4FTFA

Structure of the type ii secretion system pilotin asps from vibrio cholerae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
GAMAEKQRNLELLAGNRASLLSTELPLEFGPLNILRATAKGSTVELMMVYNTDANNAKPTEQVLQSAVSSFCANKDIRSNLDVGISYRIQMRNTRGQLMADQLVTKESC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly of the Type II Secretion System such as Found in Vibrio cholerae Depends on the Novel Pilotin AspS.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
molecule keywords Alternate secretin pathway subunit S (VC395_1821, VC1703)
total genus 34
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16549 T2SSS_2 Type II secretion system (T2SS) pilotin, S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.250 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ftfA00
4FTFA 3NPDA
chains in the Genus database with same CATH superfamily
1XNRC 2PT7G 5A1GA 1HH2P 2ONFA 2Y4OA 1XHJA 4LF9C 2ATWA 2VZEA 2P02A 1IBMC 4D4GA 4GXQA 2YX1A 4JI6C 5E7QA 1HNZC 2WD9A 4WS9A 2AYAA 3GR1A 2NCLA 5BUSA 5IFIA 4XX2A 4JI3C 1ZB9A 4X65C 1BA3A 2QVYX 4PZPA 1O9TA 4KTTA 5BUQA 1WH9A 2P20A 4GKJC 2OO4A 5K8FA 3E7WA 4RLFA 2P2MA 4B3RC 3L8CA 5BR8C 2D28C 5CZVA 4DR5C 2MCQA 5IWAC 3FCCA 2UUAC 4RLQA 5LMNC 4YHHC 4BBYA 2JNVA 3RV2A 4DUZC 2DHMA 2VQFC 1ZB8A 1MXCA 5AE3A 1IBKC 2YCBA 4DG9A 3I07A 4DV0C 1XRCA 3UEBA 4X66C 2E8EA 2E8CA 4RMNA 4AQYC 1O93A 2YWBA 4R0MA 4JI4C 2KZ0A 2P2JA 4BC7A 2D1SA 4D4IA 1LCIA 2JMPA 4RM3A 4DUYC 4LFCC 1IB8A 1T5DX 1V60A 1ULTA 2Y27A 5KYTA 1O90A 2XR1A 4RVNA 5JRHA 3UX3A 3SO4A 3DHVA 3TUFA 1HNWC 1RY2A 3VNQA 1RG9A 3LGXA 4DV3C 2E8FA 2M5OA 1XRAA 4ODJA 1P7LA 3JAMD 2F4VC 4DV1C 2ASBA 4G1IA 2OBVA 2YWCA 5BSMA 3L95X 2DYJA 3VNRA 3H2TA 2D1QA 4ISBA 3EQ6A 3IPLA 4NOZA 4LF7C 4RVOA 4RM2A 4JI8C 4NDNA 4DCSA 2Y4NA 2P2BA 3R44A 4PUIA 2ZZMA 2EGTA 5CZXA 1N34C 4D56A 4I9GA 3TR3A 3A26A 4R1MA 1VLAA 2M5HA 2OPLB 2MM9A 1JOSA 5ADZA 1FJGC 3GR0A 5T8SA 2BH1X 1N2FA 3KXWA 3A9UA 1MD9A 2MMAB 4JYAC 1TH5A 5BSVA 4DR2C 2BJOA 3CQ1A 5BSTA 5A19A 3A9VA 3CW9A 1PG3A 1EGAA 3LUSA 1NY8A 4LE5A 4KTVA 2WP0C 4BSZA 2KZFA 1XNQC 4OX9C 4LF4C 4PUHA 3GKUA 5A1IA 2KDNA 4LFBC 4X64C 3FCEA 1HNXC 4BC9A 4DR6C 4DR7C 4LF6C 3K6RA 3TQIA 2HHHC 4PUGA 4K0KC 1V26A 2P2QA 4LF8C 3E7XA 1P4EA 1O92A 4IR7A 4DR1C 4DCUA 4I9FA 1J5EC 3G7SA 1MDBA 3ETCA 5T8TA 4L4QA 3DLPX 3NYRA 4OXIA 4NXMC 2ZZNA 1V25A 4KHPC 1QWIA 3UX2A 3AF5A 4WV3A 1WCJA 3OTOC 4DR3C 3B7WA 1XMOC 2QVXX 4TPSB 3T1YC 3TDEA 4L2ZA 2PROA 1YJ7A 3UZ0A 4DV6C 2Z51A 1LQLA 1AMUA 1UWDA 2E0GA 4DV2C 1MXAA 1GPMA 4B3MC 5LCIA 3ETOA 1MDFA 4FUQA 4G36A 4DV4C 5DV9A 3C5EA 4JI1C 2QW0X 3CQ2A 4GS5A 5AE2A 4HPVA 4G37A 5A2QD 2E7GA 2D7VA 4YY3C 4JI0C 3LNOA 4ZJZA 1M6XA 3O2EA 2E5LC 1I94C 3NPDA 5FLXD 1HR0C 4B3TC 4L7IA 4DR4C 3CJEA 2HJGA 1T5HX 1K0RA 4MH4A 5AE1A 3AF6A 3UOWA 2UUBC 2D27A 3RG2A 4PHTA 2ZM6C 3AY0A 2QVZX 4U5YD 4JV5C 3I08A 1WF3A 1UKKA 2UXCC 1XS3A 2QL8A 1N32C 4D57A 4B3SC 1PA4A 3NYQA 1ML8A 3R9XA 1PU1A 1FUGA 3PESA 5KEIA 4EATA 1XMQC 3CW8X 3IMLA 4JI7C 5H9UA 4IZ6A 4OYCA 5KYVA 4GKKC 3CQ3A 3A4IA 3NI2A 2UU9C 4K0BA 4MTNA 4X62C 2UXBC 3EERA 1P4EC 3VNSA 3N54B 3PBKA 2OPLA 2PN2A 1USPB 3IEUA 3A25A 1NYEA 1USPA 4DG8A 4GXRA 3LNVA 1L2FA 5BSUA 1N36C 1IBLC 3T1HC 4JI2C 4DV5C 3R9WA 4FUTA 4JM1A 3J80D 1KKGA 4BCAA 2VQEC 4ZLPA 2D1TA 2P2FA 4LFAC 3J81D 5BURA 2CXCA 4FTFA 1FLOA 5IT9D 4LF5C 4R1LA 1MXBA 1M6XC 2D1RA 2UXDC 3N2QA 4JI5C 4DCVA 2UUCC 5BSRA 2VSQA 3PROC 4DCTA 1XRBA 4NXNC 1PG4A 1MKYA 4PROC 2CU6A 2DPLA 5GTDA 1N33C 3IEVA 2V7BA 1QM4A 3DAYA 5K85A 5BSWA 3GPCA 5LMUC 1VEHA 2CY1A 3S82A 3LAXA 4DV7C
chains in the Genus database with same CATH topology
1XNRC 2PT7G 5A1GA 1HH2P 2ONFA 2Y4OA 4LF9C 2ATWA 2VZEA 2P02A 1IBMC 4D4GA 4GXQA 4JI6C 5E7QA 1HNZC 2WD9A 4WS9A 2AYAA 3GR1A 5BUSA 5IFIA 4XX2A 4JI3C 1ZB9A 4X65C 1BA3A 2QVYX 4PZPA 1O9TA 4KTTA 5BUQA 1WH9A 2P20A 4GKJC 2OO4A 5K8FA 3E7WA 4RLFA 2P2MA 4B3RC 3L8CA 5BR8C 2D28C 5CZVA 4DR5C 5IWAC 3FCCA 2UUAC 4RLQA 5LMNC 4YHHC 4BBYA 3RV2A 4DUZC 2VQFC 1ZB8A 1MXCA 5AE3A 1IBKC 2YCBA 4DG9A 3I07A 4DV0C 1XRCA 4X66C 2E8EA 2E8CA 4RMNA 4AQYC 1O93A 2YWBA 4R0MA 4JI4C 2P2JA 4BC7A 2D1SA 4D4IA 1LCIA 2JMPA 4RM3A 4DUYC 4LFCC 1T5DX 1ULTA 2Y27A 5KYTA 1O90A 2XR1A 4RVNA 5JRHA 3SO4A 3DHVA 3TUFA 1HNWC 1RY2A 3VNQA 1RG9A 3LGXA 4DV3C 2E8FA 1XRAA 4ODJA 1P7LA 3JAMD 2F4VC 4DV1C 2ASBA 4G1IA 2OBVA 2YWCA 5BSMA 3L95X 2DYJA 3VNRA 3H2TA 2D1QA 4ISBA 3EQ6A 3IPLA 4NOZA 4LF7C 4RVOA 4RM2A 4JI8C 4NDNA 4DCSA 2Y4NA 2P2BA 3R44A 2EGTA 5CZXA 1N34C 4D56A 4I9GA 4R1MA 1VLAA 2OPLB 1JOSA 5ADZA 1FJGC 3GR0A 5T8SA 2BH1X 1N2FA 3KXWA 3A9UA 1MD9A 4JYAC 5BSVA 4DR2C 2BJOA 5BSTA 5A19A 3A9VA 3CW9A 1PG3A 1EGAA 3LUSA 4LE5A 4KTVA 2WP0C 4BSZA 2KZFA 1XNQC 4OX9C 4LF4C 3GKUA 5A1IA 4LFBC 4X64C 3FCEA 1HNXC 4BC9A 4DR6C 4DR7C 4LF6C 3TQIA 2HHHC 4K0KC 1V26A 2P2QA 4LF8C 3E7XA 1O92A 4IR7A 4DR1C 4DCUA 4I9FA 1J5EC 3G7SA 1MDBA 3ETCA 5T8TA 4L4QA 3DLPX 3NYRA 4OXIA 4NXMC 1V25A 4KHPC 1QWIA 3AF5A 4WV3A 3OTOC 4DR3C 3B7WA 1XMOC 2QVXX 4TPSB 3T1YC 3TDEA 4L2ZA 2PROA 1YJ7A 3UZ0A 4DV6C 1LQLA 1AMUA 2E0GA 4DV2C 1MXAA 1GPMA 4B3MC 3ETOA 1MDFA 4FUQA 4G36A 4DV4C 5DV9A 3C5EA 4JI1C 2QW0X 4GS5A 5AE2A 4HPVA 4G37A 5A2QD 2E7GA 2D7VA 4YY3C 4JI0C 4ZJZA 2E5LC 1I94C 3NPDA 5FLXD 1HR0C 4B3TC 4L7IA 4DR4C 3CJEA 2HJGA 1T5HX 1K0RA 4MH4A 5AE1A 3AF6A 3UOWA 2UUBC 2D27A 3RG2A 4PHTA 2ZM6C 2QVZX 4U5YD 4JV5C 3I08A 1WF3A 1UKKA 2UXCC 2QL8A 1N32C 4D57A 4B3SC 1PA4A 3NYQA 1ML8A 3R9XA 1FUGA 3PESA 5KEIA 4EATA 1XMQC 3CW8X 3IMLA 4JI7C 5H9UA 4IZ6A 4OYCA 5KYVA 4GKKC 3A4IA 3NI2A 2UU9C 4K0BA 4MTNA 4X62C 2UXBC 3EERA 3VNSA 3N54B 3PBKA 2OPLA 2PN2A 1USPB 3IEUA 1NYEA 1USPA 4DG8A 4GXRA 3LNVA 1L2FA 5BSUA 1N36C 1IBLC 3T1HC 4JI2C 4DV5C 3R9WA 4FUTA 4JM1A 3J80D 1KKGA 4BCAA 2VQEC 4ZLPA 2D1TA 2P2FA 4LFAC 3J81D 5BURA 2CXCA 4FTFA 5IT9D 4LF5C 4R1LA 1MXBA 2D1RA 2UXDC 3N2QA 4JI5C 4DCVA 2UUCC 5BSRA 2VSQA 3PROC 4DCTA 1XRBA 4NXNC 1PG4A 1MKYA 4PROC 2DPLA 5GTDA 1N33C 3IEVA 2V7BA 1QM4A 3DAYA 5K85A 5BSWA 3GPCA 5LMUC 2CY1A 3S82A 3LAXA 4DV7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTF A;  3NPD A; 
#chains in the Genus database with same CATH topology
 1XNR C;  2PT7 G;  5A1G A;  1HH2 P;  2ONF A;  2Y4O A;  1XHJ A;  4LF9 C;  2ATW A;  2VZE A;  2P02 A;  1IBM C;  4D4G A;  4GXQ A;  2YX1 A;  4JI6 C;  5E7Q A;  1HNZ C;  2WD9 A;  4WS9 A;  2AYA A;  3GR1 A;  2NCL A;  5BUS A;  5IFI A;  4XX2 A;  4JI3 C;  1ZB9 A;  4X65 C;  1BA3 A;  2QVY X;  4PZP A;  1O9T A;  4KTT A;  5BUQ A;  1WH9 A;  2P20 A;  4GKJ C;  2OO4 A;  5K8F A;  3E7W A;  4RLF A;  2P2M A;  4B3R C;  3L8C A;  5BR8 C;  2D28 C;  5CZV A;  4DR5 C;  2MCQ A;  5IWA C;  3FCC A;  2UUA C;  4RLQ A;  5LMN C;  4YHH C;  4BBY A;  2JNV A;  3RV2 A;  4DUZ C;  2DHM A;  2VQF C;  1ZB8 A;  1MXC A;  5AE3 A;  1IBK C;  2YCB A;  4DG9 A;  3I07 A;  4DV0 C;  1XRC A;  3UEB A;  4X66 C;  2E8E A;  2E8C A;  4RMN A;  4AQY C;  1O93 A;  2YWB A;  4R0M A;  4JI4 C;  2KZ0 A;  2P2J A;  4BC7 A;  2D1S A;  4D4I A;  1LCI A;  2JMP A;  4RM3 A;  4DUY C;  4LFC C;  1IB8 A;  1T5D X;  1V60 A;  1ULT A;  2Y27 A;  5KYT A;  1O90 A;  2XR1 A;  4RVN A;  5JRH A;  3UX3 A;  3SO4 A;  3DHV A;  3TUF A;  1HNW C;  1RY2 A;  3VNQ A;  1RG9 A;  3LGX A;  4DV3 C;  2E8F A;  2M5O A;  1XRA A;  4ODJ A;  1P7L A;  3JAM D;  2F4V C;  4DV1 C;  2ASB A;  4G1I A;  2OBV A;  2YWC A;  5BSM A;  3L95 X;  2DYJ A;  3VNR A;  3H2T A;  2D1Q A;  4ISB A;  3EQ6 A;  3IPL A;  4NOZ A;  4LF7 C;  4RVO A;  4RM2 A;  4JI8 C;  4NDN A;  4DCS A;  2Y4N A;  2P2B A;  3R44 A;  4PUI A;  2ZZM A;  2EGT A;  5CZX A;  1N34 C;  4D56 A;  4I9G A;  3TR3 A;  3A26 A;  4R1M A;  1VLA A;  2M5H A;  2OPL B;  2MM9 A;  1JOS A;  5ADZ A;  1FJG C;  3GR0 A;  5T8S A;  2BH1 X;  1N2F A;  3KXW A;  3A9U A;  1MD9 A;  2MMA B;  4JYA C;  1TH5 A;  5BSV A;  4DR2 C;  2BJO A;  3CQ1 A;  5BST A;  5A19 A;  3A9V A;  3CW9 A;  1PG3 A;  1EGA A;  3LUS A;  1NY8 A;  4LE5 A;  4KTV A;  2WP0 C;  4BSZ A;  2KZF A;  1XNQ C;  4OX9 C;  4LF4 C;  4PUH A;  3GKU A;  5A1I A;  2KDN A;  4LFB C;  4X64 C;  3FCE A;  1HNX C;  4BC9 A;  4DR6 C;  4DR7 C;  4LF6 C;  3K6R A;  3TQI A;  2HHH C;  4PUG A;  4K0K C;  1V26 A;  2P2Q A;  4LF8 C;  3E7X A;  1P4E A;  1O92 A;  4IR7 A;  4DR1 C;  4DCU A;  4I9F A;  1J5E C;  3G7S A;  1MDB A;  3ETC A;  5T8T A;  4L4Q A;  3DLP X;  3NYR A;  4OXI A;  4NXM C;  2ZZN A;  1V25 A;  4KHP C;  1QWI A;  3UX2 A;  3AF5 A;  4WV3 A;  1WCJ A;  3OTO C;  4DR3 C;  3B7W A;  1XMO C;  2QVX X;  4TPS B;  3T1Y C;  3TDE A;  4L2Z A;  2PRO A;  1YJ7 A;  3UZ0 A;  4DV6 C;  2Z51 A;  1LQL A;  1AMU A;  1UWD A;  2E0G A;  4DV2 C;  1MXA A;  1GPM A;  4B3M C;  5LCI A;  3ETO A;  1MDF A;  4FUQ A;  4G36 A;  4DV4 C;  5DV9 A;  3C5E A;  4JI1 C;  2QW0 X;  3CQ2 A;  4GS5 A;  5AE2 A;  4HPV A;  4G37 A;  5A2Q D;  2E7G A;  2D7V A;  4YY3 C;  4JI0 C;  3LNO A;  4ZJZ A;  1M6X A;  3O2E A;  2E5L C;  1I94 C;  3NPD A;  5FLX D;  1HR0 C;  4B3T C;  4L7I A;  4DR4 C;  3CJE A;  2HJG A;  1T5H X;  1K0R A;  4MH4 A;  5AE1 A;  3AF6 A;  3UOW A;  2UUB C;  2D27 A;  3RG2 A;  4PHT A;  2ZM6 C;  3AY0 A;  2QVZ X;  4U5Y D;  4JV5 C;  3I08 A;  1WF3 A;  1UKK A;  2UXC C;  1XS3 A;  2QL8 A;  1N32 C;  4D57 A;  4B3S C;  1PA4 A;  3NYQ A;  1ML8 A;  3R9X A;  1PU1 A;  1FUG A;  3PES A;  5KEI A;  4EAT A;  1XMQ C;  3CW8 X;  3IML A;  4JI7 C;  5H9U A;  4IZ6 A;  4OYC A;  5KYV A;  4GKK C;  3CQ3 A;  3A4I A;  3NI2 A;  2UU9 C;  4K0B A;  4MTN A;  4X62 C;  2UXB C;  3EER A;  1P4E C;  3VNS A;  3N54 B;  3PBK A;  2OPL A;  2PN2 A;  1USP B;  3IEU A;  3A25 A;  1NYE A;  1USP A;  4DG8 A;  4GXR A;  3LNV A;  1L2F A;  5BSU A;  1N36 C;  1IBL C;  3T1H C;  4JI2 C;  4DV5 C;  3R9W A;  4FUT A;  4JM1 A;  3J80 D;  1KKG A;  4BCA A;  2VQE C;  4ZLP A;  2D1T A;  2P2F A;  4LFA C;  3J81 D;  5BUR A;  2CXC A;  4FTF A;  1FLO A;  5IT9 D;  4LF5 C;  4R1L A;  1MXB A;  1M6X C;  2D1R A;  2UXD C;  3N2Q A;  4JI5 C;  4DCV A;  2UUC C;  5BSR A;  2VSQ A;  3PRO C;  4DCT A;  1XRB A;  4NXN C;  1PG4 A;  1MKY A;  4PRO C;  2CU6 A;  2DPL A;  5GTD A;  1N33 C;  3IEV A;  2V7B A;  1QM4 A;  3DAY A;  5K85 A;  5BSW A;  3GPC A;  5LMU C;  1VEH A;  2CY1 A;  3S82 A;  3LAX A;  4DV7 C; 
#chains in the Genus database with same CATH homology
 1XNR C;  2PT7 G;  5A1G A;  1HH2 P;  2ONF A;  2Y4O A;  4LF9 C;  2ATW A;  2VZE A;  2P02 A;  1IBM C;  4D4G A;  4GXQ A;  4JI6 C;  5E7Q A;  1HNZ C;  2WD9 A;  4WS9 A;  2AYA A;  3GR1 A;  5BUS A;  5IFI A;  4XX2 A;  4JI3 C;  1ZB9 A;  4X65 C;  1BA3 A;  2QVY X;  4PZP A;  1O9T A;  4KTT A;  5BUQ A;  1WH9 A;  2P20 A;  4GKJ C;  2OO4 A;  5K8F A;  3E7W A;  4RLF A;  2P2M A;  4B3R C;  3L8C A;  5BR8 C;  2D28 C;  5CZV A;  4DR5 C;  5IWA C;  3FCC A;  2UUA C;  4RLQ A;  5LMN C;  4YHH C;  4BBY A;  3RV2 A;  4DUZ C;  2VQF C;  1ZB8 A;  1MXC A;  5AE3 A;  1IBK C;  2YCB A;  4DG9 A;  3I07 A;  4DV0 C;  1XRC A;  4X66 C;  2E8E A;  2E8C A;  4RMN A;  4AQY C;  1O93 A;  2YWB A;  4R0M A;  4JI4 C;  2P2J A;  4BC7 A;  2D1S A;  4D4I A;  1LCI A;  2JMP A;  4RM3 A;  4DUY C;  4LFC C;  1T5D X;  1ULT A;  2Y27 A;  5KYT A;  1O90 A;  2XR1 A;  4RVN A;  5JRH A;  3SO4 A;  3DHV A;  3TUF A;  1HNW C;  1RY2 A;  3VNQ A;  1RG9 A;  3LGX A;  4DV3 C;  2E8F A;  1XRA A;  4ODJ A;  1P7L A;  3JAM D;  2F4V C;  4DV1 C;  2ASB A;  4G1I A;  2OBV A;  2YWC A;  5BSM A;  3L95 X;  2DYJ A;  3VNR A;  3H2T A;  2D1Q A;  4ISB A;  3EQ6 A;  3IPL A;  4NOZ A;  4LF7 C;  4RVO A;  4RM2 A;  4JI8 C;  4NDN A;  4DCS A;  2Y4N A;  2P2B A;  3R44 A;  2EGT A;  5CZX A;  1N34 C;  4D56 A;  4I9G A;  4R1M A;  1VLA A;  2OPL B;  1JOS A;  5ADZ A;  1FJG C;  3GR0 A;  5T8S A;  2BH1 X;  1N2F A;  3KXW A;  3A9U A;  1MD9 A;  4JYA C;  5BSV A;  4DR2 C;  2BJO A;  5BST A;  5A19 A;  3A9V A;  3CW9 A;  1PG3 A;  1EGA A;  3LUS A;  4LE5 A;  4KTV A;  2WP0 C;  4BSZ A;  2KZF A;  1XNQ C;  4OX9 C;  4LF4 C;  3GKU A;  5A1I A;  4LFB C;  4X64 C;  3FCE A;  1HNX C;  4BC9 A;  4DR6 C;  4DR7 C;  4LF6 C;  3TQI A;  2HHH C;  4K0K C;  1V26 A;  2P2Q A;  4LF8 C;  3E7X A;  1O92 A;  4IR7 A;  4DR1 C;  4DCU A;  4I9F A;  1J5E C;  3G7S A;  1MDB A;  3ETC A;  5T8T A;  4L4Q A;  3DLP X;  3NYR A;  4OXI A;  4NXM C;  1V25 A;  4KHP C;  1QWI A;  3AF5 A;  4WV3 A;  3OTO C;  4DR3 C;  3B7W A;  1XMO C;  2QVX X;  4TPS B;  3T1Y C;  3TDE A;  4L2Z A;  2PRO A;  1YJ7 A;  3UZ0 A;  4DV6 C;  1LQL A;  1AMU A;  2E0G A;  4DV2 C;  1MXA A;  1GPM A;  4B3M C;  3ETO A;  1MDF A;  4FUQ A;  4G36 A;  4DV4 C;  5DV9 A;  3C5E A;  4JI1 C;  2QW0 X;  4GS5 A;  5AE2 A;  4HPV A;  4G37 A;  5A2Q D;  2E7G A;  2D7V A;  4YY3 C;  4JI0 C;  4ZJZ A;  2E5L C;  1I94 C;  3NPD A;  5FLX D;  1HR0 C;  4B3T C;  4L7I A;  4DR4 C;  3CJE A;  2HJG A;  1T5H X;  1K0R A;  4MH4 A;  5AE1 A;  3AF6 A;  3UOW A;  2UUB C;  2D27 A;  3RG2 A;  4PHT A;  2ZM6 C;  2QVZ X;  4U5Y D;  4JV5 C;  3I08 A;  1WF3 A;  1UKK A;  2UXC C;  2QL8 A;  1N32 C;  4D57 A;  4B3S C;  1PA4 A;  3NYQ A;  1ML8 A;  3R9X A;  1FUG A;  3PES A;  5KEI A;  4EAT A;  1XMQ C;  3CW8 X;  3IML A;  4JI7 C;  5H9U A;  4IZ6 A;  4OYC A;  5KYV A;  4GKK C;  3A4I A;  3NI2 A;  2UU9 C;  4K0B A;  4MTN A;  4X62 C;  2UXB C;  3EER A;  3VNS A;  3N54 B;  3PBK A;  2OPL A;  2PN2 A;  1USP B;  3IEU A;  1NYE A;  1USP A;  4DG8 A;  4GXR A;  3LNV A;  1L2F A;  5BSU A;  1N36 C;  1IBL C;  3T1H C;  4JI2 C;  4DV5 C;  3R9W A;  4FUT A;  4JM1 A;  3J80 D;  1KKG A;  4BCA A;  2VQE C;  4ZLP A;  2D1T A;  2P2F A;  4LFA C;  3J81 D;  5BUR A;  2CXC A;  4FTF A;  5IT9 D;  4LF5 C;  4R1L A;  1MXB A;  2D1R A;  2UXD C;  3N2Q A;  4JI5 C;  4DCV A;  2UUC C;  5BSR A;  2VSQ A;  3PRO C;  4DCT A;  1XRB A;  4NXN C;  1PG4 A;  1MKY A;  4PRO C;  2DPL A;  5GTD A;  1N33 C;  3IEV A;  2V7B A;  1QM4 A;  3DAY A;  5K85 A;  5BSW A;  3GPC A;  5LMU C;  2CY1 A;  3S82 A;  3LAX A;  4DV7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...