1WH9A

Solution structure of the kh domain of human ribosomal protein s3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
b'GSSGSSGFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 40S ribosomal protein S3
publication title Solution structure of the KH domain of human ribosomal protein S3
rcsb
source organism Homo sapiens
molecule tags Ribosome
total genus 22
structure length 92
sequence length 92
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1wh9A01
2HJGA 3AF5A 4LF6C 3T1HC 4DR7C 2EGTA 1IBKC 3AF6A 4DR4C 4X66C 1XMQC 1USPB 4DV5C 1EGAA 2E8EA 3GKUA 4LFBC 2ONFA 3CJEA 1MKYA 1KKGA 1K0RA 4YY3C 1J5EC 5LMUC 3JAMD 1XNQC 3EERA 4JI6C 3R9WA 3I07A 4XX2A 1HR0C 2BJOA 4DR2C 4DV0C 4JI1C 4DR5C 4BSZA 4DV2C 1HNWC 4LFCC 1USPA 1HH2P 1IBMC 4DV3C 4JI0C 5IT9D 4JI4C 4X65C 1XMOC 4DUZC 4DR6C 4NXNC 4K0KC 2E7GA 5IWAC 2UXCC 4JI2C 2UUCC 4LF4C 1LQLA 2OPLB 2E8FA 4LF5C 2CXCA 5A2QD 3T1YC 1ZB9A 4DUYC 2D7VA 4YHHC 1WF3A 1N34C 3IEVA 2JMPA 1PA4A 4B3SC 2QL8A 4DV1C 1UKKA 1L2FA 4LF7C 2KZFA 1IBLC 4JI8C 1NYEA 4NOZA 2OPLA 4DR1C 3LUSA 1N32C 2F4VC 1XNRC 2DYJA 4LF8C 4DCTA 1HNXC 5FLXD 4NXMC 4OX9C 2ATWA 1FJGC 3J81D 2XR1A 4KHPC 4DV7C 5BR8C 2UUAC 4X62C 4MH4A 4DCUA 3J80D 4MTNA 1WH9A 3OTOC 4JI5C 4DCSA 2VQFC 5LMNC 2E5LC 1N33C 4JV5C 2UUBC 1ZB8A 2CY1A 4AQYC 2PT7G 2E8CA 2UU9C 2UXDC 4B3TC 1VLAA 2PN2A 2ZM6C 4B3MC 4X64C 4DV6C 2YCBA 4LF9C 4GKKC 4DR3C 4JI7C 1ML8A 1I94C 4DCVA 3IEUA 4JI3C 4B3RC 4GKJC 2HHHC 4LFAC 1HNZC 1QWIA 3R9XA 2VQEC 4DV4C 2UXBC 1N2FA 4JYAC 1JOSA 1N36C 2ASBA
chains in the Genus database with same CATH superfamily
4FTFA 5A1GA 4DR4C 5H9UA 3CW8X 4X66C 1XMQC 4DV5C 1EGAA 3RG2A 3CJEA 5BSVA 5LMUC 2P2MA 1NY8A 3I07A 5AE3A 3UX2A 4L2ZA 4DR2C 5IFIA 4JI1C 1IB8A 4DV2C 2M5HA 5KYVA 4BC9A 3NI2A 2WP0C 4JI0C 2NCLA 3GR0A 4DUZC 5IWAC 4JI2C 2UUCC 4LF4C 2OPLB 1FLOA 2P2FA 4LE5A 5ADZA 4D4IA 4YHHC 3GR1A 3ETCA 4BBYA 1RG9A 4DV1C 1L2FA 1UKKA 2Y4OA 3NYRA 5DV9A 2D27A 3LUSA 2Z51A 3IPLA 1AMUA 5JRHA 3E7WA 4KTTA 5FLXD 1XRBA 5BURA 3B7WA 2DPLA 4DCUA 3CQ2A 4I9FA 4PHTA 2P2BA 3A25A 1XRCA 2VQFC 2UUBC 5E7QA 1ZB8A 1P4EA 3A9VA 1VLAA 4EATA 2PN2A 1MXCA 3K6RA 4GKKC 3ETOA 5BSWA 5KEIA 4L4QA 4JI3C 4GKJC 4TPSB 2HHHC 2QVYX 2UXBC 1N36C 3L95X 2ASBA 3AF5A 3DAYA 2ZZNA 2EGTA 4HPVA 3AF6A 3PESA 1MKYA 1K0RA 4YY3C 1J5EC 5AE1A 1XNQC 1PU1A 3G7SA 3VNRA 3FCEA 2KZ0A 2BJOA 4FUTA 3C5EA 4GXQA 1HNWC 1USPA 1TH5A 1YJ7A 3H2TA 1M6XA 4JI4C 4X65C 4KTVA 4PROC 4OYCA 4DR6C 4NXNC 1BA3A 4K0KC 3N2QA 2UXCC 4PZPA 5K85A 4D56A 4LF5C 5BUSA 2CU6A 4DUYC 1WF3A 1N34C 4RVOA 1PG4A 4L7IA 5GTDA 4RM3A 2KZFA 4ODJA 4DCTA 3CW9A 4NXMC 4OX9C 2ATWA 3DLPX 1T5DX 2XR1A 3VNQA 3J81D 4KHPC 2UUAC 2D28C 3KXWA 1V26A 2Y27A 4DCSA 5LMNC 3DHVA 4AQYC 4G1IA 2UXDC 4B3TC 1V25A 4B3MC 1O9TA 2M5OA 4X64C 2QVXX 4DR3C 4JI7C 2ZZMA 3TQIA 4GXRA 4RMNA 5K8FA 1XS3A 4LFAC 1HNZC 4D4GA 1QWIA 4G37A 2VQEC 3NPDA 2DHMA 2D1QA 4LF6C 1P4EC 1IBKC 3A9UA 3TDEA 5A19A 3TUFA 2OBVA 3CQ1A 1USPB 3VNSA 3GKUA 4WV3A 4LFBC 2ONFA 2MCQA 3EQ6A 1KKGA 2QW0X 3JAMD 5LCIA 2V7BA 3EERA 5CZVA 3E7XA 4RVNA 4JI6C 1HR0C 1MD9A 4DV0C 4G36A 4DR5C 4PUGA 4BSZA 3RV2A 4R1MA 4LFCC 3SO4A 1O90A 5AE2A 1HH2P 4ZLPA 4D57A 1IBMC 4DV3C 3LGXA 5BSUA 2P2QA 4PUHA 2E7GA 3LNVA 2CXCA 1ZB9A 5CZXA 1O92A 4RM2A 2MMAB 3IEVA 3R44A 2JMPA 4R1LA 1VEHA 1WCJA 4RLFA 1M6XC 1PG3A 1XHJA 2AYAA 2WD9A 4LF7C 1MDBA 4R0MA 1IBLC 4ZJZA 3GPCA 1N32C 3I08A 2D1SA 2DYJA 4JM1A 4LF8C 1MXAA 4U5YD 1HNXC 4I9GA 5BR8C 2P2JA 4MH4A 3J80D 3OTOC 4DG8A 5T8TA 1N33C 2VSQA 2CY1A 2UU9C 4IR7A 2ZM6C 2YCBA 3A4IA 4LF9C 4PUIA 2E0GA 5KYTA 4DCVA 4B3RC 2VZEA 3R9XA 2KDNA 1N2FA 4JYAC 3T1YC 2HJGA 2P02A 5BSRA 3T1HC 4DR7C 2Y4NA 3NYQA 3UOWA 1FUGA 2D1RA 2E8EA 1UWDA 2P20A 4BCAA 3FCCA 3UEBA 3PROC 3R9WA 4XX2A 1QM4A 5BSTA 3L8CA 2BH1X 1RY2A 1MXBA 4GS5A 3N54B 4IZ6A 1T5HX 5IT9D 1GPMA 1XMOC 1O93A 3CQ3A 2YWBA 2QVZX 1P7LA 1LQLA 2E8FA 5A2QD 2MM9A 3AY0A 5BSMA 5T8SA 2D7VA 4WS9A 1XRAA 1MDFA 4OXIA 2YWCA 1PA4A 2D1TA 1LCIA 2QL8A 4B3SC 1V60A 3O2EA 2YX1A 4NDNA 4JI8C 1NYEA 3LNOA 2OPLA 4NOZA 4DR1C 2F4VC 1XNRC 5A1IA 2OO4A 4ISBA 3IMLA 5BUQA 3UZ0A 1FJGC 4K0BA 4DV7C 3A26A 4X62C 4MTNA 1WH9A 4DG9A 4JI5C 2E5LC 4JV5C 2PT7G 2E8CA 3PBKA 3LAXA 2PROA 4DV6C 2JNVA 4FUQA 1ML8A 1I94C 3IEUA 3S82A 1ULTA 4BC7A 4RLQA 3UX3A 3TR3A 4DV4C 1JOSA
chains in the Genus database with same CATH topology
4FTFA 5A1GA 4DR4C 5H9UA 3CW8X 4X66C 1XMQC 4DV5C 1EGAA 3RG2A 3CJEA 5BSVA 5LMUC 2P2MA 3I07A 5AE3A 4L2ZA 4DR2C 5IFIA 4JI1C 4DV2C 5KYVA 4BC9A 3NI2A 2WP0C 4JI0C 3GR0A 4DUZC 5IWAC 4JI2C 2UUCC 4LF4C 2OPLB 2P2FA 4LE5A 5ADZA 4D4IA 4YHHC 3GR1A 3ETCA 4BBYA 1RG9A 4DV1C 1L2FA 1UKKA 2Y4OA 3NYRA 5DV9A 2D27A 3LUSA 3IPLA 1AMUA 5JRHA 3E7WA 4KTTA 5FLXD 1XRBA 5BURA 3B7WA 2DPLA 4DCUA 4I9FA 4PHTA 2P2BA 1XRCA 2VQFC 2UUBC 5E7QA 1ZB8A 3A9VA 1VLAA 4EATA 2PN2A 1MXCA 4GKKC 3ETOA 5BSWA 5KEIA 4L4QA 4JI3C 4GKJC 4TPSB 2HHHC 2QVYX 2UXBC 1N36C 3L95X 2ASBA 3AF5A 3DAYA 2EGTA 4HPVA 3AF6A 3PESA 1MKYA 1K0RA 4YY3C 1J5EC 5AE1A 1XNQC 3G7SA 3VNRA 3FCEA 4FUTA 2BJOA 3C5EA 4GXQA 1HNWC 1USPA 1YJ7A 3H2TA 4JI4C 4X65C 4KTVA 4PROC 4OYCA 4DR6C 4NXNC 1BA3A 4K0KC 3N2QA 2UXCC 4PZPA 5K85A 4D56A 4LF5C 5BUSA 4DUYC 1WF3A 1N34C 4RVOA 1PG4A 4L7IA 5GTDA 4RM3A 2KZFA 4ODJA 4DCTA 3CW9A 4NXMC 4OX9C 2ATWA 3DLPX 1T5DX 2XR1A 3VNQA 3J81D 4KHPC 2UUAC 2D28C 3KXWA 1V26A 2Y27A 4DCSA 5LMNC 3DHVA 4AQYC 4G1IA 2UXDC 4B3TC 1V25A 4B3MC 1O9TA 4X64C 2QVXX 4DR3C 4JI7C 3TQIA 4GXRA 4RMNA 5K8FA 4LFAC 1HNZC 4D4GA 1QWIA 4G37A 2VQEC 3NPDA 2D1QA 4LF6C 1IBKC 3A9UA 3TDEA 5A19A 3TUFA 2OBVA 1USPB 3VNSA 3GKUA 4WV3A 4LFBC 2ONFA 3EQ6A 1KKGA 2QW0X 3JAMD 2V7BA 3EERA 5CZVA 3E7XA 4RVNA 4JI6C 1HR0C 1MD9A 4DV0C 4G36A 4DR5C 4BSZA 3RV2A 4R1MA 4LFCC 3SO4A 1O90A 5AE2A 1HH2P 4ZLPA 4D57A 1IBMC 4DV3C 3LGXA 5BSUA 2P2QA 2E7GA 3LNVA 2CXCA 1ZB9A 5CZXA 1O92A 4RM2A 3IEVA 3R44A 2JMPA 4R1LA 4RLFA 1PG3A 2AYAA 2WD9A 4LF7C 1MDBA 4R0MA 1IBLC 4ZJZA 3GPCA 1N32C 3I08A 2D1SA 2DYJA 4JM1A 4LF8C 1MXAA 4U5YD 1HNXC 4I9GA 5BR8C 2P2JA 4MH4A 3J80D 3OTOC 4DG8A 5T8TA 1N33C 2VSQA 2CY1A 2UU9C 4IR7A 2ZM6C 2YCBA 3A4IA 4LF9C 2E0GA 5KYTA 4DCVA 4B3RC 2VZEA 3R9XA 1N2FA 4JYAC 3T1YC 2HJGA 2P02A 5BSRA 3T1HC 4DR7C 2Y4NA 3NYQA 3UOWA 1FUGA 2D1RA 2E8EA 2P20A 4BCAA 3FCCA 3PROC 3R9WA 4XX2A 1QM4A 5BSTA 3L8CA 2BH1X 1RY2A 1MXBA 4GS5A 3N54B 4IZ6A 1T5HX 5IT9D 1GPMA 1XMOC 1O93A 2YWBA 2QVZX 1P7LA 1LQLA 2E8FA 5A2QD 5BSMA 5T8SA 2D7VA 4WS9A 1XRAA 1MDFA 4OXIA 2YWCA 1PA4A 2D1TA 1LCIA 2QL8A 4B3SC 4NDNA 4JI8C 1NYEA 4NOZA 2OPLA 4DR1C 2F4VC 1XNRC 5A1IA 2OO4A 4ISBA 3IMLA 5BUQA 3UZ0A 1FJGC 4K0BA 4DV7C 4X62C 4MTNA 1WH9A 4DG9A 4JI5C 2E5LC 4JV5C 2PT7G 2E8CA 3PBKA 3LAXA 2PROA 4DV6C 4FUQA 1ML8A 1I94C 3IEUA 3S82A 1ULTA 4BC7A 4RLQA 4DV4C 1JOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJG A;  3AF5 A;  4LF6 C;  3T1H C;  4DR7 C;  2EGT A;  1IBK C;  3AF6 A;  4DR4 C;  4X66 C;  1XMQ C;  1USP B;  4DV5 C;  1EGA A;  2E8E A;  3GKU A;  4LFB C;  2ONF A;  3CJE A;  1MKY A;  1KKG A;  1K0R A;  4YY3 C;  1J5E C;  5LMU C;  3JAM D;  1XNQ C;  3EER A;  4JI6 C;  3R9W A;  3I07 A;  4XX2 A;  1HR0 C;  2BJO A;  4DR2 C;  4DV0 C;  4JI1 C;  4DR5 C;  4BSZ A;  4DV2 C;  1HNW C;  4LFC C;  1USP A;  1HH2 P;  1IBM C;  4DV3 C;  4JI0 C;  5IT9 D;  4JI4 C;  4X65 C;  1XMO C;  4DUZ C;  4DR6 C;  4NXN C;  4K0K C;  2E7G A;  5IWA C;  2UXC C;  4JI2 C;  2UUC C;  4LF4 C;  1LQL A;  2OPL B;  2E8F A;  4LF5 C;  2CXC A;  5A2Q D;  3T1Y C;  1ZB9 A;  4DUY C;  2D7V A;  4YHH C;  1WF3 A;  1N34 C;  3IEV A;  2JMP A;  1PA4 A;  4B3S C;  2QL8 A;  4DV1 C;  1UKK A;  1L2F A;  4LF7 C;  2KZF A;  1IBL C;  4JI8 C;  1NYE A;  4NOZ A;  2OPL A;  4DR1 C;  3LUS A;  1N32 C;  2F4V C;  1XNR C;  2DYJ A;  4LF8 C;  4DCT A;  1HNX C;  5FLX D;  4NXM C;  4OX9 C;  2ATW A;  1FJG C;  3J81 D;  2XR1 A;  4KHP C;  4DV7 C;  5BR8 C;  2UUA C;  4X62 C;  4MH4 A;  4DCU A;  3J80 D;  4MTN A;  1WH9 A;  3OTO C;  4JI5 C;  4DCS A;  2VQF C;  5LMN C;  2E5L C;  1N33 C;  4JV5 C;  2UUB C;  1ZB8 A;  2CY1 A;  4AQY C;  2PT7 G;  2E8C A;  2UU9 C;  2UXD C;  4B3T C;  1VLA A;  2PN2 A;  2ZM6 C;  4B3M C;  4X64 C;  4DV6 C;  2YCB A;  4LF9 C;  4GKK C;  4DR3 C;  4JI7 C;  1ML8 A;  1I94 C;  4DCV A;  3IEU A;  4JI3 C;  4B3R C;  4GKJ C;  2HHH C;  4LFA C;  1HNZ C;  1QWI A;  3R9X A;  2VQE C;  4DV4 C;  2UXB C;  1N2F A;  4JYA C;  1JOS A;  1N36 C;  2ASB A; 
#chains in the Genus database with same CATH topology
 4FTF A;  5A1G A;  4DR4 C;  5H9U A;  3CW8 X;  4X66 C;  1XMQ C;  4DV5 C;  1EGA A;  3RG2 A;  3CJE A;  5BSV A;  5LMU C;  2P2M A;  1NY8 A;  3I07 A;  5AE3 A;  3UX2 A;  4L2Z A;  4DR2 C;  5IFI A;  4JI1 C;  1IB8 A;  4DV2 C;  2M5H A;  5KYV A;  4BC9 A;  3NI2 A;  2WP0 C;  4JI0 C;  2NCL A;  3GR0 A;  4DUZ C;  5IWA C;  4JI2 C;  2UUC C;  4LF4 C;  2OPL B;  1FLO A;  2P2F A;  4LE5 A;  5ADZ A;  4D4I A;  4YHH C;  3GR1 A;  3ETC A;  4BBY A;  1RG9 A;  4DV1 C;  1L2F A;  1UKK A;  2Y4O A;  3NYR A;  5DV9 A;  2D27 A;  3LUS A;  2Z51 A;  3IPL A;  1AMU A;  5JRH A;  3E7W A;  4KTT A;  5FLX D;  1XRB A;  5BUR A;  3B7W A;  2DPL A;  4DCU A;  3CQ2 A;  4I9F A;  4PHT A;  2P2B A;  3A25 A;  1XRC A;  2VQF C;  2UUB C;  5E7Q A;  1ZB8 A;  1P4E A;  3A9V A;  1VLA A;  4EAT A;  2PN2 A;  1MXC A;  3K6R A;  4GKK C;  3ETO A;  5BSW A;  5KEI A;  4L4Q A;  4JI3 C;  4GKJ C;  4TPS B;  2HHH C;  2QVY X;  2UXB C;  1N36 C;  3L95 X;  2ASB A;  3AF5 A;  3DAY A;  2ZZN A;  2EGT A;  4HPV A;  3AF6 A;  3PES A;  1MKY A;  1K0R A;  4YY3 C;  1J5E C;  5AE1 A;  1XNQ C;  1PU1 A;  3G7S A;  3VNR A;  3FCE A;  2KZ0 A;  2BJO A;  4FUT A;  3C5E A;  4GXQ A;  1HNW C;  1USP A;  1TH5 A;  1YJ7 A;  3H2T A;  1M6X A;  4JI4 C;  4X65 C;  4KTV A;  4PRO C;  4OYC A;  4DR6 C;  4NXN C;  1BA3 A;  4K0K C;  3N2Q A;  2UXC C;  4PZP A;  5K85 A;  4D56 A;  4LF5 C;  5BUS A;  2CU6 A;  4DUY C;  1WF3 A;  1N34 C;  4RVO A;  1PG4 A;  4L7I A;  5GTD A;  4RM3 A;  2KZF A;  4ODJ A;  4DCT A;  3CW9 A;  4NXM C;  4OX9 C;  2ATW A;  3DLP X;  1T5D X;  2XR1 A;  3VNQ A;  3J81 D;  4KHP C;  2UUA C;  2D28 C;  3KXW A;  1V26 A;  2Y27 A;  4DCS A;  5LMN C;  3DHV A;  4AQY C;  4G1I A;  2UXD C;  4B3T C;  1V25 A;  4B3M C;  1O9T A;  2M5O A;  4X64 C;  2QVX X;  4DR3 C;  4JI7 C;  2ZZM A;  3TQI A;  4GXR A;  4RMN A;  5K8F A;  1XS3 A;  4LFA C;  1HNZ C;  4D4G A;  1QWI A;  4G37 A;  2VQE C;  3NPD A;  2DHM A;  2D1Q A;  4LF6 C;  1P4E C;  1IBK C;  3A9U A;  3TDE A;  5A19 A;  3TUF A;  2OBV A;  3CQ1 A;  1USP B;  3VNS A;  3GKU A;  4WV3 A;  4LFB C;  2ONF A;  2MCQ A;  3EQ6 A;  1KKG A;  2QW0 X;  3JAM D;  5LCI A;  2V7B A;  3EER A;  5CZV A;  3E7X A;  4RVN A;  4JI6 C;  1HR0 C;  1MD9 A;  4DV0 C;  4G36 A;  4DR5 C;  4PUG A;  4BSZ A;  3RV2 A;  4R1M A;  4LFC C;  3SO4 A;  1O90 A;  5AE2 A;  1HH2 P;  4ZLP A;  4D57 A;  1IBM C;  4DV3 C;  3LGX A;  5BSU A;  2P2Q A;  4PUH A;  2E7G A;  3LNV A;  2CXC A;  1ZB9 A;  5CZX A;  1O92 A;  4RM2 A;  2MMA B;  3IEV A;  3R44 A;  2JMP A;  4R1L A;  1VEH A;  1WCJ A;  4RLF A;  1M6X C;  1PG3 A;  1XHJ A;  2AYA A;  2WD9 A;  4LF7 C;  1MDB A;  4R0M A;  1IBL C;  4ZJZ A;  3GPC A;  1N32 C;  3I08 A;  2D1S A;  2DYJ A;  4JM1 A;  4LF8 C;  1MXA A;  4U5Y D;  1HNX C;  4I9G A;  5BR8 C;  2P2J A;  4MH4 A;  3J80 D;  3OTO C;  4DG8 A;  5T8T A;  1N33 C;  2VSQ A;  2CY1 A;  2UU9 C;  4IR7 A;  2ZM6 C;  2YCB A;  3A4I A;  4LF9 C;  4PUI A;  2E0G A;  5KYT A;  4DCV A;  4B3R C;  2VZE A;  3R9X A;  2KDN A;  1N2F A;  4JYA C;  3T1Y C;  2HJG A;  2P02 A;  5BSR A;  3T1H C;  4DR7 C;  2Y4N A;  3NYQ A;  3UOW A;  1FUG A;  2D1R A;  2E8E A;  1UWD A;  2P20 A;  4BCA A;  3FCC A;  3UEB A;  3PRO C;  3R9W A;  4XX2 A;  1QM4 A;  5BST A;  3L8C A;  2BH1 X;  1RY2 A;  1MXB A;  4GS5 A;  3N54 B;  4IZ6 A;  1T5H X;  5IT9 D;  1GPM A;  1XMO C;  1O93 A;  3CQ3 A;  2YWB A;  2QVZ X;  1P7L A;  1LQL A;  2E8F A;  5A2Q D;  2MM9 A;  3AY0 A;  5BSM A;  5T8S A;  2D7V A;  4WS9 A;  1XRA A;  1MDF A;  4OXI A;  2YWC A;  1PA4 A;  2D1T A;  1LCI A;  2QL8 A;  4B3S C;  1V60 A;  3O2E A;  2YX1 A;  4NDN A;  4JI8 C;  1NYE A;  3LNO A;  2OPL A;  4NOZ A;  4DR1 C;  2F4V C;  1XNR C;  5A1I A;  2OO4 A;  4ISB A;  3IML A;  5BUQ A;  3UZ0 A;  1FJG C;  4K0B A;  4DV7 C;  3A26 A;  4X62 C;  4MTN A;  1WH9 A;  4DG9 A;  4JI5 C;  2E5L C;  4JV5 C;  2PT7 G;  2E8C A;  3PBK A;  3LAX A;  2PRO A;  4DV6 C;  2JNV A;  4FUQ A;  1ML8 A;  1I94 C;  3IEU A;  3S82 A;  1ULT A;  4BC7 A;  4RLQ A;  3UX3 A;  3TR3 A;  4DV4 C;  1JOS A; 
#chains in the Genus database with same CATH homology
 4FTF A;  5A1G A;  4DR4 C;  5H9U A;  3CW8 X;  4X66 C;  1XMQ C;  4DV5 C;  1EGA A;  3RG2 A;  3CJE A;  5BSV A;  5LMU C;  2P2M A;  3I07 A;  5AE3 A;  4L2Z A;  4DR2 C;  5IFI A;  4JI1 C;  4DV2 C;  5KYV A;  4BC9 A;  3NI2 A;  2WP0 C;  4JI0 C;  3GR0 A;  4DUZ C;  5IWA C;  4JI2 C;  2UUC C;  4LF4 C;  2OPL B;  2P2F A;  4LE5 A;  5ADZ A;  4D4I A;  4YHH C;  3GR1 A;  3ETC A;  4BBY A;  1RG9 A;  4DV1 C;  1L2F A;  1UKK A;  2Y4O A;  3NYR A;  5DV9 A;  2D27 A;  3LUS A;  3IPL A;  1AMU A;  5JRH A;  3E7W A;  4KTT A;  5FLX D;  1XRB A;  5BUR A;  3B7W A;  2DPL A;  4DCU A;  4I9F A;  4PHT A;  2P2B A;  1XRC A;  2VQF C;  2UUB C;  5E7Q A;  1ZB8 A;  3A9V A;  1VLA A;  4EAT A;  2PN2 A;  1MXC A;  4GKK C;  3ETO A;  5BSW A;  5KEI A;  4L4Q A;  4JI3 C;  4GKJ C;  4TPS B;  2HHH C;  2QVY X;  2UXB C;  1N36 C;  3L95 X;  2ASB A;  3AF5 A;  3DAY A;  2EGT A;  4HPV A;  3AF6 A;  3PES A;  1MKY A;  1K0R A;  4YY3 C;  1J5E C;  5AE1 A;  1XNQ C;  3G7S A;  3VNR A;  3FCE A;  4FUT A;  2BJO A;  3C5E A;  4GXQ A;  1HNW C;  1USP A;  1YJ7 A;  3H2T A;  4JI4 C;  4X65 C;  4KTV A;  4PRO C;  4OYC A;  4DR6 C;  4NXN C;  1BA3 A;  4K0K C;  3N2Q A;  2UXC C;  4PZP A;  5K85 A;  4D56 A;  4LF5 C;  5BUS A;  4DUY C;  1WF3 A;  1N34 C;  4RVO A;  1PG4 A;  4L7I A;  5GTD A;  4RM3 A;  2KZF A;  4ODJ A;  4DCT A;  3CW9 A;  4NXM C;  4OX9 C;  2ATW A;  3DLP X;  1T5D X;  2XR1 A;  3VNQ A;  3J81 D;  4KHP C;  2UUA C;  2D28 C;  3KXW A;  1V26 A;  2Y27 A;  4DCS A;  5LMN C;  3DHV A;  4AQY C;  4G1I A;  2UXD C;  4B3T C;  1V25 A;  4B3M C;  1O9T A;  4X64 C;  2QVX X;  4DR3 C;  4JI7 C;  3TQI A;  4GXR A;  4RMN A;  5K8F A;  4LFA C;  1HNZ C;  4D4G A;  1QWI A;  4G37 A;  2VQE C;  3NPD A;  2D1Q A;  4LF6 C;  1IBK C;  3A9U A;  3TDE A;  5A19 A;  3TUF A;  2OBV A;  1USP B;  3VNS A;  3GKU A;  4WV3 A;  4LFB C;  2ONF A;  3EQ6 A;  1KKG A;  2QW0 X;  3JAM D;  2V7B A;  3EER A;  5CZV A;  3E7X A;  4RVN A;  4JI6 C;  1HR0 C;  1MD9 A;  4DV0 C;  4G36 A;  4DR5 C;  4BSZ A;  3RV2 A;  4R1M A;  4LFC C;  3SO4 A;  1O90 A;  5AE2 A;  1HH2 P;  4ZLP A;  4D57 A;  1IBM C;  4DV3 C;  3LGX A;  5BSU A;  2P2Q A;  2E7G A;  3LNV A;  2CXC A;  1ZB9 A;  5CZX A;  1O92 A;  4RM2 A;  3IEV A;  3R44 A;  2JMP A;  4R1L A;  4RLF A;  1PG3 A;  2AYA A;  2WD9 A;  4LF7 C;  1MDB A;  4R0M A;  1IBL C;  4ZJZ A;  3GPC A;  1N32 C;  3I08 A;  2D1S A;  2DYJ A;  4JM1 A;  4LF8 C;  1MXA A;  4U5Y D;  1HNX C;  4I9G A;  5BR8 C;  2P2J A;  4MH4 A;  3J80 D;  3OTO C;  4DG8 A;  5T8T A;  1N33 C;  2VSQ A;  2CY1 A;  2UU9 C;  4IR7 A;  2ZM6 C;  2YCB A;  3A4I A;  4LF9 C;  2E0G A;  5KYT A;  4DCV A;  4B3R C;  2VZE A;  3R9X A;  1N2F A;  4JYA C;  3T1Y C;  2HJG A;  2P02 A;  5BSR A;  3T1H C;  4DR7 C;  2Y4N A;  3NYQ A;  3UOW A;  1FUG A;  2D1R A;  2E8E A;  2P20 A;  4BCA A;  3FCC A;  3PRO C;  3R9W A;  4XX2 A;  1QM4 A;  5BST A;  3L8C A;  2BH1 X;  1RY2 A;  1MXB A;  4GS5 A;  3N54 B;  4IZ6 A;  1T5H X;  5IT9 D;  1GPM A;  1XMO C;  1O93 A;  2YWB A;  2QVZ X;  1P7L A;  1LQL A;  2E8F A;  5A2Q D;  5BSM A;  5T8S A;  2D7V A;  4WS9 A;  1XRA A;  1MDF A;  4OXI A;  2YWC A;  1PA4 A;  2D1T A;  1LCI A;  2QL8 A;  4B3S C;  4NDN A;  4JI8 C;  1NYE A;  4NOZ A;  2OPL A;  4DR1 C;  2F4V C;  1XNR C;  5A1I A;  2OO4 A;  4ISB A;  3IML A;  5BUQ A;  3UZ0 A;  1FJG C;  4K0B A;  4DV7 C;  4X62 C;  4MTN A;  1WH9 A;  4DG9 A;  4JI5 C;  2E5L C;  4JV5 C;  2PT7 G;  2E8C A;  3PBK A;  3LAX A;  2PRO A;  4DV6 C;  4FUQ A;  1ML8 A;  1I94 C;  3IEU A;  3S82 A;  1ULT A;  4BC7 A;  4RLQ A;  4DV4 C;  1JOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...