4FTFA

Structure of the type ii secretion system pilotin asps from vibrio cholerae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
GAMAEKQRNLELLAGNRASLLSTELPLEFGPLNILRATAKGSTVELMMVYNTDANNAKPTEQVLQSAVSSFCANKDIRSNLDVGISYRIQMRNTRGQLMADQLVTKESC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alternate secretin pathway subunit S (VC395_1821, VC1703)
publication title Assembly of the Type II Secretion System such as Found in Vibrio cholerae Depends on the Novel Pilotin AspS.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
total genus 34
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16549 T2SSS_2 Type II secretion system (T2SS) pilotin, S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.250 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ftfA00
4FTFA 3NPDA
chains in the Genus database with same CATH superfamily
5E7QA 1ZB9A 1USPB 1WH9A 3I08A 5CZXA 4PHTA 2P20A 1NYEA 1AMUA 4B3TC 3C5EA 4HPVA 2HJGA 2P2QA 3UZ0A 5BSWA 1FLOA 4PUGA 3EQ6A 4KTTA 2QVYX 4RLFA 1N32C 4JI5C 4DR4C 4AQYC 4JI7C 4LE5A 2P2MA 2E8CA 4LFBC 3NYQA 5K8FA 4B3MC 1FUGA 2VQEC 1ZB8A 4JI8C 4R1LA 1WF3A 1T5HX 4G1IA 1TH5A 4YY3C 5BSRA 3R9XA 2YCBA 2JNVA 4DV0C 2UXCC 2KZFA 2V7BA 4ZLPA 4ODJA 3DHVA 4K0BA 4X65C 1XNRC 3TDEA 3GR1A 3PESA 3LGXA 1V26A 1P4EA 1USPA 2Y4NA 4DR7C 3A9VA 4X62C 4LF5C 2BJOA 3FCCA 2ZZNA 2PT7G 4BBYA 4ISBA 2ASBA 4LF6C 1XHJA 3LAXA 1JOSA 3SO4A 1RY2A 1XRCA 4NXNC 4MH4A 4PZPA 1HNZC 2E8EA 2WD9A 4FUTA 4XX2A 1RG9A 5BR8C 1O90A 1N33C 4NOZA 4BC9A 1XRAA 4IZ6A 3CQ3A 3T1HC 2E5LC 2YWCA 1MXBA 1GPMA 3OTOC 3LUSA 2JMPA 4YHHC 2D7VA 1PG4A 4JI3C 4LF7C 4R0MA 1IB8A 3TUFA 2QVXX 3CW8X 3DAYA 4PUIA 4DV7C 4RVNA 3E7XA 3R44A 1KKGA 4DR6C 2P02A 4X66C 2ZZMA 1QWIA 1XRBA 2P2JA 1HNWC 2Z51A 1XS3A 4G37A 1N2FA 2P2FA 1I94C 2E7GA 2F4VC 3L8CA 3E7WA 4DCTA 5BUSA 2VZEA 5LCIA 5A19A 4GKJC 4WV3A 3LNVA 2MCQA 1ULTA 2DHMA 5CZVA 2UUAC 2UXBC 1QM4A 2AYAA 3TQIA 3T1YC 1J5EC 4G36A 3UX3A 5DV9A 4JI4C 3DLPX 2OPLB 2YX1A 3R9WA 4MTNA 4DV5C 2UXDC 5AE2A 4GXRA 3A25A 3G7SA 1BA3A 4NDNA 4JM1A 3CQ1A 2Y4OA 4RVOA 5T8TA 1LCIA 4FUQA 4DV3C 2MM9A 4RM3A 5JRHA 2KDNA 1MXCA 3VNQA 2D1QA 1V25A 1HNXC 5ADZA 4LF8C 3GPCA 2CU6A 2ZM6C 4DV1C 1MD9A 2D1SA 1PG3A 2MMAB 3A9UA 4JI0C 3UX2A 4D4GA 2UU9C 4BC7A 1IBMC 1HR0C 2D27A 4WS9A 1XNQC 4OYCA 1HH2P 1O92A 1UWDA 2QVZX 2DPLA 4D57A 1N34C 2OPLA 5IT9D 3ETCA 4L2ZA 3K6RA 3L95X 4DUZC 4GS5A 1M6XC 5A1GA 3NI2A 2QL8A 3ETOA 1MXAA 1L2FA 3IEVA 4B3SC 1ML8A 4JI6C 2E0GA 3S82A 1T5DX 4JYAC 3J81D 4DR1C 2ATWA 5A2QD 3IPLA 3PBKA 2QW0X 4K0KC 3O2EA 2HHHC 2OBVA 5BSMA 4BCAA 4NXMC 1PA4A 3AF5A 5BURA 4L7IA 4DCUA 2WP0C 3H2TA 3JAMD 3RG2A 2PN2A 3IEUA 4GXQA 2YWBA 4ZJZA 4PUHA 3B7WA 4EATA 1XMQC 5IFIA 5KEIA 2M5HA 4I9GA 3PROC 1XMOC 4D4IA 5A1IA 1MDBA 3IMLA 1VEHA 1N36C 1WCJA 1P4EC 4OXIA 4DR2C 3UEBA 5BUQA 2DYJA 1PU1A 4DR3C 4LF9C 3RV2A 1YJ7A 4OX9C 4DV6C 4X64C 1O9TA 2Y27A 4JI1C 3J80D 3GKUA 1VLAA 1K0RA 4IR7A 3I07A 5AE1A 3AF6A 1V60A 3NYRA 4L4QA 2UUBC 4JV5C 5LMNC 4KTVA 4LFAC 2OO4A 1IBLC 1P7LA 4U5YD 3FCEA 2D1RA 3EERA 5FLXD 2D28C 4B3RC 1MKYA 4LFCC 2EGTA 5T8SA 1EGAA 3CQ2A 4DG9A 2XR1A 3A4IA 5LMUC 2E8FA 4BSZA 1O93A 4D56A 2P2BA 3KXWA 4DR5C 3VNRA 1NY8A 4DV4C 4GKKC 4DCSA 4PROC 2NCLA 1UKKA 4DCVA 4LF4C 5IWAC 2M5OA 4RMNA 3GR0A 2ONFA 3CW9A 5BSVA 1IBKC 3N54B 1LQLA 3UOWA 4FTFA 4RM2A 4RLQA 5KYVA 3CJEA 5GTDA 3LNOA 3A26A 5H9UA 2VSQA 3N2QA 3NPDA 2KZ0A 4KHPC 2BH1X 2CXCA 5BSTA 5AE3A 3AY0A 4DG8A 4JI2C 4TPSB 3TR3A 1MDFA 2VQFC 1FJGC 3VNSA 5BSUA 4DUYC 5K85A 2CY1A 2D1TA 4DV2C 2UUCC 2PROA 5KYTA 4R1MA 1M6XA 4I9FA
chains in the Genus database with same CATH topology
5E7QA 1ZB9A 1USPB 1WH9A 3I08A 5CZXA 4PHTA 2P20A 1NYEA 1AMUA 4B3TC 3C5EA 4HPVA 2HJGA 2P2QA 3UZ0A 5BSWA 3EQ6A 4KTTA 2QVYX 4RLFA 1N32C 4JI5C 4DR4C 4AQYC 4JI7C 4LE5A 2P2MA 2E8CA 4LFBC 3NYQA 5K8FA 4B3MC 1FUGA 2VQEC 1ZB8A 4JI8C 4R1LA 1WF3A 1T5HX 4G1IA 4YY3C 5BSRA 3R9XA 2YCBA 4DV0C 2UXCC 2KZFA 2V7BA 4ZLPA 4ODJA 3DHVA 4K0BA 4X65C 1XNRC 3TDEA 3GR1A 3PESA 3LGXA 1V26A 1USPA 2Y4NA 4DR7C 3A9VA 4X62C 4LF5C 2BJOA 3FCCA 2PT7G 4BBYA 4ISBA 2ASBA 4LF6C 3LAXA 1JOSA 3SO4A 1RY2A 1XRCA 4NXNC 4MH4A 4PZPA 1HNZC 2E8EA 2WD9A 4FUTA 4XX2A 1RG9A 5BR8C 1O90A 1N33C 4NOZA 4BC9A 1XRAA 4IZ6A 3T1HC 2E5LC 2YWCA 1MXBA 3OTOC 1GPMA 3LUSA 2JMPA 4YHHC 2D7VA 1PG4A 4JI3C 4LF7C 4R0MA 3TUFA 2QVXX 3CW8X 3DAYA 4DV7C 4RVNA 3E7XA 3R44A 1KKGA 4DR6C 2P02A 4X66C 1QWIA 1XRBA 2P2JA 1HNWC 4G37A 1N2FA 2P2FA 1I94C 2E7GA 2F4VC 3L8CA 3E7WA 4DCTA 5BUSA 2VZEA 5A19A 4GKJC 4WV3A 3LNVA 1ULTA 5CZVA 2UUAC 2UXBC 1QM4A 2AYAA 3TQIA 3T1YC 1J5EC 4G36A 5DV9A 4JI4C 3DLPX 2OPLB 3R9WA 4MTNA 4DV5C 2UXDC 5AE2A 4GXRA 3G7SA 1BA3A 4NDNA 4JM1A 2Y4OA 4RVOA 5T8TA 1LCIA 4FUQA 4DV3C 4RM3A 5JRHA 3VNQA 1MXCA 2D1QA 1V25A 1HNXC 5ADZA 4LF8C 3GPCA 2ZM6C 4DV1C 1MD9A 2D1SA 1PG3A 3A9UA 4JI0C 4D4GA 2UU9C 4BC7A 1IBMC 1HR0C 2D27A 4WS9A 1XNQC 4OYCA 1HH2P 1O92A 2QVZX 2DPLA 4D57A 1N34C 2OPLA 5IT9D 3ETCA 4L2ZA 3L95X 4DUZC 4GS5A 5A1GA 3NI2A 2QL8A 3ETOA 1MXAA 1L2FA 3IEVA 4B3SC 1ML8A 4JI6C 2E0GA 3S82A 1T5DX 4JYAC 3J81D 4DR1C 2ATWA 5A2QD 3IPLA 3PBKA 2QW0X 4K0KC 2HHHC 2OBVA 5BSMA 4BCAA 4NXMC 1PA4A 3AF5A 5BURA 4L7IA 4DCUA 2WP0C 3H2TA 3JAMD 3RG2A 2PN2A 3IEUA 4GXQA 2YWBA 4ZJZA 3B7WA 4EATA 1XMQC 5IFIA 5KEIA 4I9GA 3PROC 1XMOC 4D4IA 5A1IA 1MDBA 3IMLA 1N36C 4OXIA 4DR2C 5BUQA 2DYJA 4DR3C 4LF9C 3RV2A 1YJ7A 4OX9C 4DV6C 4X64C 1O9TA 2Y27A 4JI1C 3J80D 3GKUA 1VLAA 1K0RA 4IR7A 3I07A 5AE1A 3AF6A 3NYRA 4L4QA 2UUBC 4JV5C 5LMNC 4KTVA 4LFAC 2OO4A 1IBLC 1P7LA 4U5YD 3FCEA 2D1RA 3EERA 5FLXD 2D28C 4B3RC 1MKYA 4LFCC 2EGTA 5T8SA 1EGAA 4DG9A 2XR1A 3A4IA 5LMUC 2E8FA 4BSZA 1O93A 4D56A 2P2BA 3KXWA 4DR5C 3VNRA 4DV4C 4GKKC 4DCSA 4PROC 1UKKA 4DCVA 4LF4C 5IWAC 4RMNA 3GR0A 2ONFA 3CW9A 5BSVA 1IBKC 3N54B 1LQLA 3UOWA 4FTFA 4RM2A 4RLQA 5KYVA 3CJEA 5GTDA 5H9UA 2VSQA 3N2QA 3NPDA 4KHPC 2BH1X 2CXCA 5BSTA 5AE3A 4DG8A 4JI2C 4TPSB 1MDFA 2VQFC 1FJGC 3VNSA 5BSUA 4DUYC 5K85A 2CY1A 2D1TA 4DV2C 2UUCC 2PROA 5KYTA 4R1MA 4I9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTF A;  3NPD A; 
#chains in the Genus database with same CATH topology
 5E7Q A;  1ZB9 A;  1USP B;  1WH9 A;  3I08 A;  5CZX A;  4PHT A;  2P20 A;  1NYE A;  1AMU A;  4B3T C;  3C5E A;  4HPV A;  2HJG A;  2P2Q A;  3UZ0 A;  5BSW A;  1FLO A;  4PUG A;  3EQ6 A;  4KTT A;  2QVY X;  4RLF A;  1N32 C;  4JI5 C;  4DR4 C;  4AQY C;  4JI7 C;  4LE5 A;  2P2M A;  2E8C A;  4LFB C;  3NYQ A;  5K8F A;  4B3M C;  1FUG A;  2VQE C;  1ZB8 A;  4JI8 C;  4R1L A;  1WF3 A;  1T5H X;  4G1I A;  1TH5 A;  4YY3 C;  5BSR A;  3R9X A;  2YCB A;  2JNV A;  4DV0 C;  2UXC C;  2KZF A;  2V7B A;  4ZLP A;  4ODJ A;  3DHV A;  4K0B A;  4X65 C;  1XNR C;  3TDE A;  3GR1 A;  3PES A;  3LGX A;  1V26 A;  1P4E A;  1USP A;  2Y4N A;  4DR7 C;  3A9V A;  4X62 C;  4LF5 C;  2BJO A;  3FCC A;  2ZZN A;  2PT7 G;  4BBY A;  4ISB A;  2ASB A;  4LF6 C;  1XHJ A;  3LAX A;  1JOS A;  3SO4 A;  1RY2 A;  1XRC A;  4NXN C;  4MH4 A;  4PZP A;  1HNZ C;  2E8E A;  2WD9 A;  4FUT A;  4XX2 A;  1RG9 A;  5BR8 C;  1O90 A;  1N33 C;  4NOZ A;  4BC9 A;  1XRA A;  4IZ6 A;  3CQ3 A;  3T1H C;  2E5L C;  2YWC A;  1MXB A;  1GPM A;  3OTO C;  3LUS A;  2JMP A;  4YHH C;  2D7V A;  1PG4 A;  4JI3 C;  4LF7 C;  4R0M A;  1IB8 A;  3TUF A;  2QVX X;  3CW8 X;  3DAY A;  4PUI A;  4DV7 C;  4RVN A;  3E7X A;  3R44 A;  1KKG A;  4DR6 C;  2P02 A;  4X66 C;  2ZZM A;  1QWI A;  1XRB A;  2P2J A;  1HNW C;  2Z51 A;  1XS3 A;  4G37 A;  1N2F A;  2P2F A;  1I94 C;  2E7G A;  2F4V C;  3L8C A;  3E7W A;  4DCT A;  5BUS A;  2VZE A;  5LCI A;  5A19 A;  4GKJ C;  4WV3 A;  3LNV A;  2MCQ A;  1ULT A;  2DHM A;  5CZV A;  2UUA C;  2UXB C;  1QM4 A;  2AYA A;  3TQI A;  3T1Y C;  1J5E C;  4G36 A;  3UX3 A;  5DV9 A;  4JI4 C;  3DLP X;  2OPL B;  2YX1 A;  3R9W A;  4MTN A;  4DV5 C;  2UXD C;  5AE2 A;  4GXR A;  3A25 A;  3G7S A;  1BA3 A;  4NDN A;  4JM1 A;  3CQ1 A;  2Y4O A;  4RVO A;  5T8T A;  1LCI A;  4FUQ A;  4DV3 C;  2MM9 A;  4RM3 A;  5JRH A;  2KDN A;  1MXC A;  3VNQ A;  2D1Q A;  1V25 A;  1HNX C;  5ADZ A;  4LF8 C;  3GPC A;  2CU6 A;  2ZM6 C;  4DV1 C;  1MD9 A;  2D1S A;  1PG3 A;  2MMA B;  3A9U A;  4JI0 C;  3UX2 A;  4D4G A;  2UU9 C;  4BC7 A;  1IBM C;  1HR0 C;  2D27 A;  4WS9 A;  1XNQ C;  4OYC A;  1HH2 P;  1O92 A;  1UWD A;  2QVZ X;  2DPL A;  4D57 A;  1N34 C;  2OPL A;  5IT9 D;  3ETC A;  4L2Z A;  3K6R A;  3L95 X;  4DUZ C;  4GS5 A;  1M6X C;  5A1G A;  3NI2 A;  2QL8 A;  3ETO A;  1MXA A;  1L2F A;  3IEV A;  4B3S C;  1ML8 A;  4JI6 C;  2E0G A;  3S82 A;  1T5D X;  4JYA C;  3J81 D;  4DR1 C;  2ATW A;  5A2Q D;  3IPL A;  3PBK A;  2QW0 X;  4K0K C;  3O2E A;  2HHH C;  2OBV A;  5BSM A;  4BCA A;  4NXM C;  1PA4 A;  3AF5 A;  5BUR A;  4L7I A;  4DCU A;  2WP0 C;  3H2T A;  3JAM D;  3RG2 A;  2PN2 A;  3IEU A;  4GXQ A;  2YWB A;  4ZJZ A;  4PUH A;  3B7W A;  4EAT A;  1XMQ C;  5IFI A;  5KEI A;  2M5H A;  4I9G A;  3PRO C;  1XMO C;  4D4I A;  5A1I A;  1MDB A;  3IML A;  1VEH A;  1N36 C;  1WCJ A;  1P4E C;  4OXI A;  4DR2 C;  3UEB A;  5BUQ A;  2DYJ A;  1PU1 A;  4DR3 C;  4LF9 C;  3RV2 A;  1YJ7 A;  4OX9 C;  4DV6 C;  4X64 C;  1O9T A;  2Y27 A;  4JI1 C;  3J80 D;  3GKU A;  1VLA A;  1K0R A;  4IR7 A;  3I07 A;  5AE1 A;  3AF6 A;  1V60 A;  3NYR A;  4L4Q A;  2UUB C;  4JV5 C;  5LMN C;  4KTV A;  4LFA C;  2OO4 A;  1IBL C;  1P7L A;  4U5Y D;  3FCE A;  2D1R A;  3EER A;  5FLX D;  2D28 C;  4B3R C;  1MKY A;  4LFC C;  2EGT A;  5T8S A;  1EGA A;  3CQ2 A;  4DG9 A;  2XR1 A;  3A4I A;  5LMU C;  2E8F A;  4BSZ A;  1O93 A;  4D56 A;  2P2B A;  3KXW A;  4DR5 C;  3VNR A;  1NY8 A;  4DV4 C;  4GKK C;  4DCS A;  4PRO C;  2NCL A;  1UKK A;  4DCV A;  4LF4 C;  5IWA C;  2M5O A;  4RMN A;  3GR0 A;  2ONF A;  3CW9 A;  5BSV A;  1IBK C;  3N54 B;  1LQL A;  3UOW A;  4FTF A;  4RM2 A;  4RLQ A;  5KYV A;  3CJE A;  5GTD A;  3LNO A;  3A26 A;  5H9U A;  2VSQ A;  3N2Q A;  3NPD A;  2KZ0 A;  4KHP C;  2BH1 X;  2CXC A;  5BST A;  5AE3 A;  3AY0 A;  4DG8 A;  4JI2 C;  4TPS B;  3TR3 A;  1MDF A;  2VQF C;  1FJG C;  3VNS A;  5BSU A;  4DUY C;  5K85 A;  2CY1 A;  2D1T A;  4DV2 C;  2UUC C;  2PRO A;  5KYT A;  4R1M A;  1M6X A;  4I9F A; 
#chains in the Genus database with same CATH homology
 5E7Q A;  1ZB9 A;  1USP B;  1WH9 A;  3I08 A;  5CZX A;  4PHT A;  2P20 A;  1NYE A;  1AMU A;  4B3T C;  3C5E A;  4HPV A;  2HJG A;  2P2Q A;  3UZ0 A;  5BSW A;  3EQ6 A;  4KTT A;  2QVY X;  4RLF A;  1N32 C;  4JI5 C;  4DR4 C;  4AQY C;  4JI7 C;  4LE5 A;  2P2M A;  2E8C A;  4LFB C;  3NYQ A;  5K8F A;  4B3M C;  1FUG A;  2VQE C;  1ZB8 A;  4JI8 C;  4R1L A;  1WF3 A;  1T5H X;  4G1I A;  4YY3 C;  5BSR A;  3R9X A;  2YCB A;  4DV0 C;  2UXC C;  2KZF A;  2V7B A;  4ZLP A;  4ODJ A;  3DHV A;  4K0B A;  4X65 C;  1XNR C;  3TDE A;  3GR1 A;  3PES A;  3LGX A;  1V26 A;  1USP A;  2Y4N A;  4DR7 C;  3A9V A;  4X62 C;  4LF5 C;  2BJO A;  3FCC A;  2PT7 G;  4BBY A;  4ISB A;  2ASB A;  4LF6 C;  3LAX A;  1JOS A;  3SO4 A;  1RY2 A;  1XRC A;  4NXN C;  4MH4 A;  4PZP A;  1HNZ C;  2E8E A;  2WD9 A;  4FUT A;  4XX2 A;  1RG9 A;  5BR8 C;  1O90 A;  1N33 C;  4NOZ A;  4BC9 A;  1XRA A;  4IZ6 A;  3T1H C;  2E5L C;  2YWC A;  1MXB A;  3OTO C;  1GPM A;  3LUS A;  2JMP A;  4YHH C;  2D7V A;  1PG4 A;  4JI3 C;  4LF7 C;  4R0M A;  3TUF A;  2QVX X;  3CW8 X;  3DAY A;  4DV7 C;  4RVN A;  3E7X A;  3R44 A;  1KKG A;  4DR6 C;  2P02 A;  4X66 C;  1QWI A;  1XRB A;  2P2J A;  1HNW C;  4G37 A;  1N2F A;  2P2F A;  1I94 C;  2E7G A;  2F4V C;  3L8C A;  3E7W A;  4DCT A;  5BUS A;  2VZE A;  5A19 A;  4GKJ C;  4WV3 A;  3LNV A;  1ULT A;  5CZV A;  2UUA C;  2UXB C;  1QM4 A;  2AYA A;  3TQI A;  3T1Y C;  1J5E C;  4G36 A;  5DV9 A;  4JI4 C;  3DLP X;  2OPL B;  3R9W A;  4MTN A;  4DV5 C;  2UXD C;  5AE2 A;  4GXR A;  3G7S A;  1BA3 A;  4NDN A;  4JM1 A;  2Y4O A;  4RVO A;  5T8T A;  1LCI A;  4FUQ A;  4DV3 C;  4RM3 A;  5JRH A;  3VNQ A;  1MXC A;  2D1Q A;  1V25 A;  1HNX C;  5ADZ A;  4LF8 C;  3GPC A;  2ZM6 C;  4DV1 C;  1MD9 A;  2D1S A;  1PG3 A;  3A9U A;  4JI0 C;  4D4G A;  2UU9 C;  4BC7 A;  1IBM C;  1HR0 C;  2D27 A;  4WS9 A;  1XNQ C;  4OYC A;  1HH2 P;  1O92 A;  2QVZ X;  2DPL A;  4D57 A;  1N34 C;  2OPL A;  5IT9 D;  3ETC A;  4L2Z A;  3L95 X;  4DUZ C;  4GS5 A;  5A1G A;  3NI2 A;  2QL8 A;  3ETO A;  1MXA A;  1L2F A;  3IEV A;  4B3S C;  1ML8 A;  4JI6 C;  2E0G A;  3S82 A;  1T5D X;  4JYA C;  3J81 D;  4DR1 C;  2ATW A;  5A2Q D;  3IPL A;  3PBK A;  2QW0 X;  4K0K C;  2HHH C;  2OBV A;  5BSM A;  4BCA A;  4NXM C;  1PA4 A;  3AF5 A;  5BUR A;  4L7I A;  4DCU A;  2WP0 C;  3H2T A;  3JAM D;  3RG2 A;  2PN2 A;  3IEU A;  4GXQ A;  2YWB A;  4ZJZ A;  3B7W A;  4EAT A;  1XMQ C;  5IFI A;  5KEI A;  4I9G A;  3PRO C;  1XMO C;  4D4I A;  5A1I A;  1MDB A;  3IML A;  1N36 C;  4OXI A;  4DR2 C;  5BUQ A;  2DYJ A;  4DR3 C;  4LF9 C;  3RV2 A;  1YJ7 A;  4OX9 C;  4DV6 C;  4X64 C;  1O9T A;  2Y27 A;  4JI1 C;  3J80 D;  3GKU A;  1VLA A;  1K0R A;  4IR7 A;  3I07 A;  5AE1 A;  3AF6 A;  3NYR A;  4L4Q A;  2UUB C;  4JV5 C;  5LMN C;  4KTV A;  4LFA C;  2OO4 A;  1IBL C;  1P7L A;  4U5Y D;  3FCE A;  2D1R A;  3EER A;  5FLX D;  2D28 C;  4B3R C;  1MKY A;  4LFC C;  2EGT A;  5T8S A;  1EGA A;  4DG9 A;  2XR1 A;  3A4I A;  5LMU C;  2E8F A;  4BSZ A;  1O93 A;  4D56 A;  2P2B A;  3KXW A;  4DR5 C;  3VNR A;  4DV4 C;  4GKK C;  4DCS A;  4PRO C;  1UKK A;  4DCV A;  4LF4 C;  5IWA C;  4RMN A;  3GR0 A;  2ONF A;  3CW9 A;  5BSV A;  1IBK C;  3N54 B;  1LQL A;  3UOW A;  4FTF A;  4RM2 A;  4RLQ A;  5KYV A;  3CJE A;  5GTD A;  5H9U A;  2VSQ A;  3N2Q A;  3NPD A;  4KHP C;  2BH1 X;  2CXC A;  5BST A;  5AE3 A;  4DG8 A;  4JI2 C;  4TPS B;  1MDF A;  2VQF C;  1FJG C;  3VNS A;  5BSU A;  4DUY C;  5K85 A;  2CY1 A;  2D1T A;  4DV2 C;  2UUC C;  2PRO A;  5KYT A;  4R1M A;  4I9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...