2MM9A

Solution structure of reduced bola2 from arabidopsis thaliana
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
MVTKEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIKKAQTPQQWKPPSQDSATLTKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
molecule keywords BolA2
total genus 24
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2mm9A00
2KZ0A 5LCIA 2MM9A 2DHMA 2NCLA 4PUIA 2MMAB 3O2EA 1V60A 1XS3A 4PUHA 4PUGA 2MCQA 1NY8A 2KDNA 3TR3A
chains in the Genus database with same CATH superfamily
1J5EC 1HNWC 4YHHC 1KKGA 3A4IA 2YWBA 3AF5A 3IPLA 2KZFA 1P4EC 1ML8A 4FUQA 2WD9A 4LF6C 1N34C 3H2TA 5BSVA 3K6RA 2JMPA 2OPLA 4AQYC 1ZB9A 3IEUA 1V26A 2D1QA 4DR4C 2VQFC 2ATWA 2ZM6C 2AYAA 1PG3A 2D27A 2DHMA 4G37A 5BUSA 4GKJC 1JOSA 5BSWA 2E5LC 2VSQA 3OTOC 2HHHC 4HPVA 4MH4A 5LMNC 2QW0X 3C5EA 2UUCC 1K0RA 1MDFA 4LF8C 4DV3C 3T1HC 3A9VA 3IMLA 3NYRA 4DG9A 4DV4C 4FTFA 3R44A 5LCIA 3N2QA 1O93A 3G7SA 4D4GA 1M6XA 4L7IA 2QL8A 1MKYA 4PUGA 4KHPC 5K85A 4X62C 4GKKC 4PHTA 3E7XA 4NDNA 2YCBA 3CQ1A 1AMUA 3NPDA 4JI0C 1N32C 2CY1A 3CW9A 3CW8X 4JI4C 1N36C 4DV6C 1HNZC 4JV5C 2M5OA 3CQ3A 5CZVA 4K0KC 3KXWA 3PROC 4JYAC 3A25A 4I9GA 1RG9A 4DCTA 5KYVA 3AF6A 4WS9A 2PT7G 4GS5A 3E7WA 1XNRC 3FCCA 1VLAA 2KZ0A 3FCEA 2Y27A 2E8CA 5A1IA 1TH5A 1MD9A 4MTNA 4RLQA 4U5YD 2P2JA 4RLFA 4X65C 4DG8A 4B3SC 5H9UA 2M5HA 3I08A 2ZZNA 5AE3A 2UXBC 4DR2C 1HR0C 3UZ0A 3TR3A 4X66C 1XMOC 3GPCA 1IBMC 3LUSA 4DR5C 4LFAC 1PU1A 4D4IA 4DCVA 1EGAA 2MCQA 1UKKA 4JI8C 2HJGA 5BUQA 2MM9A 1XMQC 3A26A 3EERA 4ZJZA 1M6XC 3DLPX 4OX9C 1P4EA 2OPLB 4DCUA 4LFCC 4X64C 4PUIA 2P20A 5IFIA 5A2QD 3UX2A 3A9UA 2PROA 2NCLA 3O2EA 4ODJA 3LGXA 4OXIA 2UXCC 2PN2A 2UUAC 4PUHA 1UWDA 2D1RA 3B7WA 4NXNC 1NY8A 3CJEA 4B3RC 4DR3C 2Y4NA 5AE1A 5GTDA 1O9TA 1MXBA 5BSMA 3LNOA 3NI2A 5A1GA 4B3TC 1USPB 3RG2A 1XRBA 4DCSA 3R9WA 1T5HX 3TUFA 1IBKC 4R1LA 4L2ZA 3UX3A 4K0BA 1RY2A 5E7QA 4KTTA 1XNQC 5KEIA 4DR7C 4D56A 3N54B 3RV2A 2BJOA 2JNVA 1YJ7A 1V60A 2VZEA 2P02A 4LF9C 1XRCA 4L4QA 3I07A 5KYTA 2UXDC 3UOWA 5AE2A 2ZZMA 4JI2C 3LNVA 3JAMD 3PESA 1NYEA 1HNXC 4RVOA 4JI6C 4IR7A 2EGTA 4OYCA 3R9XA 3TDEA 5T8TA 4IZ6A 1FLOA 3J80D 4BC7A 4DV7C 4RM2A 2YX1A 3EQ6A 5BSTA 3CQ2A 3J81D 4JI3C 5IT9D 4YY3C 3TQIA 5A19A 1T5DX 4RM3A 1XHJA 1FUGA 3PBKA 2P2FA 5IWAC 1MDBA 4BBYA 4B3MC 4RMNA 1QWIA 3GR0A 2E7GA 1N2FA 1V25A 4I9FA 4DV5C 1N33C 1XRAA 2D1SA 4DV1C 1QM4A 2P2MA 1P7LA 1MXCA 3GKUA 2OO4A 4TPSB 4WV3A 4BSZA 1L2FA 2E8EA 1I94C 4DR6C 2E8FA 2BH1X 2KDNA 1PG4A 4R0MA 3ETOA 4LFBC 5K8FA 2QVXX 3AY0A 4XX2A 1MXAA 4G36A 4JI7C 5BSUA 4JI1C 3LAXA 4DUYC 4JI5C 2UU9C 2Z51A 1WF3A 1IBLC 3ETCA 4LF7C 1O92A 2DPLA 2P2QA 2E0GA 4GXQA 5JRHA 5FLXD 4FUTA 4BC9A 4EATA 3S82A 3UEBA 3NYQA 3SO4A 4LE5A 3L8CA 4RVNA 3T1YC 2UUBC 2QVYX 4ZLPA 4DUZC 1VEHA 4DV0C 4PROC 5LMUC 4D57A 4BCAA 1XS3A 3IEVA 2QVZX 2YWCA 2CXCA 2CU6A 4PZPA 2P2BA 5DV9A 4G1IA 4R1MA 5BR8C 1WH9A 4LF5C 3DHVA 1GPMA 3L95X 4NXMC 1BA3A 3VNQA 4GXRA 2DYJA 1IB8A 5BURA 5BSRA 2F4VC 4NOZA 4DR1C 1ULTA 3VNSA 1FJGC 1HH2P 2Y4OA 4KTVA 1ZB8A 2D28C 2WP0C 3VNRA 3DAYA 4DV2C 5T8SA 2D1TA 1WCJA 2V7BA 1USPA 2D7VA 2ONFA 1LCIA 5CZXA 4LF4C 2XR1A 3GR1A 1O90A 2MMAB 5ADZA 2OBVA 1PA4A 2VQEC 1LQLA 2ASBA 4JM1A 4ISBA
chains in the Genus database with same CATH topology
2KZ0A 5LCIA 2MM9A 2DHMA 2NCLA 4PUIA 2MMAB 3O2EA 1V60A 1XS3A 4PUHA 4PUGA 2MCQA 1NY8A 2KDNA 3TR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ0 A;  5LCI A;  2MM9 A;  2DHM A;  2NCL A;  4PUI A;  2MMA B;  3O2E A;  1V60 A;  1XS3 A;  4PUH A;  4PUG A;  2MCQ A;  1NY8 A;  2KDN A;  3TR3 A; 
#chains in the Genus database with same CATH topology
 1J5E C;  1HNW C;  4YHH C;  1KKG A;  3A4I A;  2YWB A;  3AF5 A;  3IPL A;  2KZF A;  1P4E C;  1ML8 A;  4FUQ A;  2WD9 A;  4LF6 C;  1N34 C;  3H2T A;  5BSV A;  3K6R A;  2JMP A;  2OPL A;  4AQY C;  1ZB9 A;  3IEU A;  1V26 A;  2D1Q A;  4DR4 C;  2VQF C;  2ATW A;  2ZM6 C;  2AYA A;  1PG3 A;  2D27 A;  2DHM A;  4G37 A;  5BUS A;  4GKJ C;  1JOS A;  5BSW A;  2E5L C;  2VSQ A;  3OTO C;  2HHH C;  4HPV A;  4MH4 A;  5LMN C;  2QW0 X;  3C5E A;  2UUC C;  1K0R A;  1MDF A;  4LF8 C;  4DV3 C;  3T1H C;  3A9V A;  3IML A;  3NYR A;  4DG9 A;  4DV4 C;  4FTF A;  3R44 A;  5LCI A;  3N2Q A;  1O93 A;  3G7S A;  4D4G A;  1M6X A;  4L7I A;  2QL8 A;  1MKY A;  4PUG A;  4KHP C;  5K85 A;  4X62 C;  4GKK C;  4PHT A;  3E7X A;  4NDN A;  2YCB A;  3CQ1 A;  1AMU A;  3NPD A;  4JI0 C;  1N32 C;  2CY1 A;  3CW9 A;  3CW8 X;  4JI4 C;  1N36 C;  4DV6 C;  1HNZ C;  4JV5 C;  2M5O A;  3CQ3 A;  5CZV A;  4K0K C;  3KXW A;  3PRO C;  4JYA C;  3A25 A;  4I9G A;  1RG9 A;  4DCT A;  5KYV A;  3AF6 A;  4WS9 A;  2PT7 G;  4GS5 A;  3E7W A;  1XNR C;  3FCC A;  1VLA A;  2KZ0 A;  3FCE A;  2Y27 A;  2E8C A;  5A1I A;  1TH5 A;  1MD9 A;  4MTN A;  4RLQ A;  4U5Y D;  2P2J A;  4RLF A;  4X65 C;  4DG8 A;  4B3S C;  5H9U A;  2M5H A;  3I08 A;  2ZZN A;  5AE3 A;  2UXB C;  4DR2 C;  1HR0 C;  3UZ0 A;  3TR3 A;  4X66 C;  1XMO C;  3GPC A;  1IBM C;  3LUS A;  4DR5 C;  4LFA C;  1PU1 A;  4D4I A;  4DCV A;  1EGA A;  2MCQ A;  1UKK A;  4JI8 C;  2HJG A;  5BUQ A;  2MM9 A;  1XMQ C;  3A26 A;  3EER A;  4ZJZ A;  1M6X C;  3DLP X;  4OX9 C;  1P4E A;  2OPL B;  4DCU A;  4LFC C;  4X64 C;  4PUI A;  2P20 A;  5IFI A;  5A2Q D;  3UX2 A;  3A9U A;  2PRO A;  2NCL A;  3O2E A;  4ODJ A;  3LGX A;  4OXI A;  2UXC C;  2PN2 A;  2UUA C;  4PUH A;  1UWD A;  2D1R A;  3B7W A;  4NXN C;  1NY8 A;  3CJE A;  4B3R C;  4DR3 C;  2Y4N A;  5AE1 A;  5GTD A;  1O9T A;  1MXB A;  5BSM A;  3LNO A;  3NI2 A;  5A1G A;  4B3T C;  1USP B;  3RG2 A;  1XRB A;  4DCS A;  3R9W A;  1T5H X;  3TUF A;  1IBK C;  4R1L A;  4L2Z A;  3UX3 A;  4K0B A;  1RY2 A;  5E7Q A;  4KTT A;  1XNQ C;  5KEI A;  4DR7 C;  4D56 A;  3N54 B;  3RV2 A;  2BJO A;  2JNV A;  1YJ7 A;  1V60 A;  2VZE A;  2P02 A;  4LF9 C;  1XRC A;  4L4Q A;  3I07 A;  5KYT A;  2UXD C;  3UOW A;  5AE2 A;  2ZZM A;  4JI2 C;  3LNV A;  3JAM D;  3PES A;  1NYE A;  1HNX C;  4RVO A;  4JI6 C;  4IR7 A;  2EGT A;  4OYC A;  3R9X A;  3TDE A;  5T8T A;  4IZ6 A;  1FLO A;  3J80 D;  4BC7 A;  4DV7 C;  4RM2 A;  2YX1 A;  3EQ6 A;  5BST A;  3CQ2 A;  3J81 D;  4JI3 C;  5IT9 D;  4YY3 C;  3TQI A;  5A19 A;  1T5D X;  4RM3 A;  1XHJ A;  1FUG A;  3PBK A;  2P2F A;  5IWA C;  1MDB A;  4BBY A;  4B3M C;  4RMN A;  1QWI A;  3GR0 A;  2E7G A;  1N2F A;  1V25 A;  4I9F A;  4DV5 C;  1N33 C;  1XRA A;  2D1S A;  4DV1 C;  1QM4 A;  2P2M A;  1P7L A;  1MXC A;  3GKU A;  2OO4 A;  4TPS B;  4WV3 A;  4BSZ A;  1L2F A;  2E8E A;  1I94 C;  4DR6 C;  2E8F A;  2BH1 X;  2KDN A;  1PG4 A;  4R0M A;  3ETO A;  4LFB C;  5K8F A;  2QVX X;  3AY0 A;  4XX2 A;  1MXA A;  4G36 A;  4JI7 C;  5BSU A;  4JI1 C;  3LAX A;  4DUY C;  4JI5 C;  2UU9 C;  2Z51 A;  1WF3 A;  1IBL C;  3ETC A;  4LF7 C;  1O92 A;  2DPL A;  2P2Q A;  2E0G A;  4GXQ A;  5JRH A;  5FLX D;  4FUT A;  4BC9 A;  4EAT A;  3S82 A;  3UEB A;  3NYQ A;  3SO4 A;  4LE5 A;  3L8C A;  4RVN A;  3T1Y C;  2UUB C;  2QVY X;  4ZLP A;  4DUZ C;  1VEH A;  4DV0 C;  4PRO C;  5LMU C;  4D57 A;  4BCA A;  1XS3 A;  3IEV A;  2QVZ X;  2YWC A;  2CXC A;  2CU6 A;  4PZP A;  2P2B A;  5DV9 A;  4G1I A;  4R1M A;  5BR8 C;  1WH9 A;  4LF5 C;  3DHV A;  1GPM A;  3L95 X;  4NXM C;  1BA3 A;  3VNQ A;  4GXR A;  2DYJ A;  1IB8 A;  5BUR A;  5BSR A;  2F4V C;  4NOZ A;  4DR1 C;  1ULT A;  3VNS A;  1FJG C;  1HH2 P;  2Y4O A;  4KTV A;  1ZB8 A;  2D28 C;  2WP0 C;  3VNR A;  3DAY A;  4DV2 C;  5T8S A;  2D1T A;  1WCJ A;  2V7B A;  1USP A;  2D7V A;  2ONF A;  1LCI A;  5CZX A;  4LF4 C;  2XR1 A;  3GR1 A;  1O90 A;  2MMA B;  5ADZ A;  2OBV A;  1PA4 A;  2VQE C;  1LQL A;  2ASB A;  4JM1 A;  4ISB A; 
#chains in the Genus database with same CATH homology
 2KZ0 A;  5LCI A;  2MM9 A;  2DHM A;  2NCL A;  4PUI A;  2MMA B;  3O2E A;  1V60 A;  1XS3 A;  4PUH A;  4PUG A;  2MCQ A;  1NY8 A;  2KDN A;  3TR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...