4FTFA

Structure of the type ii secretion system pilotin asps from vibrio cholerae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
b'GAMAEKQRNLELLAGNRASLLSTELPLEFGPLNILRATAKGSTVELMMVYNTDANNAKPTEQVLQSAVSSFCANKDIRSNLDVGISYRIQMRNTRGQLMADQLVTKESC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alternate secretin pathway subunit S (VC395_1821, VC1703)
publication title Assembly of the Type II Secretion System such as Found in Vibrio cholerae Depends on the Novel Pilotin AspS.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
total genus 34
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16549 T2SSS_2 Type II secretion system (T2SS) pilotin, S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.250 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ftfA00
4FTFA 3NPDA
chains in the Genus database with same CATH superfamily
2VSQA 1XHJA 1T5DX 4L7IA 1N34C 1UWDA 2P2MA 5FLXD 4R1MA 3DHVA 2CY1A 4X65C 4B3RC 2WP0C 3R9WA 3VNSA 2ZZMA 2DPLA 4LF4C 1XMQC 2D27A 3R44A 4JI6C 2P2FA 4DCTA 2QVZX 3NYRA 4LF5C 4DR6C 3IPLA 3CQ2A 4JM1A 3LNVA 1XNQC 3KXWA 4OXIA 4DG8A 5BSWA 1LQLA 2OPLA 3A26A 4KTVA 4BC9A 2QL8A 2YWCA 5E7QA 4PZPA 5LMNC 3J80D 4I9FA 1P4EA 2PT7G 4K0KC 4KHPC 2HHHC 5CZXA 1J5EC 1VLAA 1HH2P 2BJOA 5DV9A 1JOSA 1PG3A 2P2JA 1I94C 1FUGA 3LNOA 5BSTA 2JNVA 3I08A 1N2FA 4G36A 1FLOA 2MMAB 3OTOC 5T8SA 4DV4C 2P02A 3VNQA 2KDNA 2P2BA 1XRAA 5BUSA 4RLFA 3K6RA 2PN2A 4NDNA 3ETOA 4GS5A 4JI5C 2EGTA 3IEVA 1N32C 2D7VA 2E7GA 1QM4A 5BSUA 1HNWC 1O90A 5GTDA 4DG9A 5H9UA 5A1IA 4YY3C 5BSMA 3PROC 1PU1A 4L4QA 2UU9C 1NY8A 1WF3A 2WD9A 3CQ3A 5A19A 3UX2A 2QW0X 3NI2A 3CQ1A 3LGXA 1RY2A 5BSRA 5JRHA 4JI8C 4LF6C 4D56A 4DCVA 4U5YD 1FJGC 2D1TA 4DV3C 2MM9A 4MH4A 1USPA 4JI1C 3AF5A 3S82A 2UUBC 5AE2A 1P7LA 2UXDC 4JI3C 4G37A 3GR1A 3UZ0A 2E8EA 4DR2C 1IBLC 2D1RA 3L8CA 2ZZNA 3EQ6A 4PUGA 4GXQA 3CW9A 4G1IA 4OX9C 3PBKA 3J81D 4WS9A 3ETCA 4IZ6A 1MD9A 3DLPX 3RV2A 1UKKA 4PHTA 4ODJA 4PUIA 4DR4C 4GXRA 1ZB9A 3O2EA 4JV5C 3IMLA 1USPB 5BR8C 2VZEA 3GR0A 5T8TA 2F4VC 3CW8X 4D57A 3UEBA 2VQFC 4NOZA 2DYJA 1M6XC 1V26A 1PA4A 4DV0C 2HJGA 1WCJA 1BA3A 4GKJC 3TUFA 5IWAC 1HR0C 5A1GA 3A25A 4LF7C 3AY0A 1XS3A 4JI7C 4LFAC 1MDFA 3C5EA 2OPLB 1XMOC 3JAMD 4LE5A 2ASBA 4D4IA 4FUQA 4PUHA 2D1SA 5BURA 5LCIA 1TH5A 1QWIA 3A9UA 4HPVA 3IEUA 4AQYC 4I9GA 1MDBA 4B3SC 2MCQA 5BUQA 4JI0C 5K8FA 4JYAC 4RVOA 4XX2A 3B7WA 2VQEC 3TQIA 1NYEA 3DAYA 2UUCC 4DCSA 4X62C 3FCCA 2P20A 2DHMA 3N54B 5BSVA 2BH1X 4DUYC 3T1YC 4K0BA 4IR7A 1XNRC 1O92A 5LMUC 5KYTA 1RG9A 4ZLPA 5A2QD 1IB8A 2OO4A 2E5LC 1N33C 2JMPA 4LF8C 2YWBA 3LAXA 1ZB8A 4RM3A 4B3TC 4BCAA 4DUZC 4NXNC 5K85A 4ISBA 3A4IA 1N36C 1HNZC 2P2QA 2ATWA 4R1LA 2E8FA 2QVXX 2CU6A 3NPDA 3SO4A 4LFBC 5ADZA 5CZVA 4WV3A 3UX3A 3A9VA 1L2FA 1T5HX 1XRCA 3TR3A 4MTNA 3FCEA 4BBYA 2E8CA 4DR5C 2E0GA 4KTTA 1ULTA 4YHHC 4FTFA 4DR1C 2V7BA 4ZJZA 4BSZA 4EATA 4B3MC 4DV1C 1V60A 3VNRA 3T1HC 4JI2C 3PESA 1MXAA 2KZ0A 3GPCA 2YCBA 2D1QA 5AE3A 2UUAC 5IFIA 4NXMC 4X66C 4DV6C 5IT9D 3AF6A 1PG4A 4GKKC 4PROC 5AE1A 1V25A 2M5HA 3CJEA 4JI4C 4L2ZA 2CXCA 2AYAA 5KEIA 2YX1A 3LUSA 4DR7C 1HNXC 3E7WA 3H2TA 4RLQA 4DV5C 1K0RA 1AMUA 1EGAA 2KZFA 3G7SA 1XRBA 3I07A 2Z51A 1ML8A 2NCLA 3GKUA 4LF9C 2Y4OA 1IBMC 1P4EC 2UXCC 2QVYX 4DR3C 1KKGA 4DV2C 2ZM6C 1VEHA 2M5OA 5KYVA 4D4GA 2OBVA 3UOWA 4DV7C 1IBKC 2XR1A 2PROA 3R9XA 3E7XA 2Y27A 4DCUA 1GPMA 1O9TA 4TPSB 1LCIA 3RG2A 4R0MA 1MKYA 2ONFA 4LFCC 2D28C 4RMNA 1YJ7A 1MXBA 1O93A 4FUTA 4RVNA 3NYQA 3TDEA 4OYCA 3EERA 3N2QA 2Y4NA 1WH9A 4BC7A 1M6XA 1MXCA 3L95X 4RM2A 2UXBC 4X64C
chains in the Genus database with same CATH topology
2VSQA 1T5DX 4L7IA 1N34C 2P2MA 5FLXD 4R1MA 3DHVA 2CY1A 4X65C 4B3RC 2WP0C 3R9WA 3VNSA 2DPLA 4LF4C 1XMQC 2D27A 3R44A 4JI6C 2P2FA 4DCTA 2QVZX 3NYRA 4LF5C 4DR6C 3IPLA 4JM1A 3LNVA 1XNQC 3KXWA 4OXIA 4DG8A 5BSWA 1LQLA 2OPLA 4KTVA 4BC9A 2QL8A 2YWCA 5E7QA 4PZPA 5LMNC 3J80D 4I9FA 2PT7G 4K0KC 4KHPC 2HHHC 5CZXA 1J5EC 1VLAA 1HH2P 2BJOA 5DV9A 1JOSA 1PG3A 2P2JA 1I94C 1FUGA 5BSTA 3I08A 1N2FA 4G36A 3OTOC 5T8SA 4DV4C 2P02A 3VNQA 2P2BA 1XRAA 5BUSA 4RLFA 2PN2A 4NDNA 3ETOA 4GS5A 4JI5C 2EGTA 3IEVA 1N32C 2D7VA 2E7GA 1QM4A 5BSUA 1HNWC 1O90A 5GTDA 4DG9A 5H9UA 5A1IA 4YY3C 5BSMA 3PROC 4L4QA 2UU9C 1WF3A 2WD9A 5A19A 2QW0X 3NI2A 3LGXA 1RY2A 5BSRA 5JRHA 4JI8C 4LF6C 4D56A 4DCVA 4U5YD 1FJGC 2D1TA 4DV3C 4MH4A 1USPA 4JI1C 3AF5A 3S82A 2UUBC 5AE2A 1P7LA 2UXDC 4JI3C 4G37A 3GR1A 3UZ0A 2E8EA 4DR2C 1IBLC 2D1RA 3L8CA 3EQ6A 4GXQA 3CW9A 4G1IA 4OX9C 3PBKA 3J81D 4WS9A 3ETCA 4IZ6A 1MD9A 3DLPX 3RV2A 1UKKA 4PHTA 4ODJA 4DR4C 4GXRA 1ZB9A 4JV5C 3IMLA 1USPB 5BR8C 2VZEA 3GR0A 5T8TA 2F4VC 3CW8X 4D57A 2VQFC 4NOZA 2DYJA 1V26A 1PA4A 4DV0C 2HJGA 1BA3A 4GKJC 3TUFA 5IWAC 1HR0C 5A1GA 4LF7C 4JI7C 4LFAC 1MDFA 3C5EA 2OPLB 1XMOC 3JAMD 4LE5A 2ASBA 4D4IA 4FUQA 2D1SA 5BURA 1QWIA 3A9UA 4HPVA 3IEUA 4AQYC 4I9GA 1MDBA 4B3SC 5BUQA 4JI0C 5K8FA 4JYAC 4RVOA 4XX2A 3B7WA 2VQEC 3TQIA 1NYEA 3DAYA 2UUCC 4DCSA 4X62C 3FCCA 2P20A 3N54B 5BSVA 2BH1X 4DUYC 3T1YC 4K0BA 4IR7A 1XNRC 1O92A 5LMUC 5KYTA 1RG9A 4ZLPA 5A2QD 2OO4A 2E5LC 1N33C 2JMPA 4LF8C 2YWBA 3LAXA 1ZB8A 4RM3A 4B3TC 4BCAA 4DUZC 4NXNC 5K85A 4ISBA 3A4IA 1N36C 1HNZC 2P2QA 2ATWA 4R1LA 2E8FA 2QVXX 3NPDA 3SO4A 4LFBC 5ADZA 5CZVA 4WV3A 3A9VA 1L2FA 1T5HX 1XRCA 4MTNA 3FCEA 4BBYA 2E8CA 4DR5C 2E0GA 4KTTA 1ULTA 4YHHC 4FTFA 4DR1C 2V7BA 4ZJZA 4BSZA 4EATA 4B3MC 4DV1C 3VNRA 3T1HC 4JI2C 3PESA 1MXAA 3GPCA 2YCBA 2D1QA 5AE3A 2UUAC 5IFIA 4NXMC 4X66C 4DV6C 5IT9D 3AF6A 1PG4A 4GKKC 4PROC 5AE1A 1V25A 3CJEA 4JI4C 4L2ZA 2CXCA 2AYAA 5KEIA 3LUSA 4DR7C 1HNXC 3E7WA 3H2TA 4RLQA 4DV5C 1K0RA 1AMUA 1EGAA 2KZFA 3G7SA 1XRBA 3I07A 1ML8A 3GKUA 4LF9C 2Y4OA 1IBMC 2UXCC 2QVYX 4DR3C 1KKGA 4DV2C 2ZM6C 5KYVA 4D4GA 2OBVA 3UOWA 4DV7C 1IBKC 2XR1A 2PROA 3R9XA 3E7XA 2Y27A 4DCUA 1GPMA 1O9TA 4TPSB 1LCIA 3RG2A 4R0MA 1MKYA 2ONFA 4LFCC 2D28C 4RMNA 1YJ7A 1MXBA 1O93A 4FUTA 4RVNA 3NYQA 3TDEA 4OYCA 3EERA 3N2QA 2Y4NA 1WH9A 4BC7A 1MXCA 3L95X 4RM2A 2UXBC 4X64C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTF A;  3NPD A; 
#chains in the Genus database with same CATH topology
 2VSQ A;  1XHJ A;  1T5D X;  4L7I A;  1N34 C;  1UWD A;  2P2M A;  5FLX D;  4R1M A;  3DHV A;  2CY1 A;  4X65 C;  4B3R C;  2WP0 C;  3R9W A;  3VNS A;  2ZZM A;  2DPL A;  4LF4 C;  1XMQ C;  2D27 A;  3R44 A;  4JI6 C;  2P2F A;  4DCT A;  2QVZ X;  3NYR A;  4LF5 C;  4DR6 C;  3IPL A;  3CQ2 A;  4JM1 A;  3LNV A;  1XNQ C;  3KXW A;  4OXI A;  4DG8 A;  5BSW A;  1LQL A;  2OPL A;  3A26 A;  4KTV A;  4BC9 A;  2QL8 A;  2YWC A;  5E7Q A;  4PZP A;  5LMN C;  3J80 D;  4I9F A;  1P4E A;  2PT7 G;  4K0K C;  4KHP C;  2HHH C;  5CZX A;  1J5E C;  1VLA A;  1HH2 P;  2BJO A;  5DV9 A;  1JOS A;  1PG3 A;  2P2J A;  1I94 C;  1FUG A;  3LNO A;  5BST A;  2JNV A;  3I08 A;  1N2F A;  4G36 A;  1FLO A;  2MMA B;  3OTO C;  5T8S A;  4DV4 C;  2P02 A;  3VNQ A;  2KDN A;  2P2B A;  1XRA A;  5BUS A;  4RLF A;  3K6R A;  2PN2 A;  4NDN A;  3ETO A;  4GS5 A;  4JI5 C;  2EGT A;  3IEV A;  1N32 C;  2D7V A;  2E7G A;  1QM4 A;  5BSU A;  1HNW C;  1O90 A;  5GTD A;  4DG9 A;  5H9U A;  5A1I A;  4YY3 C;  5BSM A;  3PRO C;  1PU1 A;  4L4Q A;  2UU9 C;  1NY8 A;  1WF3 A;  2WD9 A;  3CQ3 A;  5A19 A;  3UX2 A;  2QW0 X;  3NI2 A;  3CQ1 A;  3LGX A;  1RY2 A;  5BSR A;  5JRH A;  4JI8 C;  4LF6 C;  4D56 A;  4DCV A;  4U5Y D;  1FJG C;  2D1T A;  4DV3 C;  2MM9 A;  4MH4 A;  1USP A;  4JI1 C;  3AF5 A;  3S82 A;  2UUB C;  5AE2 A;  1P7L A;  2UXD C;  4JI3 C;  4G37 A;  3GR1 A;  3UZ0 A;  2E8E A;  4DR2 C;  1IBL C;  2D1R A;  3L8C A;  2ZZN A;  3EQ6 A;  4PUG A;  4GXQ A;  3CW9 A;  4G1I A;  4OX9 C;  3PBK A;  3J81 D;  4WS9 A;  3ETC A;  4IZ6 A;  1MD9 A;  3DLP X;  3RV2 A;  1UKK A;  4PHT A;  4ODJ A;  4PUI A;  4DR4 C;  4GXR A;  1ZB9 A;  3O2E A;  4JV5 C;  3IML A;  1USP B;  5BR8 C;  2VZE A;  3GR0 A;  5T8T A;  2F4V C;  3CW8 X;  4D57 A;  3UEB A;  2VQF C;  4NOZ A;  2DYJ A;  1M6X C;  1V26 A;  1PA4 A;  4DV0 C;  2HJG A;  1WCJ A;  1BA3 A;  4GKJ C;  3TUF A;  5IWA C;  1HR0 C;  5A1G A;  3A25 A;  4LF7 C;  3AY0 A;  1XS3 A;  4JI7 C;  4LFA C;  1MDF A;  3C5E A;  2OPL B;  1XMO C;  3JAM D;  4LE5 A;  2ASB A;  4D4I A;  4FUQ A;  4PUH A;  2D1S A;  5BUR A;  5LCI A;  1TH5 A;  1QWI A;  3A9U A;  4HPV A;  3IEU A;  4AQY C;  4I9G A;  1MDB A;  4B3S C;  2MCQ A;  5BUQ A;  4JI0 C;  5K8F A;  4JYA C;  4RVO A;  4XX2 A;  3B7W A;  2VQE C;  3TQI A;  1NYE A;  3DAY A;  2UUC C;  4DCS A;  4X62 C;  3FCC A;  2P20 A;  2DHM A;  3N54 B;  5BSV A;  2BH1 X;  4DUY C;  3T1Y C;  4K0B A;  4IR7 A;  1XNR C;  1O92 A;  5LMU C;  5KYT A;  1RG9 A;  4ZLP A;  5A2Q D;  1IB8 A;  2OO4 A;  2E5L C;  1N33 C;  2JMP A;  4LF8 C;  2YWB A;  3LAX A;  1ZB8 A;  4RM3 A;  4B3T C;  4BCA A;  4DUZ C;  4NXN C;  5K85 A;  4ISB A;  3A4I A;  1N36 C;  1HNZ C;  2P2Q A;  2ATW A;  4R1L A;  2E8F A;  2QVX X;  2CU6 A;  3NPD A;  3SO4 A;  4LFB C;  5ADZ A;  5CZV A;  4WV3 A;  3UX3 A;  3A9V A;  1L2F A;  1T5H X;  1XRC A;  3TR3 A;  4MTN A;  3FCE A;  4BBY A;  2E8C A;  4DR5 C;  2E0G A;  4KTT A;  1ULT A;  4YHH C;  4FTF A;  4DR1 C;  2V7B A;  4ZJZ A;  4BSZ A;  4EAT A;  4B3M C;  4DV1 C;  1V60 A;  3VNR A;  3T1H C;  4JI2 C;  3PES A;  1MXA A;  2KZ0 A;  3GPC A;  2YCB A;  2D1Q A;  5AE3 A;  2UUA C;  5IFI A;  4NXM C;  4X66 C;  4DV6 C;  5IT9 D;  3AF6 A;  1PG4 A;  4GKK C;  4PRO C;  5AE1 A;  1V25 A;  2M5H A;  3CJE A;  4JI4 C;  4L2Z A;  2CXC A;  2AYA A;  5KEI A;  2YX1 A;  3LUS A;  4DR7 C;  1HNX C;  3E7W A;  3H2T A;  4RLQ A;  4DV5 C;  1K0R A;  1AMU A;  1EGA A;  2KZF A;  3G7S A;  1XRB A;  3I07 A;  2Z51 A;  1ML8 A;  2NCL A;  3GKU A;  4LF9 C;  2Y4O A;  1IBM C;  1P4E C;  2UXC C;  2QVY X;  4DR3 C;  1KKG A;  4DV2 C;  2ZM6 C;  1VEH A;  2M5O A;  5KYV A;  4D4G A;  2OBV A;  3UOW A;  4DV7 C;  1IBK C;  2XR1 A;  2PRO A;  3R9X A;  3E7X A;  2Y27 A;  4DCU A;  1GPM A;  1O9T A;  4TPS B;  1LCI A;  3RG2 A;  4R0M A;  1MKY A;  2ONF A;  4LFC C;  2D28 C;  4RMN A;  1YJ7 A;  1MXB A;  1O93 A;  4FUT A;  4RVN A;  3NYQ A;  3TDE A;  4OYC A;  3EER A;  3N2Q A;  2Y4N A;  1WH9 A;  4BC7 A;  1M6X A;  1MXC A;  3L95 X;  4RM2 A;  2UXB C;  4X64 C; 
#chains in the Genus database with same CATH homology
 2VSQ A;  1T5D X;  4L7I A;  1N34 C;  2P2M A;  5FLX D;  4R1M A;  3DHV A;  2CY1 A;  4X65 C;  4B3R C;  2WP0 C;  3R9W A;  3VNS A;  2DPL A;  4LF4 C;  1XMQ C;  2D27 A;  3R44 A;  4JI6 C;  2P2F A;  4DCT A;  2QVZ X;  3NYR A;  4LF5 C;  4DR6 C;  3IPL A;  4JM1 A;  3LNV A;  1XNQ C;  3KXW A;  4OXI A;  4DG8 A;  5BSW A;  1LQL A;  2OPL A;  4KTV A;  4BC9 A;  2QL8 A;  2YWC A;  5E7Q A;  4PZP A;  5LMN C;  3J80 D;  4I9F A;  2PT7 G;  4K0K C;  4KHP C;  2HHH C;  5CZX A;  1J5E C;  1VLA A;  1HH2 P;  2BJO A;  5DV9 A;  1JOS A;  1PG3 A;  2P2J A;  1I94 C;  1FUG A;  5BST A;  3I08 A;  1N2F A;  4G36 A;  3OTO C;  5T8S A;  4DV4 C;  2P02 A;  3VNQ A;  2P2B A;  1XRA A;  5BUS A;  4RLF A;  2PN2 A;  4NDN A;  3ETO A;  4GS5 A;  4JI5 C;  2EGT A;  3IEV A;  1N32 C;  2D7V A;  2E7G A;  1QM4 A;  5BSU A;  1HNW C;  1O90 A;  5GTD A;  4DG9 A;  5H9U A;  5A1I A;  4YY3 C;  5BSM A;  3PRO C;  4L4Q A;  2UU9 C;  1WF3 A;  2WD9 A;  5A19 A;  2QW0 X;  3NI2 A;  3LGX A;  1RY2 A;  5BSR A;  5JRH A;  4JI8 C;  4LF6 C;  4D56 A;  4DCV A;  4U5Y D;  1FJG C;  2D1T A;  4DV3 C;  4MH4 A;  1USP A;  4JI1 C;  3AF5 A;  3S82 A;  2UUB C;  5AE2 A;  1P7L A;  2UXD C;  4JI3 C;  4G37 A;  3GR1 A;  3UZ0 A;  2E8E A;  4DR2 C;  1IBL C;  2D1R A;  3L8C A;  3EQ6 A;  4GXQ A;  3CW9 A;  4G1I A;  4OX9 C;  3PBK A;  3J81 D;  4WS9 A;  3ETC A;  4IZ6 A;  1MD9 A;  3DLP X;  3RV2 A;  1UKK A;  4PHT A;  4ODJ A;  4DR4 C;  4GXR A;  1ZB9 A;  4JV5 C;  3IML A;  1USP B;  5BR8 C;  2VZE A;  3GR0 A;  5T8T A;  2F4V C;  3CW8 X;  4D57 A;  2VQF C;  4NOZ A;  2DYJ A;  1V26 A;  1PA4 A;  4DV0 C;  2HJG A;  1BA3 A;  4GKJ C;  3TUF A;  5IWA C;  1HR0 C;  5A1G A;  4LF7 C;  4JI7 C;  4LFA C;  1MDF A;  3C5E A;  2OPL B;  1XMO C;  3JAM D;  4LE5 A;  2ASB A;  4D4I A;  4FUQ A;  2D1S A;  5BUR A;  1QWI A;  3A9U A;  4HPV A;  3IEU A;  4AQY C;  4I9G A;  1MDB A;  4B3S C;  5BUQ A;  4JI0 C;  5K8F A;  4JYA C;  4RVO A;  4XX2 A;  3B7W A;  2VQE C;  3TQI A;  1NYE A;  3DAY A;  2UUC C;  4DCS A;  4X62 C;  3FCC A;  2P20 A;  3N54 B;  5BSV A;  2BH1 X;  4DUY C;  3T1Y C;  4K0B A;  4IR7 A;  1XNR C;  1O92 A;  5LMU C;  5KYT A;  1RG9 A;  4ZLP A;  5A2Q D;  2OO4 A;  2E5L C;  1N33 C;  2JMP A;  4LF8 C;  2YWB A;  3LAX A;  1ZB8 A;  4RM3 A;  4B3T C;  4BCA A;  4DUZ C;  4NXN C;  5K85 A;  4ISB A;  3A4I A;  1N36 C;  1HNZ C;  2P2Q A;  2ATW A;  4R1L A;  2E8F A;  2QVX X;  3NPD A;  3SO4 A;  4LFB C;  5ADZ A;  5CZV A;  4WV3 A;  3A9V A;  1L2F A;  1T5H X;  1XRC A;  4MTN A;  3FCE A;  4BBY A;  2E8C A;  4DR5 C;  2E0G A;  4KTT A;  1ULT A;  4YHH C;  4FTF A;  4DR1 C;  2V7B A;  4ZJZ A;  4BSZ A;  4EAT A;  4B3M C;  4DV1 C;  3VNR A;  3T1H C;  4JI2 C;  3PES A;  1MXA A;  3GPC A;  2YCB A;  2D1Q A;  5AE3 A;  2UUA C;  5IFI A;  4NXM C;  4X66 C;  4DV6 C;  5IT9 D;  3AF6 A;  1PG4 A;  4GKK C;  4PRO C;  5AE1 A;  1V25 A;  3CJE A;  4JI4 C;  4L2Z A;  2CXC A;  2AYA A;  5KEI A;  3LUS A;  4DR7 C;  1HNX C;  3E7W A;  3H2T A;  4RLQ A;  4DV5 C;  1K0R A;  1AMU A;  1EGA A;  2KZF A;  3G7S A;  1XRB A;  3I07 A;  1ML8 A;  3GKU A;  4LF9 C;  2Y4O A;  1IBM C;  2UXC C;  2QVY X;  4DR3 C;  1KKG A;  4DV2 C;  2ZM6 C;  5KYV A;  4D4G A;  2OBV A;  3UOW A;  4DV7 C;  1IBK C;  2XR1 A;  2PRO A;  3R9X A;  3E7X A;  2Y27 A;  4DCU A;  1GPM A;  1O9T A;  4TPS B;  1LCI A;  3RG2 A;  4R0M A;  1MKY A;  2ONF A;  4LFC C;  2D28 C;  4RMN A;  1YJ7 A;  1MXB A;  1O93 A;  4FUT A;  4RVN A;  3NYQ A;  3TDE A;  4OYC A;  3EER A;  3N2Q A;  2Y4N A;  1WH9 A;  4BC7 A;  1MXC A;  3L95 X;  4RM2 A;  2UXB C;  4X64 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...