4FTFA

Structure of the type ii secretion system pilotin asps from vibrio cholerae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
109
structure length
109
Chain Sequence
GAMAEKQRNLELLAGNRASLLSTELPLEFGPLNILRATAKGSTVELMMVYNTDANNAKPTEQVLQSAVSSFCANKDIRSNLDVGISYRIQMRNTRGQLMADQLVTKESC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Alternate secretin pathway subunit S (VC395_1821, VC1703)
publication title Assembly of the Type II Secretion System such as Found in Vibrio cholerae Depends on the Novel Pilotin AspS.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 34
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16549 T2SSS_2 Type II secretion system (T2SS) pilotin, S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.250 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4ftfA00
4FTFA 3NPDA
chains in the Genus database with same CATH superfamily
4GKKC 5A1GA 1PG3A 1T5DX 2EGTA 5KYTA 5A1IA 5IT9D 2P02A 4DV7C 2YX1A 1BA3A 5IFIA 2CY1A 4AQYC 2XR1A 3FCCA 4U5YD 4EATA 3UEBA 2CXCA 5DV9A 3R9WA 1MXAA 5T8TA 4NXNC 2F4VC 2OPLB 2M5OA 3ETOA 4I9FA 2Y4NA 3VNRA 2D1QA 4G36A 1FLOA 2YCBA 1N32C 4R1MA 1NYEA 3CQ1A 2WP0C 1O93A 3SO4A 4OX9C 5LMNC 4LFCC 4WV3A 4ISBA 5FLXD 4X66C 1V26A 2WD9A 3EERA 5LMUC 1XNQC 2UXCC 5BSRA 2UUBC 3T1HC 4G37A 4X62C 4DR7C 4G1IA 4DR4C 3B7WA 2E8FA 3H2TA 1ULTA 4RM3A 4DR6C 3N54B 2HJGA 5K85A 4LF8C 1ZB8A 2QL8A 4DUZC 1XRBA 2VQEC 5AE3A 4JM1A 4RMNA 3GR0A 3OTOC 4R1LA 1PU1A 4BSZA 1RG9A 4MTNA 3IEUA 3NPDA 4DR3C 4DR1C 5BUSA 1O92A 3TUFA 4DCUA 1MD9A 2QVYX 1HNXC 1KKGA 2P2BA 4DCSA 4D4IA 5BSTA 1LCIA 1P4EC 2P2MA 3AF6A 4DUYC 3AF5A 3CQ2A 2UUAC 3CW8X 3L8CA 2ZM6C 1MDFA 1IBKC 4GXQA 4ODJA 4ZLPA 1J5EC 2YWBA 5AE1A 1USPA 4B3MC 1XS3A 3VNQA 1RY2A 3RV2A 4B3TC 3E7XA 1VEHA 1HR0C 2OO4A 3R44A 1V25A 3IEVA 2YWCA 2KDNA 3CJEA 3CQ3A 4ZJZA 4LFBC 4GKJC 2V7BA 5KEIA 3A4IA 3DLPX 3ETCA 2KZ0A 1PA4A 4KHPC 2VSQA 2MMAB 4JI5C 1IB8A 2P2FA 4DV4C 1QWIA 1M6XC 3N2QA 4JI1C 2D1TA 3DAYA 3A9UA 5BSWA 4K0KC 3PESA 4JI3C 4LF9C 4I9GA 1HNWC 4OYCA 1ZB9A 4NOZA 5H9UA 3LNOA 4DCVA 2E8CA 4LE5A 4RVOA 4BC9A 4JI4C 3I08A 4BCAA 5BSMA 3A25A 3J80D 2CU6A 4DV6C 1O90A 5AE2A 2E7GA 2Y27A 4DV5C 1K0RA 4HPVA 1WCJA 1MDBA 4RLQA 3A26A 4PHTA 1NY8A 3K6RA 3GR1A 2D7VA 3GKUA 2PN2A 4FUTA 3G7SA 1QM4A 3A9VA 4OXIA 5IWAC 2DPLA 1YJ7A 3LAXA 2VZEA 5T8SA 4NXMC 4BC7A 4DV1C 4LFAC 3C5EA 3TR3A 5K8FA 4PUIA 1P4EA 1UWDA 4L4QA 4X65C 1TH5A 4FTFA 3J81D 4DG9A 5ADZA 2Y4OA 3E7WA 2QW0X 3UZ0A 5GTDA 1XHJA 1USPB 4YHHC 4MH4A 3I07A 2QVZX 4DV0C 4B3SC 4JI2C 2E0GA 4DG8A 3TQIA 4D56A 1N2FA 3VNSA 4X64C 1WF3A 4IR7A 2UXBC 2E8EA 1MXBA 1MXCA 2E5LC 2UU9C 3IMLA 2ZZNA 5BUQA 4DV2C 2DYJA 2ZZMA 4K0BA 2P20A 4GS5A 4JI6C 1XRCA 2DHMA 3R9XA 4LF4C 4JI8C 4BBYA 5CZXA 1M6XA 4KTVA 1T5HX 3CW9A 1N36C 2D27A 4DR5C 5LCIA 1I94C 2AYAA 1LQLA 3KXWA 4PUHA 3FCEA 1IBLC 1ML8A 3NI2A 3UX3A 4D4GA 2NCLA 3NYRA 4LF6C 1GPMA 3S82A 4PROC 4LF5C 4JYAC 3PROC 2ONFA 2VQFC 3T1YC 4NDNA 2OPLA 5CZVA 2UUCC 4JV5C 4GXRA 2JNVA 1HNZC 3UX2A 5KYVA 3TDEA 1WH9A 4D57A 4JI7C 2ASBA 1FUGA 1L2FA 1V60A 3GPCA 4LF7C 2QVXX 4RLFA 2D1RA 1UKKA 5BR8C 2PT7G 2HHHC 3PBKA 2UXDC 4RVNA 1EGAA 3LUSA 3LGXA 4PZPA 4YY3C 2P2JA 3UOWA 5BSVA 3IPLA 3L95X 5BSUA 1VLAA 5JRHA 4IZ6A 2BH1X 2MM9A 3EQ6A 3AY0A 5E7QA 4DCTA 2KZFA 4PUGA 2P2QA 4DR2C 4B3RC 2ATWA 2Z51A 1FJGC 1XRAA 1PG4A 2PROA 4RM2A 5A19A 4XX2A 2BJOA 1HH2P 4R0MA 2D1SA 1MKYA 4DV3C 4TPSB 2D28C 4JI0C 1N34C 3JAMD 1JOSA 1XNRC 3DHVA 1IBMC 3NYQA 2OBVA 1AMUA 4FUQA 1O9TA 2MCQA 1XMQC 4L7IA 1P7LA 5A2QD 1N33C 5BURA 3RG2A 1XMOC 2M5HA 3O2EA 3LNVA 4L2ZA 4WS9A 2JMPA 4KTTA
chains in the Genus database with same CATH topology
4GKKC 5A1GA 1PG3A 1T5DX 2EGTA 5KYTA 5A1IA 5IT9D 2P02A 4DV7C 1BA3A 5IFIA 2CY1A 4AQYC 2XR1A 3FCCA 4U5YD 4EATA 2CXCA 5DV9A 3R9WA 1MXAA 5T8TA 4NXNC 2F4VC 2OPLB 3ETOA 4I9FA 2Y4NA 3VNRA 2D1QA 4G36A 2YCBA 1N32C 4R1MA 1NYEA 2WP0C 1O93A 3SO4A 4OX9C 5LMNC 4LFCC 4WV3A 4ISBA 5FLXD 4X66C 1V26A 2WD9A 3EERA 5LMUC 1XNQC 2UXCC 5BSRA 2UUBC 3T1HC 4G37A 4X62C 4DR7C 4G1IA 4DR4C 3B7WA 2E8FA 3H2TA 1ULTA 4RM3A 4DR6C 3N54B 2HJGA 5K85A 4LF8C 1ZB8A 2QL8A 4DUZC 1XRBA 2VQEC 5AE3A 4JM1A 4RMNA 3GR0A 3OTOC 4R1LA 4BSZA 1RG9A 4MTNA 3IEUA 3NPDA 4DR3C 4DR1C 5BUSA 1O92A 3TUFA 4DCUA 1MD9A 2QVYX 1HNXC 1KKGA 2P2BA 4DCSA 4D4IA 5BSTA 1LCIA 2P2MA 3AF6A 4DUYC 3AF5A 2UUAC 3CW8X 3L8CA 2ZM6C 1MDFA 1IBKC 4GXQA 4ODJA 4ZLPA 1J5EC 2YWBA 5AE1A 1USPA 4B3MC 3VNQA 1RY2A 3RV2A 4B3TC 3E7XA 1HR0C 2OO4A 3R44A 1V25A 3IEVA 2YWCA 3CJEA 4ZJZA 4LFBC 4GKJC 2V7BA 5KEIA 3A4IA 3DLPX 3ETCA 1PA4A 4KHPC 2VSQA 4JI5C 2P2FA 4DV4C 1QWIA 3N2QA 4JI1C 2D1TA 3DAYA 3A9UA 5BSWA 4K0KC 3PESA 4JI3C 4LF9C 4I9GA 1HNWC 4OYCA 1ZB9A 4NOZA 5H9UA 4DCVA 2E8CA 4LE5A 4RVOA 4BC9A 4JI4C 3I08A 4BCAA 5BSMA 3J80D 4DV6C 1O90A 5AE2A 2E7GA 2Y27A 4DV5C 1K0RA 4HPVA 1MDBA 4RLQA 4PHTA 3GR1A 2D7VA 3GKUA 2PN2A 4FUTA 3G7SA 1QM4A 3A9VA 4OXIA 5IWAC 2DPLA 1YJ7A 3LAXA 2VZEA 5T8SA 4NXMC 4BC7A 4DV1C 4LFAC 3C5EA 5K8FA 4L4QA 4X65C 4FTFA 3J81D 4DG9A 5ADZA 2Y4OA 3E7WA 2QW0X 3UZ0A 5GTDA 1USPB 4YHHC 4MH4A 3I07A 2QVZX 4DV0C 4B3SC 4JI2C 2E0GA 4DG8A 3TQIA 4D56A 1N2FA 3VNSA 4X64C 1WF3A 4IR7A 2UXBC 2E8EA 1MXBA 1MXCA 2E5LC 2UU9C 3IMLA 5BUQA 4DV2C 2DYJA 4K0BA 2P20A 4GS5A 4JI6C 1XRCA 3R9XA 4LF4C 4JI8C 4BBYA 5CZXA 4KTVA 1T5HX 3CW9A 1N36C 2D27A 4DR5C 1I94C 2AYAA 1LQLA 3KXWA 3FCEA 1IBLC 1ML8A 3NI2A 4D4GA 3NYRA 4LF6C 1GPMA 3S82A 4PROC 4LF5C 4JYAC 3PROC 2ONFA 2VQFC 3T1YC 4NDNA 2OPLA 5CZVA 2UUCC 4JV5C 4GXRA 1HNZC 5KYVA 3TDEA 1WH9A 4D57A 4JI7C 2ASBA 1FUGA 1L2FA 4LF7C 3GPCA 2QVXX 4RLFA 2D1RA 1UKKA 5BR8C 2PT7G 2HHHC 3PBKA 2UXDC 4RVNA 1EGAA 3LUSA 3LGXA 4PZPA 4YY3C 2P2JA 3UOWA 5BSVA 3IPLA 3L95X 5BSUA 1VLAA 5JRHA 4IZ6A 2BH1X 3EQ6A 5E7QA 4DCTA 2KZFA 2P2QA 4DR2C 4B3RC 2ATWA 1FJGC 1XRAA 1PG4A 2PROA 4RM2A 5A19A 4XX2A 2BJOA 1HH2P 4R0MA 2D1SA 1MKYA 4DV3C 4TPSB 2D28C 4JI0C 1N34C 3JAMD 1JOSA 1XNRC 3DHVA 1IBMC 3NYQA 2OBVA 1AMUA 4FUQA 1O9TA 1XMQC 4L7IA 1P7LA 5A2QD 1N33C 5BURA 3RG2A 1XMOC 3LNVA 4L2ZA 4WS9A 2JMPA 4KTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTF A;  3NPD A; 
#chains in the Genus database with same CATH topology
 4GKK C;  5A1G A;  1PG3 A;  1T5D X;  2EGT A;  5KYT A;  5A1I A;  5IT9 D;  2P02 A;  4DV7 C;  2YX1 A;  1BA3 A;  5IFI A;  2CY1 A;  4AQY C;  2XR1 A;  3FCC A;  4U5Y D;  4EAT A;  3UEB A;  2CXC A;  5DV9 A;  3R9W A;  1MXA A;  5T8T A;  4NXN C;  2F4V C;  2OPL B;  2M5O A;  3ETO A;  4I9F A;  2Y4N A;  3VNR A;  2D1Q A;  4G36 A;  1FLO A;  2YCB A;  1N32 C;  4R1M A;  1NYE A;  3CQ1 A;  2WP0 C;  1O93 A;  3SO4 A;  4OX9 C;  5LMN C;  4LFC C;  4WV3 A;  4ISB A;  5FLX D;  4X66 C;  1V26 A;  2WD9 A;  3EER A;  5LMU C;  1XNQ C;  2UXC C;  5BSR A;  2UUB C;  3T1H C;  4G37 A;  4X62 C;  4DR7 C;  4G1I A;  4DR4 C;  3B7W A;  2E8F A;  3H2T A;  1ULT A;  4RM3 A;  4DR6 C;  3N54 B;  2HJG A;  5K85 A;  4LF8 C;  1ZB8 A;  2QL8 A;  4DUZ C;  1XRB A;  2VQE C;  5AE3 A;  4JM1 A;  4RMN A;  3GR0 A;  3OTO C;  4R1L A;  1PU1 A;  4BSZ A;  1RG9 A;  4MTN A;  3IEU A;  3NPD A;  4DR3 C;  4DR1 C;  5BUS A;  1O92 A;  3TUF A;  4DCU A;  1MD9 A;  2QVY X;  1HNX C;  1KKG A;  2P2B A;  4DCS A;  4D4I A;  5BST A;  1LCI A;  1P4E C;  2P2M A;  3AF6 A;  4DUY C;  3AF5 A;  3CQ2 A;  2UUA C;  3CW8 X;  3L8C A;  2ZM6 C;  1MDF A;  1IBK C;  4GXQ A;  4ODJ A;  4ZLP A;  1J5E C;  2YWB A;  5AE1 A;  1USP A;  4B3M C;  1XS3 A;  3VNQ A;  1RY2 A;  3RV2 A;  4B3T C;  3E7X A;  1VEH A;  1HR0 C;  2OO4 A;  3R44 A;  1V25 A;  3IEV A;  2YWC A;  2KDN A;  3CJE A;  3CQ3 A;  4ZJZ A;  4LFB C;  4GKJ C;  2V7B A;  5KEI A;  3A4I A;  3DLP X;  3ETC A;  2KZ0 A;  1PA4 A;  4KHP C;  2VSQ A;  2MMA B;  4JI5 C;  1IB8 A;  2P2F A;  4DV4 C;  1QWI A;  1M6X C;  3N2Q A;  4JI1 C;  2D1T A;  3DAY A;  3A9U A;  5BSW A;  4K0K C;  3PES A;  4JI3 C;  4LF9 C;  4I9G A;  1HNW C;  4OYC A;  1ZB9 A;  4NOZ A;  5H9U A;  3LNO A;  4DCV A;  2E8C A;  4LE5 A;  4RVO A;  4BC9 A;  4JI4 C;  3I08 A;  4BCA A;  5BSM A;  3A25 A;  3J80 D;  2CU6 A;  4DV6 C;  1O90 A;  5AE2 A;  2E7G A;  2Y27 A;  4DV5 C;  1K0R A;  4HPV A;  1WCJ A;  1MDB A;  4RLQ A;  3A26 A;  4PHT A;  1NY8 A;  3K6R A;  3GR1 A;  2D7V A;  3GKU A;  2PN2 A;  4FUT A;  3G7S A;  1QM4 A;  3A9V A;  4OXI A;  5IWA C;  2DPL A;  1YJ7 A;  3LAX A;  2VZE A;  5T8S A;  4NXM C;  4BC7 A;  4DV1 C;  4LFA C;  3C5E A;  3TR3 A;  5K8F A;  4PUI A;  1P4E A;  1UWD A;  4L4Q A;  4X65 C;  1TH5 A;  4FTF A;  3J81 D;  4DG9 A;  5ADZ A;  2Y4O A;  3E7W A;  2QW0 X;  3UZ0 A;  5GTD A;  1XHJ A;  1USP B;  4YHH C;  4MH4 A;  3I07 A;  2QVZ X;  4DV0 C;  4B3S C;  4JI2 C;  2E0G A;  4DG8 A;  3TQI A;  4D56 A;  1N2F A;  3VNS A;  4X64 C;  1WF3 A;  4IR7 A;  2UXB C;  2E8E A;  1MXB A;  1MXC A;  2E5L C;  2UU9 C;  3IML A;  2ZZN A;  5BUQ A;  4DV2 C;  2DYJ A;  2ZZM A;  4K0B A;  2P20 A;  4GS5 A;  4JI6 C;  1XRC A;  2DHM A;  3R9X A;  4LF4 C;  4JI8 C;  4BBY A;  5CZX A;  1M6X A;  4KTV A;  1T5H X;  3CW9 A;  1N36 C;  2D27 A;  4DR5 C;  5LCI A;  1I94 C;  2AYA A;  1LQL A;  3KXW A;  4PUH A;  3FCE A;  1IBL C;  1ML8 A;  3NI2 A;  3UX3 A;  4D4G A;  2NCL A;  3NYR A;  4LF6 C;  1GPM A;  3S82 A;  4PRO C;  4LF5 C;  4JYA C;  3PRO C;  2ONF A;  2VQF C;  3T1Y C;  4NDN A;  2OPL A;  5CZV A;  2UUC C;  4JV5 C;  4GXR A;  2JNV A;  1HNZ C;  3UX2 A;  5KYV A;  3TDE A;  1WH9 A;  4D57 A;  4JI7 C;  2ASB A;  1FUG A;  1L2F A;  1V60 A;  3GPC A;  4LF7 C;  2QVX X;  4RLF A;  2D1R A;  1UKK A;  5BR8 C;  2PT7 G;  2HHH C;  3PBK A;  2UXD C;  4RVN A;  1EGA A;  3LUS A;  3LGX A;  4PZP A;  4YY3 C;  2P2J A;  3UOW A;  5BSV A;  3IPL A;  3L95 X;  5BSU A;  1VLA A;  5JRH A;  4IZ6 A;  2BH1 X;  2MM9 A;  3EQ6 A;  3AY0 A;  5E7Q A;  4DCT A;  2KZF A;  4PUG A;  2P2Q A;  4DR2 C;  4B3R C;  2ATW A;  2Z51 A;  1FJG C;  1XRA A;  1PG4 A;  2PRO A;  4RM2 A;  5A19 A;  4XX2 A;  2BJO A;  1HH2 P;  4R0M A;  2D1S A;  1MKY A;  4DV3 C;  4TPS B;  2D28 C;  4JI0 C;  1N34 C;  3JAM D;  1JOS A;  1XNR C;  3DHV A;  1IBM C;  3NYQ A;  2OBV A;  1AMU A;  4FUQ A;  1O9T A;  2MCQ A;  1XMQ C;  4L7I A;  1P7L A;  5A2Q D;  1N33 C;  5BUR A;  3RG2 A;  1XMO C;  2M5H A;  3O2E A;  3LNV A;  4L2Z A;  4WS9 A;  2JMP A;  4KTT A; 
#chains in the Genus database with same CATH homology
 4GKK C;  5A1G A;  1PG3 A;  1T5D X;  2EGT A;  5KYT A;  5A1I A;  5IT9 D;  2P02 A;  4DV7 C;  1BA3 A;  5IFI A;  2CY1 A;  4AQY C;  2XR1 A;  3FCC A;  4U5Y D;  4EAT A;  2CXC A;  5DV9 A;  3R9W A;  1MXA A;  5T8T A;  4NXN C;  2F4V C;  2OPL B;  3ETO A;  4I9F A;  2Y4N A;  3VNR A;  2D1Q A;  4G36 A;  2YCB A;  1N32 C;  4R1M A;  1NYE A;  2WP0 C;  1O93 A;  3SO4 A;  4OX9 C;  5LMN C;  4LFC C;  4WV3 A;  4ISB A;  5FLX D;  4X66 C;  1V26 A;  2WD9 A;  3EER A;  5LMU C;  1XNQ C;  2UXC C;  5BSR A;  2UUB C;  3T1H C;  4G37 A;  4X62 C;  4DR7 C;  4G1I A;  4DR4 C;  3B7W A;  2E8F A;  3H2T A;  1ULT A;  4RM3 A;  4DR6 C;  3N54 B;  2HJG A;  5K85 A;  4LF8 C;  1ZB8 A;  2QL8 A;  4DUZ C;  1XRB A;  2VQE C;  5AE3 A;  4JM1 A;  4RMN A;  3GR0 A;  3OTO C;  4R1L A;  4BSZ A;  1RG9 A;  4MTN A;  3IEU A;  3NPD A;  4DR3 C;  4DR1 C;  5BUS A;  1O92 A;  3TUF A;  4DCU A;  1MD9 A;  2QVY X;  1HNX C;  1KKG A;  2P2B A;  4DCS A;  4D4I A;  5BST A;  1LCI A;  2P2M A;  3AF6 A;  4DUY C;  3AF5 A;  2UUA C;  3CW8 X;  3L8C A;  2ZM6 C;  1MDF A;  1IBK C;  4GXQ A;  4ODJ A;  4ZLP A;  1J5E C;  2YWB A;  5AE1 A;  1USP A;  4B3M C;  3VNQ A;  1RY2 A;  3RV2 A;  4B3T C;  3E7X A;  1HR0 C;  2OO4 A;  3R44 A;  1V25 A;  3IEV A;  2YWC A;  3CJE A;  4ZJZ A;  4LFB C;  4GKJ C;  2V7B A;  5KEI A;  3A4I A;  3DLP X;  3ETC A;  1PA4 A;  4KHP C;  2VSQ A;  4JI5 C;  2P2F A;  4DV4 C;  1QWI A;  3N2Q A;  4JI1 C;  2D1T A;  3DAY A;  3A9U A;  5BSW A;  4K0K C;  3PES A;  4JI3 C;  4LF9 C;  4I9G A;  1HNW C;  4OYC A;  1ZB9 A;  4NOZ A;  5H9U A;  4DCV A;  2E8C A;  4LE5 A;  4RVO A;  4BC9 A;  4JI4 C;  3I08 A;  4BCA A;  5BSM A;  3J80 D;  4DV6 C;  1O90 A;  5AE2 A;  2E7G A;  2Y27 A;  4DV5 C;  1K0R A;  4HPV A;  1MDB A;  4RLQ A;  4PHT A;  3GR1 A;  2D7V A;  3GKU A;  2PN2 A;  4FUT A;  3G7S A;  1QM4 A;  3A9V A;  4OXI A;  5IWA C;  2DPL A;  1YJ7 A;  3LAX A;  2VZE A;  5T8S A;  4NXM C;  4BC7 A;  4DV1 C;  4LFA C;  3C5E A;  5K8F A;  4L4Q A;  4X65 C;  4FTF A;  3J81 D;  4DG9 A;  5ADZ A;  2Y4O A;  3E7W A;  2QW0 X;  3UZ0 A;  5GTD A;  1USP B;  4YHH C;  4MH4 A;  3I07 A;  2QVZ X;  4DV0 C;  4B3S C;  4JI2 C;  2E0G A;  4DG8 A;  3TQI A;  4D56 A;  1N2F A;  3VNS A;  4X64 C;  1WF3 A;  4IR7 A;  2UXB C;  2E8E A;  1MXB A;  1MXC A;  2E5L C;  2UU9 C;  3IML A;  5BUQ A;  4DV2 C;  2DYJ A;  4K0B A;  2P20 A;  4GS5 A;  4JI6 C;  1XRC A;  3R9X A;  4LF4 C;  4JI8 C;  4BBY A;  5CZX A;  4KTV A;  1T5H X;  3CW9 A;  1N36 C;  2D27 A;  4DR5 C;  1I94 C;  2AYA A;  1LQL A;  3KXW A;  3FCE A;  1IBL C;  1ML8 A;  3NI2 A;  4D4G A;  3NYR A;  4LF6 C;  1GPM A;  3S82 A;  4PRO C;  4LF5 C;  4JYA C;  3PRO C;  2ONF A;  2VQF C;  3T1Y C;  4NDN A;  2OPL A;  5CZV A;  2UUC C;  4JV5 C;  4GXR A;  1HNZ C;  5KYV A;  3TDE A;  1WH9 A;  4D57 A;  4JI7 C;  2ASB A;  1FUG A;  1L2F A;  4LF7 C;  3GPC A;  2QVX X;  4RLF A;  2D1R A;  1UKK A;  5BR8 C;  2PT7 G;  2HHH C;  3PBK A;  2UXD C;  4RVN A;  1EGA A;  3LUS A;  3LGX A;  4PZP A;  4YY3 C;  2P2J A;  3UOW A;  5BSV A;  3IPL A;  3L95 X;  5BSU A;  1VLA A;  5JRH A;  4IZ6 A;  2BH1 X;  3EQ6 A;  5E7Q A;  4DCT A;  2KZF A;  2P2Q A;  4DR2 C;  4B3R C;  2ATW A;  1FJG C;  1XRA A;  1PG4 A;  2PRO A;  4RM2 A;  5A19 A;  4XX2 A;  2BJO A;  1HH2 P;  4R0M A;  2D1S A;  1MKY A;  4DV3 C;  4TPS B;  2D28 C;  4JI0 C;  1N34 C;  3JAM D;  1JOS A;  1XNR C;  3DHV A;  1IBM C;  3NYQ A;  2OBV A;  1AMU A;  4FUQ A;  1O9T A;  1XMQ C;  4L7I A;  1P7L A;  5A2Q D;  1N33 C;  5BUR A;  3RG2 A;  1XMO C;  3LNV A;  4L2Z A;  4WS9 A;  2JMP A;  4KTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...