2Y27A

Crystal structure of paak1 in complex with atp from burkholderia cenocepacia
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
LEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGTTGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Ligase
molecule keywords PHENYLACETATE-COENZYME A LIGASE
total genus 149
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y27A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y27A01
5IFIA 5K85A 3E7WA 2Y4NA 4R1MA 5E7QA 4D4IA 4IR7A 2QW0X 4GXQA 4E5DA 3E7XA 3VNQA 1LCIA 4M46A 4G36A 3B7WA 4R0MA 4RLQA 2VSQA 1T5DX 5BUQA 3O82A 5KEIA 3VNRA 4U5YD 4OYCA 4GS5A 3L8CA 3GPCA 1T5HX 3IPLA 1YJ7A 4DG9A 3DHVA 1V26A 5GTDA 3FCEA 5K8FA 2D1QA 3LNVA 5BSRA 3TSYA 4DG8A 3FCCA 2D1RA 4GXRA 2QVXX 3A9UA 3RIXA 2P2BA 1MDBA 3ETCA 3EQ6A 3VNSA 4RLFA 2WD9A 4RVOA 3CW8X 2P2QA 3T5AA 1BA3A 3T5CA 3NYQA 5DV9A 4ISBA 4WV3A 4G37A 2QVZX 5BSTA 1MDFA 4RMNA 3C5EA 4OXIA 3LAXA 3NYRA 3IEPA 1PG4A 1ULTA 5JRHA 2P20A 3IERA 5BSWA 5D6NA 4D56A 4RM2A 1AMUA 2QVYX 2Y4OA 2D1SA 3NI2A 2P2FA 4D4HA 5KYVA 2VZEA 2Y27A 3ITEA 3O84A 4D57A 1V25A 3WVNA 3T5BA 2D1TA 4GR4A 4LGCA 4RM3A 5BUSA 1PG3A 1MD9A 2V7BA 3U16A 5DWVA 3IVRA 3DAYA 4W8OA 3A9VA 3G7SA 4IZ6A 5BSVA 3DLPX 3WV4A 5BSMA 5BSUA 3LGXA 1RY2A 3QYAA 2P2MA 4ZJZA 4EATA 4FUTA 5BURA 3O83A 4RVNA 3CW9A 3RG2A 5KYTA 4D4GA 4R1LA 3E53A 3KXWA 3PBKA 3U17A 3R44A 3IESA 4FUQA 4PZPA 2P2JA 3WV5A 4GR5A
chains in the Genus database with same CATH superfamily
1EFCA 3L5OA 1IBKB 1QMPA 4N82A 4GLJA 4FIZA 1V45E 3EA4A 3TOVA 3WISA 5FBVB 4W6QA 1Z3CA 4KFRA 2QW0X 3THWB 2X19A 4HB0A 1LFAA 2GZ2A 1AQUA 4LDQA 1VEHA 2ZG6A 2EXXA 2CKDA 3IP9A 1AM4D 1I7PA 1SCJA 2F17A 2PXHA 4L27A 4DMUB 2EZUA 3MK31 3A25A 1JHQA 1GXSB 3MTGA 4O33A 4YREA 3TNJA 1WCJA 4F3NA 5JAIA 3TZEA 5B64A 4QQKA 3J80A 1C1HA 2PWPA 4C2BA 2X15A 3C74A 1JEYA 1Y3DE 4HAYA 4II3A 1BCSB 2IH4A 3AJRA 2HU2A 1K5DA 2VK8A 2XB9A 3KYJB 1JLRA 2GAJA 3T1OA 1AGYA 1XCMA 4RX1A 4HN2A 1PKEA 4WK0B 1OH5A 1KP2A 1U1CA 4FYVA 1QKIA 4RHUA 2KMLA 3SHWA 1D8TA 3U4HA 5HM6A 5KQMA 2RGAA 2BGMA 2TMKA 3Q85A 3OZBA 1JJIA 1ZHOA 5EXEA 1DMSA 2X4IA 2ATXA 2UU9C 1NF9A 2CD7A 3LECA 3QE0A 1EK0A 1TU0A 3I1YA 4H1TA 3SJAA 3RJZA 4DIFA 3ORSA 4BTEA 2NV2B 5LM3A 4AQDA 3DZGA 4IHJF 4O8CA 1C8BA 3SLKA 2XB4A 3TVDA 4CRWB 4QM6A 3H84A 2H0QA 2WWHA 1KDZA 5HGXA 3GMDA 3EUAA 2O48X 3GVHA 2ZBDA 2O1EA 2QV7A 3KOOA 2QMQA 4DV3B 2JAQA 1ICEA 4TMVA 2HLDD 4P1ZA 4XPIB 3UA3A 1BJKA 1PDOA 4TKVB 5G4LA 2WIKA 1KPGA 4CKWA 3E8XA 2HT1A 2PMEA 3KO8A 3EW7A 4Y30A 1IUKA 1GN9A 1X0XA 4XUDA 3ON5A 1JR2A 2JCXA 4B73A 2BD0A 2OY0A 3NYWA 2WY2D 4CTOA 1X7ZA 3KU4A 5C46F 3LNOA 3ORHA 4LGCA 2J9FB 1L5HB 1XZGA 3U3OA 3LFTA 4IEEA 3QJGA 1ZOSA 3L7KA 5JQWA 3L6CA 1RLIA 4V3BA 2FSUA 3IT2A 1J2YA 4OY3A 4G1CA 4S0ZA 3U09A 4IKPA 1LGYA 3TLEA 2HJWA 3U3JA 3OESA 1HLPA 3AUAA 3GYBA 4DR3C 4W82A 2ZSJA 3EK2A 4CT5A 1W5EA 1ZINA 4M0DA 3P2EA 1XPJA 5F7XA 3WNVA 2LP4Y 3CLVA 5HDBB 3IRUA 4JJKA 4B6SA 5K3DA 2MSKA 1P17A 3MJCA 4WADA 1GGVA 3B1JA 1BYIA 1CW2B 2GJKA 4ALLA 2FPSA 4F8YA 2VQDA 5K99A 1JHOA 3LGSA 2IDJA 1HE5A 1R5NA 3GF4A 4N5LA 3WKEA 2YDXA 4LTMA 4BDSA 2YXLA 3M1AA 4D98A 4GKVA 3UXHA 2P62A 2AWNA 1G7SA 4P0TA 2P75A 4Y9RA 2WKPA 1W47A 3MCWA 5FWAA 3WHKA 4XIJA 1XZKA 3FLBA 3O8QA 5DBGA 4CNBA 1QBGA 1OI7A 3ETJA 4IDPA 4J2OA 5I9MA 2W22A 4ZYVA 1E2PA 2PHZA 1SQFA 3TVYA 1HR0C 1IC6A 2VHXA 4V0OA 2ZZMA 3V00A 4EY8A 3BK1A 1LWOA 1RQLA 1P61B 1BFUA 1EJBA 3REQB 4YV1A 1JDNA 3V4RA 5I3ZA 2BKEA 3A6EA 5KYYB 5FPSA 2XVZA 2HU8A 2YW2A 5MDHA 1L7EA 1MXBA 5HIKA 4V0QA 1YMUA 4RHEA 2KDNA 3AXTA 4CL0A 4Q4HB 4ETNA 3PFHA 4DL9A 3GFFA 2QVLA 2JATA 1XHLA 2GLXA 4PYJA 3WTBA 3FMIA 1U6KA 4IJQA 1SC1A 4ZKEA 3WLOA 4ZYTA 2CY1A 3K70B 3RYIA 3O75A 2TYSB 2BCEA 3CSSA 2H2HA 3L4BA 2N9UA 4OHMA 3PVZA 4LJSA 3RSHA 5DSTA 4CMBA 1YZHA 3OQJA 3RKSA 5IXYA 1RYEA 1DTEA 4UOZA 1GUFA 1JFTA 1YMQA 1KTIA 3PEVA 4IPTA 3CW8X 1DARA 1LK7A 3OPVA 2P2QA 5DX0A 1QZTA 3ZN2A 1HNWC 1XZEA 1FFBA 1MABB 1QOZA 3GV0A 3GPBA 3L6RA 3MJHA 2ZRKA 5ADWA 2D28C 4A7PA 1EFPB 1ZUWA 3MILA 3QJYA 1ZVQA 1ZN8A 2RGNA 1SXQA 3UKDA 4MUMA 1WHTA 3PX3A 2XXAB 2YQ4A 3MB5A 2PVPA 1GR1A 2PZ8A 1XALA 4O5AA 5MFZA 3IEPA 2Q7DA 2Q6LA 2HQBA 4K1LA 4J16C 2ZSHA 2VNAA 1FJXA 2J9XB 3CVWA 4IG9A 1D6NA 1DCMA 1C7RA 3QA3E 4B3XA 1UADA 4GRAA 1TM2A 4D43A 2WTUA 3TPCA 2JLZA 3TE6A 4MWZA 1A27A 3BERA 4BGEA 4PLZA 4C4RA 1TM3E 2C57A 3TEJA 2AEEA 1Q19A 1H85A 4UQPA 2P2FA 4URHA 2PRZA 4XQ0A 1JJVA 3GLIA 2I1WA 3UAZA 1J99A 4G5YA 1OH6A 4M3NA 5THKA 2C77A 1N1GA 4OQZA 1F51E 4GMDA 4FPXA 1DDOA 1RAEA 4ZA2A 4HZUA 3SM9A 4EHLA 4G3XA 1EP3B 1U8YA 4YV7A 5LQRA 4RS3A 2WYHA 4L22A 5HQTA 2IYUA 3O21A 4MAFA 3TMAA 1FK8A 2OD2A 3HSKA 4E7OA 4MPPA 4OFZA 5GGYA 1TYAE 1I94B 2P2CA 4DCOA 3GPIA 4J29A 1O7JA 3BDVA 3C5HA 1VE3A 4EVRA 2CNDA 1RY2A 1WZUA 1XK7A 4R2HA 3UHPA 4QG3A 4LWPA 2VG8A 3P0EA 3UGTA 2Z4TA 5FTMA 2VSOA 2VEDA 4NOKA 2P78A 4Z8YA 4CKYA 2ZKLA 4BRSA 3KWFA 3LBFA 2YY6A 4KK4A 4M1YA 1V95A 1CKEA 3K32A 2GBLC 1DI0A 2AC2A 1OWLA 1IQPA 1BVYF 4JYPA 4N49A 3PQ7A 2QAGC 1SVSA 3OZWA 4HMPA 2YRWA 5EJ5A 3QFFA 5JCXA 3BXZA 3QFHA 3WGNA 3KLOA 1BXGA 3II6X 1Y33E 5I9SA 3ND9A 2G88A 2IBMA 3FYUB 1UBJS 4DEYA 1XNRB 3JWEA 3R6TA 4HPVA 4QDTA 4S1OA 4JB0A 2A5DA 4J8PA 1F14A 3WQHA 2I7TA 4PX9A 1A5SB 2LKCA 5I9NA 1QCDA 1M1YB 4WNAB 1WH9A 2YUIA 4Y7CA 5IAEA 2GH1A 3DTVB 4PYMA 4E5DA 2WM9B 4IQGA 3EXHA 2DPXA 3K8QA 3NX4A 3LO5A 3QLVC 4LXQA 4PPNA 4QNNA 1N9GB 3TUIC 1SK9A 1CHDA 1XJ5A 3HKBB 3V8VA 3P5SA 3VJMA 1D1TA 3P9IA 4BNFA 3TTUA 1ABBA 3WJ1A 3EOAI 2CEAA 1JDVA 1VPLA 3AHJA 4S1NA 1OIVA 2O7SA 3OPNA 1DKUA 4BX0A 3U2QA 4D4LA 1KEUA 3NBXX 3WJ7A 1LVGA 4KPYA 1PQUA 4W5JA 1AK9A 3VAYA 3SSOA 5F1KA 2IW3A 1T2VA 3L7JA 5HZKA 2G71A 3M9WA 4N0QA 4JI3B 4DANA 5A1TA 1CY4A 2KW5A 3OLWA 2X41A 3EQ8A 1SD1A 1KDOA 4JJGA 1PQPA 3BUSA 3T6KA 5JQGF 2BFEB 2QVXX 4HLCA 2JLYA 4RIFA 5D84A 3Q5GA 4CTKA 4J43A 4KKVA 5KTNA 1SCDA 2FFAA 4FJ2A 4LTDA 4P84A 4U8GA 2ZB8A 1A0OA 4JP8A 2OA0A 5FPPA 5AXAA 1UPFA 1YC2A 1XMOC 2O4UX 3MS4A 2GPTA 5JANA 3T7AA 4UXJA 1OVGA 4G0NA 3AIOA 1XNQC 2HMSA 3TOZA 3Q7QA 4ATNA 1C4OA 1EDDA 3PJDA 4QBKA 4YRJA 3TLXA 2FPMA 1L4YA 4ARZA 2BFFA 1I36A 1H5NA 4BYMA 3PX7A 3P0HA 4IEFB 1H2WA 4D74A 5U4QA 2VJBA 4O2LA 3ST7A 4CIBA 2I4TA 4EPYA 3GZ4A 4QEKA 1II0A 2HRRA 3N58A 4WACA 3LBHA 4CCSA 1MJGA 1W36C 5FWDA 3AL0C 2NPFA 4JCCA 1JXOA 3UTCA 4BFLA 3LVRE 2EL9A 2HYIC 4EK9A 1GU0A 1UK6A 2D1SA 1NXXA 3WLSA 1CX9B 5K8CA 3ENKA 4R9NA 1GL6A 1O08A 3NALA 3WO0A 2X14A 3ZWNA 1QJ4A 5DYYA 3RASA 4E5SA 2VHYA 2IY8A 3ABSB 5EJGA 5B1HA 2YWRA 1ATZA 4R7TA 4WINA 3WVNA 1E9BA 1QGDA 5FEMA 1I2BA 1SU4A 1SVWA 1N34C 1SC6A 2KS6A 1K9SA 5E3JA 5F2EA 4YXWA 4Z3OA 1RNLA 2PKRA 2R6R1 2P68A 4NCHA 2IIQA 3DP9A 3QVWA 5EZYA 4B0OA 4TWJA 4ENUA 3OJWA 4D9MA 1WMBA 1YZFA 5CNIA 5CX1B 3HI4A 1Q15A 2Y76A 4MVJA 3HU3A 1JE1A 2CYCA 3GN2A 5DGXA 2OOKA 2IXFA 5AT1A 3UUWA 1GPAA 1JKFA 3I4CA 1HG1A 4KIUA 3VKFA 3HP4A 3NHBA 1HMYA 3BHJA 2J6IA 3R0QA 2HWXA 5DOVA 1GU1A 1EBBA 3R5KA 4LC9A 5JS2A 4ZKDA 2BTQA 2BH1X 4UEKA 3T1VA 2XTNA 4MPRA 4FGLA 3D81A 3LCJA 4M99A 4ER7A 3DVSX 3TVTA 4CLEA 2CFRA 2QSJA 2YN0A 3OQBA 4KMMA 1HDIA 4M89A 4QEZA 4TXHA 5EIFA 5CD9A 4OXRA 1L5LA 1J8MF 1T4DA 3CINA 3AW9A 4IXTA 3CX4A 4OFWA 3V80A 4XH9B 3AINA 3UXYA 5CH5A 1AMNA 1V1JA 1JHRA 2ZW9A 2CDBA 5KVCA 5A3QA 3P7MA 1UANA 1J1UA 2QPLA 3TR0A 1TQ2A 4OIMA 2VNKA 5E7QA 3L46A 3J7TA 1U94A 3VZCA 3H1GA 2H1HA 4A2QA 4J90A 1JA9A 3W3AA 5TMDA 2C7QA 2IS2A 2NWQA 2B6NA 5IFLA 2WSBA 3ZDRA 4H3KB 1JG4A 1IIRA 1SHJA 1GFWA 2HMWA 2WYOA 4CEJA 2O6LA 1RKBA 3KOYA 1WQ3A 4OXXA 1LH0A 2FKAA 1P39A 2NZVG 5D5HA 4FOOA 4XQ9A 5AI9A 2J59A 4MW7A 2VJNA 2WM8A 1T8TA 1T2DA 4MZXA 1OHHD 3B8HA 1T9GR 5AJHA 1Z4MA 2MHCA 2PS1A 3CBQA 1W75A 3CYFA 5EE0A 2W8ZA 3ILXA 4B7CA 1RLJA 4FFNA 5C3MA 2D00A 3EBPA 3I3OA 5AHKA 3AUFA 3BQMB 2XT6A 4L16A 4WAUA 2QUBA 2GJ9A 5ELXA 1EINA 3RRXA 1XKLA 4HPJB 3AZOA 4XYLA 4V38A 1MJGM 3LMKA 3ZGZA 5CP8A 3DM5A 2PWYA 1GGKA 2YMMA 3KPYA 3LQYA 1PCXA 3F9RA 3PCXA 2XCUA 3AGQA 3PIIA 2V96A 3TRKA 1MAAA 4A0FA 3RBAA 3L9XA 3TIXB 1CEYA 5FH9A 1YRAA 1NE2A 3ETDA 5IFKA 1GRRA 3NOOA 2HGZA 3VR5D 3DKRA 3HS3A 1DAFA 1SG0A 4WKPA 1A9QA 3WO1A 2OCKA 4OK5A 3T0IA 1FYXA 1DB3A 1UKCA 1JPUA 1FUGA 3ABQB 4NX2A 4M21A 4DJ5X 1GVNB 4D56A 4DMFA 1WEHA 1YCDA 4EJMA 1CQZA 1YRYE 3HL4A 3K6JA 1FVHA 2QA5A 4PZEA 4QOEA 3C97A 3T1NA 1M6VB 5FFNA 2W93A 4CTNA 5TE9A 3MJ4A 1COWA 2Z2JA 1VHLA 3C5WP 4XPZA 4YUAA 4OATA 4GH5A 3LKDA 4X54A 1WULS 4GI3A 2QE7D 2VCHA 5TEVA 3CZ5A 3TQHA 1IJBA 3EASA 5F1PA 4OP1A 1OXTA 4D81A 2VF5X 3SYKA 5JYDA 8AT1A 1LBTA 3SR4A 1M73E 1UJMA 2C2BA 3LLMA 4QUHA 5EAIA 2EFYA 1XZDA 1UP7A 2B25A 4K40A 4BC0A 2NSLA 2QRQA 3P0IA 4EJ0A 4BMSA 3TTWA 4NPAA 3AR6A 2QTZA 3CZQA 3WWEA 1GGHA 1T9BA 4A10A 4EMBA 3IAFA 5CEFA 1C50A 1KIFA 2Y77A 3MUOA 4HNSA 2VTKA 5KNLA 4JXZA 1A9PA 3OLXA 3TBFA 2BI4A 4ZJZA 4XIGS 2OG1A 3ZQUA 4AF7A 4X71A 1L7MA 2QM3A 4WBNA 2NNLD 5D86A 3I2GA 4DWJA 4S12A 2IF2A 3DF9A 1ZHHA 1GRQA 3WB0A 2EWWA 1TLFA 1OYYA 1XWFA 3EZ6A 3SXJA 3H2ZA 3KR9A 4D3XA 1K06A 1OB2A 2L2QA 2R8RA 1DIHA 4MQ4A 1U8TA 9MHTA 4OHBA 4B4OA 2SKEA 2BGUA 2XECA 1GA6A 2Q6IA 3L0YA 4A73A 4QGBA 2PUCA 3EX7C 2PWZA 4OQMA 2O59A 1SBNE 2C98A 1FNSA 2X2FA 1N6KA 1X8KA 4CLXA 2XUFA 5IABA 2BFCA 2BGTA 1Q2UA 1O5TA 3LO8A 4C4XA 1NQVA 4G4IA 1XZLA 1NQ5A 2W2KB 3C4JA 4IDAA 4N0EA 4N0PA 1ZWLA 4CF5A 1IU9A 1BO6A 1T3HA 2MT9A 1UBHS 1V5GA 1N1EA 1SUEA 1EA5A 1U0TA 2E4AA 2W9XA 2WQZA 4JJFA 4NBWA 2NYRA 3R41A 1CVLA 5DM4A 1NN5A 2AYZA 4BLPA 1EHYA 3DC7A 3HJRA 3LV8A 5CIYA 2Q29A 1H8HA 1TQ6A 1XLTA 1E6WA 3AYXB 4HEQA 3O82A 1ZA2A 2V03A 3VO2A 3H1FA 4UTRA 2PRJA 4ZMRA 2P69A 1HEYA 4FEGA 3RAPR 2JCYA 5B12A 1H0SA 3M0EA 1S1MA 1VPEA 2I6XA 3GOQA 2X0NA 5IH3A 2CWDA 1AKNA 1L6IA 5D3ZA 3PQ6A 1IRXA 4OLJA 2O8BA 1XMOB 3BWMA 4ZV9A 2V3CC 3SOPA 4AZ0A 1KS9A 4IJ5A 4PQYA 2GF9A 5JWHA 2XXJA 3GIDA 4H6PA 1AUXA 4OLAA 4MTNA 4EKEA 1MDBA 5ULLA 2B6HA 1LPNA 4MS1A 1JIXA 1BKSB 3E3AA 4MQ6A 1EGAA 2HPVA 1U3GA 3B3AA 3OCCA 5LQJA 1XMQB 1U7PA 3TM4A 4MVJF 1LEHA 4N1AA 1W19A 3A7EA 4P36A 4PGAA 4QYXA 2QIPA 4XCQA 4FHEA 1RRKA 2DSTA 4ZCQA 3UV7A 4ARBA 2BFFB 4UZEA 3SX0A 2JBAB 5A5EA 1SJ9A 3IA7A 3CJEA 4MUNA 3WWDA 1MFZA 1N36C 3H8SA 2FPWA 2VQ6A 5BYAA 4I08A 2IV3A 4JYZA 4X93A 1XZPA 2D59A 2VZLA 3R74A 3W5SA 4CETA 3AFHA 3NI2A 2VK4A 3I0NA 3LHDA 4MR7B 2A88A 1TI7A 5EKUA 2M6LA 1U3VA 1M8FA 2XYGA 1ULAA 3ECSA 4JLKA 4QEDA 4ND8B 2VK2A 1MLDA 3ND8A 1QHHB 3FZYA 3DL4A 5DOZA 1KOLA 5DGCA 2I4IA 4RNCA 1QRDA 3A9RA 1NYQA 1AK1A 3RS4A 1CIJA 2XCQA 2Z56A 1CE8B 4RXTA 3IVRA 1VSVA 5DWVA 1Q5PA 4R9RA 2NTJA 2YS7A 1WXWA 4TVBA 5EMJA 4DV5C 1EVKA 3R4VA 5EXTA 4EKYA 2XB6A 4KMOA 5CXUA 1Z0UA 1ADGA 1EP1B 1GZ5A 3JYNA 3Q41A 4FBMA 5TARA 4E6EA 1P80A 4GE3A 4F2GA 1CSEE 1OWOA 1Y5MA 1L1EA 2ONCA 2XUDA 2AL7A 1UBEA 3H2YA 3NATA 5KTYA 4G25A 4X3PA 4LCJA 2YZNA 3GPLA 1AS0A 3AIIA 4OXQA 2XA9A 4WZAA 1ODCA 2VA8A 1RI4A 2YVUA 1YA6A 1KJQA 2XBMA 1LSSA 3IAS1 2IZ6A 1X7YB 2VDLB 3FPFA 1WHTB 2O0KA 2PKWA 4LRQA 4AECA 1D04A 2FZKA 4BAUA 4LY3A 4YRKA 5EJ6A 4BEWA 1XMSA 3VHXB 3ANTA 2FI1A 3D9QX 2BF7A 3EIWA 1W4LA 1SXHA 1V5FA 4W4TA 1W0KD 1II8B 3C6YA 2BH9A 5TVGA 1WX1A 4DN6A 2XMRA 1P5FA 3L18A 1XTTA 4NYMR 3G5TA 3U7RA 1MUUA 4FFPA 4XD7D 1EXMA 4W5WA 3TEFA 1L5QA 5F2KA 4IYRA 4R4JA 4KR9A 3S5JA 3EHEA 3UY4A 4OB7A 4TLDA 2P5UA 3SZUA 3WYGA 1A4IA 1LI7A 1A4UA 2BGIA 3M34A 4L3OA 3SP1A 2B37A 1TCBA 1QYWA 3EGVA 1H23A 4GVLA 1UBLS 3L7IA 4IWYA 4F9GA 2V7QA 4RK0A 4C1BA 1W0KA 3FJYA 4V0ME 2W6JA 2ASEA 2FSFA 3ZXUB 4CG0A 1OLSB 3T7IA 1I6LA 3EODA 5SZJA 3IDOA 1VFNA 1GUBA 2X7HA 5FL7D 4PCAA 5CYFA 1DIRA 3RYHB 5BR7A 3U1VA 5CVCA 3HPQA 4ZO8A 3WIDA 5BYBA 2P6UA 4EW2A 3DO8A 1GQSA 3X1WA 2CHGA 1T9ZA 2O1WA 4JI6C 3R0JA 1LTHR 2IITA 4JT9A 4JX9A 4LC0A 3ZNPA 4DDMA 4F9EA 4RTQA 1Z5UA 4O4LF 4FFBA 4FR0A 4LBWA 3QA9A 1QB7A 1G5RA 2YOGA 2ZSIA 3PXXA 4TLEA 5AVQA 2Z6UA 2VQFC 5KKAA 3MT7A 1FZTA 4X6UA 4AG6A 3TIGA 2O50A 3DMDA 2ID8A 2CVPA 1MA3A 2Q41A 1PO7A 4MYRA 2YIDA 4RV5A 4I4CA 3A6PC 4Z2YA 5IM5A 2PMDA 5FP0A 1LSOA 2OGWA 3OHPA 5IJWA 1FW6A 1R5BA 2XZPA 1PR2A 1D09A 1F2TA 4HDCA 3ONDA 3H9GA 5HE9A 5AKEA 1MNQA 1YASA 3LM8A 4UATA 3NFRA 2E85A 5GONF 3T0GA 4C88A 1WM1A 1LDMA 5LWHA 1KVUA 5L40A 1Y8CA 1RSZA 4LQDA 3GD5A 2ZIZA 4REMA 1ISGA 3DWIA 2ERYA 3ZGYA 4RK1A 4BGDA 1CJVC 2CLMB 1BS9A 2B7CA 4D3FA 4Q4CA 3ACBA 3FRJA 1S2OA 4OHOA 1KDYA 1FPMA 3DD5A 4MPTA 3ZW7A 5K3OA 5ER6A 4DLPA 3H65A 4GX5A 3P26A 5A4KA 1DXOA 2XVMA 4TMZA 3RYCA 2YHAA 5EVJA 2XZOA 4FVTA 4CDMA 3DVAA 1RC8A 2FXVA 1IBLC 1CTQA 2QLTA 3AIMA 4KBGA 1K7XB 4RVUA 1CS0A 4QDKA 5EPEA 5F7ZA 4EMSA 4DCVA 1IJFA 1YKGA 4COOA 2WD7A 3ZKWA 1EFHA 4KYUA 2VWGA 3EOZA 3NBQA 2NU9A 4ZAZA 2QN2A 5DM1A 1GPLA 1U02A 2YL2A 4WESB 1MTOA 2EW2A 2I6UA 2YWEA 4GSKA 1SUSA 4ZEWA 2QIOA 4KUHA 5CCDA 1E59A 1NASA 4BKMA 4BECA 5LIPA 5LQNA 1WEKA 2J6HA 4IMPA 5JNUA 5JVDB 2VUHB 4W9RA 3N9IA 1JFLA 1EM6A 4Q7JB 1WU8A 4JHXA 4P0PB 1L7DA 1OV6A 1T0BA 1CU1A 4GLFA 4FYKA 3IJEB 1AKWA 5JOQA 1XGKA 3S70A 1PT8A 4BO9A 3N0VA 2V4UA 3H4IA 2C4KA 5E2IA 3HI6A 1Y6GA 1PJSA 2ZE5A 3VSDA 2DE0X 4GXTA 2H5LA 2CMDA 2WU3A 1U04A 3DW1X 3W5UA 2NUAA 5J23A 4DV4B 1SXJC 1ZM3A 4L4SA 2XUHA 5COAA 1GRCA 1XA0A 3SEFA 1W35A 3IBGA 1WOYA 1XS3A 1FUEA 1TC1A 1QCZA 4JJIA 2LIPA 3NT5A 3VR5A 4ASUA 2NVWA 2OXRA 1K3UB 4PLCA 4S1TA 1NAHA 3N2QA 4UUMA 3NC1C 4ZCLA 1GL7A 1B1CA 2G83A 1IEWA 1JEOA 2OV8A 2Q6OA 2IUTA 4QYIA 4IDBA 1F2UA 3VKGA 1EHIA 4OX9Y 3VNBA 2Y9PB 4OO3A 2PXCA 1SC4A 1B16A 3C1OA 3FY4A 1VXOA 5AM5A 1VE9A 3B9RA 3D6VA 1IHOA 3FDXA 4MV4A 4UZFA 1TA0A 1WXIA 1B8OA 2GMWA 3DAGA 1YULA 4U5YD 2ZYVX 1YE3A 2PMCA 3H8VA 4R8MA 1THGA 4GLOA 3MJSA 2ODEA 1KBQA 1EX9A 4JGGA 5FPKA 2FZWA 3LPNA 3RUDA 1RRCA 4KO1S 1WR8A 1G9XA 1KJYA 4R7ZA 4IO0A 3RQIA 3RYFA 4JKIA 2PS0A 2A0FA 4JA0A 4X1IA 1FDTA 2P4SA 2VP5A 4QU0A 3JQQA 4RVSA 4WK4B 2AOWA 3V8MA 2DFPA 2X3UA 3BL6A 1QWOA 3HB7A 1R8SA 1E1NA 3ZBPA 5JY6A 3N3BC 3QHPA 4JI1C 2E5LB 1B7GO 2JGLA 5KYUA 3HB4X 3NOXA 3E5NA 2PBFA 4ECAA 2CE7A 3GMTA 4EI2A 2Y2UA 2QMUA 4BBPA 1X87A 4WBNB 4IUDS 3BFXA 2JIZD 1X70A 1K8RA 1K08A 4ILKA 4MAMA 1I7DA 3QIAA 4RMGA 4EO7A 1YL6A 4HMQA 3UW3A 2C7OA 1WHSA 3MIIA 2NTEA 1R10A 4GP7A 4CV3A 3JQ9C 3K16A 3VR4D 3PNQA 4GWLA 1S3SA 4Z0TA 3Q7IA 4GKAA 4U2EA 2Q7XA 1FMLA 3NV7A 1N3LA 5IF9A 3LX6A 4ND5A 1D2CA 1QHIA 4JI1B 1QGOA 2VNSA 1G63A 2WPDA 4HQNA 2BFCB 3KQWA 2F7SA 1HDZA 4EJFA 5ER9A 2R97A 4ZQGA 5U1PA 4MUHA 2ZJBA 4YALA 1NM5A 5T57A 1GG9A 3ZIAA 5L53A 4B74A 2AG8A 4MI9A 2RIPA 3BYZA 3Q7PA 5J2UF 1WSDA 2XMDA 2NVUB 1Y5NA 3W5IA 3IUNA 3DS8A 2HNAA 5E4JA 4A23A 4CV2A 1FFSA 4YJKA 4ND8A 5AVOA 4LF7C 1Z2EA 1GZHB 3IP6A 3LY5A 4Q7LA 2BEKA 4OI1A 1NOJA 1QOQB 2IYWA 3RU2A 1L4FA 4EW1A 3PCRB 4TS9A 1V9LA 4HRXA 4F5ZA 2QYOA 1ZN7A 3LUAA 4OM8A 4BFVA 1NYTA 3GC6A 4Z7QB 3DPUA 3IT1A 1U0NA 4PLTA 2XWPA 3GNLA 2XQKA 5DHUA 5JCZA 3V1TC 5JATA 2NOAA 2Y99A 1U8UA 3MM4A 5MGNA 1HL7A 3HKEA 4QAQA 3GFRA 4W5TA 4XKJA 5A5FA 1KNQA 1M0SA 3N54B 1Y3CE 4M7OA 3U62A 3U49A 3WTCA 2IP2A 4DRXA 1D4FA 4B3MC 1RDFA 2HMYB 2W2LA 3J81k 4DBLC 3RADC 1ZIDA 2IEIA 4WESA 1ADJA 4ITVA 1GP2A 1P1CA 1Q92A 4RJJA 3V1MA 5EQJB 1JQKA 1CUJA 4P4SB 1QYVA 4UW9A 2QM8A 2WSSD 3UV6A 4IDDA 4C0HA 1FTYA 1BE8A 3X3HA 4CLOA 2NO4A 3EUEA 3ZE9A 4DV4C 1QIEA 2P65A 5HRCA 1U7UA 3M2PA 5DM70 3GZTB 1LQLA 1X7XA 2PK3A 1N0IA 4U5QA 1T6ZA 3HXKA 1XTKA 4IZHA 2Z08A 1RJ9B 1LI4A 2CVZA 1QS0A 1KWKA 2W6QA 1N92A 1GSHA 2VVTA 5FUWA 1PKXA 1TJ4A 3DE1X 4ND6A 1B76A 1V11A 1GLGA 4X64C 2SICE 3E3LA 3HVUA 2DUWA 4QL3A 3ZLTA 4F1WA 4BHTA 3JCZA 2QDXA 2YHBA 2QT9A 1GUZA 2X6TA 2PLFA 1KYYA 5BUQA 1UBFA 2A59A 3KX2A 4O2BB 1E2NA 1ZD1A 2B83A 3BILA 4DQVA 1NQWA 2XYHA 3KXKA 1HFWA 3ADDA 1PFYA 2QX4A 1K6JA 3HNOA 1KMHA 3C4VA 4IM7A 3OM0A 5TGZA 3K09A 2CYBA 1Y63A 3NAGA 5CT8A 4BO8A 3MMSA 1SXJE 2XIJA 2Z8YA 3CLSC 3O2QB 4AS2A 2Q2OA 4FMDB 4MYTA 1PI3A 2C5HA 4NAVA 5GZ1A 1GCOA 1TW3A 3IBYA 4OBXA 1QYDA 1GG2A 1OBVA 3BWEA 4QDZA 4XLZA 4MI3A 4KFCA 1Y4ZA 3EGXB 3U4CA 4X62B 3GLGE 4KTVA 4RHCA 3DMNA 1RZUA 4HHEA 4BMOB 2Y1DA 1SUDA 2FMHA 3HJUA 5IU6A 2IKSA 4BP8A 5B36A 3DBRA 1VMDA 2H4YA 2X8JB 5B5SA 1JLLB 3S2ZA 2O3TA 3UNXA 3DONA 4FB4A 4ZMSA 3PDIA 3HLKA 1ADYA 3AY6A 4NU8X 4WEOA 4PN3A 5JI3E 3VU9A 3CG4A 3RLFA 3P2KA 2C7BA 3IPYA 2NW6A 2XDQB 4YXWD 1KA9H 1QIMA 5EGSA 5AHRA 3TIVA 1QP8A 1QDUA 3BE5A 2GXQA 5A9SB 1SVIA 2OV3A 3UMRA 3RFUA 1KXZA 1PT5A 1DX6A 4LRWA 2YXNA 5FBKA 4UQLA 4GPTA 1NXWA 4DM3A 2FJPA 2H57A 2NO5A 4IIJB 2H5EA 2RGRA 2OLJA 2ST1A 2Q50A 3DAOA 4OAPA 5TX7A 4F6RB 4D9CA 1WOMA 1OFVA 2A9JA 2WF9A 4OH7A 4PONA 4JXKA 5CT5A 2GK4A 1NSTA 3T4XA 3JYLA 1EM8A 3I07A 1ND5A 2BY4A 2NTYC 1A8PA 2VAPA 2ZU0C 3UM9A 4AUKA 3OQHA 5JZMA 2AIRA 1EZ4A 1TCUA 3ZWVA 1QGZA 3T9DA 4Q3OA 3QITA 1U65A 3UAOA 5EESA 1DAEA 2CJXA 4HXYA 3FJ1A 4UAUA 3RRFA 3T12A 3V48A 3DCIA 1ZNYA 4WK2B 4C0KA 4QDUA 4W1RA 4BFTA 2QMZA 3LUBA 4PUHA 1NRXA 2O3SA 4FR2A 1HM5A 3FRIA 1NZJA 3KYIB 1LV8A 2X6RA 1A9TA 4YLGA 5G0VA 1HR0B 2GZRA 4CM4B 4RTLA 4Y2QA 2J3KA 4ZVNA 2JHFA 2XMPA 3H1PA 3QP9A 2C5EA 4CQLA 3KB1A 4K9NA 3DDUA 1PR3A 3GDHA 3H3FA 4FT4A 3ZHOA 1GTSA 1YT5A 2C00A 2N0SA 1CY7A 3KOMA 3PFKA 1OLOA 3AW8A 4L9WA 4X65B 3ETEA 5KJCA 3WQQA 2WWRA 4I66A 1KU0A 5JNWA 4MI6A 1DEHA 2I3BA 3BE8A 1FLVA 4PG6A 2PS3A 1FFWA 4D82A 2P2JA 2V7TA 4ZK2A 1T0UA 2CV1A 2OHHA 1CQXA 3QW2A 3ANXA 3MMNA 4X3CA 4BQRA 4G8BA 5FOTA 4DJTA 3F7NA 4FZJA 3C7CB 4L8GA 1B14A 4L5IA 1QYRA 4D0GA 4L9AA 4TPKA 4INZA 3KUDA 1JKIA 1P7WA 1E2IA 4C0QC 3O47A 4MWCA 2Y68A 3HNPA 1XI2A 3PKIA 1YR7A 2F8SA 4FP9A 2WKQA 1NI3A 2O2CA 5AK0A 4EL0A 3U16A 1FYWA 4UMDA 3N2KB 4L75A 4JI2C 2AKYA 1MXHA 1KQ3A 2IEGA 3IEKA 3OSUA 4UBNA 3ZDZB 1A82A 3GFVA 2YWCA 1JRLA 2O8CB 1N1MA 4BBZA 3RVSA 2HJHA 3BXEA 5JARA 4JB2A 3LDFA 5HE8A 3D0RA 4G26A 3AJEA 1AF7A 2HRQA 1LDBA 4FSXA 2AB0A 1W46A 3UW1A 1V8DA 1H94A 1IG3A 4MEAA 1IXSB 2YV1A 2ZBVA 3A11A 1IN7A 2IRWA 3KSZO 5BWMA 1ST3A 1CF9A 4FSHA 5KYWB 1Q0UA 1P29A 1WCYA 1SIBE 4QWMA 4RHFA 4RQUA 3AWDA 5JD3A 4UTXA 5EKSA 1T6XA 3EVTA 2Q5LA 5G53C 2ZE8A 4LPSA 3BH6A 4OB6A 1C80A 2WVHA 4R84A 1YHYA 5D3QA 2J9RA 2ID7A 4QBFA 3AM4A 5BWBA 4MRRA 1ZM7A 1KKLA 2VBCA 2XSZD 4MITA 4N3NA 1JLKA 1TCAA 2QGFA 2ZBRA 4O4HA 4QJ4A 5EA2A 2QTVB 1YJ8A 4IWXA 5YASA 5DNVA 3M6XA 2JKYA 5FNVF 2HH9A 2OILA 1J5EB 1QVRA 2R8ZA 4MCHA 2B92A 3HG7A 4MX8A 4YRSA 4FFWA 4H1HA 4GZ3A 4LYFA 5ALRA 4TV9A 3VOAA 1XTQA 4DAOA 2OK7A 5CDYA 2I1QA 3EC2A 3VC1A 3R5TA 1RTKA 1T25A 3G3EA 4CR7A 3UK0A 4IMRA 4J76A 2VF7A 1L8OA 5C2JB 5LQMA 3O91A 1E1MA 1L8QA 1XTJA 3EC7A 4C4SA 1FNMA 3ZV3A 1YI0A 4X63A 2F62A 2N75A 3AP2A 2PJUA 2JCBA 3RFCA 2PUAA 4M53A 1YB2A 2PUJA 3DE7X 4F46A 3E9YA 3MTIA 2GN6A 3PVCA 1BC5A 1T35A 2ZCUA 5LDDC 3HADA 2M6KA 1SEVA 3ASYA 1NUPA 3NHJA 4HNAB 4JBGA 1QE5A 4PZUA 3WDMA 5KHLB 3RK4A 4RTOA 3WZ2A 1G64A 3AR3A 3VC2A 2Z6AA 1ITZA 1QCYA 3GVCA 5THQA 1JQDA 1NQXA 3B2NA 2ZATA 5A62A 1DRWA 4DTCA 3KYDB 2OHIA 5EWMA 4MH4A 4KG7A 2IK8A 2OWEA 1N7JA 3LX5A 3WBFA 1NBME 2X4DA 3TJMA 5KNCD 4Z4FA 3DE3X 1CR1A 1L7NA 2A9KA 3EGCA 4GSYA 5ALYA 3JWPA 3DFZA 3QUAA 1HURA 4EARA 1ISPA 5JI2E 3TN7A 2PT5A 3C41J 1EUZA 3AHEA 4U0KA 4JB8A 1NVGA 2B7BA 3SHTA 4PC2A 2DX7A 4OU5A 2YJNA 3I6BA 1K8YB 1CUEA 3B9BA 2BCJQ 4TMFA 4ML3A 4ZOLA 2WUDA 3HM9A 3TB6A 3TW8A 2B30A 2JJ2D 2IX9A 1MEOA 1JYFA 1T0PA 1EK2A 2ISCA 2Z2IA 3KM0A 4BNLA 3G85A 5K5EA 2XT0A 2C4NA 2GK3A 4J0CA 4KOAA 2BM1A 4GRDA 4WQMA 1E3IA 3B3QA 4AJIA 2ORWA 1ML3A 1SUAA 1Z8NA 3BDAA 3ECAA 4PX5A 5KYKA 4R81A 4RD1A 3ZV7A 1JLSA 3LK7A 1FJGC 3PE3A 3DWGA 1SKAA 3TCNA 1QFSA 1CS4C 1FSZA 3HY6A 1J0DA 1DAMA 3O3MB 2NU8A 3RKRA 5WRFA 1EEXB 2G25A 4Q18A 3BIJA 1N33B 3FWKA 2ZYUX 1X0VA 1W87A 2ENUA 3ICQB 1V47A 2X8WA 4F56A 3R40A 1R3DA 3KUCA 4FW9A 5HJ2A 3SE7A 4Q37A 3K53A 4YY3C 3D3KA 4UEWA 4OJQA 1BQ4A 3H11B 2PGOA 3FDZA 4JJ8A 2AE2A 4HEA1 2P9TA 3AVWA 1JXMA 1P5HA 1CUBA 1OLUB 1VMIA 2AJCA 2ZUEA 1TT5B 2CUZA 5MFPA 4CM9A 1G7RA 4K6KA 3P97A 3VYWA 3N74A 3KFVA 1UMBA 3N0TA 5F64A 1T29A 1ZRMA 1KPIA 2V6JA 1CUSA 4CEIA 1KFJB 3NGXA 4R31A 2ZJ4A 5GM1A 3G2OA 4GI2A 3ZQ6A 1SNYA 2N3ZA 4C3ZA 1E9EA 2E6UX 2Q4OA 3GLUA 1YU9A 3C39A 2IXGA 4W8HA 4Y1FA 1V8BA 5IEBA 2R8BA 5P21A 4WBNF 3OKAA 1NT2A 4LJYA 4F86A 2H1VA 2GFHA 2Z9BA 3BRSA 1Y1LA 4N9QA 5L3RA 1LB1B 3DCYA 1FFCA 4LHXA 3SU8A 2NLOA 3D5TA 3HJBA 4GSLA 5C5DA 1CF2O 4FHZA 5KJEA 1JQ5A 3LT5A 2AC7A 5A7FA 5IKXA 4Z51A 4F84A 4H7FA 3PSAA 4NJMA 5KPJA 4AC9A 1VCHA 2IBSA 1DQRA 3O8OA 2HXSA 1VHTA 3OC6A 2G5GX 2C9OA 3T8YA 3E7PA 1RI5A 3TW6A 3G0DA 1RKVA 8OHMA 1Z37A 2ZM5A 1H6BA 3E61A 5CW2A 4JT2A 1VLQA 2C31A 1F8UA 1G5HA 4R2LA 3BIXA 3PLNA 2PQ6A 1R6TA 4JL8A 3VR2A 2EP8A 3QPBA 3VR5H 1PUIA 1PSWA 3BN3A 4EKNB 1M1ZA 3M5PA 5JJ5A 4WERA 4DYHA 3HA3A 5HZHA 3BMOA 4ZGBA 2R1TA 3LOUA 4XLTA 4A15A 3HDVA 3WRYA 1OUMA 4V2UA 1XTPA 5J2UB 4YRFA 5I01A 1ZNWA 1DG9A 1GLVA 4PEVA 1N77A 2GWHA 5KYTA 2JJYA 2QEQA 3LPLA 3EDOA 5CVUA 5ESRA 5EINA 2HJRA 3RAJA 1EG7A 3PBKA 4KC0A 1O94C 1WKCA 4YAWA 4Q4DA 1IB8A 1P3JA 1LK5A 1NVUQ 3LY9A 5TQ2A 3KJNA 5TV2A 1OC4A 4HNAA 2JD2A 3WGYA 1PR9A 3AI2A 1COZA 4GKJC 3O3NB 1C9NA 4PSDA 4RV4A 3RAEC 5BN5B 2DPLA 4UDYX 1M1XB 5J58A 1LS1A 1UKKA 3UAWA 1QWSA 2AV6A 4ENVA 3IQZA 2FUEA 1FJHA 1X7ZB 3SR0A 5EP4A 3KSBC 4B3BA 4FCCA 5CGQB 1BGWA 4JXXA 1FUKA 1QHSA 5IDQA 4TZ6A 4Z9XA 4CLHA 2D0DA 2WU0A 4ZYWA 3FBGA 2W83A 4XM2A 4Q21A 3IEVA 2FSIA 3Q6NA 4AUEA 3T1HC 2OHOA 3M49A 3QE4A 4A92A 3SYMA 1RQ7A 2Y1OA 5JAMA 2I91A 2QHXA 4QYSA 3RTGA 4JVLA 1M6VA 5AKGA 4PN7A 5E9JA 3KE9A 4F45A 2K2WA 1PU2A 1KQPA 2Q3CA 2WHPA 3KIPA 1HE1C 4XDZA 2I6QA 3MUNA 4R8LA 3RREA 2ZJOA 3ELDA 2MMCA 3LJKA 5JZ9A 3AEZA 5ILQA 5DDIP 4XWGA 1XRRA 4JSTA 1LRKA 3HCAA 2OBNA 1WUYA 3UMVA 1FVFA 4LV6A 1QHXA 1GJRA 1WLYA 1B00A 3PFBA 4QFDA 1P3DA 3O38A 2QN7A 4UE2A 3CUVA 1DT5A 1OMOA 5JSZB 4AB1A 1GTRA 2UDPA 3A37A 4KLAA 2E4YA 4G23A 3SOZA 1E2DA 2FPIA 1ISFA 4R05A 5EMMA 4MWSA 4CLRA 5IC4A 5KVSA 3O8NA 1CQWA 2Z30A 1Q84A 4YJGA 5DO9A 4HC4A 4CLDA 5FULA 5B37A 1NLFA 1YZKA 1GZDA 4X60A 1STOA 2H7YA 5CMLA 5BSWA 2P9ZA 1PS9A 2R1VA 1EFVA 3FI9A 4J4TA 5I9IA 2VSYA 3VZDA 2ALJA 1ORWA 4JJ4A 2X77A 3LK6A 2B20A 3ZDXB 3I04M 1JIVA 3OE5A 1G3RA 1UT6A 3K8OE 3LL7A 4HB3A 4RKQA 3L8YA 1XUOA 4R01A 3BRQA 1K7SN 2FPGB 2RONA 2WFMA 3CZCA 3W78A 3GGDA 4X66C 4F1JA 1QF6A 5IT5A 2E4VA 3QG1A 3CLRC 4K9SA 1DJMA 1G0OA 2GPSA 1QGUB 2J9GA 3AERB 4CUJA 4LE5A 1N2HA 1YDMA 2EBHX 1PJRA 2GTIA 2YRXA 4ZAFA 4IYJA 4DA6A 1B73A 2E8EA 1MD9A 1PGJA 1ZJYA 2I8LA 3DUWA 4BO5A 5BO5A 4H6XA 1F9EA 1U2DA 2WTNA 3VO8A 1Q3KA 1VCOA 3TPZA 2C2ZA 2NVOA 4LN1A 3TOSA 2PUGA 4KE6A 2G3YA 1XCJA 3W06A 2FFRA 2CJWA 4FFRA 1E4YA 5KNDD 2OHJA 1T9AA 8ABPA 2C2KA 4ALJA 1QSGA 1RYFA 1JEDA 2V6BA 3DHWC 4ZO6A 4CL2A 3O83A 4L5CA 4ZO7A 5ANRB 3QPVA 4C4AA 3GP3A 1C4KA 3R8CA 3QE9Y 2FRVA 5AK4A 4PUIA 4R9SA 1FRQA 1FUIA 4Q47A 1Z2OX 3GVIA 5C8VA 2MU1A 1TEVA 4KPFC 2ZSEA 1GIAA 2AMLA 4D9EA 1GQQA 4X91A 2D2VA 4G63A 4CKZA 4DB4A 4YJHA 3S44A 3PDUA 1X8XA 2XWBF 4PCLA 1IH8A 1K6EA 4B3SC 4E0BA 4GW3A 3SFTA 4TVSA 4LYEA 3OKFA 3OTWA 3VH2A 1VE6A 1DL5A 3HFJA 4YUXA 1L1FA 2B35A 3G0OA 4OKIA 3ZV4A 4GXQA 4PO8A 2BFBA 3UFXB 4DGSA 5GONB 2VJKA 2CFCA 2V6GA 3VPFA 3WAKA 4A2WA 4GZLA 2BGKA 3JARB 3N8HA 4EITA 2O2EA 4V0KA 2BEWB 1XL1A 4O6VA 3B2EA 1SFRA 5JMPA 2GSDA 1RWVA 4GS5A 1F8YA 4P93A 5CVVA 3UJ7A 3H2HA 3UIEA 5JS6A 4J2TA 4TKLA 3X1JA 3ZWBA 1N1DA 1RRMA 1FMJA 3CWCA 3WLQA 3GT7A 3VHLB 3EIQA 3N59A 4F0JA 2HRDA 3DFFA 4EQ6A 1THTA 5LP1A 3C7TA 5AKHA 2FR0A 4DHEA 4FGWA 4O63O 1FFXB 1ZSNA 3HMKA 4XYMA 1FX0A 3H5RA 2IEZA 3O94A 3QXJA 4BCCA 1MRNA 1P6XA 2OPLA 5T41A 4LMAA 2HWKA 1A72A 2FFJA 2B78A 2MCFA 4BZQA 5DGTA 4TKVA 5AVYA 4C5CA 1PJTA 3L1HA 3CY6A 4IMIB 1KOGA 1GARA 1FTGA 4MGYR 4CU5A 1O8BA 4BNHA 4ZIRB 3CA8A 3SCZA 3G2PA 2WWVD 3WWYA 3IILA 1QLJA 3K0HA 1U6JA 2E4XA 3D8RA 3QV1A 1V8PA 2AGVA 4WBXC 1UQTA 1AIPA 3NEJA 4ZDWA 2Q9UA 1RADA 1PR1A 4M88A 3FCAA 2P3QA 3H5IA 5LQUA 4H1WA 3PNMA 3KZXA 1RP7A 2PL3A 4YO8A 2O9JA 2PRKA 1P31A 5JO9A 1LU9A 1FTNA 4U02A 4CM5A 2X22A 4OUDA 1BXKA 1YHNA 4P82A 3QYJA 3URMA 7REQA 4FYJA 2QVYX 4JV5B 2V3VA 1VI5A 1SKYB 3OX1A 3ZE0B 5KKCA 4EUHA 2XRFA 5C5EA 4QOFA 4HG2A 1R6XA 4CMKA 4INPA 4E1VA 1GA4A 1W36B 1UKBA 3PRHA 1E8MA 4KYIB 2WHQA 4PLVA 3H4VA 1A7JA 3ZQ4A 3EZGA 1PZXA 2GK6A 2HPZA 2OZLA 3X1XA 5CB4A 2OZPA 2IS4A 3W3AD 4HDAA 1Z6XA 2OBMA 3CR7A 2L18A 4FGSA 4LZAA 1T9HA 1UXHA 4DWVA 1F06A 4BNWA 4GI5A 1POXA 1PG2A 1FNBA 3R09A 5LB4A 4IICA 1DINA 5F76A 1Z88A 4D97A 5KYXA 4P33A 3QKUA 3WNDA 3ZWPA 4DLWA 2O8DA 5A3JA 1US8B 1USPB 2WIJA 3QYAA 1W0JD 2ACKA 4WY2A 4U63A 3WLLA 4DDKA 3FHOA 2W6CX 2PSFA 3GFGA 4HAWA 4LOIA 1R0RE 2F1JA 1Y37A 4NOJA 1BDHA 4C7KA 2QR2A 1MVLA 1PIWA 2O3JA 5ALTA 2IHTA 4LAFA 2ZBQA 1Z2PX 1MENA 4M8NE 4PRKA 1Y80A 5K0JA 1PK9A 3CNHA 4JI6B 3G9TA 1NBMD 1THZA 1O58A 3CRVA 1Q7TA 4BVAA 2C8JA 1YZYA 3C0KA 5IG2A 2VDMB 3IKTA 2D4AA 3UK6A 4K9KA 1X3SA 2WWWA 1ODLA 3F90A 5HFAA 5IWAC 1G18A 4XTRA 1W30A 3DSRA 3KQLA 4PROC 3D8NA 1ZLXA 2ILTA 2WVJA 1TKAA 4FNOA 5DNAA 2ZE7A 4QUGA 4TLCA 4BCBA 2EJTA 5KHAA 5DM0A 4E5PA 3O7MA 4PRLA 3NAQA 3N0WA 1OXMA 1RJFA 2CCKA 1KXJA 4KN9S 2LR0A 3EEBA 1JFSA 2AI3A 1KSFX 1YAHA 1ICIA 2QUHA 3CE9A 3H0EA 3IB6A 3G0HA 1YDWA 2GM4A 3SQXA 4KQWA 5LPNA 1LLQA 3RSLA 3N87A 5KBYA 4E07A 1CQJB 2LCQA 4LECA 1NJ2A 4GNRA 3QVGA 4BV8A 1CBUA 1VSTA 5AOAA 1XE3A 4MLCA 4HN4B 3F8SA 3JQ9A 4DC1A 4YV2A 4ZYYA 4P32A 3H2BA 1T8RA 3QKSB 1G8SA 3T35A 1VGRA 4QU9A 4LY6A 4P31A 2UXBC 2H59A 2AOTB 5DE3A 1XPUA 1KFEB 3FPAA 2E87A 4E51A 5JIBA 2V4ZA 1CULC 1UM9A 2ZT7A 4HMOA 3RIXA 4UTZA 4XZ3A 5DHFA 1T3ZA 1Y3HA 3FYDA 3KYDA 1U4OA 1KYXA 2CZCA 2XNHA 3EXHC 3IFSA 4PXAA 3C8UA 5CFNA 3NRJA 4KR2A 4TUYA 5DHAA 4QRIA 4E03A 5LL6P 4ZXPA 2W2LD 5LYJB 1ESDA 1WPRA 4UHHA 1G1MA 1AUQA 1WXXA 3OZCA 4IGKA 4E4TA 6REQB 2C9ZA 2C7VA 2HNKA 5JMTA 5CFOA 3NWOA 1ETHA 1R2QA 4H7PA 3PNSA 4LWOA 4U7WA 2AFVA 2WTXA 3HFRA 4LPKA 4N3GA 3VJKA 1D2AA 3ZGXA 1IVNA 3U4QB 5ITSA 5DYTA 3H5NA 2BH2A 2ODBA 5CA0A 4U8HA 3TJRA 3F96A 3HJFA 3DXFA 4HBGA 4UBKA 4X61A 4DJAA 1VLLA 2WU1A 4Q01A 3HEBA 3NNDA 3TSZA 2IU3A 5B2EA 3NWPA 1NBMA 2P5SA 1BVHA 3AEQA 1UZAA 2OCYC 3MMPA 4QJ5A 5FA6A 1QVVA 4W1PA 1VMEA 5K8UA 5TSDA 4IIVA 1MB2A 7REQB 3ZV6A 1NF8A 5KSZA 3H2GA 2EL7A 3MA0A 4NABA 4CIVA 2PUBA 2NTVA 3O2NA 2C8KA 2LBPA 1SELA 3DTVD 4AMGA 3IPRA 3RG8A 5E9WA 4L4UA 1Z8DA 2GRJA 4KQXA 4NDNE 4NNOA 1BMTA 1CJSA 1J20A 1T1JA 1C0KA 2PGDA 1V5WA 5C8ZA 5BR8C 3HMQA 3NXSA 1V8FA 5LOVA 2VHZA 2Q1YA 1IOVA 1CUWA 1G5PA 2GEVA 3B1ZA 3TQOA 3TF5A 1TT5A 2ZVQX 3ZY3A 1CWUA 1DX4A 1ZRNA 4NVRA 1RWKA 1MGPA 1X14A 3H9CA 4H7JA 4URWR 5G3YA 2V1XA 1ZCBA 2BISA 2GNOA 3UBTA 3EZYA 2D0OB 3FMOB 1WCV1 2X0JA 2X5NA 1J90A 2JA1A 4C87A 1N6OA 2PVCA 2CXHA 3ZD7A 1OLXB 5EWLB 1NP6A 3JATA 2LGJA 1WU7A 4DV6B 1UJ4A 2JGEA 5IVIA 2XX3A 2J4CA 4RKYA 2DTDA 3H05A 2O1XA 3NHFA 4JLSA 1V9CA 4AMZA 3OG9A 1EG2A 1XZCA 4YJ2F 3EIHA 2C9CA 3MNFA 2WRZA 5GONA 3O8OB 3KJGA 3LUDA 4RKWA 4V3CA 5DI3A 221PA 3SJBA 2ANBA 1D03A 4JLJA 1QIJA 3CH7A 4BATA 1H42A 1O97D 2XDYA 3EGWA 1AZTA 3K7EA 1IHPA 2EJVA 3LU1A 4PZDA 1RS0A 2ZTHA 2A4KA 4H4CA 4PTLA 3ETGA 4YRTA 1VKOA 5J63A 3W4KA 1HDYA 2NPOA 1GUYA 4YCDA 4EKDA 5GTDA 4ABTA 1NVAA 1LNQA 1AKUA 1VL5A 2GBIA 4M0FA 4ZC1A 1C3OB 2A0XA 4IJVA 4E5NA 3W77A 5KIAA 1EDZA 2FG6C 3VTZA 1P7YA 3JZIA 3L0ZA 1XQ9A 4AJKA 4TX1A 1NW6A 1V7ZA 4BAZA 2QG6A 2QD1A 5CT9A 4BQQA 1YK0A 5A4AA 3OQIB 3T5AA 4DCMA 1F6WA 2HWYA 5L3SA 4LTNA 4DTIA 3TTYA 4DRZA 1SOWA 2R5NA 4BO6A 1QK3A 2HZ7A 1QV9A 2Q5HA 2YV3A 3D5EA 4LDNA 1GTZA 1RQRA 1ST2A 4MQLA 1CK4A 4RTSA 1QZ3A 5T8SA 4WCVA 3TUZC 1HKUA 2WMOB 3E6AA 4L78A 2YVKA 3K94A 3EH1A 4YMVA 5FEUA 3DEZA 5LMZA 1ZQ9A 3IQEA 3GRRA 3HR4A 3H1BA 3JRWA 3R7LA 4BVKA 3OTOC 1W2HA 4GM4A 5BXQC 1EUYA 3AVXA 3UHFA 5DXAA 1ECJA 1WPXA 3G13A 4EFLA 1N5JA 1IVYA 4MAAA 2JF0A 4U5XA 3CZMA 2QYHA 4J16A 1YFKA 4S35A 1SCUA 3FIJA 2PUHA 4RKEA 4ZYXA 4ASUD 2IV7A 1B0UA 5DEIA 2C7GA 3GW8A 2JLCA 5TQJA 2Y1LA 2Y1CA 5CITA 3EYAA 4WKGA 2JAHA 3AFIA 1IOZA 1CS0B 4MEJA 4BKRA 5KQLA 4UEOA 2Q6VA 3LP5A 1E5DA 4MA4A 4UDXX 1KFKB 2WE7A 3PGKA 3TLJA 1QONA 3O9VA 3BM5A 3DQPA 4IFTA 4LJ6A 3K6SA 2AHOA 2GCEA 2ZRNA 3AU8A 2UUPA 3LGXA 2OQVA 1Z39A 2OHFA 1UR5A 1SKQA 4AK9A 3QHAA 1U9IC 2OPBA 1ZD2P 2QXYA 3E7FA 5TJHA 3TTXA 1Z18A 2JLUA 1XD9A 1PT7A 3CUUA 3TQIA 2D1YA 1XVAA 1RQGA 2ADOA 2UUOA 2Y1WA 2MR6A 3AI7A 3N39C 4LVNA 1K6XA 4X84A 4XIYA 5ALJA 3WLTA 1NUAA 1P5ZB 2E7ZA 1MO5A 2PFGA 1GKLA 1AD2A 1DKMA 3I8OA 3JAKB 3NEAA 4QXRA 5F77A 1XEXA 4BGVA 5T7BA 3ZE1B 3IMEA 2IELA 1I7SB 2BGGA 3D4PA 3TIIA 3CRRA 1G5TA 3WLHA 1DX9A 2CXUA 1BD4A 4REOA 4XX1A 4OLHA 5J2TB 1Z6TA 3ZDYB 1CUAA 3N7TA 3BZWA 1SXIA 3MIZA 2XJ9A 2RHRA 3N8NA 2ZYTX 3Q3EA 4NE9A 4WZZA 2O8EB 1T2FA 2J3DA 4WFQA 4PRYA 1I9CA 1KYZA 1NJSA 3BB1A 4G5RA 2JG3A 1ZUIA 4FYXA 1WB6A 4HPXB 4KR3A 1GKIA 4TS1A 2DQZA 2VF8A 3B7PA 3UK1A 4MS3A 4NC9A 1OYVA 1R6AA 3LF1A 4G36A 3GT0A 2ZSFA 2EGHA 4MWDA 4LFAB 2PVSA 2HM7A 4H7HA 1XP8A 3COZA 1ZO8A 4AY3A 3OE4A 4G97A 1DNPA 1KVQA 1NI4B 2ODTX 4ZQHA 1LLCA 3NWBA 3OFNA 3RJMA 4DUYB 3GFOA 2O2DA 1DSSG 1GDTA 1RYYA 1ZZGA 4AZSA 4KDFA 1TZMA 2FEMA 2ZS8A 3JQAD 3ACCA 4PLWA 4ZI3A 5KWEA 1Q0ZA 4Y2UA 3HBAA 1MPTA 1SIUA 4N0MA 4ZQCB 5AWFC 3WYCA 4TWAA 4CMJA 1ZOOA 4H0NA 5FBWB 2FP4B 4H08A 4N8DA 4YRGA 1EM8B 3N70A 5EE3A 4I1PA 4EG6A 4U6NA 3IR6A 1X2BA 4G2NA 1CC1S 1Z08A 3KXIA 4NNJA 2YASA 4TZ0A 1IY2A 2FCAA 1FSPA 4LJAA 2C2YA 4X90A 1DC4A 1R64A 3NHWA 4JB3A 3OQPA 3URKA 5BY2A 3ZI0A 1MMFB 4YCJA 3A3OA 4IDGA 1LS6A 1XDDA 4B6RA 1VHQA 2YY7A 5BN4A 1P4EC 1DBWA 3PKZA 4HDOB 1YD7A 5L4NA 1XZJA 3DTNA 4CVNA 1TIKA 2X9GA 4EB6A 1D07A 2QORA 1DTWA 4QTUB 3UQYS 3I08A 1RZ3A 4DFDA 1OF1A 2BMFA 2W2PA 2YHSA 3I8XA 3AV0B 1XVLA 4MP3A 1E58A 3T4UA 4LDPA 4A36A 2FDRA 3S1SA 1JLLA 3NHPA 2WM2A 3OSZA 4MPJA 3R9XB 4NXMB 2AW3A 3G9UA 2YXPX 5CGZA 3T3EA 4BMPB 1DVRA 3NM5A 2OM2A 2R87A 4HH0A 2OO3A 4IUCS 4F8JA 4PHHA 4RFSB 3OBBA 1T9KA 1HWYA 4MPDA 4QBTA 5DHSA 3WS7A 2XQVA 5GV8A 2Q7OE 1DWUA 2I0FA 3PE6A 1MZVA 6AT1A 1EVIA 2A78A 4OBBA 5JSUA 4AKHA 5LSAA 1YSCA 3BMNB 2XYPA 3RSQA 4AJOA 4EHAA 2WVAA 1JYSA 2EJWA 2V7BA 2BPOA 1NWHA 4OQPA 2DF8A 4DLYA 5C8DA 3DMGA 1PVVA 4ZQBA 5FCDA 4BDTA 2LW7A 3NC4A 3LCRA 3RVQA 1JG1A 1N7HA 3L07A 3MN1A 3RIHA 3PQFA 2P4EA 2PTGA 5FAKA 3A06A 3H5TA 1EFPA 1NYRA 3QEAZ 1FU7A 4RABA 1U5AA 5G3ZA 5AXDA 4N5IX 2GILA 4GBMA 2ONKA 1FEZA 2GHTA 4QPJC 4MUFA 3F6YA 4YRZA 1NUUA 2H31A 3L7YA 5MF6A 1EFRA 1VYTA 4JVOA 2WD8A 1L7PA 4PG7A 1YDGA 2TS1A 2APJA 1RBZA 4J7CA 4RIEA 2C3MA 4A6PA 4P3OA 1N4DA 5FOVA 4QLBA 1JVSA 3S0JA 3HDHA 3WGTA 3QV2A 4CDNA 1D0IA 3CN7A 3WGLA 1GITA 2BR4A 4DXHA 4AUMA 2A8YA 4UHEA 4PE5B 4ZDIA 3OQNA 1UBMS 3FVQA 1PTJC 4LX8A 2WJVA 2Z51A 2QU7A 3KKPA 1WBJB 2D5BA 3F2IA 3N53A 2IVZA 1PJ4A 3OC0A 2PGLA 1QP0A 1F5NA 2FZ5A 5J4HA 2UXDC 2XIQA 4DR2B 2JK1A 5E6UB 3E2PA 5KWIA 3UYKA 1FTQA 2Q6KA 2Q5IA 3K5IA 3PT9A 3NNNA 1RTTA 3B6ZA 1YV9A 3M3PA 4NE7A 4RXUA 1R0WA 2WP0A 4Q7MB 1Z5ZA 4MVJG 4ZN6A 1FNCA 4RK7A 3QLTA 1M7GA 4P2GA 3STHA 5KJ6A 3AUXA 1VMAA 3SIXA 2J85A 4C43A 1TADA 4PYRA 1AV7A 1BN7A 2QM7A 3A0UA 4LHZA 4O25A 4UHDA 3EWIA 1DBQA 1F2VA 2GFIA 3D5QA 3AO0B 4TN1A 5CW1A 5F9FA 1KRHA 2O8EA 5KSYA 1O5IA 3NNSA 1YL5A 4A3SA 4DXAA 4E31A 1ZI6A 2WZQA 1XRLA 1GNRA 4GI1A 1BA2A 2E37A 2QQ0A 3AVPA 4JC8A 4QM7A 4Y2YA 4ZZ2A 3ZWYA 3T0FA 4E3ZA 4F11A 3RARA 1DUSA 1M72A 1UWKA 3PIDA 4KB5A 2YJ6A 2R6GA 5CVJA 5LZ4A 1JFRA 2GN2A 3KTAB 1LW7A 2YY5A 2PLRA 3A3KA 4AWBA 5JSHA 3EVEA 3FVVA 3B6MA 4Q3DA 1PDWA 2XCSB 4GKJB 1NRWA 1LTKA 4MIEA 4EHNA 5IDVA 3E8SA 5JNTA 4IIUA 3KVNA 1PN3A 1N2FA 1QM4A 3DNPA 3KK0A 1GNSA 1OW3B 4XJVA 1C1DB 5JQGA 1QR2A 4C3OB 3JVVA 4OKSA 1I32A 1X9IA 9LDTA 4FYMA 4CIDA 3F6RA 4YCLA 2RBEA 1ZK4A 3PEEA 3PSHA 6YASA 4YRDA 5FD8A 1E4VA 1ZRSA 2W71A 4B6OA 1T0HB 7ADHA 1E5QA 1PR0A 3FWZA 3IERA 4MDFA 1RRVA 1YQEA 3PC6A 4Y2PA 5JAUA 1MOZA 1PWXA 2B0JA 4LNUB 4RDHA 1DOAA 3PLRA 4PAOA 4QKQA 3DMTC 2ZXUA 3ER6A 3K1TA 3K70D 1RFGE 2O52A 1SHZA 3LC7O 5GM2A 1U3UA 5DN6A 4Z0PA 4JMPA 4I3FA 5HS6A 3W3ZB 4N5NA 5JNSA 2JIRA 2R11A 5B4UA 2PLNA 4JL6A 4Z4EA 2DLNA 3SR3A 3I2JA 1TYZA 4D9GA 3LBNA 1NPYA 2FOLA 3DL7A 3PWKA 4HAXA 3OURA 1NE7A 2BSXA 3LXUX 4P54A 4YYZA 3RYFB 1VIDA 5I7VA 2KJQA 5T64A 4CKCB 1N5IA 4YJ3A 2BFNA 4YY3B 4IGAA 1E3LA 3MWLA 4PY2A 4RSMA 2QXUA 1CDEA 3A9VA 2J8ZA 4QUJA 4QNMA 4XFDA 3BF7A 3WMGA 5HOEA 4R1UA 1BXRA 2G76A 3CS3A 3WGKA 4D3ZA 3FGOA 4TV9B 1QTNA 3M6VA 3SHOA 2JFNA 3T5TA 1W4CA 3DD1A 4O4IA 3ZVLA 1AGNA 3HB5X 1YR6A 4ONEA 4PSKA 2NV6A 1X7GA 3GJYA 4NCKA 4PHTA 4K0KC 3LQ4A 4B3DA 3OTGA 1H2YA 3KUXA 1Q2XA 1Z13A 2PD6A 4AKSA 1RLUA 2AX4A 4GX1A 3AJDA 1O95A 1CUHA 1WSAA 1ZY2A 4MI1A 3H0KA 2VQEC 1QFMA 4NMLA 4IIYA 3K70C 1N8SA 2QAGB 5LD2B 2BFDB 4KTTE 5A3RA 2R2AA 4HAUA 3QLUA 5AKIA 4CFZA 1KY3A 3PDCA 3IESA 4DOMA 3BQ9A 3S1LA 4IS2A 4NBKA 4ZOAA 4J75A 3ZXYA 3T3OA 2E82A 5IFIA 3CF0A 4NONA 1HRDA 2FNAA 2RCNA 3HPRA 4K05A 1Y5RA 4IEIA 4NESA 3LDUA 1FCJA 3CEPB 1R9JA 3H87A 2YCLA 3KKLA 3DOHA 3FTCA 4I8IA 5L9AA 3RVDA 4QOGA 3H6GA 4WZ6A 4CG3A 3QWAA 3W5VA 4WXMA 4GZ6A 4BFSA 1PHPA 4YXFA 3F71A 1V7CA 4B2LA 1JN0A 3HTXA 2GBCA 2VXBA 2VUIB 3FSRA 2NYAA 2XRMA 4HXEB 1OPRA 2P41A 2AUNA 1WPGA 4D45A 3UEBA 1ULBA 3KJXA 1NXOA 1A76A 2FG7C 4YRLA 2XUAA 1JXAA 2G4LA 1M2VA 4QVGA 2A9PA 4S2EA 3WYBA 4AO6A 1ZR2A 2IYZA 3FNBA 2BP7B 4KQJA 2CLCX 4YHHB 1G16A 1Z4QA 2XQIA 3ABRB 1IL0A 1C81A 1AXRA 3LFHA 2NX2A 3AEKB 1R8YA 2VP3A 1EVJA 5EJ4A 3R23A 1TQ4A 2IUFA 1ODIA 5F2OA 2O3QA 4LJ4A 4PAWA 3TINA 4UREA 3GGGA 1R0ZA 1YBFA 1DWPA 2YZKA 3ZBQA 2JKZA 4YA6A 4GMKA 2NNWB 5CURA 1REQA 3LBAA 1V43A 2IZ5A 2JDIA 2HLNA 2IYFA 2QRZA 2BR5A 1L5RA 3QF7A 1ENZA 4EF4A 3R8FA 5CZVA 2P90A 2E4UA 2EJBA 4MYHA 1FMFA 3NC0C 1MFPA 3FNIA 3R1IA 1GYQA 1OAAA 2DTXA 3OE7A 4FJ0A 2MCQA 4LF4C 4OOEA 5EQDA 4EI8A 4M1MA 4DSZA 1W8DA 2P1RA 4YPVA 3S8MA 3H2KA 1ECBA 5J47A 2VBGA 2ABWA 4R0VA 1WP4A 1IM2A 1MC1A 2HF9A 2Z2KA 3B5IA 4MVJD 4DC9A 1ECFA 1QIGA 2J67A 3WHPA 2IZZA 1HTTA 1SC3A 3NGLA 4RPJA 2H9AA 3TZBA 1NONA 5LYYA 3ZVNA 2ZSKA 3B9PA 4UPVA 2PAAA 5K09A 3Q87B 3EXG2 2JVKA 4RK5A 2IZ7A 3WMRA 4EVIA 4TYWA 2C1XA 2J7KA 3FOAA 4L8LA 2QPTA 3FSGD 4URVR 4I1OA 1EEHA 1U3FA 1V25A 3IP3A 2RHOA 1MXCA 2FAXA 3GGOA 4XLLA 5EIAA 2DWUA 5IAOA 1N2IA 1FS5A 3KEQA 4A1OA 4PVCA 2ZJ3A 5JS7A 4MW4A 1TUEA 2JFYA 5AVTA 1GFZA 5JH7A 4NEHB 2AOVA 3FNFA 3PG5A 1Z5WA 1HDGO 4JGBA 2HNBA 3EGOA 2ASBA 2A30A 2LIVA 4CIXA 5L3QB 2EWVA 2ZPTX 1Z6ZA 1XPOA 3OLZA 1A77A 4DLAA 3K35A 2A2ZA 1PQYA 2ILVA 3IV9A 2P2MA 2AN3A 1WUIS 4N5DA 1EB9A 2OKCA 3PHGA 1Y48E 3CEJA 4N40A 2AQKA 2GLTA 3GZJA 4G41A 1CQPA 4UMVA 1A8HA 4HTFA 4JJEA 2HRBA 3S99A 1V1MA 2Y6VA 5LZ8A 1UKYA 1RXVA 5ALUA 2Q0XA 2VJLA 2WWTA 2IQIA 2PZMA 1RQPA 3I5AA 5LA6F 3EW9A 1RMTA 3DDCA 4JC5A 4AY6A 1L3IA 3CW2A 3QKWA 4KQKA 1X94A 1BAPA 3WICA 2ZUTA 3S2SA 4N7JA 3NPMA 1II9A 4XWTA 3GBVA 5JDCC 4X95A 1WCIA 1KI2A 1PSDA 4UZSA 3HV0A 4NJMB 3TUFA 1AB6A 2I34A 1H69A 1FTWA 3ZI7A 4WN9B 3JWGA 4NENA 2OP1A 3VR6H 1PLKA 1UAYA 4M46A 1IYZA 4LDZA 4NJEB 4DPKA 4RGQA 1VL2A 1M6EX 4HLDA 2AG5A 3ZDBA 1PGNA 6PFKA 3U7FB 5GAJA 4NU5A 2FSGA 1OVMA 2X2OA 4N7BA 2Y6UA 4YV0A 5ADUS 3IBCA 3THXB 1GAXA 4TSFA 4EJSA 3K6SB 3B1FA 1A4XA 4XIFA 1CYEA 1DEAA 5IN5A 1FUYB 1HH4A 2OQRA 1N57A 1E9FA 4DV6C 4ETMA 4Q93A 2XGGA 1NBOA 3FI0A 3UZ0A 2DQKA 3KOZA 1DIBA 2R86A 4MRMA 3K09C 1JEJA 2XT9A 4EZBA 5B55A 5HM8A 1WZCA 2JGRA 1NV8A 4H1UA 4DM7A 5T8KC 2F67A 2UVPB 3AESA 1Y4DE 3KQTA 3NHLA 1XRQA 2PZEA 3KB8A 4PIPA 3W5CA 4YASA 4CCYA 5HR5A 4OK3A 5JJCA 4IW3B 3W1EA 1SGWA 1YKFA 4FLEA 2QZPA 4ND3A 3T95A 2CL7X 1E77A 2XITA 3UAVA 4US0R 2RH8A 3HXLA 1AA9A 4DIKA 1BRTA 4HP8A 2BJVA 5CXXA 3ELBA 2F55A 5BMVF 2PCLA 1AGXA 2ZJ5A 4FQ5A 2GN8A 1ISSA 3HGTA 5I48A 5DTRA 3U7IA 4UCQA 5K7SA 1VCMA 13PKA 2J4DA 4ER3A 2P20A 4DLLA 2EFCB 5EIBD 2B0CA 3RNOA 4YMGA 3ENVA 1A5AB 4OL9A 4L72A 2X0FA 3CRNA 2PM8A 3GOHA 4TS3A 5FUYA 3VU0A 4O1IA 1CJMA 3I58A 2QNBA 1E1KA 2RKOA 2XLBA 3A3YA 2ATCA 4JOCA 5EGNA 3CLUD 5AVVA 1GKUB 1PJBA 1A50B 1R4ZA 4OHWA 3HDJA 4WZBA 2HBQA 4WHMA 3WWOA 1VE5A 3R20A 2GEUA 5JD4A 1KI6B 2YWBA 2PD3A 2YJTD 2ZU6A 3SIPA 1R27A 2HA0A 2R7LA 4U7HA 4MW1A 4ZARA 4MYCA 4F92B 4D3YA 2OENG 2YW9A 1W6RA 3IR7A 3L0DA 1I80A 5ALDA 3QIVA 2PSJA 1UINA 4HFNA 2CHQA 1LPBB 3PC3A 4KE9A 3COWA 1RQXA 3D31A 2O0HA 4JI7C 3SYLA 4CKCA 5HMLA 2VIIA 3CXRA 1S9DA 4CUKA 3KNZA 2ZJ0A 1Z12A 3AB3A 1R16A 4B83A 4AD8A 3LI2A 4X5OA 4HDNA 4L9SA 1XZAA 2XA1A 2BR3A 2VPQA 4C3VA 4J0JA 4TKUA 2XDAA 2ZDGA 4BPRA 4J4HA 1B8NA 2F3PA 2BM8A 5T6MA 2M5OA 2AEMA 2I4MA 2BRUC 4PIVA 1RCTE 4ZVPA 3I2KA 5TNXA 3SDZA 4CR8A 1QFZA 3ICCA 4J6FA 1SA0B 5KMGB 2Z4RA 3V1LA 2K6GA 4TVKA 4EBFA 2CJPA 3LUCA 4I6GA 5FX2A 4TM7A 2ZS7A 4O1MA 3QYFA 4UXIA 5HNKA 1P0FA 1M54A 4YC7A 3AERA 4I8DA 2NQ2C 2AW5A 3HJGA 4XR4A 5A0VA 1J8VA 4H15A 3THWA 3N6VA 2GN0A 1BHSA 3PS9A 4W1QA 3WIBA 4CMCA 1B3RA 1W0CA 4S2UA 1MJ5A 4O4JB 2WQ7A 3NAZA 4QQFA 1GNTA 2O06A 1E9VA 5KTKA 3NKFA 1NJ6A 2PT7A 4RORA 2I8CA 4JLAA 4GMXA 3O6VA 3NORA 4WL0A 4YJHB 3UGKA 3UMGA 1T2CA 1M67A 1T5DX 5BQXA 2VKQA 3ZE2B 4R2MA 1RYMA 5HKOA 3THYB 1LQ2A 3SJUA 4LGYA 5DWDA 3K15A 5KQRA 3HYSA 1MO3A 1QV6A 4RAOA 4ZV7A 5ALVA 1KI3A 2FW6A 1RMYA 4I0WB 4N41A 2DFDA 3FETA 4G4SP 2R1UA 2X0EA 3T1YB 4JQSA 4QE3A 1NBIA 4Z4QA 1Y1RA 1KAHA 2IXAA 1E2FA 2GS9A 4NV3A 4OSOA 2PXXA 4PBTA 3QLUC 4AXXA 1QG2A 5H4GA 3OFSA 1AA6A 5LIRA 1SZPA 5J59A 2J5XA 1NL3A 4NBNA 1ZMXA 2RGUA 3EUFA 4GM0A 3SS9X 3CRMA 3DYIA 2J07A 4FS3A 1N9KA 4M4SA 4EG3A 3HBMA 4Q12A 4OL0A 4O4IB 3EXIB 4FEEA 2XMBA 4F4UA 2MSEB 3OPMA 4HSEA 4FYIA 4KIFA 1EDEA 3RLIA 1JJBA 3I42A 4M1OA 1YFJA 2AUTA 3MYYA 4KR7A 1GPJA 1M74A 1QAOA 1UL1X 2AH5A 3OWXA 3BIOA 2CNWD 3W8RA 4G84A 2J6CA 4WXEA 2VI5A 4F4FA 2WYIA 4MQBA 4K88A 3WLPA 4EG4A 1OFUX 2H4HA 3BFPA 4LFAC 1ZD9A 1LJ8A 4HJRA 1MAHA 4O4IF 3ZXIA 4CPDA 6ADHA 4K0KB 5IJAA 3D3JA 5ALEA 3CLKA 4ZT6A 4BAGA 3B1KA 1N5MA 4OHXA 1DV2A 4EKGA 3GLFA 3IAUA 4QICA 4LF5C 2IUUA 1KMQA 1SVKA 3JQDA 3BH7A 2PV0A 3H1TA 1KSJA 3NDIA 4LCEA 4UUOA 5IKPA 2XJ4A 4P2BA 2WC1A 3HJCA 1EXWA 1Z06A 3IDAA 2HHCA 1A8UA 2CUKA 3AR8A 2CL5A 1UWLA 1VRVA 3FFXA 1Y98A 3L0BA 1G60A 4ADSG 3L05A 3P4YA 4YQFA 3VMFA 2C5AA 4WXRA 3L4JA 1P2GA 1ID8A 5J4KA 3E9RA 4FZRA 5FI1B 2VAVA 3P52A 2N1BA 3IB3A 2JNVA 3MWYW 4J0GA 4UCWA 3UC9A 3OZAA 4JUFA 1OT3A 1QO7A 1RPTA 2H7CA 3QOXA 3DLPX 3VV3A 3U60B 1R7RA 5LJLA 2IWRA 2AZDA 2V45A 1T91A 1KETA 3WGHA 1IB6A 3ZHUA 3DEJA 5IX8A 5KINB 2PUEA 5JSKA 4ND4A 2O2YA 4QA9A 4B3FX 1G6KA 2MMGA 4DCTA 4E09A 2HMUA 2MTBA 2FWJA 4TXMA 3OQ1A 1U81A 1M2NA 1G6Q1 2P9FA 4HYQA 4JMLA 5CH8A 3PL5A 5A4JA 4KMSA 2GZ3A 3ZNNA 4DLNA 2PUTA 2YCBA 3KKZA 1J97A 2OTCA 5JLAA 1C9KA 1SXGA 3K8YA 4EEZA 2DHRA 3EWSA 4R1LA 1MJFA 3IPAA 2CGEA 2X42A 1IZ9A 1PHRA 1ZW1A 2G8NA 2WAOA 2ZCVA 3GCZA 5CM8B 1FFDA 3M4YA 5K51A 1P4HA 4DM4A 3SBDA 4YAEA 1GL9B 3O4RA 4UMEA 1WE2A 1WUTA 1T4BA 4EHDA 3EXG1 1DDIA 1KSHA 1PX2A 1Y4SA 3K6RA 2HDWA 3LSTA 3Q7TA 4PFQA 4JWTA 4BOYA 4I55A 2RCYA 3OLYA 1OX6A 1JEQB 1UEIA 1FDVA 1JHUA 4JI4B 2GXSA 1ZJJA 3NHYA 3QXXA 3ROQA 1E94E 5L6MB 2O20A 3AEXA 5TS3A 2DTEA 3MJVA 4I1VA 2HADA 4U0JA 5DSXA 4AQYC 3WWCA 3QVKA 4QVKA 1J7JA 1Y9ZA 3DOFA 2XQFA 1ZGHA 3EG9B 1RJGA 4ZGGA 4YGYA 4ZJYA 4KI0A 2WJWA 4CM7A 1T5HX 1JG2A 1R6BX 3GRFA 4JHLA 5DNEA 1M83A 3HJHA 1W49A 1XVTA 4X41A 4BE7B 1WBBA 1TKRA 3ILVA 1YB1A 1V26A 3MCAA 4H3VA 1GQRA 4LBYA 4AP9A 4H1VA 4NDZA 2JANA 2ZQ5A 3HVHA 3AI3A 5BSRA 4EJSC 1HNXB 1J49A 3G0CA 1ZH4A 2XR1A 3CNLA 4G67A 4HY3A 3AKEA 2L42A 2QROA 3SS7X 1V1RA 4HQLA 4PWZA 5L4SA 4TGLA 3PFFA 2WWGA 3OETA 2UZ1B 1VP3A 4IZOA 2HJVA 3OU2A 3M89A 4YGXB 5C4MA 3ESRA 4Z53A 1AXEA 4Q15A 1AUPA 2FN3A 2HLDA 5JCPA 2CXXA 2G5PA 2WHRA 1K4MA 3NAMA 2ZKIA 2OE2A 2OSBA 3L6DA 2IUSA 3I9OA 3UJBA 1M6YA 1YK1A 2EBUA 3PXDA 1PJLA 4K9RA 2E4WA 2FWIA 1W5AA 2ZRLA 3FZNA 1ZJZA 2B9EA 3FX2A 3PUXA 3U9TA 4Z7JA 5DJ5A 2PR7A 4JT8A 2C96A 2H7VA 4BB0A 10MHA 3FWPA 2W2NA 1KZ9A 2L82A 3FUCA 4QWWA 5IM4A 1TYEB 4OHZA 2WZDA 3HLTA 1RPZA 3P9NA 3V2UA 1PP4A 5HWSA 3NG1A 3IBTA 4BN4A 4NQRA 4MQFA 3SQOA 2Z57A 4DV3C 3GDOA 1R8XA 2BC9A 2C4UA 1Z4JA 4MJLA 3GX1A 1E6MA 4R8SA 5HPYB 3FF1A 4BCAA 1UP4A 1XTVA 2H8GA 3HL0A 3PPVA 4L2IB 1IE3A 3U3KA 3D2LA 2EFJA 4F7DA 1K8ZB 5LYJA 1V16A 3EEIA 4RF5A 4DRYA 1WL8A 2NZWA 3KXPA 3R3UA 5KX5F 1XAJA 3AI1A 4DR5C 1XD2A 4C29A 3FZGA 4CM6A 2QN3A 3KYBA 3AWIA 1OB5A 1NXQA 2VPXA 1G42A 2OCAA 3H5OA 2EKBA 3TQFA 1QWIA 2QYSA 4TLBA 1X9GA 4ZEMA 2ZUCA 4F93B 3FSEA 3DEFA 5AQ1A 3MGAA 5A1JA 2ENWA 1E61A 3O95A 3P9RA 2JZCA 3N8DA 4RLSA 3TL3A 2AJBA 5CB0A 2KZFA 1TZ2A 1G3QA 1PLJA 2FQQA 1H2XA 2ODNA 2JEYA 3I5MA 4BNUA 2WOJA 3CZAA 3Q15C 3H9EO 3QXHA 4M9ZA 1XZBA 2GEDA 2W2TA 3EWAA 4D4KA 2FN7A 2HBRA 3OJEA 1DIAA 5AJTA 1G7TA 1XEAA 5AKJA 5JVDF 3DFUA 4IF4A 3DJYA 3PIRA 4OQFA 1M5TA 4KQ6A 4WOCA 4M87A 3H2IA 4TQ9A 5ALQA 3WE7A 4I50B 2JAUA 1Z8FA 4TL7A 5EFZA 4A8JC 3Q3VA 4B3JA 4YR9A 4U7FA 3ZGVA 4AFNA 1GQYA 3BT7A 3WB1A 1H9BA 4LMBA 3OQIA 3BFJA 4GOND 1QBKC 2GJ4A 3ISVA 5KQPA 3P9SA 3LPDA 3SLRA 1QZZA 4BB9A 1J8FA 1EWYA 2BFWA 3DKPA 3ANYB 3SS8A 2CXQA 4G1UC 3A04A 2AVNA 1L5SA 3GWZA 3G2LA 3IUJA 1XVUA 4M76B 4AT1A 3GEMA 1JKXA 1U8ZA 2EFGA 4Z0NA 3R7SA 1AG9A 3IH5A 3NIFB 3ANNA 4NHEA 5G0TA 3Q3CA 4BNVA 2HHJA 1I3NA 4R8RA 4H35A 5L6LB 1PNTA 3EJ6A 1TO6A 2OP0A 4QHYA 3DPIA 1VL8A 4XWKA 1SM4A 1ESZA 1BH2A 1O94A 2NSJA 4FI3C 4RTPA 2DWOA 1YZ3A 3QENA 3CF2A 1DEOA 3DUFB 1W96A 2G5CA 2JHGA 2OXFA 3HABA 3K0EA 3KKNA 3P0JA 4FYPA 4HTAA 4RSRA 3RS3A 3VPDA 4DLKA 4ZRDA 1R6VA 1VJDA 4WLVA 3CEHA 3K0AB 1J0EA 4KIWA 4RPCA 4ZC8A 4JBIA 2UYYA 2XUGA 3EMBA 1XZQA 4J9UE 5F3WB 1PJ3A 2I62A 1V4NA 2DWPA 3JQ7B 4LFCB 1M1NB 1MJHA 1TIPA 4F71A 1NW3A 5BR4A 1UDCA 3E5RA 1JQJC 3G02A 3E9ZA 4G0YA 4Q5IA 4UD2A 4PPGA 1ESCA 1A8SA 1RKXA 4IKEA 2GHIA 2YINC 2YYSA 5CZXA 1YRBA 2DT5A 3H7AA 4RYDA 4ZAYA 4C7BA 1WVGA 5IS2A 1KEEA 1M5RA 5JRZA 1XLUA 2OCLA 2XYRA 4DLSA 4FKBA 1KY4A 3OUTA 3FDFA 2K5UA 1F4PA 1R0SA 2FZVA 3IQGX 3IVCA 3L8MA 2VYND 4JDPA 4OM7A 1KJNA 4EY5A 4Y2GA 4GPD1 4NCJA 1RYDA 2VZ9A 4E4RA 4G2TA 4KHZA 1K4KA