBA 3KE8A 3QY0A 1IZ0A 1QUEA 2J7KA 2VA9A 3K16A 4GKBA 4LKOA 3RSOA 1CDZA 2D8MA 2WV9A 1P6XA 3EG5A 1LNZA 1SWVA 3JQCA 4OL9A 4HGYA 1QM5A 5JNLA 3WAJA 4Q66C 2AJCA 3IIIA 3WIBA 4NXMB 1V8PA 1XWIA 3JATA 3SQLA 5B37A 3VZQA 5FFFA 3D1VA 1BZYA 3EGWA 1XL0A 5IJWA 2AQIA 2I3GA 4UBNA 4G5GA 1YL6A 1G5HA 3V7UA 3RG2A 2GUWA 1ONPA 2V7GA 3JD1A 1XROA 3N7AA 2J3QA 4MVJE 4B2IA 4D7AA 4EO4A 2OXFA 3MNFA 1NLZA 2OBYA 3PZRA 4KH1A 1G2OA 1OH7A 3RTCA 3FLMA 3WZLA 1X7ZA 1L2TA 1JKMA 4BLUA 2JGMA 3UGKA 3BIXA 3UB3A 1DQYA 2UZAA 1NRIA 1UC5B 3B