2MM9A

Solution structure of reduced bola2 from arabidopsis thaliana
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
MVTKEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIKKAQTPQQWKPPSQDSATLTKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords BolA2
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 24
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2mm9A00
5LCIA 1XS3A 4PUIA 1V60A 2DHMA 4PUHA 2KZ0A 2NCLA 1NY8A 4PUGA 3TR3A 2MMAB 2MCQA 2KDNA 3O2EA 2MM9A
chains in the Genus database with same CATH superfamily
1HNWC 4DG9A 4LF6C 5A1IA 4DV7C 5FLXD 4JI3C 2OBVA 5LMUC 4RVOA 2BH1X 3R44A 4D4GA 4LF5C 1M6XA 3T1HC 4NOZA 4LF8C 2M5OA 5KEIA 3JAMD 1AMUA 3KXWA 2UUBC 4BSZA 1WCJA 4NDNA 3DLPX 4K0KC 3TR3A 2QVXX 4D4IA 1TH5A 4RMNA 3LUSA 3DAYA 2Y4NA 5KYVA 1O9TA 4IR7A 4PUIA 4TPSB 4B3MC 1MDBA 1RY2A 4WV3A 1GPMA 2OO4A 2D28C 5BSMA 4DV0C 3AF6A 1V25A 4XX2A 2E5LC 4NXMC 1M6XC 4GKJC 1N33C 1UWDA 4FUQA 3CJEA 4I9FA 5BSTA 4DG8A 2CU6A 4FUTA 1MXAA 3UZ0A 4DUZC 4OXIA 4DUYC 4DR6C 2YWBA 2YWCA 1O90A 1FJGC 3FCEA 3TUFA 4G37A 4X66C 3N2QA 1MDFA 3CW8X 1XHJA 1ULTA 2F4VC 3CW9A 3L8CA 1JOSA 1XNRC 3CQ2A 5H9UA 1XRAA 2P20A 5JRHA 4B3TC 4PHTA 2YCBA 2ZZNA 1FUGA 4DR2C 2KZFA 3AY0A 3CQ1A 5BR8C 4DV4C 3K6RA 5K8FA 1LCIA 3LAXA 1KKGA 3RV2A 3NYQA 1XRBA 3IMLA 4MH4A 4LF7C 5AE2A 3A9VA 1VEHA 1N32C 3NI2A 4ZLPA 3PESA 3GR1A 4G36A 5A19A 1USPA 2PT7G 1WF3A 2QL8A 4LE5A 1UKKA 2UUAC 4OYCA 2UXDC 4DCUA 1HR0C 4FTFA 2UXCC 3H2TA 1ZB8A 3VNRA 2P02A 4NXNC 3R9WA 1PG4A 1RG9A 1J5EC 4LFBC 2D27A 4DCVA 3G7SA 1P4EA 1K0RA 4RM2A 2D1QA 4U5YD 1MXBA 3PBKA 5K85A 4JYAC 4I9GA 4R1MA 3UX2A 3A9UA 2P2JA 2P2QA 2ATWA 4LF4C 4DCSA 5LMNC 3LNOA 4G1IA 5CZVA 1N36C 1USPB 4DV5C 3R9XA 2MMAB 2Y4OA 4GKKC 4EATA 3UEBA 1ZB9A 3NYRA 1HH2P 1P4EC 4DR7C 1V26A 4ISBA 4PZPA 1N34C 5BSWA 4GXRA 2WD9A 4JM1A 3B7WA 4KTVA 1T5HX 3J81D 4HPVA 3UOWA 2PN2A 4D57A 2Z51A 3OTOC 2JMPA 2VQEC 2CY1A 1ML8A 1PU1A 2D1RA 2BJOA 3CQ3A 3T1YC 1PA4A 3N54B 4MTNA 2KZ0A 1NYEA 2WP0C 3E7XA 2JNVA 3FCCA 4KTTA 2D1TA 4PUHA 1HNZC 4PUGA 2V7BA 3NPDA 2QW0X 3GKUA 1XNQC 5BSVA 4WS9A 4DV1C 1LQLA 1PG3A 3UX3A 1MXCA 3C5EA 4BCAA 3I07A 3TQIA 4D56A 2E7GA 5BSRA 2DHMA 1HNXC 1P7LA 1XRCA 1I94C 3AF5A 3GR0A 2E8EA 5AE3A 4JV5C 5CZXA 1VLAA 4PROC 2OPLA 3EERA 3L95X 4L4QA 4DV6C 2ZM6C 2VZEA 1XS3A 2P2FA 4DR1C 1XMOC 2YX1A 5BURA 2DYJA 3GPCA 5T8TA 3E7WA 1FLOA 1N2FA 2UXBC 5GTDA 1BA3A 4OX9C 2KDNA 1V60A 5A1GA 4RM3A 2HHHC 5DV9A 1IB8A 1L2FA 4JI1C 5AE1A 4DR4C 4JI2C 3PROC 2PROA 4JI0C 4LFAC 4BC9A 1QM4A 2ONFA 4B3RC 4X65C 3O2EA 3VNQA 3A4IA 4DR3C 5E7QA 2M5HA 2P2BA 4JI4C 5BUQA 3SO4A 2E8FA 2EGTA 4LF9C 2E0GA 1O93A 3A25A 4ODJA 3IEVA 4R0MA 3EQ6A 2MCQA 3J80D 2HJGA 5LCIA 2OPLB 4L2ZA 1WH9A 2ZZMA 4X64C 2P2MA 2MM9A 4DV2C 2AYAA 4X62C 4DCTA 4DV3C 2XR1A 3LNVA 2UU9C 5IFIA 5KYTA 3ETOA 4JI8C 2QVYX 5BSUA 1MD9A 4K0BA 1MKYA 4B3SC 4JI5C 2D7VA 4GS5A 2VSQA 3S82A 4L7IA 1XMQC 2D1SA 4DR5C 2CXCA 4KHPC 3TDEA 4GXQA 5T8SA 4ZJZA 4LFCC 1IBLC 1T5DX 5IWAC 4YHHC 4RVNA 1IBMC 4YY3C 2E8CA 2QVZX 2Y27A 2NCLA 3IPLA 5BUSA 4R1LA 3ETCA 3IEUA 4JI6C 4IZ6A 2VQFC 5ADZA 4RLQA 5A2QD 1YJ7A 1O92A 4BC7A 1NY8A 3I08A 2UUCC 1EGAA 4RLFA 2ASBA 4AQYC 3A26A 2DPLA 3LGXA 1QWIA 3DHVA 5IT9D 3VNSA 3RG2A 4JI7C 4BBYA 1IBKC
chains in the Genus database with same CATH topology
5LCIA 1XS3A 4PUIA 1V60A 2DHMA 4PUHA 2KZ0A 2NCLA 1NY8A 4PUGA 3TR3A 2MMAB 2MCQA 2KDNA 3O2EA 2MM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCI A;  1XS3 A;  4PUI A;  1V60 A;  2DHM A;  4PUH A;  2KZ0 A;  2NCL A;  1NY8 A;  4PUG A;  3TR3 A;  2MMA B;  2MCQ A;  2KDN A;  3O2E A;  2MM9 A; 
#chains in the Genus database with same CATH topology
 1HNW C;  4DG9 A;  4LF6 C;  5A1I A;  4DV7 C;  5FLX D;  4JI3 C;  2OBV A;  5LMU C;  4RVO A;  2BH1 X;  3R44 A;  4D4G A;  4LF5 C;  1M6X A;  3T1H C;  4NOZ A;  4LF8 C;  2M5O A;  5KEI A;  3JAM D;  1AMU A;  3KXW A;  2UUB C;  4BSZ A;  1WCJ A;  4NDN A;  3DLP X;  4K0K C;  3TR3 A;  2QVX X;  4D4I A;  1TH5 A;  4RMN A;  3LUS A;  3DAY A;  2Y4N A;  5KYV A;  1O9T A;  4IR7 A;  4PUI A;  4TPS B;  4B3M C;  1MDB A;  1RY2 A;  4WV3 A;  1GPM A;  2OO4 A;  2D28 C;  5BSM A;  4DV0 C;  3AF6 A;  1V25 A;  4XX2 A;  2E5L C;  4NXM C;  1M6X C;  4GKJ C;  1N33 C;  1UWD A;  4FUQ A;  3CJE A;  4I9F A;  5BST A;  4DG8 A;  2CU6 A;  4FUT A;  1MXA A;  3UZ0 A;  4DUZ C;  4OXI A;  4DUY C;  4DR6 C;  2YWB A;  2YWC A;  1O90 A;  1FJG C;  3FCE A;  3TUF A;  4G37 A;  4X66 C;  3N2Q A;  1MDF A;  3CW8 X;  1XHJ A;  1ULT A;  2F4V C;  3CW9 A;  3L8C A;  1JOS A;  1XNR C;  3CQ2 A;  5H9U A;  1XRA A;  2P20 A;  5JRH A;  4B3T C;  4PHT A;  2YCB A;  2ZZN A;  1FUG A;  4DR2 C;  2KZF A;  3AY0 A;  3CQ1 A;  5BR8 C;  4DV4 C;  3K6R A;  5K8F A;  1LCI A;  3LAX A;  1KKG A;  3RV2 A;  3NYQ A;  1XRB A;  3IML A;  4MH4 A;  4LF7 C;  5AE2 A;  3A9V A;  1VEH A;  1N32 C;  3NI2 A;  4ZLP A;  3PES A;  3GR1 A;  4G36 A;  5A19 A;  1USP A;  2PT7 G;  1WF3 A;  2QL8 A;  4LE5 A;  1UKK A;  2UUA C;  4OYC A;  2UXD C;  4DCU A;  1HR0 C;  4FTF A;  2UXC C;  3H2T A;  1ZB8 A;  3VNR A;  2P02 A;  4NXN C;  3R9W A;  1PG4 A;  1RG9 A;  1J5E C;  4LFB C;  2D27 A;  4DCV A;  3G7S A;  1P4E A;  1K0R A;  4RM2 A;  2D1Q A;  4U5Y D;  1MXB A;  3PBK A;  5K85 A;  4JYA C;  4I9G A;  4R1M A;  3UX2 A;  3A9U A;  2P2J A;  2P2Q A;  2ATW A;  4LF4 C;  4DCS A;  5LMN C;  3LNO A;  4G1I A;  5CZV A;  1N36 C;  1USP B;  4DV5 C;  3R9X A;  2MMA B;  2Y4O A;  4GKK C;  4EAT A;  3UEB A;  1ZB9 A;  3NYR A;  1HH2 P;  1P4E C;  4DR7 C;  1V26 A;  4ISB A;  4PZP A;  1N34 C;  5BSW A;  4GXR A;  2WD9 A;  4JM1 A;  3B7W A;  4KTV A;  1T5H X;  3J81 D;  4HPV A;  3UOW A;  2PN2 A;  4D57 A;  2Z51 A;  3OTO C;  2JMP A;  2VQE C;  2CY1 A;  1ML8 A;  1PU1 A;  2D1R A;  2BJO A;  3CQ3 A;  3T1Y C;  1PA4 A;  3N54 B;  4MTN A;  2KZ0 A;  1NYE A;  2WP0 C;  3E7X A;  2JNV A;  3FCC A;  4KTT A;  2D1T A;  4PUH A;  1HNZ C;  4PUG A;  2V7B A;  3NPD A;  2QW0 X;  3GKU A;  1XNQ C;  5BSV A;  4WS9 A;  4DV1 C;  1LQL A;  1PG3 A;  3UX3 A;  1MXC A;  3C5E A;  4BCA A;  3I07 A;  3TQI A;  4D56 A;  2E7G A;  5BSR A;  2DHM A;  1HNX C;  1P7L A;  1XRC A;  1I94 C;  3AF5 A;  3GR0 A;  2E8E A;  5AE3 A;  4JV5 C;  5CZX A;  1VLA A;  4PRO C;  2OPL A;  3EER A;  3L95 X;  4L4Q A;  4DV6 C;  2ZM6 C;  2VZE A;  1XS3 A;  2P2F A;  4DR1 C;  1XMO C;  2YX1 A;  5BUR A;  2DYJ A;  3GPC A;  5T8T A;  3E7W A;  1FLO A;  1N2F A;  2UXB C;  5GTD A;  1BA3 A;  4OX9 C;  2KDN A;  1V60 A;  5A1G A;  4RM3 A;  2HHH C;  5DV9 A;  1IB8 A;  1L2F A;  4JI1 C;  5AE1 A;  4DR4 C;  4JI2 C;  3PRO C;  2PRO A;  4JI0 C;  4LFA C;  4BC9 A;  1QM4 A;  2ONF A;  4B3R C;  4X65 C;  3O2E A;  3VNQ A;  3A4I A;  4DR3 C;  5E7Q A;  2M5H A;  2P2B A;  4JI4 C;  5BUQ A;  3SO4 A;  2E8F A;  2EGT A;  4LF9 C;  2E0G A;  1O93 A;  3A25 A;  4ODJ A;  3IEV A;  4R0M A;  3EQ6 A;  2MCQ A;  3J80 D;  2HJG A;  5LCI A;  2OPL B;  4L2Z A;  1WH9 A;  2ZZM A;  4X64 C;  2P2M A;  2MM9 A;  4DV2 C;  2AYA A;  4X62 C;  4DCT A;  4DV3 C;  2XR1 A;  3LNV A;  2UU9 C;  5IFI A;  5KYT A;  3ETO A;  4JI8 C;  2QVY X;  5BSU A;  1MD9 A;  4K0B A;  1MKY A;  4B3S C;  4JI5 C;  2D7V A;  4GS5 A;  2VSQ A;  3S82 A;  4L7I A;  1XMQ C;  2D1S A;  4DR5 C;  2CXC A;  4KHP C;  3TDE A;  4GXQ A;  5T8S A;  4ZJZ A;  4LFC C;  1IBL C;  1T5D X;  5IWA C;  4YHH C;  4RVN A;  1IBM C;  4YY3 C;  2E8C A;  2QVZ X;  2Y27 A;  2NCL A;  3IPL A;  5BUS A;  4R1L A;  3ETC A;  3IEU A;  4JI6 C;  4IZ6 A;  2VQF C;  5ADZ A;  4RLQ A;  5A2Q D;  1YJ7 A;  1O92 A;  4BC7 A;  1NY8 A;  3I08 A;  2UUC C;  1EGA A;  4RLF A;  2ASB A;  4AQY C;  3A26 A;  2DPL A;  3LGX A;  1QWI A;  3DHV A;  5IT9 D;  3VNS A;  3RG2 A;  4JI7 C;  4BBY A;  1IBK C; 
#chains in the Genus database with same CATH homology
 5LCI A;  1XS3 A;  4PUI A;  1V60 A;  2DHM A;  4PUH A;  2KZ0 A;  2NCL A;  1NY8 A;  4PUG A;  3TR3 A;  2MMA B;  2MCQ A;  2KDN A;  3O2E A;  2MM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...