2Y27A

Crystal structure of paak1 in complex with atp from burkholderia cenocepacia
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
LEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGTTGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Ligase
molecule keywords PHENYLACETATE-COENZYME A LIGASE
total genus 149
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y27A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y27A01
3LNVA 2VZEA 4WV3A 5KYTA 3E7WA 3U17A 2P2QA 4R0MA 5JRHA 4OXIA 4ZJZA 3FCEA 3WVNA 5BSUA 3R44A 4M46A 4U5YD 3E53A 4RLQA 5D6NA 3KXWA 4PZPA 4RMNA 4GXQA 4RVNA 5KEIA 1LCIA 1PG3A 2QW0X 4LGCA 1YJ7A 4D57A 3T5BA 2P2FA 4R1MA 1T5HX 2WD9A 4FUQA 2P2BA 3L8CA 1RY2A 3O82A 4EATA 3IEPA 4G36A 3ETCA 2D1TA 4G37A 3B7WA 1MDBA 1MD9A 3ITEA 4DG8A 3U16A 3CW8X 1V26A 2D1RA 3G7SA 3IERA 3DHVA 5BSVA 2Y4OA 4IR7A 5BSMA 3QYAA 1V25A 4D56A 5DV9A 5K85A 3DLPX 3E7XA 1ULTA 5K8FA 3IVRA 5KYVA 5GTDA 5BSRA 5BUSA 3T5AA 4DG9A 4RM3A 2Y4NA 4GR5A 3CW9A 3EQ6A 2QVXX 3C5EA 3RIXA 5E7QA 3WV4A 5BSTA 4GXRA 3WV5A 2QVZX 5BURA 3A9UA 4D4HA 3DAYA 4IZ6A 4RLFA 2D1SA 3O84A 1MDFA 4D4GA 2V7BA 4R1LA 2Y27A 4E5DA 5DWVA 4OYCA 3IPLA 4RVOA 4GR4A 4GS5A 2P2JA 3IESA 3LGXA 3NI2A 3VNQA 2VSQA 5BSWA 5IFIA 3TSYA 4RM2A 2D1QA 1AMUA 1PG4A 3FCCA 3LAXA 3PBKA 3O83A 3T5CA 2P20A 4ISBA 3VNSA 4D4IA 2QVYX 3GPCA 5BUQA 4W8OA 1BA3A 2P2MA 3RG2A 4FUTA 3A9VA 1T5DX 3NYQA 3VNRA 3NYRA
chains in the Genus database with same CATH superfamily
4CG3A 1P7PA 2PGJA 3U4MA 5FH9A 1PT9A 1L0BA 3OP1A 2UUCC 1YR2A 1GEGA 1Y8QA 4LVUA 3LUHA 2AOUA 4L4RA 1Z39A 1FTYA 1TGVA 3ZHQA 3FSGA 3OH8A 3R0ZA 1R9MA 5KVVA 3SBOA 4AWBA 3MBIA 5HK8A 3H7IA 5FOWA 1RPAA 1JMKC 2D27A 5EP3A 3WLTA 4NQRA 4DA8A 3ZZNA 3WGOA 4ZMRA 4NE9A 5T4BA 5JWOA 1LQUA 4GKKB 3UIEA 4YC7A 1Z3CA 1JIKA 2C4MA 2ZS9A 2ISSD 4OK5A 2P30A 4RWZA 3B3AA 3V2IA 1U8TA 3I28A 4CMKA 2POCA 5JARA 2W6NA 3LIIA 3H42B 1T8SA 2BONA 3W7BA 5G1OA 3C3MA 3ZE9A 4YCNA 1CIJA 3K6KA 4FMDB 4DZTA 2QG9A 1OXMA 1ULHA 2GN4A 2B7LA 3AKDA 4PYRA 3SR4A 1QBKC 2PY6A 1JSCA 3EA5A 1VG9B 2I55A 3L46A 3EIEA 5DCYA 4J49A 4RD1A 4TWJA 1N7HA 4WLNA 4C7BA 1OXBB 3FVWA 3ZJYA 2W6CX 3CURA 4NE7A 2ZJOA 1FDVA 2J4DA 3HSKA 3OZXA 4K9OA 5EWLB 5KPDA 1VCNA 1BWQA 5JHGB 1I1QB 1E77A 2IGTA 5FAKA 4EP1A 2L18A 4YDRA 3S2UA 5GIPE 3RVLA 2FZCA 4HVLA 2PZKA 4EY3A 4F2HA 2WU1A 2ZRAA 4BE4A 4MAFA 5COBA 4EY7A 4NDNE 1USVA 3GUVA 4KWTA 4JKYA 3L6EA 3ROMA 5MN4A 3WRXA 3B1YA 4YXFA 2IYWA 4INZA 1EGQA 4KIGA 3VDXA 2XE7A 1U1CA 3BKWA 4HB3A 4D80A 3NFYA 4B73A 1ZOPA 3H86A 4RLSA 2GYVA 2B1GA 5DX0A 1GRQA 3KB1A 4LK2A 4LWZA 2Q2OA 1U7TA 3OZFA 4OHZA 5M34A 2NZUG 2C5BA 3BL8A 4OOFA 3K31A 2F9FA 4FJ1A 4MW2A 4PFSA 3GJ6A 5AQEA 3MW8A 4Y1GA 1J5EB 1LPNA 3V46A 1ABBA 2B69A 1E96A 2V9CA 2O2YA 1O89A 3PF8A 4FEGA 4QA9A 3ZR4B 2VYQA 4TTVA 1AQUA 4LSGA 2YINC 3CTPA 4JT4A 1DG3A 1DLIA 3WR5A 2XVMA 2Y27A 3C15C 3F1KA 4J0GA 4XIFA 1RHMA 1ZVKA 1DX9A 1NQTA 1N1GA 1SUIA 5EIWA 1QG0A 3VNVA 1GTMA 3TINA 5JECA 4LNAA 2I4NA 3NAGA 1R6XA 3SXUA 3ZDFA 1P9RA 1C8BA 3TLGB 5FUMA 1RABA 4TRJA 1OYVA 3SSOA 2OFOA 5DW3A 2NQ8A 2JJ1A 1ZWLA 4PG6A 4CM6A 1IY0A 4TTJA 1AD2A 2D5CA 4O2AF 2VP3A 5J9FA 4GI3A 1NC3A 3C4QA 2LIPA 2RH8A 3GFTA 4XGKA 2ZRKA 5C8YA 3ZWAA 1RRPA 3VO8A 1YJQA 4UOQA 3S2FA 1L5VA 2BHSA 3K8QA 1MV8A 2G07A 1XQWA 4XX2A 2RJOA 3FLMA 5IJXA 2Q7DA 1ZINA 4J0KA 1GR1A 3WJAA 1Q91A 2CGEA 4HQOA 4P32A 3LQFA 4RKFA 4RZUA 1FSFA 2Z95A 3UZ0A 1WDLA 2A1TR 3HR4A 4LG1A 3OQOA 2FKNA 2VHUA 4ESVA 1P2UA 4FGWA 5H70A 2AXNA 1F8YA 3NCHA 3URKA 2EBUA 3FWYA 4LE2A 1I4OA 4DR3C 2C4VA 3QPUA 1B73A 3QW4B 3ZK7A 4MUAA 5A4JA 5HIAA 3P96A 2CU6A 4BV2A 4CLDA 4CKEA 1SIBE 1ID1A 1RM3A 4EF5A 3ZD9A 1U6KA 2VT6A 2GSDA 3OCYA 2H4JA 3I34X 3GY0A 4K87A 3KC2A 3R5JA 4PFJA 5JAUA 2LKCA 1JQ3A 1R6VA 2PKRA 5K8CA 5ECWA 3ZDQA 4L95C 4E0BA 4QAJA 1BYUA 1ZG3A 4KR9A 5GV7A 4LCJA 5JY6A 4HR7A 1OKKD 4OLFA 4YY3C 3WK5A 1FP1D 1H1LB 1IHYA 3WBBA 4GMFA 5B4TA 5EP2A 1XLWA 2OCIA 4G37A 1JZQA 3W9YA 1KFEB 3QEAZ 2ZJ1A 1CCWA 1AS0A 1TF2A 4KBGA 1CR6A 2FW9A 4AUNA 5CNJA 4ER3A 3G6WA 4DSUA 2GAJA 1KZ9A 4P4GA 2JCYA 2WIBA 5F2KA 5JSZA 1COWA 1XWIA 1DT3A 1TU3A 2NPIA 4RLHA 2UYCA 2Q9UA 1ZNQO 1QU2A 2Q3JA 1KS2A 3MEQA 2NQTA 3IA2A 4X1KB 3V4PB 5KJ6A 5DNYB 4JSTA 4ZGWA 2G36A 3VNBA 4BJHB 10MHA 2ZREA 1LQLA 2LD4A 4PUHA 1EB8A 3IMKA 2EKZA 5E9AA 3MZ0A 1P4SA 3A3PA 4E7PA 3AQIA 3BXXA 3NBZC 3VTKA 4X6XA 3R41A 1CD5A 4LXGA 3LC7O 2OCKA 5K0NA 1ECFA 3ESYA 4Q93A 1TK3A 3MJTA 4UUQA 1C8VB 1SOVA 3PC7A 4LBYA 1NDHA 4TVBA 4BNHA 3EXFB 3D54D 5K3FA 5CCEA 4L3WA 4HS9A 2PX6A 2O8BA 1YB5A 4LX0A 2PS3A 3I61A 2VUSA 3FE2A 4PNEA 3BE5A 2GN1A 4XH9B 1E1CB 3RPEA 4B7UA 1Y37A 3OESA 3V2HA 1G2OA 3N8KA 2JLBA 2O59A 3DDHA 4IHKA 3GWZA 4KAFA 1WF6A 2WPDD 2XQGA 1EBBA 1QP0A 3K0CA 2EX4A 2WNSA 4CKZA 2CK3D 1SMKA 1V1MB 1WOMA 2GDZA 3QNWA 3H2HA 2WW8A 3O3OB 3PC3A 1DZ3A 1HF3A 4UM9B 4ZV4A 1X74A 1FTQA 4BQSA 2DERA 1WDWB 2CDNA 4UBOA 2R6DA 4N76A 4KE8A 2ZWAA 4OQZA 5JFGA 1DC5A 2HQBA 3QY9A 4MOWA 5HF8A 3IOYA 1ZESA 3SMVA 4R9RA 5DGHA 2VDLB 3W7AA 2DBVO 2XV1A 5JZMA 1F38A 2BOVA 3KXDA 1CZNA 4W7IA 4D74A 5IUNC 2R8OA 1HZZC 3BMOB 3OMXA 4IXWA 5IAEA 2A9FA 3TDMA 4EI8A 5BW8A 1PI3A 5HKOA 4U7TB 4RHEA 3L77A 1OLUA 3U2QA 1XJ5A 3DZBA 2R1TA 1UEJA 2ZYTX 3DFFA 4RS4A 4YV2A 4ZHSA 2OKCA 3FIUA 2ZTSA 3Q6NA 4BB9A 3MRXA 3HJGA 1J23A 3AUTA 3TG2A 2ZJ5A 4LECA 3DKVA 3TZ6A 1NYQA 4BN4A 1QVRA 1WW8A 3PJEA 3LUFA 3CNBA 4DR2B 4MDEA 1EZ4A 1BWSA 1HFEL 2BELA 2RK4A 4M3NA 1KYTA 2VYVA 4J7XA 1E8NA 4K40A 4NONA 3K0SA 1NRIA 2C59A 2X3YA 1ZD1A 2PIAA 2FN9A 2NT4A 3A3YA 4I8DA 4P0TA 1NBME 2CFTA 5C4MA 4P36A 4MVJH 1E79A 4PYLA 1GY8A 1KBZA 2AN4A 1P62B 2J9FA 2WB4A 4PW0A 2ZR8A 3H75A 2W93A 4NSNA 3O92A 4PANA 3L8ZA 5C8XA 1WJGA 4RDIA 2WJ4A 3I2HA 2FJPA 4FOSA 3T94A 3FOCA 2B5OA 4G65A 2IYYA 3I45A 4NDZA 1L7PA 3WNDA 4Q6WA 3OCCA 4E3WA 3ZX5A 4WZBA 1DQRA 1N2XA 2XMPA 4OHMA 5CITA 4CKWA 1FLVA 1V5FA 3SBDA 1X42A 1FNCA 4QUIA 3W8EA 3OAAD 2QZSA 2XRMA 1O8CA 1VRCA 4YI5A 2Z58A 2HHCA 5BSFA 5A0VA 4EYKA 1AKVA 1RQLA 4B7AA 3UJ3X 3HZZA 4NBUA 4IBOA 4AX4A 2P78A 3ITEA 4UNPA 3SYMA 2RFLA 1L5NA 3UYKA 1I10A 1Y9ZA 2VBFA 4WA8A 4YRZA 1XTPA 5JH7A 4YJDA 2GJKA 2PLFA 3EHEA 2FZLA 3CKMA 1LU9A 3AJAA 4I6JA 1L8LA 4RPCA 5ITSA 1T3ZA 4CEJB 3PX7A 4DIFA 1G8HA 2RH4A 2O2IA 2ZBEA 4RA9B 5CTAA 3ABRB 4JSYA 3N0VA 4MV4A 3WAKA 3CVYA 1XDWA 2O23A 5GV8A 3R7SA 3WLOA 3CISA 5EHQA 1P39A 4C4SA 3LY8A 4KGVA 3CVOA 1Z4PX 5GTDA 4IG4A 1WPQA 4CL3A 3R9WA 1KYZA 1WPXA 2QTHA 1AHNA 4PLGA 1H2AS 2PYZA 4ALLA 1WHSA 5LZ7A 3CEPB 3RT1A 5IWAC 2WF5A 4ZVNA 2CZGA 1OAOA 3UT5B 1KI9A 3DZHA 2PR2A 2E4ZA 4G5YA 3ES9A 1B43A 3NV7A 1IEVA 3ADOA 4WHMA 3KJFA 5AKGA 4QHTA 3QHAA 1RM4A 1NUHA 4JUIA 1DBWA 4OXYA 5FO1A 3CG0A 2YWRA 5YASA 4E2WA 4YRBA 4Q00A 1KFBB 3M9WA 4G1IA 1WCIB 4H0NA 5JALA 1TIBA 2EFDB 4GX0A 3K5PA 1XTBA 4JP5A 1E69A 1NG1A 5AHRA 1HDIA 2H1FA 4DDHA 3QLUC 5HFNA 3D7KA 4YP5A 5J2TF 1NY5A 1W59A 5G41A 2VUHB 3SZRA 4YYZA 2QT9A 4KSCA 5IHPA 2P1DA 3T3EA 2JHFA 2WFAA 3LPNA 1QQAA 3M34A 2JLRA 2EWVA 3OPXA 1UMBA 3D0RA 4CT5A 2JARA 4GE3A 1Z35A 2R7KA 1XKLA 4UHEA 5IZCA 1XZFA 5EIOA 5K3CA 1L5ZA 2QN2A 3C6ZA 1ODIA 3GEEA 3AVVA 2V6BA 4KBYA 2I3ZA 2GARA 4D97A 4YXWD 2FSVA 1KP9A 1MJGA 4TYYA 2RHCA 4FIZA 2JKVA 4X6YA 3TTYA 1MQAA 3F98A 5EP4A 4E08A 5BNTA 4C29A 1SVUA 4A8TA 3FMIA 4JLWA 1V35A 5LR6A 4RL4A 2XUJA 3U80A 2OENG 2QZJA 1IPHA 2O57A 2QOEA 3BXOA 2I4LA 3KSRA 3OG9A 3QKWA 4YRTA 3AVYA 1J8YF 2E5FA 2Q8PA 3P9XA 4X85A 2FLKA 2M5OA 2C1ZA 1SXJB 1CUUA 1BCRA 2N46A 1S3SA 1WXGA 3A6HA 4RCYA 3RHFA 4AZTA 3FKSD 3SF8A 1V9SA 3OJWA 3Q3CA 4PWYA 5JH7B 1VFPA 4TS3A 1YB2A 1S5PA 4KX3A 1Y6GA 3JRWA 3NVAA 1C9KA 1H2BA 2HMWA 3NORA 2H0QA 3R5FA 1AUOA 2IY7A 1EVQA 2HYIC 2C5FA 2ERCA 1NR5A 3LZ6A 1RRCA 1EXDA 4L57A 3AMVA 4EB8A 4DV0B 2YTZA 4YCSA 3V8QA 3W5BA 4NMXB 3V4SA 4PINA 4ZI3A 1JTEA 1ZB9A 4TYNA 4CHGA 2QZZA 2I0FA 3TZBA 4K9PA 1KQGA 1TEVA 1YMUA 2JGJA 4HXYA 4ZCSA 3W06A 4X93A 4FE7A 2UZAA 1Q7RA 3TS1A 3F0TA 1JDZA 3CT4A 4JT9A 4YTEA 2JZNA 2WYWA 1T8WA 3N2IA 1ILWA 1CQJA 3FA2A 1BTOA 4MQEA 1Q1EA 2IUEA 4ESOA 4CM4B 2ZM6B 1IRIA 5G4KA 1IY9A 1PZNA 3QUCA 5JYDA 4RTPA 3ROEA 2HREA 1XRQA 4EG5A 4QTTB 2D7CA 4BLQA 5IN5A 5D00A 3VDMA 2MSEB 4E5PA 1DRVA 1XLTA 2EEPA 1S2NA 4HWTA 4X54A 3VO2A 2NNWB 1MH9A 4N3BA 2JNVA 5JYBA 1VLJA 3FKQA 1E6EA 1TCVA 3L43A 2EJVA 3RD5A 4KQ6A 4M1ZA 4JJ7A 2VHQA 1V9LA 1WDTA 4N7RA 2F3TA 2I6TA 2YFHA 4X7RA 1OH6A 1EE2A 1QH8B 5JXHA 3BULA 1H6DA 3S2YA 3E3LA 2C8KA 5L3RA 2D5LA 1XHJA 2RGEA 4YAKA 5A4FS 1HXHA 4YHHC 1F2TB 2A67A 2IZOA 4KLZA 1XZBA 3M6MD 4II3A 3VR5D 421PA 4DC1A 5IARA 5ICMA 1OB2A 1ONNA 3AU8A 2PWBA 1A2BA 3RCBA 4J43A 4H7HA 1WS6A 2IX9A 3LPCA 4MX8A 3BD9A 4AKSA 2QJFA 4DCCA 1BGWA 1KQNA 1PO7A 1B8VA 3U7QA 4QOJA 4ZALA 3UH1A 3BMNA 3BXPA 5DNCA 1QQ6A 1WQ3A 2ZI4A 2OCGA 1D2EA 2ZRCA 4WVLA 3VSCA 2DKOA 2DPMA 4CMAA 1PQ4A 1CC1S 3MS7A 5B7NA 5C5EA 1R64A 4G5GA 4YO7A 3WQHA 1W2GA 4BTEA 3RWMB 1F4LA 2N75A 3GIDA 4EZBA 4H6XA 4G8DA 3JQAD 5JAZA 4R01A 1DIBA 3UB2A 3B3QA 2P41A 4TWZA 5AK3A 1YDGA 5DGCA 4CIXA 4EJ6A 2WB2A 3MHTA 4BQQA 5EVJA 6PFKA 1U7ZA 2BMEA 2BH2A 2C7QA 3ZW8A 1V8PA 2QDKA 3CIOA 3LECA 5KNBA 3NJ8A 4DM3A 1PJRA 1W5EA 1ODLA 3DCJA 1ZL2A 3EZFA 1T4CB 2VAWA 3JAWA 1IH8A 3EW7A 3FTQA 4HNSA 2JFZA 3EXG1 2XCTB 1RXCA 1YQ9A 3KBOA 3OT4A 2PKCA 1RVDA 3Q5GA 3LX4A 3R6GA 3L95X 2REOA 1IXYA 2NO4A 3KR9A 4GICA 4Z3OA 4LC1A 1ZXBA 1P77A 1K8XB 3DR3A 4MUFA 2GMWA 1GG8A 3E15A 3R0VA 3U4GA 1XOIA 3EGXB 3LT0A 1CQIB 1ISMA 5KSOA 4GOJA 1DBVO 4ZOLA 3ZWDA 1F6DA 4KR2A 1WX1A 1GGVA 1SKAA 3CV3A 4FU0A 4JLOA 4Q3CA 3HWWA 3OTWA 1C5KA 4KREA 4PAWA 3FPBA 3M5PA 5LXTB 3LVQE 5TR9A 4GWKA 1Q19A 2CHUA 4HGPA 2I80A 4BO4A 1UOPA 3TNJA 3TECE 2NU8B 3WLNA 1VMAA 3CF0A 4DW8A 5L40A 1OFHA 5H4HA 2IL1A 4ME6A 1HDRA 2A8YA 2VLIA 1PAUA 5D5HA 3IBFA 1NT2A 1PT7A 1E2QA 3QWAA 3CH6A 1F9AA 5G40A 2R79A 2QIOA 1FYVA 2RKWA 1RHKA 5KHOC 1N34B 3EZ6A 2XA2A 4PSKA 1CY1A 4Q1DA 3DE2X 3HBNA 2KZ0A 1TIKA 3G1TA 2IGBA 1LW6E 2VP4A 4RVUA 1SCAA 4UE2A 5FCDA 4TKLA 4IV5A 4Q5IA 3LLMA 4ASUA 3EARA 4EMUA 1L2FA 4HEA1 4BO0A 1EDOA 1FDOA 2IELA 1K0RA 2OHHA 4K88A 3IT1A 3OJOA 4B44A 2J5QA 4N3CA 4A2QA 4PXYA 4N4AA 1CV2A 3TTTA 5JE8A 1GCUA 2ASEA 4XPIB 3TZLA 3DEKA 3DFZA 1OA1A 4IEFB 1JFFA 4FIDA 2OBFA 2VZLA 4WRRA 2QZ4A 4C3ZA 3QLUA 2VXBA 5KWJA 3SKYA 1QGOA 2CJFA 2VQ6A 4E4RA 5BSRA 1N5DA 1PZGA 4U63A 4R6XA 2XMDA 2H7XA 5IDXA 4QU8A 4Q3LA 1NUQA 4H7KA 1US8B 4KGZA 1P74A 4DY4A 5I4CA 1GA4A 1Z4KA 4L72A 5EYPA 4PCLA 1VL0A 1OU0A 3TR0A 2F3UA 1A27A 2J9XB 1EWVA 3H6GA 3UUWA 4BGIA 4Q7KA 4D92A 4WBSA 1YE8A 3LQKA 1SXHA 3G7UA 3I3OA 1GG5A 3TOSA 1OAOC 3UK6A 2EQBA 4ZT2A 2XBMA 1H85A 3OO0A 4QUGA 2E4WA 4IPTA 5DTQA 1VE9A 4DUZB 3MTDA 4C7VA 1F3OA 1JDPA 1BVRA 2XD4A 3HRKA 1OXXK 3KBBA 4ZOAA 3ZJ4A 1C9EA 2A1UA 4MWEA 4IDNA 4I9FA 1S7CA 1W93A 4RIIA 4BNTA 4F97A 4HD8A 1FIUA 1CUBA 2CLCX 1JG1A 4FT2A 1VYVA 3RFVA 3RLFA 5D87A 5LA6F 4BLWA 2PUGA 2AI3A 2NXJA 2Z6VA 2BGRA 3QMWA 5IFIA 5B6JA 1Q15A 5ESRA 2WQ7A 1C80A 2BFAA 4I19A 3DV2A 3LFTA 4TWAA 1MX5A 1N9GA 3EGIA 3W9SA 2O2GA 3KYJB 2B9EA 3THWB 3LM8A 1GSOA 2GVZC 1ZMBA 3PL5A 3GPCA 3QHQA 5E4FA 3RR2A 3CS3A 1EQ2A 2GYWA 5B3JC 5H83A 3RC1A 1SHUX 2QGFA 4XB1A 1TCBA 3VOBA 2B1QA 4B4OA 1DOHA 3MCUA 4XSGA 3GPLA 1CZRA 1N9KA 1I2CA 2P4EA 2TYSB 2V9PA 3X1ZA 4O29A 3OY7A 1OZHA 4IGIA 3ZJVA 4HUQB 4IUBS 2X2FA 3CSUA 3JQ7B 4IDEA 4U2KA 5IFLA 5DYIA 2O3UA 2AK3A 3NBKA 1MNQA 2F2TA 4WN3A 3MTEA 4BNIA 5L3SB 3DKPA 2P2QA 5FUXA 4U8GA 1LC0A 4G01B 1IK6A 1QPBA 1N2OA 5CBPA 4B76A 4XTRA 1GAXA 3U0BA 2H4ZA 3D7MA 4RY2A 2HSWA 3OZSA 3GZ4A 2YWHA 3TL3A 5KHAA 2A4KA 2NQ2C 5B53A 2H57A 3ZDXB 3ZCPA 5ABPA 3P9IA 3FOAA 5EKTA 3H6KA 3TZQA 1EFAA 3PPYA 4AS3A 1U5CA 1L8OA 1L8AA 2ZE7A 3RODA 4RVNA 2ZYDA 4B7CA 1P3JA 2QTAA 4LJAA 3WIUA 3BSSA 2W2XA 3K1TA 3QY0A 4FCTA 2MSDB 3OTIA 4Y1FA 1P1JA 1YIOA 4TRMA 4BKUA 3OO1A 2OFWA 3X2SA 3A1CA 4K86A 4O4HA 4ZVVA 2RC6A 2OHOA 3SYKA 2QVGA 3LQYA 3L8CA 1CKEA 2ILTA 4KH1A 4P98A 1DKNA 3LG2A 4KV9A 4FJ0A 1DKQA 1ZGJA 2W2QA 1LNZA 2JA1A 4J94A 1BEZA 2CBZA 3CCCA 4K05A 4FGSA 4LV8B 4ZT3A 3VGPA 1A72A 1UKVY 4OLHA 4MGEA 4MSUA 1OFIA 3GP3A 4OP1A 4QDUA 3SIPA 3WLMA 4D0NA 4TM8A 3W4KA 3EC7A 3H8WA 3LO5A 3O8QB 1MOQA 1RYEA 3TNFA 1UJCA 3NDPA 3QYAA 3O4VA 5C2JB 1BVYF 4NAUA 4TMVA 4WFKA 4BPBA 1FL9A 2JFBA 3DO6A 1IAVA 1M1ZA 3K70B 1Z2PX 1KF0A 2FJ0A 2EW1A 2JS7A 1XLVA 1L4GA 1W5TA 4I5GA 4R2IA 5ALZA 4AQDA 1USUA 5CBPB 4IH4A 5LXTF 1H6AA 1I3LA 4U39A 2Y1WA 3PPWA 1ISFA 5ARDA 2C5GA 3HCEA 1P72A 2FKAA 2Q5EA 4AIRA 4ZJUA 4X91A 1E64A 2OXIA 3OIDA 3B6JA 4H3KB 5CNMA 2DFNA 4UM8B 1D2AA 2QG6A 4DLAA 5EWJB 2XCUA 2GD1O 5A2QD 3C14C 3GF4A 5E95A 5IBCA 4PYJA 2QSJA 4MCHA 4RVCA 2PUVA 4JI1B 2BCJQ 3TSYA 3NU1A 5LZ4A 4I2VA 4AAYA 1A9OA 4P2BA 1G5TA 4WLFA 3SEZA 1JFRA 1NLZA 1HFKA 3DAHA 3NHUA 3HZOA 4YCAA 5K51A 1ONSA 4M0MA 4FILA 3ZE2B 5C4GB 2PU5A 3ML1A 3NUZA 1E1KA 3JWIA 3G13A 2NUPB 4RYLA 1E9EA 1IZ8A 1R0CA 2GA8A 3FKSA 4YR9A 1KR5A 2ZI6A 4N7BA 3CZPA 2B35A 3QUAA 2VPIA 5BNWA 4B43A 2D5AA 5EJ8A 1JFTA 2QM7A 3SXUB 4ENPA 2J3KA 2X7JA 4HHEA 2Z4RA 4YMWA 2FFQA 3CPEA 2GJ4A 5AHXA 3UAZA 1ZC3A 1SM4A 1N0HA 3A4VA 4BRUA 4A5SA 2IXEA 3BE8A 2XVYA 3AF0A 3BF8A 4KIJA 5CB8A 3RVOA 3MBKA 4PE5B 4JU9A 1BCSB 3K5HA 1C4WA 2WD8A 3U4IA 3UT0A 3EDYA 3S6JA 5FTLA 2WSYB 2X1VA 2IYXA 3I2IA 3KXLA 4BV9A 3V4RA 4NPAA 3FTEA 3WDKA 3NNNA 3EUWA 5BN4B 1CZKA 4TPSB 1ZA1A 2CF6A 3Q98A 5AKHA 3T1YB 1Z7WA 2WUWE 3SBXA 1Y81A 3PS9A 3DMYA 4B46A 4RAQA 1DFGA 2RONA 2WVGA 3CIFA 1RSZA 3ZE1B 3PUYA 4DWOA 1N92A 5BYAA 1ACLA 4P84A 5FNVA 1VL6A 1O90A 2ATCA 3BD6A 1LZKA 2CLFB 1UPTA 2HXSA 3EIFA 3BXEA 5JCJD 1G55A 1IL0A 1OWLA 1V9CA 1BAPA 2Q21A 3ZWOA 1I1HA 1X7YB 2F6RA 4OUDA 2OOSA 1GPDG 3BWVA 2TMYA 3DS8A 3ELDA 2EFHB 2WWTA 3QPVA 4JLSA 3UVEA 2O3TA 3WK4A 1UPXA 4ER7A 4TYWA 4FFBB 3SHQA 5CD9A 1JDVA 2BD0A 1T0UA 1MDBA 2NU9B 2IS4A 4D9EA 2G6BA 3GGSA 4EELA 3F9RA 4PPFA 4Z4EA 5HUHA 3MGCA 4CMEA 5BSVA 4YS6A 1EGHA 1PEDA 1R27A 2JJ2D 3PWSA 1CHDA 1GNQA 1I3KA 1DC8A 3DTNA 1XEWX 1V25A 4XQ9A 5CR9A 3T38A 4CTNA 5JSFA 2C2KA 4PPQA 3M3HA 4C03A 2DFVA 3T95A 5TPZA 3JYNA 3A1NA 5AM1A 2WAYA 4Z4IA 1FDIA 1XLUA 2X22A 4OQLA 4WOCA 3TAUA 4ZYWA 2WU4A 3DMPA 3HCCA 3IEXA 4R68A 2DU8A 2QVBA 1Y1PA 2OGWA 3HK2A 5EXXA 1MEOA 3WL3A 3BB1A 4DYDA 2H7YA 4MDHA 1WOYA 1CUGA 3MQ4A 2JA2A 3D1LA 4FCWA 5IN4A 4KXWA 2UUBC 2R5NA 4BX2A 3FF1A 2Q0XA 1VXOA 1WHTB 2VHCA 2F48A 2W2OA 3K3PA 3PNVA 4QU0A 4RFVA 4UMFA 1AHHA 1A76A 2QT0A 3IQZA 1TQ8A 3KJHA 3KRTA 5NULA 3SD7A 4FEAA 2HJGA 2QRVB 2QKYA 4A1OA 5G4KB 2B9VA 5BQOA 3RC8A 1KH3A 2ID8A 4FFSA 5CM2Z 2X1HA 3GJ8A 1AA9A 3I62A 5LKAA 4Z5XA 5I9IA 3VJKA 2B4TO 4AYWA 4LDPA 1ZL0A 3ZY5A 2FPPA 2YH2A 4B3DA 5AR1A 3O8CA 4UZFA 1QUEA 1YB1A 4ILKA 4L15A 4TQGA 2XKAA 4EHKA 1WCYA 2SKDA 4TMKA 4GGOA 4TLBA 1ZEJA 5IH7A 5JXWA 1N2CB 3K9LA 4REMA 3BCRA 3V34A 3IB6A 3Q88A 2C8VA 4BFVA 2DBZA 5FJIA 2HKIA 3ROKA 4DA9A 3K6JA 3IEVA 3ZVRA 4X65C 1O5IA 2GEUA 3VHQA 1OREA 2A59A 3RRFA 3ZLBA 1U9CA 2CLOB 3FNHA 1Z6TA 3KB2A 4CTJA 2H4FA 2R7MA 1DADA 3K92A 3PQDA 3D3QA 5DEIA 1T2VA 3KQSA 2P2YA 3F3MA 1N2EA 1E4EA 4CQJA 1Q3HA 1ISHA 5KNDH 1RLMA 3VDNB 1ML3A 1K75A 1Q77A 2Z1MA 3HDVA 4HC4A 5A0FA 4YRAA 1AB6A 2AT1A 3QNUA 3GZTB 4OHBA 2P0EA 4Q1AA 2VO1A 3DZFA 2FEXA 2P7HA 3L0BA 4OLJA 3KDPA 3SDZA 2G5TA 4PROC 3BMQA 1ADBA 4AUKA 1YE3A 2COKA 4AD8A 1Y1TA 4JITA 3FPAA 1TZ2A 2PSJA 3QLTA 1EAMA 1JLSA 4X66C 3HBMA 4MKFA 3F6RA 5HBGA 1Z4OA 3EAQA 4W6QA 4LI3X 3ORHA 5KVSA 1N4AA 5JDIC 4KW7A 1DWUA 1XR3A 1OFUA 3W7VA 4KXQA 3F4KA 5JS7A 1EWQA 4X3CA 2G76A 4RDXA 5I8PA 4R1PA 1EXNA 1SA0A 4QKQA 2OUKA 4U7DA 1JR4A 2X0FA 2VK2A 4GLOA 1JDNA 3ESRA 2ATXA 4KXUA 3CZAA 3WYNA 2DLCX 2VRWA 3FNQA 5T8KC 1QH9A 2BUAA 4RIGA 2VPTA 3AYZB 3IE0A 3QXXA 5H16A 2R1VA 2YHBA 2ASBA 3C6MA 4MUEA 3A6FA 3ZK8A 2CL7X 1WHSB 5CA0A 3G9TA 4L07A 4OUKX 1XQ9A 4EB3A 1LJ8A 1P2DA 2WIJA 1TW3A 4I4TA 1ZMOA 3G23A 3GQVA 2FUG1 1LBEA 1N25A 1R0YA 4RD4A 2FPLA 5AKKA 1R0ZA 3CUTA 3DTYA 4HQ6A 4DWJA 2CVHA 4JLDA 3IQHX 3WFIA 4JWTA 4B09A 4ZQCB 3EQ7A 5L45A 1CRQA 4OI4A 2Z1NA 3MTQA 2OYRA 4NCAA 3VR5H 1LK5A 2WMOB 2GETA 2BP7B 3FCAA 4ND8A 2XZTA 3B5EA 2BKVA 4H7PA 4OPMA 4U6NA 4R0VA 2H8GA 1QYVA 1X7ZA 2OCBA 1T10A 3T5AA 3EZ2A 3IC5A 4K9NA 3L8GA 4HDMA 5JSYA 4IVRA 1C41A 2IYEA 3AZQA 4Q3AA 3HL0A 2E82A 4DSAA 4EHDA 3O8DA 2BGWA 2ZWOA 4MQ5A 2J32A 3GFVA 4MP3A 3ZLVA 3VVCA 2Q3LA 1CQXA 3NHSA 3MJRA 1KQ3A 3TKLA 3C8HA 3PQ2A 4WPGA 1XMIA 3WADA 5GWXA 3EFHA 3II6X 4NBTA 1X39A 1YZLA 5KKNB 3V42A 1CVLA 1T15A 3AF5A 1JG4A 3MELA 1W29A 3COJA 4COOA 3W2TA 3I9MA 4ZT5A 3RVRA 1GV1A 4DMUB 1RPZA 3KQWA 1SKUA 1RLOA 1QMPA 1CJSA 1UP6A 2ENWA 1DTWA 1XZCA 3EQ2A 3GVIA 4RXUA 4C6SA 3U48A 4XEHA 1NJ6A 3L0ZA 4I3GA 3ZI7A 4CM1A 4CDRA 4YV7A 721PA 1KETA 1VA5A 1N1DA 2PFKA 4D41A 4YIHA 1ORTA 5G3ZA 4C76A 5IJAA 1G20B 2J6HA 1YIAA 5AOCA 4ZA2A 4R4JA 2V1XA 4NVRA 2C9DA 4H16A 3ED5A 1D9XA 6LDHA 2IEDA 2AE2A 4M7OA 3C3EA 3RF6A 2J7PA 4YQYA 3JD1A 1NBEA 3ZGXA 6AT1A 2OV1A 1HQYE 5KQMA 1ZKMA 3KPVA 4K6HA 2JATA 2ZYVX 3CLHA 3JATB 1DPGA 2ZG6A 3IUBA 4FGUA 4DLLA 2VRNA 3V55A 3KK0A 1G6KA 3AM4A 3KWMA 3FWHA 4MJ7A 5KTSA 4Z53A 2CMGA 4KH0A 2AV6A 1TM1E 1U2PA 3GRCA 5HEKA 4V24A 1TF5A 1OXVA 1YJ5A 5EJ5A 2B1JA 4JMLA 1GTL1 1KMHA 5FUWA 3CSSA 2H7CA 2JIZA 3CO5A 4IHJA 3TOCA 1K98A 3SZ3A 1W4LA 5I6DA 2V7GA 2PKQP 5K0CA 3D3JA 3I42A 2VSNA 3O3MB 4FWIB 4HDNB 1LI7A 4UBIA 3PXBA 3Q0TA 4MUMA 2WJVA 1YB7A 4JXKA 3PT5A 5LZ5A 4I9UA 3S2SA 1MBZA 2AF4C 2X5JO 3AVXA 2Y0CA 3QMMA 4D79A 2GM5A 3R76A 4AKGA 1E3WA 1SC6A 4YCBA 3G7NA 3X1XA 2YL2A 1QPZA 5KIAA 3AWIA 3GRZA 1Z8HA 2QN7A 3AF3A 3DMTA 3LUGA 4FYPA 4JCCA 1G20A 4WY5A 5A4IS 1VECA 2QYHA 3X3HA 3FBTA 3CQ1A 2Q5FA 4N6NA 4JLBA 5E7JA 1SXJA 4Q16A 1KDZA 2APJA 4JC4A 4JI2B 2WWGA 1OLXA 4RZHA 2R5WA 4X8MA 2W4QA 4MW6A 1DJNA 1M2KA 3G2QA 1NI3A 3OQBA 4LKOA 1JTFA 4AURA 3CH5A 4LF5B 5LVAA 2B4RO 1OR8A 4RWEA 1QF7A 2I2FA 3G68A 4S12A 1Z88A 4QXRA 4H31A 4YBRA 2HUPA 3S2GA 4A0RA 2VTDA 3VJMA 3UN1A 2P2NA 4D9BA 3GEIA 4ZPXA 3CX8A 4W5JA 1U8ZA 3UG7A 3UK2A 4MUKA 5DYYA 1GG2A 2NO5A 2VDVE 4KDCA 4EI2A 1D0SA 3NJ4A 3O5AA 1FSSA 3P71T 3LLSA 4EO9A 1ULSA 1JE0A 3K2BA 4HZGA 2GDJA 1CF2O 2AG8A 2P5YA 2E55A 4LF7C 3MJHA 3QJGA 4R8RA 5BUSA 4QARA 1SCKA 1MZVA 1NQOA 1RQXA 4Y6OA 3LU1A 1XTUA 2OCDA 4HX9A 3ZY4A 3E5HA 3JQBC 4PLWA 1WCJA 5ALTA 3TK1A 1XRNA 4YQZA 1FJGB 4ND4A 2XE4A 1TU4A 1ZGCA 5KNCA 3I5MA 3I8OA 1EJBA 1G6OA 3PITA 4C0QC 2HV8A 1UOOA 2Q6IA 2WU8A 2VPYA 4MUYA 4IL5A 4QUEA 3RFFA 3ZXUB 2P40A 1GTVA 2WHRA 3BDVA 1GGJA 3PQ8A 2AN3A 4TV8F 3I5AA 3KU1A 3FRJA 4L4SA 2NCLA 2BSQA 4R71A 3EFOA 1FSZA 3ENVA 1KU0A 1IM5A 1Z0DA 1O9BA 5EE5B 3TI9A 3ZV3A 5L95A 3GLFA 2PZ8A 2CHVA 4CQMA 3LUSA 3A4TA 4YRMA 3E6AA 3MJVA 3FCXA 2VP2A 2NV0A 4B7XA 5EUCA 1E2HA 1SK8A 1NOIA 1X80A 2FPGA 3EMDA 4DNXA 2FK8A 2FDCA 1DRJA 1PGPA 2PLWA 5KJCA 4P3OA 3U7QB 1GXSB 4OBBA 1FEZA 4OBWA 1LPPA 2Q6LA 4O0LA 3VBEA 3ZZTA 1GKUB 2ACWA 2DP4E 1BS1A 2GEJA 2G28A 4FDLA 4OU4A 4WJKB 4R16A 3A9VA 1LNQA 3INRA 4KFCA 3GNSA 4IDHA 4PICA 4XXHA 1EX7A 4DCTA 1R5NA 1MXAA 1UH5A 3CWCA 2G09A 4JJ6A 2ANBA 4YAJA 3KOYA 4XGNA 3DOFA 5CDUA 4UHHA 5E4JA 3SJZA 1KO4A 3K70D 5JRHA 4MQBA 2V4MA 1FFWA 4FQ7A 3I6QA 3KAJA 2VBGA 4GYKA 3JTMA 3ZHXA 5E6SA 4S2UA 3B2QA 3OPYI 3RUCA 1OCEA 3MM4A 4IJ6A 4FMPA 1J0BA 1OU4A 3BYZA 1NN3A 3AY7A 3QE4A 1JFSA 2ONKA 3GKUA 4RZ3A 3K9WA 4R1UA 4WZ6A 1FTGA 2QN3A 4O2LA 3GLIB 1BOFA 1UKCA 2WHEA 1VPEA 3RJZA 3VYTB 2GSWA 3RS3A 4ZOBA 3CLUC 2FNAA 4MUHA 2PEYA 4FW9A 3L1VA 4W7HA 1GZ7A 4YRDA 4E5NA 4H3SA 1Z33A 4GP7A 1C7JA 4P38A 2AQ8A 3P2YA 4ILEA 4QDJA 1T5HX 3ROFA 2RAVA 2XXAA 2N1MA 3RVBA 2Q3HA 4A6EA 3CPHA 3REQB 3BXFA 2OO5C 2NU8A 1GNLA 1EUDB 4MVJA 5C3UA 5E2AA 3WGGA 1T34A 4EJ0A 2HEGA 2PUWA 2ADFA 2MINA 1CUDA 5TQJA 1M1XB 1TCAA 3B1XA 1Z0SA 3AZPA 3EOZA 1YXMA 3FUUA 3LWNA 4UUOA 5HIKA 3B3JA 4AJLA 2AN9A 5A04A 4XCXA 3ROPA 5BNZA 5BY2A 5IC4A 2C2BA 3EGXA 1O8BA 3R6WA 4E46A 1MB9A 2HM7A 3FM9A 3OCVA 1L8QA 4GQBA 5B1EA 1HDOA 2ZU6A 2AGVA 1DIGA 1RHUA 5BPFA 4HEHA 3AOGA 4MO2A 1QB8A 1G4UR 3IP7A 5HF5A 3RBAA 1U3GA 2DHEA 4H7EA 4NZ9A 4AY5A 1N36B 4M99A 5D01A 3UAXA 1SVSA 2YWGA 4UKDA 2C2WA 3VZBA 4NULA 4AL4A 1ZCAA 3L7DA 2A9RA 4J16C 2QLJA 4Q3BA 4WOJA 4N8EA 5DXJA 5LZ8A 3K9FC 1GVHA 1I0LA 2YRWA 3K6SB 1KO7A 3BFXA 3S8MA 1O96A 2JH3A 3DMTC 3T1YC 2HZBA 3GFQA 3L93A 2UZIR 2VNIA 3AFHA 1J49A 2QL7A 3ZCQA 4KPUB 1QLJA 2V6IA 3EW9A 3PWZA 3S7ZA 3WHLA 1ST3A 3UXMA 5KQGA 5CIQA 1RU3A 4L4YA 3G2PA 3QE9Y 3JZMA 3T0IA 4AKEA 1DG9A 1GKIA 3C3YA 4WXRA 3WMRA 1DSSG 2GR9A 1M6YA 3F5QA 4Q82A 1WHTA 2HOQA 2NZWA 5CT9A 5BN3B 4L8WB 1AA6A 3F49S 4ID3A 2YW9A 2CLLB 1Q22A 1WQ4A 1GZSA 1YRAA 1P0PA 3CE9A 2PSSA 3M0EA 3VAAA 3E81A 4BFUA 4DAOA 1XFDA 4DNOA 4EW1A 3ZD7A 4BP8A 5IWAB 3ADDA 3TLJA 2Z4TA 3VVLA 3VXKA 1YKFA 5HM6A 1VLHA 3JR7A 2C7PA 4AS1A 2P9TA 3P32A 3UW3A 3ETDA 4EJSA 4GXNA 4D9CA 5JYEA 3FWPA 4V0NA 1OPRA 1JEDA 1JHUA 1JEQB 3DMFA 4NMMA 5BQFA 1W36C 1JJAA 4QFBA 3AGPA 2HNAA 4Z9AA 3STVA 4Y6LA 1AMOA 4AX8A 1W0JA 3N70A 2WFLA 3Q4GA 2G9VA 1NBHA 1KSJA 5AESA 3RWOA 2ZCVA 3U9SA 4G4IA 1SIWA 3DXXA 2A0KA 1JTVA 2UKDA 4F72A 2OYCA 5EE3A 4BC0A 1N7GA 3HL4A 5I4IA 2Z2XA 3DBIA 4NWIA 621PA 1QTQA 1HH2P 5IEBA 5EJAA 3B1KA 2WSLA 4ND5A 4URFA 5DVZA 4V1CI 3R44A 2QUHA 2VN8A 3I4FA 2YWDA 3QKRB 4YRPA 3V97A 4O4IF 1LD3A 2IKSA 3MWEA 5BV2P 1SOMA 4KUGA 3WWEA 2L19A 3BHMA 4NAHA 4P4SA 3NC4A 4Y7DA 4Q7QA 4CF7A 1ZJZA 4X45A 4WLOA 1N8SA 1SKBA 4KE6A 1JAHA 4IXNA 4TKMA 5HPYB 5F5NA 3P2EA 5DBGA 2P11A 5B1YA 1G7RA 5ALMA 4R1MA 4JMPA 4NBVA 2QY6A 3JTEA 3NRJA 1NRJB 1EXWA 2VT3A 4MQLA 4BQIA 2AQKA 4JASB 3V1YA 3ZU2A 4Q9JA 1V71A 4Z2AA 3KFVA 3D7RA 2FP4A 2PD6A 1PNQA 3DFIA 1CUXA 3NDBB 5FLXA 1FBTA 1XMVA 4WWHA 4EKDA 3OQVA 2K7ZA 5KVCA 2IP1A 1FFSA 1VE1A 2NGRA 3PDIB 4FZVA 5BMVF 5EWJA 5JR3A 4MVYA 4UW9A 3NAQA 3VJLA 2UXCC 4KL8S 2QT1A 5HGXA 3A3KA 3HGMA 3T7SA 3CJEA 1SVNA 3O94A 1T5OA 4LV5B 1NW5A 1U2ZA 2FMXA 2B94A 3JV7A 2ZUDA 2P7IA 3A6GA 3IVRA 3TOZA 4Y2YA 4DC0A 7ABPA 2ORVA 2BEVA 3FCUB 5AI9A 1T9GR 3EEYA 1NAIA 1Z26A 3H3JA 3I09A 2YHIB 3OCXA 3C8DA 2I22A 5CT4A 3WMGA 4CCSA 3QU9A 2I7VA 2VL7A 1NMZA 4YJ2B 2Y1DA 3UMMA 5HS4A 2ID4A 1G8PA 2Q1WA 3H1TA 4PBTA 1QTIA 5JVDA 3QVKA 4QXMA 2C57A 4CFYA 1T4DA 5CYPA 3RYIA 2PFSA 4G4SP 3GRYA 4G24A 1DEOA 4UJ3A 3PIDA 3WRYA 1BVUA 2JFGA 1M10A 1JDSA 3KVYA 4N6OA 4Q3OA 5AKJA 4EJSB 2AC7A 2WJAA 4EDHA 4KQHA 4XX0A 1DWOA 4EGCB 1Y9AA 4ZI7A 1L5YA 3EDQA 4HOYA 5LPNA 1HDEA 3Q3IA 4FR0A 2ZRHA 1Q50A 1IBCA 2BC9A 4JNCA 1ZUD1 3QI2A 1UEIA 4K6GA 4X5OA 1BRMA 4GSKA 3K6RA 2DAPA 2VC2B 3CH7A 3IT3A 4KLAA 3NTLA 2JLCA 4O3MA 1DEAA 1XTIA 3FDIA 4IIGA 5IYZA 1U9JA 4ZP1A 3I12A 5KDOA 1E3SA 1CJTC 2HMAA 1X87A 3PHHA 5F77A 4Z0PA 1IQUA 3PTAA 5TE9A 4HDRA 3W05A 5JLAA 4B3IA 1J0CA 3DE6X 5AHWA 1RWVA 4MARA 3QPWA 3RUHA 3E1SA 1HC7A 1XB2A 3OMLA 4EB0A 1FFCA 1RYFA 2AFIE 3GDOA 3HKBA 1F8GA 4YJGA 3HRHA 3MA0A 1GAQA 3G2NA 3RVSA 4F60A 1ETUA 4ECAA 1M6VB 4A3SA 3A7EA 2KX7A 5KJ1A 1I14A 4QYWA 4GM4A 5JNWA 5HIJA 2GKSA 2CJPA 4QNMA 3TFQA 4U2CA 3LQQA 5TS3A 1MQ9A 4D3DA 4WLUA 4YMLA 2WTAA 2J4FA 4JBWA 3H1FA 3K4QA 3SZMA 2LTAA 3BMXA 3ZNOA 5I4KA 1X1CA 2FN4A 4TV9A 3VA7A 1NVVR 5KOJB 5LA6B 1AKNA 3VDRA 1LI4A 1LNSA 2UVQA 4RK0A 4GXQA 1PWZA 1YC2A 4D3ZA 4AZSA 5A4MS 5T3UA 5F2NA 1I13A 3D8BA 2HSGA 4GVLA 5BN4A 2GS9A 1PS8A 1PTJA 2IA5A 2NTJA 2ZWMA 2NVBA 2BFOA 4OQQA 1WNTA 5E6RA 3SU8A 3TQQA 3U4HA 4CCAA 5LMUB 1Z12A 3JALA 2JD0A 4J6EA 2E21A 3O0TA 1R6AA 2DPGA 1I4LD 4MQUA 3WLFA 1LW7A 2CNBA 3USZA 3ETCA 2IDJA 5JAPA 3EERA 2J41A 3B7WA 5G02A 2WA2A 3HEBA 1YZ3A 1EVZA 1SCQA 3IHWA 1OHHA 3J7AC 3O0DA 3L4EA 2PH3A 4I50A 4JB2A 2HDHA 3JVVA 4WAUA 5SY9A 3RNOA 1Z6AA 4O4IA 4Z4HA 1E2JA 4I4CA 3AOEA 2XBUA 3BTUA 3DMNA 3F7NA 2W4IA 2DG2A 1NZJA 4OHFA 3K4PA 4KX5A 1AM4D 1C0IA 2ZRDA 3JQFA 4JS0A 4EA8A 3ICVA 1U94A 3QVGB 2QD4A 3GCGA 3F8SA 2J7KA 1DRUA 2IK8A 1CFJA 2UUAC 1QONA 3GJZA 2R1VB 3FUTA 3LJKA 3U7EB 1U2RA 1R0BA 1BWRA 3E5NA 4IIHA 3SE0A 1FP6A 2AS0A 2QORA 1WMBA 2FK7A 1XS3A 2MTBA 4HRXA 4P6VF 3BMNB 3T1HB 2MMGA 4HLUA 1VEHA 1IB8A 1QE5A 4OXQA 1MB3A 1ZFNA 1XNHA 4O4LA 4I55A 3ELUA 1R00A 4MKIA 4Y8VA 1IK4A 5JNTA 2IVFA 4D02A 2IXAA 1HQDA 4Z6KA 1U04A 2EWWA 3HI6A 5BWBA 1TZKA 3E05A 1SVLA 4YHBA 5DM4A 4F3NA 1Z75A 2FETA 2JI4A 3A10A 4FKBA 2RDMA 4R2JA 1WIWA 1WVGA 1UBMS 4CQLB 5IJ9B 1M83A 3AQ4A 1ZNWA 4RS3A 2GEDA 2EV9A 1XA3A 4PC6A 4A4DA 4TVOA 2H5EA 1GRNA 2GRJA 3C3CA 3E9DA 4G4SO 4EJSC 2ZDGA 4NBWA 4RNDB 4O4IB 4TMXA 2WP0C 4XJTA 1TMYA 2A9PA 3TN7A 4DIUA 3DL0A 4HYEA 4K0KC 3UM9A 3SOZA 3WYAA 2B2CA 1E9RA 4CJXA 3JARB 4DEYA 3L40A 5ER6A 6NULA 1CJBA 1LVGA 5EKDA 2EVWX 4P0QB 1G1MA 2P5SA 1R4NA 5A05A 5BV1A 5I5EA 1AKQA 5KHLB 5DCUA 1UWDA 2ATIA 3VYRB 5F9FA 2Z8YA 3F5FA 4Z49A 3KV3O 1N5OX 5GZ6A 3V8EA 5LP6B 5FLXD 1HDXA 1SC1A 4AROA 1I6WA 2A84A 2UXBC 2FLVA 3N86A 4LAFA 1YTLA 2XOXA 1PGJA 2V4UA 3L6BA 3UJNA 4PTYA 1E3DA 3BBPA 1JKXA 1QVVA 3UPDA 2WI8A 4OYHA 4BB6A 2X7XA 3CUUA 1KYWA 3HCOA 1H9CA 4JQOA 1FNNA 1HNZC 4B81A 3K73O 4NNPA 1KRHA 2AFHE 2PN2A 4F38A 4S3MA 3OIVA 4J0JA 1LFDB 4M1WA 4TQAA 3N0WA 2PGAA 2X3FA 2AEMA 2CUZA 2WF9A 4MV9A 3TR6A 4E14A 3D64A 4XASA 2G80A 1MUUA 4INAA 4L5IA 1EUCA 2PD4A 4LISA 4M46A 4MK4A 3NHBA 2OVFA 1B3RA 1RTKA 2VJMA 5EGNA 5B6PA 4F91B 2WYVA 3RUIA 1Z9BA 4RMNA 1XRPA 2NT3A 4A6DA 2IPOA 3NWBA 4JBXA 3IQFA 4YJ2F 4ZO7A 3QP9A 1X2EA 3W5JA 2W11A 1DAGA 2G4LA 3VVMA 5KYYA 2YXNA 2ID7A 2YJ4A 3GLTA 4DR7B 4FUQA 2GBLC 4MVXA 2BFPA 4QATA 5A3QA 1EP2B 4OFBA 4CL0A 4IOJA 5AIAA 1Q74A 3EFEA 2GB4A 4WOKA 2OQVA 2HWKA 1YCFA 3OM9A 1E2UA 2B21A 4MYSA 3SAJA 4C6TB 2E9SA 1TA0A 4EUEA 1TGYA 4I8XA 5GP1A 4HGYA 4EFMA 2GT1A 3LBHA 1IHXA 4H35A 2FDXA 2FXIA 2JGDB 1E9DA 4ES6A 3WGHA 3UUGA 1VG0B 5FBZA 4I0WB 3LGSA 2FHSA 4IRMA 2PDAA 1R4MB 1J8MF 1ESMA 1Z5NA 2AWNA 2ZB2A 1KWKA 3V1UA 1G4AE 1EXVA 2YXLA 2CLHB 3LUCA 2GNPA 4QGBA 3PQ6A 3WMWA 1J2YA 2D74A 2IOQA 3CN7A 3IP5A 3WS7A 2IUTA 4RETA 1X7WB 4CPDA 2EHJA 1PT5A 3MT9A 3OE5A 2PZAA 1E0DA 4KRGA 1R6DA 4I50F 5K99A 4KLCA 2ONYA 2I6XA 1Q0UA 3DLIA 2C5SA 2BP7A 3EUEA 3HJCA 3OIWA 4ND8B 2Z83A 4MS3B 3TEMA 3U7HB 3WHIA 2NU7B 2Z5LA 2VYCA 3IDFA 1NU6A 1OFUX 5IXJA 4IMPA 1GKYA 1IN8A 1HT3A 1KO1A 3UB3A 4A2CA 4WK2B 5TS2A 3C98A 2ROQA 1PZMA 1UBTS 3MWGA 5LMNC 4MKHA 3N07A 4NU8X 5ECDA 5K1ZA 2PMWB 2VH5R 4TLAA 1C8KA 3UAOA 3IKTA 3DZ8A 3E18A 4HGZA 3TLBA 1EFKA 1PG2A 1G38A 3GRRA 1U0FA 4MHTA 1AGPA 4M0FA 3NEAA 5DH9A 1IQRA 2OXTA 1NPYA 4MQMA 4US1R 1YNSA 2PS1A 4ZV7A 4HNQA 4BY9E 4C2BA 1GAWA 4I55F 5F1OA 1PG4A 3FROA 3TTXA 2IS2A 2DY0A 3LUJA 2WICA 4YCJA 3GMTA 3PYLA 5FV7A 2JD1A 3D2LA 3QE3A 4BFSA 4R2KA 4WKOA 3A6DA 3O8BA 1H6BA 2G8LA 3V8BA 4JWKA 3OZIA 1SD5A 1AKWA 4H6PA 2GCEA 2RHDA 2OD9A 1Z34A 4IJKA 4BPRA 3SVTA 1XD2A 3FYUA 4FYJA 3KVOA 2B2XA 3WGMA 1N2CE 3P94A 3LXMA 1K7SN 1CVIA 3LXUX 3J81D 1J21A 1RT9A 4LCBA 3F6CA 4EWLA 5AOBA 5L6MB 5F76A 2HIHA 2CV0A 1KI8A 1TNDA 1YR7A 1QWSA 2QPAA 1TX4B 3KR2A 3QYPA 4RESA 5ALHA 2O6LA 1XVLA 1G3MA 1T3LA 3MN1A 3DW1X 3ORSA 4O2BF 3U1TA 4B4UA 1OC4A 1LVHA 5L6LB 2EZ9A 2HF2A 2P2ZA 1DOAA 2VDKB 3OJXA 1K2WA 2E4VA 3FW1A 3I1IA 4HTAA 4IIJA 1TM4E 1E4OA 1RPJA 3PX3A 4DYVA 2FMUA 1MAAA 2I2WA 4PN7A 2YIDA 5TVKA 2P02A 4B4KA 2P4HX 4KIFA 1XZKA 2RGCA 2HA2A 4O5AA 3TSCA 3EFBA 2JLSA 4DR1C 1X15A 1XRJA 4F5DA 5JCOC 4J90A 4LZOA 5TQ0A 1M8FA 3U3JA 1ZK3A 1AZLA 1P0FA 1Z36A 2BFWA 4GMXA 4L3OA 4P34A 5ALXA 4C4RA 5K8UA 2C0PA 2LNDA 1J1ZA 5ENDA 1XZIA 4K26A 1U8UA 4JEUA 4Z0HO 2ZYWX 1PYDA 3AM5A 5AHKA 5LP6F 5B7GA 2GWHA 3HI4A 5E6SB 1OIWA 3T3IA 1WCIA 4QU9A 4FWTA 4PS1A 4YALA 2Q9CA 1YACA 2ZM6C 5I48A 3F6PA 3TM4A 4Q1CA 3NOOA 3OZWA 2YS6A 4URZR 2O5EA 4EJ2A 2QTVB 3ND7A 3ZEIA 4Y1RB 4GP6A 2Y4OA 13PKA 3V4LA 1RZRD 4ENSA 1GO2A 1G42A 3HZRA 3L0DA 4RPLA 1E2LA 1O94A 3IVCA 4I46A 5LDHA 1ZRSA 1ZAKA 4H3HB 1XWFA 4B2PA 4LXTA 2QMZA 3R3VA 3TD9A 3NC1C 5EVCA 2QBYB 1O03A 3JSAA 1ULAA 1V47A 3TKYA 2P67A 5BSEA 4PLFA 4LV6A 1M6XA 1Y6JA 3DJYA 3HYLA 4KDFA 1U31A 5E1BA 1JI3A 3TE6A 4BJ1A 3W5UA 5KBYA 1IPFA 5CDFE 2WSIA 1JKJB 5C53B 3DKRA 4LFBB 2C88A 4CLXA 4US2R 2C3UA 3GP8A 2ZYSA 3V9AA 1E7RA 4FFPA 4LF6B 1C4KA 1DKUA 4NR0A 1O9TA 1UXGA 2X8BA 1Z8FA 4BVJA 4NU6A 4PC1A 1A9XA 2P4UA 5H02A 1ZJ5A 4ZTZB 1P0IA 5LJIA 1WAMA 2HHLA 2HA3A 3U09A 2E4YA 3FYUB 3G8BA 3UF0A 1X86B 2B2NA 2G9NA 4F3CA 1JJFA 4BNKA 3MT0A 1V95A 1E2BA 4BYGA 2HV9A 2Q45A 5E6UA 1S6YA 2KZFA 4W6ZA 4F7WA 3UX2A 2O0HA 2UUCB 2C9CA 3ESBA 4CUZA 4ESEA 1XVVA 5EMJA 1QK3A 3AESA 2BFNA 2DHRA 2NAPA 2YCLA 2WY2D 2OCLA 1YSCA 4P08A 3ICPA 3THRA 3I23A 4UNIA 3NDIA 1Y8ZA 1QOQB 4W8OA 1EVIA 2GF0A 2C4WA 4EB6A 2YIVX 4ONEA 3G1UA 1RRMA 4JOCA 1E5LA 3I39X 5BRNA 3PJRA 1QC5B 3M4ZA 5HQTA 2KHZA 1UKYA 1K2VN 3H5VA 3MTIA 4N5DA 1U9ZA 1QX3A 4AI6A 4OSOA 5CD1A 5JY1A 3H7AA 4OF4A 1QHNA 4OXIA 2X86A 2QE7D 1E61A 2EZ4A 3KZKA 5FTKA 1VHWA 4Q1BA 2Y2UA 3IR6A 3T5GA 2SKEA 2FPUA 3OLWA 2IYVA 2BM9A 2Y68A 3LBIA 1L4MA 1AX9A 4I9NA 5ALNA 2VXYA 2QMQA 2WEKA 4JR2A 1TUIA 1W85A 2X4IA 1RKXA 3NHLA 2YMLA 4B71A 4RCVA 2WIFA 2JAOA 4AQYB 1RXUA 1C2YA 1NTOA 5EZ5A 3UK1A 1L9KA 4JX9A 4F45A 2RIPA 4JP8A 4RF2A 4XA8A 3LAWA 3M8KA 1RYZA 1GYRA 2SICE 4D57A 2ZUVA 3QV2A 1W76A 4KR3A 2V7QD 2QNRA 4MV0A 4MYDA 1RY2A 4WZAE 5FYDA 5KU1A 3PNMA 4FJ2A 2ZYGA 2PX2A 5BVHA 1P7ZA 1NF9A 4LJ8A 4XX1A 3H2BA 2ABWA 3KQQA 3OSZA 4Q7MB 2Q7OE 2D1RA 1N6OA 3D2CA 4UHKA 3EPRA 2FZVA 5FUYA 1ZB8A 1NULA 4AZ3B 5DNVA 2QTBA 5DASA 1WTAA 1UKEA 5FLKA 1TKBA 1UWCA 4RTLA 5FOSA 1XZAA 3MWKA 1Z16A 4MS4B 4X0EA 5KOIA 1BXRB 1YJXA 2A0XA 2J31A 3F6YA 2PBRA 2XQIA 3D8NA 3LL7A 4EA9A 4DJAA 4HUTA 4JH0A 2O19A 3BD7A 1PK9A 1O6GA 3QW2A 4LZAA 4FLEA 1H2YA 2W2NA 3PR2B 3R4CA 2NN3C 4JC0A 1PFYA 3RJTA 3GLHB 3BGIA 2AN1A 3H2GA 4B34A 2VP6A 4NU5A 4EG0A 4F3RA 1EEXB 2CNKA 1DIRA 3VSAA 4B35A 4OB7A 4B6EA 3WLHA 1YVUA 3C5EA 2YHAA 1QBGA 3H8SA 1ZKDA 1YS1X 4MKXA 3UWSA 4ER5A 3QIAA 3VKGA 1G5IA 3ER6A 1BJRE 1SU6A 1PFGA 3VZPA 1T24A 1C9MA 1SQ6A 2GHRA 3BPSA 2F00A 2R66A 3KS9A 4RJ2A 3KUKA 4EBBA 5CDGA 4MW0A 1FNBA 1B2LA 4GRDA 1XAJA 2A78A 2J85A 5FLYA 1DBIA 4QZVA 1II8A 3G6KA 4JJ4A 5ALLA 1D1QA 2ONFA 1ULBA 2R86A 5DNWA 5C9ZA 4PTLA 3DBRB 1PEYA 2ATEA 3LF2A 4F12A 1AV7A 2OR3A 3FYUC 3HU1A 1LSSA 1E18A 1LSJA 2ZJFA 3TAXA 3K1YA 9GPBA 5DBFA 1KDRA 1GN9A 1PS9A 1YT5A 3WTBA 1DAIA 2R7AA 3H9EO 4M2LA 5IDYA 2IE8A 4P3NA 1C14A 2A7XA 4OHPA 4MH0R 4UFPA 3EMBA 3RRMA 5KU7A 4RTJA 3V1MA 2AW5A 4Y9DA 2WVHA 3AONB 1ZJYA 3EDCA 1S8OA 5G3YA 3THSA 1YQQA 2HJWA 3PXDA 4KXYA 1P1IA 5EMMA 5A1TA 4BTVA 4F4FA 3S55A 1T4GA 3KZVA 3WP1B 2I1LA 3G5TA 1L7DA 5G4LA 3GFPA 1P1CA 2HHJA 3SEFA 1M76A 2IBSA 1RAFA 2J09A 4Q15A 3G0BA 1NSFA 4R8KA 4RDHA 1EFLA 4ZOCA 2X0DA 4ZT4A 2XYRA 4ZO6A 3EVDA 2VHTA 2PZMA 3M33A 2EU8A 3O21A 3P4YA 5FPPA 5H82A 2JW5A 4L4QA 2C20A 2D4HA 1IEQA 1N5LA 4RKYA 3TLZA 4ENTA 2PO5A 4MQ6A 5HRAA 1NVKA 2NSHA 3AXSA 4GPIB 4UEQA 3W6ZA 3KEFA 4M1MA 4TX1A 5AIBA 2JCVA 3YASA 1OPXA 3KHSA 1FLDA 2WM8A 5K05A 3B38A 2LRHA 3TTUA 2X0JA 5H81A 1ZCFA 1FUKA 2Q0HA 2DJ5A 4QD3A 5JW6A 4Y2SA 3EY9A 1CE8B 5ESWA 1RJEA 9LDTA 2C7RA 3C5HA 3KXPA 4EPRA 3BM5A 4TVKA 1V3UA 3I01M 3PFWO 5KYUB 1EDEA 2ESRA 2EP7A 1NVXQ 2YZGA 3L7NA 4PXSA 1NOKA 5FADA 1TKCA 1IC6A 3N8GA 1CDOA 3IO3A 2G1KA 1LV7A 4REQA 3V4OA 3VSDA 1MB4A 2ORWA 4BX8A 3AR5A 4OLBA 3RRJA 4AYXA 4KKVA 3HA2A 5KDLA 2NUBA 4IGEA 5IF9A 4MV5A 4ZFNA 5GJWC 3LHDA 4GX5A 4KR0A 4XUEA 4LXQA 1JG2A 3KSBC 1QPGA 1F8FA 1KDPA 4BHTA 1MLDA 4PSDA 3NASA 3OE1A 5KO2A 4EW3A 2AFHB 2WG2A 3UCEA 2A1UB 1D7OA 1GYQA 1X7ZB 2GBIA 1SPXA 4K9QA 2FTKE 4RFSB 5B36A 3E0QA 7ADHA 3HY3A 3JQGB 2FR0A 1Z07A 4NNOA 2HBRA 3HKDB 3R75A 3BSWA 5HZGA 3MFYA 4FHDA 4DAEA 5CBKA 1N6KA 4N49A 4TMYA 1E32A 1ZSYA 4AWXA 1XDUA 4LZLA 3ZK9A 4LJ5A 3FYHA 3N2YA 5K85A 2RBEA 3W8RA 4EZEA 3TI7A 3FDXA 4EH1A 1G59A 2X9VA 4G41A 5IG2A 4B6GA 2NYVA 1KI7A 3BCSA 2XZLA 3OA2A 3I64A 1UDBA 3NT5A 2XECA 4PGMA 4F04A 3OM1A 4FXPA 5JEEA 3W3AH 4KTTA 2O0KA 2ZYRA 1KEUA 3QWFA 2WTNA 1CJMA 4HXGA 5DSTA 4CKCB 2O54A 2ZIEA 2RCYA 3A8TA 3H83A 1FP4B 1QSGA 2IYFA 1XMOC 2JVKA 3P45A 4M9XA 3X1DA 3FXAA 1H0SA 5KUTA 4U2GA 4HUQA 1XNRB 1EWRA 1P3Y1 1QK5A 3C2QA 4GXRA 4PBRA 1PUXA 4HO1X 4QJIA 2GOYA 1M0SA 2JAPA 2JFNA 3E03A 5EXPA 3WOHA 3R7NA 2AWOA 4TOIA 1P0MA 1LI5A 3F67A 2G63A 1DC4A 2AJBA 4X1KA 3C7CB 4XQCA 1E3LA 1RPTA 4RVHA 4ZI5A 3TKAA 4WFJA 1BKYA 5JJIA 1UP7A 1TJNA 4DPMA 2GUGA 1U8YA 3HKBB 4YJGB 3REFA 2ZPUA 1L8XA 2X40A 3NIWA 2QAJA 3P2IA 1RWOA 3QXJA 3M3DA 3RV4A 3AUXA 4ZOEA 3M3PA 4BP3A 4WFQA 3LP6A 4F1WA 4V3BA 3UEOA 1IY2A 2HA5A 3TQIA 4EA7A 4A1FA 4N3GA 5JRDS 1KEVA 1NOJA 2BJHA 3DONA 3N05A 3NP7A 5EFOA 1PR4A 1ZC4A 3KPWA 3VV2A 2L17A 4KZKA 2CLDX 4W8HA 4CF4A 4L28A 4XWKA 1QCYA 3U39A 4EQ6B 5C7LO 1NXVA 3IAXA 4NPHA 1G8AA 1HV8A 3U5TA 1UMDB 4DILA 1SRQA 5J43A 4CEHA 3C4VA 1GCAA 2GFHA 1FVFA 1WXXA 1E6CA 4NJEA 4FQ5A 5CURA 4TZ0A 5CB4F 2VPQA 2HTEA 5HVNA 2A9QA 1UZAA 2Q3CA 5KZMB 1TAUA 4C01A 1XQYA 2NWQA 4U3JA 2HT6A 1IAQA 5JVDB 4X7BA 4AMBA 2LE0A 4M0DA 4V2UA 1Z4MA 2YQ4A 1I30A 3BIFA 3E9RA 1BMDA 1TAQA 3GDWA 3OE4A 4U7HA 1V6AA 2I3BA 1EDDA 3C6YA 3NBXX 1ZISA 3K94A 4IJMA 4QC2A 5K3SA 2CHEA 4Y30A 3VO1A 1GPAA 2YXEA 4A36A 2C31A 4G0OA 3AEQA 1ZI9A 2YDXA 1KMCA 2FQQA 2HK7A 3L2OB 1KC3A 2XBLA 3BSFA 2ZJZA 2I6SA 3COSA 1IULA 2XUPA 3EGDA 4MP6A 5F73A 1JHXA 2X6QA 5LBIA 2YX1A 5FV4A 2VS1A 3RSFA 4M0EA 3IBYA 5KEIA 1S2MA 2ODNA 4D6YA 1UC8A 4WESB 5BSGA 1D2RA 1UMKA 2HA4A 4JQSA 3P26A 4TUYF 1PN3A 3H99A 3W8NA 3T1HC 3QEMA 3EG9B 4CDMA 2AG1A 1XN4A 1SXQA 3E9ZA 2PQMA 2J5RA 3IPRA 3PGMA 3W9BA 4JD5A 2KSQA 3DEHA 2ODQA 4Z3KA 1FA9A 2ZUEA 3P9RA 1BMQA 4QXOA 1HA3A 4YASA 4CV1A 3I07A 2HA6A 2ZIVB 3AL0C 1OROA 4YWHA 5DN6A 1P1BA 5CMLA 3O6VA 1D4OA 2SCUB 3ZLUA 3MINA 1WABA 5I7EA 1C1YA 1Q2XA 4WNCA 3VR4A 3FMGA 1U5AA 1UPBA 1QRAA 2QSZA 4FFDA 5KYXA 4HRVA 1B41A 2G5CA 1KL7A 3F6SA 1C1HA 4Y2JA 1KXJA 2HSDA 4L8GA 2ADOA 3CRW1 3WNCA 1FPMA 4MMYB 2QLLA 1AHIA 1QQ7A 5IS2A 1EDBA 2QENA 2H8KA 3C87A 2YZMA 3HJBA 1W9MA 4RM3A 3DEZA 4BFXA 1MF7A 2YICA 1IRXA 4MLDA 3EGDB 4BYMA 1PSWA 3KSDO 2Q1UA 4CW7A 1URPA 3LDUA 3I53A 2BLLA 1LBHA 3B2EA 2V8BA 3L06A 1FUIA 2BFMA 3FB1A 1XYYA 1ZW6A 1NUPA 3EGOA 3DTTA 3HO8A 1WVMA 3JALB 3H8JA 1Z7GA 4F6RB 4CIYA 5ICEA 2OQRA 3FTDA 3J80D 3B13B 4KQGA 4L08A 1O3YA 5EAIA 5A6SB 5EHZA 2OHVA 3A28A 3CKYA 1TIPA 1UPFA 2OZEA 1YRBA 2BISA 3DLAA 4PG4A 4Y7CA 2JFPA 3K1AB 3NWOA 4YY3B 4AQYC 5KNBH 3C3XA 3UJCA 1OBFO 4B6FA 2ZRJA 1QZXA 5FQNA 2R1ZA 3AWDA 2PNJA 3GFRA 3VISA 4WXMA 1PK7A 3DD5A 3H18A 1EUQA 1GM5A 1CR2A 1AKYA 2IE0A 1SVMA 1ONBA 5JQGA 1S8NA 3OURA 3HXOA 1G8FA 4ZRNA 1O94C 2HQ1A 1FU7A 2AXQA 3PDHA 4NG5A 1EUCB 4HNVA 4HGOA 3PKIA 3M2PA 2OZPA 3WGNA 3GUZA 1VGQA 3UC5A 4E4YA 3AL2A 2YYYA 4LYGA 3O47A 3V7WA 3DQPA 1Z37A 2ENUA 3CJQA 3L18A 2FWNA 3TSOA 3UANA 4IQGA 5JNVA 3FJOA 1P4EC 1ST2A 3EEOA 2JIBA 4ETIA 1Q0PA 1ULZA 1JBQA 1NVTA 2R84A 3KD2A 4JQCA 2DX7A 3N2QA 3WLEA 1LPAB 1PFUA 4P81A 1Z74A 1ZA2A 1T2UA 5C1IA 3IPXA 2V65A 4KGXA 3RJMA 5J4YA 2JBHA 3AP3A 3EJ6A 4UEKA 2GZHA 5AXCA 4C21A 3HJNA 1U6JA 1KJQA 5TC4A 2EEZA 2IRWA 3CNHA 2E8FA 3E22A 1KO8A 1N8TA 1V39A 2JFQA 3I05A 3L1IA 1KERA 3QVWA 4OATA 1W1WA 1DQZA 2WF6A 3VOSA 2QW8A 1SBTA 2YV2A 3KOZA 1Z15A 2HU5A 2HU8A 5A5FA 2Z2YA 3HM2A 2FLWA 2DBQA 4K6FA 4N65A 5EL0A 1NHGA 1XD2B 1NKSA 2Z43A 4GPEA 4R98A 4EEKA 1RCFA 3EOBI 3UMJA 1YWGO 1GN8A 4M36A 5JJBA 2BR4A 4C08A 1Q92A 1XRSB 3MUNA 1MC8A 2M1XA 1T3SA 3R3WA 5LMNB 3N87A 4R83A 3LTNC 2VCYA 1MTOA 5D2CA 5C31A 2D2FA 2IC5A 3CF6R 3QWBA 1YZYA 2DEUA 3NBUA 1QM5A 2VWGA 2XXJA 2AIRA 4MICA 2W70A 3GD5A 5CHEA 4V0QA 1L5FA 2P1RA 4HRYA 3ZCUA 2CVZA 4L6IA 1Z6PA 3KAQA 1UFRA 2AL7A 4JHLA 4XR4A 1IBLB 1IN1A 4QEZA 4ABYA 1A98A 2Q4EA 4RJTA 3H3FA 3M9LA 3OX2A 3V5NA 3K9HA 4JGIA 1R8YA 1FXSA 3B8HA 3C85A 5HFAA 1E1LA 4LHWA 1G2QA 3UMFA 4QJ4A 3ZKAA 8ADHA 4QGSA 1U4NA 3I6YA 1Z5UA 4LJSA 4PO3X 5CG1A 3IYLW 3WK8A 4URYR 1IQ0A 1S1CA 4YWJA 5H59A 2E4AA 1QFJA 1VXRA 3FFXA 1UKBA 4RDCA 4MGYR 4PQEA 1M0WA 1P5HA 2IXFA 4YFYA 1XTVA 1JALA 5GADl 3IKMB 2GZAA 1LKZA 3LVRE 3Q41A 2H1IA 4UTNA 5FNZA 4RV9A 3AHJA 5C5DA 2Y8EA 3O1JC 1MENA 2QIPA 2YY7A 1DOZA 3DEJA 4J03A 1ZHOA 4OQYA 4K0KB 3C3JA 2OV4A 4ZO9A 2DQSA 3E8MA 3NYWA 5SZHB 1D1SA 1QV9A 3CR8A 3R7BA 1P8AA 1KOFA 3V32A 2VQSA 5EIHA 5EZYF 2EW8A 1B8OA 2XLBA 4MVJM 4DB4A 3TCXB 2VT2A 2EFYA 4OHRA 4WNAB 3F71A 3ELWA 1G6HA 2Z04A 4K1XA 4B87A 3R9XA 3SCZA 4HJXA 4P31A 5IX8A 5FWYA 1J6UA 1M2NA 3IESA 1GL3A 1RLUA 4C5AA 4F6CA 3VAYA 2GBCA 1ESEA 2SHKA 3ZIUA 3RVDA 4IINA 3WXBA 4CM5A 5GY7A 4FCVA 3F8WA 4GP9A 4NKRA 1NXTA 4B7ZA 1J70A 1KDTA 3K70C 1WEKA 2G7MC 2JK1A 2ZZKA 3KZOA 4CTMA 4KO3S 5AVWA 3EUAA 3QA3E 2OMEA 5EN4A 3C6BA 4MHSA 3WLIA 3RGGA 4ZVMA 2BH1X 2VKQA 5FI3A 3P20A 4B8ZA 1C7RA 2AEJA 3I83A 4LRXA 2J0UA 1PW5A 2XUZA 2GRUA 3DLTA 4E51A 1A8IA 5KCZA 1CK4A 2RK3A 1BZYA 2P2CA 5FBKA 2JGRA 3VU8A 4YFVA 4CXMA 4G09A 1UT5A 2JFUA 3JRNA 2G71A 1JH8A 4CLOB 2PCJA 5HIIA 5KOHA 5BQ3A 3FPEA 1JJ7A 1U28A 1VA4A 2QL5A 2ZETA 2W37A 1VBNA 1BDMA 2QV7A 3Q8WA 3U9TA 2FPSA 3OT5A 4KN8A 1YZKA 2QUJA 4MRMA 1QGDA 5JNRA 1BQEA 3NZEA 3R9XB 1M6XC 5MN5A 1JJVA 2QLMA 4PNPA 4TLEA 1XJWA 2IYTA 4Y1RA 1M1YA 3KJZA 1NVAA 1XRRA 1XZNA 5H0IA 1HNNA 1N2ZA 3S1AA 1NUAA 2D8MA 2UU9C 3R6DA 4DT1B 2X5XA 4Z7OB 1QC5A 4OMCA 5CDYA 5T8SA 3FHCB 2QW0X 3HUUA 5BT8A 3JQEA 4XUCA 2GD2A 3P0RA 4DMCA 2DOKA 4HFJA 1N5RA 5KNCH 4XWTA 4P2GA 3KKQA 1LBIA 5HIMA 4CMIA 1QP7A 5EC8A 4C5CA 2ZJ0A 1S7GA 2WSSA 2AVDA 1V7PC 4YCMA 3KVNA 2DFTA 4ZDJA 1AHPA 1HE5A 4KN6A 4QRHA 4KO8A 4UQOA 4M1OA 1JSLA 2UUBB 2GN9A 2INGX 4FDVA 4I99A 5ESXA 3VM6A 3Q7TA 4Z86A 4IUCS 2OO7A 1KEKA 5BR8B 2P4QA 2W9XA 4XKJA 3V4ZA 4TTTS 5AO9A 1TM7E 2VDNB 3K0EA 4CDNA 4EF6A 5ANRB 3PFIA 4UDOA 3R1IA 4H1WA 4QM7A 2XCOA 3OKAA 4AJEA 3HADA 5JCOA 1OV6A 3EBLA 2FR8A 3EIOA 4RQBA 5I9LA 3ZDCA 2PGOA 2I8CA 3ZWBA 4Z7QB 5I3CA 4DR2C 1UMCB 1NWCA 1JSZA 3FTCA 4K0RA 1V8OA 2IXGA 4UPEA 1AURA 3OUZA 4XQGA 3T9FA 3CEMA 3AETB 3W5VA 5LKRA 3BK2A 3ED1A 3PNBA 5KTPA 2J87A 2IIBA 3ZHRA 3HCFA 1KIMA 4QX6A 5F35A 1C7QA 1J06A 1Y9EA 4XWGA 1NKTA 4ZEWA 5T3YA 4FYWA 4JVMA 1WB6A 3RWBA 3KD3A 3NFRA 1PLLA 5EMNA 5CFQA 4R1LA 1JFFB 4ZVQA 3DC2A 3ETEA 2FA9A 3N8NA 4Z1MA 2WSSD 1P18A 3RIYA 5LMZA 1QQ5A 3D6FA 3L0PA 1WXEA 3RYCB 2O8EA 2G04A 3FGNA 5F4BA 3QXGA 1IM8A 5C3MA 3MWDA 2FDRA 3DYVA 3MJEA 4RVOA 5IC6A 3VO9A 1KYXA 1QQBA 4DV7C 3FTPA 4Y9TA 3T5DA 2RGNC 5DHFA 5JFOA 1X92A 3CX7A 1NX6A 2D5BA 3F1LA 2OAEA 1I5RA 1H5NA 1RJFA 2O3SA 3L8YA 3N2NA 4G1EB 1WLSA 3GP5A 1ZOIA 3ZHUA 2WKRA 3M6IA 1F20A 1U3TA 4PPNA 4PV7A 3VH2A 2PN1A 3QXSA 1SXJD 1AC5A 5BW5A 4GWLA 1K88A 5EZYA 5EJ4A 1N5MA 5BYKA 1E66A 1KJNA 2CLIB 2VQFB 4C7JA 3ZU5A 1JX6A 4GZLA 4B85A 4EGSA 4GL4A 1KQFA 1T5DX 2XRYA 1G16A 2TMDA 3GLFB 1RXVA 1X7DA 2YRFA 2PKYX 2GF2A 3N2ZB 3HBJA 3OC6A 1T0BA 2OORA 4JIGA 3D5EA 2EC5A 3WNZA 3C3PA 2J45A 4ARZB 1RAGA 3HJFA 1TVEA 1SN7A 2WVAA 1Y34E 4HWOA 4JA0A 4OHOA 4ACAA 4BFWA 1B8PA 3TQFA 4AO7A 1BIFA 4HAIA 4EQ6A 2WIDA 3WJ7A 2PZFA 4CGYA 3OTOB 3OI7A 1H9AA 1BJKA 1QKJA 2REXB 1X9IA 1AE1A 4A8PA 2VQDA 1Z7YA 3IAS6 2A9OA 3FVTA 1OWNA 4RV5A 3ESCA 4QDOA 2JVJA 3GRVA 5FTJA 4O4JF 4DR6C 1JS1X 3W9UA 2HW8A 3NHFA 3G5AA 4LTMA 1H5QA 1I7SB 3BHJA 2QM3A 3IO5A 4ZVKA 5EMHA 2H16A 3S5JA 5CB6A 3ABOB 1ZCBA 1WB9A 3D3KA 3AUJB 1ZH4A 4ZHQB 3A9RA 3WDMA 1IBLC 2HLPA 1RJ9A 3Q8KA 2CDBA 1FYFA 1XF1A 2PMKA 3ILSA 3HUEA 5M29A 1QM4A 1XYVA 4NBNA 3QMVA 4XVHA 2V5AA 3FJYA 1ZR2A 3VR5A 2WAMA 3C70A 4BXOB 1GTJ1 3EEIA 4QEDA 1F7UA 1OTHA 1XA4A 3NRCA 1AKMA 1NXXA 3SIXA 2AEFA 1UFOA 1JIQA 1M6HA 1T6NA 1THTA 3D8TA 1A5BB 3Q0IA 1R0RE 4QPNA 1IJEA 2AH5A 4UEOA 4CTOA 1ZN7A 1TAGA 4LSZA 4QYXA 3AVQA 2ZIXA 1YR9A 3LBFA 4MWZA 1XAGA 1BOOA 3E5MA 1SU4A 1ULTA 4GQAA 4DIKA 3T5PA 1XTRA 3NP9A 4GPBA 2OFFA 3VOAA 5DT2A 4NZPA 3A9WA 5K6AC 3LBAA 1UJMA 2FMIA 2W2LD 3CPJB 3CUWA 3DF7A 1AY0A 4KGDA 3BIWA 1QYDA 2H0RA 5AOAA 4DJDC 3HCWA 3WLQA 5JTTA 3HKDA 2F55A 3GNTA 3OF2A 1AUVA 3PVZA 1FXWF 1QAMA 1KZHA 1XDZA 1TO6A 3UJDA 3WRYC 7MHTA 1YZTA 3OJFA 2EDAA 4RLFA 3SC2B 4EYGA 1NW9B 5KYXB 3KNZA 3V48A 1KP2A 1G21E 1B7GO 2R6HA 1U7WA 1PFQA 3VR0A 3AEKB 3DBLB 3PFNA 3T7DA 4MIOA 1EK2A 4OJTA 1FLAA 1YCGA 1ZQ9A 4WDRA 1OV4A 1G0NA 3IHTA 4K8RB 4L0CA 3B78A 5I7SA 3EZLA 1QF6A 5IBQA 3MRTA 1WSBA 2JGLA 2Q50A 4B6RA 1UJNA 2W4MA 4QBKA 4UUMA 4YONB 3G9QA 5IC5A 5A5DA 4LF9B 1SHKA 2JF0A 3TDEA 2CZCA 2NO1A 2Q9AA 3DFMA 1ORRA 1T9BA 2PBFA 2QNBA 3L84A 4OO3A 1UC5B 2VRBA 3B60A 4NJMB 4BN5A 2OYSA 4U2EA 4ZZ2A 2CYAA 1PJSA 3G1WA 2VXCA 2GILA 5SYMA 3W1VA 1IBRA 4B83A 4S1WA 2PRSA 1R88A 2P2SA 1OMOA 1JDTA 4BUZA 4LI0A 5C0OE 2ZZMA 1U4OA 1XALA 2I4TA 3BXHA 3FNEA 3GCXA 4NYMQ 4AWAA 1UZLA 4DXDA 4LRSB 3GFOA 4JAVC 3AVWA 3KLMX 2H2GA 4ZRDA 1ZGZA 1L5MA 2BFBB 2JIMA 3GJSA 4QPJC 5FXMA 5MN6A 2RGYA 1GRCA 2C9ZA 1Q12A 2XW6A 4X62B 4CMBA 1XVAA 2WG0A 3KE9A 1M8JA 2V7XA 5DFAA 3GA7A 3RRBA 3GLUA 3HKEA 3T52A 1IWOA 4DCSA 4NDNA 3COZA 3H97A 3A9CA 3N2KB 4ND3A 3FSGD 4NBRA 3WHKA 2OP0A 3GW8A 1W581 4KMRA 3DZDA 5THKA 1K92A 2D3TA 4GO1A 4S1NA 2QR2A 3NATA 3VYSB 2O1EA 3BJMA 1XD9A 3KEQA 4ZAYA 2DQZA 1DT5A 1VHLA 3K8ZA 3QNMA 1KAHA 3JQDA 5FUVA 3U60B 4ANFA 2PA3A 1ZM9A 1UBJS 2HCRA 4QOEA 4ZDKA 4GM0A 1AXEA 3UXYA 1TMOA 4QGHA 1Y82A 4TT8A 1J1IA 1CTQA 3AHCA 3IPYA 2B8TA 2JGAA 4YH1A 1W9HA 2WA1A 3I2GA 4XM2A 3SJ7A 3TDNA 2HHHB 2ZTHA 3V6LA 2XWQA 2DYKA 3HO6A 1KYYA 1YULA 1MO3A 4JLMA 4RMIA 4X9XA 3PRHA 3GI1A 1EEHA 2Q99A 5HTKA 5TIIA 1GFIA 5CVJA 3U16A 1U7HA 2B8EA 2PZEA 5CH8A 5I7RA 4DR5B 2YJTD 3LWBA 4HDKA 4LSWA 3S27A 3P0FA 1TH5A 3ABIA 1OZFA 1GKKA 5CX4A 1Z68A 3FNIA 1I32A 1KOJA 4WN9A 5KWVA 2PUTA 3RB8A 3FSJX 3IDAA 4P22A 1HDCA 1SELA 2CNDA 3HKCA 2HJVA 5ER9A 3SQXA 1O93A 5DX1A 2JBAA 2DFKB 2R96A 4BBZA 1JYFA 3GR0A 2DKNA 3MBOA 4RZIA 4JGGA 2IZ1A 2QZPA 4L76A 3U9LA 1GILA 2VCEA 4KFTA 3AIKA 2B8NA 1OVMA 3CW9A 1NT4A 2CL5A 4D98A 1JEQA 5ALGA 3QX3A 3EQ6A 2X0EA 2PUJA 1SVIA 2I67A 1TJYA 2B6NA 2XYHA 4C0XA 3LW8A 4J7AA 2OESA 1KVSA 2Z0MA 2WK1A 3HXQA 4XSHA 3VPCA 2ZAYA 2LBPA 2QL6A 3RYHB 2CY0A 1MT0A 3UJ9A 2ZBRA 4DY6A 4JOBA