1P7LA

S-adenosylmethionine synthetase complexed with amppnp and met.
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthetase
publication title Crystal structure of the s-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 121
structure length 383
sequence length 383
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1p7lA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1p7lA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1p7lA01
1O90A 4KTVA 4HPVA 4KTTA 5T8SA 2YWBA 1XRAA 3IMLA 5T8TA 1O9TA 1O93A 5A1IA 3S82A 2P02A 4WS9A 2YWCA 5A1GA 4L7IA 1QM4A 1P7LA 1MXCA 1XRCA 1XRBA 3TDEA 4NDNA 3RV2A 3UOWA 1FUGA 1MXBA 2OBVA 1RG9A 1O92A 4L2ZA 4ODJA 5A19A 4K0BA 4LE5A 1GPMA 2DPLA 3A4IA 1MXAA 5H9UA 3SO4A 3TQIA 4L4QA
chains in the Genus database with same CATH superfamily
4PROC 5GTDA 4X66C 4GXQA 1O93A 4DUYC 3EERA 2MCQA 5LMNC 3LUSA 3K6RA 4G37A 4NOZA 2ONFA 3VNQA 4JI5C 2UXCC 4DR4C 4L2ZA 1IBLC 1V26A 4X62C 1KKGA 1LQLA 4DR6C 4BCAA 2V7BA 2D1SA 3A4IA 2D7VA 1WH9A 2ZZMA 4AQYC 2YWBA 5A2QD 4G36A 3AF5A 4JI8C 4PZPA 1XRCA 5IWAC 1UKKA 4D4IA 3CW9A 2P2MA 2PROA 5DV9A 4EATA 4K0BA 5E7QA 4B3MC 4WV3A 4D4GA 2DPLA 1ZB8A 2M5HA 2E8CA 4DG8A 4JI2C 1RY2A 1PU1A 3GR0A 3RG2A 2D27A 2ATWA 4OYCA 4JI0C 3CQ2A 3T1HC 2UUCC 4JV5C 3JAMD 5ADZA 3IEUA 4JYAC 3ETOA 2MM9A 5BSTA 2JMPA 5AE2A 2D28C 1FLOA 1EGAA 3UX2A 5BSWA 4LFAC 5BR8C 3GPCA 2E0GA 2QVZX 4JI4C 2CXCA 4BSZA 3OTOC 4BBYA 3A9VA 4LFCC 2WD9A 2AYAA 1V25A 3C5EA 4DV5C 4PUHA 4ISBA 4LF4C 2D1QA 2KDNA 2EGTA 3FCEA 1VEHA 1K0RA 4FUQA 1IB8A 1N32C 5FLXD 1BA3A 1O9TA 4OX9C 2ZZNA 4WS9A 2VZEA 3NI2A 2OO4A 4DV3C 3DHVA 2OBVA 3LNVA 3E7XA 3R44A 3AY0A 1XHJA 4DR3C 3E7WA 3SO4A 2CU6A 5BSRA 3IMLA 3IEVA 4JI1C 1T5HX 3CJEA 3UZ0A 3CQ3A 4DR5C 2XR1A 2KZ0A 4LF9C 2KZFA 2M5OA 1YJ7A 3LNOA 4DV0C 3UOWA 3G7SA 4ODJA 4B3RC 2UUAC 5BURA 5BUQA 2E7GA 4KTVA 1WF3A 3DAYA 2PN2A 4DV2C 1FJGC 1XNQC 2F4VC 3GKUA 1AMUA 3UEBA 5K85A 1LCIA 1P7LA 2P2QA 2UUBC 2UU9C 3TR3A 1VLAA 4RVOA 2QL8A 1JOSA 1XNRC 4HPVA 3A9UA 5BSMA 2ASBA 4ZLPA 5A1IA 4KHPC 2JNVA 5CZVA 4R0MA 2Y27A 4BC9A 2DHMA 1L2FA 4DR1C 2DYJA 1QWIA 4MH4A 1I94C 1ML8A 1O90A 2P2BA 1NY8A 4ZJZA 1IBMC 2VQEC 4IZ6A 1MXCA 2WP0C 3J80D 3CQ1A 4DUZC 1RG9A 1O92A 3CW8X 4LF5C 1TH5A 3LAXA 4B3TC 4G1IA 5LMUC 4R1LA 2D1TA 3TUFA 4JI3C 1XMOC 5T8TA 4LFBC 4PHTA 1P4EC 2P02A 2VSQA 2YWCA 4DV7C 4L7IA 3ETCA 3TDEA 4DCVA 4DV1C 3I08A 4DR7C 1PG3A 4D57A 5KYVA 1IBKC 4GKJC 3I07A 3A25A 5T8SA 2Z51A 4B3SC 4D56A 3NPDA 1M6XC 3L95X 1T5DX 5KEIA 1N36C 3PROC 4I9FA 4DG9A 4TPSB 1P4EA 4BC7A 1MDBA 4GXRA 1MXAA 3VNSA 2CY1A 3R9WA 4YHHC 5BSVA 3AF6A 5K8FA 5A1GA 4FUTA 2E5LC 2MMAB 4JM1A 4GKKC 4K0KC 5A19A 2YCBA 1M6XA 3UX3A 4DV4C 4LF6C 1MDFA 1HH2P 2PT7G 4X65C 4IR7A 5AE3A 1XS3A 1N34C 4DR2C 5H9UA 3NYQA 4L4QA 3IPLA 1UWDA 4XX2A 1HNZC 3T1YC 4NXNC 3N2QA 3GR1A 1USPB 3KXWA 4NDNA 4YY3C 2QVYX 2OPLB 2D1RA 3EQ6A 1PA4A 4OXIA 1GPMA 2E8EA 4JI6C 2UXDC 2HJGA 3TQIA 4DCSA 2P2JA 3L8CA 4LF7C 4KTTA 4RMNA 1XRAA 3LGXA 3S82A 1USPA 3B7WA 2NCLA 1J5EC 1QM4A 1ZB9A 3O2EA 3VNRA 5AE1A 2OPLA 5IT9D 4PUGA 4R1MA 3RV2A 4LF8C 3A26A 4DV6C 3J81D 4JI7C 2Y4NA 2QW0X 5CZXA 2QVXX 3PBKA 3R9XA 2YX1A 3N54B 2BH1X 4RLQA 4DCUA 5JRHA 2HHHC 2P2FA 1HNXC 4NXMC 1XRBA 1ULTA 1N33C 1MXBA 3PESA 3H2TA 4U5YD 4FTFA 2VQFC 1N2FA 1V60A 4RLFA 1WCJA 2E8FA 3NYRA 4RVNA 1MD9A 2Y4OA 2ZM6C 3FCCA 1PG4A 4I9GA 4RM3A 4RM2A 4DCTA 4MTNA 2BJOA 2UXBC 2P20A 4GS5A 3DLPX 1FUGA 5BSUA 5IFIA 1XMQC 4X64C 5BUSA 4PUIA 4LE5A 5LCIA 1MKYA 1HR0C 1NYEA 1HNWC 5KYTA
chains in the Genus database with same CATH topology
4PROC 5GTDA 4X66C 4GXQA 1O93A 4DUYC 3EERA 5LMNC 3LUSA 4G37A 4NOZA 2ONFA 3VNQA 4JI5C 2UXCC 4DR4C 4L2ZA 1IBLC 1V26A 4X62C 1KKGA 1LQLA 4DR6C 4BCAA 2V7BA 2D1SA 3A4IA 2D7VA 1WH9A 4AQYC 2YWBA 5A2QD 4G36A 3AF5A 4JI8C 4PZPA 1XRCA 5IWAC 1UKKA 4D4IA 3CW9A 2P2MA 2PROA 5DV9A 4EATA 4K0BA 5E7QA 4B3MC 4WV3A 4D4GA 2DPLA 1ZB8A 4DG8A 2E8CA 4JI2C 1RY2A 3GR0A 3RG2A 2D27A 2ATWA 4OYCA 4JI0C 3T1HC 2UUCC 4JV5C 3JAMD 5ADZA 3IEUA 4JYAC 3ETOA 5BSTA 2JMPA 5AE2A 2D28C 1EGAA 4LFAC 5BSWA 5BR8C 3GPCA 2E0GA 2QVZX 4JI4C 2CXCA 4BSZA 3OTOC 4BBYA 3A9VA 4LFCC 2WD9A 2AYAA 1V25A 3C5EA 4DV5C 4ISBA 4LF4C 2D1QA 2EGTA 3FCEA 1K0RA 4FUQA 1N32C 5FLXD 1BA3A 1O9TA 4OX9C 4WS9A 2VZEA 3NI2A 2OO4A 4DV3C 3DHVA 2OBVA 3LNVA 3E7XA 3R44A 4DR3C 3E7WA 3SO4A 5BSRA 3IMLA 3IEVA 4JI1C 1T5HX 3CJEA 3UZ0A 4DR5C 2XR1A 4LF9C 2KZFA 1YJ7A 4DV0C 3UOWA 3G7SA 4ODJA 4B3RC 2UUAC 5BURA 5BUQA 2E7GA 4KTVA 1WF3A 3DAYA 2PN2A 4DV2C 1FJGC 1XNQC 2F4VC 3GKUA 1AMUA 5K85A 1LCIA 1P7LA 2P2QA 2UUBC 2UU9C 1VLAA 4RVOA 2QL8A 1JOSA 1XNRC 4HPVA 3A9UA 5BSMA 2ASBA 4ZLPA 5A1IA 4KHPC 5CZVA 4R0MA 2Y27A 4BC9A 1L2FA 4DR1C 2DYJA 1QWIA 4MH4A 1I94C 1ML8A 1O90A 2P2BA 4ZJZA 1IBMC 2VQEC 4IZ6A 1MXCA 2WP0C 3J80D 4DUZC 1RG9A 1O92A 3CW8X 4LF5C 3LAXA 4B3TC 4G1IA 5LMUC 4R1LA 2D1TA 3TUFA 4JI3C 1XMOC 5T8TA 4LFBC 4PHTA 2P02A 2VSQA 2YWCA 4DV7C 4L7IA 3ETCA 4DV1C 3TDEA 4DCVA 3I08A 4DR7C 1PG3A 4D57A 5KYVA 1IBKC 4GKJC 3I07A 5T8SA 4B3SC 4D56A 3NPDA 3L95X 1T5DX 5KEIA 1N36C 3PROC 4I9FA 4DG9A 4TPSB 4BC7A 1MDBA 4GXRA 1MXAA 3VNSA 2CY1A 3R9WA 4YHHC 5BSVA 3AF6A 5K8FA 5A1GA 4FUTA 2E5LC 4JM1A 4GKKC 4K0KC 5A19A 2YCBA 4DV4C 4LF6C 1MDFA 1HH2P 2PT7G 4X65C 4IR7A 5AE3A 1N34C 4DR2C 5H9UA 3NYQA 4L4QA 3IPLA 4XX2A 1HNZC 3T1YC 4NXNC 3N2QA 3GR1A 1USPB 3KXWA 4NDNA 4YY3C 2QVYX 2OPLB 2D1RA 3EQ6A 1PA4A 4OXIA 1GPMA 2E8EA 4JI6C 2UXDC 2HJGA 3TQIA 4DCSA 2P2JA 3L8CA 4LF7C 4KTTA 4RMNA 1XRAA 3LGXA 3S82A 1USPA 3B7WA 1J5EC 1QM4A 1ZB9A 3VNRA 5AE1A 2OPLA 5IT9D 3RV2A 4R1MA 4LF8C 4DV6C 3J81D 4JI7C 2Y4NA 2QW0X 5CZXA 2QVXX 3PBKA 3R9XA 3N54B 2BH1X 4RLQA 4DCUA 5JRHA 2HHHC 2P2FA 1HNXC 4NXMC 1XRBA 1ULTA 1N33C 1MXBA 3PESA 3H2TA 4U5YD 4FTFA 2VQFC 1N2FA 4RLFA 2E8FA 3NYRA 4RVNA 1MD9A 2Y4OA 2ZM6C 3FCCA 1PG4A 4I9GA 4RM3A 4RM2A 4DCTA 4MTNA 2BJOA 2UXBC 2P20A 4GS5A 3DLPX 1FUGA 5BSUA 5IFIA 1XMQC 4X64C 5BUSA 4LE5A 1MKYA 1HR0C 1NYEA 1HNWC 5KYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O90 A;  4KTV A;  4HPV A;  4KTT A;  5T8S A;  2YWB A;  1XRA A;  3IML A;  5T8T A;  1O9T A;  1O93 A;  5A1I A;  3S82 A;  2P02 A;  4WS9 A;  2YWC A;  5A1G A;  4L7I A;  1QM4 A;  1P7L A;  1MXC A;  1XRC A;  1XRB A;  3TDE A;  4NDN A;  3RV2 A;  3UOW A;  1FUG A;  1MXB A;  2OBV A;  1RG9 A;  1O92 A;  4L2Z A;  4ODJ A;  5A19 A;  4K0B A;  4LE5 A;  1GPM A;  2DPL A;  3A4I A;  1MXA A;  5H9U A;  3SO4 A;  3TQI A;  4L4Q A; 
#chains in the Genus database with same CATH topology
 4PRO C;  5GTD A;  4X66 C;  4GXQ A;  1O93 A;  4DUY C;  3EER A;  2MCQ A;  5LMN C;  3LUS A;  3K6R A;  4G37 A;  4NOZ A;  2ONF A;  3VNQ A;  4JI5 C;  2UXC C;  4DR4 C;  4L2Z A;  1IBL C;  1V26 A;  4X62 C;  1KKG A;  1LQL A;  4DR6 C;  4BCA A;  2V7B A;  2D1S A;  3A4I A;  2D7V A;  1WH9 A;  2ZZM A;  4AQY C;  2YWB A;  5A2Q D;  4G36 A;  3AF5 A;  4JI8 C;  4PZP A;  1XRC A;  5IWA C;  1UKK A;  4D4I A;  3CW9 A;  2P2M A;  2PRO A;  5DV9 A;  4EAT A;  4K0B A;  5E7Q A;  4B3M C;  4WV3 A;  4D4G A;  2DPL A;  1ZB8 A;  2M5H A;  2E8C A;  4DG8 A;  4JI2 C;  1RY2 A;  1PU1 A;  3GR0 A;  3RG2 A;  2D27 A;  2ATW A;  4OYC A;  4JI0 C;  3CQ2 A;  3T1H C;  2UUC C;  4JV5 C;  3JAM D;  5ADZ A;  3IEU A;  4JYA C;  3ETO A;  2MM9 A;  5BST A;  2JMP A;  5AE2 A;  2D28 C;  1FLO A;  1EGA A;  3UX2 A;  5BSW A;  4LFA C;  5BR8 C;  3GPC A;  2E0G A;  2QVZ X;  4JI4 C;  2CXC A;  4BSZ A;  3OTO C;  4BBY A;  3A9V A;  4LFC C;  2WD9 A;  2AYA A;  1V25 A;  3C5E A;  4DV5 C;  4PUH A;  4ISB A;  4LF4 C;  2D1Q A;  2KDN A;  2EGT A;  3FCE A;  1VEH A;  1K0R A;  4FUQ A;  1IB8 A;  1N32 C;  5FLX D;  1BA3 A;  1O9T A;  4OX9 C;  2ZZN A;  4WS9 A;  2VZE A;  3NI2 A;  2OO4 A;  4DV3 C;  3DHV A;  2OBV A;  3LNV A;  3E7X A;  3R44 A;  3AY0 A;  1XHJ A;  4DR3 C;  3E7W A;  3SO4 A;  2CU6 A;  5BSR A;  3IML A;  3IEV A;  4JI1 C;  1T5H X;  3CJE A;  3UZ0 A;  3CQ3 A;  4DR5 C;  2XR1 A;  2KZ0 A;  4LF9 C;  2KZF A;  2M5O A;  1YJ7 A;  3LNO A;  4DV0 C;  3UOW A;  3G7S A;  4ODJ A;  4B3R C;  2UUA C;  5BUR A;  5BUQ A;  2E7G A;  4KTV A;  1WF3 A;  3DAY A;  2PN2 A;  4DV2 C;  1FJG C;  1XNQ C;  2F4V C;  3GKU A;  1AMU A;  3UEB A;  5K85 A;  1LCI A;  1P7L A;  2P2Q A;  2UUB C;  2UU9 C;  3TR3 A;  1VLA A;  4RVO A;  2QL8 A;  1JOS A;  1XNR C;  4HPV A;  3A9U A;  5BSM A;  2ASB A;  4ZLP A;  5A1I A;  4KHP C;  2JNV A;  5CZV A;  4R0M A;  2Y27 A;  4BC9 A;  2DHM A;  1L2F A;  4DR1 C;  2DYJ A;  1QWI A;  4MH4 A;  1I94 C;  1ML8 A;  1O90 A;  2P2B A;  1NY8 A;  4ZJZ A;  1IBM C;  2VQE C;  4IZ6 A;  1MXC A;  2WP0 C;  3J80 D;  3CQ1 A;  4DUZ C;  1RG9 A;  1O92 A;  3CW8 X;  4LF5 C;  1TH5 A;  3LAX A;  4B3T C;  4G1I A;  5LMU C;  4R1L A;  2D1T A;  3TUF A;  4JI3 C;  1XMO C;  5T8T A;  4LFB C;  4PHT A;  1P4E C;  2P02 A;  2VSQ A;  2YWC A;  4DV7 C;  4L7I A;  3ETC A;  3TDE A;  4DCV A;  4DV1 C;  3I08 A;  4DR7 C;  1PG3 A;  4D57 A;  5KYV A;  1IBK C;  4GKJ C;  3I07 A;  3A25 A;  5T8S A;  2Z51 A;  4B3S C;  4D56 A;  3NPD A;  1M6X C;  3L95 X;  1T5D X;  5KEI A;  1N36 C;  3PRO C;  4I9F A;  4DG9 A;  4TPS B;  1P4E A;  4BC7 A;  1MDB A;  4GXR A;  1MXA A;  3VNS A;  2CY1 A;  3R9W A;  4YHH C;  5BSV A;  3AF6 A;  5K8F A;  5A1G A;  4FUT A;  2E5L C;  2MMA B;  4JM1 A;  4GKK C;  4K0K C;  5A19 A;  2YCB A;  1M6X A;  3UX3 A;  4DV4 C;  4LF6 C;  1MDF A;  1HH2 P;  2PT7 G;  4X65 C;  4IR7 A;  5AE3 A;  1XS3 A;  1N34 C;  4DR2 C;  5H9U A;  3NYQ A;  4L4Q A;  3IPL A;  1UWD A;  4XX2 A;  1HNZ C;  3T1Y C;  4NXN C;  3N2Q A;  3GR1 A;  1USP B;  3KXW A;  4NDN A;  4YY3 C;  2QVY X;  2OPL B;  2D1R A;  3EQ6 A;  1PA4 A;  4OXI A;  1GPM A;  2E8E A;  4JI6 C;  2UXD C;  2HJG A;  3TQI A;  4DCS A;  2P2J A;  3L8C A;  4LF7 C;  4KTT A;  4RMN A;  1XRA A;  3LGX A;  3S82 A;  1USP A;  3B7W A;  2NCL A;  1J5E C;  1QM4 A;  1ZB9 A;  3O2E A;  3VNR A;  5AE1 A;  2OPL A;  5IT9 D;  4PUG A;  4R1M A;  3RV2 A;  4LF8 C;  3A26 A;  4DV6 C;  3J81 D;  4JI7 C;  2Y4N A;  2QW0 X;  5CZX A;  2QVX X;  3PBK A;  3R9X A;  2YX1 A;  3N54 B;  2BH1 X;  4RLQ A;  4DCU A;  5JRH A;  2HHH C;  2P2F A;  1HNX C;  4NXM C;  1XRB A;  1ULT A;  1N33 C;  1MXB A;  3PES A;  3H2T A;  4U5Y D;  4FTF A;  2VQF C;  1N2F A;  1V60 A;  4RLF A;  1WCJ A;  2E8F A;  3NYR A;  4RVN A;  1MD9 A;  2Y4O A;  2ZM6 C;  3FCC A;  1PG4 A;  4I9G A;  4RM3 A;  4RM2 A;  4DCT A;  4MTN A;  2BJO A;  2UXB C;  2P20 A;  4GS5 A;  3DLP X;  1FUG A;  5BSU A;  5IFI A;  1XMQ C;  4X64 C;  5BUS A;  4PUI A;  4LE5 A;  5LCI A;  1MKY A;  1HR0 C;  1NYE A;  1HNW C;  5KYT A; 
#chains in the Genus database with same CATH homology
 4PRO C;  5GTD A;  4X66 C;  4GXQ A;  1O93 A;  4DUY C;  3EER A;  5LMN C;  3LUS A;  4G37 A;  4NOZ A;  2ONF A;  3VNQ A;  4JI5 C;  2UXC C;  4DR4 C;  4L2Z A;  1IBL C;  1V26 A;  4X62 C;  1KKG A;  1LQL A;  4DR6 C;  4BCA A;  2V7B A;  2D1S A;  3A4I A;  2D7V A;  1WH9 A;  4AQY C;  2YWB A;  5A2Q D;  4G36 A;  3AF5 A;  4JI8 C;  4PZP A;  1XRC A;  5IWA C;  1UKK A;  4D4I A;  3CW9 A;  2P2M A;  2PRO A;  5DV9 A;  4EAT A;  4K0B A;  5E7Q A;  4B3M C;  4WV3 A;  4D4G A;  2DPL A;  1ZB8 A;  4DG8 A;  2E8C A;  4JI2 C;  1RY2 A;  3GR0 A;  3RG2 A;  2D27 A;  2ATW A;  4OYC A;  4JI0 C;  3T1H C;  2UUC C;  4JV5 C;  3JAM D;  5ADZ A;  3IEU A;  4JYA C;  3ETO A;  5BST A;  2JMP A;  5AE2 A;  2D28 C;  1EGA A;  4LFA C;  5BSW A;  5BR8 C;  3GPC A;  2E0G A;  2QVZ X;  4JI4 C;  2CXC A;  4BSZ A;  3OTO C;  4BBY A;  3A9V A;  4LFC C;  2WD9 A;  2AYA A;  1V25 A;  3C5E A;  4DV5 C;  4ISB A;  4LF4 C;  2D1Q A;  2EGT A;  3FCE A;  1K0R A;  4FUQ A;  1N32 C;  5FLX D;  1BA3 A;  1O9T A;  4OX9 C;  4WS9 A;  2VZE A;  3NI2 A;  2OO4 A;  4DV3 C;  3DHV A;  2OBV A;  3LNV A;  3E7X A;  3R44 A;  4DR3 C;  3E7W A;  3SO4 A;  5BSR A;  3IML A;  3IEV A;  4JI1 C;  1T5H X;  3CJE A;  3UZ0 A;  4DR5 C;  2XR1 A;  4LF9 C;  2KZF A;  1YJ7 A;  4DV0 C;  3UOW A;  3G7S A;  4ODJ A;  4B3R C;  2UUA C;  5BUR A;  5BUQ A;  2E7G A;  4KTV A;  1WF3 A;  3DAY A;  2PN2 A;  4DV2 C;  1FJG C;  1XNQ C;  2F4V C;  3GKU A;  1AMU A;  5K85 A;  1LCI A;  1P7L A;  2P2Q A;  2UUB C;  2UU9 C;  1VLA A;  4RVO A;  2QL8 A;  1JOS A;  1XNR C;  4HPV A;  3A9U A;  5BSM A;  2ASB A;  4ZLP A;  5A1I A;  4KHP C;  5CZV A;  4R0M A;  2Y27 A;  4BC9 A;  1L2F A;  4DR1 C;  2DYJ A;  1QWI A;  4MH4 A;  1I94 C;  1ML8 A;  1O90 A;  2P2B A;  4ZJZ A;  1IBM C;  2VQE C;  4IZ6 A;  1MXC A;  2WP0 C;  3J80 D;  4DUZ C;  1RG9 A;  1O92 A;  3CW8 X;  4LF5 C;  3LAX A;  4B3T C;  4G1I A;  5LMU C;  4R1L A;  2D1T A;  3TUF A;  4JI3 C;  1XMO C;  5T8T A;  4LFB C;  4PHT A;  2P02 A;  2VSQ A;  2YWC A;  4DV7 C;  4L7I A;  3ETC A;  4DV1 C;  3TDE A;  4DCV A;  3I08 A;  4DR7 C;  1PG3 A;  4D57 A;  5KYV A;  1IBK C;  4GKJ C;  3I07 A;  5T8S A;  4B3S C;  4D56 A;  3NPD A;  3L95 X;  1T5D X;  5KEI A;  1N36 C;  3PRO C;  4I9F A;  4DG9 A;  4TPS B;  4BC7 A;  1MDB A;  4GXR A;  1MXA A;  3VNS A;  2CY1 A;  3R9W A;  4YHH C;  5BSV A;  3AF6 A;  5K8F A;  5A1G A;  4FUT A;  2E5L C;  4JM1 A;  4GKK C;  4K0K C;  5A19 A;  2YCB A;  4DV4 C;  4LF6 C;  1MDF A;  1HH2 P;  2PT7 G;  4X65 C;  4IR7 A;  5AE3 A;  1N34 C;  4DR2 C;  5H9U A;  3NYQ A;  4L4Q A;  3IPL A;  4XX2 A;  1HNZ C;  3T1Y C;  4NXN C;  3N2Q A;  3GR1 A;  1USP B;  3KXW A;  4NDN A;  4YY3 C;  2QVY X;  2OPL B;  2D1R A;  3EQ6 A;  1PA4 A;  4OXI A;  1GPM A;  2E8E A;  4JI6 C;  2UXD C;  2HJG A;  3TQI A;  4DCS A;  2P2J A;  3L8C A;  4LF7 C;  4KTT A;  4RMN A;  1XRA A;  3LGX A;  3S82 A;  1USP A;  3B7W A;  1J5E C;  1QM4 A;  1ZB9 A;  3VNR A;  5AE1 A;  2OPL A;  5IT9 D;  3RV2 A;  4R1M A;  4LF8 C;  4DV6 C;  3J81 D;  4JI7 C;  2Y4N A;  2QW0 X;  5CZX A;  2QVX X;  3PBK A;  3R9X A;  3N54 B;  2BH1 X;  4RLQ A;  4DCU A;  5JRH A;  2HHH C;  2P2F A;  1HNX C;  4NXM C;  1XRB A;  1ULT A;  1N33 C;  1MXB A;  3PES A;  3H2T A;  4U5Y D;  4FTF A;  2VQF C;  1N2F A;  4RLF A;  2E8F A;  3NYR A;  4RVN A;  1MD9 A;  2Y4O A;  2ZM6 C;  3FCC A;  1PG4 A;  4I9G A;  4RM3 A;  4RM2 A;  4DCT A;  4MTN A;  2BJO A;  2UXB C;  2P20 A;  4GS5 A;  3DLP X;  1FUG A;  5BSU A;  5IFI A;  1XMQ C;  4X64 C;  5BUS A;  4LE5 A;  1MKY A;  1HR0 C;  1NYE A;  1HNW C;  5KYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...