2Y27A

Crystal structure of paak1 in complex with atp from burkholderia cenocepacia
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
LEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGTTGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHENYLACETATE-COENZYME A LIGASE
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Ligase
total genus 149
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y27A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y27A01
1V25A 5BSMA 5JRHA 1MDFA 3LAXA 3QYAA 2D1SA 3T5BA 3L8CA 3LNVA 3EQ6A 4D4HA 1MDBA 4FUTA 4D4IA 4W8OA 5DWVA 1YJ7A 3E7WA 4G36A 4EATA 4GR4A 3KXWA 4GXRA 4GR5A 5D6NA 4ZJZA 5GTDA 1PG3A 3WV5A 1RY2A 1BA3A 4OYCA 3IPLA 3DLPX 3LGXA 1T5DX 4PZPA 2VZEA 2WD9A 2QW0X 3O84A 4GXQA 5K85A 3NI2A 4R0MA 5BUSA 4OXIA 2P2JA 2QVYX 2P2QA 4RVNA 4M46A 4WV3A 4R1LA 5BSVA 4RLQA 3B7WA 3DHVA 3ITEA 5KYTA 2P2BA 4RMNA 3DAYA 5BURA 4DG8A 3FCCA 3IERA 3RG2A 3IVRA 4IZ6A 5BSTA 5BSRA 2P2FA 1LCIA 2V7BA 4FUQA 3CW8X 3FCEA 5BUQA 3O82A 4U5YD 3RIXA 5DV9A 2P20A 2P2MA 3E53A 3NYQA 3G7SA 2D1QA 3E7XA 3T5AA 3IEPA 1ULTA 4D57A 2QVZX 3R44A 2Y4OA 2QVXX 4RM3A 3GPCA 4D56A 3NYRA 1MD9A 3VNQA 3TSYA 3C5EA 4D4GA 2D1TA 2Y27A 3ETCA 4GS5A 5K8FA 3A9VA 3WV4A 3CW9A 3IESA 5IFIA 4IR7A 5KEIA 3O83A 3T5CA 3A9UA 4R1MA 3PBKA 4ISBA 4E5DA 5BSWA 4G37A 1PG4A 2Y4NA 4RLFA 5KYVA 4DG9A 1T5HX 4RVOA 1AMUA 3WVNA 3VNRA 3U16A 3U17A 1V26A 4RM2A 4LGCA 2VSQA 5E7QA 2D1RA 3VNSA 5BSUA
chains in the Genus database with same CATH superfamily
1L7PA 1PLKA 3VMMA 5CXUA 2XKJE 2PFSA 1EZ4A 3RG8A 1JJBA 5J2UB 3FCSB 5LU8A 4Q3BA 1XNQB 4L95C 3RARA 4GRIA 1YVPA 1KJJA 2O5VA 4OQLA 3OECA 2Q28A 1Z2DA 2BMWA 1S2NA 5JD6A 4QQNA 4FHEA 4RWZA 3M8KA 5LQRA 3NIGB 2WZQA 2YIVX 3Q40A 2PH1A 4DCJA 3KXWA 3EH1A 4KDEA 2I03A 4CFSA 4ZYWA 3PEUA 1DG3A 2ZSAA 3GUYA 1CE8A 2GPWA 1THTA 2J07A 1V6CA 3A10A 3LGSA 1EFUA 3ZK9A 1RLJA 2H4JA 3RS9A 1QH8A 2JW5A 4X66C 1YIAA 2ZDQA 2F4NA 4CDNA 1JYEA 4NBWA 2VP0A 2B25A 1OJLA 1E9SA 1TW3A 3SF8B 4JI7B 2V59A 2VEOA 4MQ4A 3IBTA 4ZQHA 1EQ2A 3KVYA 1S1CA 2ZAYA 4NEGA 3LHKA 5EXXA 2DHDA 5BWBA 2GHQA 2XMCA 2EZ9A 3H1FA 1OR8A 1PFYA 2VAXA 5TB5A 2Q5CA 4C6HA 2IHNA 1KKGA 1FUGA 1Z6ZA 4NU6A 4INZA 3KQLA 3IDFA 3MWGA 1XJ0A 1VIVA 1UT8A 3FKSD 3G23A 4X20B 5TMBA 1OTXA 1AGYA 2FN9A 4JVMA 4P82A 3TQSA 4P0PB 1YJAA 2Z08A 2P41A 3UJ8A 3ZGNA 1I4LD 4DRXB 1VIDA 3LDHA 1BJKA 2RIPA 1K8XB 1LW7A 1YCDA 4ERXA 2IE0A 3COSA 4HCJA 1JG4A 1V8FA 1QM5A 3FAKA 3LECA 1ACMA 3BRQA 2PUGA 1OX5A 4NMMA 2FZVA 5HGXA 1RBZA 3EUAA 3WOVA 5JHGB 1XTVA 1KVUA 5ALRA 2YRFA 1BXKA 3Q9SA 3ESAA 2WT4A 5B2EA 5F7OA 2JVIA 3I8OA 4I14A 5COQA 2P20A 1KYTA 4BMZA 5E6SB 2B6HA 1NURA 1OXSC 5JAQA 3VOBA 4XJVA 2O8CB 2JFZA 2XMRA 2FTKE 3UX2A 2YWGA 2ZDGA 4B31A 1Z7BA 4KZKA 1H2EA 2H2GA 1KP9A 3EUWA 3TI9A 3GLIA 5JNUA 4YAIA 2P6RA 4NXNC 2Q5QA 5ELMA 3D3NA 2D5AA 3BRCA 3GT0A 1FMJA 2F4VC 1X7YB 3PHIA 4GE0A 5G3YA 3U0VA 3WBFA 4J43A 3THXB 1R6TA 2C4TA 2ZRJA 1UKKA 3H16A 2RH8A 1Y7PA 2WIDA 4QJ3A 3EULA 3LLMA 1ZNZA 4DV5B 2LVBA 4LV5B 1CR6A 2LNDA 5JNWA 3D4NA 3RBAA 3IDSA 4WXMA 1FMTA 2ONKA 2WSSA 2G76A 4UE3S 3BWDD 4URHA 3AR5A 2W11A 2WV7A 4IMIB 4ZQFA 3I83A 5EC8A 2JHPA 4CWAA 3I05A 4QXMA 1RAIA 3QW2A 1FOEB 1J70A 4LECA 4MMZB 1AQLA 5AOBA 4C2BA 3DF9A 3M5WA 3G2IA 1Z4MA 4HNGA 2XLCA 2CYCA 1IL0A 4LRUA 4PQFA 1Z0SA 2GZRA 5ES3A 5CG1A 2B2NA 4H4DA 1FTQA 2NX2A 2ZBDA 3CVJA 5L53A 1W4CA 4B3MC 2GEBA 3AJ9A 3RJMA 4BMSA 4N49A 1Z35A 3ZV7A 1FDVA 2RGNC 3SFVA 2QUBA 1UBMS 2ONZA 2NYAA 4P0TA 4YLGA 1PQ4A 4DLLA 4F2HA 5JC1A 4R4JA 1FPMA 4TPKA 2IY7A 1F6WA 5H82A 1FP6A 2OK8A 5CIWA 2B1GA 3OM1A 5ICEA 5JROA 4DB4A 1PZGA 1UDRA 4FC6A 3A7DA 3LAXA 5DASA 5DGHA 5JLAA 2DH6A 1HTBA 2GZHA 3U60B 4OOEA 1KSFX 3SJ7A 1O1YA 2JLBA 5C7IO 2Q4OA 1YI8A 1Y1LA 3V4FA 4EKEA 1C9KA 2GH1A 2E5LC 3DF7A 3GJSA 3OZGA 1U1FA 4YP1A 1NVVQ 2ORED 4OQEA 1Z39A 2SNIE 3MELA 3ZHRA 3EX7C 4AZ3A 1U1CA 3B3JA 1GTJ1 4GZ3A 1X9IA 3UH0A 3BIFA 2PIDA 3ZD9A 1G5HA 2IU6A 2PR2A 3AIOA 2WI8A 4UC0A 3ZLVA 1MENA 2AUNA 2X42A 3IIJA 3MWDA 4IMPA 1XZNA 4K2HA 4B6PA 1RHMA 2F1OA 1REQB 2XOEA 3G49A 2C5EA 3MGBA 3QX8A 4ZOAA 3ANLA 4DCUA 1XSEA 1ES9A 2VP6A 4L28A 1M0SA 5CCBA 1M6EX 1M7GA 2HRZA 3ACDA 3D4PA 3GJ5A 1NP7A 2OZLA 4FQ5A 1T1JA 2BC9A 5A4IS 1EK2A 2OORA 3L6RA 3LXUX 2XRFA 3QY9A 4NBLA 4RU1A 5AJTA 1JEAA 4BO5A 1LJUA 3EIQA 5FQNA 1Y7IA 2BGMA 2ZIVB 5K3OA 4DEVA 3FKSA 4B09A 1KFKB 2Q07A 2YWEA 3HWWA 4MW5A 1N9GB 3EWNA 2HJHA 4IHAA 5F4BA 3WGTA 1GAWA 3OQBA 2YNMD 4DMHA 3ADKA 3OY7A 5HK8A 1Y4SA 4BZQA 4I9HA 1QVAA 1Z28A 4HXGA 1IPFA 1IY8A 4DQDA 5HHTA 2GM4A 4B7CA 1T29A 3NZEA 3O4RA 4WLEA 3HRHA 4NAVA 3VYWA 2C0PA 4B75A 5CVUA 2PKRA 4QICA 3OFVA 4TV9A 1R4AA 4LHEA 4N03A 4NFHA 4TQUS 1CJKC 3ZHVA 3TNLA 4QPPA 3PQFA 2UUAC 5BOSB 3ZG6A 5BT8A 1U90A 5IF3A 2P2GA 1D04A 1GQ2A 3U1BA 3ZGXA 4DMCA 1R6VA 4Y18A 3VI3B 1JLMA 3KDAA 3C7CB 3QNMA 3PXCX 2I9KA 1Y4ZA 3NVKI 1O6CA 4RDCA 4UTPA 4EQZA 1NMXA 3OD1A 3SYRA 2Q1UA 2PKWA 1QO0D 2Y1GA 5BW5A 3TI7A 4YJGA 1YFKA 3NO4A 2XUFA 3KSAC 2WDZA 1AUOA 4G0UA 5F21A 5JDIA 4MDFA 3W2GA 1DWQA 1X7ZB 4EZEA 1X8XA 4GLLA 4IDGA 1MP0A 2XADA 3DCYA 3F3KA 4PGMA 2PJDA 3KELA 1OT5A 3ZHSA 5LP6A 5AQEA 2QUIA 2UUPA 4LQDA 1QUFA 4I4CA 2XIJA 4DSTA 2A88A 3I6ZA 5AJVB 4YHHB 2VUIB 2R8BA 1KJ8A 1H1TA 1H6DA 3K4PA 4MX8A 1PU1A 2P69A 2JDID 2BWJA 2ODEA 2PHZA 1E3JA 4RZQA 1WBBA 4GYYA 3ABZA 1P2FA 1N6RA 2YXNA 1NT4A 3DLIA 4GMHA 4J0FA 2QR5A 2AOTA 3MRVA 4BMYA 5C5EA 2UXCC 3EODA 4UUMA 1D2EA 3NM4A 3NBUA 2WUEA 3EG9A 1GZHB 3L0ZA 2PS1A 4TN5A 2RH4A 4C08A 3EFHA 4E15A 5EYPA 1PJ3A 2EJWA 1XP5A 3HYSA 4AURA 2OBBA 5FL7D 1G60A 4H2DA 2C5GA 2NU8B 2J46A 2HSZA 1IOLA 1G2PA 1AMNA 2QBYB 1NAHA 3D6JA 3HI6A 5JPCA 1U0OC 3RTEA 3VR0A 4EI9A 3ZKWB 3R4VA 1M1ZA 5SY9A 2CXHA 5KX5F 1Y3FE 2X5OA 4BNFA 1TAQA 4FFNA 5GONA 4BLPA 4BBJA 2AJCA 4R31A 4GMDA 3S99A 3SQMA 2QV7A 2YJ5A 3IA7A 3ND5A 4D3ZA 4OH7A 3DUFB 1GTZA 1S2DA 1GPNA 1I9CA 4GPAA 2X8JB 4URFA 3V3KA 3A3NA 1YIDA 2JIDA 1VI2A 2W4MA 4QULA 4R3WA 2FPXA 2QL8A 1DC6A 4MJLA 4JASB 2AKAB 2OCDA 3FNRA 4BRZA 4B46A 1IATA 2HNBA 2QN7A 3E9RA 3LQ4A 3B1KA 4BFUA 2WF8A 3D9QX 4PBSA 3FOWA 1Z5OA 4KFUA 3KKQA 1BZYA 4LOIA 1I5OA 1PRYA 1PDVA 3W8FA 4ETWA 2WB2A 1WXGA 3AEQB 5G4KB 1W93A 1RWPA 2B4TO 2XBMA 2WYHA 2G88A 4O2BA 3I0MA 4JB3A 2PKEA 1EUZA 1Q2UA 2FWBA 2YYAA 3H4MA 3NVAA 2C9ZA 2VK8A 5D6OA 5AKIA 3SDZA 4DIFA 4EPWA 2CHEA 2YNMA 3FGPA 4J2TA 3EEYA 3U7EB 3S7ZA 3G8CA 3ZJYA 5EJ6A 4R2HA 1FFHA 4KV7A 2Y1FA 3QWFA 4HB2A 3TCNA 2PTHA 4LJ8A 5J2UA 1OF1A 1YGPA 2E4XA 3RYTC 4MWOA 4NY1A 5FR2A 1OA1A 2I1QA 2VT2A 4WKGA 4EKGA 1Y1QA 3IL2A 3PI6A 7GPBA 4L15A 2I2AA 1QUEA 2XWJI 3JVIA 1JR3D 3BWXA 4MKXA 1Z34A 4RHTA 4Y9TA 3ZUPA 3WWDA 1H3FA 1CR1A 1ENYA 1NQUA 2WJ6A 5JIBA 4FGKA 4KXVA 5IJAA 1I2ZA 2H1CA 4KXYA 3PYMA 1Z33A 3N86A 3T7AA 4B3TC 1XAJA 1YI0A 3LUBA 3TTUA 1T4BA 3LQQA 3PQ7A 1QO0A 3OF3A 5HS6A 3OT4A 4EI7A 1EHIA 3F8TA 1H9AA 4DV6C 4U02A 3ED1A 4BFTA 5JAMA 1CJBA 3VBEA 2PH3A 4BVHA 4MS3B 1K9VF 3WMEA 1GNQA 1YKSA 3SF8A 3ZLJA 3BMXA 4CTNA 2BRUA 4RGBA 1JXAA 4MW0A 1U81A 2Q1YA 4RMJA 3ISJA 1TQ8A 1XTRA 1B42A 3GA0A 4ZXFA 2EP5A 3PWZA 3N2NA 5JYEA 4NZOA 2DQZA 3MJEA 1QZTA 4QAQA 1FPQA 2J5BA 3L6OO 4OK5A 2JDIA 3A1EA 4X20A 1TB4A 3CZ4A 1F06A 4G86A 4LMBA 1PGNA 1DTSA 4NU0A 4PFKA 2ZTUA 4V0MA 2Q1TA 3UWSA 4EM6A 1XD2B 2VSNA 1V47A 2H11A 4DRXA 1RYEA 3FA2A 3KX2A 3ZDBA 3ZUGA 3HDGA 1DBPA 1UBGA 1YKGA 3G9XA 3IQHX 5CCEA 1QPZA 3G7UA 1C7JA 1M76A 2O2IA 3MS4A 2E87A 3LCRA 3QE2A 4JB2A 5JG7A 2WOJA 5FL7A 1N5LA 1KTIA 2PFKA 3HB0A 4BFXA 1KFJB 3ZBUA 2QN8A 5E6SA 1PSDA 1WA5A 2L2QA 2MR5A 3DH0A 1PJRA 3DW1X 3UENA 2O8CA 1E98A 2YJ4A 3PFIA 1G8GA 4IVQA 4QQ8A 1N3LA 2EWWA 1NW4A 2YWXA 3I08A 1R9NA 1E59A 1YK0A 3GG9A 3OZVA 4FYMA 2H2FA 4PHCA 5DW0A 1KI2A 3DEKA 1UM8A 4EO7A 2HHHB 2V8OA 2WMYA 1X7YA 3HSKA 3NS7A 4I4TA 4N3NA 4Q4DA 4TQ9A 5ALQA 4MXDA 3KB6A 1KS2A 5DYWA 5BPFA 3THXA 2R85A 5EIOA 4NABA 3OTOB 1WMSA 1L5SA 5M34A 1B6TA 2QW1A 3UMFA 1XPRA 2WPDD 3T3PB 3OEED 4ZP1A 4N6GA 1A82A 1V4BA 3LX8A 1B26A 3AM5A 1Z5WA 2EGTA 4QPCA 4I5GA 1EX1A 4EJ2A 2FR8A 1JMVA 1L7RA 5FLXD 3ENQA 4K0RA 1J39A 4JYZA 2OYRA 5I7WA 4PGGA 1P31A 1I3NA 3FJ1A 1X0VA 1PEAA 3G1TA 2ALJA 5LP1A 2DEUA 2RHMA 4MV3A 5CDUA 1N92A 2P9BA 2WKPA 2WKSA 4E5KA 1NVUQ 1UPTA 1G7SA 5EZYF 2G9ZA 2QA5A 2XT9A 1A27A 2AF4C 1FX0B 3L4EA 3LSYA 4NZNA 4OBWA 5FIUA 3JQFA 4X24A 2D3WA 4W7SA 3HA7A 4TQGA 1UFVA 5AUPB 1Q0TA 3W6OA 3QXHA 2I22A 4KE7A 3MRSA 4AW9A 3IOMA 1VRWA 1VZ3A 2IXEA 4KGVA 4OMDA 1L4BA 2FETA 4QGHA 4N3CA 3VR6H 2Z8YM 4E4YA 5BSVA 3AM3A 2CL0X 2QX9A 2QN2A 1JR3A 2H4FA 2C1ZA 1T1RA 4DYVA 1U1IA 3JQBA 1K4KA 2H65A 4QVKA 3N5CA 5EE5B 3ICWA 2P4EA 4MVJI 2CLLB 4HDOB 3CEAA 1W7AA 1FDOA 2Q2QA 2X9GA 1GCGA 3IAHA 4AXXA 5DP2A 3JVVA 2XNHA 1EUQA 2OMKA 1TC2A 2WAAA 2BGJA 2GEKA 3T5PA 4P4GA 4YRIA 3AHEA 4GO1A 3GO4A 4YCJA 5E7IA 5G0TA 1REQA 2LE0A 5JYCA 5F33A 1HI9A 3M82A 4IIGA 3TUZC 3AY6A 3A2KA 5E4FA 4EF4A 1MIOB 4FYVA 1L5OA 3BWCA 1W49A 5FPSA 4DREA 2XYQA 1PTKA 4NQZA 2O1SA 5E0OA 5KTTA 5L7TA 3C48A 1DFIA 1GGEA 3AKEA 3D8SA 3OQVA 3PUZA 3WLMA 2HW8A 4G0OA 1N78A 2J3HA 3NKVA 4GVLA 2ZZKA 2OPLB 1ZD8A 2F8LA 1N9GA 2B3DA 1GQSA 3CXUA 1RXVA 1ZVKA 2IPLA 2M6RA 4MITA 1MT0A 1SBYA 4OQXA 4YMTA 5BRNA 3I45A 3QA3E 4LW8A 1MVLA 4X63A 1WXHA 4BNMA 2JATA 5K51A 3BA1A 3HJRA 1NZJA 1J5EB 2G0AA 5E8RA 4DR7C 1WD5A 4N9WA 4MGYR 3ZU6A 1SIUA 4MJ3A 4ESOA 3DLBA 3CF6R 4EKYA 2YZGA 3DBRB 4K6OA 2PRJA 2HFKA 4R2IA 4ZCRA 2EZTA 4OXQA 2X6RA 3TCKA 4IF4A 3BXHA 5BOSA 3F4KA 1DFHA 2BD0A 2B36A 4Y6RA 4NBSA 2QXTA 3RRXA 1C1XB 4QDXA 2VQDA 3H9UA 2MWMA 1LNSA 2JIPA 4GPD1 4DFDA 1GTRA 4TSKA 3R3JA 1YTLA 1K8RA 4ZVUA 4BLQA 3WWOA 3I52A 1F48A 4BP1A 3C3YA 3IE1A 3ZCUA 5DI9A 2A5GA 3HA3A 4TKLA 1P1JA 3FFBA 2MOKA 2JCBA 3SZRA 3THOA 5FB3A 1U2DC 5JW6A 1M2FA 1X7ZA 2R11A 6YASA 2R5FA 4JLKA 2YXDA 2M5HA 4GX2A 1FDTA 4ZQEA 1DELA 3PVSA 5HIMA 3V7FA 1U80A 1J00A 2WPDA 5A71A 3OEEA 4MLPA 3SNKA 2IPXA 1J2UA 4MVJE 5IAGA 4BKRA 2PMCA 2NXCA 2WICA 1JSRA 3AWIA 4G5QA 4MQLA 3DZDA 4RV9A 3OSUA 5LDGA 4BNTA 4ZHSA 5FLXA 1HNZB 4ZAGA 2XDQB 3MJDA 3VPSA 4JI5C 3ZQ6A 4FXOA 4ND7A 1KXJA 3CH5A 2GN1A 3GNTA 3HFRA 4OF4A 1KEPA 1T0IA 5J58A 4B6FA 4EQ6B 5F12A 2XHEA 1PJLA 2MJLA 4HNHA 4B7ZA 4BNVA 2Y1DA 2WUFA 3COYA 2YYSA 2PX6A 1JIKA 4D02A 2FPRA 2H2IA 1GZSA 1R6XA 2PZFA 3GQBB 3SXUB 4WRRA 4TMXA 4FOSA 1QP4A 2QQ5A 3MEQA 4RMIA 2NU8A 1K7YA 3EIEA 1ISIA 1K6MA 1J8DA 1H8HD 1NE2A 1TQ6A 2QN9A 4IFBA 1Q3TA 4UAVA 5AI9A 3ONFA 3Q0TA 2QBYA 4UMVA 5E6RB 4IRMA 4IH1A 4JC0A 3ZKWA 5BUSA 2Q3EA 1RPZA 1P8JA 3D0KA 1N7GA 3H87A 1LS1A 3NT2A 2P11A 3TNDA 2HYIC 5IUKC 1J24A 5CFZA 3FI0A 3DUFA 2V3VA 3TRFA 2IGBA 4RSHA 1L9XA 1GGNA 4BZZA 1XPOA 5K4AA 1AZWA 2G6BA 3OA2A 3FCCA 2BJOA 1VKNA 3QVMA 3GGOA 2ZK7A 3BFKA 5I45A 2XQFA 4ZV9A 1DIGA 1JQJC 1UJMA 2FEAA 2OD2A 4NYIR 4Q9LA 1B93A 3T7IA 4BN5A 5HMMA 4E7PA 3TDKA 4LXHA 4KUHA 3G1UA 5F5NA 1TFUA 2NO4A 5I5GA 1CQXA 4IQGA 3ZTTA 3AEQA 1QBGA 3OPVA 2FX3A 5G4KA 3A1DA 4JVSB 1YQEA 3DB1A 1IYZA 1HF3A 3F5QA 1Y3DE 3RI3A 3ZWYA 4QGAA 5FR1A 4PYKA 3UC9A 4IRUB 1KI1A 4RA6B 4JBNA 4RGYA 3VVLA 1IBLB 3IEVA 1TJ4A 1F8GA 1SOUA 3C74A 3S2EA 4FZRA 4Y6GB 1ZMOA 3GCXA 4X61A 2NAFA 1E5TA 1XQXA 1ZICA 5D00A 2GR9A 3A6FA 2ANCA 3L6EA 3SIXA 2B4YA 1SQ0A 4MA0A 4NCNA 2EJTA 3OOJA 5LWQA 4I46A 3C5EA 1OA0A 1N2JA 3OWOA 4LK2A 2J31A 3GGPA 1G3IA 2RHLA 4KVFA 4R9RA 4RPGA 5D3QA 3QEOA 1UBCA 4Q4CA 3E7DA 2CJPA 4HBZA 1ATIA 1DC4A 3WZLA 3BXZA 1ZCAA 1L2FA 3T5CA 3EZYA 3CZ5A 5AJZA 4F6RB 1VL8A 2HJRA 1GFIA 3H04A 4FDLA 3WB9A 4F0JA 4WOJA 1BJRE 4ZCSA 3N39C 2XMSA 4YIKA 4HDQB 1A96A 1E4EB 1HL3A 4PAWA 4BEVA 1KFEB 4Z1OA 1PQYA 5DP1A 2YDYA 6AT1A 3HJTA 1G98A 1XRPA 1SZPA 4D9MA 5KSYA 4MS3A 3WA7A 1Q0PA 1PWYE 1ZXBA 4J6EA 4C07A 1ZINA 4QT4A 1DARA 1FP1D 2WAMA 2PLNA 4D0GA 5LA6F 1DADA 2WWWA 4MW1A 4MYUA 2OENG 1Q1AA 1VMKA 2XE6A 3TEMA 5CIYA 4DJEC 2NTEA 4HR7A 4XIGS 4E6EA 3KQKA 5LA6B 3K0AB 3N07A 2OWDA 1OZGA 3LW7A 2X19A 1FYVA 4AYXA 1PYGA 1XD2A 1QG6A 2OCAA 3M34A 4B17A 1YASA 1GAJA 2NIPA 1LPSA 1L4LA 1P6XA 4J8PA 2GK4A 1XFDA 2BFNA 4Q5IA 1OI3A 4KP7A 2B5VA 2CLOB 4NYJR 4C7JA 4PN7A 2FWPA 3W4JA 4BQNA 3VPGA 2QVBA 4F4HA 2VK4A 1Q74A 5I7RA 5ERGB 2XJ9A 1N6IA 1CRWG 1N1EA 5AI5A 5KPJA 1H8HA 4HUTA 3ZS8A 2GZMA 3DLPX 1YQUA 3I2GA 5DBFA 4AFNA 5C37A 3V1NA 4BQOA 1MJGM 5AH0A 2Q8QA 1JV2B 2QRUA 3OPNA 2I7DA 2IXGA 1NVKA 2O07A 3EXFB 4JI0B 5EE3A 1JQDA 4PZEA 3L1HA 1GY8A 5FWDA 2JFFA 4NU8X 1M1UA 3NRCA 4BKMA 1SRRA 1SUIA 2CW5A 2DWOA 2F9MA 3GDWA 3LC7O 2B2XA 3IURA 3QVTA 4YECA 3UJ9A 4C7OA 4K9PA 1EG7A 5I7SA 2UUBB 3K0CA 4LXGA 4EARA 3GCGA 3NXSA 2ZRGA 4C0KA 4CMGA 4PAQA 1QHYA 4QYMA 2ZUVA 4K87A 5L4SA 4B85A 1A76A 5CDTA 1I80A 4MCIA 5JISA 1DAEA 2X6QA 2WP0A 4L0DA 1GNLA 4ITVA 2O7NA 5BSTA 3O4VA 4M8SA 5DW3A 1Q17A 3SEAA 2PKXA 5LQSA 4DGSA 4EG6A 3T4PA 3GB9A 1UBTS 3OTHA 4MV1A 1GUFA 2EX0A 4FNOA 4EUSA 3K30A 5DV9A 3GFGA 1T6XA 3ZWAA 4EPRA 3KOMA 2QEQA 2NTJA 3PQ3A 1KE2A 3WLJA 2D1QA 3K31A 1ZD2P 4KO8A 4MDYA 2BM8A 1DJOA 5HTKA 4W9NA 5ALUA 1E6LA 3S6JA 2HA2A 2HF8A 2OILA 1FX0A 3O3MB 4MEAA 3D2CA 3CUUA 4HWSA 5GGXA 5DSXA 3E1KA 4MRVA 5EGNA 2KB0A 4YRDA 3S29A 4E13A 3GG2A 3NHKA 1J23A 2W4QA 4H08A 1XZIA 4P1ZA 3K16A 3JATB 1AS3A 4JSRA 4LUCA 4B48A 4GPZA 2Q3DA 5FTWA 5BNTA 1MX5A 3A37A 3JYHA 3WLFA 1MTZA 1VM6A 3OQJA 4JJKA 4LVUA 3R7SA 3T0GA 4GPTA 4X0EA 5CB4F 2IS4A 2G17A 3GH3A 1U1GA 3ETCA 4QJBA 2ZEJA 1E7QA 3SDSA 4DUYB 2OKGA 2RD2A 1SUCA 3K32A 16PKA 4L75A 4PX2A 1T25A 1OU0A 3KYJB 5B57C 2Q3HA 1KZ7B 4MO9A 3K71B 4W82A 3CX3A 5JSUA 4EG4A 1LA2A 1YE3A 2H52A 3DLAA 1GVHA 4OAPA 4WFQA 1C7EA 4AVYA 3HB9A 1YZKA 1QHGA 1U0HC 4MK4A 5JCOA 4D8XA 2G7ZA 2YCBA 1K97A 4RAQA 3AF1A 1R27A 1MIOA 1C7QA 2CZCA 4L27A 4ZCQA 3SDBA 3X1ZA 2GOYA 4BGEA 3OCYA 2KPOA 3NG1A 121PA 2JFOA 4TZKA 3AEKB 4LC9A 3IB3A 4CT5A 3GUZA 4PC6A 1NRWA 4KB5A 1XZAA 1JQ3A 1AS0A 3WK8A 3RC1A 1JEOA 3RYCB 1U7TA 4ER5A 1ORIA 2O2JA 2OPLA 4X6YA 1SELA 4NONA 2OCBA 2Y9MB 2VYVD 3PDHA 4NX2A 6PFKA 3HXLA 2GFHA 3L8CA 2CXRA 1OXBB 2IKQA 3PNBA 1V16B 3FPFA 2XUKA 3G0IA 1S2IA 2OQ2A 4MVJF 3GOHA 5FI1B 4HO1X 4WHMA 4ETIA 2BFWA 3BRWD 4HH1A 5JUWA 1N8SA 2BJVA 3PENA 4DA6A 1C8BA 3DBRA 4KR2A 1KEKA 1K5PA 2X13A 4R8KA 3DOOA 2HBRA 2O0MA 3ISVA 4C89A 3DOJA 3F0TA 3SJBA 4KYTA 1DKPA 1EAMA 1BS1A 2Q5JA 1C1XA 2R6GA 1DIRA 3TRHA 1HG1A 4MUHA 5KDDA 1E9EA 1JNYA 2IA5A 4X94A 5K0LA 3PEWA 4YWHA 2VZEA 4PZPA 1YDEA 1UMCB 1P2DA 2DC1A 2G40A 3C5WP 3U3MA 4JC5A 3CVXA 1O9BA 2B4KA 3FUWA 2KBEA 3N70A 2FPPB 2P30A 1PSZA 3L1KA 4EB0A 2P2DA 1XDUA 5K09A 1W35A 4KGXA 2AYZA 5IU6A 3TL6A 1QH0A 3LY5A 2EFDB 3NXKA 3A1NA 1ICEA 4RVDA 3CKKA 3NBQA 2P2ZA 3IQZA 4QQKA 5F78A 2R6R1 3IQEA 3MTEA 2V7XA 4K1LA 4NYIQ 5CAEB 3ZDXB 1P19A 3TZEA 3HGMA 3O0DA 2CCKA 2MTBA 5KKCA 2GCGA 1ECPA 4AQYB 4YTEA 2XDQA 4H27A 2VBIA 2DFPA 1G19A 3NHWA 3T1QA 4RDXA 1M3SA 2J08A 3I4LA 2YFYA 1U2PA 5FULA 3SQLA 3UMSA 4EQ6A 2NU6B 3W7AA 2DMRA 3LO5A 2PTGA 4UU7A 4U5YD 4ENTA 5JXGA 3DE6X 3GQBA 4Q1AA 5TRTA 3SXUA 4B5LA 3Q0IA 3HXQA 3R76A 3SC6A 3WR5A 1AB5A 1UFKA 4O4LB 3R5JA 3SFZA 4B6QA 4ZZ3A 4JOBA 4ZD6A 5HQJA 2JGRA 5TMEA 3CF2A 3GRCA 5J63A 1NF3A 2FYTA 2XUGA 3ON5A 5E6RA 1OAOC 3S8YA 4TTVA 3OLZA 2X23A 3CWQA 4K40A 1UIRA 1RZVA 1R0YA 1DOHA 5SY6A 3T52A 4M9SA 1KS9A 2GMWA 4RORA 4ZVKA 3TSYA 2HRRA 1BWRA 1I7DA 2B1RA 5KYKA 5JCPA 1E6UA 2X41A 3SKYA 2JGKA 2H29A 1P29A 3MTIA 4JLOA 5CLQA 3HDTA 1QRRA 5CEFA 1V9CA 3MILA 1FJ2A 1M6YA 1R00A 3N0VA 4CF5A 3VXKA 5KOYA 2BUAA 2HL6A 5DZSA 4ZOLF 1OFUX 1WPXA 1JRLA 1X6VA 1JDSA 4PNZA 4JI6C 4B33A 3ZQJA 2WAYA 4JC4A 3KOZA 4A0HA 2DH5A 2QSYA 3ET5A 1D6MA 3H99A 4RA6A 4A82A 2OZVA 4WDRA 1HWYA 3T9BA 2GCIA 4O4IB 5MF6A 1Z16A 1A95A 3V3TA 4ZVQA 2VYVA 1BX1A 1DQZA 1DXQA 2OOKA 4YGYA 3PQCA 1W5AA 3GV0A 3DNFA 3QF4B 1CHDA 2R6JA 4P7JA 2OGUA 4NYJQ 3VNVA 4DILA 5C8YF 5F1KA 1TF5A 1W0JA 3BRWA 4RZXA 2P91A 3IV6A 5DTQA 4I1SA 3SM9A 5MFPA 5BR8B 1ZMBA 5C8YB 4KU4A 3C4VA 1ZG3A 1SBCA 2RBEA 1EZZA 1RRFA 3KYBA 4GE3A 2R7AA 3E9ZA 1T4MA 3S3TA 5JFGA 2OQVA 1V39A 1ANKA 3EZGA 4RCZA 4B6EA 4BCBA 1NLFA 4IOJA 3WFIA 4F6RA 2ZBPA 4YCCA 1IK6A 4KC0A 5HF6A 3E9EA 3KOXA 1M8GA 3E48A 3RJ5A 5BY2A 3LBIA 4ERNA 3MQFA 2WQ7A 1TA0A 1TEVA 2X77A 2EKPA 1E60A 1N34B 5WRFA 5CM2Z 3MTJA 3GNSA 3HFGA 3TEJA 1FSFA 1ZGBA 3D0QA 4JXJA 2NU7B 2C4HA 3IELA 1H2BA 4NMLA 1KWKA 2Q50A 1TF2A 2PDAA 4DB2A 2F9FA 2VJPA 1BKDR 2E55A 3K70C 2O2YA 4I36A 1M67A 2JZCA 1ACJA 1RZUA 3I58A 4O8CA 2D62A 1AQ6A 5A1IA 3M4XA 4HGYA 3GBVA 3QPUA 1IEXA 3PFHA 3QV1A 3X1WA 5LA6A 2HB6A 5IMBA 3M5DA 1I2AA 3K0AA 4L2IB 3WMXA 3E8MA 1GA6A 2IZ7A 4Y6QA 2WHEA 3RUAA 5BMOA 3NM5A 3TG2A 2TMYA 4WOPA 4IO1A 3A3PA 3H4TA 2ZETA 3H5RA 5IJ0B 4P0QB 4JQZA 4LISA 3NTOA 3CY6A 4G0PA 2XQJA 1W9HA 3LMKA 1L4NA 4ME6A 1GNPA 1TTPB 3GR0A 2Z9CA 3AJDA 3W5HA 1V1MB 1Z68A 3S2IA 3FUTA 5GV7A 4BVAA 3WC4A 4NS1A 1RCFA 1N4DA 2HR1A 1VBFA 1N3YA 3IUPA 4O08A 3T7RA 2XWSA 3P2KA 4QXPA 4HS9A 3QE9Y 4F93B 1OYWA 1KYWA 2CCJA 1KAMA 2GXQA 3A4MA 5HP4A 2DFVA 3CH6A 2YS7A 1I9GA 4L02A 3JASB 1QOQB 1RQLA 3LLSA 1EVJA 4MUXA 2I6XA 4PC2A 3EXFA 4PR3A 1G8PA 5KQRA 4NE2A 5DMXA 2BTQB 4NCKA 5CFPA 2Z6QA 4ZQBA 4Y6SA 4CTKA 1QHFA 2YHAA 4D42A 4Y2XA 5C9ZA 5GJCA 4C3ZA 3A7EA 3GYGA 2EWVA 5LMCA 3WADA 2PWAA 1GPWB 2OEPA 5F2OA 2JAHA 3C98A 2H2HA 3OY2A 3N76A 3U40A 2V8BA 3GMSA 4HLNA 1NJ8A 3JX9A 3MOSA 1JVBA 1KZ4A 4JEIA 3VPHA 4F9TA 2XMGA 1R9JA 3GD5A 5EZQA 4X66B 1TZCA 2H92A 2OLKA 4QDUA 5HR5A 2Z30A 3EEBA 1XD8A 4ER6A 4F45A 1CZLA 1W85B 1CLEA 1U6IA 3QFFA 4YMVA 3L0PA 2ESRA 5AHOA 5TT1A 4E5VA 3HLYA 1XG5A 4HWPA 1MQAA 1NJFA 2FPGB 3OZRA 2F3UA 2Q7XA 4OMCA 5FHRA 3G2HA 2K6GA 4PC3A 2GZDA 1ICIA 2EDAA 3FZGA 4MW2A 4KHPB 2F3RA 4KI0A 4ZPJA 4JM1A 1OXTA 1V2GA 4CL8A 3ZQKA 4W5WA 1L7MA 2AE2A 5CDFA 5AW4A 4KWIA 1T3TA 3LZCA 4TPSB 1RJEA 4PSCA 4F4CA 5JH7B 4REOA 4M37A 3JATA 3LXRA 4ZGWA 4D4LA 4DR5C 4I9UA 5CVJA 4TWBA 2JGLA 1RLMA 4UM5A 3SJUA 2XWBF 3URMA 3QXXA 4LF8B 3FR7A 4KVZA 2JJMA 5KUTA 4D7AA 5IDYA 4D4HA 3VZRA 2X9NA 5IZCA 5AW9A 5DN6D 3IIKA 3BCSA 4GC5A 2O6HA 1RYFA 5CZXA 3FDJA 4OHFA 1SCNE 2ZB8A 1P7CA 3CSUA 3ETOA 5JRZA 3T41A 2X7HA 3VU9B 3PROC 1H1DA 2BMFA 3H1BA 2IK8A 3WTBA 1ZNXA 4NXNB 5EFOA 3UAOA 4A2PA 4FFMA 2OB1A 3AV3A 2ZI5A 2BHTA 3W8RA 1H4QA 1KETA 3EMKA 1BA3A 4Y3UA 5E8JA 3V4SA 2PH5A 3THSA 4UBNA 4IGEA 3VSAA 2P78A 1KY4A 3O84A 3IUMA 4EKIA 2IDKA 4ETNA 4QXOA 5K7SA 1XTSA 2ATIA 1F0YA 3AEKA 3FFXA 3OCXA 4GDMA 1XL0A 3DFUA 1KMNA 1GL3A 4EYQA 2ZJZA 1RZ3A 2EU8A 1S1MA 5PNTA 3UNXA 3OCCA 3TO5A 5MDHA 4NZMA 3T1HC 2HU2A 4URVR 4ZV4A 3RYCA 1XAIA 3UZ0A 2J3MA 4X71A 3DNMA 3O6VA 4X60A 3OQOA 1DXHA 1SPBS 1SO8A 2OV3A 3QKTA 4ZMRA 3NATA 1XLVA 1D5WA 1KY5A 1V16A 3ENWA 3WMFA 2VWHA 3CR7A 3V9AA 2ZTLA 3ZNPA 2BGNA 1P9RA 1ONNA 2PKQP 2Y93A 3CU5A 4O6VA 3RT9A 4C14A 2JFNA 4EJSB 4D9NA 4I8XA 2D7DA 1CEYA 4CM8B 4UULA 1NDHA 1Y81A 2QLLA 2JJ8A 3GGCA 4A8TA 2ONFA 5DM60 1RBYA 2ZPUA 5B3JC 2I5PO 3O74A 4DNFA 1L5HB 4ENPA 4KXFB 3RH0A 3AM1A 1TIBA 3EA4A 1DKMA 4BX9A 1A9RA 5C32A 4HKTA 3HSSA 4KWTA 2HMWA 5EJ7A 1JALA 1TEXA 1XYGA 4MINA 1UMCA 1HDIA 1DIHA 3E3MA 3OFJA 3U80A 1FNBA 4IEEA 4QC2A 5HOEA 4OO3A 5BPHA 2HA3A 4WZBB 2FPPA 3CNNA 2CDRA 2XCQA 3VZBA 4DLYA 3CO5A 1GSIA 4HRVA 3WHIA 2GJ4A 1ZKDA 3AF5A 3PQ6A 3NP9A 4LXYA 8OHMA 5A3RA 2H1SA 3PD1A 3AU8A 1RQ2A 4KODA 3O2NA 3KKKA 3OQ1A 2ET6A 3JVEA 3N58A 3ITKA 4QSHA 5CAEA 5CB6A 4DTIA 2PUDA 4JLVA 1D2RA 5GPBA 5L6MB 3MWJA 3KLMX 1J97A 3IMLA 4K5QA 2AHOA 4Q39A 2Q2OA 2A5YB 2YJ6A 3AI1A 3GEDA 2VZ8A 2DKOA 2G9QA 2QTNA 3DOHA 3QXSA 4GFDA 4J0QA 3T9AA 1MOZA 5T8SA 3VR4D 1N5JA 2EEZA 4OHUA 4F1JA 2NU6A 4Z51A 4C0LA 1E3MA 3BMCB 3I9LA 3WB2A 4H0NA 1PS0A 3LYHA 1ADBA 3OETA 3SVLA 4DV1C 5CFOA 4O4LA 3VUEA 1ZP6A 2EBHX 4M1OA 5BV1A 4ARAA 2V96A 4RTMA 3STUA 2GXUA 4ADSG 2JEYA 3FMGA 2V6FA 3T1NA 5BQXA 3BGVA 3TDMA 2BF4A 2IT1A 5KTYA 2ONJA 3B1YA 3A6HA 3LU1A 3L79A 3RS3A 1KI3A 3CMMA 3DEYX 1ZHHA 2IIPA 2D5LA 2N42A 5DN6A 3NJ4A 3GGGA 3IC5A 4M76B 3ZWXA 1VSQA 2JBAB 5C18A 2BBWA 3LKBA 3IQDB 3UCFA 3AOEC 4CU2A 2O8EB 1OXUA 1YAHA 2RI6A 2YN4A 1JTVA 3HBJA 1XQ1A 4JLPA 1RBMA 1YVUA 1SUSA 2M5OA 4UREA 2CV1A 2IEDA 5JBQA 1YR1A 4M9XA 2OFFA 2ZZNA 4INPA 2QDKA 5F9FA 1B6SA 4R01A 4G65A 1V3UA 3GPBA 2BGKA 3RRYA 2YX1A 1G8JA 1FLAA 1UDWA 4ILEA 3SLGA 1FVHA 4KQ6A 4R3UC 1BE1A 4AULA 1QRSA 1XPJA 1I10A 3A6JA 3E81A 3AFOA 4HLUC 2I62A 2R60A 4HS4A 4MS4B 2PNJA 4NV3A 2JIRA 1Z8FA 5AXAA 3VSBA 3WRYC 2C5HA 1XBTA 2OCKA 2IZ6A 5EMKA 3KHUA 1II8A 4R0MA 2VXYA 2Z58A 1GV0A 3RF7A 4AWAA 4JL8A 3DKIA 2AKEA 4O4IA 1YU6A 1EWQA 5CTJA 1Q3KA 4MMXB 4DADA 2UXCB 4RVNA 1P1CA 4RPCA 5EL0A 2G9VA 4D3FA 2BR3A 1NBME 2HBQA 3QF4A 4OG2A 3TKLA 3CNEA 1DV2A 2FUEA 3D6HA 3FCXA 4KN5A 1SB9A 4F4IA 1XU7A 1UBLS 3RVRA 1WU8A 4RK4A 4DC1A 2ZWAA 5K1ZA 5C8YA 1WBDA 2E0GA 2DPYA 3VKFA 2Q5OA 5CHYA 3I9V6 3Q9UA 2VTBA 1XRAA 2F64A 2C7GA 1ENPA 2CUNA 2OHIA 4KN6A 1OTHA 4IX9A 2AI1A 3DHNA 1UXJA 5CHEA 3SN6A 3PFCA 3RIXA 3PU6A 3ADBA 4ARSA 2AZDA 3W6ZA 1EVZA 1F20A 4AXBA 5K6AC 2E7GA 1HZJA 3EOZA 2NU7A 5LOVB 2H00A 1YB5A 1MB4A 4RPIA 1LDYA 2EKQA 4FGSA 1NQXA 5JV5A 1QCZA 1T0PA 2UXDC 4J90A 2GWRA 3ZV5A 2C9OA 4A8JB 1N5MA 2IZ0A 3BDVA 2J67A 2E5WA 3R0ZA 2I55A 4MQ6A 4WPGA 3DWEX 1BDJA 1ZFNA 2G07A 4D8UA 4LF7C 2X14A 2JKZA 4UM9B 1M2JA 3ZDFA 1LBSA 1G9TA 1SJ9A 3L04A 4OJNA 2HV9A 3F49S 4L2IA 2C5LA 3K72B 1YCFA 2W6PA 3BJZA 4F56A 2HADA 1V5IA 1USIA 1WXEA 1FUKA 3RIGA 5IJ0A 1ZVVA 1JIQA 2DLDA 2Q2NA 3G3EA 3VR4A 3O8LA 1OC4A 1JR4A 1Y5LA 1VBMA 3WX0A 2GUWA 3ZCQA 3REGA 4M89A 1V1MA 1DRVA 1NYRA 4WJZA 3SZOA 2XRYA 1JAYA 2DTXA 4QNRA 4XIJA 2ORWA 4MRAA 4AL4A 5JRDS 1CEXA 3IQWA 3L1UA 1A3CA 2RCNA 5E4JA 1ZM4A 4LV6A 1BX0A 1WZ2A 1N6PA 1A8QA 4AX8A 2FOXA 3G0GA 1Y0BA 4NBVA 4MUYA 1OLSB 4P4LA 4RJKA 2WJZB 4CG2A 3JASA 1NL3A 4CG3A 1GZVA 5I8PA 3IAM1 3ZYZA 2HSEA 2CF5A 3SQNA 1TUEA 4N5LA 1M73E 3BH0A 2BTQA 3EVDA 4HTFB 5DXAA 4R6XA 5EKTA 4XASA 4X7BA 4GKJC 1F8XA 3HCPA 4ZZ2A 4YV0A 4WSOA 1HLFA 4QECA 1QCDA 2XWPA 4I9NA 1PR6A 1UR5A 4MUEA 2J59A 1KFCB 5CB0A 2B37A 4PSKA 4TMVA 4J1QA 3L4KA 3RJ9A 521PA 2LPMA 3LRXA 2XKAA 4B7XA 2ZBEA 1RABA 4DLPA 3ZVKA 3T4XA 3T5TA 2CY1A 4KGZA 4QODA 1X1QA 3TTTA 4DXDA 1W85A 4A1FA 2XVMA 3PR1A 3BCUA 4B2IA 2YFKA 1Z0JA 1KQFA 4Q9AA 1UT5A 5TMPA 4B76A 1PF7E 4GR5A 3I9OA 3AEZA 4QU8A 2YV3A 4CV3A 2FPGA 1LK0A 2H8GA 2J3DA 3LT2A 4JL5A 2H31A 3ORHA 2PAFA 3B89A 1OILA 1TM3E 1Y5RA 3NBAA 4JWTA 1QDLB 5T64A 1UKEA 1HYQA 1KKLA 2XTJA 1TIPA 1LDNA 3H0EA 4KWCA 1UZLA 3VFDA 2QRMA 4YBRA 2FGKA 2HC9A 3FFWA 5CT4A 3WNDA 1QHIA 5EKUA 1C3VA 1ZBDA 2D2EA 3P94A 4PRLA 5EERA 4EFDA 5JJKA 1UF9A 5JH7A 4CF7A 5M3BA 1E32A 4FEEA 3NDBB 3FZYA 5GJBA 4GZLA 1IHDA 2EG5A 4ZMSA 4P80A 3GLGE 1DQSA 5TF4A 3E58A 4KQXA 1WLSA 1HDXA 1KMQA 3MT8A 3PWTA 5K3DA 4DLWA 1E79D 1R0WA 4I8IA 3D7NA 4NOJA 4OIMA 5SYNA 4RS4A 5BURA 5IXSA 2F90A 3GLTA 1VSUA 2VWGA 4EK9A 4RK1A 5IDQA 4RCVA 3WYEA 2IEAA 1GGVA 3JWJA 4NJEB 3K9GA 3U6BA 2VH1A 1FE8A 1GUDA 2YXEA 4AMZA 4B9AA 3WYBA 4DWJA 3VU9A 2EYUA 2ERXA 3CR3C 1ONSA 1DDOA 4LY6A 5CIQA 3O1IC 1ZM3A 2VHYA 1I4TD 3BJRA 4BB0A 2ZYSA 3DFZA 4YXFA 1YE8A 1NF8A 1TM7E 1EINA 1XROA 3DE4X 1QIGA 1GNTA 5LC1A 2O5CA 2JFVA 4RCYA 2G63A 5BN3A 4GL2A 1F0KA 4TYWA 1XNHA 4KG7A 2GYWA 1Z4PX 3HJHA 4CE6A 9LDTA 5ALTA 1CNMA 3RS7A 1LGYA 3D1VA 4RK7A 5K8LA 2V7WA 2ISCA 4CM4B 1ZKMA 4AJJA 2YMQA 1CUJA 3F2IA 3C70A 4I3GA 4OJMX 2ZU6A 1H69A 4B6OA 2PUHA 4JSTA 1LNQA 1YHYA 2ZS7A 5ALDA 3L77A 1FTGA 4EJSA 5DYTA 2WMOB 3GLFB 4CM8A 3EPKA 4P38A 1CS0B 3GEMA 3CUSA 4QWWA 1J8MF 2E21A 4G4JA 4CMIB 3E3LA 2AGVA 4GSLA 1L5HA 1X2EA 4K81B 5CUQA 4HVTA 4NIMA 4OYLA 3LL7A 5EXPA 1NNI1 4EJ6A 3L6CA 3DOIA 3PDCA 4NZZA 2FN7A 2PD6A 3GZNB 1YDFA 1BFDA 2R1TB 3SZUA 4AK9A 4FWTA 2FZWA 3R77A 4ZDWA 1MB3A 3AL2A 4YIHA 4WZBA 1N5OX 1DWPA 2VRCD 3HY3A 2WMDA 3AHJA 4KRYA 1DZ3A 3AFGA 4GT1A 5EUBA 1JKJB 3QVSA 5IAEA 4N4AA 2W00A 2BYTA 4OL0A 2UYGA 3D6AA 4NG5A 2ECFA 3PYXA 5E9QA 4UM9D 2C2HA 5EJFA 4EG7A 3Q7QA 4CEHB 1D8AA 2Q7DA 1LZKA 3IP3A 5KQMA 2PU7A 4J4BA 2O5EA 4OMUA 1OGYA 4HZIA 1LFAA 1EEHA 1OV6A 4FI3F 2MCFA 3K73O 1R10A 2NSHA 1X94A 2Y2UA 3RDPA 5AW7A 5J4KA 2C3YA 1FVFA 4XCQA 4JJ6A 2JNVA 4KAAA 2E5FA 2C7OA 4AJOA 4L5CA 5DYYA 1TJNA 1SG6A 4OM8A 1Z29A 3BMCA 1M2EA 3C3BA 1V7ZA 4KIGA 4M8LA 3JARB 3R3YA 1ZRSA 3LGXA 1ZDMA 2HRDA 3GFSA 5HIIA 1WTAA 2G36A 3BULA 1D3AA 2HM7A 1N2IA 3DPUA 3KR2A 3OPQA 3OUZA 4XTRA 4HDRB 3VO1A 2EVWX 4CR6A 4DT1B 1G2QA 4ECAA 2ZFUA 3VH3A 1WULS 5HNKA 1DO8A 4IDNA 2HOQA 4OGGA 3VU8A 4BOYA 1AD2A 2IXAA 1R74A 5JNTA 3SVZA 2G1UA 4DV0B 4M99A 2GJAA 1E79A 4UPVA 1M10A 1L7XA 5H8WA 1D6SA 3C3PA 3ZI4A 4ZEVA 1RADA 4Q4AB 3TECE 2JBAA 2O8EA 2YVLA 4PYNA 3EF1A 3F6BX 3EVFA 3L0DA 1WW3A 3NOXA 4IF6A 4WL0A 4H1HA 1VMIA 1N6KA 1UK6A 3PR3A 1ZEJA 4I08A 4XVHA 4PIPA 1UWCA 4L51A 4KR0A 5ALSA 2FCRA 3SOPA 4JHLA 4F71A 2PX2A 4YGXB 3VSDA 1J09A 2A67A 3RFCA 3ZY5A 4HWTA 7AT1A 1GWNA 5ENZA 5KTRA 3HACA 1E6KA 2GYUA 2QIOA 3HA5A 1LH0A 5CT8A 3QPDA 5BR7A 2ILTA 3NCTA 3TPFA 1LI5A 1WVMA 2GRAA 4Z99A 2QAGB 2QPOA 2Q5LA 3DTNA 4LFBC 4LSWA 4KMMA 1OXVA 1TM5E 3I5UA 3O21A 4MS4A 4CF4A 1R8QA 1W88B 1I3OA 4JLWA 4BEBA 2E4AA 2Q99A 1ZN8A 1SOVA 1NYLA 2FXIA 3DMTA 1I01A 4N0MA 4QBTA 5C46F 2IPNA 1C7RA 5LKAA 3R75A 4RVGA 5E2BA 4JI5B 2IX3A 1QK4A 2QRLA 3DXYA 2FZ4A 5F9MA 4YBZA 1E9BA 1A7AA 2ZAOA 4U8GA 4Q9IA 3D1JA 4AG6A 4IIJF 3BZBA 1N3IA 2AH5A 4B3SB 1BHO1 1I0LA 2Q6LA 2VKQA 2WU0A 4YAKA 4LC0A 2RJ3A 4URWR 1USVA 2QIPA 1NBOA 2J3EA 2WLTA 4HNRA 4ZCLA 4B83A 5H1YA 5DM0A 4D9HA 1QC5B 1S02A 2VPZA 1SCDA 4X64C 2YXLA 4I4IA 4HYYA 1NVEA 3I0ZA 3M6IA 2IUUA 3WI7A 3BZUA 3DYBA 4EG8A 1V5GA 3O83A 3SBEA 2Y0BA 2WZBA 2I1VB 2E18A 3P9ZA 4YRLA 3LV8A 2FG5A 4JEHA 3ZKAA 2R62A 2R9VA 1A4UA 2RHWA 1EE1A 4RTRA 2HF9A 3FLAA 4J29A 2Y0EA 2C83A 3BORA 3OZCA 1RKVA 1WXWA 1UPXA 2V54A 4FLEA 4ZJYA 1JU3A 1Y7HA 5AI0A 3L6DA 3E2IA 5BN4B 2VRCA 3DC2A 5DFAA 1PEYA 2HSJA 3JVDA 5LOVA 1CJUC 1TQ2A 2BP7B 3JTMA 4KKVA 5D5HA 4EITA 1OREA 5A2GA 2UUCB 4DZRA 2FFQA 3PXBA 1UWDA 2WFZA 3ORRA 4ZOBA 4OYYA 4A8JA 5EIAA 2NVWA 1JJAA 1C3XA 4UBLA 4BE9A 1N6LA 3K5PA 4K0KB 1KFBB 1XNJA 4HG2A 2OFXA 4FIZA 2FUCA 5GV8A 3RS0A 3F5FA 3ZV3A 3RSQA 2B1QA 4KE9A 1ZNQO 4US1R 3U7IA 2OP1A 4OXXA 3GFVA 4I1UA 5D5PA 4BGUA 1Z6GA 1FVOA 1P73A 1M1XB 1XNRC 1O92A 1RJDA 2VJMB 4Q7EA 3UTDA 1NYTA 4D26A 3OJLA 1RQPA 3W4IA 2RCYA 3S2UA 1XA3A 1YH3A 1TMGE 1SVMA 2X0RA 3RKSA 4QELA 3RS5A 1RIIA 1XEFA 1ZIXA 1QLJA 1CR4A 1CG6A 2WF6A 2W2OA 1NN1A 4TTTS 2GNOA 2N1MA 3HA2A 2UU9B 2QL6A 3IQXA 4BQQA 3K6KA 1D4ZA 1JKXA 5FI5A 1J1IA 1T8WA 1NP3A 1OLSA 5DX8A 4IFTA 1YHNA 3V8EA 5GJVC 4M86A 5AM0A 2Z0MA 1O93A 4YRQA 4HRAA 4BFVA 5CCDA 1E9DA 2RGCA 3HZHA 3HNOA 4HTFA 2C2WA 2Z5GA 1NG1A 3JQ7B 1XJCA 4X44A 3VSCA 4JV5C 3HXMA 4OREX 2B34A 2ZAMA 2O3UA 1K6XA 4IOKA 3C3MA 2F3SA 5KNDD 4CDMA 3B8HA 2HJSA 2XGSA 3NOQA 2FRDA 4LCJA 3ZE0B 1L5VA 3JZIA 3RYHB 3ZU4A 3L8MA 1IM8A 1Y6GA 4EMBA 3PYLA 4GOLD 1K7CA 3HGQA 2IHZA 1B2RA 1FK8A 3PGVA 4PO8A 4TT3D 2AJBA 2PGAA 1X15A 4IICA 2QL7A 1U9ZA 4R41A 4ROSA 4XA8A 3TKAA 1E20A 2RAVA 4E3WA 5LJIA 3E15A 4FC7A 3FCEA 2C0QA 2O6LA 4HNVA 1DB3A 2IYFA 1V60A 4U9UA 2P9FA 1CFZA 4DL9A 4B8WA 3BQMB 4Q1CA 1P44A 1Z73A 4HL6A 4M53A 5BYAA 1WABA 1L5FA 1I24A 4BATA 1KU6A 3VV3A 4BLSA 1KKMA 1SKQA 3HYCA 1UMDB 1Z6YA 4M8IA 1N4AA 4ZZIA 2PQMA 1QFSA 3G0OA 1IB0A 3C3DA 2ZUWA 1ABEA 3QTTA 3ICPA 1N2CE 4KRGA 5FO0A 5HFJA 4UNQA 4DRYA 4DSNA 3A1WA 4NULA 3I92A 3RAJA 2CYAA 3AUAA 3VKVA 3OZUA 4C30A 4AB1A 5FPTA 2F1KA 1JVNA 2GLTA 4BLVA 1Q1BA 2H08A 2VRBA 5KSOA 1EUCB 1DAFA 5DHQA 5AVKA 4NENB 4NJEA 3F73A 4NFYA 1GZDA 1IVYA 3QE0A 2R6CA 4V3BA 3F90A 2OAEA 5IM4F 1FEZA 4YJ3F 3DV0B 3QVUA 3EG5A 3Q3EA 4BCDA 4H1WA 2GASA 5ESXA 1QHEA 5FNZA 2ECQA 2NUPB 4ODIA 4W5QA 5FT9A 3WMGA 4MWTA 4PG7A 4PO1A 4YK7A 4P3PA 4A6DA 5DDIP 4MVJH 2PN1A 3T5MA 1OH8A 1SURA 4CG1A 1M2KA 4NLLA 2A1TS 4RMHA 3HP7A 4R2MA 3VZCA 2OCLA 4YAEA 3GEIA 2ZI4A 1L1FA 1QR6A 3MLAA 1RRPA 3ROGA 1A5ZA 4BO6A 4JKYA 5YASA 1L7EA 3HP4A 4KRXA 4RWEA 3GJ0A 3Q2KA 2J33A 4H7JA 4F8YA 5KOIA 4CM4A 5IWAC 1MX9A 2AA3A 2YW2A 1L7AA 1R66A 2VATA 1UC5B 2X7XA 4OFBA 4Q6WA 3VPXA 1FUIA 3VTZA 3FWNA 1NM5A 1CZHA 3B70A 5D01A 4LJKA 2R1VB 4FINA 1MN6A 3UV3A 2FSGA 4E2ZA 1G16A 5MN6A 1PV2A 4LQ4A 5ED4A 3GLFA 9MHTA 3PUKA 2C4KA 4X97A 2HHLA 1ENOA 1CS0A 1SA0B 2FSUA 2OOSA 5K6AA 2R8YA 4KI7A 3UJDA 4CMIA 1QF9A 4CODB 3PC3A 4EPTA 3L7KA 2HF7A 2XECA 3C3JA 4WXYB 1ESMA 2DT5A 3FROA 1KO4A 3IHKA 4GQIA 1ZOLA 3UJAA 2AYYA 5K0JA 4US2R 5G4LA 4ZARA 1MBZA 1T8TA 3GZNA 1GPBA 2R1TA 2VDRB 3R20A 2A7XA 4BL5A 2VP2A 1PJTA 2QU7A 1J8QA 5AKEA 1LVGA 2ABWA 4PYLA 1E7MA 3FF4A 2GPAA 3ROFA 4D0RA 2DE0X 4D46A 1O9HA 4YLYA 4JX8A 3B9QA 4R40A 5KNDA 3O4IA 1BEEA 4GOND 2QK4A 1JKJA 4RGVA 5DHSA 5DOZA 1S2MA 3RTAA 2PQ2A 1DUIA 5HUQA 2P4SA 1YDGA 4UUAA 1UANA 1GGJA 4CIVA 2XYPA 1GCIA 1Q0UA 2FX2A 2AN3A 3L6BA 1IN5A 2I0FA 4ZU1X 5BYJA 3RC9A 4TT3A 4CR7A 1F2UB 2ON6A 4IVRA 1MW8X 5EJ4A 4DWVA 1PZFA 3TTWA 1TCBA 1UMKA 2V0CA 4S0ZA 5F7ZA 1A5BB 3QMPA 1JIVA 2QUKA 1QANA 4MYCA 4O63O 4PCAA 4DAEA 5ARBA 1YZYA 1KXZA 1MB9A 4NAUA 2O14A 4Z7QB 3I9FA 2AVNA 3SWWA 2H18A 2JH3A 3G2QA 3JYQA 2BONA 4PRKA 1QVRA 2HCBA 2R97A 4UJ5A 5CFMA 4OJKA 3TQRA 3QVGB 4HPXB 4NZPA 2QN1A 2VJKA 3JARA 4BJHB 3HN2A 3WL8A 4QEDA 4JDPA 3UK1A 3ZBTA 5IKMA 2NVBA 3PL5A 3C7KA 3U7HB 2W8BB 3RVKA 4L8WB 3CONA 4HDRA 5FUYA 2LIVA 2DFNA 4XM0A 4DT1A 2XXJA 4BDSA 4B44A 2ADFA 1E92A 3HRKA 4TLLB 2XOKD 2AW3A 1ZOOA 2GZAA 2IVZA 1SG9A 2AEFA 4GXNA 1UKYA 3PL1A 4PPNA 3I9NA 3BSSA 1U2GA 1FLVA 1SKYB 3ANMA 1N8KA 2PBZA 2RJNA 1BXZA 3IBGA 3NAMA 4XB2A 1OROA 3SIRA 4Q4AA 4EUHA 4KREA 3VYRB 1CY7A 1K89A 1ZC3A 4QOSA 2G72A 5TMDA 3HPRA 4AZSA 5KVVA 4GS5A 1Y3HA 3EF3A 2EOAA 4M1QA 1E8DA 5E1MA 1M5TA 4DIBA 1P0CA 1ZGGA 2AG5A 4MP6A 2H1LA 3H2HA 3KPVA 4IYJA 2O4CA 3ZE6A 4FVTA 3ICEA 4BGVA 1JFVA 4H77A 1U7HA 3BT7A 2RK6A 4WZAE 2BSXA 2O8NA 4ISBA 1X9HA 2QAGA 3G2KA 3EVTA 5KVAA 2Y0CA 2NQ2C 2WA2A 5FYQA 3U16A 1UOQA 1NTOA 1W88A 3KAPA 4L16A 3WVNA 1N2SA 2VPPA 1YJQA 4PPGA 3C8MA 1OYVA 4JVLA 4TKUB 4JNKA 1C9JA 2N0SA 1NNSA 5JOQA 3DL4A 3VNSA 1EBUA 3I5AA 1XEAA 2BKVA 2Z83A 3GWZA 4XLTA 1IBRA 1M0TA 1O6GA 3LA8A 2VZ9A 1CRZA 3KSMA 4TTAA 5IT5A 1YRYE 5BXYA 3AVWA 2P68A 4HAOA 5AVTA 1NJ5A 3HCRA 1O97C 4QUAA 4TZ0A 2XUZA 3T3NA 4M54A 1YZHA 3DAPA 4MLCA 1QC5A 2JLCA 2RDMA 4OCZA 1J20A 2BFAA 5TPWB 3T3OA 2R68A 2IVFA 2TRSB 3J81D 3LHIA 2REXB 2XQKA 3LBYA 3TINA 4ZHQB 4ZYVA 3DO8A 4YONB 3TW6A 3VR5D 3MXOA 4AP5A 1A8UA 1DHRA 4XIYA 1LDEA 3G79A 3SG0A 3W90A 3NHZA 1IAVA 3WV5A 4NZ9A 5CA0F 5K0TA 4CM9D 1T3GA 2VNKA 1UPAA 2XR1A 3H6KA 1D1SA 4P4UA 3O9VA 2WEKA 2DHEA 5BN4A 1RRMA 2YXPX 2BP7A 3ETJA 3R6WA 4PC1A 1FU8A 2JCGA 4H0FA 2C0CA 3LA6A 3P9QA 2WIKA 3GFFA 4NDNA 2Z3VA 5KHLB 4RVUA 2G9RA 5A5FA 3O8NA 4HQLA 4BNHA 2RGEA 1BRTA 2CHGA 3B1JA 5IULC 3GT7A 4TMZA 2FZ5A 1RLIA 3KVRA 5DHPA 2SKDA 1JB1A 3RVOA 3DOUA 1OXXK 4O29A 4DWWA 1BH6A 1GR0A 1QYIA 1SXIA 2XQGA 4JI6B 3CN9A 4TTQA 3RKRA 2GM9A 4CLHA 2UXBB 2GTHA 5TX7A 3PJFA 2CEKA 5KJ6A 1X1EA 3V97A 1YO6A 2PN2A 1E3QA 2VJMA 1CJSA 3B6KA 1SKUA 2CE7A 2FWNA 4HQOA 4U1RA 5DXJA 5TF0A 1EWRA 1YULA 4KFSA 3VSEA 4Z2YA 3AK4A 3F8WA 4PX3A 5HIKA 4G97A 3UK2A 1MV5A 1O7JA 2AFHB 4P83A 2BE9A 5ED0A 1SOAA 3IQFA 3CJRA 3KZXA 4IBOA 4JKIA 3UUFA 3E0XA 4O5OA 5FWAA 4EHAA 2JJ2D 1C9YA 1QHHB 1KI7A 1RJFA 2ZQYA 3STXA 4A7PA 2HZBA 5CLJA 1QRDA 1Y1RA 1Y8ZA 1QM4A 1KIAA 1ZU5A 1DXOA 2H7YA 2MSEB 3WRXC 1PGQA 2XOKA 3FTDA 4CXMA 2ZJ1A 1OSNA 4N5IX 2P6UA 3R9XB 1V3TA 2V9ZA 3MJTA 1WEHA 4MPDA 4DYHA 3TSOA 3KWMA 4FGLA 4KWEA 1B1AA 3C14C 3JQ7A 4TRRA 3OO1A 4GW3A 2EKBA 3D0RA 3H5AA 4C29A 3ZJTA 1S89A 3RGWS 4NTZA 2OHGA 3BE6A 2L82A 1PTJA 4ALMA 1VI5A 4Q03A 5HE8A 3LFUA 1Q44A 1TK2A 3I61A 3V2IA 3RYHA 1ZQ9A 1RWXA 2YZ2A 3TSWA 2LKDA 4ZALA 2DR2A 2XVZA 3EBLA 3T0FA 2ZTVA 1E1LA 2V55B 3P8ZA 4KQHA 3ACBA 3R3VA 3A6DA 4PLPA 3A6LA 5F35A 4RE6A 4EPVA 3ND6A 2G5CA 4NP6A 4N18A 1GNSA 1U8YA 3GRAA 5AXCA 5T3YA 2NNLD 1QYVA 4ZICA 4CMCA 2HU8A 4HLCA 4WEOA 1C4WA 3NPDA 1JXOA 3U19A 1DCKA 2VSOA 3CRNA 3E5MA 3S40A 3ESRA 1NU6A 2DQSA 1GA4A 3LY8A 1GZ7A 3JAMD 1N2BA 1UMDA 3L0SA 3BSWA 1HORA 4P4TA 1A1VA 4X3OA 4XYGA 4LX8A 1Y6ZA 5B55A 1G21E 1WQ4A 4DCVA 2WSIA 1ZJ6A 1JLSA 2WIFA 4PLGA 5AE1A 1L3CA 4UHHA 3F47A 1USGA 4GZ5A 2IUYA 4M87A 4MYTA 4EAAA 6CHYA 3J81A 2CVQA 1J8VA 1F9EA 2M9MA 4B80A 1EUCA 3D3WB 1ZVJA 2D06A 3O4GA 5FBLB 3VR5A 3NWJA 3WIEA 3WO0A 1PVOA 3A9TA 2YJGA 4NENA 4A6XA 1QGDA 5TT0A 1H2FA 2Q3MA 1SD2A 5ALKA 4PM4A 1GUAA 3KJFA 3QBTA 5JYDA 2ROQA 3ESDA 2V97A 1E3LA 1XU4A 4G8DA 4CM9A 4HV4A 5JZBA 4TWAA 4BLOA 3SE7A 4JUCA 2NUPA 4M21A 3EXHB 4PYMA 3ZHOA 3GDHA 1NVXQ 3EFBA 4A4DA 1Z6TA 3IXLA 3KXPA 3L7MA 5CNJA 5BR4A 3P45A 1X70A 2W71A 2WU3A 4KO2S 5ITSA 5EXDA 1CBUA 4LZPA 3SKXA 5DLEA 1CK4A 4RTPA 4RA9B 1S5PA 3I07A 3K8ZA 5F64A 1CY6A 5CXXA 2CBGA 4MKHA 4XWWA 1SWVA 4GQBA 4BSZA 4RENA 1WB6A 2G8NA 3PRKE 3USZA 3WYDA 3FX2A 2JVKA 4IFIA 1MOQA 1ZW6A 2A6PA 3S2FA 4AD8A 4FTWA 3OKFA 4U0JA 1ONBA 2R1VA 2JA1A 4W9RA 3ZHQA 4DCCA 1BHSA 1EP1B 5GADl 1YKFA 2QB5A 4UCQA 3UOWA 1SA0A 4EHHA 1WSWA 5ADUS 4YQZA 4F96A 5K0GA 2IXBA 3W05A 5JXJA 5JE8A 4X1KB 2JCXA 3ABRB 4PCVA 4LI0A 4DR5B 5I9TA 1BVHA 3S5UA 4C1NA 1QQAA 1WU7A 3ESXA 3U3XA 2BDTA 3FOEC 3MNFA 1NR1A 4BAGA 5GGYA 1OLXB 2EATA 5EHQA 1PYDA 1TJYA 5HFAA 4N5NA 2HLPA 3OM8A 5HIJA 1PQPA 1JHOA 1YDMA 3O47A 5K4GA 3QK7A 2GWHA 2JFUA 5LMZA 5FBWB 2CFOA 4FEAA 3L1VA 5FPQA 2R8PA 4ZO9A 4MPRA 1GPH1 4ZEMA 4C2AA 3U7JA 3MGKA 4PX9A 3QG1A 4YVFA 3E9MA 1R3UA 4JBHA 1OIVA 5HJEA 2JI6A 3KCQA 5LQNA 5AVJA 3H4VA 4MWCA 1CJVC 1WPGA 1IPEA 1F2UA 3SR4A 3VYSB 1U8XX 1OZ0A 5K0SA 3S44A 4LRQA 2R96A 4B3IA 2JB9A 2P1RA 2W9XA 5IT0A 2B0JA 2EXXA 2O2XA 2QG6A 4I55F 2A94A 5JS2A 4MO2A 3LYLA 3EXG2 4JODA 2I8CA 1RSZA 3CPEA 4KXNA 4OUDB 5EEHA 4ND4A 5MFZA 3QVGA 2JLSA 3B1WA 2E7ZA 3AERB 3BIOA 2J4CA 2Y4NA 3JAMA 1SVKA 3H3XA 3G1WA 3KQYA 2CD9A 4ARBA 3HXOA 2W8BA 2H7XA 2FDXA 2R4UA 2CLSA 3JYPA 4YQEA 2BISA 5HKBA 1HE4A 1H3EA 1ZM9A 2ZJ5A 5JDCC 1T8YA 2QTGA 4QGFA 2YWBA 3GA7A 3HU5A 5LYJB 1EXDA 2GD2A 1NC3A 4K2AA 3V4OA 4B3HA 2YYZA 2WIJA 1KMIY 1CUDA 1G5QA 2W8ZA 1DO2A 3FFTA 4WADA 1XO1A 3MRTA 3B6MA 2FN4A 1XRBA 1BQEA 1QONA 3B5IA 3I2HA 5ESDA 3RVDA 3AFNA 1HSZA 4WEQA 2J6HA 1GTVA 4UMFA 2C2BA 4GHWA 1GV1A 3B5EA 3H1PA 4G8JA 1YDHA 1P4EC 1QHSA 4LNAA 4GGMX 3GWGA 1W0KD 3W04A 3H0CA 4ALJA 1U0FA 5DGIA 5C8VA 1NDUA 1YR9A 3DP7A 3LS2A 4DTCA 2JCSA 1JR6A 2AV6A 1AKNA 1DLIA 5DEOA 4XLLA 4GNRA 3G0BA 4FYXA 1QXSA 2GM5A 4QUJA 3TIVA 5DM70 1WVIA 2NTVA 4KSCA 1COZA 3ZD7A 1OWOA 3PJGA 2X0NA 4NFSA 4TKUA 5C5IA 3OJEA 2WKQA 2MSCB 2PZEA 3V34A 2P9GA 1RW4A 3NOOA 3NUGA 4KH1A 4F8EA 2QWXA 4YT8A 4TVSA 4A2WA 4Y1EA 1N8NA 1E1MA 3H7AA 3ZV6A 3VZPA 3H42B 3D64A 4DSZA 1NZFA 1S96A 1VHTA 2DSTA 1BC5A 2ZYIA 3CZCA 3DFKA 3HJGA 3KU1A 3QM1A 3MWEB 1PX2A 4BE4A 5TPWA 2OXCA 2H1VA 4LBWA 3HK2A 1NONA 3RV4A 3ZV4A 4ZHQA 3M5CA 5EA2A 5CRIA 4AKGA 1W5TA 5K8CA 5MN5A 3NFYA 3PITA 1YB1A 3H97A 4UVEA 1SXJB 4A2CA 3Q8KA 5FPHA 1RRCA 3CFYA 1O95C 3HVHA 1ZMXA 4IDAA 4A23A 4QOEA 3V8QA 1L5RA 3W1VA 3MQ4A 4YPOA 2A33A 2P7IA 5CA1F 1GN8A 4QYSA 1XA4A 4FZJA 1FW6A 2VEDA 2JLAA 3EVAA 2R6HA 1IVSA 2QLNA 3HBAA 1ZXLA 3FZEA 3VKWA 1JLRA 2PQ0A 5EMMA 2NVUB 4WGGA 4ZTZB 1JEYB 4M0KA 1BMTA 3B6JA 3ZE8A 4UMDA 2C84A 1WG8A 3L8FA 3S2GA 5EXTA 1KHTA 4BVFA 1NJ1A 2PK3A 4XM2A 4E88A 1TU0A 5FOQA 2RB4A 2MCQA 3BGSA 4KWHA 4RC9A 4LVNA 1QO7A 3FDZB 5SZJA 2YJTD 2D7CA 1PG0A 1Q3HA 3QLUA 5IYZA 4UTZA 4YS6A 3V5NA 2MHCA 2A0UA 3CRVA 4EUEA 3L95X 4D9JA 1XZEA 4MAFA 3ELWA 2AFHA 2O0KA 3AZQA 4MQBA 1RKBA 5TPZD 4BPRA 2WM3A 3E82A 4C6TB 2HA6A 4R2KA 1KYYA 1I0ZA 1OXMA 1QHHA 2QM0A 3H2KA 4KJZA 3UFXB 3P0JA 3CF0A 4WFKA 1DBRA 2YDXA 3IBYA 3IKLA 4NATA 4OHVA 5LMNB 3WLEA 4MWEA 3I04M 2RGAA 2WVAA 1ISSA 3UGKA 1CDDA 1T9AA 1ULSA 1WSDA 2YIJA 4GL4A 4P9NA 1FCJA 1JQEA 5JBIA 3R9XA 5AW2A 5TR9A 1BW9B 1GL6A 3BEDA 2C77A 2HWKA 4GBGA 1LTQA 3A70A 3KQOA 3IAS1 3HWRA 3DDWA 4MYRA 1DJQA 3MWFA 4AG5A 1V8BA 1ZJYA 2I2FA 5A4DA 3QKWA 3I5YA 4KR7A 3GJ3A 4BTVA 2X1MA 4HB4A 3W2HA 2QQ0A 1E8MA 3VYVA 3UPTA 1I4EB 1JPJA 3R4CA 2FUNB 4G9GA 4XD7D 1UJ2A 2Y68A 3LI2A 2Z8YA 1N5IA 1R0RE 3TJRA 1W0KA 1HNWC 1SXGA 3EPLA 3W5DA 2RI1A 3CE9A 3HNRA 3HU3A 3RE1A 1EG2A 2BR5A 3ROMA 3RW9A 3C3WA 2DOKA 3CEPB 2DZDA 4V3CA 3ZJUA 2QG4A 1RY2A 4DV2B 2WR8A 4MV8A 3VHQA 1XIVA 1D03A 3GBSA 1TFRA 2AR9A 3N59A 4JP3A 1YR8A 3PPWA 5LLTA 3EB9A 2FOIA 4Q66C 4E1BA 4RD6A 3PNYA 3IAM6 4XOIA 3IEUA 1Z6PA 1MGOA 2QSJA 3RAPR 1TT7A 3QXJA 1I7PA 3V2UA 1HL7A 1MFPA 4OLBA 1JG3A 1FBNA 3D4IA 4OB8A 4ZEWA 1NXPA 1L4KA 2Z09A 4BIIA 4G5XA 4UEQA 3QVJA 1UPFA 1G4UR 4HQ6A 3TLKA 8ADHA 4TTIA 1W2HA 1O5TA 3D3WA 3IEXA 1DS6A 2CMFA 3UT0A 4BU1A 4R7ZA 4KTTA 4OHMA 1PE0A 1Q77A 2DBYA 1IQ0A 1Z7GA 1LX7A 4DM3A 4ZCTA 4RTKA 3J7AC 4LFAC 4P7BA 2ACWA 3TNFA 3NYWA 3W7BA 5AKXA 2YBEA 2NVOA 1JF8A 3P0HA 1XS3A 3IB6A 3EXHA 3Q6IA 1JL3A 4OGWA 3G7SA 1QWOA 4CCWA 4BKOA 4JCCA 4P98A 1JBEA 4Q7MB 4CN9A 2H2DA 2YN2A 1T6ZA 3CCBA 5HE9A 3KR9A 3V1UA 3DDZX 1IRXA 4E3ZA 2CSXA 4P32A 3PUVA 2PSDA 4RA9A 3QU9A 2WSBA 1O77A 3EH2A 4X6LA 5FOWA 1KVRA 1CRQA 1NC1A 5IT4A 3UHAA 3OP1A 3FVVA 2O1XA 3V7NA 3WIVA 2D28C 1RQGA 2DG2A 5C1BA 5FPKA 2J0UB 3L1JA 4LHWA 4MTCA 3FH0A 2GHTA 1X1TA 4J1TA 1OFHA 4TWIA 2HIGA 4U7FA 3WIBA 4B45A 4BRWA 3KKLA 4PANA 4O0LA 4C88A 2CL6X 4XWYA 1PAUA 1DKQA 1E0KA 3P19A 5TPZA 3TUJC 3FPGA 4TX1A 3KOOA 3G59A 2Y1EA 4NMHA 4MCJA 4I1PA 1DJLA 3CVYA 3OJCA 4X1KA 4MHTA 1SXJD 4FX2A 1C7FA 4BTLA 1UKCA 2FHSA 2PSFA 3N3AC 4ZU6X 4UEOA 1FUEA 1M7HA 1GKIA 1JQAA 1WIWA 1XVUA 4G37A 2OPBA 2WHQA 4KMSA 3ICQB 2AFIE 3RUHA 3WL7A 3F6CA 3FYUB 2F43A 1UBEA 1YUMA 2OG2A 3EIOA 1DBWA 2XT0A 2WQ6A 5C2JB 3PX3A 5DWQA 3B20A 2BM9A 2O0LA 1AN9A 1Q6ZA 4RTJA 2BFDB 1D2CA 3DKVA 1COWD 3OZBA 3QXCA 2PD3A 4QARA 4HNTA 2UV8A 3PG5A 1K6EA 1E58A 2IW1A 4XD7A 2IX9A 3A1TA 3DBOB 3G5UA 1M8KA 3FLEA 4UHCA 4L08A 3OF2A 1EM6A 3W9SA 1K3TA 4BV8A 1X3SA 2XVAA 4AF7A 3LE8A 3MC1A 3P2YA 3GEPA 3VR3D 1EWVA 1R0KA 2CB9A 1G4HA 1ZW1A 2QUJA 4DLRA 2H3HA 2OORC 1ZWKA 1TT5B 1E5LA 2AMLA 5H80A 5HK9A 4PINA 5IJXA 5T4EA 3LCUA 4AJ4A 3ZJVA 1DEHA 3C1AA 4OUDA 3GAZA 3CXRA 4JROA 1CDZA 2ZKIA 3WKBA 4PBTA 4IFEA 3AERA 3OO0A 1EGAA 3AQ4A 1D6JA 3OLVA 3QUCA 3RLIA 5FRDA 1Q83A 3LUHA 2BN4A 3DNPA 1BIFA 1GM5A 3KKOA 1KO5A 3LZDA 2WJAA 3ZPXA 2SHKA 4EA7A 2FN8A 4UOEA 3ENKA 2XF8A 4CKZA 1Z5PA 2EQ5A 2GSDA 3OG9A 1OGJA 3KXKA 4INOA 5LYJA 5B3JA 3PCXA 3E4DA 3UGQA 3UYLA 4NL4H 3S1SA 1C0LA 4RQAA 5HQ3B 4QA9A 4F12A 1NPDA 3NANA 2Y0PA 1JE1A 2XMBA 1N0WA 4S2EA 2QTVB 3DB2A 4CT4B 3PHBE 5A3JA 4FW8A 2WVJA 1EJ2A 4JJ8A 2PS9A 4JFAA 5EUQB 5D84A 4RFVA 3FTNA 4M1MA 1JEQB 2BHNA 2JD1A 3CKYA 2P62A 1JR2A 5AM5A 1M2VB 2QSUA 3K6JA 1E89A 1FTNA 1DX6A 1XVAA 1YMUA 2EV9A 3I9MA 3LRPA 4QPZA 2NPFA 2IS2A 5JDIC 4GLOA 4YQFA 4ZVNA 3PLNA 2EG9A 1QYRA 3W8DA 2R0QC 3LDUA 1J21A 1MX3A 3K5HA 2Y8EA 1T4CB 3BYZA 3IOCA 3KKMA 3EWSA 5LP6C 1N33B 1KP3A 2D0IA 4DM7A 3E9DA 2KDNA 4HVAA 2FPLA 5M7EA 1NVWQ 2AI2A 3IBFA 1XRNA 4P7FA 2BZ1A 3O73A 3QX9A 2H16A 3DDNA 4IG9A 3ZN2A 3S1AB 2FJ0A 1K7SN 3MLBA 3VU1A 2AXNA 7ABPA 3H3JA 5LZ2A 3O3CA 3IHTA 1YAJA 2V7QD 3BC1A 1FJGC 3QXGA 1T2NA 1P3JA 1NJ2A 1C0EA 1WDLA 3RIYA 3OMWA 2DETA 2B78A 2JIMA 3IPXA 2F67A 3MWEA 3GLIE 1PFWA 4R1PA 2CXSA 4K1XA 4RF3A 3RS4A 3A6KA 4R8RA 5L3SB 1J2EA 2EERA 2IYSA 3D3QA 3QPVA 1M0WA 4JS0A 1G8AA 1I5EA 2X76A 1SXJA 5T7BA 2B82A 3NBFA 2CJFA 3JWIA 1IOVA 2BPOA 2QHXA 1N8TA 3B9BA 4OLJA 2GERA 1WXDA 5G0WA 3T94A 3BXOA 4M1WA 4ODJA 3FI9A 1AQNA 8MHTA 1PZXA 2VNSA 1L5KA 1RZRD 4RMGA 1N36C 2O7RA 2XUHA 2A5DA 4ZRMA 5G53C 3U48A 3OIDA 3L0IB 4EHDA 2NVUA 1DKLA 1COWA 4II7A 5T57A 1JEYA 1J42A 1Z2AA 1TVKB 1LKZA 2P8JA 4N3GA 5FTKA 4QQRA 1MJGA 2WJ4A 5I9MA 4B4DA 2VQSA 4DDHA 3PWKA 1IUOA 3R8CA 4BLWA 2X22A 2VSFA 8ABPA 3ESYA 1U28A 3EE6A 2GBCA 2OAQ1 1M34B 2XF2A 1XVLA 2J3KA 2QMHA 4FMDB 4J7UA 3OZAA 4PHGA 2AOXA 2FEOA 4KXQA 2E4WA 5DM2A 1X77A 5TQ2B 4W8OA 3VR3A 3AUXA 3ICCA 2ZSHA 3FDZA 2D00A 3TZHA 2CYBA 1XP8A 2OV2A 1QFJA 4QDTA 3K2EA 2DPXA 3WGNA 4YAGA 2H4HA 2P4HX 5CLGA 4G8BA 1WTCA 4CM1A 2PUCA 2Q62A 3OZTA 3FWKA 5DMHA 5HUHA 2YNMC 3A58B 4UVHA 3TS1A 4ZI7F 5I4CA 5H70A 3UFXA 2CY0A 5TEWA 4JXZA 1KQGA 2DQKA 1Z8NA 2EKDA 1SD5A 3FBWA 5EG5A 5A0FA 3FOFC 4C6RA 1XNQC 4TZ6A 2PZJA 3GFBA 4K88A 5IG2A 2SICE 2H7CA 4I66A 1BW9A 3LQFA 1O0SA 4ZQCB 1VPWA 3CIFA 3FZNA 3UAGA 5LU9A 1XLTA 5HJ2A 3TLMA 4B7UA 1Z8DA 1GPAA 4OU4A 1C5KA 1MF7A 2NV0A 1R50A 3VHLB 2CNBA 4U63A 2J8ZA 5A1GA 1OU4A 2IPAB 2XAUA 3AB3A 4LAFA 1XCJA 2V6IA 4WK4B 2LRHA 4FHFA 1F9AA 1SHJA 1SUEA 4KDFA 4PE5B 5FP0A 3WK4A 4EGCB 4XVCA 3O3NB 2RKBA 3IVRA 2Q5IA 2VPIA 3QBJA 1G1MA 1KRXA 1VHDA 4JI7C 1WAMA 2BRUC 3HGTA 3W5JA 3P0EA 1YOVB 5LUAA 1R6UA 4II2A 3TRKA 4RJTA 2I2XB 4RH0A 1M6HA 1KYZA 1XQ9A 2TS1A 1C4XA 4PX5A 1ZITA 3SF0A 3U3OA 3IDAA 1LX6A 1YFZA 1JAXA 3IP9A 4RNCA 5EVCA 1YMVA 1OH7A 1CR0A 1RLTA 3FWYA 3TG8A 5CNIA 4HJRA 2V7QA 3A0UA 2MMCA 3FWHA 1AX9A 2P75A 2PWPA 5FH9A 2WKRA 1DCTA 3N54B 3JAWB 1IY0A 4PYJA 2V58A 4R2JA 3G13A 4IDDA 3TLJA 2ZPAA 3CUVA 4D99A 1TEZA 3F6EX 2ZIGA 4HFMA 3R0XA 4PTLA 3F6PA 5SICE 2UYOA 3ED5A 3OESA 3RFTA 1P8AA 3U3RA 2R84A 1PQUA 2FWAA 3IVAA 1ZH2A 4OGFA 1JIJA 2FP4B 1JXMA 5JPIA 1G2OA 3EWIA 5I48A 1J33A 3ISTA 3WGHA 2OCYC 5JSKA 1O4WA 4FCWA 3VC3A 1I2CA 1RJWA 4AZVA 1QFXA 3K4HA 3SHFA 5EI5A 1DIAA 4DAOA 5A1JA 1L6RA 1RZRA 2TMDA 3CS3A 4DIEA 3Q5GA 1QNFA 1E2UA 1UK7A 2QLFA 1Q20A 4U3JB 5A3SA 1PBNA 4M1SA 2VTBB 4KQGA 2DAPA 3GRUA 4WLOA 5LXTF 3ILYA 4EHJA 4L5IA 4UM7A 4D92A 1GCAA 1W5BA 2JAWA 4J7XA 3U17A 2OO7A 2B8TA 3HZOA 4CDRA 4DV5C 3BE8A 5JLJA 3F6YA 1GPYA 4BFYA 4FJ0A 1UZMA 5LXTB 3J81k 2XEDA 4POOA 3OSZA 4N0QA 4JSYA 1OFVA 2KZ0A 4D0LB 1BYUA 3RQSA 2C4UA 1B4DA 2FR8C 2A92A 4PWYA 4C05A 1U7DA 3B12A 4WXRA 5AJUA 5F2EA 4MH0R 4CIWA 4RV4A 2JLRA 3VPBA 2J0UA 4XFKA 4RANA 4F3TA 1U8CB 3R7FA 3B3QA 1D4AA 1NWHA 1WS6A 4EBFA 3FPEA 3PIRA 3K9QO 4P93A 5DIZA 4Z3KA 2ZRQA 3DZIA 2BFOA 3AHGA 5AJHA 2QQFA 2AN1A 2COEA 2ZTMA 1PU2A 1PS9A 3D7RA 1VIAA 1EA5A 5D85A 3R3HA 5HGJA 3S27A 3STTA 3W4KA 2QJTA 2Z57A