2DHMA

Solution structure of the bola protein from escherichia coli
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
107
structure length
107
Chain Sequence
GSSGSSGMMIRERIEEKLRAAFQPVFLEVVDESYRHNVPAGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHTYTIKEWEGLQDTVFASPPCRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein bolA
publication title Solution structure of the BolA protein from Escherichia coli
rcsb
source organism Escherichia coli str. k12 substr.
total genus 13
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2dhmA01
2KDNA 2MCQA 2KZ0A 2MM9A 3O2EA 1V60A 4PUGA 4PUIA 3TR3A 1NY8A 2DHMA 5LCIA 4PUHA 2MMAB 1XS3A 2NCLA
chains in the Genus database with same CATH superfamily
3R44A 2QVZX 5A1IA 2D1SA 1FJGC 5LMUC 5AE1A 2CU6A 3R9WA 3O2EA 5CZXA 1NYEA 3SO4A 2F4VC 3LNVA 3TUFA 5BSWA 1XRBA 4RMNA 1KKGA 4D4GA 4LF6C 4B3SC 4OYCA 2ONFA 3UX2A 1XRCA 2ASBA 4FUQA 5JRHA 5KYTA 3KXWA 2P02A 3E7XA 5KYVA 4DCSA 1PA4A 1N36C 2HHHC 1XHJA 4ZJZA 2CXCA 1NY8A 3CQ1A 1K0RA 2D28C 4KTVA 4BCAA 4B3MC 1N2FA 3C5EA 5LCIA 2YX1A 2MCQA 4DR5C 3CW8X 2MMAB 3LUSA 1PG3A 4I9GA 5T8SA 4DG8A 4HPVA 2PT7G 4PZPA 3PROC 4R1MA 2P2BA 2Y27A 1WCJA 1BA3A 4BC7A 1N33C 1ZB9A 1QWIA 4DCVA 4JI7C 1ULTA 3T1YC 1HNXC 1ZB8A 3DHVA 3FCEA 5KEIA 2PROA 1I94C 1MDFA 2UU9C 1HH2P 1L2FA 3A25A 5ADZA 2VSQA 2P2JA 2UXBC 5BUQA 4DR7C 1VEHA 1T5DX 1AMUA 4RVNA 4X65C 5BURA 5BSRA 2E8CA 4EATA 5FLXD 4GKJC 5CZVA 4I9FA 2DPLA 2P2QA 1MXBA 4G37A 3UEBA 3CJEA 4BBYA 4PUIA 4JYAC 1VLAA 4JI0C 4LE5A 3A9VA 1MXCA 1EGAA 4R1LA 4DV3C 1WF3A 1RG9A 3K6RA 2Y4NA 2UUCC 1IBLC 4AQYC 3PESA 4U5YD 3VNSA 3E7WA 4DV1C 3N54B 4DR6C 1MKYA 4LF5C 4KTTA 4MH4A 3G7SA 1XMOC 2WP0C 1N34C 4DV2C 4IZ6A 2P2MA 5E7QA 4LF9C 3DAYA 4OXIA 1T5HX 2UUBC 3IEVA 4GXRA 4WS9A 3J81D 3IMLA 2E7GA 4DCTA 3A26A 4FUTA 3IPLA 4RLFA 4X66C 3GR0A 3AF6A 4K0KC 1PG4A 4L2ZA 4DUYC 3EQ6A 4LF7C 3A4IA 3VNRA 1USPB 2XR1A 5K8FA 1GPMA 3NYRA 4GKKC 1UWDA 3NYQA 2DHMA 2QW0X 4JI4C 4DR2C 4PUHA 5A19A 5K85A 3S82A 2D1TA 4DUZC 4PUGA 5A2QD 3AY0A 3UZ0A 1IBMC 1IBKC 5BSTA 3TQIA 1HNZC 1JOSA 5H9UA 2NCLA 3CW9A 4YY3C 3LNOA 3JAMD 1MD9A 1YJ7A 5BSMA 5IFIA 5AE3A 3NPDA 2ATWA 3T1HC 4KHPC 2M5HA 3DLPX 4D4IA 2ZM6C 2E5LC 4LFAC 1V25A 4R0MA 3EERA 5BUSA 4JI2C 1TH5A 4YHHC 1MDBA 1USPA 4MTNA 5BR8C 4NXMC 1O93A 2AYAA 1V26A 1XRAA 2DYJA 2QVYX 2KZFA 2YWCA 1M6XA 2HJGA 4B3TC 4D56A 3I08A 3RG2A 2UXCC 3B7WA 1J5EC 1P4EA 3UOWA 4JI8C 1WH9A 1O90A 3TDEA 4G1IA 2P20A 4JI5C 5IWAC 4D57A 1M6XC 1P7LA 3TR3A 2UUAC 1RY2A 4JM1A 4JI3C 3GPCA 2WD9A 4RVOA 4WV3A 3L8CA 4LF8C 2OPLB 2JNVA 1P4EC 4NOZA 1HR0C 5LMNC 4GS5A 4IR7A 4X62C 4BSZA 4JV5C 1XNRC 1V60A 2D27A 4XX2A 3VNQA 3CQ2A 4LF4C 4GXQA 5AE2A 3A9UA 2D1RA 1FUGA 3J80D 3AF5A 4NDNA 4DV0C 2YCBA 4OX9C 2MM9A 3IEUA 2OPLA 2VQFC 4DR3C 1O9TA 1MXAA 1HNWC 4B3RC 4DG9A 3I07A 4JI1C 2CY1A 4DV5C 2Y4OA 4DV6C 2QL8A 2D1QA 2ZZNA 4RM2A 3GKUA 4PROC 1IB8A 3ETCA 5T8TA 2V7BA 4RM3A 2QVXX 5IT9D 4L7IA 3GR1A 4PHTA 1FLOA 5DV9A 5GTDA 4NXNC 2M5OA 1ML8A 3N2QA 3RV2A 2E8EA 3H2TA 4DV4C 3ETOA 2KZ0A 4DR4C 1XMQC 1XS3A 3UX3A 3FCCA 2BH1X 2Z51A 4K0BA 2KDNA 4ISBA 4LFCC 1LQLA 2PN2A 4BC9A 2E0GA 1UKKA 4X64C 1O92A 4TPSB 2ZZMA 3PBKA 2E8FA 1XNQC 2OBVA 1QM4A 5BSVA 2VZEA 1PU1A 4ZLPA 2VQEC 3R9XA 2JMPA 1LCIA 3LGXA 2P2FA 4FTFA 2D7VA 5A1GA 5BSUA 4DR1C 3L95X 3LAXA 1N32C 4ODJA 2UXDC 4G36A 4DV7C 3OTOC 3NI2A 2OO4A 4RLQA 4DCUA 4L4QA 2BJOA 2EGTA 4JI6C 3CQ3A 2YWBA 4LFBC
chains in the Genus database with same CATH topology
2KDNA 2MCQA 2KZ0A 2MM9A 3O2EA 1V60A 4PUGA 4PUIA 3TR3A 1NY8A 2DHMA 5LCIA 4PUHA 2MMAB 1XS3A 2NCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDN A;  2MCQ A;  2KZ0 A;  2MM9 A;  3O2E A;  1V60 A;  4PUG A;  4PUI A;  3TR3 A;  1NY8 A;  2DHM A;  5LCI A;  4PUH A;  2MMA B;  1XS3 A;  2NCL A; 
#chains in the Genus database with same CATH topology
 3R44 A;  2QVZ X;  5A1I A;  2D1S A;  1FJG C;  5LMU C;  5AE1 A;  2CU6 A;  3R9W A;  3O2E A;  5CZX A;  1NYE A;  3SO4 A;  2F4V C;  3LNV A;  3TUF A;  5BSW A;  1XRB A;  4RMN A;  1KKG A;  4D4G A;  4LF6 C;  4B3S C;  4OYC A;  2ONF A;  3UX2 A;  1XRC A;  2ASB A;  4FUQ A;  5JRH A;  5KYT A;  3KXW A;  2P02 A;  3E7X A;  5KYV A;  4DCS A;  1PA4 A;  1N36 C;  2HHH C;  1XHJ A;  4ZJZ A;  2CXC A;  1NY8 A;  3CQ1 A;  1K0R A;  2D28 C;  4KTV A;  4BCA A;  4B3M C;  1N2F A;  3C5E A;  5LCI A;  2YX1 A;  2MCQ A;  4DR5 C;  3CW8 X;  2MMA B;  3LUS A;  1PG3 A;  4I9G A;  5T8S A;  4DG8 A;  4HPV A;  2PT7 G;  4PZP A;  3PRO C;  4R1M A;  2P2B A;  2Y27 A;  1WCJ A;  1BA3 A;  4BC7 A;  1N33 C;  1ZB9 A;  1QWI A;  4DCV A;  4JI7 C;  1ULT A;  3T1Y C;  1HNX C;  1ZB8 A;  3DHV A;  3FCE A;  5KEI A;  2PRO A;  1I94 C;  1MDF A;  2UU9 C;  1HH2 P;  1L2F A;  3A25 A;  5ADZ A;  2VSQ A;  2P2J A;  2UXB C;  5BUQ A;  4DR7 C;  1VEH A;  1T5D X;  1AMU A;  4RVN A;  4X65 C;  5BUR A;  5BSR A;  2E8C A;  4EAT A;  5FLX D;  4GKJ C;  5CZV A;  4I9F A;  2DPL A;  2P2Q A;  1MXB A;  4G37 A;  3UEB A;  3CJE A;  4BBY A;  4PUI A;  4JYA C;  1VLA A;  4JI0 C;  4LE5 A;  3A9V A;  1MXC A;  1EGA A;  4R1L A;  4DV3 C;  1WF3 A;  1RG9 A;  3K6R A;  2Y4N A;  2UUC C;  1IBL C;  4AQY C;  3PES A;  4U5Y D;  3VNS A;  3E7W A;  4DV1 C;  3N54 B;  4DR6 C;  1MKY A;  4LF5 C;  4KTT A;  4MH4 A;  3G7S A;  1XMO C;  2WP0 C;  1N34 C;  4DV2 C;  4IZ6 A;  2P2M A;  5E7Q A;  4LF9 C;  3DAY A;  4OXI A;  1T5H X;  2UUB C;  3IEV A;  4GXR A;  4WS9 A;  3J81 D;  3IML A;  2E7G A;  4DCT A;  3A26 A;  4FUT A;  3IPL A;  4RLF A;  4X66 C;  3GR0 A;  3AF6 A;  4K0K C;  1PG4 A;  4L2Z A;  4DUY C;  3EQ6 A;  4LF7 C;  3A4I A;  3VNR A;  1USP B;  2XR1 A;  5K8F A;  1GPM A;  3NYR A;  4GKK C;  1UWD A;  3NYQ A;  2DHM A;  2QW0 X;  4JI4 C;  4DR2 C;  4PUH A;  5A19 A;  5K85 A;  3S82 A;  2D1T A;  4DUZ C;  4PUG A;  5A2Q D;  3AY0 A;  3UZ0 A;  1IBM C;  1IBK C;  5BST A;  3TQI A;  1HNZ C;  1JOS A;  5H9U A;  2NCL A;  3CW9 A;  4YY3 C;  3LNO A;  3JAM D;  1MD9 A;  1YJ7 A;  5BSM A;  5IFI A;  5AE3 A;  3NPD A;  2ATW A;  3T1H C;  4KHP C;  2M5H A;  3DLP X;  4D4I A;  2ZM6 C;  2E5L C;  4LFA C;  1V25 A;  4R0M A;  3EER A;  5BUS A;  4JI2 C;  1TH5 A;  4YHH C;  1MDB A;  1USP A;  4MTN A;  5BR8 C;  4NXM C;  1O93 A;  2AYA A;  1V26 A;  1XRA A;  2DYJ A;  2QVY X;  2KZF A;  2YWC A;  1M6X A;  2HJG A;  4B3T C;  4D56 A;  3I08 A;  3RG2 A;  2UXC C;  3B7W A;  1J5E C;  1P4E A;  3UOW A;  4JI8 C;  1WH9 A;  1O90 A;  3TDE A;  4G1I A;  2P20 A;  4JI5 C;  5IWA C;  4D57 A;  1M6X C;  1P7L A;  3TR3 A;  2UUA C;  1RY2 A;  4JM1 A;  4JI3 C;  3GPC A;  2WD9 A;  4RVO A;  4WV3 A;  3L8C A;  4LF8 C;  2OPL B;  2JNV A;  1P4E C;  4NOZ A;  1HR0 C;  5LMN C;  4GS5 A;  4IR7 A;  4X62 C;  4BSZ A;  4JV5 C;  1XNR C;  1V60 A;  2D27 A;  4XX2 A;  3VNQ A;  3CQ2 A;  4LF4 C;  4GXQ A;  5AE2 A;  3A9U A;  2D1R A;  1FUG A;  3J80 D;  3AF5 A;  4NDN A;  4DV0 C;  2YCB A;  4OX9 C;  2MM9 A;  3IEU A;  2OPL A;  2VQF C;  4DR3 C;  1O9T A;  1MXA A;  1HNW C;  4B3R C;  4DG9 A;  3I07 A;  4JI1 C;  2CY1 A;  4DV5 C;  2Y4O A;  4DV6 C;  2QL8 A;  2D1Q A;  2ZZN A;  4RM2 A;  3GKU A;  4PRO C;  1IB8 A;  3ETC A;  5T8T A;  2V7B A;  4RM3 A;  2QVX X;  5IT9 D;  4L7I A;  3GR1 A;  4PHT A;  1FLO A;  5DV9 A;  5GTD A;  4NXN C;  2M5O A;  1ML8 A;  3N2Q A;  3RV2 A;  2E8E A;  3H2T A;  4DV4 C;  3ETO A;  2KZ0 A;  4DR4 C;  1XMQ C;  1XS3 A;  3UX3 A;  3FCC A;  2BH1 X;  2Z51 A;  4K0B A;  2KDN A;  4ISB A;  4LFC C;  1LQL A;  2PN2 A;  4BC9 A;  2E0G A;  1UKK A;  4X64 C;  1O92 A;  4TPS B;  2ZZM A;  3PBK A;  2E8F A;  1XNQ C;  2OBV A;  1QM4 A;  5BSV A;  2VZE A;  1PU1 A;  4ZLP A;  2VQE C;  3R9X A;  2JMP A;  1LCI A;  3LGX A;  2P2F A;  4FTF A;  2D7V A;  5A1G A;  5BSU A;  4DR1 C;  3L95 X;  3LAX A;  1N32 C;  4ODJ A;  2UXD C;  4G36 A;  4DV7 C;  3OTO C;  3NI2 A;  2OO4 A;  4RLQ A;  4DCU A;  4L4Q A;  2BJO A;  2EGT A;  4JI6 C;  3CQ3 A;  2YWB A;  4LFB C; 
#chains in the Genus database with same CATH homology
 2KDN A;  2MCQ A;  2KZ0 A;  2MM9 A;  3O2E A;  1V60 A;  4PUG A;  4PUI A;  3TR3 A;  1NY8 A;  2DHM A;  5LCI A;  4PUH A;  2MMA B;  1XS3 A;  2NCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...