1P7LA

S-adenosylmethionine synthetase complexed with amppnp and met.
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the s-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords S-adenosylmethionine synthetase
total genus 121
structure length 383
sequence length 383
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1p7lA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1p7lA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1p7lA01
1O9TA 1MXCA 4L2ZA 4ODJA 5A1IA 1O92A 4L4QA 2DPLA 1RG9A 1O93A 4WS9A 1GPMA 2YWBA 1MXBA 5T8TA 5A19A 5A1GA 1XRAA 3RV2A 3A4IA 3UOWA 1P7LA 5H9UA 1XRCA 4LE5A 1FUGA 1O90A 4KTVA 1MXAA 2YWCA 3TDEA 4HPVA 4NDNA 3S82A 4KTTA 1QM4A 2OBVA 2P02A 3SO4A 3IMLA 4K0BA 4L7IA 5T8SA 3TQIA 1XRBA
chains in the Genus database with same CATH superfamily
4DUZC 1M6XC 4X66C 4B3TC 4IZ6A 2UUBC 1QWIA 4I9GA 4NXNC 2VSQA 2YCBA 2ZZMA 2CXCA 4LF4C 3FCCA 3J80D 1K0RA 4YY3C 4ISBA 4LFCC 3DAYA 3LNVA 4DV4C 4K0BA 1XNQC 4DCTA 4DV3C 3LAXA 3DHVA 2YX1A 5JRHA 2WP0C 4B3RC 4GXRA 5E7QA 2D1TA 3S82A 3A9VA 1MD9A 3H2TA 3LGXA 3CW8X 4GS5A 3TR3A 5BURA 1O93A 4BCAA 1TH5A 1USPA 1LQLA 1N32C 4BSZA 2P20A 2E7GA 1FUGA 2JNVA 1MDFA 2P2FA 1BA3A 4G1IA 4BC7A 1ULTA 2E8EA 3O2EA 1XRBA 2UXDC 3DLPX 3I08A 4L2ZA 2DPLA 1LCIA 1XRAA 4BBYA 5AE2A 4AQYC 2P2JA 4NOZA 1HR0C 2WD9A 4XX2A 4GKJC 3I07A 2ONFA 4PROC 3C5EA 3SO4A 4KHPC 3PROC 4PHTA 1HNZC 3UZ0A 4LF9C 4ODJA 5BSUA 1XMQC 5AE3A 1USPB 4RM3A 5T8TA 5BR8C 5KYTA 1AMUA 4JI3C 2ASBA 4DV2C 4LFAC 2QVYX 4OYCA 1MKYA 2CY1A 1V60A 4LE5A 1NY8A 4LFBC 4PUIA 3VNQA 2MMAB 3IPLA 2QL8A 1N34C 1VEHA 4DR1C 1XHJA 4DR4C 2D7VA 4WS9A 4ZJZA 2ZZNA 1MXBA 3CQ3A 4EATA 4X65C 1ZB9A 3CQ1A 4IR7A 3UX3A 5FLXD 2KZ0A 1N2FA 1N33C 1UKKA 3TQIA 1PG4A 3CQ2A 3IEUA 2M5OA 1RG9A 2BH1X 2P2BA 2ATWA 3R9XA 2AYAA 4I9FA 1RY2A 1I94C 3J81D 1P7LA 5K8FA 4DR3C 2JMPA 3EERA 3NPDA 2D1QA 4GXQA 3GKUA 4JYAC 2OBVA 4RLFA 4JM1A 4D4IA 2UXCC 4DUYC 2Z51A 3ETOA 1JOSA 3T1YC 5BSMA 2OO4A 3AF5A 2F4VC 2Y4OA 3RV2A 1IBLC 2VZEA 3UOWA 4ZLPA 3LNOA 1NYEA 2EGTA 5IT9D 1WCJA 2P02A 4YHHC 3NI2A 4X62C 5IWAC 4X64C 1M6XA 2D1SA 1PG3A 2BJOA 4JI7C 3UEBA 4GKKC 1EGAA 5AE1A 3GR0A 5A19A 2P2QA 3A25A 1XS3A 4DR2C 3B7WA 4RMNA 1HNXC 5BSRA 4FUQA 2KDNA 4DCVA 4JI4C 5BUSA 3GR1A 1VLAA 1XMOC 1FJGC 2D1RA 1IBKC 5KYVA 4L4QA 4B3SC 4JI0C 1MDBA 2KZFA 2HJGA 3G7SA 4JV5C 3NYQA 1J5EC 1IBMC 5K85A 5CZVA 5BSWA 3PESA 4DV1C 4DV5C 3PBKA 3K6RA 2Y4NA 4FTFA 2QVZX 1QM4A 3L8CA 4BC9A 3IMLA 4MTNA 2DHMA 5DV9A 2E0GA 4G36A 5ADZA 3RG2A 4DV7C 3CW9A 2MCQA 2ZM6C 4JI1C 1ZB8A 2XR1A 1HH2P 1L2FA 2UU9C 4RVOA 5BUQA 3VNSA 4NXMC 4R0MA 4DCUA 4JI5C 3OTOC 2P2MA 4DV0C 4RLQA 4K0KC 4LF6C 4DG9A 4JI2C 4LF8C 1P4EA 3FCEA 4TPSB 2D27A 4DG8A 1T5HX 3E7XA 4OX9C 4KTVA 4NDNA 3KXWA 3UX2A 5BSVA 1ML8A 1O9TA 2PT7G 1P4EC 1MXCA 3AY0A 2PROA 4JI6C 4PUGA 1FLOA 2OPLA 5LMNC 2V7BA 1GPMA 5BSTA 2VQFC 5IFIA 5CZXA 4D4GA 5H9UA 3LUSA 4RVNA 3TDEA 2D28C 2PN2A 1V25A 2QW0X 5T8SA 4DCSA 3JAMD 2YWBA 4RM2A 5A1GA 2UUAC 5A2QD 3IEVA 2NCLA 5LCIA 4LF5C 5LMUC 1XRCA 2DYJA 4U5YD 1PA4A 2E8FA 3T1HC 1WH9A 4OXIA 4L7IA 3TUFA 4MH4A 4D57A 4FUTA 2CU6A 1O92A 4DR5C 1XNRC 3CJEA 4JI8C 4DR7C 2E8CA 4WV3A 5KEIA 3N2QA 3A4IA 2OPLB 1WF3A 3NYRA 5GTDA 1O90A 1YJ7A 2Y27A 1MXAA 2YWCA 3A9UA 1HNWC 3ETCA 3E7WA 2UXBC 4R1LA 3VNRA 1UWDA 2QVXX 5A1IA 4LF7C 1IB8A 3A26A 4PZPA 4PUHA 4B3MC 3R44A 4D56A 2HHHC 1PU1A 4DV6C 3N54B 3EQ6A 4R1MA 1V26A 1N36C 3L95X 2VQEC 4HPVA 4DR6C 3AF6A 2E5LC 4KTTA 1KKGA 3GPCA 2M5HA 1T5DX 4G37A 3R9WA 2UUCC 2MM9A
chains in the Genus database with same CATH topology
4DUZC 4X66C 4B3TC 4IZ6A 2UUBC 1QWIA 4I9GA 4NXNC 2VSQA 2YCBA 2CXCA 4LF4C 3FCCA 3J80D 1K0RA 4YY3C 4ISBA 4LFCC 3DAYA 3LNVA 4DV4C 4K0BA 1XNQC 4DCTA 4DV3C 3LAXA 3DHVA 5JRHA 2WP0C 4B3RC 4GXRA 5E7QA 2D1TA 3S82A 3A9VA 1MD9A 3H2TA 3LGXA 3CW8X 4GS5A 5BURA 1O93A 4BCAA 1USPA 1LQLA 1N32C 4BSZA 2P20A 2E7GA 1FUGA 1MDFA 2P2FA 1BA3A 4G1IA 4BC7A 1ULTA 2E8EA 1XRBA 2UXDC 3DLPX 3I08A 4L2ZA 2DPLA 1LCIA 1XRAA 4BBYA 5AE2A 4AQYC 2P2JA 1HR0C 4NOZA 2WD9A 4XX2A 4GKJC 3I07A 2ONFA 4PROC 3C5EA 3SO4A 4KHPC 3PROC 4PHTA 1HNZC 4LF9C 3UZ0A 4ODJA 5BSUA 1XMQC 5AE3A 1USPB 4RM3A 5T8TA 5BR8C 5KYTA 1AMUA 4JI3C 2ASBA 4DV2C 4LFAC 2QVYX 4OYCA 1MKYA 2CY1A 4LE5A 4LFBC 3VNQA 3IPLA 2QL8A 1N34C 4DR1C 4DR4C 2D7VA 4WS9A 4ZJZA 1MXBA 4EATA 4X65C 1ZB9A 4IR7A 5FLXD 1N2FA 1N33C 1UKKA 3TQIA 1PG4A 3IEUA 1RG9A 2BH1X 2P2BA 2ATWA 3R9XA 2AYAA 4I9FA 1RY2A 1I94C 3J81D 1P7LA 5K8FA 4DR3C 2JMPA 3EERA 3NPDA 2D1QA 4GXQA 3GKUA 4JYAC 2OBVA 4RLFA 4JM1A 4D4IA 2UXCC 4DUYC 3ETOA 1JOSA 3T1YC 5BSMA 2OO4A 3AF5A 2F4VC 2Y4OA 3RV2A 1IBLC 2VZEA 3UOWA 4ZLPA 1NYEA 2EGTA 5IT9D 2P02A 4YHHC 3NI2A 4X62C 5IWAC 4X64C 2D1SA 1PG3A 2BJOA 4JI7C 4GKKC 1EGAA 5AE1A 3GR0A 5A19A 2P2QA 4DR2C 3B7WA 4RMNA 1HNXC 5BSRA 4FUQA 4DCVA 4JI4C 5BUSA 3GR1A 1VLAA 1XMOC 1FJGC 2D1RA 1IBKC 5KYVA 4L4QA 4B3SC 4JI0C 1MDBA 2KZFA 2HJGA 3G7SA 4JV5C 3NYQA 1J5EC 1IBMC 5K85A 5CZVA 5BSWA 3PESA 4DV1C 4DV5C 3PBKA 2Y4NA 4FTFA 2QVZX 1QM4A 3L8CA 4BC9A 3IMLA 4MTNA 5DV9A 2E0GA 4G36A 5ADZA 3RG2A 4DV7C 3CW9A 2ZM6C 4JI1C 1ZB8A 2XR1A 1HH2P 1L2FA 2UU9C 4RVOA 5BUQA 3VNSA 4NXMC 4R0MA 4DCUA 4JI5C 3OTOC 2P2MA 4DV0C 4RLQA 4K0KC 4LF6C 4DG9A 4JI2C 4LF8C 3FCEA 4TPSB 2D27A 4DG8A 1T5HX 4OX9C 3E7XA 4KTVA 4NDNA 3KXWA 5BSVA 1ML8A 1O9TA 2PT7G 1MXCA 2PROA 4JI6C 2OPLA 5LMNC 2V7BA 1GPMA 5BSTA 2VQFC 5IFIA 5CZXA 4D4GA 5H9UA 3LUSA 4RVNA 3TDEA 2D28C 2PN2A 1V25A 2QW0X 5T8SA 4DCSA 3JAMD 2YWBA 4RM2A 5A1GA 2UUAC 5A2QD 3IEVA 4LF5C 5LMUC 1XRCA 2DYJA 4U5YD 1PA4A 2E8FA 3T1HC 1WH9A 4OXIA 4L7IA 3TUFA 4MH4A 4D57A 4FUTA 1O92A 4DR5C 1XNRC 3CJEA 4JI8C 4DR7C 2E8CA 4WV3A 5KEIA 3N2QA 3A4IA 2OPLB 1WF3A 3NYRA 5GTDA 1O90A 1YJ7A 2Y27A 1MXAA 2YWCA 3A9UA 1HNWC 3ETCA 3E7WA 2UXBC 4R1LA 3VNRA 2QVXX 5A1IA 4LF7C 4PZPA 4B3MC 3R44A 4D56A 2HHHC 4DV6C 3N54B 3EQ6A 4R1MA 1V26A 1N36C 3L95X 2VQEC 4HPVA 4DR6C 3AF6A 2E5LC 4KTTA 1KKGA 3GPCA 1T5DX 4G37A 3R9WA 2UUCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9T A;  1MXC A;  4L2Z A;  4ODJ A;  5A1I A;  1O92 A;  4L4Q A;  2DPL A;  1RG9 A;  1O93 A;  4WS9 A;  1GPM A;  2YWB A;  1MXB A;  5T8T A;  5A19 A;  5A1G A;  1XRA A;  3RV2 A;  3A4I A;  3UOW A;  1P7L A;  5H9U A;  1XRC A;  4LE5 A;  1FUG A;  1O90 A;  4KTV A;  1MXA A;  2YWC A;  3TDE A;  4HPV A;  4NDN A;  3S82 A;  4KTT A;  1QM4 A;  2OBV A;  2P02 A;  3SO4 A;  3IML A;  4K0B A;  4L7I A;  5T8S A;  3TQI A;  1XRB A; 
#chains in the Genus database with same CATH topology
 4DUZ C;  1M6X C;  4X66 C;  4B3T C;  4IZ6 A;  2UUB C;  1QWI A;  4I9G A;  4NXN C;  2VSQ A;  2YCB A;  2ZZM A;  2CXC A;  4LF4 C;  3FCC A;  3J80 D;  1K0R A;  4YY3 C;  4ISB A;  4LFC C;  3DAY A;  3LNV A;  4DV4 C;  4K0B A;  1XNQ C;  4DCT A;  4DV3 C;  3LAX A;  3DHV A;  2YX1 A;  5JRH A;  2WP0 C;  4B3R C;  4GXR A;  5E7Q A;  2D1T A;  3S82 A;  3A9V A;  1MD9 A;  3H2T A;  3LGX A;  3CW8 X;  4GS5 A;  3TR3 A;  5BUR A;  1O93 A;  4BCA A;  1TH5 A;  1USP A;  1LQL A;  1N32 C;  4BSZ A;  2P20 A;  2E7G A;  1FUG A;  2JNV A;  1MDF A;  2P2F A;  1BA3 A;  4G1I A;  4BC7 A;  1ULT A;  2E8E A;  3O2E A;  1XRB A;  2UXD C;  3DLP X;  3I08 A;  4L2Z A;  2DPL A;  1LCI A;  1XRA A;  4BBY A;  5AE2 A;  4AQY C;  2P2J A;  4NOZ A;  1HR0 C;  2WD9 A;  4XX2 A;  4GKJ C;  3I07 A;  2ONF A;  4PRO C;  3C5E A;  3SO4 A;  4KHP C;  3PRO C;  4PHT A;  1HNZ C;  3UZ0 A;  4LF9 C;  4ODJ A;  5BSU A;  1XMQ C;  5AE3 A;  1USP B;  4RM3 A;  5T8T A;  5BR8 C;  5KYT A;  1AMU A;  4JI3 C;  2ASB A;  4DV2 C;  4LFA C;  2QVY X;  4OYC A;  1MKY A;  2CY1 A;  1V60 A;  4LE5 A;  1NY8 A;  4LFB C;  4PUI A;  3VNQ A;  2MMA B;  3IPL A;  2QL8 A;  1N34 C;  1VEH A;  4DR1 C;  1XHJ A;  4DR4 C;  2D7V A;  4WS9 A;  4ZJZ A;  2ZZN A;  1MXB A;  3CQ3 A;  4EAT A;  4X65 C;  1ZB9 A;  3CQ1 A;  4IR7 A;  3UX3 A;  5FLX D;  2KZ0 A;  1N2F A;  1N33 C;  1UKK A;  3TQI A;  1PG4 A;  3CQ2 A;  3IEU A;  2M5O A;  1RG9 A;  2BH1 X;  2P2B A;  2ATW A;  3R9X A;  2AYA A;  4I9F A;  1RY2 A;  1I94 C;  3J81 D;  1P7L A;  5K8F A;  4DR3 C;  2JMP A;  3EER A;  3NPD A;  2D1Q A;  4GXQ A;  3GKU A;  4JYA C;  2OBV A;  4RLF A;  4JM1 A;  4D4I A;  2UXC C;  4DUY C;  2Z51 A;  3ETO A;  1JOS A;  3T1Y C;  5BSM A;  2OO4 A;  3AF5 A;  2F4V C;  2Y4O A;  3RV2 A;  1IBL C;  2VZE A;  3UOW A;  4ZLP A;  3LNO A;  1NYE A;  2EGT A;  5IT9 D;  1WCJ A;  2P02 A;  4YHH C;  3NI2 A;  4X62 C;  5IWA C;  4X64 C;  1M6X A;  2D1S A;  1PG3 A;  2BJO A;  4JI7 C;  3UEB A;  4GKK C;  1EGA A;  5AE1 A;  3GR0 A;  5A19 A;  2P2Q A;  3A25 A;  1XS3 A;  4DR2 C;  3B7W A;  4RMN A;  1HNX C;  5BSR A;  4FUQ A;  2KDN A;  4DCV A;  4JI4 C;  5BUS A;  3GR1 A;  1VLA A;  1XMO C;  1FJG C;  2D1R A;  1IBK C;  5KYV A;  4L4Q A;  4B3S C;  4JI0 C;  1MDB A;  2KZF A;  2HJG A;  3G7S A;  4JV5 C;  3NYQ A;  1J5E C;  1IBM C;  5K85 A;  5CZV A;  5BSW A;  3PES A;  4DV1 C;  4DV5 C;  3PBK A;  3K6R A;  2Y4N A;  4FTF A;  2QVZ X;  1QM4 A;  3L8C A;  4BC9 A;  3IML A;  4MTN A;  2DHM A;  5DV9 A;  2E0G A;  4G36 A;  5ADZ A;  3RG2 A;  4DV7 C;  3CW9 A;  2MCQ A;  2ZM6 C;  4JI1 C;  1ZB8 A;  2XR1 A;  1HH2 P;  1L2F A;  2UU9 C;  4RVO A;  5BUQ A;  3VNS A;  4NXM C;  4R0M A;  4DCU A;  4JI5 C;  3OTO C;  2P2M A;  4DV0 C;  4RLQ A;  4K0K C;  4LF6 C;  4DG9 A;  4JI2 C;  4LF8 C;  1P4E A;  3FCE A;  4TPS B;  2D27 A;  4DG8 A;  1T5H X;  3E7X A;  4OX9 C;  4KTV A;  4NDN A;  3KXW A;  3UX2 A;  5BSV A;  1ML8 A;  1O9T A;  2PT7 G;  1P4E C;  1MXC A;  3AY0 A;  2PRO A;  4JI6 C;  4PUG A;  1FLO A;  2OPL A;  5LMN C;  2V7B A;  1GPM A;  5BST A;  2VQF C;  5IFI A;  5CZX A;  4D4G A;  5H9U A;  3LUS A;  4RVN A;  3TDE A;  2D28 C;  2PN2 A;  1V25 A;  2QW0 X;  5T8S A;  4DCS A;  3JAM D;  2YWB A;  4RM2 A;  5A1G A;  2UUA C;  5A2Q D;  3IEV A;  2NCL A;  5LCI A;  4LF5 C;  5LMU C;  1XRC A;  2DYJ A;  4U5Y D;  1PA4 A;  2E8F A;  3T1H C;  1WH9 A;  4OXI A;  4L7I A;  3TUF A;  4MH4 A;  4D57 A;  4FUT A;  2CU6 A;  1O92 A;  4DR5 C;  1XNR C;  3CJE A;  4JI8 C;  4DR7 C;  2E8C A;  4WV3 A;  5KEI A;  3N2Q A;  3A4I A;  2OPL B;  1WF3 A;  3NYR A;  5GTD A;  1O90 A;  1YJ7 A;  2Y27 A;  1MXA A;  2YWC A;  3A9U A;  1HNW C;  3ETC A;  3E7W A;  2UXB C;  4R1L A;  3VNR A;  1UWD A;  2QVX X;  5A1I A;  4LF7 C;  1IB8 A;  3A26 A;  4PZP A;  4PUH A;  4B3M C;  3R44 A;  4D56 A;  2HHH C;  1PU1 A;  4DV6 C;  3N54 B;  3EQ6 A;  4R1M A;  1V26 A;  1N36 C;  3L95 X;  2VQE C;  4HPV A;  4DR6 C;  3AF6 A;  2E5L C;  4KTT A;  1KKG A;  3GPC A;  2M5H A;  1T5D X;  4G37 A;  3R9W A;  2UUC C;  2MM9 A; 
#chains in the Genus database with same CATH homology
 4DUZ C;  4X66 C;  4B3T C;  4IZ6 A;  2UUB C;  1QWI A;  4I9G A;  4NXN C;  2VSQ A;  2YCB A;  2CXC A;  4LF4 C;  3FCC A;  3J80 D;  1K0R A;  4YY3 C;  4ISB A;  4LFC C;  3DAY A;  3LNV A;  4DV4 C;  4K0B A;  1XNQ C;  4DCT A;  4DV3 C;  3LAX A;  3DHV A;  5JRH A;  2WP0 C;  4B3R C;  4GXR A;  5E7Q A;  2D1T A;  3S82 A;  3A9V A;  1MD9 A;  3H2T A;  3LGX A;  3CW8 X;  4GS5 A;  5BUR A;  1O93 A;  4BCA A;  1USP A;  1LQL A;  1N32 C;  4BSZ A;  2P20 A;  2E7G A;  1FUG A;  1MDF A;  2P2F A;  1BA3 A;  4G1I A;  4BC7 A;  1ULT A;  2E8E A;  1XRB A;  2UXD C;  3DLP X;  3I08 A;  4L2Z A;  2DPL A;  1LCI A;  1XRA A;  4BBY A;  5AE2 A;  4AQY C;  2P2J A;  1HR0 C;  4NOZ A;  2WD9 A;  4XX2 A;  4GKJ C;  3I07 A;  2ONF A;  4PRO C;  3C5E A;  3SO4 A;  4KHP C;  3PRO C;  4PHT A;  1HNZ C;  4LF9 C;  3UZ0 A;  4ODJ A;  5BSU A;  1XMQ C;  5AE3 A;  1USP B;  4RM3 A;  5T8T A;  5BR8 C;  5KYT A;  1AMU A;  4JI3 C;  2ASB A;  4DV2 C;  4LFA C;  2QVY X;  4OYC A;  1MKY A;  2CY1 A;  4LE5 A;  4LFB C;  3VNQ A;  3IPL A;  2QL8 A;  1N34 C;  4DR1 C;  4DR4 C;  2D7V A;  4WS9 A;  4ZJZ A;  1MXB A;  4EAT A;  4X65 C;  1ZB9 A;  4IR7 A;  5FLX D;  1N2F A;  1N33 C;  1UKK A;  3TQI A;  1PG4 A;  3IEU A;  1RG9 A;  2BH1 X;  2P2B A;  2ATW A;  3R9X A;  2AYA A;  4I9F A;  1RY2 A;  1I94 C;  3J81 D;  1P7L A;  5K8F A;  4DR3 C;  2JMP A;  3EER A;  3NPD A;  2D1Q A;  4GXQ A;  3GKU A;  4JYA C;  2OBV A;  4RLF A;  4JM1 A;  4D4I A;  2UXC C;  4DUY C;  3ETO A;  1JOS A;  3T1Y C;  5BSM A;  2OO4 A;  3AF5 A;  2F4V C;  2Y4O A;  3RV2 A;  1IBL C;  2VZE A;  3UOW A;  4ZLP A;  1NYE A;  2EGT A;  5IT9 D;  2P02 A;  4YHH C;  3NI2 A;  4X62 C;  5IWA C;  4X64 C;  2D1S A;  1PG3 A;  2BJO A;  4JI7 C;  4GKK C;  1EGA A;  5AE1 A;  3GR0 A;  5A19 A;  2P2Q A;  4DR2 C;  3B7W A;  4RMN A;  1HNX C;  5BSR A;  4FUQ A;  4DCV A;  4JI4 C;  5BUS A;  3GR1 A;  1VLA A;  1XMO C;  1FJG C;  2D1R A;  1IBK C;  5KYV A;  4L4Q A;  4B3S C;  4JI0 C;  1MDB A;  2KZF A;  2HJG A;  3G7S A;  4JV5 C;  3NYQ A;  1J5E C;  1IBM C;  5K85 A;  5CZV A;  5BSW A;  3PES A;  4DV1 C;  4DV5 C;  3PBK A;  2Y4N A;  4FTF A;  2QVZ X;  1QM4 A;  3L8C A;  4BC9 A;  3IML A;  4MTN A;  5DV9 A;  2E0G A;  4G36 A;  5ADZ A;  3RG2 A;  4DV7 C;  3CW9 A;  2ZM6 C;  4JI1 C;  1ZB8 A;  2XR1 A;  1HH2 P;  1L2F A;  2UU9 C;  4RVO A;  5BUQ A;  3VNS A;  4NXM C;  4R0M A;  4DCU A;  4JI5 C;  3OTO C;  2P2M A;  4DV0 C;  4RLQ A;  4K0K C;  4LF6 C;  4DG9 A;  4JI2 C;  4LF8 C;  3FCE A;  4TPS B;  2D27 A;  4DG8 A;  1T5H X;  4OX9 C;  3E7X A;  4KTV A;  4NDN A;  3KXW A;  5BSV A;  1ML8 A;  1O9T A;  2PT7 G;  1MXC A;  2PRO A;  4JI6 C;  2OPL A;  5LMN C;  2V7B A;  1GPM A;  5BST A;  2VQF C;  5IFI A;  5CZX A;  4D4G A;  5H9U A;  3LUS A;  4RVN A;  3TDE A;  2D28 C;  2PN2 A;  1V25 A;  2QW0 X;  5T8S A;  4DCS A;  3JAM D;  2YWB A;  4RM2 A;  5A1G A;  2UUA C;  5A2Q D;  3IEV A;  4LF5 C;  5LMU C;  1XRC A;  2DYJ A;  4U5Y D;  1PA4 A;  2E8F A;  3T1H C;  1WH9 A;  4OXI A;  4L7I A;  3TUF A;  4MH4 A;  4D57 A;  4FUT A;  1O92 A;  4DR5 C;  1XNR C;  3CJE A;  4JI8 C;  4DR7 C;  2E8C A;  4WV3 A;  5KEI A;  3N2Q A;  3A4I A;  2OPL B;  1WF3 A;  3NYR A;  5GTD A;  1O90 A;  1YJ7 A;  2Y27 A;  1MXA A;  2YWC A;  3A9U A;  1HNW C;  3ETC A;  3E7W A;  2UXB C;  4R1L A;  3VNR A;  2QVX X;  5A1I A;  4LF7 C;  4PZP A;  4B3M C;  3R44 A;  4D56 A;  2HHH C;  4DV6 C;  3N54 B;  3EQ6 A;  4R1M A;  1V26 A;  1N36 C;  3L95 X;  2VQE C;  4HPV A;  4DR6 C;  3AF6 A;  2E5L C;  4KTT A;  1KKG A;  3GPC A;  1T5D X;  4G37 A;  3R9W A;  2UUC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...