1WH9A

Solution structure of the kh domain of human ribosomal protein s3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
GSSGSSGFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the KH domain of human ribosomal protein S3
rcsb
source organism Homo sapiens
molecule tags Ribosome
molecule keywords 40S ribosomal protein S3
total genus 22
structure length 92
sequence length 92
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1wh9A01
1XNQC 2E8CA 2UUBC 4B3SC 1XNRC 4DUZC 4X62C 4DR7C 4LFBC 4DR1C 4LF9C 1K0RA 4JI4C 2OPLA 3J81D 4JI6C 4LF6C 3AF5A 2UXDC 1N34C 1ZB8A 1UKKA 4NOZA 5LMNC 4DR3C 5IT9D 1ZB9A 4JI8C 1WH9A 4XX2A 2F4VC 3J80D 1ML8A 1I94C 3OTOC 4DUYC 1USPA 4NXMC 4DCUA 1IBLC 2E5LC 1XMOC 4DCTA 4JI2C 4KHPC 3GKUA 4OX9C 2EGTA 4DV3C 4DR4C 1N33C 1HR0C 4JV5C 1NYEA 2CY1A 1HNZC 4DV0C 4DV1C 5BR8C 4DV5C 3EERA 1HNWC 4B3MC 2VQEC 5FLXD 2QL8A 4JI5C 4LF8C 4JI1C 2KZFA 3T1HC 3LUSA 1MKYA 1IBKC 1WF3A 2DYJA 4DV6C 1JOSA 1N32C 2BJOA 1EGAA 3CJEA 1N36C 1IBMC 2ONFA 1FJGC 4DR6C 4YY3C 3AF6A 2UU9C 3I07A 3T1YC 1L2FA 2E7GA 4K0KC 2ASBA 4LF4C 3R9XA 2D7VA 4X66C 2UUCC 4DV2C 5IWAC 4MH4A 2VQFC 1USPB 1KKGA 4MTNA 4DR5C 1VLAA 4JI7C 3JAMD 2PN2A 4DCSA 4LF7C 2ATWA 4X65C 1HNXC 4B3RC 2UXCC 2UXBC 4LFAC 2E8EA 4DR2C 2XR1A 1XMQC 4DV4C 5LMUC 4JYAC 2YCBA 1PA4A 5A2QD 4LFCC 3R9WA 4JI0C 1QWIA 2PT7G 3IEUA 2CXCA 2HJGA 2JMPA 4BSZA 2HHHC 4LF5C 2UUAC 4NXNC 4AQYC 1LQLA 4YHHC 3IEVA 4GKKC 2OPLB 4X64C 1J5EC 2E8FA 4DCVA 4B3TC 1N2FA 2ZM6C 4GKJC 1HH2P 4JI3C 4DV7C
chains in the Genus database with same CATH superfamily
4B3SC 5LCIA 4DUZC 3FCCA 4DR1C 2P2JA 3A25A 3TUFA 1N34C 1P4EA 4DG8A 4ZJZA 5A1GA 2M5HA 4D56A 5BSVA 1RG9A 5AE1A 1I94C 4EATA 1USPA 4DCUA 1IBLC 4RM2A 2E5LC 2P20A 3IMLA 5IFIA 4DCTA 4JI2C 1P4EC 2AYAA 1HR0C 2Y27A 4BBYA 2QVZX 4DV5C 1HNWC 1O9TA 4BC9A 3LNVA 5BURA 2QL8A 4PUIA 1XHJA 3LUSA 1MKYA 4U5YD 1N32C 4DV6C 2DHMA 4I9GA 1NY8A 3I07A 3FCEA 2MCQA 1L2FA 1PU1A 2ASBA 2D7VA 1MXCA 1BA3A 2VQFC 5ADZA 1KKGA 4FUQA 4OXIA 2PN2A 2ATWA 4X65C 1V26A 5KYTA 2UXBC 4D4IA 4LFAC 4DR2C 2XR1A 4DV4C 3TDEA 4LFCC 3R9WA 1QWIA 4LF5C 2CXCA 2HJGA 5E7QA 4GKKC 2JNVA 1MD9A 3IEVA 4YHHC 1RY2A 2D1SA 2E8FA 1N2FA 2ZM6C 1M6XC 3C5EA 4G1IA 1LCIA 2E8CA 2WP0C 1MDBA 3PESA 4X62C 4DR7C 3NYRA 3UX3A 3AF5A 3CQ1A 1ZB8A 4R0MA 2BH1X 2KZ0A 1WH9A 1XRCA 3LAXA 4NXMC 2ZZNA 2QVYX 3UOWA 1XMOC 2YX1A 2ZZMA 4G37A 3DAYA 4OX9C 5KEIA 1NYEA 4RLFA 1HNZC 5GTDA 3A9VA 5BR8C 3EERA 3RG2A 4WS9A 1PG4A 3DHVA 4RM3A 4LF8C 4JI1C 2KZFA 3LNOA 2Z51A 1AMUA 4GXQA 1WF3A 2DYJA 1TH5A 4RVNA 3VNRA 1EGAA 1O90A 1IBMC 3AF6A 3NI2A 4RLQA 3UX2A 3R9XA 4L4QA 3AY0A 3NYQA 2VZEA 4JM1A 1VEHA 1VLAA 4PROC 1XMQC 1PA4A 4NDNA 5A2QD 4RVOA 2HHHC 2JMPA 2UUAC 3L8CA 2OPLB 4X64C 1J5EC 4DCVA 1M6XA 2V7BA 1XNQC 3CW9A 4KTVA 5CZXA 1PG3A 1XNRC 2D1RA 5JRHA 1T5HX 2VSQA 3EQ6A 4LFBC 2D1QA 2P2MA 1K0RA 3J81D 1QM4A 4NOZA 1YJ7A 3K6RA 3PBKA 5LMNC 5IT9D 2D27A 5A19A 2CU6A 2OBVA 3IPLA 4LE5A 2F4VC 4D57A 3J80D 1ML8A 5BUSA 3GR1A 3OTOC 4RMNA 2OO4A 1MXAA 4KHPC 5BUQA 2QW0X 5BSUA 3ETOA 3O2EA 1FUGA 2EGTA 4DV3C 3CW8X 5K85A 4IZ6A 4DG9A 2WD9A 3R44A 4DV1C 5H9UA 4B3MC 2VQEC 3PROC 5T8SA 4JI5C 4R1LA 3A26A 2E0GA 4FTFA 2BJOA 1ULTA 4TPSB 2ONFA 1FJGC 3T1YC 4PUHA 2E7GA 1XS3A 2Y4OA 4LF4C 3S82A 3NPDA 1UWDA 4X66C 2UUCC 1WCJA 3ETCA 4DV2C 4MH4A 4L7IA 3KXWA 1USPB 2D1TA 4ODJA 4MTNA 3JAMD 3RV2A 4LF7C 5BSRA 1HNXC 2PROA 4B3RC 2UXCC 2P02A 2MM9A 3GPCA 5LMUC 4PHTA 4KTTA 5BSMA 4GXRA 4D4GA 4JYAC 2YCBA 2YWCA 2M5OA 5CZVA 1LQLA 3VNSA 3G7SA 4GKJC 4BCAA 3A9UA 5A1IA 1O92A 1XRAA 2UUBC 4K0BA 4LF9C 4JI4C 2OPLA 4JI6C 4LF6C 3TQIA 2UXDC 1UKKA 4DR3C 1MDFA 4PUGA 3UZ0A 4BC7A 1ZB9A 4JI8C 2NCLA 4XX2A 2QVXX 4DUYC 3LGXA 3GR0A 1IB8A 3CQ2A 3N54B 3GKUA 2Y4NA 4ISBA 5K8FA 3CQ3A 4DR4C 1N33C 4JV5C 2CY1A 3UEBA 4DV0C 1O93A 3E7XA 5KYVA 4G36A 5FLXD 1XRBA 3I08A 1P7LA 3T1HC 3H2TA 3TR3A 4ZLPA 2P2FA 3B7WA 1IBKC 1JOSA 2DPLA 1MXBA 4OYCA 4L2ZA 1T5DX 3CJEA 3E7WA 1N36C 5BSWA 4DR6C 1V60A 4YY3C 2UU9C 4PZPA 4R1MA 3DLPX 4K0KC 4I9FA 5AE3A 3A4IA 4FUTA 4WV3A 5IWAC 2P2QA 2YWBA 1FLOA 4DR5C 4GS5A 4JI7C 4DCSA 1V25A 3L95X 3N2QA 2P2BA 2E8EA 5AE2A 5DV9A 5T8TA 1GPMA 3SO4A 2MMAB 4JI0C 2PT7G 4BSZA 3IEUA 3VNQA 4NXNC 4HPVA 4AQYC 4IR7A 5BSTA 4B3TC 2KDNA 1HH2P 2D28C 4JI3C 4DV7C
chains in the Genus database with same CATH topology
4B3SC 4DUZC 3FCCA 4DR1C 2P2JA 3TUFA 1N34C 4DG8A 4ZJZA 5A1GA 4D56A 5BSVA 1RG9A 5AE1A 1I94C 4EATA 1USPA 4DCUA 1IBLC 4RM2A 2E5LC 2P20A 3IMLA 5IFIA 4DCTA 4JI2C 2AYAA 1HR0C 2Y27A 4BBYA 2QVZX 4DV5C 1HNWC 1O9TA 4BC9A 3LNVA 5BURA 2QL8A 3LUSA 1MKYA 4U5YD 1N32C 4DV6C 4I9GA 3I07A 3FCEA 1L2FA 2ASBA 2D7VA 1MXCA 1BA3A 2VQFC 5ADZA 1KKGA 4FUQA 4OXIA 2PN2A 2ATWA 4X65C 1V26A 5KYTA 2UXBC 4D4IA 4LFAC 4DR2C 2XR1A 4DV4C 3TDEA 4LFCC 3R9WA 1QWIA 4LF5C 2CXCA 2HJGA 5E7QA 4GKKC 1MD9A 3IEVA 4YHHC 1RY2A 2D1SA 2E8FA 1N2FA 2ZM6C 3C5EA 4G1IA 1LCIA 2E8CA 2WP0C 1MDBA 3PESA 4X62C 4DR7C 3NYRA 3AF5A 1ZB8A 4R0MA 2BH1X 1WH9A 1XRCA 3LAXA 4NXMC 2QVYX 3UOWA 1XMOC 4G37A 3DAYA 4OX9C 5KEIA 1NYEA 4RLFA 1HNZC 5GTDA 3A9VA 5BR8C 3EERA 3RG2A 4WS9A 1PG4A 3DHVA 4RM3A 4LF8C 4JI1C 2KZFA 1AMUA 4GXQA 1WF3A 2DYJA 4RVNA 3VNRA 1EGAA 1O90A 1IBMC 3AF6A 3NI2A 4RLQA 3R9XA 4L4QA 3NYQA 2VZEA 4JM1A 1VLAA 4PROC 1XMQC 1PA4A 4NDNA 5A2QD 4RVOA 2HHHC 2JMPA 2UUAC 3L8CA 2OPLB 4X64C 1J5EC 4DCVA 2V7BA 1XNQC 3CW9A 4KTVA 5CZXA 1PG3A 1XNRC 2D1RA 5JRHA 1T5HX 2VSQA 3EQ6A 4LFBC 2D1QA 2P2MA 1K0RA 3J81D 1QM4A 4NOZA 1YJ7A 3PBKA 5LMNC 5IT9D 2D27A 5A19A 2OBVA 3IPLA 4LE5A 2F4VC 4D57A 3J80D 1ML8A 5BUSA 3GR1A 3OTOC 4RMNA 2OO4A 1MXAA 4KHPC 5BUQA 2QW0X 5BSUA 3ETOA 1FUGA 2EGTA 4DV3C 3CW8X 5K85A 4IZ6A 4DG9A 2WD9A 3R44A 4DV1C 5H9UA 4B3MC 2VQEC 3PROC 5T8SA 4JI5C 4R1LA 2E0GA 4FTFA 2BJOA 1ULTA 4TPSB 2ONFA 1FJGC 3T1YC 2E7GA 2Y4OA 4LF4C 3S82A 3NPDA 4X66C 2UUCC 3ETCA 4DV2C 4MH4A 4L7IA 3KXWA 1USPB 2D1TA 4ODJA 4MTNA 3JAMD 3RV2A 4LF7C 5BSRA 1HNXC 2PROA 4B3RC 2UXCC 2P02A 3GPCA 5LMUC 4PHTA 4KTTA 5BSMA 4GXRA 4D4GA 4JYAC 2YCBA 2YWCA 5CZVA 1LQLA 3VNSA 3G7SA 4GKJC 4BCAA 3A9UA 5A1IA 1O92A 1XRAA 2UUBC 4K0BA 4LF9C 4JI4C 2OPLA 4JI6C 4LF6C 3TQIA 2UXDC 1UKKA 4DR3C 1MDFA 3UZ0A 4BC7A 1ZB9A 4JI8C 4XX2A 2QVXX 4DUYC 3LGXA 3GR0A 3N54B 3GKUA 2Y4NA 4ISBA 5K8FA 4DR4C 1N33C 4JV5C 2CY1A 4DV0C 1O93A 3E7XA 5KYVA 4G36A 5FLXD 1XRBA 3I08A 1P7LA 3T1HC 3H2TA 4ZLPA 2P2FA 3B7WA 1IBKC 1JOSA 2DPLA 1MXBA 4OYCA 4L2ZA 1T5DX 3CJEA 3E7WA 1N36C 5BSWA 4DR6C 4YY3C 2UU9C 4PZPA 4R1MA 3DLPX 4K0KC 4I9FA 5AE3A 3A4IA 4FUTA 4WV3A 5IWAC 2P2QA 2YWBA 4DR5C 4GS5A 4JI7C 4DCSA 1V25A 3L95X 3N2QA 2P2BA 2E8EA 5AE2A 5DV9A 5T8TA 1GPMA 3SO4A 4JI0C 2PT7G 4NXNC 4BSZA 3IEUA 3VNQA 4HPVA 4AQYC 4IR7A 5BSTA 4B3TC 1HH2P 2D28C 4JI3C 4DV7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ C;  2E8C A;  2UUB C;  4B3S C;  1XNR C;  4DUZ C;  4X62 C;  4DR7 C;  4LFB C;  4DR1 C;  4LF9 C;  1K0R A;  4JI4 C;  2OPL A;  3J81 D;  4JI6 C;  4LF6 C;  3AF5 A;  2UXD C;  1N34 C;  1ZB8 A;  1UKK A;  4NOZ A;  5LMN C;  4DR3 C;  5IT9 D;  1ZB9 A;  4JI8 C;  1WH9 A;  4XX2 A;  2F4V C;  3J80 D;  1ML8 A;  1I94 C;  3OTO C;  4DUY C;  1USP A;  4NXM C;  4DCU A;  1IBL C;  2E5L C;  1XMO C;  4DCT A;  4JI2 C;  4KHP C;  3GKU A;  4OX9 C;  2EGT A;  4DV3 C;  4DR4 C;  1N33 C;  1HR0 C;  4JV5 C;  1NYE A;  2CY1 A;  1HNZ C;  4DV0 C;  4DV1 C;  5BR8 C;  4DV5 C;  3EER A;  1HNW C;  4B3M C;  2VQE C;  5FLX D;  2QL8 A;  4JI5 C;  4LF8 C;  4JI1 C;  2KZF A;  3T1H C;  3LUS A;  1MKY A;  1IBK C;  1WF3 A;  2DYJ A;  4DV6 C;  1JOS A;  1N32 C;  2BJO A;  1EGA A;  3CJE A;  1N36 C;  1IBM C;  2ONF A;  1FJG C;  4DR6 C;  4YY3 C;  3AF6 A;  2UU9 C;  3I07 A;  3T1Y C;  1L2F A;  2E7G A;  4K0K C;  2ASB A;  4LF4 C;  3R9X A;  2D7V A;  4X66 C;  2UUC C;  4DV2 C;  5IWA C;  4MH4 A;  2VQF C;  1USP B;  1KKG A;  4MTN A;  4DR5 C;  1VLA A;  4JI7 C;  3JAM D;  2PN2 A;  4DCS A;  4LF7 C;  2ATW A;  4X65 C;  1HNX C;  4B3R C;  2UXC C;  2UXB C;  4LFA C;  2E8E A;  4DR2 C;  2XR1 A;  1XMQ C;  4DV4 C;  5LMU C;  4JYA C;  2YCB A;  1PA4 A;  5A2Q D;  4LFC C;  3R9W A;  4JI0 C;  1QWI A;  2PT7 G;  3IEU A;  2CXC A;  2HJG A;  2JMP A;  4BSZ A;  2HHH C;  4LF5 C;  2UUA C;  4NXN C;  4AQY C;  1LQL A;  4YHH C;  3IEV A;  4GKK C;  2OPL B;  4X64 C;  1J5E C;  2E8F A;  4DCV A;  4B3T C;  1N2F A;  2ZM6 C;  4GKJ C;  1HH2 P;  4JI3 C;  4DV7 C; 
#chains in the Genus database with same CATH topology
 4B3S C;  5LCI A;  4DUZ C;  3FCC A;  4DR1 C;  2P2J A;  3A25 A;  3TUF A;  1N34 C;  1P4E A;  4DG8 A;  4ZJZ A;  5A1G A;  2M5H A;  4D56 A;  5BSV A;  1RG9 A;  5AE1 A;  1I94 C;  4EAT A;  1USP A;  4DCU A;  1IBL C;  4RM2 A;  2E5L C;  2P20 A;  3IML A;  5IFI A;  4DCT A;  4JI2 C;  1P4E C;  2AYA A;  1HR0 C;  2Y27 A;  4BBY A;  2QVZ X;  4DV5 C;  1HNW C;  1O9T A;  4BC9 A;  3LNV A;  5BUR A;  2QL8 A;  4PUI A;  1XHJ A;  3LUS A;  1MKY A;  4U5Y D;  1N32 C;  4DV6 C;  2DHM A;  4I9G A;  1NY8 A;  3I07 A;  3FCE A;  2MCQ A;  1L2F A;  1PU1 A;  2ASB A;  2D7V A;  1MXC A;  1BA3 A;  2VQF C;  5ADZ A;  1KKG A;  4FUQ A;  4OXI A;  2PN2 A;  2ATW A;  4X65 C;  1V26 A;  5KYT A;  2UXB C;  4D4I A;  4LFA C;  4DR2 C;  2XR1 A;  4DV4 C;  3TDE A;  4LFC C;  3R9W A;  1QWI A;  4LF5 C;  2CXC A;  2HJG A;  5E7Q A;  4GKK C;  2JNV A;  1MD9 A;  3IEV A;  4YHH C;  1RY2 A;  2D1S A;  2E8F A;  1N2F A;  2ZM6 C;  1M6X C;  3C5E A;  4G1I A;  1LCI A;  2E8C A;  2WP0 C;  1MDB A;  3PES A;  4X62 C;  4DR7 C;  3NYR A;  3UX3 A;  3AF5 A;  3CQ1 A;  1ZB8 A;  4R0M A;  2BH1 X;  2KZ0 A;  1WH9 A;  1XRC A;  3LAX A;  4NXM C;  2ZZN A;  2QVY X;  3UOW A;  1XMO C;  2YX1 A;  2ZZM A;  4G37 A;  3DAY A;  4OX9 C;  5KEI A;  1NYE A;  4RLF A;  1HNZ C;  5GTD A;  3A9V A;  5BR8 C;  3EER A;  3RG2 A;  4WS9 A;  1PG4 A;  3DHV A;  4RM3 A;  4LF8 C;  4JI1 C;  2KZF A;  3LNO A;  2Z51 A;  1AMU A;  4GXQ A;  1WF3 A;  2DYJ A;  1TH5 A;  4RVN A;  3VNR A;  1EGA A;  1O90 A;  1IBM C;  3AF6 A;  3NI2 A;  4RLQ A;  3UX2 A;  3R9X A;  4L4Q A;  3AY0 A;  3NYQ A;  2VZE A;  4JM1 A;  1VEH A;  1VLA A;  4PRO C;  1XMQ C;  1PA4 A;  4NDN A;  5A2Q D;  4RVO A;  2HHH C;  2JMP A;  2UUA C;  3L8C A;  2OPL B;  4X64 C;  1J5E C;  4DCV A;  1M6X A;  2V7B A;  1XNQ C;  3CW9 A;  4KTV A;  5CZX A;  1PG3 A;  1XNR C;  2D1R A;  5JRH A;  1T5H X;  2VSQ A;  3EQ6 A;  4LFB C;  2D1Q A;  2P2M A;  1K0R A;  3J81 D;  1QM4 A;  4NOZ A;  1YJ7 A;  3K6R A;  3PBK A;  5LMN C;  5IT9 D;  2D27 A;  5A19 A;  2CU6 A;  2OBV A;  3IPL A;  4LE5 A;  2F4V C;  4D57 A;  3J80 D;  1ML8 A;  5BUS A;  3GR1 A;  3OTO C;  4RMN A;  2OO4 A;  1MXA A;  4KHP C;  5BUQ A;  2QW0 X;  5BSU A;  3ETO A;  3O2E A;  1FUG A;  2EGT A;  4DV3 C;  3CW8 X;  5K85 A;  4IZ6 A;  4DG9 A;  2WD9 A;  3R44 A;  4DV1 C;  5H9U A;  4B3M C;  2VQE C;  3PRO C;  5T8S A;  4JI5 C;  4R1L A;  3A26 A;  2E0G A;  4FTF A;  2BJO A;  1ULT A;  4TPS B;  2ONF A;  1FJG C;  3T1Y C;  4PUH A;  2E7G A;  1XS3 A;  2Y4O A;  4LF4 C;  3S82 A;  3NPD A;  1UWD A;  4X66 C;  2UUC C;  1WCJ A;  3ETC A;  4DV2 C;  4MH4 A;  4L7I A;  3KXW A;  1USP B;  2D1T A;  4ODJ A;  4MTN A;  3JAM D;  3RV2 A;  4LF7 C;  5BSR A;  1HNX C;  2PRO A;  4B3R C;  2UXC C;  2P02 A;  2MM9 A;  3GPC A;  5LMU C;  4PHT A;  4KTT A;  5BSM A;  4GXR A;  4D4G A;  4JYA C;  2YCB A;  2YWC A;  2M5O A;  5CZV A;  1LQL A;  3VNS A;  3G7S A;  4GKJ C;  4BCA A;  3A9U A;  5A1I A;  1O92 A;  1XRA A;  2UUB C;  4K0B A;  4LF9 C;  4JI4 C;  2OPL A;  4JI6 C;  4LF6 C;  3TQI A;  2UXD C;  1UKK A;  4DR3 C;  1MDF A;  4PUG A;  3UZ0 A;  4BC7 A;  1ZB9 A;  4JI8 C;  2NCL A;  4XX2 A;  2QVX X;  4DUY C;  3LGX A;  3GR0 A;  1IB8 A;  3CQ2 A;  3N54 B;  3GKU A;  2Y4N A;  4ISB A;  5K8F A;  3CQ3 A;  4DR4 C;  1N33 C;  4JV5 C;  2CY1 A;  3UEB A;  4DV0 C;  1O93 A;  3E7X A;  5KYV A;  4G36 A;  5FLX D;  1XRB A;  3I08 A;  1P7L A;  3T1H C;  3H2T A;  3TR3 A;  4ZLP A;  2P2F A;  3B7W A;  1IBK C;  1JOS A;  2DPL A;  1MXB A;  4OYC A;  4L2Z A;  1T5D X;  3CJE A;  3E7W A;  1N36 C;  5BSW A;  4DR6 C;  1V60 A;  4YY3 C;  2UU9 C;  4PZP A;  4R1M A;  3DLP X;  4K0K C;  4I9F A;  5AE3 A;  3A4I A;  4FUT A;  4WV3 A;  5IWA C;  2P2Q A;  2YWB A;  1FLO A;  4DR5 C;  4GS5 A;  4JI7 C;  4DCS A;  1V25 A;  3L95 X;  3N2Q A;  2P2B A;  2E8E A;  5AE2 A;  5DV9 A;  5T8T A;  1GPM A;  3SO4 A;  2MMA B;  4JI0 C;  2PT7 G;  4BSZ A;  3IEU A;  3VNQ A;  4NXN C;  4HPV A;  4AQY C;  4IR7 A;  5BST A;  4B3T C;  2KDN A;  1HH2 P;  2D28 C;  4JI3 C;  4DV7 C; 
#chains in the Genus database with same CATH homology
 4B3S C;  4DUZ C;  3FCC A;  4DR1 C;  2P2J A;  3TUF A;  1N34 C;  4DG8 A;  4ZJZ A;  5A1G A;  4D56 A;  5BSV A;  1RG9 A;  5AE1 A;  1I94 C;  4EAT A;  1USP A;  4DCU A;  1IBL C;  4RM2 A;  2E5L C;  2P20 A;  3IML A;  5IFI A;  4DCT A;  4JI2 C;  2AYA A;  1HR0 C;  2Y27 A;  4BBY A;  2QVZ X;  4DV5 C;  1HNW C;  1O9T A;  4BC9 A;  3LNV A;  5BUR A;  2QL8 A;  3LUS A;  1MKY A;  4U5Y D;  1N32 C;  4DV6 C;  4I9G A;  3I07 A;  3FCE A;  1L2F A;  2ASB A;  2D7V A;  1MXC A;  1BA3 A;  2VQF C;  5ADZ A;  1KKG A;  4FUQ A;  4OXI A;  2PN2 A;  2ATW A;  4X65 C;  1V26 A;  5KYT A;  2UXB C;  4D4I A;  4LFA C;  4DR2 C;  2XR1 A;  4DV4 C;  3TDE A;  4LFC C;  3R9W A;  1QWI A;  4LF5 C;  2CXC A;  2HJG A;  5E7Q A;  4GKK C;  1MD9 A;  3IEV A;  4YHH C;  1RY2 A;  2D1S A;  2E8F A;  1N2F A;  2ZM6 C;  3C5E A;  4G1I A;  1LCI A;  2E8C A;  2WP0 C;  1MDB A;  3PES A;  4X62 C;  4DR7 C;  3NYR A;  3AF5 A;  1ZB8 A;  4R0M A;  2BH1 X;  1WH9 A;  1XRC A;  3LAX A;  4NXM C;  2QVY X;  3UOW A;  1XMO C;  4G37 A;  3DAY A;  4OX9 C;  5KEI A;  1NYE A;  4RLF A;  1HNZ C;  5GTD A;  3A9V A;  5BR8 C;  3EER A;  3RG2 A;  4WS9 A;  1PG4 A;  3DHV A;  4RM3 A;  4LF8 C;  4JI1 C;  2KZF A;  1AMU A;  4GXQ A;  1WF3 A;  2DYJ A;  4RVN A;  3VNR A;  1EGA A;  1O90 A;  1IBM C;  3AF6 A;  3NI2 A;  4RLQ A;  3R9X A;  4L4Q A;  3NYQ A;  2VZE A;  4JM1 A;  1VLA A;  4PRO C;  1XMQ C;  1PA4 A;  4NDN A;  5A2Q D;  4RVO A;  2HHH C;  2JMP A;  2UUA C;  3L8C A;  2OPL B;  4X64 C;  1J5E C;  4DCV A;  2V7B A;  1XNQ C;  3CW9 A;  4KTV A;  5CZX A;  1PG3 A;  1XNR C;  2D1R A;  5JRH A;  1T5H X;  2VSQ A;  3EQ6 A;  4LFB C;  2D1Q A;  2P2M A;  1K0R A;  3J81 D;  1QM4 A;  4NOZ A;  1YJ7 A;  3PBK A;  5LMN C;  5IT9 D;  2D27 A;  5A19 A;  2OBV A;  3IPL A;  4LE5 A;  2F4V C;  4D57 A;  3J80 D;  1ML8 A;  5BUS A;  3GR1 A;  3OTO C;  4RMN A;  2OO4 A;  1MXA A;  4KHP C;  5BUQ A;  2QW0 X;  5BSU A;  3ETO A;  1FUG A;  2EGT A;  4DV3 C;  3CW8 X;  5K85 A;  4IZ6 A;  4DG9 A;  2WD9 A;  3R44 A;  4DV1 C;  5H9U A;  4B3M C;  2VQE C;  3PRO C;  5T8S A;  4JI5 C;  4R1L A;  2E0G A;  4FTF A;  2BJO A;  1ULT A;  4TPS B;  2ONF A;  1FJG C;  3T1Y C;  2E7G A;  2Y4O A;  4LF4 C;  3S82 A;  3NPD A;  4X66 C;  2UUC C;  3ETC A;  4DV2 C;  4MH4 A;  4L7I A;  3KXW A;  1USP B;  2D1T A;  4ODJ A;  4MTN A;  3JAM D;  3RV2 A;  4LF7 C;  5BSR A;  1HNX C;  2PRO A;  4B3R C;  2UXC C;  2P02 A;  3GPC A;  5LMU C;  4PHT A;  4KTT A;  5BSM A;  4GXR A;  4D4G A;  4JYA C;  2YCB A;  2YWC A;  5CZV A;  1LQL A;  3VNS A;  3G7S A;  4GKJ C;  4BCA A;  3A9U A;  5A1I A;  1O92 A;  1XRA A;  2UUB C;  4K0B A;  4LF9 C;  4JI4 C;  2OPL A;  4JI6 C;  4LF6 C;  3TQI A;  2UXD C;  1UKK A;  4DR3 C;  1MDF A;  3UZ0 A;  4BC7 A;  1ZB9 A;  4JI8 C;  4XX2 A;  2QVX X;  4DUY C;  3LGX A;  3GR0 A;  3N54 B;  3GKU A;  2Y4N A;  4ISB A;  5K8F A;  4DR4 C;  1N33 C;  4JV5 C;  2CY1 A;  4DV0 C;  1O93 A;  3E7X A;  5KYV A;  4G36 A;  5FLX D;  1XRB A;  3I08 A;  1P7L A;  3T1H C;  3H2T A;  4ZLP A;  2P2F A;  3B7W A;  1IBK C;  1JOS A;  2DPL A;  1MXB A;  4OYC A;  4L2Z A;  1T5D X;  3CJE A;  3E7W A;  1N36 C;  5BSW A;  4DR6 C;  4YY3 C;  2UU9 C;  4PZP A;  4R1M A;  3DLP X;  4K0K C;  4I9F A;  5AE3 A;  3A4I A;  4FUT A;  4WV3 A;  5IWA C;  2P2Q A;  2YWB A;  4DR5 C;  4GS5 A;  4JI7 C;  4DCS A;  1V25 A;  3L95 X;  3N2Q A;  2P2B A;  2E8E A;  5AE2 A;  5DV9 A;  5T8T A;  1GPM A;  3SO4 A;  4JI0 C;  2PT7 G;  4NXN C;  4BSZ A;  3IEU A;  3VNQ A;  4HPV A;  4AQY C;  4IR7 A;  5BST A;  4B3T C;  1HH2 P;  2D28 C;  4JI3 C;  4DV7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...