1WH9A

Solution structure of the kh domain of human ribosomal protein s3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
GSSGSSGFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 40S ribosomal protein S3
publication title Solution structure of the KH domain of human ribosomal protein S3
rcsb
source organism Homo sapiens
molecule tags Ribosome
total genus 22
structure length 92
sequence length 92
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1wh9A01
2QL8A 4XX2A 4NXMC 4NXNC 2UUCC 2YCBA 1XMOC 2UXCC 3R9XA 4MTNA 1N33C 3JAMD 1JOSA 2PN2A 5FLXD 1NYEA 3IEUA 4DUYC 2CY1A 4DV7C 5IWAC 2VQEC 4DUZC 4LF4C 2UU9C 2ZM6C 2E7GA 4GKJC 1IBKC 1UKKA 2D7VA 1I94C 1ZB8A 2KZFA 4JI4C 2ONFA 1ZB9A 3LUSA 4NOZA 1EGAA 4B3TC 4LF7C 3AF6A 1ML8A 2E8FA 4DV5C 4DV6C 1IBLC 1K0RA 1IBMC 1XNQC 4DR7C 4DCSA 2JMPA 1WH9A 1LQLA 4JV5C 4AQYC 5A2QD 1N2FA 4DCTA 4B3SC 2F4VC 3GKUA 2DYJA 5LMUC 1USPA 2HJGA 4JI5C 5IT9D 1XNRC 4DV1C 2BJOA 2EGTA 2UXBC 2PT7G 4DV3C 4X66C 4X64C 4X65C 2VQFC 4JI7C 1USPB 4OX9C 5LMNC 2E8CA 4JYAC 4DV2C 3T1HC 1HNZC 3AF5A 1QWIA 1XMQC 4X62C 1N36C 4JI2C 4DR6C 2XR1A 4BSZA 4B3MC 3R9WA 4LFCC 4DR4C 2UUBC 4YHHC 4JI3C 4DR1C 4JI1C 3I07A 1N34C 2ASBA 2UXDC 4LF8C 3J80D 4JI8C 3T1YC 2HHHC 2ATWA 4JI0C 1HR0C 4DR5C 1J5EC 1FJGC 3J81D 2E5LC 4K0KC 4JI6C 1VLAA 2E8EA 4LFBC 4DCUA 4DV0C 1WF3A 4MH4A 4KHPC 2OPLA 4DR3C 4DR2C 4LF5C 4LF6C 1HNXC 4LFAC 1L2FA 1N32C 3OTOC 4LF9C 1HH2P 3EERA 2UUAC 3IEVA 4B3RC 5BR8C 1HNWC 4DCVA 1MKYA 2CXCA 4YY3C 4DV4C 1KKGA 2OPLB 4GKKC 1PA4A 3CJEA
chains in the Genus database with same CATH superfamily
4NXMC 4NXNC 1XMOC 2ZZNA 1TH5A 1T5HX 1PU1A 1JOSA 5FLXD 5K8FA 1P7LA 3VNRA 4DUYC 2Y4OA 4KTTA 5KYTA 2BH1X 5IWAC 4LF4C 1ZB8A 1XRAA 4BCAA 5KEIA 3GR1A 2D1TA 4ZJZA 1ML8A 2CU6A 2E8FA 5E7QA 4PZPA 4DV6C 4DR7C 2JMPA 2P2FA 1LQLA 1N2FA 4B3SC 5BSWA 4BC9A 3TQIA 5LMUC 5IT9D 5BSTA 3UOWA 1WCJA 2BJOA 4G36A 2UXBC 4X66C 4X64C 4OYCA 3IMLA 4ZLPA 4KTVA 1V25A 4JYAC 3AF5A 5BURA 5DV9A 4RLQA 5BSRA 4X62C 1N36C 4D4IA 4JI2C 2P02A 1RG9A 1AMUA 4YHHC 4DR1C 1N34C 2KZ0A 4PUHA 3TUFA 1HR0C 4JI6C 1VLAA 2E8EA 4LFBC 1MD9A 4PROC 1P4EC 4KHPC 2OPLA 4I9GA 4DR2C 5BSMA 5GTDA 2NCLA 3I08A 2WP0C 3G7SA 3UEBA 1M6XC 1HH2P 1QM4A 4ISBA 4DCVA 4PUGA 1LCIA 2CXCA 4DV4C 2OPLB 3CQ3A 5BSVA 1PA4A 2P2QA 3CJEA 4G1IA 5T8TA 3NI2A 5AE1A 2QVXX 4MTNA 4L4QA 1N33C 4GXRA 3JAMD 2PN2A 3O2EA 2D1QA 5ADZA 2CY1A 2M5OA 3PROC 2VQEC 3ETCA 2UU9C 2ZM6C 2E7GA 1IBKC 1UKKA 5BUQA 4FTFA 3GR0A 4JI4C 2KZFA 4R0MA 2ONFA 4BBYA 3LUSA 3L8CA 4GXQA 3CW9A 3UX2A 1YJ7A 2P2BA 4JV5C 4AQYC 5A2QD 2F4VC 5JRHA 5A1GA 2HJGA 4JI5C 2MMAB 4JM1A 4RLFA 1O93A 2EGTA 2MCQA 1BA3A 3VNSA 4DV3C 2M5HA 4X65C 1NY8A 2E8CA 5K85A 5BUSA 5H9UA 1HNZC 1QWIA 2QVZX 4ODJA 2OO4A 5IFIA 4LE5A 4DG9A 3R9WA 2QVYX 2VSQA 4JI1C 4BC7A 2Y27A 3J80D 4JI8C 4DR5C 1MXAA 3J81D 2DPLA 4DV0C 2Y4NA 4MH4A 1UWDA 3RG2A 1VEHA 1HNXC 2DHMA 1L2FA 4R1MA 4RVOA 4RM3A 2YX1A 3A26A 3EERA 5AE3A 1V26A 4B3RC 5BR8C 3ETOA 4I9FA 4L7IA 1O92A 4GKKC 4XX2A 2YCBA 2ZZMA 4IR7A 4D57A 4WV3A 3DAYA 3K6RA 1RY2A 3TR3A 1IB8A 1XRBA 4D56A 4D4GA 4DUZC 1PG3A 2D1RA 3C5EA 3LNVA 4HPVA 4NOZA 2OBVA 4LF7C 3AF6A 3A9VA 1IBLC 1K0RA 2D28C 1IBMC 5BSUA 4DCSA 1WH9A 2Z51A 1MXCA 3GKUA 1MDBA 2DYJA 1USPA 2PROA 1XNRC 3SO4A 4DV1C 3L95X 4PUIA 1O90A 1O9TA 2PT7G 3NYRA 2AYAA 1FLOA 1USPB 4OX9C 1V60A 1MXBA 4PHTA 1GPMA 2YWBA 3UX3A 2XR1A 4B3MC 4LFCC 3UZ0A 4JI3C 3I07A 3T1YC 4JI0C 3E7XA 2D27A 1J5EC 2D1SA 4K0KC 4RVNA 4DCUA 3FCCA 1WF3A 5AE2A 4FUTA 5T8SA 3KXWA 1MDFA 2VZEA 3OTOC 3LGXA 3NYQA 3DHVA 1MKYA 5KYVA 2WD9A 4YY3C 2KDNA 4FUQA 2QL8A 3E7WA 4RMNA 1P4EA 2UUCC 2UXCC 3NPDA 3R9XA 5CZXA 1ULTA 2MM9A 1NYEA 3IEUA 1M6XA 2E0GA 5A1IA 4DV7C 3DLPX 4GKJC 2D7VA 4U5YD 1I94C 1XS3A 2P2JA 3PESA 3GPCA 1ZB9A 3A25A 3AY0A 3CQ2A 1EGAA 4B3TC 4TPSB 3N2QA 4DV5C 2YWCA 1XNQC 1XHJA 3CW8X 2JNVA 4R1LA 4DCTA 4NDNA 4DG8A 3IPLA 4EATA 2QW0X 3EQ6A 4IZ6A 1XRCA 2P2MA 2P20A 5LCIA 4L2ZA 4K0BA 2VQFC 4JI7C 5LMNC 4DV2C 3T1HC 3S82A 3TDEA 1XMQC 1FUGA 5CZVA 4DR6C 4BSZA 3A9UA 2V7BA 4DR4C 2UUBC 3H2TA 2ASBA 2UXDC 4LF8C 2HHHC 3FCEA 2ATWA 1FJGC 3VNQA 4G37A 2E5LC 4OXIA 3RV2A 3R44A 3N54B 1PG4A 3A4IA 4RM2A 3CQ1A 4WS9A 4DR3C 4LF5C 4LF6C 4LFAC 1N32C 3PBKA 3B7WA 3LNOA 4LF9C 2UUAC 3IEVA 1HNWC 3LAXA 5A19A 1KKGA 1T5DX 4GS5A
chains in the Genus database with same CATH topology
4NXMC 4NXNC 1XMOC 1T5HX 1JOSA 5FLXD 5K8FA 1P7LA 3VNRA 4DUYC 2Y4OA 4KTTA 5KYTA 2BH1X 5IWAC 4LF4C 1ZB8A 1XRAA 4BCAA 5KEIA 3GR1A 2D1TA 4ZJZA 1ML8A 2E8FA 5E7QA 4PZPA 4DV6C 4DR7C 2JMPA 2P2FA 1LQLA 1N2FA 4B3SC 5BSWA 4BC9A 3TQIA 5LMUC 5IT9D 5BSTA 3UOWA 2BJOA 4G36A 2UXBC 4X66C 4X64C 4OYCA 3IMLA 4ZLPA 4KTVA 1V25A 4JYAC 3AF5A 5BURA 5DV9A 4RLQA 5BSRA 4X62C 1N36C 4D4IA 4JI2C 2P02A 1RG9A 1AMUA 4YHHC 4DR1C 1N34C 3TUFA 1HR0C 4JI6C 1VLAA 2E8EA 4LFBC 1MD9A 4PROC 4KHPC 2OPLA 4I9GA 4DR2C 5BSMA 5GTDA 3I08A 2WP0C 3G7SA 1HH2P 1QM4A 4ISBA 4DCVA 1LCIA 2CXCA 4DV4C 2OPLB 5BSVA 1PA4A 2P2QA 3CJEA 4G1IA 5T8TA 3NI2A 5AE1A 2QVXX 4MTNA 4L4QA 1N33C 4GXRA 3JAMD 2PN2A 2D1QA 5ADZA 2CY1A 3PROC 2VQEC 3ETCA 2UU9C 2ZM6C 2E7GA 1IBKC 1UKKA 5BUQA 4FTFA 3GR0A 4JI4C 2KZFA 4R0MA 2ONFA 4BBYA 3LUSA 3L8CA 4GXQA 3CW9A 1YJ7A 2P2BA 4JV5C 4AQYC 5A2QD 2F4VC 5JRHA 5A1GA 2HJGA 4JI5C 4JM1A 4RLFA 1O93A 2EGTA 1BA3A 3VNSA 4DV3C 4X65C 2E8CA 5K85A 5BUSA 5H9UA 1HNZC 1QWIA 2QVZX 4ODJA 2OO4A 5IFIA 4LE5A 4DG9A 3R9WA 2QVYX 2VSQA 4JI1C 4BC7A 2Y27A 3J80D 4JI8C 4DR5C 1MXAA 3J81D 2DPLA 4DV0C 2Y4NA 4MH4A 3RG2A 1HNXC 1L2FA 4R1MA 4RVOA 4RM3A 3EERA 5AE3A 1V26A 4B3RC 5BR8C 3ETOA 4I9FA 4L7IA 1O92A 4GKKC 4XX2A 2YCBA 4IR7A 4D57A 4WV3A 3DAYA 1RY2A 1XRBA 4D56A 4D4GA 4DUZC 1PG3A 2D1RA 3C5EA 3LNVA 4HPVA 4NOZA 2OBVA 4LF7C 3AF6A 3A9VA 1IBLC 1K0RA 2D28C 1IBMC 5BSUA 4DCSA 1WH9A 1MXCA 3GKUA 1MDBA 2DYJA 1USPA 2PROA 1XNRC 3SO4A 4DV1C 3L95X 1O90A 1O9TA 2PT7G 3NYRA 2AYAA 1USPB 4OX9C 1MXBA 4PHTA 1GPMA 2YWBA 2XR1A 4B3MC 4LFCC 3UZ0A 4JI3C 3I07A 3T1YC 4JI0C 3E7XA 2D27A 1J5EC 2D1SA 4K0KC 4RVNA 4DCUA 3FCCA 1WF3A 5AE2A 4FUTA 5T8SA 3KXWA 1MDFA 2VZEA 3OTOC 3LGXA 3NYQA 3DHVA 1MKYA 5KYVA 2WD9A 4YY3C 4FUQA 2QL8A 3E7WA 4RMNA 2UUCC 2UXCC 3NPDA 3R9XA 5CZXA 1ULTA 1NYEA 3IEUA 2E0GA 5A1IA 4DV7C 3DLPX 4GKJC 2D7VA 4U5YD 1I94C 2P2JA 3PESA 3GPCA 1ZB9A 1EGAA 4B3TC 4TPSB 3N2QA 4DV5C 2YWCA 1XNQC 3CW8X 4R1LA 4DCTA 4NDNA 4DG8A 3IPLA 4EATA 2QW0X 3EQ6A 4IZ6A 1XRCA 2P2MA 2P20A 4L2ZA 4K0BA 2VQFC 4JI7C 5LMNC 4DV2C 3T1HC 3S82A 3TDEA 1XMQC 1FUGA 5CZVA 4DR6C 4BSZA 3A9UA 2V7BA 4DR4C 2UUBC 3H2TA 2ASBA 2UXDC 4LF8C 2HHHC 3FCEA 2ATWA 1FJGC 3VNQA 4G37A 2E5LC 4OXIA 3RV2A 3R44A 3N54B 1PG4A 3A4IA 4RM2A 4WS9A 4DR3C 4LF5C 4LF6C 4LFAC 1N32C 3PBKA 3B7WA 4LF9C 2UUAC 3IEVA 1HNWC 3LAXA 5A19A 1KKGA 1T5DX 4GS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QL8 A;  4XX2 A;  4NXM C;  4NXN C;  2UUC C;  2YCB A;  1XMO C;  2UXC C;  3R9X A;  4MTN A;  1N33 C;  3JAM D;  1JOS A;  2PN2 A;  5FLX D;  1NYE A;  3IEU A;  4DUY C;  2CY1 A;  4DV7 C;  5IWA C;  2VQE C;  4DUZ C;  4LF4 C;  2UU9 C;  2ZM6 C;  2E7G A;  4GKJ C;  1IBK C;  1UKK A;  2D7V A;  1I94 C;  1ZB8 A;  2KZF A;  4JI4 C;  2ONF A;  1ZB9 A;  3LUS A;  4NOZ A;  1EGA A;  4B3T C;  4LF7 C;  3AF6 A;  1ML8 A;  2E8F A;  4DV5 C;  4DV6 C;  1IBL C;  1K0R A;  1IBM C;  1XNQ C;  4DR7 C;  4DCS A;  2JMP A;  1WH9 A;  1LQL A;  4JV5 C;  4AQY C;  5A2Q D;  1N2F A;  4DCT A;  4B3S C;  2F4V C;  3GKU A;  2DYJ A;  5LMU C;  1USP A;  2HJG A;  4JI5 C;  5IT9 D;  1XNR C;  4DV1 C;  2BJO A;  2EGT A;  2UXB C;  2PT7 G;  4DV3 C;  4X66 C;  4X64 C;  4X65 C;  2VQF C;  4JI7 C;  1USP B;  4OX9 C;  5LMN C;  2E8C A;  4JYA C;  4DV2 C;  3T1H C;  1HNZ C;  3AF5 A;  1QWI A;  1XMQ C;  4X62 C;  1N36 C;  4JI2 C;  4DR6 C;  2XR1 A;  4BSZ A;  4B3M C;  3R9W A;  4LFC C;  4DR4 C;  2UUB C;  4YHH C;  4JI3 C;  4DR1 C;  4JI1 C;  3I07 A;  1N34 C;  2ASB A;  2UXD C;  4LF8 C;  3J80 D;  4JI8 C;  3T1Y C;  2HHH C;  2ATW A;  4JI0 C;  1HR0 C;  4DR5 C;  1J5E C;  1FJG C;  3J81 D;  2E5L C;  4K0K C;  4JI6 C;  1VLA A;  2E8E A;  4LFB C;  4DCU A;  4DV0 C;  1WF3 A;  4MH4 A;  4KHP C;  2OPL A;  4DR3 C;  4DR2 C;  4LF5 C;  4LF6 C;  1HNX C;  4LFA C;  1L2F A;  1N32 C;  3OTO C;  4LF9 C;  1HH2 P;  3EER A;  2UUA C;  3IEV A;  4B3R C;  5BR8 C;  1HNW C;  4DCV A;  1MKY A;  2CXC A;  4YY3 C;  4DV4 C;  1KKG A;  2OPL B;  4GKK C;  1PA4 A;  3CJE A; 
#chains in the Genus database with same CATH topology
 4NXM C;  4NXN C;  1XMO C;  2ZZN A;  1TH5 A;  1T5H X;  1PU1 A;  1JOS A;  5FLX D;  5K8F A;  1P7L A;  3VNR A;  4DUY C;  2Y4O A;  4KTT A;  5KYT A;  2BH1 X;  5IWA C;  4LF4 C;  1ZB8 A;  1XRA A;  4BCA A;  5KEI A;  3GR1 A;  2D1T A;  4ZJZ A;  1ML8 A;  2CU6 A;  2E8F A;  5E7Q A;  4PZP A;  4DV6 C;  4DR7 C;  2JMP A;  2P2F A;  1LQL A;  1N2F A;  4B3S C;  5BSW A;  4BC9 A;  3TQI A;  5LMU C;  5IT9 D;  5BST A;  3UOW A;  1WCJ A;  2BJO A;  4G36 A;  2UXB C;  4X66 C;  4X64 C;  4OYC A;  3IML A;  4ZLP A;  4KTV A;  1V25 A;  4JYA C;  3AF5 A;  5BUR A;  5DV9 A;  4RLQ A;  5BSR A;  4X62 C;  1N36 C;  4D4I A;  4JI2 C;  2P02 A;  1RG9 A;  1AMU A;  4YHH C;  4DR1 C;  1N34 C;  2KZ0 A;  4PUH A;  3TUF A;  1HR0 C;  4JI6 C;  1VLA A;  2E8E A;  4LFB C;  1MD9 A;  4PRO C;  1P4E C;  4KHP C;  2OPL A;  4I9G A;  4DR2 C;  5BSM A;  5GTD A;  2NCL A;  3I08 A;  2WP0 C;  3G7S A;  3UEB A;  1M6X C;  1HH2 P;  1QM4 A;  4ISB A;  4DCV A;  4PUG A;  1LCI A;  2CXC A;  4DV4 C;  2OPL B;  3CQ3 A;  5BSV A;  1PA4 A;  2P2Q A;  3CJE A;  4G1I A;  5T8T A;  3NI2 A;  5AE1 A;  2QVX X;  4MTN A;  4L4Q A;  1N33 C;  4GXR A;  3JAM D;  2PN2 A;  3O2E A;  2D1Q A;  5ADZ A;  2CY1 A;  2M5O A;  3PRO C;  2VQE C;  3ETC A;  2UU9 C;  2ZM6 C;  2E7G A;  1IBK C;  1UKK A;  5BUQ A;  4FTF A;  3GR0 A;  4JI4 C;  2KZF A;  4R0M A;  2ONF A;  4BBY A;  3LUS A;  3L8C A;  4GXQ A;  3CW9 A;  3UX2 A;  1YJ7 A;  2P2B A;  4JV5 C;  4AQY C;  5A2Q D;  2F4V C;  5JRH A;  5A1G A;  2HJG A;  4JI5 C;  2MMA B;  4JM1 A;  4RLF A;  1O93 A;  2EGT A;  2MCQ A;  1BA3 A;  3VNS A;  4DV3 C;  2M5H A;  4X65 C;  1NY8 A;  2E8C A;  5K85 A;  5BUS A;  5H9U A;  1HNZ C;  1QWI A;  2QVZ X;  4ODJ A;  2OO4 A;  5IFI A;  4LE5 A;  4DG9 A;  3R9W A;  2QVY X;  2VSQ A;  4JI1 C;  4BC7 A;  2Y27 A;  3J80 D;  4JI8 C;  4DR5 C;  1MXA A;  3J81 D;  2DPL A;  4DV0 C;  2Y4N A;  4MH4 A;  1UWD A;  3RG2 A;  1VEH A;  1HNX C;  2DHM A;  1L2F A;  4R1M A;  4RVO A;  4RM3 A;  2YX1 A;  3A26 A;  3EER A;  5AE3 A;  1V26 A;  4B3R C;  5BR8 C;  3ETO A;  4I9F A;  4L7I A;  1O92 A;  4GKK C;  4XX2 A;  2YCB A;  2ZZM A;  4IR7 A;  4D57 A;  4WV3 A;  3DAY A;  3K6R A;  1RY2 A;  3TR3 A;  1IB8 A;  1XRB A;  4D56 A;  4D4G A;  4DUZ C;  1PG3 A;  2D1R A;  3C5E A;  3LNV A;  4HPV A;  4NOZ A;  2OBV A;  4LF7 C;  3AF6 A;  3A9V A;  1IBL C;  1K0R A;  2D28 C;  1IBM C;  5BSU A;  4DCS A;  1WH9 A;  2Z51 A;  1MXC A;  3GKU A;  1MDB A;  2DYJ A;  1USP A;  2PRO A;  1XNR C;  3SO4 A;  4DV1 C;  3L95 X;  4PUI A;  1O90 A;  1O9T A;  2PT7 G;  3NYR A;  2AYA A;  1FLO A;  1USP B;  4OX9 C;  1V60 A;  1MXB A;  4PHT A;  1GPM A;  2YWB A;  3UX3 A;  2XR1 A;  4B3M C;  4LFC C;  3UZ0 A;  4JI3 C;  3I07 A;  3T1Y C;  4JI0 C;  3E7X A;  2D27 A;  1J5E C;  2D1S A;  4K0K C;  4RVN A;  4DCU A;  3FCC A;  1WF3 A;  5AE2 A;  4FUT A;  5T8S A;  3KXW A;  1MDF A;  2VZE A;  3OTO C;  3LGX A;  3NYQ A;  3DHV A;  1MKY A;  5KYV A;  2WD9 A;  4YY3 C;  2KDN A;  4FUQ A;  2QL8 A;  3E7W A;  4RMN A;  1P4E A;  2UUC C;  2UXC C;  3NPD A;  3R9X A;  5CZX A;  1ULT A;  2MM9 A;  1NYE A;  3IEU A;  1M6X A;  2E0G A;  5A1I A;  4DV7 C;  3DLP X;  4GKJ C;  2D7V A;  4U5Y D;  1I94 C;  1XS3 A;  2P2J A;  3PES A;  3GPC A;  1ZB9 A;  3A25 A;  3AY0 A;  3CQ2 A;  1EGA A;  4B3T C;  4TPS B;  3N2Q A;  4DV5 C;  2YWC A;  1XNQ C;  1XHJ A;  3CW8 X;  2JNV A;  4R1L A;  4DCT A;  4NDN A;  4DG8 A;  3IPL A;  4EAT A;  2QW0 X;  3EQ6 A;  4IZ6 A;  1XRC A;  2P2M A;  2P20 A;  5LCI A;  4L2Z A;  4K0B A;  2VQF C;  4JI7 C;  5LMN C;  4DV2 C;  3T1H C;  3S82 A;  3TDE A;  1XMQ C;  1FUG A;  5CZV A;  4DR6 C;  4BSZ A;  3A9U A;  2V7B A;  4DR4 C;  2UUB C;  3H2T A;  2ASB A;  2UXD C;  4LF8 C;  2HHH C;  3FCE A;  2ATW A;  1FJG C;  3VNQ A;  4G37 A;  2E5L C;  4OXI A;  3RV2 A;  3R44 A;  3N54 B;  1PG4 A;  3A4I A;  4RM2 A;  3CQ1 A;  4WS9 A;  4DR3 C;  4LF5 C;  4LF6 C;  4LFA C;  1N32 C;  3PBK A;  3B7W A;  3LNO A;  4LF9 C;  2UUA C;  3IEV A;  1HNW C;  3LAX A;  5A19 A;  1KKG A;  1T5D X;  4GS5 A; 
#chains in the Genus database with same CATH homology
 4NXM C;  4NXN C;  1XMO C;  1T5H X;  1JOS A;  5FLX D;  5K8F A;  1P7L A;  3VNR A;  4DUY C;  2Y4O A;  4KTT A;  5KYT A;  2BH1 X;  5IWA C;  4LF4 C;  1ZB8 A;  1XRA A;  4BCA A;  5KEI A;  3GR1 A;  2D1T A;  4ZJZ A;  1ML8 A;  2E8F A;  5E7Q A;  4PZP A;  4DV6 C;  4DR7 C;  2JMP A;  2P2F A;  1LQL A;  1N2F A;  4B3S C;  5BSW A;  4BC9 A;  3TQI A;  5LMU C;  5IT9 D;  5BST A;  3UOW A;  2BJO A;  4G36 A;  2UXB C;  4X66 C;  4X64 C;  4OYC A;  3IML A;  4ZLP A;  4KTV A;  1V25 A;  4JYA C;  3AF5 A;  5BUR A;  5DV9 A;  4RLQ A;  5BSR A;  4X62 C;  1N36 C;  4D4I A;  4JI2 C;  2P02 A;  1RG9 A;  1AMU A;  4YHH C;  4DR1 C;  1N34 C;  3TUF A;  1HR0 C;  4JI6 C;  1VLA A;  2E8E A;  4LFB C;  1MD9 A;  4PRO C;  4KHP C;  2OPL A;  4I9G A;  4DR2 C;  5BSM A;  5GTD A;  3I08 A;  2WP0 C;  3G7S A;  1HH2 P;  1QM4 A;  4ISB A;  4DCV A;  1LCI A;  2CXC A;  4DV4 C;  2OPL B;  5BSV A;  1PA4 A;  2P2Q A;  3CJE A;  4G1I A;  5T8T A;  3NI2 A;  5AE1 A;  2QVX X;  4MTN A;  4L4Q A;  1N33 C;  4GXR A;  3JAM D;  2PN2 A;  2D1Q A;  5ADZ A;  2CY1 A;  3PRO C;  2VQE C;  3ETC A;  2UU9 C;  2ZM6 C;  2E7G A;  1IBK C;  1UKK A;  5BUQ A;  4FTF A;  3GR0 A;  4JI4 C;  2KZF A;  4R0M A;  2ONF A;  4BBY A;  3LUS A;  3L8C A;  4GXQ A;  3CW9 A;  1YJ7 A;  2P2B A;  4JV5 C;  4AQY C;  5A2Q D;  2F4V C;  5JRH A;  5A1G A;  2HJG A;  4JI5 C;  4JM1 A;  4RLF A;  1O93 A;  2EGT A;  1BA3 A;  3VNS A;  4DV3 C;  4X65 C;  2E8C A;  5K85 A;  5BUS A;  5H9U A;  1HNZ C;  1QWI A;  2QVZ X;  4ODJ A;  2OO4 A;  5IFI A;  4LE5 A;  4DG9 A;  3R9W A;  2QVY X;  2VSQ A;  4JI1 C;  4BC7 A;  2Y27 A;  3J80 D;  4JI8 C;  4DR5 C;  1MXA A;  3J81 D;  2DPL A;  4DV0 C;  2Y4N A;  4MH4 A;  3RG2 A;  1HNX C;  1L2F A;  4R1M A;  4RVO A;  4RM3 A;  3EER A;  5AE3 A;  1V26 A;  4B3R C;  5BR8 C;  3ETO A;  4I9F A;  4L7I A;  1O92 A;  4GKK C;  4XX2 A;  2YCB A;  4IR7 A;  4D57 A;  4WV3 A;  3DAY A;  1RY2 A;  1XRB A;  4D56 A;  4D4G A;  4DUZ C;  1PG3 A;  2D1R A;  3C5E A;  3LNV A;  4HPV A;  4NOZ A;  2OBV A;  4LF7 C;  3AF6 A;  3A9V A;  1IBL C;  1K0R A;  2D28 C;  1IBM C;  5BSU A;  4DCS A;  1WH9 A;  1MXC A;  3GKU A;  1MDB A;  2DYJ A;  1USP A;  2PRO A;  1XNR C;  3SO4 A;  4DV1 C;  3L95 X;  1O90 A;  1O9T A;  2PT7 G;  3NYR A;  2AYA A;  1USP B;  4OX9 C;  1MXB A;  4PHT A;  1GPM A;  2YWB A;  2XR1 A;  4B3M C;  4LFC C;  3UZ0 A;  4JI3 C;  3I07 A;  3T1Y C;  4JI0 C;  3E7X A;  2D27 A;  1J5E C;  2D1S A;  4K0K C;  4RVN A;  4DCU A;  3FCC A;  1WF3 A;  5AE2 A;  4FUT A;  5T8S A;  3KXW A;  1MDF A;  2VZE A;  3OTO C;  3LGX A;  3NYQ A;  3DHV A;  1MKY A;  5KYV A;  2WD9 A;  4YY3 C;  4FUQ A;  2QL8 A;  3E7W A;  4RMN A;  2UUC C;  2UXC C;  3NPD A;  3R9X A;  5CZX A;  1ULT A;  1NYE A;  3IEU A;  2E0G A;  5A1I A;  4DV7 C;  3DLP X;  4GKJ C;  2D7V A;  4U5Y D;  1I94 C;  2P2J A;  3PES A;  3GPC A;  1ZB9 A;  1EGA A;  4B3T C;  4TPS B;  3N2Q A;  4DV5 C;  2YWC A;  1XNQ C;  3CW8 X;  4R1L A;  4DCT A;  4NDN A;  4DG8 A;  3IPL A;  4EAT A;  2QW0 X;  3EQ6 A;  4IZ6 A;  1XRC A;  2P2M A;  2P20 A;  4L2Z A;  4K0B A;  2VQF C;  4JI7 C;  5LMN C;  4DV2 C;  3T1H C;  3S82 A;  3TDE A;  1XMQ C;  1FUG A;  5CZV A;  4DR6 C;  4BSZ A;  3A9U A;  2V7B A;  4DR4 C;  2UUB C;  3H2T A;  2ASB A;  2UXD C;  4LF8 C;  2HHH C;  3FCE A;  2ATW A;  1FJG C;  3VNQ A;  4G37 A;  2E5L C;  4OXI A;  3RV2 A;  3R44 A;  3N54 B;  1PG4 A;  3A4I A;  4RM2 A;  4WS9 A;  4DR3 C;  4LF5 C;  4LF6 C;  4LFA C;  1N32 C;  3PBK A;  3B7W A;  4LF9 C;  2UUA C;  3IEV A;  1HNW C;  3LAX A;  5A19 A;  1KKG A;  1T5D X;  4GS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...