3R9WA

Crystal structure of era in complex with mggdpnp and nucleotides 1506-1542 of 16s ribosomal rna
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords GTPase Era
total genus 101
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3r9wA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9wA01
3CNOA 1OXUA 1OKKD 4LC1A 1VG9B 5DYIA 1E79A 1QHGA 5FUYA 3QKSB 4I81A 5H70A 1CS4C 2IS2A 3KB2A 2IS1A 2O8EB 3PEUA 3FWYA 3QBTA 1CBUA 3T1QA 4WA7A 1ZUNB 2QQ0A 4P3YA 5GVSA 3FMIA 3W8RA 4IVRA 4DR5C 3BFXA 3U3OA 1JNYA 1SULA 1KKMA 3T35A 1C1YA 4RFSA 4LY6A 2Z4RA 1E2IA 3KKNA 2JLQA 1EWQA 5EP1A 3A1TA 3CRW1 1VDZA 2WMNB 3AVUA 4BPBA 1LNZA 1I4DD 2GEUA 2YINC 4KAXA 1T3HA 3BBPA 4FCTA 1ZJ6A 2PT5A 3GQBA 4Q1CA 1ZVQA 4KITB 1COWA 1Z0KA 4LX0A 3CF2A 2IYXA 1MV5A 4MYCA 4B71A 2FA9A 1GIAA 4CZ2A 1KDTA 3W3ZB 3DPUA 1BO6A 4QKQA 4DZZA 2V55B 3U4QA 1NLFA 1ZB9A 4TQ9A 4OQMA 4DV2C 4BUJA 4ASUA 3O8CA 3KQLA 4Q9LA 1DG3A 1U8YA 1XMQC 2VP9A 1OH6A 3IIKA 1VCNA 3BB4A 2R65A 4Q9HA 3ICQB 3LFUA 4OI4A 1XF9A 4JLJA 1KI9A 4OI0A 1ZCAA 4AKIA 5EE1A 2ZI4A 1HT1E 2G83A 1N5KA 3CPHA 4C2UA 2JJ1D 4YMSA 4U02A 4MKGA 1V5WA 2HF8A 3FVQA 4LFBC 2UXDC 1E32A 1FUUA 2YHSA 4YMUA 5TVKA 1GOTA 3LRPA 4AKEA 2BEJA 1ZUHA 4AKGA 4D4JA 2UXCC 4PHFA 3W5JA 4DDVA 2J5XA 2Q9AA 3C8UA 5G3YA 2E8EA 5FBQB 2GXUA 1NMXA 4C0HA 1WQ1R 1JR6A 1NYEA 4ZKDA 4AK9A 4B6FA 4QGFA 3MMPA 4QFMA 4WXRA 3NBXX 1N6LA 4LHXA 2JLUA 3ZQJA 4WOPA 4GDFA 2FE4A 1GL6A 1P75A 4YY3C 1E2KA 2BVNA 1W4BA 3V4FA 3G5UA 1XD9A 1XEFA 4JLAA 5JCPA 1P61B 1NIJA 2HYDA 4IDNA 2NOAA 2BBTA 5J4HA 1FUKA 3AGPA 2PN2A 2IYLD 3CO5A 3HWSA 1Z47A 3QENA 4H9GA 5DI9A 4HDCA 1G18A 1GVNB 3ZS8A 1II8B 5M04A 3H0KA 2VO1A 2LWIA 4UXIA 2H18A 1GKUB 4NP6A 4XD7A 4WZAE 3WBKA 4BWYA 1R2QA 4DWJA 4CIDA 4JBYA 3NEYA 3B1VA 2ZYVX 5HKKA 3BE4A 5JRJA 5BN3A 1OIVA 2JIZA 5BWMA 5HZKA 4DXAA 1DG1G 2YWFA 1Q1BA 3LVRE 2WWHA 5J5CA 1C4OA 1NJFA 3M0EA 5GJCA 4XSGA 3E2IA 1IJFA 2WWWA 3GLIE 3TIFA 1N6HA 1I2DA 1IOZA 2FMXA 1GNQA 4R2IA 5AJZA 1PLKA 3EW9A 1F5NA 1W1WA 1HUQA 1DAIA 2MMCA 1M34E 3KUCA 1G7SA 3QKSA 4JL5A 4BECA 5JEDA 1R5NA 2ZVQX 4OHXA 2HV8A 4FCVA 4KV9A 4W5WA 3VNVA 2VHCA 2QL6A 4Q1FA 2ZR9A 4RCZA 1TUIA 3PCRB 1NY5A 5JWHA 4F91B 4PAQA 3NKVA 621PA 3AH8A 4FMCF 4V02A 1GG2A 3RRYA 5KOYA 1AJEA 1JJ7A 1P73A 1YVDA 4EPWA 2GKSA 3UIEA 1U8AA 2W00A 3TR5A 4ZKEA 3GLFB 2W58A 2CHVA 1KO7A 1E2MA 1NSFA 2NQ2C 3RS3A 2JLSA 1YZUA 2V8OA 4JVNA 2CK3D 2F3TA 5ELXA 4QHYA 2BEKA 3C7KA 1VTKA 3U3MA 4DDUA 2PJRA 2OXCA 3ETLA 3PVSA 2VL7A 2VHQA 2ZE8A 2QZ4A 3KL4A 2H5EA 2KBEA 2OFWA 2OESA 3ZZUA 3K70D 4UJ3A 1UFQA 1P60A 4KLZA 3NXSA 3I8SA 4LJ8A 4DR4C 3ZVLA 4ASUD 5KNBA 3LY5A 4PX9A 4IKEA 3I32A 1F6BA 4OJQA 5KSOA 1JEEA 4BRUA 3RC3A 4TT3A 3MG9A 4PZYA 2GCOB 4BZQA 4K81B 1K6MA 3TK1A 1ZC3A 2Q3MA 3SHWA 4DHEA 1W36C 1IN5A 4B75A 3A4MA 5HR5A 2ZPTX 3U6BA 4RKFA 4TYWA 4TMWA 3G0HA 2RAPA 1HE1C 5FPSA 4DV7C 2NMVA 4K46A 1M1YE 1XXHA 2QGNA 2J7PD 4NL4H 1F2UA 1YE8A 4DV5C 3F5FA 2OXRA 4M1SA 1RYHA 2GEVA 4DV4C 5P21A 3I5YA 5LB4A 2CHGA 3HR7A 3B7GA 4JLMA 1EFRD 4GPTA 4HAWA 2JLWA 5CITA 1RFLA 4QGAA 3HU3A 4ZIRB 3M4YA 1Z2CA 3F8TA 2VSFA 4ZPXA 2B7BA 4ESVA 1U9IC 1FTSA 5KPJA 2WAXA 4RZ3A 2O8DA 1YZQA 1E2EA 4DDWA 2Z0MA 1US8B 3Q72A 3X1ZA 2IWHA 4E22A 1KI2A 3OFND 3VX4A 2J0UB 1G8GA 2DFTA 2I3BA 3CF0A 4AG5A 4DC9A 2HCJB 4LJ4A 1E2HA 2QE7D 4JYBA 4B3DA 4DDTA 4DR3C 3DZ8A 5KYKA 2ZAOA 1ZRHA 2PZFA 2O8CA 3UMFA 4X62C 3T5DA 3AKDA 4B43A 2XSZD 3NC1C 3DMNA 1WRBA 1ZM2A 5A4JA 4FMDF 3QJYA 4PR0A 2Z83A 5EE9A 3T1YC 2QU8A 1JI0A 4TLDA 3CJEA 1P7CA 2VQFC 4R7ZA 2KE5A 1E1QD 3EXAA 1IHUA 1P72A 2UUBC 3WNCA 2WSMA 1R8SA 4TYYA 3C5CA 3I72A 2AFHE 4JI7C 4YC7A 2RGBA 4JV5C 3WYAA 1KY3A 2REBA 4ZV4A 2J0UA 5FTMA 3K9NA 5ANRB 2W83A 1ZIPA 2O0KA 3QI2A 4Q48A 2O5VA 4URUR 3U7GA 2E8FA 3LW7A 4L8GA 3RRZA 3OESA 3SFZA 3LV8A 2QBYA 4A0RA 5HE9A 3KQUA 1KJYA 3VKHA 3M6AA 1OHHD 2IUUA 1DAEA 5HCIA 2V3CC 1L4YA 3CR8A 4DSOA 3HPQA 4GOKA 4I1SA 3A1UA 3IEVA 1D6JA 1WBBA 3N2EA 2OFXA 1OIXA 1P2SA 5SZHB 2WKRA 5FR1A 3TKLA 3SFVA 2GBLC 2N46A 5EQTA 4X65C 2E87A 4PC3A 2VA8A 2G0NA 4C4PA 1IBMC 1SXJC 4LDJA 4YMTA 1AK2A 4N1AA 2P6NA 2F7SA 1HURA 2JAQA 2IBMA 1DS6A 3K09C 1M7HA 1JPNA 1NVXQ 1XMSA 1EXMA 2QP9X 3KFVA 4BFZA 2CL0X 1UBEA 1CEEA 2XITA 3L43A 2O0JA 1FL9A 2QT0A 4RKEA 3HR8A 3SJAA 2XSZA 4JBXA 1YR8A 1CTQA 4B2LA 3V4RA 4PZLA 1VYTA 2GJAA 4DT1B 3SJZA 3I62A 2E9SA 4OQFA 1XNJA 2HYIC 1TAGA 3UKDA 2GEDA 1T5LA 1MRSA 2G1KA 4BFYA 1UKYA 4B34A 4AQYC 3VQTA 1CLUA 1E69A 1G3RA 4NH0A 2OLJA 4HYYA 4OBEA 4E09A 4DUGD 2FPMA 4D80A 1E4YA 2C9YA 3GLFA 2GWHA 2OEPA 1E3MA 1RC8A 1CXZA 1EFRA 2GAAA 2XJ9A 3AGQA 4OL0A 3AVVA 2GJ8A 3LLMA 3TMKA 1UDXA 1W4RA 5DO9A 1ZM9A 4LRWA 1JOSA 4Z54A 1LY1A 5FH9A 2ZIAA 4JI3C 4ACAA 2F6RA 2WOOA 4NXNC 3MRSA 5FPKA 1G3MA 4EKDA 4Z1MD 1MABA 2D7CA 2JDID 3J81D 3SJBA 1G4AE 2IYRA 4E07A 1BKDR 4KFUA 3A1SA 2XX3A 4NE2A 5IK2D 3FYHA 1CRPA 4R98A 4ARZB 4ZDWA 2GTPA 1VMAA 5H8WA 4OKSA 4M53A 2OAQ1 4BFVA 1PJRA 2J45A 1E4VA 2CY1A 3FE2A 4FIDA 2NPIA 4Q18A 2XZLA 5KDLA 5BN4A 2OCAA 3FMPB 1N6KA 5L3RA 4F4IA 4RD1A 5HZHA 3NEJA 4B2IA 3U3JA 3AP1A 2GXAA 1MR3F 1M2OB 1N0WA 3MUFA 1JAIA 1XU4A 1ODFA 1LS1A 1NKTA 1WXQA 3NTUA 1T0JB 1XTSA 3X1XA 2JMPA 4Q4JB 3SC3A 3EPLA 2A9KA 2GXSA 4RY2A 3VU9B 1U8ZA 2NO0A 3DKVA 3B13B 3GJ0A 1XJQA 5J4KA 2L0XA 2ZRGA 3QY0A 4B3BA 2VHUA 2C8VA 3I8XA 1M6NA 2RGAA 2XNSA 1AZTA 3QBVA 5AUOB 3T61A 3OIUA 1VECA 2C2HA 1X8LA 3AKEA 3RS4A 4URXR 3AF1A 3EPKA 1P4SA 4PC6A 1TQ6A 1UAAA 1GUAA 3FKQA 4IRUB 4GP6A 4MGIR 2EFDB 3K0FB 1CF4A 2Z43A 4QHSA 4WAUA 1LQLA 5L3QA 2HCBA 4AKHA 1I4LD 5DIFA 4LYAA 5IDVA 2AD5A 2C9CA 5DYGA 3DO6A 3JVUA 3IIMA 1YJ5A 3LH5A 5H68A 4LF9C 3QF4A 4NBSA 5CK4A 3THWA 1CP2A 1UM8A 1DAFA 2OCYC 8OHMA 2WWYA 2GVZC 5G3ZA 2OFOA 2YOHA 5CDFA 4B3GA 4UNNA 3LBHA 3B82A 2GCPA 3W3AA 4LBWA 4DV0C 2DPXA 2BKEA 4ZDJA 2CJWA 3FMOB 4B73A 4IEEA 5CB6A 4NONA 1D2EA 1DPFA 1F2UB 1N2CE 1QVAA 1E9CA 2ZRAA 4GOXA 4A1FA 2F55A 1BYUA 4MGKR 1XWIA 4XVQA 1Q1EA 1TEVA 3EIQA 5FPYA 3GP8A 2HT6A 1X1RA 2BMJA 2C77A 2R44A 2O8BB 2V54A 4RZUA 2AK2A 2UUCC 2D2EA 4IFEA 2ZREA 1WDTA 4LJAA 5TB5A 1OH7A 2X2EA 3L82B 1U98A 2OBLA 2ZRLA 3EWSA 3OZXA 4Q4HA 4QG7A 3PEYA 4FCWA 4A6XA 1ZD1A 5KTYA 3SNHA 2ORVA 2HLDD 2WJHA 3C41J 2ASBA 1P62B 1W4AA 1G7RA 1Z06A 3B85A 2N1BA 5D3QA 3ZD7A 5FPHA 4DCSA 1OFHA 1HR0C 2OV2A 4LJYA 3D8BA 3QVVA 1OF1A 1E6CA 2NZJA 4PTLA 4I4LA 1HTWA 1NVUQ 4V0LA 1W7AA 5BXQC 1Z28A 3R9WA 5LD2B 2FGJA 3EIHA 4MRNA 3BB1A 2ZRKA 5DSZA 1N33C 3RHFA 3LO5A 3CF6R 1UJ2A 4B3CA 3VKGA 2ZI9A 1ZU4A 1NMZA 2QN6A 1NN5A 4LBVA 1VYVA 1N6RA 4OI2A 5FTJA 4B32A 4GBMA 1NG9A 1JQJC 5FOXA 2E1RA 3WMEA 4LUCA 1XJ0A 3OAAA 4RSGA 4WVFA 4UNQA 4E5UA 3BC1A 3X1WA 2PBRA 1EFHA 2QNRA 3WHLA 3K0FA 3PJRA 1TU4A 3RAPR 1X3SA 1KJWA 4IFBA 4QBFA 3PITA 4PPFA 1NY6A 2UKDA 4EFNA 1N5JA 4EPYA 2DFKB 221PA 2H17A 2QY9A 3LX5A 5C1BA 2W2XA 5JWRA 3GEIA 4EPTA 2JATA 3RSOA 1CULC 1Z0FA 5JI2E 5E7MA 1A7JA 2VPPA 3H84A 1H8ED 4GRAA 3OE7A 1ELOA 5C4GB 3VU9A 4Q4JA 2C96A 1ZM7A 3THYA 1DO0A 1XTQA 1SVKA 4ZCMA 1DVRA 4Q9JA 1XP8A 5HE8A 4DEYA 1ZBDA 3QXJA 5E4FA 4DV3C 5EZ6B 4C30A 2QTFA 2PH1A 3P1JA 5JCZA 3CPJB 3AVWA 2OCBA 2ODWA 3E70C 4D4MA 4G5GA 2FV8A 2ZYTX 4F92B 3DMDA 4BFWA 2AXNA 2CCJA 1RJ9A 2V7QA 1AN0A 1G20E 2QUZA 4L5BA 4LOAA 4DLTA 3GLGE 4JYAC 4HB4A 2W2VA 3AVYA 1HNXC 1HH2P 2EWWA 2CMKA 2REOA 2WM9B 2I4IA 1KK2A 5CYPA 2IS6A 1T8TA 2A3RA 4X8HA 3NHAA 3ZH9B 4DLXA 4P0TA 3TE6A 3U3KA 2BJOA 2LKDA 1CJTC 1MRNA 2ZSBA 2VF7A 1QRAA 4Q1AA 2PLRA 2WJGA 4MUBA 3W6PA 3Q85A 2ATVA 4JYCA 1AS3A 1HV8A 1A1VA 5K8IA 3NG1A 1GNRA 3OIVA 3VKWA 2GK7A 2OILA 5GADl 4D4KA 4BLPA 4JIMA 4PQYA 2IHYA 5AK0A 3AF2A 3P32A 3HP1A 1GNPA 4QNMA 4C0BA 3L2OB 1DAHA 1UPTA 2QMOA 2H16A 4LHVA 4XVUA 4XTCS 1HY3A 4K8OA 4JVMA 1Z08A 4L15A 2PZGA 1S0UA 1S8FA 1ZM4A 3QSYA 1FFHA 3Q5EA 1SVWA 3L8ZA 3AF3A 4HSEA 4Q9KA 4CYMA 1R10A 4LV5B 4M1MA 3R20A 4TLCA 1VIAA 2J87A 4K0KC 5SZIA 2YWHA 1Q57A 5LB2A 1E2JA 2GCOA 3EZ2A 3TQFA 4MYTA 1RRGA 1WA5A 2J59A 2RGNC 4BFUA 1Q12A 2QM8A 3TW8B 1QZXA 2XXAA 1YRAA 2EFEB 5IWAC 4BLRA 1OB5A 4RFSB 1X8JA 5SZKB 1E1RD 1E2DA 1G9XA 2R6GA 2JGNA 4P4SB 3TQCA 2R6CA 3MJRA 1ZW6A 4C7OB 1QHXA 4DJTA 1BS1A 3KFXA 4IXNA 3P27A 4PFSA 1JR3E 3SI7A 1N6PA 3L0PA 3CNNA 3PG5A 1A82A 1NVVR 1E2FA 2D7DA 1Y3AA 4B6EA 4A8JA 4P4TA 1U0LA 1G7TA 2J0VA 4MKHA 1AZSC 1YZGA 4FW9A 2EFGA 1VG0B 5DE3A 4IOJA 4RD3A 4MDEA 5F9HA 4KHZA 1W5TA 1DAKA 1OLOA 4JI5C 1OSNA 1E2PA 3K09A 1NKSA 4MGZR 2YNMA 2HUPA 2ZJZA 5JFGA 2PCLA 2X19A 4JI1C 4JI2C 2FSHA 2C78A 3H4MA 1KZGB 1Z6GA 2H1LA 1RRFA 4Q00A 4NYJQ 1I94C 2QORA 1AS0A 2CK3A 4YMVA 4M9XA 1IJEA 1FNMA 3D3QA 1ESNA 4UQOA 2FGKA 3CPEA 1NI3A 5A0FA 3T12A 1IY1A 4GZLA 4DSUA 1E0SA 1KO5A 2ZJ8A 1YKSA 1WB9A 1AKYA 1VHLA 4Q03A 2ORIA 3IDQA 3EPJA 2VTKA 2CCKA 4M4SA 2QPTA 4JLPA 2V6JA 4JVLA 2CVHA 3HU1A 2GDJA 2ZRBA 4HATA 1JEDA 3U6KA 4MDFA 4DSTA 2CL6X 3TW4A 1U94A 3DDCA 3K0EA 4RD4A 4II7A 1KO4A 2PJZA 4B3FX 4JVSB 4JKIA 2IYYA 4C0QC 3M1IA 5FOWA 4A0GA 4JLBA 4YMWA 3RS2A 2Q6TA 2AX4A 4FMDB 3QXHA 1E9DA 3GLGA 3E5HA 2FX3A 1KSHA 2QMUA 4EPVA 2AWNA 2AHOA 3HU2A 2FG5A 2B8TA 1KI3A 5BR8C 3ZIAA 4UNRA 2VH5R 1G8YA 2QM7A 4YQFA 4TYNA 121PA 5AJWA 2X8AA 1E0JA 4DLRA 4DUZC 5CIQA 1XEWY 4MRSA 3A1VA 2C95A 4TQUS 1ZAKA 4PSVA 1EFCA 5B2ZA 3ZVNA 3KUDA 1KTVA 3PXGA 1G7CA 4GKJC 4W5JA 1L2FA 3REGA 5EJEA 1UDWA 2IEYA 3D7MA 3TAHA 3REFA 2ZANA 4MQBA 4PO8A 1FOEB 5KSPA 1CJKC 1KK1A 4JI6C 1VHTA 1T3SA 2BC9A 2WWIA 1GRNA 3IILA 4L9WA 4RD2A 3LQQA 2REXB 1VIYA 4AY2A 4US0R 1G5RA 4C2TA 2YZ2A 1SKYE 2DYKA 2VRWA 4KU4A 1ZIOA 3CWQA 3IBGA 1YHNA 3P4XA 3K8YA 3SS8A 1XTRA 3PEVA 1VCMA 4NU0A 4MH4A 4DUGA 2OAP1 4KFSA 4TMTA 1CKEA 2QMEA 1W48A 4PQRA 1TF2A 1OXVA 3PFIA 3KB1A 3DHWC 4XOIA 4JLOA 4Y0VA 4M9SA 4DLYA 2A2ZA 4FMCB 1JJVA 5F9FA 3K9LA 2QTVB 3NDPA 2ZRHA 1E2QA 2GZAA 4PZZA 3MAAC 1ZUIA 1N3BA 3MWYW 4Q4HB 5KU1A 1WP9A 2WAYA 4KLNA 1M7GA 2I1VB 4KSBA 1KSJA 4DCNA 2XJ4A 3SZRA 2X2FA 1UKVY 1Z6TA 2ZS7A 2ZJ5A 2Q9CA 3C16C 3Q7QA 3KQNA 4TZ6A 1VLAA 2QENA 1YR7A 1VG8A 3U44B 1ZYUA 4YHHC 1FNNA 4IVQA 4Q7LA 5FOVA 3SBEA 4EQ6B 2RGGA 3KJEA 4LBZA 2GHIA 4CT5A 2GBLA 5JLJA 4ZO4A 1NBMD 2VSOA 3OTOC 1GSIA 2KB0A 1D8TA 1BH2A 4LZZA 4OHZA 1A4RA 4ACBA 1J99A 1W0JD 3EERA 4JLNA 1EFTA 1E9RA 3CONA 5J4VA 1A2KC 3LBNA 5JJLA 1X6VA 2NTYC 1AA9A 4GNKA 5BQ5A 4B48A 1KDPA 1T0HB 4CF7A 5L3SB 2H92A 3TGPA 4FXPA 5AWFC 2LKCA 4AG6A 1OH8A 2AKYA 5KSYA 1N5IA 2FSGA 3RANA 1W2HA 2XNDD 4Q4AB 2J7PA 3RSLA 2QGZA 4GZMA 2DYJA 5KNDA 1ZNXA 5CDFE 4G3XA 1PZNA 2RHMA 3BB3A 4V0NA 5LDDC 3MSXA 1R5BA 2EFHB 3TLXA 1RKBA 1JQLB 2R6FA 4A0HA 1D9ZA 4D25A 2FSFA 3AF0A 2E7GA 2ZM5A 721PA 2BOVA 5G41A 2WTUA 4U5XA 1N5LA 3DKPA 5FL3A 2FH5B 1U2RA 3N70A 3SHFA 3VTKA 5LMNC 1N6OA 1ZD8A 4PPQA 3TAUA 4BQSA 3KXLA 1P9NA 3R8CA 3KJIA 1H65A 4Q7KA 3RS5A 1KMHA 2WWGA 3W34A 2G88A 4A0FA 3B6EA 3QXCA 1E99A 4XWAA 4X66C 1E9EA 3T1VA 3AF5A 2P65A 4QJ4A 2G1JA 1OYWA 3B1YA 1KI1A 2PX0A 4KO8A 1YR9A 2QRNA 3MGCA 3TVDA 3LUSA 2IYZA 4OX9C 2J41A 3KJGA 1SXJB 1Z6XA 4MKIA 1C9KA 4X8LA 2IYWA 2ZRNA 4D0NA 5JMTA 1GTVA 3ADCA 1P9RA 5SZJA 5L8VA 2BMDA 5JSZA 4LYJA 3O47A 5TMPA 1G21E 3SQXA 1IN7A 3LXRA 4DV1C 4QL3A 421PA 1YZKA 2XEXA 1EESA 1BOFA 1YRBA 4D4LA 4P33A 1CJMA 4B47A 2FFHA 1OFUX 2GZHA 2PEYA 3KXKA 4EJSB 2V6IA 2ZAMA 4PQFA 1OXXK 4ZIRA 3BGWA 3F0TA 1NBME 1G291 3T06B 3ICEA 3N2IA 5J4YA 1Z83A 4G5RA 5LPNA 4QRHA 2ATWA 2NG1A 4ITRC 4TTPA 1M74A 3AVPA 4F4JA 1KI6B 5FTLA 5JI3E 3AF4A 3QEOA 1TNDA 3MD0A 5UKDA 1XXHB 2WMOB 5B57C 3NH9A 4QJ3A 2ZRFA 5GJBA 2GILA 4V0MA 1ZNYA 1W2GA 4LPKA 2FFQA 2JLYA 5FPTA 3WRXC 4NYMQ 1MO5A 4YXWA 1I2MA 2BBWA 4KI0A 2GCNA 4LF6C 1IXRC 2R62A 4CGZA 3CUEF 1EK0A 3WP1B 1XPRA 3FKSD 3O8DA 3PUXA 2X1VA 1DTSA 1IBLC 5KNCA 3CW2A 4JI0C 3V9PA 5KDDA 1XMVA 1II0A 1EGAA 3K0CA 2ANCA 1LW7A 2VF8A 2WKQA 3JVVA 4MYUA 1L7VC 2IYQA 4EQ6A 3J80D 2GESA 1JALA 3FFBA 4B35A 2KZFA 1BYIA 5JRZA 2OZEA 4NCNA 3GFPA 4NCIA 1UBCA 5KUTA 1UEIA 2E8CA 4A92A 2BIFA 3UATA 1R0YA 5K8UA 2MMGA 3WHKA 1AS2A 2W6JA 2ONKA 3EC1A 3AVTA 2EQBA 4PO1A 3BS4A 1AIPA 1SVOA 5FTNA 3THOA 4BRWA 1OV4A 3UPUA 3OEEA 5E95A 2JDIA 4URYR 1P2VA 1W5SA 4OHVA 2V1XA 1IY2A 1R8QA 4WZBE 2QA5A 5CIWA 1Q3TA 3WRYC 2DR3A 4WIAA 1E9FA 2H8KA 4CEHA 5KSZA 4LYFA 4UNPA 4RFVA 4PAMA 1FP7A 2CJWB 1IONA 4J0QA 3JZAA 4MKFA 4ZCIA 3OIWA 4MYHA 3ZJYA 1Q3HA 5B30A 1QWIA 5GJVC 1HNWC 1J90A 5FBVB 3PUZA 1LVGA 1DBSA 2RHDA 4HAXA 4GKKC 3B1ZA 1XNRC 1UKZA 3DM5A 4US1R 4X8MA 5E7IA 3A1WA 3BORA 5EE5B 4IDOA 5LD2C 2P0EA 2FPKA 4OJKA 2NGRA 4L16A 4PPGA 2EU8A 4JT2A 4I1UA 3CRMA 4LF4C 3TSOA 1VKJA 1TQ2A 5J47A 3B2EA 4DKXA 3KQHA 4QBIA 3IQXA 4DR7C 2QAJA 3NVAA 2ZI5A 5C46F 1FP6A 3CX7A 1KHTA 5AJXA 3T1TA 4OI1A 4LF5C 2IUSA 4B3XA 1XNQC 2OE2A 3AV0B 3P26A 1XEXA 5K8LA 4GT1A 4WBSA 3U61B 4CT4B 2UXBC 3ZQ6A 4ZI3A 4GP7A 1Z8FA 3VX3A 5JS8A 1VPLA 2IXEA 3IKJA 2N42A 4LWZA 1PUJA 3S1AA 4KBFA 3GPLA 2F9MA 2HF9A 1KAGA 1TF7A 3DM9B 1MO6A 2I1QA 4RZXA 1Z3IX 4IVPA 1QHIA 2DCUA 2WWFA 4FINA 3CIOA 4BZXA 4QNRA 2CEAA 4DB4A 2Q21A 4KCGA 1IBRA 2CNWD 3LD9A 4Y0AA 4HLDA 4HI0E 4PC1A 5B58C 4DB2A 1FQJA 4CEHB 1JR3A 4C3ZA 5CB8A 2G3YA 2A5DA 3FDIA 4KHPC 2XOKD 4JL6A 1KI8A 5EZ5A 1KI4A 2WJJA 2VEDA 5LMUC 1D5CA 4B76A 1A5TA 2VP2A 3ZZTA 3O8BA 3RVBA 2ZI3A 3AUYA 3FHOA 3QXXA 3TH5A 2ZJAA 3RDPA 3U3RA 1HQYE 3ADDA 4JL8A 1FTNA 4PPNA 1IN6A 5FUWA 4U00A 1GL9B 4DUYC 4BASA 4BSZA 4UNSA 2QMHA 3EZ6A 4TN1A 2EW1A 3AUXA 4Q01A 5AUPB 4NTZA 2AN9A 4NYIQ 2JJ2D 1JXOA 2HJVA 4MRRA 3OE7D 3CKLA 2VYFA 2VQEC 1G6OA 4KVAA 3VHXA 3RRNA 2B92A 3KKQA 5JWOA 4NOZA 2OM2A 1ESMA 1E9SA 5IRCD 1G8FA 2D4HA 4URZR 4BE7B 1W49A 4B2PA 1EG7A 1XBTA 1TTTA 2UU9C 1M7BA 2ZQ5A 3IGFA 1GDDA 3GEEA 5KPDA 4MITA 2W6IA 1P5ZB 1QVRA 2HXSA 2RCNA 2W0MA 5D3MB 3UWOA 1R0ZA 3DOFA 4M22A 4D0GA 1JR3D 3JZMA 2F1JA 2C9OA 5TDHA 4A9AA 3AVQA 1CR4A 2PT7A 1TQDA 2Y8EA 3AKYA 1WMSA 3OF5A 4XIGS 3R7WA 1L2TA 3AKCA 3B8HA 1UADA 1L8QA 4Z8YA 3WXMA 3BWDD 2B8WA 3RS7A 1HE8B 1E0KA 1SKQA 4KVGA 4XVRA 4HUQA 2QP3A 5FR2A 3GLGB 2CE2X 4M1WA 3W90A 4R71A 1QBKC 3A4LA 5CLLA 2YC2C 4Q02A 1ZCBA 2NPFA 3SYKA 1IXZA 4JT4A 3PUYA 1FMLA 1SZPA 1T8UA 1RRPA 2JLXA 2JJ8A 2JJ2A 3NH6A 1NVVQ 1E1QA 4YDHB 1U0JA 4R9UC 4AYTA 2AFIE 2FN4A 3QVUA 3KZ1E 2R8RA 1NBMA 5EP2A 4NYJR 1MT0A 2E5LC 1D2MA 1PVOA 2V1UA 3ND8A 4TZ0A 2QT1A 2VBCA 1JB1A 4Q1EA 3R9XA 1OJLA 1ZU5A 3EC2A 3SQWA 4GSYA 1KNQA 2BJWA 3FTQA 3SYNA 1DO2A 1R6BX 4HAZA 2WKPA 3QIAA 1N6IA 1H8EA 1T4GA 1ZINA 1J70A 1GAJA 2EYQA 3NC0C 4ARZA 2IK8A 2XOKA 2ZSAA 5HCNA 3AVXA 2AL7A 1IN4A 4B44A 2KWIA 4MTNA 3K53A 1NLYA 4C0LA 1JECA 2O8CB 2CL7X 4JBWA 4RVCA 5DH9A 1B23P 1Q1ZA 2CNWA 4U7DA 1SHKA 2W0SA 4UKDA 5KDOA 1NN1A 2KI5A 5DHFA 3K0CC 3TJZA 2XR1A 3SR0A 2A5GA 3K9GA 2WJYA 2W6ID 4JLDA 4E03A 3B60A 1KO1A 2GNOA 4IOKA 3TRFA 3CBQA 4HEJA 2MSEB 3ZS9A 1G16A 2NO6A 3BK7A 1Z07A 3THXB 4HLUA 2LCFA 3FB4A 1ZD9A 4TSFA 4P4SA 4TYQA 1GKIA 3P4YA 1OIWA 1D2NA 1J7KA 2NZ8A 2WWXA 4HB2A 4NCHA 1WCV1 4N0EA 4TTRA 2P6UA 5LBIA 4F7WA 1PLJA 1XD2B 1XTIA 5BN5A 5IF9A 2QRZA 4XSHA 5L3VA 1D9XA 3UXMA 3IO5A 3OIYA 1X1SA 4TQAA 2OHFA 2Z4SA 3GLHA 2QI9C 3WP0A 3BH6A 1KIMA 2PLFA 2D06A 2QAGB 4IXMA 5B64A 3UWKA 2A5FA 3KXIA 3BH0A 2ZE5A 3KQKA 4GMXA 2ZRIA 5K8TA 4XX2A 4LGMA 3MWLA 4W5HA 1NLZA 2YCBA 4QBHA 2WZQA 2ZJ2A 2F1IA 2JJ1A 1TF5A 2XGJA 3BD9A 3NHBA 1SKYB 1W36D 1NG1A 5FI0B 4HZUB 2YWGA 3MCAA 4D6PA 1FX0A 4RCYA 4PHHA 2ZETA 3VR1A 4QM6A 1NVWQ 2RGCA 2VP0A 4TYPA 3LAWA 3FHCB 1HH4A 2OSBA 2KBFA 2PMKA 5EE3A 3VMFA 1S9HA 3EG5A 3FPAA 3K9HA 4Z1MA 1XTJA 3PIRA 3ADKA 3S1AB 3U7FB 1TPZA 2ZSFA 2BM0A 3I4LA 5JECA 2ZE7A 1NIPA 4QC2A 2RMKA 1T6NA 1MH1A 1BMFA 1OFTA 1XD2A 1LS6A 4C0JA 3VNUA 1HT2E 1R7RA 4TTQA 1E2LA 4QXAA 2WSSD 4AI6A 2GETA 3KTAA 2FNAA 2YYZA 1J8YF 3ZVMA 2ZU6A 4M1OA 4BFSA 3THXA 5FOSA 3SBDA 3L8YA 2ODEA 3B1WA 1Z0DA 4M9ZA 3QEJA 3Q8XB 2RGDA 1TU3A 3LDAA 3WYGA 2J7KA 3FKSA 4C0KA 1U81A 2P5TB 1ML8A 5KHOC 4G01B 3AEZA 3CWZA 3DZDA 3W9YA 1XEXB 3T15A 2JLZA 3KX2A 4IEIA 2ZVPX 2YOFA 1W4CA 2BCGY 2A5JA 2YWEA 3CH4B 4TMZA 2ZJYA 2PZEA 2WJIA 2WPDA 3IHWA 2PEZA 1FZQA 2IL1A 4I99A 3O8RA 1X8KA 4I1OA 3NDBB 1SVLA 1XB2A 2XB4A 3HYRA 3QPUA 4ZCLA 1MOZA 2WJVA 1GILA 5JZVA 4EFMA 4AIIA 1XZQA 2BM1A 3LBIA 3RLFA 1GM5A 4FWIB 1OXSC 1QG2A 1EX7A 2JEOA 2OG2A 4YONB 3NBZC 1T91A 3ASYA 1T3LA 4A8JB 3EPHA 5BW8A 3IQWA 2ODNA 1OE0A 1GZSA 3L0SA 3LQRA 4OQLA 2HDNB 4CW7A 1FW6A 2D7VA 4M0LA 1G1MA 5TXGA 1P2TA 1U9IA 4BZPA 4TLBA 1KSFX 1Z6YA 4GOJA 2ZSEA 2KJQA 4HLQB 4G0NA 1AQYA 3GJ7A 2BBSA 1DADA 1Z29A 3LWNA 2F1RA 2VP4A 4AURA 4DLWA 1H8HA 1J5EC 3GLHE 1T9HA 4LK2A 4TT3D 3VR5A 4DRZA 1W0JA 3QE0A 2DFLA 4DLUA 4HB3A 3EASA 2QE7A 2YOGA 3ECCA 5TARA 1RVDA 2CHQA 4N0DA 1V43A 3R9IA 4BFXA 1CJVC 3D31A 2IA5A 1TUEA 1FX0B 1GP2A 4XTRA 5JJKA 1VCIA 2IEZA 4M1YA 5EXPA 3SDZA 1K0RA 1VYUA 1N0VC 2QG6A 4JJKA 4TMVA 3SE0A 3PENA 3I3SR 2JA1A 4CEIA 1Z5ZA 2OT3B 2ZYUX 1Z0JA 3GCGA 2HLDA 4GI7A 5JHHB 4NPHA 4NCKA 4C7OA 3RRMA 2ZUBA 2XB2A 3D6TB 3EAQA 2Q3FA 2WIAA 3K0AB 1KI6A 3K0SA 1E2GA 2F1HA 2AR7A 1TX4B 2RB4A 1EFUA 2WVJA 3G82C 2FOLA 3AP3A 5DHAA 1R0XA 1P9WA 1LF0A 2Z6VA 4JS0A 1Z0AA 2BMEA 2VQSA 4B74A 2BCJQ 1N6NA 1W36B 1DELA 1YU9A 1ONBA 1VG1A 5CM9C 1HA3A 3RWOA 1QHNA 4KYIB 4N3NA 4RD0A 3W6OA 4RD6A 2J9RA 4S2EA 3J81k 2PCJA 4JMPA 4PSKA 1BMFD 5F98A 3K1JA 5GVRA 2CE7A 1LTQA 4IJMA 5JSZB 4FWTA 2C99A 2DB3A 3VFDA 3BAFA 4PO9A 4A82A 5FUVA 3OAAD 2XAUA 3ZZ0A 4V0ME 1SQ5A 2WHXA 4A4DA 1KJZA 2ZR0A 4HDOB 1XTKA 5HKKD 3A37A 4PXAA 2FDCA 2JIZD 1TADA 1HEIA 1HQCA 1JPJA 5CLQA 1NP6A 3TSWA 1OYYA 1II9A 1CR0A 5GJWC 3NWJA 1KK0A 3KJHA 3UK6A 1E9AA 2YJTD 2FF7A 1N32C 3T1HC 1IBKC 1LF5A 3TUZC 4A36A 4NDZA 1W46A 1XDBA 1QHSA 1F2TB 1I4TD 3GJ4A 3PR1A 4TL8A 4HLUC 3VHLB 2GJKA 1G64A 1SXJE 2BBOA 4PC2A 3TVTA 5EP4A 3CRQA 1Q1QA 1XX6A 5FTKA 1U90A 3ZLJA 2QL8A 1FPMA 3ZIAD 2P67A 4PANA 2NO1A 4URWR 1S4QA 4QM7A 2ZM6C 1NL3A 2FZLA 2ZE6A 2BKUA 3LW8A 1P2UA 4M1KA 4JSTA 3WNBA 1QHHA 3JAMD 5EE0A 4US2R 4XWKA 4KFRA 4LJ9A 1KZ7B 5FUXA 1ZNWA 2FFBA 1Z63A 3IO3A 2ONJA 1CU1A 2AXPA 2B7CA 2P6RA 4TMXA 1OB2A 4ERNA 4HUTA 2OPLB 4LJ6A 1JBKA 4QBGB 4Q4AA 1G3QA 3LVQE 5FOTA 3TUJC 1XPOA 1G5PA 1SHZA 3UG6A 4AYXA 1R5OA 4TMKA 4LFAC 1UBGA 4QOSA 4JI8C 1O87A 3T1OA 5AUQA 3GLIB 2J0QA 2UVQA 5DGXA 2CLSA 3W8NA 4IHQA 1DOAA 4NXMC 3WYFA 2ZRCA 3THYB 3EA5A 4ZDKA 4MH0R 2C98A 2VHTA 1GRRA 5AJVB 3I61A 1S1CA 1IM2A 1QHYA 1RYFA 1XCGB 2W2TA 2GA8A 1MKYA 2YC4C 1IAQA 3WMGA 4D0LB 2DBYA 5EXSA 1Q22A 4FMBB 5JS7A 4Z8XA 2BWJA 5E3HA 1K8RA 3RS0A 4RJLA 1GL7A 1NSTA 1ZB8A 2ZI6A 2QP4A 5KO2A 4Z51A 4EPXA 4EIWA 1NN0A 3B1XA 2ZRPA 2QSYA 1XCMA 1CJUC 5DI3B 2EWVA 2OLKA 4L9SA 4KJZA 2GJ9A 3LLUA 3CNLA 3CRRA 4L4UA 1S1MA 1COWD 1XJCA 5D3MA 2BMFA 2C5LA 4HZIA 3U60B 4DVGA 5JEEA 3WBJA 2QEQA 1NMYA 1KY2A 1NRJB 4W9MC 2UUAC 2ATXA 3DEFA 1KDOA 3GMTA 3TR0A 4AYWA 1WBDA 4NYIR 4LJ5A 5A2QD 2A5YB 4YXWD 4KYUA 4HDQB 3AF6A 3L0OA 5IT5A 1QDEA 4CEJB 2G9NA 1KI7A 1W0KD 4LYHA 1XXHE 4NMMA 1Q20A 4NHOA 3GEHA 4QJ5A 3GFTA 5C2JB 2V9PA 4TL9A 4B3MC 4PHGA 4C9BA 2ZSDA 5HTKA 4F38A 3IPXA 4OQXA 1XRJA 3KKMA 1OKKA 4P4UA 2HT1A 1X86B 3MFYA 4CRWB 2RKOA 2RGNA 2ZRJA 3OEHA 3WNDA 3C14C 1FQKA 4IDQA 2GK6A 4G5QA 4DEXA 1L4UA 1DEKA 2WOJA 2YKGA 1ZM3A 2JASA 4NCJA 2YVUA 3I92A 1IN8A 2NO9A 4FD2A 4XH9B 1OFIA 1OHHA 1G4UR 1ZNZA 1EX6A 3CR7A 1PUIA 3EIEA 4LI0A 3ZD6A 3FMFA 2GXQA 4ESHA 2EVWX 5DI3A 4Q1DA 2R6AA 4UJ5A 4W7SA 1OW3B 1F48A 4LPSA 4P32A 1KDRA 1XPUA 2VP5A 4B3TC 2ZU0C 3EZFA 5IHPA 1RJ9B 1Z0IA 1F60A 3AVOA 3A8TA 2ZS8A 4LC0A 1PA4A 2OO7A 5EP3A 4OK5A 2F3RA 3X1YA 3UG7A 2CBZA 5EUQB 5FI1B 4G5SA 1G8PA 2H7VA 2ZEJA 3P20A 1PLLA 3HJNA 5FLXD 1JAHA 4PAOA 4CDGA 4D82A 1W44A 1E0AA 1II8A 3Q7PA 2IW3A 4Q4LA 1LB1B 4LHZA 3GLIA 1XD8A 4PSAA 1PV4A 2PX3A 4EDHA 2Q0HA 2ZR7A 4POAA 4M8NE 1RPZA 1SXJD 3H86A 1J8MF 2FWRA 3QG5A 2B21A 4PHTA 3TNFA 4Q7MB 2DFNA 2P5SA 1MO4A 4DR1C 3RNLA 4D81A 3U7HB 4O3MA 4F4CA 1IQPA 4Q7JB 3IEUA 3LXXA 2XZPA 3DOEA 2CLCX 1CRQA 2VIIA 3Q5DA 2A30A 2DWPA 4GMDA 3PUVA 3CX6A 4TSFD 1GKYA 4OHYA 1USPA 1QHHB 3A58B 2QSZA 1KK3A 5E7JA 1S3SA 2A78A 2ZROA 1R4AA 1U0HC 2Q9BA 2G6BA 5FFMA 3VAAA 1YQTA 3DVLA 2G0TA 4JLKA 4BLSA 2XNDA 4LFCC 4UXJA 2Z5FA 2ANBA 4GFDA 2IC5A 1ANKA 3T5GA 2JLRA 3T34A 3GLFE 3CRVA 1Q0UA 3GJXC 3CLVA 3BFVA 4KODA 4H1VA 3CH5A 1ZP6A 1UKEA 3H1TA 3HYTA 4PC7A 4WXPA 2AD1A 1OPXA 4O2RA 3WMFA 2DWOA 3ZDQA 4HZUA 2O0HA 4OK6A 2XZOA 2DHRA 4Q19A 5JHGB 4EJSC 2IX3A 3PUWA 2ASEA 2DY1A 5J4LA 3GJ6A 1DARA 4OK3A 3RYTC 4QGGA 2QPAA 4IDHA 2F43A 1YZNA 3QOFA 3ZYCA 2JLVA 4OQNA 2JCSA 1MABB 3B9PA 3GD7A 4Q5IA 1WF3A 1CR1A 4KFTA 1XMOC 1LFDB 4URVR 4MRVA 4JSYA 1BIFA 3H2YA 2CLDX 4HAUA 1GITA 3BH7A 4F93B 2F9LA 1Z22A 5EXXA 3Q3JB 1SGWA 2AKAB 2GZDA 4TWZA 2IYSA 1AGRA 2O8BA 2WPDD 4BEJA 2BHRA 1E2NA 5TV2A 1N36C 3F3YA 4ILEA 1RW4A 2AWOA 4Q9IA 3VR2A 2HJGA 4D2IA 3IUYA 1XMIA 4DIEA 2YV5A 3SJCA 4LV8B 5F2EA 5FOUA 6Q21A 1E1RA 1KKLA 3GJ3A 5DN6A 1S96A 1KGDA 2GJSA 3QPVA 3QUSA 4M2LA 3U7EB 1K5DA 4IOLA 1Z6AA 4TLEA 4WW0A 2WIBA 1MO3A 5JBQA 2XXAB 2VP6A 3BJIC 3I73A 4CEIB 2BJVA 3QF4B 2BV3A 2IWRA 3THWB 3FHTA 2O8EA 3TSZA 2J0SA 5FL7D 1ETUA 3AB3A 1E94E 1P6XA 3PQCA 4G5OA 4BLTA 3FOZA 4Q1BA 1F3OA 1A2BA 1GRQA 2ZUCA 4A15A 5CYOA 5J40A 4KXFB 1KYIA 2CDNA 3A36A 2EFCB 1UF9A 1RIFA 4UXHA 2ONFA 4YDSA 3RC8A 4XD7D 3B5JA 2XTMA 2F43B 2IYTA 1AKEA 3GKUA 1NN3A 4BEBA 4A2QA 4V0KA 5AR1A 3NIBA 3EZ7A 4B3RC 5IT9D 1AGPA 1M8PA 1RE0A 4M9QA 4Q66C 4ZI2A 3IHLA 5EUMA 3OHMA 2ZUDA 3A4NA 1XEWX 4HAVA 5A5GA 2W6JD 2ZS9A 2QBYB 1U99A 2IXFA 1DAGA 1HNZC 4A2WA 1KOFA 2ZRDA 3X1DA 4JI4C 2D2FA 2UZ3A 1N2FA 1IXSB 3QQ5A 5G53C 4C0SA 2ZITA 3BRWD 4C0AC 4XJXA 1AM4D 3LX8A 2K5UA 3RWMB 4V0OA 3UANA 5FBWB 4IDPA 2ZJOA 3MLEA 2R6DA 3QNUA 4DBLC 3ADBA 2C04A 3KKOA 1NNEA 4NZYA 2ZXUA 2PL3A 4BLOA 2O8DB 3QKTA 1YZLA 1F2TA 3IIJA 1O3YA 2SHKA 4IOMA 2HXYA 2FU5C 4LF7C 3HPRA 3QPWA 1CIPA 3IBYA 4X64C 3C15C 2QAGC 4HUQB 4R2HA 1KMHB 1N34C 1WE2A 2QROA 4AC9A 2V4ZA 2A7QA 3U4QB 3B78A 3R7WB 1S2MA 2IUTA 4MRPA 4EUNA 1GWNA 1SVSA 3ASZA 3CB4A 1N0UA 2ERYA 3WY9A 1J2JA 1SVMA 4JLVA 3MJHA 3K70B 4LJ7A 4P31A 3EZ9A 5C4MA 5L3SA 4LHWA 4BFTA 1HYQA 3I07A 4DLSA 3I1FA 4EFLA 3U5ZB 3GJ8A 3EX7C 2GRJA 2QQEA 3N5CA 2ECKA 3K70C 4DR6C 1KKGA 2OBNA 4DLVA 1T5IA 4DCVA 1Q44A 3EARA 2GF9A 1P3JA 3UMSA 2EYUA 3GJ5A 2FEOA 1Z2AA 3BERA 3DL0A 3K0AA 3R8FA 4DIDA 5FBLB 5CM8B 4DT1A 3CM0A 3BXZA 2PMDA 3NBFA 3ND9A 3QKRA 5CJPA 2FEMA 2O8FB 3IPYA 1K5GA 2X77A 3ZVRA 2B6HA 2D62A 2EGTA 2ZRMA 1RRCA 5FL7A 4HAYA 1G41A 3V00A 2RGXA 4LHYA 5G40A 4A6PA 1Q21A 4OHWA 2GAOA 2VHJA 1XCPA 3QG1A 3KDSE 5F3WB 3A6PC 3KKPA 1S3GA 1E98A 3EWAA 3AQ4A 1OT3A 1W0KA 2BDTA 1ZMXA 2AK3A 2J1LA 4OYHA 4KBGA 4ON9A 1E79D 1NF3A 1FJGC 4LV6A 3OFNA 4X8OA 4YLGA 4AWXA 1NJGA 3SEAA 3U44A 1GFIA 4DSNA 2V7QD 2QPOA 4G1UC 4DV6C 2XTZA 2IT1A 4D26A 2IS4A 4JZKA 1KSGA 2GVDC 2QTHA 4QGHA 3CX8A 2RH5A 2FPLA 2TMKA 5TY0A 1TQ4A 3RABA 3X2SA 2IF0A 3E1SA 1QF9A 1UBFA 4Q47A 3FFAA 4NKRA 2ORWA 5DLQC 1KO8A 3QXSA 3C5HA 3C4JA 1ZC4A 4B3SC 1XZPA 2VSXA 1KNXA 1B0UA 3OEED 4BLQA 3GLHB 3SN6A 5EXTA 1FMJA 3PEWA 2R2AA 4M1TA 1N25A 2IXGA 2KSQA 3NBYC 1USPB 3W6NA 1AQUA 1OH5A 2CXCA 3GFOA 4AD8A 5BYKA 2ZI7A 1KMQA 2MSDB 3QKRB 4O0MA 2O8FA 4RZ2A 2WSSA 1DAMA 2WV9A 3LA6A 5AJYA 4TL6A 4NYMR 3PV0A 1G3IA 3ONWA 2WBLC 4DR2C 4MGYR 3BOSA 5AUNB 2R9VA 1TMKA 2XTNA 1UEJA 1OXTA 5JJIA 5CJ2A 821PA 1G17A 4JJZA 3EA0A 1LV7A 5DN6D 1RZ3A 4BGDA 3AP2A 1UKKA 4IW3B 2WICA 3W5IA 3QKUA 3Q9LA 1US8A 4WZ6A 4EJSA 2F4VC 1CR2A 2D3WA 4DCTA 5BYJA 2CCGA 4S35A 2FJUA 4TLAA 3SYLA 1DE0A 2DWQA 4Q21A 3CZPA 3CZQA 2IHBA 2RGEA 2MSCB 4KSCA 3TBKA 5L3QB 3BFKA 1SVIA 5CK5A 5DISB 3B9QA 1Y63A 3SU8A 1EWRA 1KAOA 3KTAB 4DLZA 3FGNA 1QG4A 1SXJA 4LF8C 2OPLA 2J3EA 2ZTSA 2D74A 2O52A 1R0WA 3TUIC 5C18A 2IYUA 5DNYB 4M21A 3BIFA 2HHHC 5H1YA 4LCBA 3VR4A 2FSIA 3LNCA 3AM1A 2P2LA 3MWJA 2Q3HA 1E9BA 2ODBA 1W47A 2GF0A 2P3SA 4I1VA 4JKYA 3I5XA 2C03A 5FBRB 4V03A 1G19A 2NO7A 4LSGA 521PA 1JXMA 2ERXA 4HLCA 4ZDIA 1H8HD 1E96A 1G3UA 4QHTA 2IYVA 2OUKA 2NIPA 3MWKA 3QF7A 1G5TA 4O25A 3UMRA 4GL2A 1IY0A 2CVFA 4FI3C 4A8JC 2HEIA 3U2QA 1XMJA 5HPYB 1YZTA 4FN5A 4O2LA 2VLIA 1YR6A 4H1UA 2ZJBA 1G8HA 1S9DA 2IF2A 2OBMA 2G77B 1VCOA 4MA4A 2CXXA 3ZGXA 4DCUA 2FZ4A 2H57A 1XFAA 2UZIR 4ABYA 2ZYWX 4HB0A 2PT7G 4MUAA 4A2PA 3VR3A 4EAQA 2J46A 4CVNA 5IK2A 3VR6A 3SOPA 4TL7A 2FFAA 1TL7C 2OCPA 3HDTA 4CEJA 1TEXA 3L0IB 2QAGA 3OEHD 1WH9A 4B33A 4EPRA 4XWOA 4LBYA 1G6HA
chains in the Genus database with same CATH superfamily
5K3CA 1T2VA 4NBTA 3SC4A 1ZVKA 2QJTA 3CNOA 3QFHA 4EVSA 4JJIA 3AJRA 2W90A 2VWHA 4HWKA 4LC1A 5SY6A 1E79A 5FUYA 5LN1A 3PJFA 3QKSB 1BEUB 1Q50A 2NACA 4IH9A 1ZZEA 2O8EB 1THMA 3PEUA 4ENTA 2DP4E 1XKLA 1ZUNB 1GZUA 3SEFA 3U4AA 1QRDA 4P3YA 4BO8A 1IZ8A 1C9DB 1EPUA 3KLNA 4FHFA 1U0TA 1X7XA 5IAEA 1I1NA 3W8RA 5C8ZA 3UFXA 3DL4A 1J24A 2GBGA 1NC3A 1K0FA 3UOGA 3RK4A 1C1YA 1KRHA 2VJMA 4PX5A 2J67A 4HTFA 1C8LA 1E2IA 1M2VA 4RFSA 4UUAA 5K3AA 2Z2JA 2FSVA 1EWQA 4PZUA 3CRW1 4LMAA 4MI1A 1VDZA 6ADHA 1QIMA 2R7KA 3AVUA 4BPBA 1I4DD 5IMBA 1UBSB 4TSRA 2MYTA 4EY5A 2ZUFA 5ADWA 5A0VA 1LWNA 3D4LA 3E4DA 1W59A 3LPNA 1TDJA 3BBPA 5TPWA 1N3LA 2PT5A 3DEYX 2PMFA 4Q1CA 2V0GA 3WWDA 1Y82A 4R2LA 3KEGA 5DCUA 5HIJA 3CF2A 1M8KA 1AD2A 3OCYA 5KSWB 1YD7A 2FHPA 2POCA 3A4TA 4RMGA 4JELA 3IEMA 1L6RA 1BO6A 4WDQA 3PRJA 1X1AA 3N8DA 3OX4A 4BVBA 4DZZA 4ZVRA 2CXQA 3N0TA 1OX4A 2PZ8A 1A9TA 2EATA 2WJZB 5JT1A 4ZHSA 1QGZA 4QGSA 3U4MA 3UXYA 3N2GA 2FOXA 3DUWA 4J49A 2CNNA 2C9DA 3EN0A 2Z58A 3N0WA 1B74A 3HN2A 3PE3A 2BEWA 1K7YA 4Q9HA 2AW5A 1Y1LA 2GYYA 1W35A 6REQB 3ICQB 3LFUA 3O8QA 3WB2A 1XF9A 4JLJA 3U40A 1ZCAA 3T7EA 5FBHA 2OXTA 5I7WA 4GX0A 5JQWA 3WJ2A 1QX3A 2CFTA 3CZRA 3PGLA 4U02A 3L06A 2MWMA 1V5WA 2HF8A 3E27A 2VYNA 2W93A 1OAAA 4LWPA 1HXHA 1SOVA 4NOLA 3DOHA 4BKRA 1FFYA 4AKGA 3ICVA 4D4JA 2UXCC 4DDVA 2VTDA 1K8QA 5GZ6A 4UEOA 4I0WB 5EIBC 5G3YA 2ZLBA 3A05A 5FBQB 2HR1A 2CXNA 1XDWA 5GONB 1U7DA 1QX4A 2Z4TA 3R0JA 2C5SA 4I9FA 2IYPA 4PLTA 2X7JA 4QFMA 3NBXX 4OXQA 2EIXA 2FE4A 2PMCA 2CNOA 3O3OB 1W4BA 1YAJA 3K9WA 2YZNA 3G5UA 1QS0B 1UMKA 2JFNA 5GOTA 3ZCTA 4AXBA 1XD9A 2P2YA 1NIJA 2ZYHA 5ER9A 4RY9A 3ZQKA 2A58A 2BBTA 1M1XB 4F3TA 3KZOA 3GNSA 4MQUA 5H59A 1FUKA 2DFVA 3CO5A 3BMCA 3HWSA 3LMKA 4H9GA 3GFBA 3ONNA 3P0RA 4LYGA 1II8B 2LWIA 4UU7A 2WPNA 4I6GA 4IIFA 1GKUB 4GYJA 4WZAE 4PHCA 1FFWA 4KRYA 1EGVB 1R2QA 5EQJB 4CLRB 4CIDA 3TIXB 1IRXA 2H4JA 3DCYA 3MIZA 3F47A 2P75A 3NEYA 4J1QA 4KGZA 5K8VA 2ZYVX 1RNLA 3V4PB 1UP7A 5JRJA 2GEFA 3CCFA 1V1JA 1MQ8B 4R81A 2GRAA 1B1AA 2HMAA 3O4HA 1CS0B 2PD3A 4UEJA 3WRWA 2VK8A 1L5MA 5GJCA 3ZGNA 1DDGA 3AR7A 2I3DA 1IJFA 3T94A 2ZBGA 1N6HA 3T3OA 5IRCD 3U7QA 2GVNA 3WLOA 1R0LA 5B12A 4TKLA 5AJZA 3ELDA 4MEBA 2AG1A 3EW9A 3EVGA 1F5NA 3KUCA 1SCDA 3W2IA 4NJMA 2OHXA 4R54A 3VNVA 1KS9A 2QRQA 2P9YA 3FKJA 3HUFA 3V32A 1XRSB 3D54D 4YJGA 3T3HA 5BSGA 4F91B 2DSTA 2BJHA 3QKIA 4PAQA 1GA1A 5CNKA 4R1NA 4PTZA 3ESBA 5KOYA 1AJEA 2HSEA 3SXPA 4C20A 2GKSA 1YHZA 4L50A 2TMYA 3LKZA 4LYYA 3PC4A 4TRNA 2GFHA 2HNKA 4ZKEA 3RYFB 4F86A 1V3TA 2W58A 3HCAA 1B3RA 1E2MA 2X8JB 1E8NA 2XGSA 3RS3A 4ZGWA 3UJBA 1G5IA 2XAAA 4ENWA 1T6BY 2YWJA 2V8OA 3R3UA 2IZ7A 2F3TA 3DBOB 5ELXA 1JEAA 4WEOA 3C7KA 4QUBA 1EWTA 1DI0A 3U3MA 1NR7A 1LV8A 2OXCA 3PUHA 5AM1A 4DDUA 3ETLA 3JWEA 2A33A 3GFGA 3G2IA 2G07A 5FIUA 5JZMA 1JHRA 2FG6C 2KBEA 3UUWA 3ZZUA 3QLJA 3K70D 5A9TA 1RXSA 3RBZA 3A11A 3ZVLA 3IRUA 2A9PA 4ASUD 4MV3A 1P8JA 2EZTA 3CZ9A 3ZHXA 2OV8A 3IMGA 3WWYA 1Y89A 2HWUA 3LWDA 4JP1A 4BRUA 3RC3A 1F51E 3NXKA 2PE5A 2O2ZA 1FE8A 1K6MA 3TK1A 1B6GA 2Q3MA 2RI6A 3PHBE 3SHWA 4GDMA 2IU0A 5FJJA 1W36C 3NTQA 1FRVA 2BEUB 4Y6LA 4OBWA 3EIFA 3GZJA 1WHSA 3QU2A 4G0MA 1QXSA 4TMWA 4Y6GB 5DNAA 3OUZA 1ESDA 1Y4DE 2AQKA 5IJAA 2X5OA 3FRJA 4U2KA 2E5LB 4ENVA 1WQ3A 4HV4A 3ELBA 5F3RA 2PWYA 2W43A 2D0PB 4AX4A 1N1EA 2GD1O 3HA3A 3N2KB 4NI5A 4R05A 2OXRA 1CDOA 2C4UA 1CIJA 4KN6A 4TMFA 5LWHA 2GHQA 5LB4A 3I5YA 1RRMA 4KC0A 4FDAA 3B7GA 3ZH2A 2PPVA 3TRJA 4LF5B 4GPTA 1P81A 4UD2A 4PY2A 4ZIRB 2QI9F 3M4YA 1RAAA 1MQSA 4RUKA 4ZPXA 4OXYA 1FTSA 2WAXA 2PUJA 3GUVA 1K7SN 1YZQA 4B3MB 3OC6A 3AQIA 4RHEA 4GBGA 4M1QA 2H85A 2IWHA 3S44A 4OMDA 3IOBA 1ISSA 3D8TA 4CF5A 4ER0A 5IKXA 2I3BA 2FZVA 2G63A 2XHZA 3KZNA 2QD3A 4DC9A 4BNDA 3GPLA 1YRQA 2HM7A 2QE7D 4MLDA 4DR3C 3DZ8A 3HC7A 4H35A 1MAAA 1ZRHA 2XDWA 3BFJA 4Q4CA 4GYKA 2X8BA 1HZZC 2W11A 1S2NA 3ET4A 3NC1C 4MVJP 1WRBA 3KQPA 4QQFA 4DANA 2QD1A 1ZM2A 5CDUA 3UMYA 2UYCA 1XAGA 4CFZA 3EIOA 4U2FA 1AA6A 2IPMA 4K1XA 3N8HA 5EE9A 3N8IA 3DZFA 4I19A 1WS6A 1VRVA 1P7CA 1P0FA 2WV7A 4R7ZA 5JAIA 3Q6NA 3OF2A 2G82A 3DDSA 5JSFA 1YR3A 2UUBC 4I2VA 3BWXA 3WNCA 2WSMA 5A5VA 2AZXA 1OLSB 4CKBA 1SOWA 2XDQA 4A16A 1KY3A 5CW1A 1RHJA 5HDBB 3SHVA 1UC4B 5EL0A 1X7WA 4MP8A 1DJOA 1XDSA 2FZWA 3EXHB 2Q8NA 2ORYA 5ALDA 4TTIA 1ZH8A 3CEMA 3LW7A 3N9IA 5EZYB 2QRGA 4UD6A 4EY8A 3LV8A 1ULTA 4YUVA 3KQUA 1KJYA 2RGRA 3T41A 3ABSB 3O8QB 1YS9A 5JD5A 4LF7B 3SO4A 3LOPA 5L40A 3ZWOA 5EINA 2A86A 1NW3A 1QGUB 4W8HA 4RACA 5DTQA 5DYTA 3FUUA 3N2GB 1QE5A 4KXLA 3QV2A 1DKNA 2XCUA 1SY7A 4C4RA 3H5RA 2EP5A 1SK8A 2XECA 4YQYA 5DEOA 3DYBA 5IKMA 3LT2A 4OPMA 1PT5A 4HQRA 4PC3A 4KN8A 2XUAA 3KELA 3OMXA 4LDJA 1AK2A 2G67A 2HU8A 2HAEA 2P6NA 4YMTA 1HURA 3B12A 2I4OA 4XD2A 1BVRA 3BHMA 1AKMA 3BHJA 4P9NA 2VUSA 1XMSA 1RG9A 3AM5A 3KFVA 1E1NA 5ALIA 4HWSA 1E7SA 4BQNA 4EG3A 3JALA 2O0JA 2OYSA 2Y1LA 6Q21A 5EXEA 1O0SA 5A6SB 3Q6MA 3IQEA 1QWSA 4PYRA 4BVAA 3ZE6A 2NADA 5T4BA 4PZLA 4LZLA 3NATA 3PEFA 4X62B 1O9BA 3EVCA 3EVFA 4DT1B 4JV5B 5MF6A 4EB3A 4YJ2B 3R0VA 2HYIC 3BT7A 2OGUA 3IFSA 4K3UA 1QQ5A 5C9ZA 1QTRA 1WL8A 2GEDA 1P4GA 4RVHA 5CP8A 5ITWA 2XCLA 4HPWA 1UKYA 4BWVA 3OETA 1Q7BA 1H1LA 4YHBA 1CLUA 1P1FA 3TI9A 3VQTA 4EVQA 3Q2OA 4OBEA 4HYYA 3STTA 3Q5GA 1AQLA 1ZUNA 5B3AA 4B80A 4C29A 1M6VA 4D80A 1E4YA 1S3FA 1S8OA 2QN1A 2GWHA 2OEPA 2JGAA 1I3OA 1VJ0A 1Y3CE 2O20A 2ZBEA 3AGQA 3DUFB 3QPBA 1TXGA 4XCQA 2D28C 1I6MA 4JYPA 5T3YA 5DO9A 1HFJA 2HCRA 1ORVA 2ZIZA 3DULA 5FH9A 2F3SA 4ITVA 4MLZA 4ACAA 4JI3C 1JR4A 1NC1A 2F6RA 3ITEA 3UZ0A 2JZOA 3P2KA 1K86A 4BVHA 5FPKA 1RZRA 3BWCA 3NM5A 3J81A 5IDXA 4PFKA 2WVHA 1I6LA 3SJBA 1JT2A 3LRXA 4EZBA 2CVZA 3D3WB 4PYJA 1F9AA 4QICA 2XKKA 2C4VA 4NE2A 4DR5B 4UPDA 3G8BA 1IBLB 3GCZA 1NXQA 3QBDA 4C2AA 4CT0A 2R66A 3EJ6A 2GPNA 3TNJA 4DGSA 4AMUA 1GA6A 4OKSA 3E03A 4BFVA 1V41E 2J45A 1H6DA 3QTTA 3C39A 1MC5A 4FIDA 2NPIA 3ESQA 4XFJA 5AW5A 5F2KA 2XKJE 4KE6A 4F4IA 2QYOA 3MS7A 5HZHA 3G9QA 3KAJA 1OXBB 2XQJA 2ODAA 4B2IA 4KUEA 4H3HB 1P8AA 2XQGA 4HXFB 1YKFA 1DJQA 5LJIA 1N0WA 2XWBF 1XU4A 1V35A 3TCKA 1ODFA 1LS1A 1NKTA 3NTUA 1R8XA 1ISRA 2F8LA 4NBRA 2IZ1A 4L0CA 1T0JB 1XTSA 3MXOA 4LRQA 5EHIA 3R7LA 1Q0TA 2KM1A 4GPAA 4CCAA 1SQFA 2X14A 2Q1XA 3B13B 3SVLA 3I1IA 1QZTA 3IP8A 1EFVA 3FG9A 1UT8A 4NCXA 3ZI0A 1KJJA 4TPSB 3QY0A 4FIZA 4NBVA 3IAS1 2VHUA 3DTVD 4EOGA 2QTRA 2XNSA 1LPOA 2JF0A 2XIQA 5HK8A 1ZNQO 2FEAA 2G5GX 4AUMA 1NQOA 3AF1A 4EEZA 1FQOA 2NSHA 3N59A 1VI5A 4IRUB 1JVNA 5DSTA 3E7XA 2WU1A 2D2IA 2Z43A 5HXAA 1LQLA 4RKWA 2HCBA 5IJ9B 2BGIA 2PG3A 3CJRA 2CSUA 2AFIA 5KQGA 2HPAA 2C7RA 3SIWA 1L5OA 4JU9A 1I4LD 3QUTA 3A2KA 3CF4A 3L0ZA 1JEYA 4WI1A 1Z7YA 1PO7A 2B0JA 2FQWA 2WD9A 4QDUA 4RWZA 2B20A 4MQ6A 5IVIA 4D3XA 2ATCA 4DIBA 1O5IA 3KCNA 1LA2A 4LF9C 1DC5A 2ARKA 3LJKA 3NUZA 5CK4A 3SLRA 4B6GA 2V9ZA 2Q1TA 1CHDA 2PSFA 2OFOA 2YOHA 3PQ3A 3RT9A 4AJKA 1Q7RA 1ZONA 2GCPA 3KYCB 3LBFA 2V03A 3W3AA 3COZA 1AXGA 2I6TA 2JI6A 1UWDA 2WM3A 2W2QA 3AEUA 3R09A 3FVVA 1A2OA 3V8RA 1I0ZA 4B73A 5CB6A 2ZT5A 1NV9A 1PKXA 4ZREA 2YQZA 4PCUA 1RYBA 1ZGJA 3BE5A 4K6HA 4LZPA 2JLBA 1BYUA 4XVQA 1XWIA 3IAFA 4UM9B 1Q1EA 4G81A 4P1ZA 4RGQA 4Y2XA 5CFOA 2YHBA 2BMJA 3LS2A 2VZ8A 4ILKA 4MS4B 2XF2A 4D9CA 1T3GA 2XXBA 3RQIA 2FWMX 2D2EA 3RU9A 4OAOA 1W6RA 3ZR4B 3R7AA 1OH7A 2CMDA 3BXOA 3U1BA 5AXAA 2CJPA 5KTYA 4KUGA 3LHIA 3P2YA 2V3VA 3AETB 2RI1A 2ENUA 1ODJA 4NJMB 1G7RA 3HDYA 3KALA 3SDBA 1ZOLA 2VJQA 3JD1A 1XAIA 5CA0F 3ZV3A 5PGMA 5BNWA 4KACA 4IF6A 2NTJA 2P3LA 1RDFA 1PRYA 5GPBA 3ZV4A 3AOGA 4G23A 7ABPA 1REQA 4J1TA 3HNPA 4JJ7A 5HOQA 4IXTA 2V6FA 3AY3A 4PTLA 4WZBA 5ETJA 2ZWMA 1HTWA 4UHFA 5DT9A 4NC9A 1NVUQ 1F5SA 4IPTA 5BXQC 1Z28A 5EHZA 4BC9A 3EGXB 4X93A 3VR5D 1NU8A 2FGJA 3GHHA 3BB1A 1N33C 2BFWA 1Y1QA 1QOZA 3CF6R 1MQAA 4FS8A 4YCNA 4CIAA 3E9QA 1MA3A 3GRCA 3E1KA 2D1RA 1N6RA 5KYWA 2PUWA 3F90A 1RWOA 1Q0SA 1JQJC 1UKBA 5FOXA 4DJ5X 5C1OA 2ZB3A 3C8DA 1IWBB 4LUCA 4RSGA 5G1NA 4BC7A 4ZVKA 4E30A 3X1WA 1EBUA 4BVKA 1PUXA 4PX3A 3K0FA 1N8TA 1JE1A 2XOEA 3PJRA 1P39A 3DWIA 3RAPR 5HG0A 1KJWA 4IFBA 2BMVA 4QBFA 4F0JA 1KZ6A 1NY6A 2UKDA 2R6ZA 2HA3A 1C3EA 2DFKB 3ZDBA 1CRZA 2CDAA 1OTXA 3CUWA 4IMIB 1YJBA 4ZXFA 1CYEA 1RQLA 1OU4A 2ECFA 5TF0A 4EPTA 2OA0A 1U2TA 1CULC 4WFQA 5YASA 1LUAA 5JI2E 5E7MA 4CMEA 4F2WA 1A7JA 1OC2A 4GRAA 2VXYA 2G80A 1HOTA 2ZWOA 3DB1A 4ZU6X 3UJPA 2PVSA 1PGJA 3KD2A 2G04A 3GAAA 2ZT6A 2WFLA 4MB0A 4O2AA 4Q3DA 2PAAA 4Q4JA 3SX4A 3JQBA 3TR3A 3LVBA 1DO0A 3K72B 4LTNA 4YJ3B 1JGTA 4Q9JA 3VDRA 2EJUA 2GN9A 3I5MA 1M2OA 4XR9A 3WLTA 4DEYA 2DPGA 1W85A 4C30A 1UPCA 2QTFA 4I66A 2HTEA 3G49A 3IUSA 1M67A 3Q11A 4X0EA 5DNUA 3GP3A 1KQOA 2ODWA 3HFSA 3NHMA 5BRAA 5C7IO 2FV8A 3DMDA 4BFWA 1PJCA 2AXNA 2CCJA 3GLGE 1G20E 3L7KA 3ORRA 1NR5A 5LA6A 2C9ZA 1PG0A 4WS9A 2QVYX 2Q5CA 1HNXC 1G63A 5LOVF 1QU2A 2Q4RA 2WM9B 1XDZA 4Z2AA 2G4VA 4UC0A 5CYPA 4DJJA 3MQ4A 2FDXA 4N0QA 4YCDA 5E38A 4KZKA 3V1NA 3DTVB 4UTXA 1H6CA 1KP3A 1M6EX 3EIUA 3IOCA 5JIBA 2P6PA 1Y9DA 4QYWA 3IT3A 5BQOA 3ZH9B 4DCPA 7ADHA 1ONOA 3COWA 1E89A 3IR7A 4GSLA 5E3JA 1CJTC 4KO1S 1MRNA 4G9GA 1YGPA 1U9YA 4G1EB 4Q1AA 4R1OA 4D9NA 1TFUA 2J5RA 5JBIA 1ZVVA 3PQ7A 5E8RA 4JQZA 5REQB 3I2GA 5G2OA 2IZOA 3RO7A 3AXSA 5FO0A 3TOSA 3QU9A 3OTGA 3JRXA 1HV8A 3M6MD 1K8YB 3ZHZA 1D4OA 5LKAA 1WW3A 1GNRA 3NG1A 1VKZA 3OIVA 3L6OO 4G86A 3NUQA 3VKWA 5A7FA 2R4TA 2GZRA 5AKLA 1V5EA 4DMHA 2OILA 4DBZA 4BLPA 4MW0A 4RF5A 2IHYA 4KE9A 4WDRA 1O94A 2Q8QA 2RBEA 3KQTA 4XUDA 1AU9A 2LIPA 1WNFA 1JDTA 1P7YA 1DAHA 3AW8A 3L7CA 4AJHA 4Z7JA 1LCIA 1L5SA 2QMOA 3D8NA 5CZVA 4DIMA 4XTCS 4ZEXA 4P0QB 4L15A 3QSYA 3OHSX 1V95A 3IAEA 1RPTA 5IZCA 4L7VA 3OLCX 4HSEA 1RWQA 1J9EA 1EKXA 1KVRA 1T9CA 3AEQA 5DLPA 4CR8A 1E5TA 2ZB7A 4M1MA 4INPA 4TLCA 2ZSKA 3D0KA 5AP9A 3H2ZA 2JHCA 4K0KC 3A9CA 4GR9A 3CUSA 4X6UA 5SZIA 1X42A 2W6PA 1AUQA 2YWHA 4RULA 2BYTA 3CVYA 1EP9A 2GCOA 3LY7A 1ILWA 3AR8A 4PGMA 5KYUB 2J59A 3LDFA 1HL7A 2HMVA 2RGNC 5LLSA 4AFNA 2IEDA 4BFUA 1W19A 1R9JA 3TW8B 4DBLE 3GVXA 3EQ8A 3U13A 1M6XA 5IT0A 1FU8A 2ZW9A 3IQIX 3KSMA 1OB5A 1R1DA 3CLRC 5SZKB 1Y33E 3ZXUB 2FDCA 1O97C 2JANA 5TMDA 4DV5B 3UPTA 4KRFA 4KGVA 3M5DA 5IM5A 4H6PA 1ZW6A 1FXUA 1P0QA 3HYLA 4RA6B 5ADUS 5K2OA 1VB5A 4JENA 3P27A 4PFSA 5B7QA 4BVJA 3GYBA 4RTLA 2DF8A 4OLFA 5EOVA 1YVRA 5E6SA 5TQ2A 1NVVR 4WRRA 2R5WA 3UYKA 4AY5A 5HQ3B 3TECE 1E2FA 1SOUA 5E9QA 1DXYA 3AIMA 2C2OA 2B5VA 1F8GA 5CUQA 3DOJA 2J0VA 3S29A 1YZGA 4EBBA 5KREA 1DGQA 1O6FA 4O4IB 5DW3A 1AH2A 3HE3A 3F4BA 5DE3A 4AMYA 4IOJA 4RD3A 3IPLA 2O4UX 3I53A 4AJ2A 4KHZA 2HD4A 5F9HA 3RTCA 4TTVA 1W5TA 5HQJA 4JI5C 4U4AA 4LJLA 1YA8A 2ALJA 1PYDA 3K09A 4MGZR 5GP1A 5BMOA 1NBIA 2VPXA 4CU5A 2HB6A 3LQKA 1IQRA 1RE1A 1DWOA 1U2SA 4UTRA 2DERA 5AKGA 3JQAA 2X19A 3IAXA 4UAGA 5JQGB 1PWXA 1Z4JA 1JAZA 2FSHA 2C78A 1PDVA 4ECAA 1LQ2A 2REQA 1ZD2P 4QYTA 1Z74A 2QORA 2CK3A 4JEHA 3VI4B 1R4ZA 4B3SB 2VYVD 2CV2A 1IJEA 1FNMA 1WDWB 2OWDA 2QU7A 4RPCA 3D7KA 2P62A 3E9DA 4L51A 2FGKA 3GNQA 2B61A 3OMWA 3LUFA 1HDEA 1VLJA 1G5QA 2XVYA 4EYGA 1VHLA 1O96A 4R8VA 4X7PA 3WGYA 2ORIA 4ALMA 3RAEC 5CTJA 2CCKA 2ZB8A 4KSYA 4IY1A 5ENDA 2CF6A 4JI5B 2CL6X 1XZMA 4FFWA 1U94A 1DKMA 2B1RA 1T2DA 1U8XX 1EFPB 2PGJA 2Y1FA 4RD4A 1SXQA 1CIVA 2ZG6A 5AYVA 2NU7B 1TIBA 4JKIA 2IYYA 2QVXX 1M1UA 3M1IA 1KR5A 2YUIA 1JTFA 3RS2A 1NR1A 5IJZA 1DXHA 2XOXA 4UE2A 5I4IA 5J2UA 1RIIA 2QN3A 4L27A 3AEYA 3H9JA 2IYOA 1D1SA 3VH3A 2AHOA 1RRKA 2B8TA 1WXIA 2NYAA 3ZIAA 3IIEA 1WZIA 2XI4A 2YS6A 3N8GA 4O4JA 4MRMA 121PA 1ETHA 4X45A 1NQ5A 1ZOIA 2X8AA 1E0JA 2ZCVA 3RUFA 1X1CA 1XEWY 1YIDA 2G25A 2I6QA 2PK3A 2Q5HA 3FGZA 2LD4A 2PR2A 3I9LA 5HEKA 5B2ZA 4IIBA 3KUDA 2Y9PB 3KAQA 3TINA 3I09A 4MA5A 4W5JA 2VNJA 2JG3A 2FW8A 1L2FA 5EXDA 2QTTA 1SCBA 2IEYA 2JAWA 3ONVA 4J07A 3E8SA 4KXXA 4H7HA 4BY9E 1DJMA 3HFJA 4GHWA 3L4BC 3VSBA 2D1FA 4IQGA 1CJKC 1KK1A 2BC9A 1T3SA 3JCZA 1Q7TA 4FILA 2OYCA 5BW4A 4PROC 3L7JA 4DR6B 3LQQA 3N6XA 3NNDA 1IATA 4W1SA 4G26A 2QZSA 2VRWA 4FFNA 1Z56C 1OUMA 3IBGA 2Y4NA 1FLDA 2C97A 2HREA 2JAOA 2ID9A 4FGLA 2YL2A 3CBGA 1NX6A 4G0WA 3OZGA 3DNPA 4KQEA 4TMTA 1I1OA 4PQRA 3BQMB 1U8EA 3KB1A 1XT6A 4M83A 1PFUA 2P7HA 4M9SA 4FMCB 4WZAB 4A5SA 1F4VA 2UVPA 3OOEA 5EWJB 3K9LA 1JLLB 3IV7A 3NDPA 4MR9B 5K7SA 3WOVA 5A2GA 4F7DA 1QYXA 5HX7A 1B4DA 4YK7A 1N3BA 2ON6A 1ND5A 3MWYW 4JR0A 2C8LA 1WP9A 2WAYA 4I3FA 4Q4HB 3VDQA 1NFQA 4O02B 1VKOA 1YBHA 1ARZA 3NM6B 1XYVA 4GUAA 3I6BA 4RPJA 4NICA 4TXMA 4V3CA 2M5OA 1X7DA 3G7SA 4EUHA 1C3JA 2DJ5A 3N8KA 4DMLA 1GAEO 3GU3A 4BB0A 5CA1B 2HY7A 4UBNA 1VG8A 1TYBE 4H31A 3RVOA 5FOVA 1Y8AA 4ZAXA 3I9MA 4PV7A 1KOGA 2FYTA 1FFEA 4FN4A 1WKCA 2GBLA 5CZXA 1NBMD 1QV7A 3CZAA 4ZO4A 1NI4B 1XZFA 2X41A 1YIOA 4ZRNA 3TBFA 1D8TA 2KB0A 4LZZA 5D85A 3U19A 1YZVA 3LK7A 3E5NA 4D8UA 1B8OA 4B87A 5JS1A 1W87A 1M54A 1TW3A 2BELA 2MR5A 3LBNA 5DGCA 4N0PA 3OECA 2V7EA 2E6UX 3ZGZA 4MQEA 5BNIA 2I34A 2VBFA 2W2LD 3AYXB 1Z73A 1KDPA 5K1ZA 1SXHA 4B48A 5L3SB 4HH4A 3TZKA 4J0JA 3V2IA 3S1SA 2VDNB 1XS3A 2H92A 1HLDA 3GAFA 2ZJ4A 2LKCA 1TB4A 3OLVA 2RI0A 2AI1A 3WLJA 1XRRA 2AKYA 1CZRA 4PU0A 4XAQA 5CX1B 5KSYA 2C2XA 2FSGA 2IU3A 2Q0QA 3CO0S 3ROMA 3T0IA 2XNDD 4Q4AB 5K4GA 3GRAA 4RQBA 3RSLA 2QSUA 3BUSA 1KETA 3SVZA 3ZHOA 2YY6A 3WX0A 1NJSA 1PGQA 4L8WB 4GZMA 2I2WA 4LQCA 4Q4DA 5KNDA 3KTFA 3O03A 2W42A 1EGHA 1OT5A 1Y6RA 3HN6A 1PZNA 2PY6A 1ZWLA 2RHMA 2VWPA 3BD6A 4V0NA 3U3ZA 3GT7A 5LDDC 2NP6A 5JVDF 3E9EA 1FDTA 2QRLA 2BPOA 2E4UA 4ID9A 4JJ4A 4JB3A 1D9ZA 1PFGA 4MMXB 3LCVB 2PRZA 2ZM5A 2BOVA 4ZT4A 3J7TA 4Q9LA 4YCBA 4OJMX 2WFMA 1ZY2A 1N5LA 5FL3A 3SHFA 1O95D 3F71A 3VTKA 1VBMA 1ZD8A 1N6OA 2XVZA 2RGYA 1LBSA 5EMLA 5A02A 1E2BA 2PBZA 2XUIA 2CNKA 2IYFA 3BIWA 3R8CA 1XZBA 2QUHA 1H65A 3PLRA 3V3KA 4C4OA 3TIVA 4CKEA 1I3MA 3CJTA 1DQNA 1THZA 4OQEA 2QLNA 4YLEA 1H4SA 2AOUA 1QBGA 1E9EA 4J7AA 3AF5A 2P65A 3EH1A 3T1VA 5IXSA 2YQ4A 5F9MA 2PX0A 4M7PA 1XFDA 1XRMA 2HA0A 1E1LA 2QRJA 5LXTF 4RPKA 1CZUA 4X7RA 5TGTA 2J41A 3ROFA 2OXEA 1IBMB 1RXIA 2MINB 2WP8J 1JILA 1OTHA 4JI0B 2HRZA 2V5AA 4X65B 2ZRNA 5EKXA 4KWHA 1P9RA 5SZJA 4TOIA 3O3CA 1G21E 3QLEA 5LYYA 3A6FA 4L4ZA 4WGGA 4IDEA 2XEXA 5BSWA 1YRBA 3BMXA 4ND6A 4B47A 4WLOA 2GZHA 2PEYA 3KXKA 4NDAA 1BW9A 1XEAA 3S7ZA 4E3ZA 3WLEA 5CVTA 1BGXT 3RVJA 3ICEA 2M5HA 4WGFA 1GTMA 4BAGA 1JKIA 1DDIA 1Z83A 3PFWO 4HG2A 3L05A 2ATWA 2NG1A 3A32A 1OGJA 3HCWA 3DFZA 3EC7A 3AVPA 3OCWA 5KOHA 4DVJA 4F4JA 3ODPA 4C5AA 2X4LA 2HK7A 3P9ZA 3W2TA 1TNDA 1K68A 3LUKA 4NV1A 5UKDA 2ZYDA 3T5TA 3I9KA 3KWMA 5B57C 5IG2A 3LXUX 3O9VA 1CY8A 3H5IA 3QYFA 2ZTUA 4GLFA 3NH9A 4QJ3A 5KTMA 2X9LA 5A4FS 4V0MA 1Z5NA 3P52A 4OXNA 2IV3A 2G9UA 4BNYA 1UMDA 2F64A 2G70A 4MEAA 5A6VA 1IOWA 2O1EA 4DA0A 1JG3A 1MO5A 2I9PA 1I2MA 2BBWA 2PKQP 5AVTA 2R62A 3O2JA 1L8AA 4BL5A 3GARA 3TQHA 4WADA 1T9GR 4LA4A 4FB5A 5ALQA 3PUXA 1YE3A 1V8DA 3CQ3A 1YCFA 1I14A 4B6OA 1PV2A 4I5EA 1T5DX 5KDDA 4ND7A 2ZK7A 1MEJA 1SUDA 3K0CA 3L1UA 3T7JA 3VSDA 2X5NA 2NXEA 3LCUA 1B93A 1Y5IA 3QOXA 1U3UA 3R74A 3TBHA 1A4IA 1NRXA 3QX9A 4FR0A 2GESA 4C7JA 1EXWA 3DD1A 4B35A 1BYIA 1UANA 2LZ0A 4HGYA 3VH1A 1BU5A 3AM3A 3P0JA 2CXHA 3SSMA 1GZ5A 1ECBA 4KFCA 1RYYA 5TF4A 3IVAA 4KXUA 2E8CA 1EAYA 2BIFA 4A92A 3UATA 1XSEA 2GPWA 5FKJA 1AS2A 1HEYA 2I2BA 2ONKA 1R5JA 2X2OA 1HE2A 1O57A 3IE2A 3VZBA 3HY6A 3BS4A 1SVOA 3THOA 3MAJA 3LT4A 1RLIA 3DXZA 5C37A 1YACA 1YB6A 3FFWA 1QRSA 4URYR 1J0AA 4GAEA 1O94D 1Y9AA 3OWHA 1JYSA 1TO1E 2W4QA 3VAYA 1K0UA 4BBZA 3D5QA 2BT4A 2V1XA 2V7GA 1IY2A 1R8QA 3OZUA 3QKWA 1A8QA 5DHQA 2HQSA 3EXEB 2EX1A 4WIAA 4FBMA 2X0KA 1E9FA 5IULC 4CEHA 1ORWA 2AZMA 4YS6A 4E2XA 5BV2P 3CT4A 2O9JA 1Y1RA 4C7VA 3C1TA 5LQKA 4S1VA 1QYWA 3OQNA 5TT1A 1KOLA 1YRWA 4FKBA 2QUJA 4IV8A 3JZDA 4MKFA 4BX2A 4PBSA 4MYHA 1D09A 4QASA 1VIVA 4MQLA 1LVGA 5BOSA 4G2TA 4HAXA 1PDWA 2R7LA 2JL1A 1XNRC 1PEYA 4D9GA 4L28A 4US1R 1L4MA 4N6NA 4WNAB 2HN9A 1AZWA 4IDOA 3VXKA 3N53A 5AXDA 2V5UA 5BMVB 4PPGA 3WGOA 2AYYA 2NZ2A 2FFRA 3B70A 4ISBA 4LF4C 3UAWA 2NAPA 1Z8DA 1O9TA 1ZIXA 3JD4A 3OQJA 1I6WA 4QEDA 4X1IB 5AKKA 4L2IB 4P0PB 3F4KA 2Z8XA 4UDXX 2EWMA 1R3UA 5CT5A 4MDHA 3CX7A 3BRSA 3HO8A 4WEQA 3R77A 2X4DA 2EKZA 4V0RA 2A7XA 4B3XA 1QZ3A 1XNQC 4KNYA 3KJNA 1JRLA 1ZK3A 3AV0B 3P26A 4QFCA 3SF0A 5JQGF 5SYNA 3IT0A 4WBSA 4MJXA 2JB9A 5KZMB 1HDGO 2WT8A 2UXBC 4OFWA 3KLPX 1BA3A 3GHYA 5JS8A 1A95A 2G1AA 3E5MA 4QOGA 4XWTA 1PW7A 1G5FA 3IKJA 4C88A 4KPFC 4EB6A 4HNUA 5M5BA 3W4KA 2N42A 5IWCA 3EGDB 4KBFA 1Z34A 1AVTA 4BBYA 4MQEB 2F9MA 4HWTA 2CF5A 5B1IA 1P3Y1 1TF7A 2HO4A 4RZXA 1ZZGA 4IVPA 4GGMX 5TLSA 3AB7A 3CIOA 1V25A 4IQ4A 5B55A 1KAMA 1E3WB 4LDZA 4DB4A 1P2FA 5JXWA 4WNYA 4CKYA 3LC2O 4IH4A 5HJEA 3H3XA 3JPYA 3LD9A 5CB0A 4Z0NA 1ZW1A 1BTOA 2QVLA 2K7FA 4DLAA 2PWPA 5KAMA 3HYSA 4L8YA 3KYJB 4DB2A 2OZVA 2ET6A 5TPZD 2BFCB 4UBKA 4TKUB 3REOA 3FDIA 2A5DA 4JL6A 2XOKD 1JA0A 4FFDA 4P58A 4II2A 2WJJA 4EHNA 3S81A 3WGMA 4GI5A 5FUMA 5LP6A 1EXVA 2K2QB 1KBQA 1BD3A 1YFKA 2I4NA 5HKLA 5A9SB 5DKFA 1HMPA 4RNDB 1Z33A 2ZJAA 1HQYE 3ADDA 1MA0A 3H8VA 1FTNA 3RK0A 5FA5A 1IN6A 5IT4A 5HIMA 3VJRA 1FFBA 2HNBA 3A28A 4TTSA 5FUWA 1ZMOA 4KR7A 4OUDA 4U00A 3NOQA 3STHA 4BNTA 2UXBB 1IQ0A 4BSZA 2I76A 4OMUA 1WTAA 4OREX 3VH4A 5I3ZA 3LUCA 4TN1A 1OD6A 1SIOA 4XLLA 4YAFA 3HSSA 4P5DA 4DZRA 1UINA 3PESA 2AN9A 1BDHA 1X9HA 4COOA 3PA8A 3JY6A 1Z2NX 1ORDA 2HJVA