2Y27A

Crystal structure of paak1 in complex with atp from burkholderia cenocepacia
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
LEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGTTGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Ligase
molecule keywords PHENYLACETATE-COENZYME A LIGASE
total genus 149
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y27A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y27A01
4G37A 5BSRA 5BUQA 5BSTA 2WD9A 2QVZX 4W8OA 3LNVA 2D1RA 1MDBA 1T5HX 4FUQA 4WV3A 5BSWA 4RM2A 4R1LA 4GXQA 2QVYX 3CW9A 2P2JA 1PG4A 5BSMA 2D1SA 2P2QA 5BUSA 5KYVA 3R44A 2D1QA 3NYRA 3O84A 1MD9A 5JRHA 2VZEA 4EATA 4FUTA 4GR5A 3KXWA 3IPLA 3DHVA 2VSQA 4GXRA 2Y4NA 3EQ6A 5BSUA 1BA3A 2P2MA 3E7XA 4IZ6A 4RM3A 3C5EA 3PBKA 4RLFA 5BSVA 3WV5A 5BURA 2QW0X 2D1TA 4OYCA 4RVOA 3IESA 4R1MA 2Y27A 1RY2A 5D6NA 4ISBA 3GPCA 4GS5A 4PZPA 1T5DX 3QYAA 4D57A 4ZJZA 3T5CA 4E5DA 4LGCA 4RLQA 3FCCA 2P2FA 3VNSA 1YJ7A 3NI2A 3E7WA 4OXIA 1V25A 5KYTA 4IR7A 3IEPA 3G7SA 5K85A 3DAYA 4D56A 2QVXX 2Y4OA 3RG2A 2P20A 3VNRA 3ETCA 4R0MA 3FCEA 1AMUA 5IFIA 3LAXA 3IERA 3IVRA 4M46A 5K8FA 3ITEA 4G36A 4D4GA 1LCIA 3LGXA 1V26A 2V7BA 4RVNA 5DV9A 3U17A 1MDFA 3O82A 5DWVA 3CW8X 3B7WA 1ULTA 3TSYA 3A9VA 3O83A 5KEIA 5GTDA 3A9UA 4GR4A 3T5BA 3WV4A 3T5AA 4DG8A 5E7QA 3NYQA 4D4HA 3E53A 4D4IA 3DLPX 4RMNA 4U5YD 3WVNA 4DG9A 3VNQA 1PG3A 2P2BA 3L8CA 3RIXA 3U16A
chains in the Genus database with same CATH superfamily
3OSUA 3HRHA 1VKOA 4J90A 4I1UA 3E6AA 1KPGA 3E9EA 4S2EA 4WK2B 1NLFA 4BQQA 1G66A 3O4RA 1PYOA 3CG0A 2OFOA 5HW0A 2R96A 4QLAA 1QYCA 4GPZA 3A9RA 3C3JA 3L43A 5JRDS 1IOWA 1T25A 4Q9KA 1K1EA 4P0QB 4ZQIA 2X8JA 2Q21A 2C99A 2R8BA 4X90A 3PQCA 5JPDA 3FTPA 4ZAFA 1U7XA 3R0IA 3PX2A 4AZVA 5E0OA 3NP7A 3RHSA 2ZRLA 3FOCA 1HYGA 1MD9A 1IPFA 2EATA 4UCXA 4MVWA 3I5MA 4FNAA 2C4NA 4UREA 4K0KC 2WMNB 1SVNA 3K0CC 3UJPA 3IURA 3OQMA 1SKMA 1IY0A 1D5WA 2OLJA 4O8CA 3U5ZB 1X1BA 3D81A 3EEFA 3PWTA 4KWIA 4CLHA 2XLBA 3HKCA 1U9CA 5FUMA 1N2XA 3UUFA 2IYAA 1U8TA 1Z83A 3W78A 5HM8A 2XNDD 4MJ7A 2CSXA 3KPUA 1JQAA 3VBEA 3AF2A 2WIJA 5CYFA 5F98A 3QFFA 5HBRA 1IM2A 4AX4A 4ENRA 3K0HA 2JLQA 2EFCB 2WICA 5LM3A 1KEEA 2VTBA 3ESAA 3RVNA 2CVZA 1N32B 1O87A 1J23A 2VPWA 5LDHA 3DTNA 2HJWA 1PR1A 2QD3A 3QXGA 3G0CA 2FSIA 3ILHA 3SG0A 1D7OA 5HUJA 2V1UA 3U9SA 3LWBA 2Z4TA 1RACA 5JQGB 3H2BA 1CJCA 1GZ3A 1HYEA 2Q1SA 1M76A 2RAPA 2AJBA 4UXIA 4WBNB 1RWBA 1TEVA 4EGJA 3ENQA 2A1TS 5FLKA 2X8LA 4DLTA 3L0ZA 4CR8A 4ITRC 4J4TA 5I9TA 4MIOA 4ND2A 4B3MC 3AO0B 3ZCUA 1U7OA 1K9VF 3MT9A 4BB0A 2Y67A 5CFOA 1Q3KA 3HZRA 3A6KA 3HBNA 5TARA 2CXPA 3WMRA 2ZREA 4E14A 5BWOA 2ZXUA 4TVKA 2W7TA 2ZDQA 1E9VA 3BOSA 3OKAA 2QRVA 5JECA 4LXHA 4MV0A 4C3UA 4GMKA 1UP6A 4QYXA 4K7JA 3FYUB 3FCUB 4J91A 1RYYA 1FQOA 1CUBA 4CM7A 3KYCA 5ABPA 1DO2A 2G09A 5CUQA 2NN3C 2Z08A 3SJ7A 3SAJA 3W1VA 2GM4A 1XZKA 3EF1A 4XSHA 5SZKB 4QLBA 2CFSA 1JUDA 3P2EA 3C6BA 4Y6SA 3VXKA 3WLKX 3M34A 3IUYA 4UPDA 3MGKA 3PS9A 5AW7A 2GH1A 4J7XA 1RPNA 4NXMB 4BCCA 4ZT6A 3WV4A 1OZAA 2BTQB 3DA8A 3WIVA 1JLSA 1SOMA 3H13A 2IYPA 3RANA 4BLSA 4D0LB 1IJEA 2FPGB 3AUAA 3OUUA 4U5YD 1MZVA 2PPLA 5FA6A 3WDLA 5BQ5A 5EXPA 4CR7A 1B43A 4J4HA 1FMFA 4BBPA 3S1AA 4B40A 1PZXA 1ORWA 2PGJA 2GK4A 2W00A 3HZZA 1IHXA 4UM8B 3IQXA 5IAJA 4L7QA 2HOQA 4CIXA 1P1BA 3HB5X 2IX3A 1TQ4A 5JMPA 2AN3A 1S8OA 4D9IA 3KZNA 5B1YA 3R0XA 4TWIA 3N6RA 1JPJA 4GSKA 4F3TA 4RK6A 1EMDA 3CR8A 2OHXA 4N9QA 1RWKA 1BG6A 2F9FA 2NO5A 3EYAA 1M6WA 4Y6LA 3ZOKA 1ZNYA 2PZEA 3RAJA 1M34E 4OOFA 4ENUA 3FIJA 2B20A 2CK3A 1DO8A 1JJ7A 5GVSA 3FTEA 1YXMA 1IUOA 4CKWA 3HPQA 1C7QA 4OA5A 3TQRA 2F8TA 3M3HA 1ISFA 1L5MA 2LCIA 4OV6B 1TI7A 4X6LA 1NXSA 5JCXA 1V11B 1WXDA 4J43A 2XYGA 2HX1A 2O1WA 3C6MA 4IDAA 4U9UA 5EXXA 4ZTZB 3QFSA 4OQ4A 4UOZA 3EXG2 2OXRA 2HRBA 2J0EA 4J76A 1CF4A 3T3IA 4RXUA 4LI0A 3VR4H 3AY6A 4NOZA 1K6EA 2ZRAA 4G3XA 3W8NA 4LQCA 3RPEA 2WZQA 5GY7A 1KEKA 1IXYA 1DBQA 3K09A 1QV9A 5EJMA 5JG7A 5KNDD 5EIXA 2IDMA 1D4ZA 2PS0A 3FKSA 1GGKA 1ZVMA 3UICA 2YINC 2YRFA 5JYDA 1Z5OA 3BFXA 1N2CB 2AC4A 4MVJG 2EKZA 5LXTB 3JU3A 1BQ4A 1BXKA 1YR8A 1YT5A 1WUTA 2PBLA 3E22A 1I33A 4KKVA 4WLNA 1A72A 2YFQA 3H8SA 4PONA 5FTWA 1JE1A 4UBNA 4HEHA 1GGHA 3EK2A 3EMKA 3IRUA 3X1XA 3HJHA 5CGZA 2DLNA 3MZ0A 1R8XA 2XYVA 3ILVA 4YREA 3ZLVA 5LQCA 3GMSA 3SS9X 4AMYA 2O8VA 3FROA 5BRJA 1O94C 3AUFA 1COZA 3TEMA 3MS7A 3TOSA 2QI9C 3AR2A 3TLKA 2I7TA 1LBQA 4Z9YA 1NVUQ 1L5LA 2UUAC 2JAQA 1S9HA 1JR3A 3T3PB 1SC3A 1TYCA 1VHLA 3L6OO 5AKHA 3HY4A 5K85A 1DG9A 2PZFA 4LRTB 1Q0LA 2H0RA 2XB9A 5LMZA 1XDGA 1Z6GA 2CLOB 4FWTA 3GPDG 2AE2A 3ZLBA 2OUIA 4UU1A 3GU3A 4OHXA 2VHQA 3ZD8A 4CL0A 4D1YA 4N76A 4MAFA 5K0CA 3SR4A 7GPBA 4CF7A 5HIAA 3OWXA 2H85A 1A77A 5SICE 1LDNA 1UPFA 3HJAA 3LZCA 4UBOA 4W4TA 1LV7A 1YZKA 4CG3A 2VPZA 4AUNA 1KI7A 2MSDB 1F8YA 1XRMA 3DEYX 2NTJA 1B76A 3HKDA 4LJ9A 2EP7A 4LF8C 4LC9A 3IEMA 2ZE5A 4R9RA 4NDAA 3GLVA 1OMOA 1PS8A 4O2AA 5EJFA 5CAEA 3V1UA 1X9HA 4FOTA 5IUNC 3BT7A 2GDJA 3OCXA 3HVRA 1X8KA 4HAWA 2PLNA 1O9TA 3G8AA 2MDTA 1J97A 1HRKA 1Z2OX 3KLPX 2RAVA 4LYHA 1VGRA 4TOIA 1O4VA 3JYQA 3OZXA 2J3EA 1ZX1A 4B3RB 4TYYA 1TRHA 1W4ZA 3T0GA 5FQOA 3HY6A 1QVRA 3V6MA 1EX9A 3GJ0A 2ZITA 1Z13A 2IQ5A 2RMKA 1QH9A 3MG9A 1YCDA 3I2YX 4M38A 1CP2A 2ZZKA 2IOYA 3GMDA 3I9NA 2I2DA 4LZAA 4PCAA 4TV8B 3VAZA 4HAYA 2X0NA 3W79A 4ONEA 4MQLA 3MOIA 2VSNA 3GDOA 1CERA 3HN2A 1MH9A 1RYEA 2KYRA 2FWBA 3P94A 5FRDA 621PA 3RC7A 1GDTA 4TWZA 1PEAA 4CYMA 5JY1A 1NUQA 1E1QA 3DW1X 5T4HA 3GC6A 4Q21A 3FZEA 1SC6A 3NNNA 3UOAB 5DW3A 4MS1A 3LQ1A 1E9FA 5FBLB 1IZ7A 1KFJB 2BCJQ 1NXOA 1QGAA 2C4KA 1QHSA 2DULA 4O25A 4BNTA 5J2UA 2GFIA 2ZM6B 5BSMA 3NDIA 4OBBA 1MKYA 4CF3A 2ISSD 3IV9A 3P2JA 4X66C 2WFMA 4LQDA 3N74A 2AJLI 3K72B 1MQ8B 1W25A 3N2GB 1VJTA 4WPGA 5L6MB 2B98A 1JPVA 3BWYA 3VTAA 5KYYA 2QM0A 5DGHA 2AFHB 2CXOA 4FUTA 2OXIA 4D80A 1DFHA 1DXYA 1YQWA 4LZJA 2BHLA 1W1UA 3HCEA 3D9QX 3PR2B 1YKSA 2M6KA 2NZWA 3ZCVA 2W2XA 3H2ZA 3PI7A 1AZWA 3OPYI 4OLJA 4ZU6X 4X66B 3OZCA 3AESA 5KDDA 3AHHA 1IY8A 4X84A 2WLTA 3WJ2A 1GUBA 1H6AA 3EXEA 1N32C 3D8NA 4NCKA 1WBDA 1X9GA 2AX4A 1Z4PX 3UA3A 4WEOA 2KHZA 4UBJA 4E03A 2EGGA 1T8PA 1Y37A 2FMUA 3EC7A 4ARUA 4F91B 1Y42X 1V8OA 1QWSA 1QVAA 1ULUA 3CF0A 1G1AA 2Y1DA 1H6CA 3D6HA 3BN3A 4KJZA 4M99A 3OZAA 5KMGA 4HV4A 3A06A 5C53B 1U0JA 1ZM2A 2P78A 1FYVA 3KDPA 4YRKA 2PMCA 3OCCA 2XBMA 3HP7A 3D2AA 5A4KA 3SVLA 4E5DA 2W71A 1J0XO 2XOXA 4Z0NA 2DR3A 1RLUA 2XODA 4MGIR 4G4IA 4R01A 4MB2A 3C85A 1BIFA 2OAGA 4IJWA 1C3VA 1OX5A 2PH7A 5TDHA 3WR5A 5JDCA 2HF8A 1HNWC 3H19A 3GPBA 2GARA 3P26A 4WA8A 1VA4A 2IXFA 2NQTA 5DOVA 4TROA 2Q99A 5H0IA 5A0TA 2DVMA 5ALVA 4K6GA 1UJ4A 1GARA 3CLSC 2VQDA 4HWTA 3OQVA 2BGKA 3DD5A 3FWPA 3F6BX 4Z9AA 3W5DA 2CVPA 3DE3X 3SVTA 1U6JA 2K2QB 3HC7A 1G60A 1Y7IA 2P4QA 2EL7A 2D7JA 2RGEA 3CW2A 3KBOA 3MBKA 4FYWA 4EVQA 1ZK3A 5BYJA 3PDIA 5BSFA 1OX6A 4B6RA 2QD5A 3UT0A 2FG6C 3UK1A 1BFKA 1NP3A 2ZSKA 4OP3A 3COZA 3K0BA 4QBFA 4RHUA 3ICPA 3LDHA 4Q1BA 2FZVA 4Q5IA 5J4VA 1C2YA 1QQBA 5HKAA 1N5IA 2I0FA 4HWPA 4RPLA 4F5EA 4YRDA 4LF9B 1HQCA 3C48A 1U9IA 3IXQA 3RUIA 3B8EA 1WSDA 2XUQA 2QGFA 1PDWA 5EIWA 1AKWA 3EIFA 2ZTLA 1XJCA 4J0EA 1T6NA 4KWTA 4ZC1A 3SICE 4YRBA 1KQ3A 1MXCA 1CK4A 3M6WA 4F3KA 2JEOA 2BGRA 4L76A 5BQOA 2IS6A 4X24A 1LBTA 4Q1AA 5JEEA 1MB9A 1EFPB 1NNI1 5HQ3B 1YI1A 4J2OA 3UHPA 2CDBA 3DL2A 4DDKA 5JV5A 2PVSA 3ZWVA 2RARA 4IVQA 4OFXA 5LDGA 3DTTA 1B0UA 2FJ0A 1N6OA 5L3ZA 5EJ5A 2EEZA 4GBJA 5T8KC 3OZDA 4D9MA 4GMHA 5JNUA 1A96A 3QE0A 1JBQA 3A3KA 3TOCA 2YYYA 4BNGA 1E4OA 2GWRA 4PZAA 2JFUA 1DSSG 3P0IA 2QD1A 2O4UX 2ZR8A 4CIAA 1Z7WA 1N1EA 3MFYA 1RI2A 4UM7A 3QMVA 5B12A 1GUFA 1U8UA 3E5NA 1XI2A 3GEEA 3SP1A 2WJHA 4BE4A 2I6FA 5GINE 3L7NA 2MSEB 2E4YA 2CZGA 2IV3A 2OFWA 4OJNA 3AKDA 3OCWA 5H5JA 3LBFA 2ATWA 1UJCA 3GOHA 4Q66C 1YDWA 2B1JA 2VRNA 1VYVA 1AKVA 1B16A 3P45A 4NARA 4RVUA 3RLIA 1CEXA 2O4CA 3WMWA 3HL0A 1W2HA 4WDRA 4A0RA 4B3IA 4ZZ0A 1V1RB 2DPXA 4OCZA 3P4XA 4RPIA 4L8VA 1EFUA 4C0XA 3N5KA 5ADZA 1MW9X 1TAGA 2IPNA 3EBPA 4MGZR 3BPSA 3CLKA 1OY1A 1P3DA 2ZSUA 4ZVMA 2EW8A 2BL4A 1XFAA 1TM1E 5CDGA 4DLVA 3DFKA 4LFAC 2FLVA 4AB1A 3CGGA 4UD6A 3I23A 4L27A 4LBYA 4DHWA 1Y9DA 2Q9CA 1BCRA 3VR0A 3A6ZA 3R41A 1XWFA 1R6DA 4ZHQA 3JS5A 1OB5A 1ZA2A 3X43A 4YLYA 1ETUA 1FFEA 4FFOA 2IXTA 1OROA 4IXWA 5LMNB 2WP0C 5DYGA 4CKEB 3RU7A 1P1KA 4GX5A 1YUNA 3IXMA 1Z07A 3GLHB 1MIOB 1MQAA 1NXPA 2HDWA 2JZOA 3LW7A 3P0HA 3PJDA 1F0PA 2NSYA 4IOLA 4J6EA 4B79A 1H4TA 2R7AA 4NPCA 4CDNA 3ZUGA 2FZGA 1LRJA 2ODEA 4QXMA 3BGOS 4WOKA 5LYYA 4C0BA 4FC6A 3QBDA 2Q5CA 5K09A 3WHPA 1A69A 5IM4A 3PXXA 1UMCB 3CZ5A 3C3XA 4J1TA 2RGNC 2YY7A 3SEZA 5JVDF 3QG1A 1KI1A 5LMNC 5HK9A 3TBFA 3OLYA 4OXIA 1YQGA 2OCAA 3ADOA 1TA4A 1HT1E 5FOQA 3GI1A 1LBEA 5IP5A 5JQGA 3ZWAA 1NUTA 2FN3A 2VP6A 3MJDA 3RT7A 5I6DA 4R1TA 1E79A 2QAIA 2B7LA 2HRCA 2WUEA 2J5XA 3AVOA 4LYFA 1XPOA 1IZ0A 2WTEA 5J4HA 1J8DA 3MGBA 1NPYA 2YC2C 4JEIA 4E2ZA 2O8NA 3KWJA 2FMKA 2AZMA 1K3FA 2HQ1A 1YBHA 4K1LA 3W2FA 1ID1A 1M1YB 2PUJA 4OAOA 3O7MA 5I48A 2BN4A 1SZPA 4WNAB 3M3PA 2JHCA 1O97C 2ZQZA 4QNMA 3H5WA 1JZTA 4JJEA 4YWHA 3AHJA 4GRAA 4REMA 2XPCA 2BMVA 4JLAA 3RVDA 5JSQA 2Z95A 5TC4A 3VA7A 3WYFA 2F1IA 2ZI5A 3DE6X 3EPJA 3A9VA 1W19A 3I01A 3HGTA 3Q2IA 1SCAA 2WUGA 5FBHA 5FL7A 2P9TA 5C8DA 5EMJA 4BNDB 3DOIA 2JZCA 5JSKA 2QL9A 1HT2E 4QSHA 2JJQA 1CQJA 1LLQA 2JEYA 3EWNA 4XE5A 2VT6A 5FT9A 4D92A 4DDVA 3U9TA 5JNWA 1I94B 5A05A 2CN1A 5REQB 1PGPA 2V9CA 4HG2A 4P84A 2M5OA 1CQIA 5E8JA 3VZBA 5IF9A 1AV6A 1XCLA 4OATA 3B52X 3ENWA 4WUTA 1C9KA 3GJ3A 3MJFA 1FNCA 4BLUA 3JV7A 1T2DA 3FUCA 1X38A 1FL9A 3UJNA 2IYFA 3L6BA 4IQ0A 3B9PA 3KYDB 2O3JA 1GL3A 2L18A 3G0DA 4HCJA 4WL0A 1NNLA 5F64A 2X23A 2ZBUA 4G37A 3O31A 3R4CA 4NX2A 4ALLA 4EFNA 1CNMA 2AOTB 4WFJA 3ZWYA 3A4TA 2JRCA 5DGXA 1FUEA 4PLYA 5ENDA 3ZZMA 3BDIA 5H70A 4RVCA 3C3CA 4QGFA 4LF7B 2NVWA 2QTCA 2VP9A 2AI3A 4ZO9A 1BHJA 1SELA 3BD6A 2VUUA 3HCCA 4QIHA 4ERNA 5I3CA 1Q84A 1DQSA 3G0GA 5TT1A 3K94A 1Y3AA 3DKIA 4ZDKA 3O75A 4OQQA 5E4FA 4CLOA 4GC5A 2WNSA 4H4DA 1BH2A 3EN0A 4CDGA 5CXSA 3UAWA 3INTA 1UFQA 4MV1A 3C7KA 4KX3A 1H66A 1V7ZA 3W2IA 4MRAA 3VKGA 2WG0A 3KO8A 5KREA 1A27A 4EG7A 2ZG6A 3PUWA 6LDHA 2J9YB 2XV1A 3ZWXA 1ZW6A 5C1BA 1Q91A 1DBRA 2G4VA 5TS3A 3VUEA 4MUKA 5T6BA 3IO5A 1BW9A 3LDFA 5CPBA 2DB3A 3IPLA 1QE0A 2PBRA 3A1EA 3VBCA 1KZ6A 3ENZA 2AZDA 2P9CA 4DPMA 4KTVE 2IYTA 3ESYA 4IZOA 2XUPA 2CNBA 1HC7A 3AFOA 3EFOA 3QBTA 4HBGA 5DLDA 4BMZA 1II9A 1U2GC 1I1HA 4OLAA 3A3OA 4C5BA 5LMCA 3PB3A 3BJRA 4PHFA 2CLEB 1KAMA 4CNBA 1M34A 2H07A 5FOVA 2IHZA 3OA0A 3EQ7A 3DMHA 3GEMA 3VM6A 2IXEA 3V8BA 4Z3OA 2ZWPA 3CA8A 3G7UA 2DHCA 4R7ZA 1TIBA 4LJSA 1OLSB 5TGZA 5DHAA 3R0VA 1HETA 3BD7A 1IG3A 1EK0A 3AF1A 3G6KA 3IDZA 1GTSA 1TK3A 1YV9A 4RZIA 3E7WA 3QK7A 5B37A 1DCFA 5DFAA 4I0WB 1UWLA 2J3MA 1CQXA 2O1EA 4WS9A 3MLAA 4OHVA 4RV5A 3M89A 4YAIA 4X20A 3CJTA 3WLEA 1ST2A 4PLTA 2H1SA 1C5KA 1TU3A 1T0BA 1J06A 2EIHA 2QTAA 3F4KA 3FDZA 3MUFA 2ZM6C 1G9SA 3NKLA 1V5IA 3CNEA 2HU7A 5IEBA 3RBZA 4DV3C 5G53C 4YRZA 1TCUA 4KK4A 4K3VA 5EIFA 2FEMA 2C0QA 2JH3A 3HM2A 1XSEA 1E6CA 4RGYA 1XPJA 1PL0A 4QYMA 4NOLA 2HNBA 4HGOA 4W8HA 3U4AA 3PVZA 1FDSA 1AF7A 5AW3A 5J1SB 1XQWA 3C1AA 2DM6A 3A70A 2WMYA 2PGNA 4DA9A 4Q34A 5DV9A 1PW5A 1YDMA 3OMLA 3TFOA 2HMVA 3B1WA 2PUTA 3TZKA 3TNFA 1I3MA 2ONJA 3JQBA 3GPIA 2HGZA 2IP4A 3IMLA 2OWDA 4JP2A 4N5HX 4F2HA 5IAAA 5ALZA 3DAGA 3IHTA 2BKEA 2Q3EA 2PX0A 1CHNA 2YWXA 3IO3A 4QVIA 1ZW1A 2DFTA 2QJWA 3LFTA 2P1ZA 3GUYA 5AOAA 3WYAA 2EJVA 4CMAA 5BQFA 2KM1A 3UBMA 3I9KA 1P2DA 3KX2A 3PEUA 1LRKA 3SBEA 3TTXA 2E4ZA 1ID8A 1FXWA 4P6VF 3IE1A 2XRMA 4JLUA 1HKUA 2PKYX 2Q4OA 4JC5A 3H04A 4R2HA 4BX2A 4JGIA 1TNDA 2B6NA 2XQIA 3JVUA 5FCDA 4QEZA 3QUSA 4BO0A 3NWEA 2R1TB 5HRAA 2IYZA 5U9CA 3X2SA 1GGJA 4LRXA 4DIFA 2OYRA 2BEUA 3OQHA 3OFNA 1B42A 2WPDD 2Q0XA 4FGKA 1QHHA 3FMOB 2OWEA 3KVVA 4GEKA 4U3JB 4L4QA 5CK5A 5F1KA 4JIGA 2YX1A 4KO4S 4XYMA 1OHHD 1Q2UA 5FYDA 4DCGA 2PIDA 2BEJA 3OPQA 3CJQA 3DFUA 4TWAA 1X9IA 2IZ5A 2CLCX 2MWMA 3AEQA 5K0LA 2VRCA 3VPDA 4Z51A 5C81A 3F5FA 3H7IA 3UM9A 1IUKA 3HYCA 2DWCA 4I1IA 4CTJA 3JQ9A 3OLXA 1WUJS 3EOAI 3JD0A 2AFIB 4FKZA 5KYKA 4ZTUB 4ER3A 3PEEA 4X5OA 2PUVA 1U4OA 3NRJA 2EZTA 4CGZA 1D6SA 3QXHA 1EDEA 4RAQA 1HEYA 2MR6A 2FK7A 2YJ4A 2XT9A 4C1BA 1R2QA 2ATXA 5FI3A 5GIOE 2ZI3A 2ERXA 1Y6ZA 1VCHA 5FOXA 1QTQA 521PA 4HNRA 1XAIA 2HLPA 2IIQA 4M54A 2C1ZA 1IONA 1RM0A 3GO4A 4V0LA 1GSAA 2V7VA 5KNBD 3QV1A 5BR1A 4ZARA 3CUUA 1P91A 1FFHA 1YONA 5T4BA 3J81A 3WA7A 4EA8A 4V0NA 2F8SA 2G0NA 2YUIA 1BXRB 2VHEA 2Y77A 4G01B 4FYMA 5P8WA 2F1RA 3RS7A 4YJ2F 4UMEA 5EJAA 1Y0BA 3LNOA 3AXSA 2PQ2A 4R7GA 3HJBA 4MOWA 1PJZA 2IIBA 4QU0A 2IY8A 2X15A 2OP0A 1WXEA 1AKQA 1Z18A 1U3DA 3KQVA 1AKRA 1PAUA 1H05A 1EVKA 1QH0A 4UNPA 4I36A 4FEEA 3TRHA 2RJNA 3C3BA 5EIAA 3LRTA 4AKGA 2H2AA 5AHXA 3TL2A 2OPHA 4XQ0A 2NG1A 3BXFA 4R71A 2XJ4A 1A4IA 3RS5A 3KSUA 2O5RA 2ZCJA 2H2GA 1YKFA 4JLDA 3UV3A 1O5OA 3GK3A 4F4DA 1YBAA 3BF8A 5KC9A 2L2QA 1BDHA 1NUUA 1XTIA 5CT6A 1GTRA 2ZRIA 1QWOA 1WOYA 1MCZA 3BB3A 5HA5A 4DIBA 3D02A 2UYCA 3S8MA 1GPKA 2INGX 3SF8B 3NVAA 4M46A 3RO7A 7MHTA 1R0LA 3P2IA 4BATA 4XTRA 3Q7TA 5J3JA 4QYIB 1BN7A 4YJ3A 4EDHA 4DIDA 2QAGC 2GEJA 3DKKA 2HSJA 3FYSA 3QKSA 3SJCA 1F9EA 1PZEA 3PIIA 2ZIUB 1GV0A 2J3LA 2VH1A 4DQLA 4LZWA 3ESZA 3MILA 1PFWA 4HGNA 4N8SA 1C7RA 4TKLA 2HDHA 2GESA 1T8RA 5AK3A 4TZKA 1HSOA 1UMBA 2G80A 2XTNA 4C7OA 2GAJA 1O9GA 3BICA 2UU9B 2HRZA 4X54A 3WNDA 1RHKA 1B4DA 5GM2A 3WO1A 5DCYA 1RHMA 2QMQA 1AUXA 1C9MA 1N5RA 3AH8A 3O03A 4MV8A 2QI9F 1SIUA 1O97D 3MWEB 3WOHA 4PTZA 5AD1A 1QQAA 3GDWA 4EX7A 1K6MA 2CXHA 3GEGA 4ZOEA 4B7UA 1NXQA 3OU2A 3AZOA 1XOIA 5EJ9A 3P0EA 3KD3A 3O2SB 1JR3D 4O63O 4MW9A 4RY2A 3WG9A 4RO0A 3DBLB 4M60A 3LSYA 4M1MA 2XZOA 4I5IA 1CX9B 4HBZA 1I2CA 3AM3A 4KPFC 4ON9A 1KAEA 2O3UA 2FFAA 3FKQA 4ND5A 1N6NA 1WW2A 3L2OB 3C3AA 5ESXA 5BN3B 4YEDA 1AGRA 3KE9A 2ZKLA 4O08A 1GAEO 2FFBA 2DSTA 2C5BA 2YHIA 1TM4E 4Q0MA 2G76A 3JQGB 2PQ6A 4BMVA 1G8MA 2PZAA 3PENA 4BKMA 4EHNA 4TXMA 2I4MA 1E5DA 1MAWA 5CRIA 3M6UA 5M5BA 2QY9A 2R47A 2ZWIA 1HV8A 1SOAA 1ZBDA 3UOGA 1ZUIA 1V3VA 1VMDA 3X1WA 3UK6A 1L5HB 4IZIA 1AIPA 5EUBA 5A6SB 3ONVA 1C1DA 3KKPA 3S2ZA 4LOHA 2PLFA 3DHYA 1DRJA 1V60A 1OFIA 1OXXK 1DAPA 2A0KA 2IV7A 3TX6A 3OLZA 4R5MA 1VE9A 4PAWA 2P9EA 3EVEA 4E12A 4M1EA 1PU1A 4OHWA 3FMGA 4RX1A 3RYCB 4JITA 2C4VA 3KJNA 1QGDA 1UP4A 4KV9A 4UTVA 4EAAA 2TMGA 3BYZA 1DV1A 5F2KA 3ZU5A 1BC5A 4NLLA 5BOSA 3ROZA 1A0OA 1S4MA 3E7XA 4FDTA 1USIA 2EKLA 5H4HA 3SQOA 2PSHA 3ZE0B 4RLFA 1YNOA 4EEKA 3VTKA 3C97A 4PG5A 1UPTA 4WKGA 5CNKA 4ID3A 3BMCB 4AKHA 3AM4A 2R8RA 2OQ2A 2VJMA 3TQQA 1QIMA 3V32A 2N0SA 2GCGA 1DJQA 2C2XA 5K0NA 4J0GA 3TZCA 1AS3A 1CRLA 2R8XA 3I32A 3L7LA 5FF9A 4ILEA 1N7IA 2WG2A 2GYWA 4RTJA 3ZV6A 4FFBB 4PZ9A 3RTAA 1G8GA 5EP3A 4Q9LA 3IVCA 4L2IB 4MS1B 4TLMB 1GFSA 2A9FA 1MJNA 1RCFA 3FPAA 3V2HA 5AE3A 5TEWA 3E3OA 3KEFA 3N28A 1VPTA 1PJ3A 1SR8A 3DULA 4Y2SA 3RD5A 4EBFA 3G79A 1RM3A 2A58A 2WABA 5LP6A 1ZCJA 1LPOA 4JLOA 2NSJA 4MGYR 3IVAA 6ADHA 3WNCA 3H4TA 1MEJA 5ETJA 3MMSA 1F2VA 4NCXA 1KJ9A 2V74B 5TB5A 1VL8A 1FDTA 4B3FX 3E35A 4J9VA 4RZXA 5EE5B 4C43A 5FWYA 5A0VA 2ZSDA 5IAKA 1GCOA 1LPMA 1MJGM 4JI4C 3H97A 2MCFA 2H0QA 2GN0A 2WWRA 2QPOA 2ZIXB 4RIGA 4I5GA 2YZKA 3AESB 1M7GA 4BWGA 3GFTA 3CW8X 4CM8B 5C4IA 5A71A 1ISHA 2CL0X 2YJZA 3B53X 3HVUA 4BBZA 2HHHB 3GX1A 2JJ2D 3CSDA 5DLYA 4MUXA 1YQEA 3CVOA 4Y6RA 1Z2AA 2OO3A 4LMAA 1ULZA 2B0JA 2X9LA 3BMCA 1ECJA 5ECGC 5BORA 1US8A 1XXHA 3W90A 1GZSA 1SRRA 1X70A 1CFJA 3FPJA 4KBYA 1IYZA 2ALJA 5I8PA 3HMQA 5ITZB 2F1HA 2YHIB 2WP8J 4DEYA 1CE8A 4TKUB 1YZFA 1ORIA 3AVVA 4QC2A 3R5SA 2N46A 3OHPA 4X8OA 1X1QA 1FX0A 3AHFA 4NL4H 2WWGA 1L2TA 5DULA 1BE1A 1L7VC 1U0HC 1XTZA 2NYAA 4E88A 1E1DA 1PG5A 3DWIA 2WTBA 3QW4B 2AMYA 4ZO6A 2O8EB 1U1DA 3C8DA 1ISMA 2IITA 5EP4A 3L1IA 1AKMA 1GRQA 4TVBA 1T0IA 4QDOA 1SXIA 4NBLA 3NYIA 4NCNA 2GFQA 1HNZC 4OH7A 5A1JA 3ENKA 2QWXA 1D0IA 1A50B 2XNDA 2E4AA 4P36A 4RLHA 4ZYXA 1Z3CA 2G67A 3DDHA 1O77A 4PFJA 3KSBC 2WDPA 1FZQA 3LQFA 4N9WA 4O6VA 1J9EA 2IUEA 4UBIA 4MB0A 5J5CA 3AF0A 4QPJC 1E1LA 3L6EA 1R15A 3EDQA 2A5YB 1A8SA 1V9SA 2GEUA 4CIWA 1KC3A 5K45A 1Q5PA 1HLGA 2F3TA 2VHVA 4CMGA 4B3BA 1KHTA 1M2VA 2OK7A 1IJBA 2OR3A 2X9NA 3D6MA 4MA4A 4UM9D 2KE5A 3IRVA 3VGPA 4CDMA 5C5IA 5E1BA 2HBQA 1LDGA 4MHSA 4Y67A 3D6FA 2PRIA 2XIJA 3JAWA 5JHGB 4IDPA 3MJSA 1SEPA 4RA9B 2VRWA 4EQ6A 1T3ZA 1TFUA 3GOQA 4C89A 2GPWA 2R4UA 3KKOA 2QL6A 1ZI9A 4LRYA 4AROA 5AVYA 1IBSA 1SK9A 1FX0B 4UE2A 5TV2A 1JKXA 3AZPA 3IESA 4RMHA 4Z49A 1DWOA 2CYBA 2AGVA 1S3GA 2Y0CA 1Q22A 2WNHA 5KYNA 4HMOA 1Y7HA 1NE2A 1CS0A 4U0JA 3CX8A 4DDUA 3NKFA 3TDNA 1WB4A 4BV2A 2GZ3A 1D2HA 2F90A 4J29A 1UJMA 4HNSA 4MO2A 4O02B 5JS6A 1EXVA 2HIAA 1TK9A 2PEZA 1KZ9A 3AUKA 2XCLA 3ZV5A 4K9RA 3PNPA 1OKKD 4EABA 4KUHA 4FFDA 3O95A 2RD2A 5ELMA 1G98A 2QW8A 5J23A 1DIAA 3UHAA 4ZI3A 3ICOA 7YASA 4N6OA 3VNRA 3L4BA 4XB6B 2XCRB 5KQPA 4YMGA 5AW2A 1QKKA 1NJSA 1UJ2A 3AP3A 1USGA 4AL4A 3E5RA 2JAPA 4IF4A 4XVQA 1A9XA 3EXHA 4DR1C 5D87A 5B6IA 1SA0A 3P97A 3A4LA 4KFTA 5HDQA 1SKQA 2OQIA 3OJFA 5A4FS 3FKJA 4MVXA 5LNK6 2W43A 3EMBA 1R0WA 1R4NB 1ZIOA 2OFFA 2ORED 2P5YA 3MB5A 5DSTA 2VQEC 4KQ2A 1W88B 2AHRA 4PLCA 1C9NA 3GMTA 3PZRA 5EI5A 4I8DA 3TG2A 1CUYA 2P3OA 4UOQA 1E3SA 4EG0A 5A0FA 3K9QO 4D3YA 3O8QB 1CRWG 1A7UA 3BFKA 2B34A 2W2OA 2XLCA 4KTTA 2P5TB 1JKJB 2Y1LA 3MXOA 3PFKA 3VDRA 4A6EA 1F8FA 1ZM4A 2PRZA 4GDFA 1QX4A 1W4AA 2DJ5A 5JO9A 1RLTA 2PA3A 2XWSA 3QJ5A 4KACA 5EFOA 4BNDA 4CEIB 4KB5A 3USES 2O0HA 4OHKA 2YNMA 2E6UX 2ZB2A 2HV8A 3LLCA 1T35A 4C7BA 3NP9A 2PROA 2V7GA 3I8SA 2ERYA 3I9V6 3ZK8A 4D8VA 1WP4A 5FNVF 3LWDA 5IF3A 3K9FC 4Q82A 2BJHA 1LPNA 1NW7A 2W2PA 3QPAA 4MVCA 1XKQA 2JGNA 4TVSA 5AUNB 1AC5A 4AMVA 1YS4A 2D1RA 1S96A 2DFDA 4ZKEA 5BOSB 5FAXA 1XZEA 4JUAA 5REQA 3TUJC 4RETA 2VF4X 3ICWA 4YV7A 3HXTA 3BS4A 1EE1A 2D74A 3D3WA 4OXQA 4LBZA 4BX8A 3K70B 1XA4A 4MWBA 1JG7A 3R76A 1ML3A 2ES4A 1YI8A 3CRQA 4YRSA 3ZE2B 3H05A 3C2QA 3DE4X 1QO9A 4ACAA 4D3ZA 4OHBA 2XUOA 3JQ8B 3GG2A 5DXFA 1P2VA 1UT8A 2XOKD 1RKQA 3Q7PA 1N4AA 4S1PA 1JJAA 2F3SA 2X8JB 2XVMA 1NONA 3EERA 1O5IA 2BLLA 2OY0A 1OXKB 3KNZA 3WIBA 1GAXA 4UPEA 3U44A 2FPRA 1YQXA 3B1JA 3MOGA 1JG1A 4LVCA 4AZ3B 5C32A 1PK7A 3AKYA 2FP3A 1F48A 1PGNA 2C4HA 3L0IB 5I7AA 1KDPA 4OBWA 2PEYA 4DSAA 1K7CA 1CIVA 2BFFA 2CZQA 1BE6A 5E7IA 3ZI7A 2QXUA 2NU9B 1W5AA 1YUMA 2QM7A 5A1IA 1Z0KA 1FVXA 3I45A 3WC4A 4AS3A 4W5RA 1RBZA 1ZMXA 4ALMA 3X44A 2JGRA 2WD7A 4YHBA 5BV0A 2C42A 4CIDA 4EPVA 2Y76A 4YP6A 3T41A 4HNTA 1COWD 2J6CA 4HL6A 5DBIA 4HGQA 3U60B 4ZI7A 4L8WB 5I7EA 2CXTA 1PJLA 4QOIA 1NA5A 3SKXA 3IJRA 1RQ2A 1GPAA 2NWQA 4B0PA 1G5RA 5FPQA 1U98A 5KU7A 4JUFA 1QYRA 2V54A 2XQGA 3FPKA 1YJ5A 4E4YA 3LNCA 1BQEA 4KGVA 4C07A 1X77A 2VAWA 1N9KA 3W7AA 2YUTA 4N7RA 4QBHA 2AN4A 4DM4A 1NW3A 1BH6A 1Y7LA 2FQXA 3HXOA 3UX3A 2YJ3A 1AVTA 1OI4A 1NXWA 2NX2A 4OB7A 3ZU4A 2P2ZA 4K86A 4TTVA 2D4AA 1CG6A 1R0RE 1LJUA 1YDEA 1I13A 1T36A 3QV2A 1O95D 5FUWA 2R7NA 1W88A 3T4EA 2BR5A 2PH1A 3RYHB 1Z6YA 5IVIA 1HGXA 2H9AA 2UXBC 2RC6A 1BJKA 4I50F 3FCEA 4KHZA 4ZYTA 5IFIA 4UUAA 2DG2A 4PHHA 3OZSA 4IQGA 4FNGA 4MH4A 2VJKA 1C8VB 5J9FA 3QH4A 3C15C 4DQXA 3DXFA 2QUBA 2B21A 5L4SA 4F2PA 3OQPA 3ORYA 1Z5PA 4BX3A 5EZQA 3TXYA 1LPSA 2A4KA 1EZ4A 3N2KB 1W6UA 3B3GA 4ZTBA 2R7LA 3TB6A 1F6BA 3WWDA 2E87A 4CKYA 1MAVA 5FNZA 4WLVA 1UMBB 2WT8A 3L3BA 1Z22A 4I50A 4ARIA 3FGZA 3MWDA 5ALQA 2GVNA 1UQTA 1NRWA 4TSFD 5AI5A 3QY0A 2JLXA 1Z06A 3WKAA 4CM5A 1D4OA 3HLKA 3JAKB 4K9OA 4UD2A 3G2NA 1IIRA 3E9YA 4EGAA 1NR5A 3I0ZA 3VR2A 3COVA 1ZU5A 4GNRA 3E5MA 4L28A 4Q39A 4E0BA 1FP1D 2A6PA 2LIVA 2R8ZA 1OU0A 5SY6A 5ALUA 1K8ZB 2H52A 3C4VA 3WHIA 5F9FA 2YS6A 2TMYA 2J6HA 2OMEA 4AK9A 2OILA 1I6MA 3NH6A 2PRSA 2SKDA 1WMEA 1C7IA 1ODLA 4ZVQA 4K0RA 2CEAA 1WD7A 3HCRA 3QPWA 4RXTA 3DLTA 4AJ9A 2CLKB 2DFKB 4MUJA 4E2WA 1SXQA 3K4PA 4E5NA 2HDNB 4LOLA 2PGAA 1O0SA 3CRW1 4HAOA 3RS0A 1G5TA 3UX2A 4G84A 4PSCA 2C98A 1ULSA 4P92A 3VH3A 1PG4A 2LBPA 3DZBA 1M2VB 3ZJ5A 3U7HB 1Z5VA 3ZQUA 2UVPB 3GCWA 2IYRA 4XM2A 1V9LA 4OQYA 2P2QA 5G3ZA 1H8HA 3BQNB 4G1IA 2ASVA 4TTQA 3SQMA 4F4UA 1XMXA 1EFKA 3O3MB 3ETGA 1SD5A 3O73A 4LDAA 4QECA 3RDPA 3G5AA 4G0OA 3WGTA 2A4MA 1A2BA 2OCPA 3ABIA 3DUWA 3I64A 4P2BA 1L5KA 2W6CX 4CMEC 4JYPA 1T5IA 1KERA 1KORA 1NRIA 1QF7A 2GA9A 4YHHB 1FUGA 1Q6ZA 1U5AA 1UKZA 2Z2YA 3RSLA 2E6KA 1I4DD 2OCLA 4DRXB 1X7WA 4L5JA 4AVYA 2AXEA 4AY4A 1H6DA 3RVQA 1CUHA 3O7WA 3X1YA 1CYDA 1DPGA 4KI7A 3KJHA 4EJMA 3VU9A 2OO5A 1M2GA 4WN3A 5KQLA 2X13A 4IGIA 3PCRB 5CFLA 2XUZA 1TJ4A 5CITA 1OFVA 4HAIA 4LYAA 1OPRA 1ZH0A 4XPZA 5U4XA 4HH3C 1Y5MA 3PE4A 4PN7A 3GRFA 4V1CB 3GEHA 3RUFA 4LGCA 4H6XA 4QARA 3MCTA 4XUCA 1Z0SA 1NJGA 3IXLA 3ZDFA 3H5RA 2PD4A 5B4TA 2VF5X 3EJWA 4NCBA 5I3ZA 5HF9A 1NBAA 2P67A 1KXJA 5TMBA 3IIIA 3I28A 1PLKA 1TZKA 4CKZA 1CJVC 2G9ZA 1XTPA 5CFZA 3RG2A 3T3OA 4XOUA 3ZS9A 4HPVA 1ECGA 1C30B 2WJVA 3OTQA 2Z5VA 1S89A 1YCFA 4W7SA 2XD4A 1YBMA 4P2GA 4A8TA 1XMIA 1GTL1 1L2FA 2D54A 2GBPA 3OEEA 2HCBA 3LV8A 1YZUA 2COKA 3DMTC 5DU2A 4CKCA 3UAYA 5F7XA 3O94A 2AS0A 4AS1A 1O96B 2PKXA 2VTEA 1ILWA 3MRXA 4US1R 5T6MA 2C9CA 4Z4IA 2CMKA 1RZ3A 4PWZA 4M36A 4MAAA 1RI4A 4L07A 4YY3C 3HWWA 1KZ4A 5BNIA 4BQIA 2QNBA 3AVWA 3PROC 4F6RA 1E3WB 2HIMA 1F7VA 1J5EC 1REQB 1KJJA 2D06A 5MDHA 5HZMA 4WESB 3ROXA 1MAHA 5FV7A 2WHPB 3PQFA 2F3RA 5U1PA 2W8BB 5DM60 1S8NA 1OFUX 2H1HA 4G5GA 3WLNA 3ZHTA 1JFVA 3SJZA 2GZ1A 1ZH4A 2IZZA 2ZUSA 1K7YA 2BGIA 4EF6A 5BSGA 5JZMA 2PD3A 2B94A 2GXQA 3DDNA 3LA8A 1N6RA 2YWCA 4R8MA 3KZOA 4R6XA 4XPIA 3CMMA 5KTRA 3PFWO 2BFDA 2QD2A 4HDMA 2B69A 2Q3MA 3QOFA 1S01A 3PPYA 3RREA 4D02A 1QZZA 2DHEA 2JFPA 4F4HA 2WNIA 2OA0A 3THOA 3MCAA 1IN6A 5FLEX 3FFAA 3KU1A 2IEBA 1K63A 1WAMA 2ZETA 4UDYX 5D3MA 2M6LA 2W6ID 4IEEA 3DV0A 4TV9F 3PPIA 3L7AA 4JEMA 1ABFA 3WIDA 2ZBRA 2H08A 1ZR4A 2O20A 2IELA 1PQPA 2FRDA 2G6TA 3JRXA 4LHYA 2I7XA 3X1JA 4L5BA 2OTCA 1Y9EA 5FYQA 3UC9A 3E23A 4BIMA 1J8VA 3DO8A 2C9DA 1YWGO 1DHTA 2B3DA 3MMPA 1QYVA 1WEHA 2Q5OA 5HEKA 3KKLA 3OHSX 5JD3A 3WBFA 4NNJA 1N77A 3AK4A 2W2LD 2AH5A 3GR6A 3KDAA 4D6XA 4YUZA 5AW8A 4D0NA 5KOYA 1HFEL 3DG9A 3KWFA 4B3HA 2EFJA 2QIPA 1F5NA 4IILA 1TMYA 3DH0A 2ZQ5A 2J4CA 3A1SA 4KLAA 4YJKA 3UWPA 4F84A 2NU9A 3FOWA 3GRPA 2GJSA 1W49A 2CD9A 3EOBI 1ZO8A 2BMEA 4DN6A 4PNEA 1FQKA 1OTHA 4CF4A 1JSCA 4IEIA 3L05A 3WGGA 4ZGGA 2BHTA 4DNXA 2ZK7A 4MW0A 1HBJA 1BMFD 1OGYA 2GNOA 2VPXA 4FMCF 4OYYA 4DZTA 5AVSA 4BQFA 5E1OA 3LY8A 4BVEA 2YZ7A 4WQMA 1G17A 1YR9A 1V3UA 1KYYA 4QHSA 3RKUA 2HMUA 1HDYA 3MWYW 4JJ7A 4LOJA 3JQ7B 2NM0A 4KXVA 2ZE7A 3F49S 4LHVA 3GJ6A 1TIKA 4L8YA 3O9MA 4QD3A 1L5YA 1MAUA 2B4AA 4NMXB 3T94A 5GIPE 3H1EA 3ZVKA 5L45A 5BPFA 2G9RA 2O23A 3DMPA 3HP1A 1I30A 4X00A 5GOZA 4ZN6A 1DAHA 3DZ8A 3MERA 4LV6A 2QX7A 4KHPB 4X65C 1IBMC 1G64A 1SUBA 5IJ0B 3QTTA 4Y9RA 2JA1A 3N6VA 5I4BA 5A2QD 1J2UA 2KJQA 3JY6A 3UAOA 5ADHA 1U0FA 1NVTA 5KDOA 1L7QA 4KR2A 1M6NA 4J7CA 2SECE 4V3CA 4F5DA 3KUUA 4B7AA 4HQFA 5KIAA 1KNQA 1NMXA 3CE6A 3EB9A 3R2JA 4Q15A 5CG2A 2R6CA 3RROA 1XPUA 1VYTA 2HTEA 4NMHA 1YO6A 2C8JA 1TZ2A 2V55B 4IDEA 1Z8DA 3O8QA 1LVUA 1XAGA 2FV8A 3JZDA 2Q6VA 5I9SA 4E46A 4RADA 3GNTA 3HJUA 2P40A 3NOQA 3TIFA 3UFBA 2UXBB 3HWRA 2VG8A 2VTDA 4N5LA 4PFSA 2PWBA 3RQIA 1U3UA 3LVRE 1G9TA 4NESA 4LE0A 4RVNA 1H8ED 3PUXA 1ZITA 1U5BA 1UMKA 2QX9A 5CAEB 1HDCA 3EE6A 2BAGA 2H7XA 2WIDA 5K0FA 5DASA 3WTBA 4GMGA 2DKOA 2FLKA 2EJWA 2UYOA 4NEQA 5F5XA 3QI7A 1KQNA 1Y5IA 4BO6A 1PWEA 1J25A 1H0SA 2FE1A 1HSZA 2RB5A 4GRDA 4MULA 3EXHB 4EARA 4I1PA 1J42A 1EEXB 2XZLA 1J0CA 1NPDA 2IHJA 1SQ5A 4Z4HA 2GEFA 3K8QA 1KSJA 2NYVA 2MSKA 1AUOA 2HPVA 4D4IA 2V58A 5ALYA 4LXIA 5BW4A 3SSAA 3OLVA 4DR5C 1C9EA 1KYIA 1M67A 1E0KA 3LUSA 2AG0A 1NT4A 2YC4C 3GL9A 1GAQA 2DQSA 4I4NA 4L3VA 4MTCA 3U2QA 1XRSB 3UEOA 5ISMA 4FVTA 1HH2P 1OQAA 4AN1A 2D3TA 4CW7A 2GMWA 2AKAB 1OWOA 2GO7A 3FLBA 3LYUA 4Q3NA 1LWOA 3V4VB 2LKDA 5KTPA 4YJGB 3PIRA 4BU1A 2XKJE 3UMSA 4DUYB 2BJWA 4FYJA 3KAQA 4LXYA 2J3KA 1VBNA 5IARA 4MR9B 3QGMA 3G2KA 5EXSA 4WINA 3BC1A 5BSKA 2ROQA 5KYXB 1E6EA 1M6HA 3EY9A 4M49A 2B5VA 3PHHA 3H0CA 1SHJA 3IT0A 2IBMA 3TH5A 1H94A 2X86A 4C7VA 4O8ZA 1AS0A 4PGHA 1RJGA 4MX8A 3SBXA 4D96A 3AEZA 2C8LA 2IUFA 2BM1A 4CXMA 3R74A 4UAJA 4CCYB 2VBIA 4UVIA 3DW3X 2X8WA 4QTUB 5BO5A 2QQFA 2WR8A 2PZBA 4YJ2B 4KXWA 4C30A 3UT5B 3LUJA 3PHIA 2YMLA 5TSDA 1FP7A 1OWPA 4LTMA 1GL7A 4LSWA 3L8HA 1DEXA 2EOAA 4G5XA 4PU0A 1DC7A 4M0CA 4B0OA 4MPTA 1FS6A 3LCUA 1URPA 3E2MA 2WTMA 3CLSD 3E82A 3L1HA 1OB2A 4LF6B 3VSDA 1YQ9A 3BL8A 1VIMA 1Y7PA 3EIXA 1GQFA 2VVTA 3DVQX 3CQ3A 3WGNA 1GAWA 2GAOA 5JC8A 4MV6A 3ZW8A 4G41A 3L46A 1XS3A 1FP2A 2XA1A 3BIOA 4H08A 2EQ5A 4BMDA 1ZYUA 3D1LA 3F47A 3VPGA 1E7RA 2JI4A 3LBIA 3QVUA 1LPAB 2I7VA 4WXMA 2Q2OA 5EIOA 4AMZA 2LKCA 1PTJC 5JAPA 2FMTA 4HOYA 3QIAA 5FJJA 3OETA 4DV7B 4NHOA 2FSHA 4R6WA 4R2MA 3ENVA 3OFKA 4PLGA 1OI3A 3CF2A 3GRYA 2R8YA 1M1YA 2XUKA 4AUEA 1EX7A 3ADBA 4PCLA 2WZBA 2J08A 1U8CB 4DMRA 1DU4A 2P91A 3II6X 3RJ9A 3V4RA 2VSFA 5DRTA 2OOSA 1JH8A 1HZZC 4NQZA 3T3GA 5B1EA 3H6GA 4L6CA 3BSSA 1V8ZA 2QVBA 1OV6A 4EGFA 3O1HB 4GI2A 3OFVA 1XU4A 1KKUA 3JZAA 4ZO8A 1EFHA 3JWPA 1I1NA 5L3SB 2I6TA 4HMQA 4TQAA 4RESA 1RKUA 1SVWA 4KI0A 1X7ZB 1GTMA 4I9NA 4NFHA 1RSZA 4CLXA 3G2HA 2WB4A 3I09A 1VPDA 4GVXA 4XX0A 1GLNA 3E4CA 2WOJA 1VKHA 3C6YA 4V3BA 1I24A 1QR2A 3QF4B 4B6PA 4YUWA 4YYEA 5DJ5A 5DNDA 4A36A 3FVQA 4ESHA 1VIDA 5IBQA 4KNWA 1B7GO 4F9GA 3MELA 4Q18A 1DTWB 4DUGD 1Z36A 3A1UA 4WN9B 3ESQA 4Z86A 4BV3A 3GLUA 3CH5A 1AK2A 4C4TA 3N3BC 1HDGO 4P4LA 1Q11A 5BSTA 4NZ9A 1YDGA 4P3OA 4ZICA 5C80A 5LOVB 3GELA 4ZQHA 4WZAA 2PRKA 3REGA 3LG2A 5DEIA 4EW6A 3KJIA 4LY9A 5C1OA 3JARA 1YA4A 1FNDA 4Q7KA 5DBOA 4BMYA 1PR2A 1VRWA 2XEXA 1NVDA 3EVCA 5HFJA 3ZDXB 2FQ1A 2V5VA 5AVTA 1PUJA 5BUSA 4E4TA 1YR1A 2IY9A 2KLHA 3ROGA 2G1JA 2GR9A 2XCIA 4QOFA 4YECA 2VBFA 5CZVA 2QAGA 3QVGB 1MRSA 1U04A 4IHQA 5EC8A 3TE7A 3TTTA 5CVTA 4XDYA 3I53A 3V8PA 3SZOA 1SN7A 3WB9A 4MW7A 4TRNA 4R4JA 4RJTA 4EPRA 3GR1A 3PV0A 4MCJA 2CNNA 3JQEA 1TRKA 3CZPA 4ZEOA 3ZOZA 1G7CA 4KV7A 3FCOA 2PKEA 4C06A 4CKBB 3HCFA 4U9IS 3S5UA 1Q1QA 1WLYA 5JYBA 1Y9JA 1DX9A 3VKVA 3PBKA 2Z9CA 4DB2A 2IOHA 4I6EA 4OO3A 1FFAA 1KH1A 5JCJD 4IPTA 1FF9A 5JDIC 4K9KA 4R0NA 4ZYVA 1W8IA 4H2DA 5MN6A 3N2GA 1ONSA 1QQTA 3OX3A 1CZNA 2RDMA 2JNWA 4M22A 4IIFA 5FULA 4DPLA 2ADMA 5HIIA 3ISJA 2I78A 3W1WA 3ZQKA 1J56A 3HU2A 4ZYWA 4Z1MA 1NZDA 2P2FA 3BMNA 5L3RA 1AXRA 4EO4A 2JCXA 2C59A 5BW5A 1KI4A 4QVGA 3NBQA 4M2LA 4N41A 3D4LA 4XKJA 3GWGA 2HBRA 3HSSA 3VOBA 4C4YA 3O90A 3WJ1A 1IATA 3K31A 5IABA 1O6ZA 2VHUA 4DCVA 1WZCA 4YAOA 1GNSA 3A36A 3A6FA 4ZREA 4BZXA 4P5DA 2FDCA 2I1LA 3PFNA 1N6PA 3ITKA 4AYTA 3I72A 4BLRA 1FNNA 2O5VA 3JZMA 5KHLB 4GAEA 3IVGA 1MNAA 4PZ0A 1W87A 5CEFA 3I42A 1KPIA 4LJ7A 4FSXA 1PEKE 2QW1A 4FNOA 1Y5RA 3WZLA 2GNPA 2IHTA 2DTEA 1Y1KE 3GIWA 4X7BA 3NOXA 3STVA 1RJWA 3WYBA 2O14A 1D3AA 3ZXSA 3NDBB 4DC1A 1P7ZA 2C3MA 2VRCD 4KVGA 1XNQB 4GHWA 4XR4A 4M88A 1CJUC 3FWKA 2CL5A 1V0JA 4QTXA 4PO9A 1UKCA 2RGCA 1F2TB 3H83A 4HFJA 3I9FA 4X60A 2D28C 2ZYGA 3CX3A 4HVLA 1BO6A 5KPDA 1JB1A 3PFGA 4LF5C 2RBKA 1EUQA 4BFLA 3P2YA 1C0KA 1XKXA 4PLPA 3JQGA 3V1TC 3OFND 3R75A 2BF4A 5ANRB 4C7XA 2UYYA 2OP1A 3KOOA 4PRKA 5C8YF 4PXYA 3B6ZA 3SQNA 4YFYA 3GT4A 1H5QA 1MN6A 3HYLA 4OI1A 4E94A 3UKOA 2JIZD 5KSPA 2QE6A 1U11A 4CI9A 2YXNA 1VJ0A 1Y4SA 3ON5A 1G0OA 3TDKA 1WHTA 4CCYA 4FZJA 2ZIZA 3GVCA 2VNAA 2VZLA 1FTGA 1W0KA 3L18A 4FHFA 3RUDA 2H11A 1A9YA 4LGYA 4QTZA 5I7UA 1FYFA 1VJCA 3BH0A 3M49A 4YP0A 1K08A 4MGKR 1JPUA 1V16B 4XDGA 4UTRA 5E4YA 3EAGA 2X42A 4QA9A 1UJNA 1GTVA 1M74A 1S3SA 2CNKA 5BW6B 2A1UA 1QZXA 4RF3A 2BH9A 2PWZA 5DGCA 3VYUB 1PI3A 3ICEA 3RS9A 1H42A 4C5CA 2P8JA 5JSZB 3OZUA 4G97A 2JB9A 1EE2A 3H87A 4Z0PA 5CH3A 5I4IA 3R5HA 3FYTA 4Q9NA 1MW8X 1LSSA 4XW2A 4H77A 1E1RD 3OECA 5EJIA 4BZWA 2P27A 3W5BA 5AOBA 1K7FB 1A3CA 5TPWA 3X1DA 1NN3A 3IUNA 2DFNA 4K9DA 3WXBA 5AM2A 1WMSA 4DOMA 1ZGCA 4ZAYA 1WTAA 4CU5A 1KKGA 1OV4A 5CW1A 3KBBA 2VO1A 4OYRA 2G08A 3M1AA 3B38A 2OQRA 1M6XA 3EARA 3KYJB 1O58A 1ZHFA 2DY1A 3DHNA 3OWHA 4PY2A 3KEMA 4HX9A 4M83A 2RGWA 4ZRMA 4BNIA 2PL5A 3C5WP 1TYZA 3LHSA 4BO2A 5LQRA 1MH1A 4X94A 1EVQA 1R0ZA 2OHJA 2P4UA 3P2OA 1Q7GA 3RYFA 3R77A 4PZYA 3P5SA 1FRQA 1LEHA 2NTVA 3HDJA 4J0FA 1P4JA 4PG4A 3P2KA 3IULA 4G5FA 2AUTA 2OCKA 4TM8A 4NU8X 4MUMA 2POCA 5C7IO 3REQB 4UXJA 3MM4A 1H4VB 1Y48E 3DEHA 3DV2A 2EFDB 3PDJA 4R1NA 1SXJC 3VSAA 4DV5B 3FUVA 3OQJA 4KR9A 3SXUB 2G6BA 3GNLA 2QF7A 3HUTA 2QUZA 1QVZA 3ZCTA 1DAFA 1PR0A 4KXNA 5DM4A 3FNEA 2RJOA 3GP5A 3KB8A 4HYYA 4X45A 1RPZA 3DOHA 3C6XA 3VR5H 5ER6A 1VJGA 4AXXA 4JI6B 3EPHA 1BXGB 1KQPA 3KTOA 1OASA 2JBHA 4YRCA 2VT2A 3Q7IA 4AG5A 3PEYA 1P1CA 1GGNA 1WQ3A 5EKDA 4EUHA 3NBMA 3IAAA 1B6SA 1PQYA 2ADOA 1E2IA 4DEVA 5AWFC 1AHIA 2A9KA 4KLNA 5H7XA 2G5GX 5I8WA 3LBHA 1AURA 4Z0HO 1IZYA 1UWCA 1GRVA 3WLHA 1B6RA 5DLPA 5BYKA 1WMFA 1QM5A 3JQ6A 1XQXA 1ZHHA 3AF6A 1R8QA 2GEVA 2W93A 4R8VA 2JI7A 4KXXA 4OHMA 1SBZA 3PDHA 5FTJA 3SEFA 2C5FA 5HZGA 1Q0TA 1CB7A 1KAGA 1GNVA 1NJ1A 1SCUA 1WVIA 2AI2A 3LXMA 1M0WA 1SG0A 1SXJB 3O92A 3PE6A 4N18A 2H31A 3U19A 4JBNA 4YJGA 1CUEA 3KJGA 4IBOA 4K1XA 4H1TA 1NTRA 2C7PA 3RS8A 2P7HA 3BRWD 3W6PA 2WDZA 1ZZEA 2CYCA 1XU9A 2ONYA 4JI0C 4F97A 2FZLA 4PLZA 3BGWA 1P2FA 3DLAA 5CFRA 3M83A 4KREA 4S1OA 2CLDX 3MT7A 3LQYA 3EUFA 1LTHR 1C0EA 2SICE 2O0LA 4KO1S 4AU1A 3L95X 1B2RA 2O3QA 5ALSA 1Q1BA 2RHWA 2YCBA 4NJEB 2LPMA 3QELA 2JCGA 3NXKA 1VRVA 5FL7D 1NMZA 4QG7A 4GQIA 3IDOA 2FUCA 1T4DA 4S1TA 3EVFA 2CWWA 5E6RA 3D2LA 1PNRA 2XB8A 1PWHA 1XJ5A 2C2HA 2HMWA 3NYWA 1PVDA 3AT1A 1EDZA 3R3JA 3SZUA 4AXBA 2A5JA 1CY6A 2V7UA 1PFYA 1T10A 3SC2B 4CKWB 1DTEA 1YZLA 3AUYA 3AEKB 1PD0A 2D2IA 3HWX1 3L4BC 1FYXA 2O3TA 3CQ9A 2AFHA 1SD1A 2NT3A 3IP9A 4G0ZA 4B3CA 3BE6A 4D9CA 3H1TA 2CBGA 1QIJA 2H18A 3TTSA 3UVEA 5JXGA 3LPNA 2JKVA 5CJ2A 4CL8A 3O2JA 4JJAA 4URVR 4U3JA 5TT0A 3WP0A 3PPWA 2G88A 4CM3A 2ECKA 4YCJA 4HX2A 2DHMA 2UUCB 4H0NA 4GECA 3VKWA 3EODA 4N40A 3TKYA 3KZCA 2JJ8A 2GM9A 2ZSJA 2NP7A 1T9HA 1A9SA 5KX5A 2IU6A 2VDLB 3HU1A 4M4SA 2ZTHA 1XL1A 3QKSB 2AXNA 5DX1A 3SJAA 3SYNA 2C4WA 1BX0A 3Q4GA 4KGZA 4P4SB 2C0CA 2JFXA 1Y9ZA 4AQYC 2XCQA 5AKLA 4B6FA 5G2OA 2NO9A 3UEBA 1B0AA 1GLVA 2EW2A 2MTBA 1B6GA 3NIGB 3OT1B 1AF4A 1JQBA 4OKNA 2O05A 3I04M 1NI4A 1SD2A 2IU0A 2AMLA 2AFRA 3NZEA 3OUTA 3OY7A 4PBRA 2KQUA 4YCBA 1S2OA 2QTMA 1L8OA 2YNMC 4QDKA 4US2R 1X3SA 4RHXA 1AK1A 3DC2A 3NM5A 5FFMA 1H1DA 4BQOA 4HATA 3OM8A 1W36C 1B1AA 1XALA 4HXEB 4DR6B 1O92A 2BY4A 3S6JA 3QHPA 3AL3A 2X5JO 3T7RA 2V4ZA 4ADSG 3RKSA 5GMOA 3GRZA 3FDJA 4V0MA 4V39A 3A31A 4M87A 5CCXA 3V4LA 1KEPA 1UBNA 4RNDB 5FD8A 4K40A 4B83A 221PA 2XMRA 2OBXA 1QDEA 2JEZA 4K6FA 1FMJA 2VJPA 5TQVA 1XZGA 1RLMA 1VLLA 2NQ2C 2YWDA 4JI7C 2VKQA 4CLRA 4PPFA 2WY2D 2VBCA 4PZLA 1SZDA 3LCCA 1CUWA 3NT4A 4GZ6A 3GA5A 3VR6A 4XLZA 3QJYA 5JHHB 1X13A 2JHGA 3PQ8A 3GFBA 3EXG1 4KRGA 5EVCA 1GY8A 1PDVA 3NV7A 4RHEA 4DMUB 2Z2JA 4YBRA 1W85B 1Z4MA 5CLJA 4ZCPA 1EUDB 4J2TA 2IEGA 2GYUA 1R50A 4MVJP 5JMWA 3W9UA 2ZVQX 5FR2A 1EFRA 3P96A 4QPCA 2B37A 1XMOC 1PJ2A 2O06A 3L9XA 3NWBA 1KMHA 4G26A 4LXTA 3T9CA 2WAXA 2XX3A 1XUOA 4KSBA 4I55A 1WDKA 2EL9A 1RE1A 2O5CA 4IG4A 4OY3A 2PAFA 4NYIQ 4DA0A 3E53A 3HYSA 3M9XA 2JD0A 2YVLA 4P3YA 4RY8A 1KKLA 1VBFA 3FHCB 1FEZA 4XGNA 1VL2A 2AEJA 3KR0A 2FX2A 4MLZA 4OHYA 1I51A 4OL9A 1NC1A 3C14C 4MUHA 2NV0A 3H2KA 4I55F 2G9UA 2RKOA 4U4AA 4WZBB 4QICA 3LK7A 2UYGA 3TLMA 1PLJA 3D59A 4REOA 5BN4B 3ZKWB 1R3DA 5ADWA 4DR1B 2WF5A 1JSLA 2OT3B 4B3JA 1G2PA 3IOMA 1L5NA 2WSLA 5DSXA 2XKKA 3VNUA 3GP8A 2C4UA 4EHAA 1M9NA 1M5UA 1Z8NA 2OBYA 3O2NA 4WZZA 4AM8A 2HRRA 3PVCA 4XJXA 1NN1A 3FGPA 1TJ5A 1DTWA 4EVSA 1ZD3A 3LBYA 2IH5A 1MG5A 4PSKA 1Y1PA 4DUGA 5HZKA 5IYZB 2Z51A 1GN8A 1N3BA 3NLLA 3UUEA 3WK5A 4Z53A 4CIBA 3ZD7A 3MT8A 2AV6A 3HACA 3N0VA 5EJGA 1RZUA 4QDUA 3WMEA 1P0IA 1TU0A 2NUAA 2ZJ3A 4MPPA 1Q83A 3EEIA 4YUXA 1RXEA 4JU9A 3CNQS 3LDAA 6CHYA 3HVKA 1H65A 4ZHQB 3LCMA 1FBNA 1YVDA 2GHIA 5JSUA 2P4SA 4AMGA 5LQJA 5A3VA 4C2BA 1ZOLA 5F7ZA 4BVGA 1I3NA 1W5TA 3KETA 5IULC 1TZJA 4L4UA 2OAEA 2OHIA 3SYTA 1GJRA 3TEFA 3V6LA 2RAUA 5FUBA 4DUPA 1IC6A 4GMDA 3EZLA 4PLFA 2FPWA 2Y05A 1T9GR 1N9GA 3DE7X 3LPLA 1JILA 1C3JA 3WAJA 4EENA 3K70D 1NVWQ 1II0A 4HMPA 3O8RA 7ADHA 3V1KA 1I1OA 3MNFA 3CPJB 5FNVA 1GKLA 2ZIVB 4H59A 1U8EA 2HIHA 5HF8A 5THXA 4Z9XA 1IM8A 1VFNA 4M1YA 2XT6A 3B2EA 3CWQA 2JS7A 3OM1A 2QLTA 3B6EA 4MW5A 2AQHA 2ZWAA 5IG2A 2WUFA 4Q7EA 2ZAIA 2HSGA 3LCJA 3WLQA 4BVFA 3K7EA 1KY3A 2C77A 5DNCA 4G8DA 4NDNE 3N0XA 1GZUA 1KS2A 1UDAA 4R16A 4QVKA 4BPBA 4IIJF 1WETA 1LDYA 4MDYA 4O3FA 3M8KA 2DT5A 5AR1A 3EZXA 5KCMA 5T5QA 2P0EA 1LZKA 4PO1A 1SCUB 2R751 1JIVA 4N49A 5FO1A 3VU3A 4C1NA 4CL2A 1HDOA 1Y8ZA 3QE9Y 3PL5A 1DAOA 1EWYA 2OC9A 2ZRDA 4Q37A 2IPOA 1NLMA 1NZJA 3QMMA 1NLYA 2IDKA 3QLTA 4Y2JA 1CDOA 1UPUA 4FR0A 1V96A 3T7CA 2WU1A 2B9VA 3WQRA 2WM9B 2RHMA 4KE8A 4DLAA 1DJLA 1U4NA 3O26A 1Z3IX 1YJBA 5K3AA 5KNCH 2IOFA 4Q1EA 4JENA 4NNPA 5LA6F 1P0CA 1KO7A 1NAIA 2OO5C 2DZDA 3R5XA 2XRYA 4INOA 4FS3A 2HY7A 5KHAA 3WICA 5A3JA 4E3WA 1PJBA 1ZOIA 4ZT4A 4LF7C 1Z74A 1NR7A 2IYQA 2QL7A 4XFKA 3UWKA 4G5HA 2A33A 2ZIWB 1V47A 5CP8A 4LFBB 2BPOA 2DHRA 4IH1A 3WJAA 3A0UA 1MPTA 3LW8A 5K3OA 1ZB9A 1X14A 4FYXA 1TIPA 2C7GA 2QVZX 3ODGA 3ND6A 4NENA 2RKBA 2Q45A 1I9CA 3RU3A 5JNSA 2V0GA 2ZR9A 5DXJA 1OWNA 1WTCA 1LW7A 4MPRA 2O2GA 4O2AB 4R40A 1EZZA 1O7JA 1FYDA 2K87A 1U2DA 4XZ3A 5FUVA 5HS6A 1MG0A 4W9MC 3FFTA 1UDCA 5DBHX 3HNRA 4RYDA 3ZWOA 3BRQA 2E18A 2IYOA 4B43A 2QRMA 2JFYA 4IVPA 1QC5B 1X7YB 4FMDF 4IIHA 4Z3DA 4J9UE 1F4LA 5C1DA 4QM7A 4G8BA 3FSJX 1G8KA 4HP8A 1I0IA 1QV7A 1WV0A 4QASA 2MINB 2VNSA 4TS9A 5B7GA 1H9BA 1WPXA 3HU5A 4Z4EA 2VR1A 1ESMA 2QGNA 1ZNXA 4HPJB 4RJIA 3RSZA 2WV9A 4WBSA 2GBLC 5TMEA 3EXEB 3C41J 3WLFA 2PSSA 2Q2QA 3PR3A 1NJ5A 2QRGA 1DKUA 2VATA 4MDHA 1E7YA 3ZHRA 3I3OA 5BR8B 2EZUA 2A5DA 4BQPA 1Z47A 2ENWA 1J2EA 1CSEE 2D8AA 3T15A 4JGGA 4I4IA 1IB0A 1Q0RA 1SG6A 2BISA 3H2IA 4WJZA 2AN5A 4EHLA 4XB2A 3LLVA 5IAOA 5FPHA 4R2IA 2J0UB 2QXYA 5IU6A 3THXB 4EPXA 1G8PA 4AY2A 1VE7A 1E4EA 2QW0X 1TT7A 2X2OA 2IPXA 2Y71A 1N7GA 1V9CA 2X0KA 1Q15A 4CV1A 1NM5A 3KFXA 4PYLA 4NBKA 3JWEA 3HKBB 2PMWB 1LTQA 1Z68A 1RZVA 3IMCA 4Y2TA 1M2HA 2FSFA 2DX7A 5M04A 1JT2A 4O2BA 4C3ZA 4FPXA 5FI1B 4GBGA 3NEYA 1T9GS 1F9AA 3IIEA 3Q8XB 3IAUA 4IKEA 4U00A 1NIPA 2PO5A 2VHCA 4HFNA 4NJMA 3BJIC 2IT1A 1DKMA 1NMEA 2VJDA 3W7BA 3O4IA 3N2ZB 1R9NA 2QAJA 2PKWA 3FH0A 2VK2A 2CMGA 3GWZA 3AW9A 5KNDA 1DG3A 2HQOA 1UC8A 2QPTA 2C07A 2C9BA 4KPEC 1DFIA 1JNXX 2IKSA 3OJ0A 8ABPA 5KMGB 4HQKA 3DOOA 3THRA 4MV7A 3V7WA 5T4EA 1JKMA 2Y99A 3DE2X 1TUEA 5AW5A 1SUSA 1VCIA 2P20A 1H2BA 2NVBA 3KVNA 3LIPA 1R0YA 3O8LA 2FN7A 4XM1A 1H1LB 3DLCA 5CNIA 3FLEA 2RI0A 4V0RA 2R65A 2H1IA 1O1YA 1PE0A 1EBBA 1OC2A 1PJ8A 1KJZA 2NV2B 2W6QA 2XT0A 4P4GA 4PIMA 1KE2A 3SXUA 2ETVA 1O54A 2PPVA 2OHOA 3ZWQA 1JHPA 3WB1A 4RTNA 5F51A 3BG5A 2H5EA 3ET4A 4BFVA 1RZRA 3K1JA 3KELA 4BO5A 5DI3B 5HFNA 4BO7A 2TS1A 5KINB 1ZMRA 3QENA 2GFHA 3UZ0A 4PC1A 4MQFB 4G0NA 3RFTA 4DG5A 5GZ1A 1GM5A 2W98A 3QKRA 5KNBH 3LUDA 1JTEA 2XW6A 1FXUA 2HCJB 1V48A 2GXUA 5LPNA 4DJDC 1Y7TA 3WLSA 2VJOA 3NYQA 3TPCA 4KQ6A 4RQTA 1DBPA 1WS6A 2OO7A 2YVUA 1TMKA 2BSXA 3QFCA 2H2HA 3R8XA 3N59A 3H8JA 1RD4A 2FVYA 4EJSC 1DT5A 5CT5A 3L0CA 5E6SB 3ZGOA 3ZWPA 1ZH8A 1G4AE 3H7AA 2CD7A 2QVCA 5D3KA 5EXDA 1F2UA 4E22A 5KVSA 2FPUA 3LF1A 3NRBA 4N65A 3W2HA 1MENA 3AHCA 4NG4A 3D6JA 2HJVA 2JG3A 5EQJB 1LD3A 3G1UA 1PR5A 3BFJA 2J1LA 3AU8A 3C0KA 4ZT2A 3BIFA 4QNRA 4WXYB 2WQ6A 3FTFA 2CMDA 4AKEA 2CMFA 2H1CA 2CB9A 2QIOA 1BD4A 4HAUA 5BVHB 1BRMA 1D07A 3DBVO 3FVTA 3GRUA 3DP7A 4Q48A 4GLLA 3GLQA 2I2XB 5E7JA 2FWJA 2Y1WA 4LHXA 1JHYA 1NQTA 4WNCA 3PFCA 2FQWA 5BT8A 1WZNA 2E89A 3NHBA 2R1VA 2BI7A 1U5CA 3BIJA 1GG8A 1QTIA 1XN1A 1QH8A 4B81A 2EGTA 4P7GA 1V95A 1VIVA 4J6FA 1V1JA 4MWSA 2JARA 2DQ4A 1C9YA 1RKXA 3V42A 4DMMA 1DIHA 2ZRNA 1OI7A 1BHO1 4FQ8A 4PM4A 5F78A 6PFKA 3M6VA 4WADA 4KBFA 5CDFE 4DXAA 1XZHA 3NFYA 1Z0UA 2H0AA 1RYMA 4ZU1X 3CVJA 5I4KA 2X1LA 3SFTA 2VQEB 2XVAA 3TD9A 4HDKB 1QHXA 3NW9A 4B4VA 2BC9A 2D0DA 5CMLA 2P2MA 1DQZA 5F9MA 5GVRA 3RE1A 3R24A 4GM1A 4PYQA 3U7QB 2OVBA 5ALLA 4ZWNA 3VZSA 2CNDA 2DBZA 4B7XA 3KQSA 1EPUA 3D0OA 4TSFA 5DKFA 2NUTA 4GM0A 4TN5A 3P9XA 5TGTA 2PU7A 3QOWA 1E7WA 5ILQA 1VXRA 1XZQA 2VHYA 4BEJA 3QLUA 4RPJA 4QFMA 2PCJA 1D03A 3UTDA 1MRZA 4JJZA 3HA5A 2QMYA 2CDNA 1B3RA 2C9ZA 1RHQA 5B36A 5GWXA 4IOMA 4OXKA 4F2DA 2ZSAA 4HLUA 3CUWA 5IMSA 4JZYA 5D1NA 1A95A 5J5AA 4QUKA 3HY3A 2ID7A 3DT9A 3V34A 1CT9A 3ECAA 4JD5A 3UH0A 3RUPA 4CL3A 3B5JA 5GONB 3VQTA 1FSSA 3YASA 2R6FA 1CF9A 3F1KA 5ALXA 1ULHA 3OJXA 3T5GA 3T7AA 4DBZA 5IJ9A 5FBWB 2COEA 1E59A 2FEOA 4HVTA 1NBWB 1MC4A 4J4BA 4X71A 1QH8B 5IJZA 4B6EA 4JYZA 2CV2A 2DCUA 1JHUA 1KXZA 3WS7A 1UZNA 5IWCA 4A10A 1X0XA 2WJZB 2DUJA 4N03A 1Z0FA 1QAOA 3L6DA 4EJ6A 3E2PA 4FEGA 4K8OA 5E2IA 4UVDA 1LCIA 2J85A 3ZHVA 3O8OA 4OUDA 4KIJA 2LGJA 4K6CA 3S70A 4MKXA 3VZRA 5C7YA 1JFLA 1KA9H 4TQ9A 1XE3A 1K8QA 1MX1A 4N5MA 4WNIA 3ONWA 3B7GA 4FE4A 2O8FA 2J5RA 1JA9A 4FD3A 1GQSA 2W5UA 3D8UA 3OU7A 4QQKA 3H1AA 4OQXA 4PPQA 3D31A 4DR2C 2FE4A 4XUGB 3IAXA 4EI9A 3RRFA 4D44A 1FYWA 2XWBF 3CU5A 1C8KA 1MOZA 2ENUA 4UUBA 3ZIUA 4BP8A 2X0JA 4ETMA 3ILYA 2WSYB 3SCZA 2YASA 3RNOA 2I4NA 3O4HA 4P32A 3RHFA 1H8HD 1KU0A 2EERA 2VYVD 3CEPB 3E27A 1EFCA 4MRPA 4QEDA 1EFVA 2GLXA 4OJMX 2DT8A 1RWMA 2R6R1 2CXNA 4QUIA 3PJGA 1ZRHA 3LXRA 2GPSA 1AJEA 5A03A 3U16A 3AVUA 4LYYA 3C87A 4NP6A 2GVDC 2OLKA 3NH9A 4YPOA 3R3XA 1F3OA 3OE1A 3K6SA 4Z4FA 3SPXA 4LUCA 1ND6A 4L16A 1AHHA 4GXTA 2FCRA 2ID8A 4J0QA 2FW0A 1S2DA 2GJKA 2QS9A 3OKCA 3OTHA 1NE7A 5M34A 3EEOA 4OP1A 3ADDA 1NOIA 1WZIA 3RTEA 1B93A 2VJNA 4OXYA 2WUWE 4DCJA 1QHYA 3BK7A 2FSSA 3ROKA 3DNPA 3I9OA 3IKJA 1TAUA 3V2IA 3V33A 2UYQA 3QITA 3GLGB 3UXHA 1CQWA 4PGMA 1SHZA 3OFSA 3SKYA 1D6MA 1G19A 1I4LD 3KJQA 4BFWA 3AIOA 1DP4A 1HZZA 4LC1A 4JYAB 4IXDA 4U39A 3D7RA 3OIFA 4CEJA 4WACA 4BNWA 2FW8A 1KMCA 2ZUVA 1A1SA 5TGDA 1SCBA 4EATA 1X6VA 1FP4B 3T61A 5AICA 1JAXA 2BFPA 2F17A 3ZZ1A 2FMFA 1BFDA 2ZQYA 4NBSA 1FFSA 4XIJA 2WYWA 1RRPA 2B7CA 5L40A 1ZK2A 3C1UA 2YNMD 1OWLA 1VBKA 5GP1A 4RTPA 1TW3A 4OEHA 2YVQA 4FHCA 3U3JA 4K9LA 1D1QA 3U6BA 4UTPA 5B53A 1JTVA 3CVVA 4AQ7A 2XZDA 4O2BB 3EXIB 3TQTA 3JATB 4JI5B 2HW8A 1A7AA 2VJCA 1KL7A 3CLTD 4FE7A 3K9WA 4HNQA 3EPRA 3EEBA 5F76A 3IMEA 4NZNA 3FRHA 1K8YB 3H5TA 3WL5A 3S8YA 1LV8A 2AEFA 3BRCA 4DJ5X 4ZJZA 4U2DA 2G1PA 1TPZA 4UEJA 3TDEA 1O95A 3O74A 4ILKA 4L85A 3ROQA 3TEJA 4AICA 2AOUB 2HK6A 2SBTA 1V25A 3PFFA 1YMQA 1CLEA 1W47A 2I34A 5A3QA 2YJ5A 4TSRA 5FPYA 3DAYA 1A8UA 1BEZA 2CSUA 2WWTA 5EZ6B 3LUBA 4ESOA 1FXWF 2O8DA 4O0MA 3STTA 1G8JA 4NOKA 2JI9A 4DRYA 3U26A 2CHQA 1XNHA 1EDBA 1JHXA 1RMYA 3J80D 2NPFA 1Z0AA 2IHNA 1GPNA 2DC1A 2YBDA 3O21A 4NH4A 3H8WA 3WYNA 3AF4A 3DUFB 1LSJA 2D2XA 4GKKC 3EIEA 3ZWCA 1TTHA 3NPMA 1QP7A 2HWKA 3FF1A 4MS4A 2QN8A 4F06A 4ECEA 2QLFA 4Q4AA 3TSAA 4UEKA 5LBIA 3VAYA 1Z9BA 1A9TA 2XF2A 1VTKA 4HS4A 4WLOA 1VMAA 1Z5NA 4ZT7A 5BOVA 2C5EA 4PIVA 3DJYA 1I7LA 4ZQCB 2V7TA 2I65A 4FU0A 3ZHCA 4YDSA 3HABA 1RXWA 5KOJA 1CUCA 2R1UA 4OX9Y 3AJ8A 4JXZA 2BBSA 5F2EA 3A14A 1U1FA 4NC9A 3C24A 1MA0A 4NDNA 5CLQA 1JIKA 2PNFA 4IMJB 3ZV7A 4TUYF 3C7DB 2O8DB 2CLLB 2AJCA 2DY0A 5DTJA 4EG5A 4DG9A 3VNQA 2XQJA 4NF2A 4PE5B 2WAOA 4HD8A 3RU9A 4K05A 4E1VA 1HYQA 5C5CA 2PDAA 3W6UA 3VDQA 1Q44A 4UDNA 8AT1A 3W9BA 3ZQ6A 4PN3A 1A9QA 3VHXA 5H02A 2W4MA 2OM6A 1OZ0A 1VMIA 2O2ZA 2Q3DA 4X6YA 4DLRA 4TMKA 3EC1A 1GDHA 2Z3WA 1Q2XA 3FWNA 1Q0UA 3H5OA 3AKZA 2MYUA 2FJPA 5EHZA 3RK1A 2EEPA 3FDXA 3CW9A 4CJXA 1KIMA 4BC1A 5EG5A 2ZJFA 1OH8A 1NW4A 2ZWVA 1YS9A 3THXA 2FN8A 2C7VA 3M5CA 3RIEA 3DEAA 1DQYA 2OV6A 4DQVA 1NVXQ 1QONA 3L93A 3W5HA 1XTSA 5JAHA 5BV2P 4HRYA 4UNNA 1GCIA 1TUBA 2JGFA 1QCZA 1N0HA 1UQUA 3COPA 3ETJA 4JVLA 5A9TA 1J1IA 1Z7YA 4G9GA 1P5RA 2BEUB 2G77B 3MTQA 4YJHB 3JQFC 2WWYA 2FQQA 1THMA 2R6ZA 2V5AA 1RQPA 1J70A 2H2FA 5CA0A 5CXQA 4L73A 1USPA 1GUAA 4IOJA 3ZBTA 3QEOA 1TJNA 4Q9DA 3SZ3A 2RFLA 3O9ZA 3FG9A 1KZ1A 1SUIA 3UHOA 4NU6A 3K5PA 2H5IA 3NEJA 1S7GA 3T1VA 4B4WA 5ICMA 3UPUA 2AFIA 4X93A 2IP2A 4MVJI 3ZEAA 1C1DB 5DTQA 2H4ZA 1TAQA 4OFZA 4QJ3A 5D6NA 3WHLA 1QBGA 4UHFA 3LY9A 5C46F 1OZHA 2ADFA 1AUVA 2H57A 5J5VA 3OIVA 2PL9A 5IBCA 2O2SA 3D7KA 2COUA 3CUTA 1G5IA 1M1YE 1UK6A 4AKSA 3GGPA 2AUNA 3CCFA 4PNHA 3CF4A 1OKKA 1PK8A 3KXIA 2OCYC 2HN9A 4L4ZA 4RCYA 1QORA 1RVV1 3E61A 1X19A 2R84A 5B5SA 5ERYA 2XUGA 2ZB3A 3HVJA 4TTTS 1UWVA 1S4QA 2GSDA 2C5LA 3BKWA 2JIOA 5K3CA 4Q93A 1IN5A 5LUBA 1N8NA 1ZIDA 1W44A 1OH6A 2OO4A 1IMOA 2A3NA 4G09A 4Q4LA 4G89A 2VRBA 4JSYA 3KZMA 3ZWKA 1X87A 1HURA 2DHQA 4LMPA 5F2OA 4DCSA 4REQA 4W9NC 5CBPA 4WT7A 2WFAA 3SIXA 1U28C 1ZUHA 1EX6A 5LMUC 2I4LA 1UXGA 4QX6A 3PGJA 2ZI4A 4YIHA 3DS8A 4R7TA 4YJDA 1LFDB 3KPYA 1JDPA 2BE9A 4DQDA 3U1BA 1YULA 3QW2A 2VSXA 2PZLA 4PYRA 3HADA 1U65A 4PZEA 4DQ0A 3G8DA 1INLA 1M6VB 3KWLA 4O5OA 5FUXA 1IEVA 3NT5A 1GGMA 5CA0B 5JSHA 1VLJA 1NJFA 2OE2A 2QOEA 2WW8A 1WW8A 3FETA 1D1SA 3SYKA 4AMBA 3QX3A 1E1CA 4E3ZA 2QX6A 4DNOA 2Q5JA 3PYMA 3DGEC 5H8WA 2CV0A 4I1YA 4ZD6A 1DELA 3WX0A 3JYLA 3OF3A 1UFOA 5SYNA 4OKSA 1RI5A 4LPKA 1W0JD 1CTQA 2Z4RA 3R6GA 1DZ3A 4CHTA 3DTVB 1YC2A 2GN1A 1DOAA 3TB4A 1CW2B 5JVDA 1MX9A 1BN6A 4L72A 5LA6A 3V5NA 1ORDA 3HB4X 3MBOA 2QG9A 4X8MA 3RBAA 4CT4B 5ES3A 3C39A 2WVJA 1KP3A 5IEJA 3O3OB 2AZ4A 1DADA 3P9RA 3FOZA 4GIBA 4GPTA 3U9LA 4J2HA 3TS1A 4DLZA 1FB5A 2X22A 3R6LA 3IP1A 1W36D 4UAGA 3UN1A 5CT4A 3OPXA 1WCWA 1OFTA 3HYRA 5DW0A 1YRQA 4AO7A 1S0UA 3NDPA 1FY2A 4UHCA 4D5GA 1FPQA 3FPGA 2NVUA 2BBOA 2N47A 2QZ9A 1NFFA 5JTTA