2Y27A

Crystal structure of paak1 in complex with atp from burkholderia cenocepacia
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
b'LEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGTTGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHENYLACETATE-COENZYME A LIGASE
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Ligase
total genus 149
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y27A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y27A01
1LCIA 3A9UA 4G36A 2P2JA 1AMUA 4GR4A 4PZPA 5BSUA 3IPLA 3QYAA 2D1SA 4G37A 5BSTA 4RM3A 2QVXX 5BSVA 3IEPA 4FUQA 4RLFA 5E7QA 4EATA 5KEIA 3U17A 3T5AA 3GPCA 4OXIA 5GTDA 3DAYA 2V7BA 4D4IA 1PG4A 3B7WA 3VNRA 5K8FA 4GR5A 3EQ6A 1RY2A 3E7XA 4FUTA 4GS5A 3O84A 3T5CA 2P2QA 1T5DX 1V26A 2P2MA 3PBKA 4DG9A 5D6NA 2VSQA 2QW0X 3FCCA 4D4HA 3CW9A 2D1RA 3T5BA 3RIXA 3WV5A 4R0MA 1V25A 2WD9A 4RMNA 3ITEA 3TSYA 5K85A 4IZ6A 4D4GA 5BSMA 5KYVA 3G7SA 3WV4A 3LAXA 5BUQA 1YJ7A 3LGXA 3FCEA 4E5DA 4RLQA 3RG2A 3E53A 5BSRA 2VZEA 5JRHA 3DLPX 4W8OA 1T5HX 3O82A 4WV3A 4DG8A 4LGCA 4GXRA 3VNSA 1BA3A 3LNVA 3IVRA 5DV9A 2P20A 4OYCA 4R1LA 5IFIA 3NYRA 4RVNA 4IR7A 3WVNA 4U5YD 1MD9A 5BUSA 4GXQA 2Y27A 3IERA 3U16A 2QVYX 3E7WA 3NYQA 3CW8X 3ETCA 3NI2A 4R1MA 2D1TA 1ULTA 5KYTA 1PG3A 3KXWA 3IESA 1MDBA 4ZJZA 5BSWA 3VNQA 5BURA 2P2BA 3DHVA 3R44A 1MDFA 3C5EA 2Y4OA 3L8CA 4D56A 5DWVA 2Y4NA 3A9VA 4ISBA 4RVOA 2QVZX 4RM2A 3O83A 4M46A 2P2FA 4D57A 2D1QA
chains in the Genus database with same CATH superfamily
2P62A 3T3MB 5I4IA 5AW7A 3MTJA 1AMUA 1RXEA 5EEGA 4L0MA 5KHAA 1JHYA 4MVCA 5CX1B 3AWIA 4CUZA 3H65A 4UBLA 2IGTA 1ISRA 1GKLA 1A9SA 1J56A 2L42A 5EEHA 2ZB3A 4ENWA 5KX5A 4YRMA 3GG2A 4NJOA 3FKSA 2QM8A 1GQFA 5AW6A 4NBSA 2VS1A 3K1YA 4RPJA 3NAGA 1ULAA 2B4QA 2OUKA 3JVDA 5B6IA 2I4OA 2ZR0A 1DKRA 1NRWA 4MEAA 2VHEA 5AJXA 4L4ZA 1EDOA 1JKXA 2C5AA 3ZQ4A 1GPMA 2E8FA 1Q95A 4X45A 2C2XA 4ZCQA 2IH2A 2VNJA 2VEDA 1REQB 4RH3A 1XQXA 3O4RA 3PHIA 2XQIA 3DD1A 3GJXC 3MT7A 4G97A 4OCZA 5F52A 4FYJA 2AW5A 3KD3A 5D5PA 4KB5A 2Z3ZA 3RI3A 1PL7A 2JPDA 4MVJF 4KW7A 4AMUA 5JNWA 1SZDA 3CIOA 7AT1A 3BULA 3ILSA 5CLGA 5HP4A 1XLWA 3D64A 3GCXA 2JGFA 4XOIA 4AI6A 3D8UA 3CKKA 4MVJG 4IIJF 5C4GB 3W06A 2A94A 4B76A 4KNYA 3P1JA 5JW6A 5FO1A 1PL8A 2PKQO 4AXXA 2EGHA 1O90A 3ZX5A 4KXLA 1FLAA 1J1IA 1KH2A 2CEAA 4DREA 3E7FA 1A96A 2WLSA 4YRTA 2GPWA 3A4LA 1Z7YA 2IS2A 1ZM7A 4GBED 3TLJA 1PR0A 5ES4B 4QVGA 3EG9B 3IELA 3S70A 2XMSA 3OQ1A 5COBA 5LMUC 5B6PA 1GXSB 1Z68A 3QKSA 1F8FA 4JNKA 4N9WA 4YQEA 2YS6A 1P5JA 3RYHA 4BO2A 5IJ9A 4N3CA 5H68A 2ATIA 2DPXA 1U4NA 1US8A 4BN0A 4DW8A 3OURA 4RS4A 1F2TA 2QXTA 3ZUGA 1CU1A 1HFKA 5K8CA 2M32A 1SVLA 2K4MA 3EPPA 1AURA 1JFVA 1VHJA 3NV9A 3C6ZA 3SSMA 5B2FA 4HS9A 2I1LA 3ZDBA 3WLSA 2O14A 4PF1A 1RT9A 4W7IA 3ROGA 5JBNA 5A0TA 1BD3A 3TUIC 4BNVA 3IULA 3MGKA 2I6FA 3T41A 3PUIA 3GVXA 4NENA 1NXWA 4DJFC 4MGKR 3MMPA 5D85A 1G20E 4E1BA 4GOKA 4QQNA 5E6SB 3EPKA 2Z2JA 4FLFA 4Z8YA 5CDGA 1L4UA 2FE1A 4PFJA 5JXJA 5KQLA 1I0IA 3T35A 3JCZA 3GLIE 4Q4AB 2G67A 3MJFA 3PDUA 3NEJA 4AVYA 3DZHA 3JAWA 2F1KA 4PNHA 2D13A 3WLQA 3ROTA 4PHFA 2C7PA 1SEPA 3GVPA 1ML8A 4RZ3A 3LM8A 4Y2HA 2ES4A 1VLMA 3D3EA 3L06A 2H4ZA 3AJEA 2XUIA 1SQ6A 4EUHA 1S4MA 4GGOA 3SHFA 1JFFB 4D57A 1KS9A 4FQ5A 4GEKA 2JJ2D 4J0HA 1DRKA 4FJ1A 2IODA 4JBLA 3L04A 3JQBC 3G2NA 4RKQA 1LD3A 1RI4A 3H19A 2F7SA 4LYHA 1PT6A 1FNDA 2ZAMA 1PGQA 1O6GA 1K98A 4G25A 4JUCA 4OA5A 5CHEA 4DY4A 3AVXA 1R12A 2FPRA 4DPLA 2Q3FA 3WDKA 2X8JA 3MCVA 1PLJA 1EDEA 4O1HA 1C8VB 2GEJA 3AW8A 1UAAA 1RI5A 4FYYA 4XCVA 1HSZA 1H05A 1CUBA 2HT6A 4ZT5A 3GELA 3K0BA 1N5IA 1BH2A 4HYQA 8ABPA 1BSVA 2G1PA 2K2WA 1XCOA 2KLBA 3W4KA 1ZGJA 4IIJB 4U1RA 3ZJ4A 1YD7A 2C07A 3BE5A 4UBOA 1DJLA 1JEOA 1YZGA 4UD6A 2YQ4A 3KSAC 1ZA1A 4IQ4A 1M0WA 3TLYA 3MW8A 4PWYA 1ZINA 2ADMA 3R0ZA 2P6MA 4F38A 4HD8A 2VF5X 3KS9A 4IGKA 1VDZA 2FCRA 4PO3X 5FBQB 2N1BA 5C37A 1PX0A 2RG1A 1ZO8A 1RI3A 2WNSA 1GRCA 2DSNA 4DCTA 2J8ZA 3JWIA 3O74A 4HNAB 4JGGA 5DI3B 4Y2PA 2ZE8A 2ZJ5A 3GNTA 2J1LA 3DO6A 4N5NA 2P9TA 3C1OA 1PYOA 3Q12A 1QUEA 1G21E 2LVBA 3DTVD 3DXXA 2BMEA 3DCJA 4V39A 3D7NA 4JOCA 3U7QB 2C9CA 2GOYA 3DF9A 4QO8A 4Y2GA 3OFKA 2ZE7A 2QRUA 2XTZA 2DQZA 3FYTA 4PPYA 4G84A 3H2HA 3GMTA 2XJ4A 2E3JA 2OYRA 3SJUA 5BSMA 2MDTA 3CZ9A 1PEAA 2ZU6A 1UJ5A 4KR9A 3VOBA 4DXAA 3SS7X 3V8PA 5TNXA 5KWEA 5J58A 3CVYA 2QE6A 4JVNA 2VF7A 1DBIA 1E63A 2JJ2A 4MKGA 3TE6A 3MBIA 1MORA 4O0LA 1BS9A 4UASA 2W0MA 2VHCA 5CTJA 4EG8A 3V7YA 5JS1A 4GG1A 3QVSA 1OAAA 2QAGA 2RGNA 3A6FA 3FVTA 4NATA 1KZ7B 1HXHA 3KLPX 4QBGB 3S7ZA 2O7QA 1C80A 4P54A 4MCIA 1JAIA 3A28A 5C0OE 3A4MA 1KKMA 3ROKA 2W2KB 2X77A 2ZW9A 4TYWA 1P7YA 1UFQA 5HKKD 1Q83A 5K3AA 3TN7A 2IBTA 1TT7A 2G72A 2ZUEA 4DUYC 2GTPA 3ISVA 2G3YA 2PAFA 1NE7A 1Y80A 4MV5A 3SLRA 3HJRA 4YP7A 1UPXA 2J9YB 4ZI5A 4XVCA 5EJ8A 2A5GA 2I4IA 2OFWA 3M1IA 3U3KA 1M5RA 3JQEA 4M0PA 5HIIA 4INOA 5B3JA 3WYGA 1OWOA 1SUSA 1VHDA 2KE5A 2OCKA 2QRMA 3MWFA 4LF8C 3DHYA 5EP1A 3WK7A 1KS2A 2XI4A 5H81A 1W8DA 3EGXA 3H05A 2FWJA 1R7RA 2Y3IA 3DTVA 3ZWCA 3G7NA 2FFJA 1T3GA 4XPIA 3MWDA 3NHBA 1U28A 3H83A 1M2NA 1SHKA 2YYSA 3CH5A 1ECCA 4OGLA 2GK3A 4NYJQ 1M0TA 4ZYXA 2Q5JA 3BMXA 4KV7A 4B7UA 1QRDA 2ZYTX 4Y2JA 1BN6A 1L5QA 3H8WA 4AUKA 4EGJA 4ECEA 1BDMA 1P2SA 4K9OA 4F96A 2CGEA 4BNDB 4FGLA 2RBKA 2C57A 3LGAA 1KY2A 1EXWA 4D4MA 3EUFA 2POCA 1JG3A 2G6TA 2IYPA 5HOEA 4HQKA 5A1GA 3SX4A 5M29A 3UXYA 1IUOA 2ANBA 3JVEA 2Q6KA 3KWMA 3PC3A 5CDTA 3FWYA 5JDCC 2QRVA 3QF4B 3DEYX 4GVXA 1SKYB 4UAGA 4REMA 4J1SA 3SQDA 5ICGA 4EQ6B 3CB2A 1Z35A 3IVMA 3R74A 5CCBA 2QWXA 1A5SB 2WTNA 2ZS8A 3SF8B 4PO9A 3WBJA 4YMSA 3ZWNA 1QCYA 2PT7G 3N2ZB 4PRZA 4A23A 1ZHOA 5EWJB 1ZRNA 2QRZA 3LY9A 5ARDA 5HKKA 4F2GA 4M86A 1U4OA 5EGNA 3LKDA 2IWRA 3AJRA 4BAGA 4YAGA 2QN1A 3SDSA 4QQ8A 1KO4A 3OT1A 1FSZA 3GWZA 4H1VA 2D5BA 5EKSA 4YR9A 3B8HA 3FVWA 1VCIA 2FP3A 2W37A 4MSUA 3A36A 1XT6A 4OJQA 3IB6A 4E1AA 2IDMA 2YMPA 4HZGA 3VUEA 1GR0A 1LS1A 3SSAA 4YRLA 1JEYB 3B1VA 2WNHA 2QN9A 3G8CA 3H8SA 1ZPDA 3KVVA 5CEFA 2DHMA 1K3FA 1RHRA 4FYIA 1YDMA 2QX4A 4MTLA 4NS1A 1WNFA 4GLLA 5JOQA 4B31A 4RNDB 1JDVA 3WK5A 4EGCB 1W7AA 3UMFA 2CJFA 3AF6A 1F38A 2UAGA 1MR3F 2R6FA 4OP1A 4AW9A 3PQ5A 1CUEA 4MYTA 4CF3A 2D6FA 1AQYA 3RJ5A 2WWGA 3KXIA 2WTAA 2ZUBA 1QGOA 4PBSA 5ALOA 3LRXA 2Q1TA 3LK7A 2BI7A 3N87A 4EVIA 4F8JA 4QUDA 3HBLA 3AINA 2R5FA 3T3IA 1QUFA 4JMLA 5BORA 3C7TA 1MVNA 1NRXA 3SIRA 5CXUA 1AHPA 2MR5A 3D81A 3R5JA 2HCRA 2VAPA 3WSTA 4JR0A 5AUPB 4E30A 2N46A 2HZBA 3RVDA 4KSBA 1X80B 3FA2A 3V7NA 2WIBA 2IIQA 1NL3A 2JBWA 4D6YA 3ZVMA 4CQMD 4TKUB 1AK2A 1RHUA 4KX3A 4C7JA 2WICA 1S9DA 3F97A 5AHXA 1F9AA 2I1QA 2UUAB 2ZZKA 3IIJA 5KKCA 2VYVD 1XZQA 1P4EA 3P2KA 1G3MA 2VWHA 4N18A 5K8JB 2CU6A 1QOPB 2DGDA 1B16A 2Y1DA 2V4UA 3HXLA 4OSPA 4MCAA 4R3WA 1FFHA 1XAIA 4ZCTA 5F9FA 4JZKA 2ERYA 3DHVA 1T5SA 2PLFA 3OPMA 5DMXA 3G2PA 1DL5A 2G08A 4MWZA 1LA2A 4OMFG 4JBXA 4D56A 3KTDA 1U2DC 2XZTA 2WE7A 3HACA 1PFUA 4MVYA 3MCZA 5KJCA 3IX7A 1ZP6A 5CURA 4D0NA 2AZXA 2NZWA 3N2IA 5G0UA 3AG5A 2BM1A 1W96A 1LC3A 4ZOQI 4Y6QA 1WD5A 2QYOA 4IIBA 1JJAA 4XEHA 4B5LA 1VJ5A 4F9TA 3EW9A 1SA0A 1M2OA 3BTVA 3DE6X 3FWHA 4E2XA 4YCDA 3MUNA 1ODCA 4IIHA 4Q37A 4YUVA 1C7FA 3CN7A 3FKQA 3MGAA 1XNQC 1F9EA 4OIFA 1GCAA 4K0KB 4PIPA 2G8NA 1FOEB 3OFJA 1GZ4A 4B3JA 4YYEA 3EEFA 3AYXB 1BRMA 4U6QA 2AN4A 1E6MA 1ODFA 2DMRA 5HX7A 2QLJA 3HJCA 3GV0A 4IOMA 4MW1A 3THSA 4OUKX 4CQMA 1MEJA 4UEJA 4CLXA 3PX2A 4Y2TA 2VTEA 4U0JA 4EF6A 1BXRA 4X95A 4ROSA 1M8JA 1O9GA 4MLZA 4WW0A 2PGAA 5TGDA 2XVAA 4RFSA 1QR2A 2VYVA 3AFMA 4I1RA 4YRKA 3D5QA 2UUCB 2XGJA 2GDJA 2GCPA 3M9WA 2CJWA 1P9OA 3PDCA 2OD9A 1D4OA 3RM3A 1BS1A 1WB4A 2ZBFA 2OHVA 4QDTA 1A9QA 5KX5F 1I94B 4H1HA 3HKDA 4PFQA 3EVBA 5SYMA 3ZE7A 4Z4HA 3ZV3A 1C9EA 4X8HA 5F35A 1V1MA 5A5GA 4MS1B 2QM7A 3HL0A 4C2AA 3TTYA 2JW5A 1XR3A 2QUHA 3ONWA 3W5AA 1BDHA 4FGJA 4WNCA 1XTTA 4FX2A 4CDRA 4ER0A 4IGIA 5C5IA 4DTCA 3KB8A 3IUYA 2OGSA 4TMZA 2O4CA 3CUWA 1JTEA 2ZTMA 4Y2QA 4DEYA 5K03A 1DTWA 1CUJA 1SCBA 3NHKA 1G8GA 4LECA 4RWEA 5GZ1A 1LDBA 5D87A 1E3EA 2DFDA 2CL0X 2HU2A 4J4BA 4RVGA 5IM5A 1AV6A 1P9RA 2XOKD 5CFPA 5ADZA 2LDXA 3NDPA 4LF8B 4ZXPA 3ZDCA 2OXEA 3A6DA 4PYOA 5CCXA 4DR1B 1X1RA 4ZAVA 3FBTA 3TGWA 1RPZA 2JGEA 3D4LA 5K05A 2YXNA 3KZVA 2COEA 3SJAA 3TIVA 2UYQA 4UMEA 4U2KA 3FWZA 2JB9A 4EARA 3GDGA 2JJMA 4R7ZA 1ADYA 4V2UA 1Z0SA 3PNBA 1MX3A 3U0VA 2GJ8A 4BNZA 4EMSA 4E3ZA 1MT3A 5BN3B 2ONKA 2P4QA 1TMGE 3QVKA 3OLYA 5TS2A 4DHEA 1C0IA 2VA8A 4HAOA 1ADCA 2DBVO 4A36A 2IQ5A 3L0OA 3L7JA 4R9VA 1ZFNA 721PA 1KVQA 1ADGA 1VL0A 2GBFA 1SWWA 1ZK1A 4LRSB 1FFWA 3LC7O 1PKEA 4LHZA 2Y68A 4IUYA 3ZEIA 1C3OB 1JAXA 3MINB 3ZTWA 2OG2A 4L8GA 2ZI9A 1ZMRA 1TK3A 3SHWA 3FB1A 4M4SA 2ZJFA 5SZKB 1EFVB 2P5YA 1UF9A 3K1AB 2Y4NA 4X6UA 5B6JA 1X7YA 3CR7A 3DC2A 5DYWA 1CERA 2BKUA 2QAGC 2RGNC 1F12A 3RU2A 4B7AA 4ZI3A 5B5SA 3WA7A 1T8PA 2VBFA 4DV2B 5LZ7A 3LZDA 3DAFA 3OX3A 1OLSA 2PUCA 2LNDA 4PYLA 1Z17A 3SNHA 4OHBA 4MA0A 4BKOA 5F2KA 2O5EA 3ZU3A 1PUXA 1SIOA 3P94A 4YRBA 1KMHA 2IYOA 3LXUX 2JC3A 3SVTA 5A2QD 1M33A 2C4KA 2XE6A 1UFKA 2ZIEA 3C5VA 3DG9A 3EZXA 3LA8A 3UMRA 5LQSA 1SBYA 3OWOA 3VVCA 4W6QA 4EJMA 4ER7A 1KI6A 3LVFO 4QHTA 2PJRA 1J5XA 2QIPA 3AVWA 1HPLA 1SQFA 2WWWA 3KQUA 3HM2A 4G8JA 5F21A 2XECA 3NVAA 4M3NA 2ZYSA 1TYBE 3BFKA 3NHRA 5KX5B 3DBHA 1FUYB 1J0AA 3RR2A 3FYUA 4JCOA 4EZIA 1R8QA 2EP5A 2R7LA 2HFKA 2Y1FA 4WFIA 5TVKA 3R1IA 1KHHA 2GVZC 3WLFA 1N5JA 3E8MA 3VPAA 4KGVA 1NNUA 2YWFA 3IOCA 3CO5A 3H2BA 1GZVA 2DWPA 1VPLA 5EA2A 1UKKA 2QUZA 4HDAA 2A33A 1U28C 4HI0E 1PD1A 5GQSA 5TJ9A 3RGGA 2ZT7A 3TNYA 4O6VA 4TT3D 3ETOA 5DB4A 1BDIA 4M0EA 5I7OA 2YWGA 1CP3A 3QWHA 1OFHA 2D28C 3ONEA 4KXXA 2GXSA 5JTTA 3M6UA 4OXYA 4LBVA 4OQFA 5EJEA 1U8UA 4GX1A 1BAPA 3O3NB 3E9YA 2XMCA 4UQLA 2ADFA 221PA 2I3DA 1KI8A 3SMQA 3VV2A 2A9KA 2B3TA 1BROA 1MJHA 3UJBA 1R16A 3DP9A 1R4ZA 5BXQC 1WPGA 1NBAA 1MJGA 3PHCA 3H9QA 1BVUA 3ETDA 1PE0A 5JZOA 4LZPA 3PE3A 4LGYA 1Q3HA 3NNNA 1BHSA 4M6WA 3WBBA 2Z1MA 4IILA 4WBSA 2F4VB 1OTHA 2VHXA 1I24A 5KS2A 1IUNA 1QGZA 2I2BA 1NJ1A 5A2QA 4GRIA 3ROXA 1VXOA 5FR2A 3MGBA 4QHYA 3U4CA 2ZBDA 2PQ2A 3PXXA 2P75A 4V3CA 2E89A 1V48A 2L69A 1B8OA 3QKSB 2PX6A 3DCIA 4URXR 3R3VA 3BYZA 2AUTA 3RYHB 3K3PA 4IIFA 4V0MA 1ZVKA 5GJWC 3ZQUA 5IJ9B 1QRUA 2IYSA 4GM4A 5EE1A 1QQ5A 1AQIA 1SVNA 4PG6A 3PQFA 4BE9A 2PQ0A 4OHMA 5JRDS 2YHBA 4TLMB 4ZA2A 2ZANA 3CSSA 3D3QA 5JIBA 1DQNA 2BOVA 2EQBA 3HY6A 3EZ9A 4R51A 4UBKA 2NUTA 1II0A 2WJAA 2QRJA 1U1EA 1I9GA 2RIPA 1J49A 1V0JA 2UUOA 3A1CA 3QFTA 4JJIA 5DGTA 5J2TA 2OV6A 4FBLA 5KDLA 4NENB 3I5XA 1RZVA 2XR1A 1XUOA 1CZNA 1V37A 1KPGA 1BFUA 1YZTA 2Q3CA 2ZG6A 3ITKA 2C8LA 2VPWA 4AIRA 4L4XA 2XWJI 5GINE 4H17A 2F1OA 3TGLA 4OD0A 3AKCA 3DZIA 5C4MA 2QNRA 4FQ7A 4L5IA 2IUUA 3L01A 4A26A 1EUZA 3JAWB 1ZX1A 4KPUA 4QARA 1XK6A 4I9UA 4Z9FA 4G4IA 1LKZA 4QC2A 1QVWA 1MJFA 2QSZA 3GJQA 3HGQA 5GJCA 1M2GA 1ICIA 3EMDA 4RJKA 4BMCA 4G36A 1SHUX 2NPOA 3SCZA 1ESDA 1RM4A 4PZPA 1XG5A 1M1ZA 3L7AA 4ZTUB 2D1SA 2PSHA 2WKPA 1USGA 2N42A 3A9RA 3AI1A 1FYXA 2Y1XA 4PGFA 4ZANA 3ROEA 1IWPB 3LCVB 4AZSA 4KLAA 1X6VA 4F3YA 2ASEA 5HWSA 1P6XA 1K75A 3F8TA 3AEQB 4GVLA 4JQZA 2IUEA 1Z5UA 3R7BA 1E3QA 2PRSA 3MOIA 3O94A 1PHRA 2F59A 4LMAA 4NOJA 4O4HF 3N2NA 2PGNA 4BIIA 2G25A 4B8ZA 3ICEA 4HQNA 3K5PA 3PROC 2JA1A 2Z6AA 4AMYA 2X8JB 1GAXA 1IE3A 3MSCA 3CQ2A 4IQ0A 2PBLA 2CDAA 3KEGA 2V9PA 3L6EA 4MS4A 5I9SA 3U3OA 3X44A 3ZWAA 3NKVA 5T8SA 2G7ZA 1C8BA 2IXBA 3I9V1 3LW7A 3FRJA 4XDHA 1TLFA 4EUSA 1HDIA 4L51A 4MWDA 4XKJA 3LQFA 3T4XA 1GD1O 4XWWA 4CTOA 3UB4A 1Y9DA 1MB4A 4GPAA 1EM8A 4PONA 2YJNA 2OHHA 3AVTA 1AKRA 2XCUA 5CH3A 5E3JA 3E1GA 1JNYA 2JFNA 4EKIA 5ADHA 2HJWA 1CP2A 4O33A 5HIAA 2CCJA 3AKEA 1GZHB 2Z2IA 1O0SA 3BWCA 1DIBA 1BEUB 3B82A 2I8AA 3NJRA 3VSCA 1QB7A 2GZ2A 4LV6A 4O8ZA 1CEXA 1N1GA 2JKZA 3ABZA 4CEJA 4AF6A 1TD1A 2CVPA 2O2JA 1NBEA 2F9FA 5T4BA 4WZBE 3WZMA 2D62A 4ZOCA 9ABPA 3EOAI 3DE3X 4FYKA 1WTCA 3FDZA 5DT2A 2XUKA 2XADA 3IKJA 4RDHA 4M1QA 4UCWA 5HRUA 1NURA 2Y1GA 1V35A 3O4JA 4IHQA 4P92A 1H94A 2V0CA 4IOKA 3PQ8A 3K4QA 4RCVA 6ABPA 3D43A 1DQYA 4GPD1 2BFBA 2CKDA 2EKLA 1IBLB 3T0IA 4FWTA 2V1XA 4BKQA 2IUYA 2C3OA 2XX3A 4PPGA 1GA6A 4D0LB 3H75A 1QGDA 4JLBA 4JFRA 1TK9A 4C04A 3PU6A 5F5NA 5JAZA 2IVFA 4MTNA 3M82A 4LXHA 3WYNA 2O1WA 4ZGWA 3K9FC 2BFDA 1SUCA 1DO2A 1HFEL 1TUBA 2C2ZA 3WLEA 1NZFA 2HH9A 1GLNA 1YR7A 2ZSBA 4NZPA 1Q7CA 2BBTA 2WKQA 4R05A 3AX6A 4WXHA 2QVYX 1L3IA 2QVGA 5ARCA 5JAUA 5I5GA 4R2IA 2G4LA 2XIQA 2PT6A 2PL1A 3PPYA 3L18A 4Y1GA 5AKHA 3STUA 3SS8A 3KEQA 1ETHA 3ZJ5A 4F12A 4NK4A 1SOWA 4NFSA 4PC1A 3DE2X 1BU8A 3BFXA 3LQ4A 2IKSA 1OPXA 1P9LA 1XALA 1HNZB 2MIIA 4YWHA 4V1CB 1CY8A 1QGYA 4ZARA 3U56A 1C9DB 4EG4A 2NIPA 4RV4A 3WK4A 1E18A 1FFXA 3FCUB 1MJ5A 2W6NA 3IJRA 1UPAA 3NWOA 5AM1A 4O4HB 3EGXB 1Y9AA 4OYRA 4JI4C 3R5HA 3FIJA 3O7WA 3MTGA 3BXFA 5LB2A 4QQRA 3DTVB 5AUOB 5EKXA 2TMKA 3VR1A 3ZS9A 3OEWA 2P2ZA 1WVGA 2LKCA 3C0KA 3M4XA 1U9IC 3WHPA 2F62A 3ZE2B 3ZWBA 4BQFA 1PZHA 4PUHA 1PT5A 4GW3A 4M1YA 1XC7A 4UEOA 1JHAA 2JBAA 1ESMA 4D3YA 2PEZA 3VOTA 1LEHA 1TYZA 4NH0A 4N76A 2IS1A 1G7CA 2ZZMA 3QVJA 4UZSA 3OAAA 2YUIA 1F8GA 4REOA 3FPKA 4X0EA 5COAA 3LO5A 1Z8DA 2BF4A 2R5NA 4MEBA 1ADBA 3FDFA 4OK3A 3NHYA 4DEVA 4YCJA 3ZK9A 3P19A 2C5GA 2QRVB 3IKLA 4L27A 5JU6A 2FDCA 2AQIA 4XASA 4EZBA 4WQMA 4EJ2A 4EF5A 2WYIA 1FMCA 1XPUA 5JAMA 2IHYA 4D42A 3JQGA 2QRNA 3NC4A 1PGOA 3KVOA 3L40A 2A0KA 2WJPA 3DZDA 3IPAA 1YJCA 3Q7EA 2BKLA 1KI1A 3HBFA 3MTAA 4QBFA 3O03A 4BX3A 3R8FA 2EIHA 5HZMA 2WVJA 1GVHA 5ICEA 5KQMA 5JECA 2HO4A 3W4IA 2JK1A 1G5TA 1UM9A 2QRQA 3IHWA 3CLSD 1I7NA 1PJTA 2YMLA 5SV2A 5TRTA 2AOUA 4F7WA 2O2YA 5CA0A 4OX9Y 3TZEA 5BRAA 1GADO 1Q7EA 4HQLA 4RCZA 5JMPA 4F4JA 5EMMA 4MDFA 2XNJA 3HKBA 2Z58A 2P2NA 2QD4A 1P80A 4RD6A 1GGNA 5CXQA 3LAXA 5C1DA 4WJZA 1YZNA 4KXMA 5AK3A 4HQRA 3QUAA 3RVKA 3UT5A 4EW1A 4R0NA 3B3JA 1KU6A 2OENG 2YZGA 2F1IA 2XDYA 2ZUTA 2GNOA 1H66A 3QVWA 1AKMA 2C3UA 3NGLA 1SUPA 1KEVA 1PDWA 4TMTA 3KOYA 1AN0A 4G0MA 4XGRA 1BDBA 3HEBA 5FBLB 3R0IA 4O8CA 1TJ5A 4AS3A 5LM3A 5EAIA 2J3EA 1SMKA 3AF0A 2WV9A 1WE2A 1FNBA 1J7JA 1YE3A 2ZRJA 4F7DA 1NHWA 1LLCA 4JI1C 4IFBA 4GYYA 5IJWA 2OV8A 1Y6QA 1K7CA 3AR7A 5DGDA 5KAMA 4GH5A 2O1SA 1RWKA 3MXOA 3VSBA 2G71A 3JXEA 1MD9A 2UYYA 3OCUA 3CRMA 2A1IA 4TXJA 4RMHA 2JCSA 4BJ1A 3JY6A 4RTRA 2HA2A 4IIEA 4BBPA 1YTLA 4FYXA 3X1WA 1M6XA 5K0TA 2D1TA 3FTCA 1JYEA 2MJLA 2VRBA 3PNSA 4GC9A 2CDNA 1S8AA 2QRHA 2XOXA 1D6JA 4C6HA 3IDZA 3KC2A 4DT1A 2R751 4HGOA 5H9WA 1QYRA 4K5QA 2O0HA 4FZVA 5KNCA 3BJMA 1I4EB 2FOLA 3D3NA 1KR2A 1YBVA 2FYTA 4BP3A 3TK1A 1BJKA 4E5PA 5KWVA 4CL2A 4OB7A 1GRRA 2PGOA 2KWIA 1ZVJA 4NWIA 1BXKA 4W63A 1KJNA 2WT4A 4C3OB 3ZCSA 1RP7A 1YZHA 5A6SA 4OIMA 1VG0B 2RAFA 3N8IA 3RFUA 2MU1A 1U2QA 5T57A 1P2DA 5K2OA 4CIWA 2ORIA 3HMQA 2FMFA 3M5PA 5IC5A 1VC2A 3TSWA 5KOJA 2OB2A 2CLEB 2JRCA 4XCQA 1P0FA 1MC4A 5BSTA 2PEYA 2AJBA 2IHUA 3OPNA 2QG6A 4XIIA 2YCBA 4JYAC 1MU0A 1SA0B 1YHYA 4GZ3A 1ULBA 4EJSA 5LXTA 4HDRB 1XRCA 5BYBA 1UJ4A 3RCBA 4GI2A 4ENTA 2EGTA 1QNLA 1T4DA 3PWZA 4MQ4A 5K01A 1E6CA 1LLFA 2RI6A 1KOGA 3TRKA 1M6HA 1HDZA 2CDCA 3DXYA 3BOSA 3FHLA 2P2YA 1ZIXA 4Y6SA 4N4AA 4BB5A 4FMBB 3SICE 3BA6A 3NGXA 4KAFA 3RYIA 2YH2A 4BATA 4I8IA 3Q3CA 1DX6A 5FOUA 1HO3A 3HV0A 3QHQA 3S6JA 3VFDA 1IBMC 4A8JB 1WEKA 1T6BY 3N2KA 5UKDA 2YBDA 4R1UA 3DM5A 3LKZA 4CQMB 1TJYA 1VPWA 1QP4A 3OLCX 1QPZA 5AVSA 4HN2A 1BXRB 2IE0A 5FJIA 5BQPA 3BAFA 2VPTA 3LD9A 2A7XA 3AHGA 3HJGA 2DG2A 1QKKA 1VI5A 2CJWB 1SG9A 3VOAA 4V02A 4R9NA 1T9ZA 4D4KA 1KQNA 4RMGA 3PJEA 4P5EA 2UZ3A 3OKPA 4DJAA 4IZHA 1W4ZA 2D06A 3PFNA 4B74A 4E46A 5HIKA 1YB6A 4L4QA 3HKDB 2WMYA 3WKAA 3ORFA 5EL0A 4ALIA 2FXIA 2CZCA 1V1MB 1FLOA 5LYJA 5K2MA 4DYHA 3IAUA 1G5HA 1B8UA 4XRRA 1QVZA 4CPDA 1YKGA 2XUJA 5AOBA 3ECAA 4JQYA 4X54A 5F1KA 2GWHA 9GPBA 2RE8A 3U13A 2OHOA 3PD1A 1HETA 1NXOA 4P6VF 5A9TA 1L4YA 2BGUA 4BNKA 4E88A 1R0SA 3O82A 4LVUA 4M1WA 6LDHA 5FPTA 3GLGE 4PZAA 1U9ZA 1XAGA 2GNAA 2GESA 1G3QA 3HCOA 3L8ZA 5GONA 4F91B 4CM1A 2P20A 1DO0A 5JD5A 5E1DA 1P1IA 2E9SA 2ZYDA 2P3OA 4D9JA 1XJCA 1FX0A 2DT5A 4GM1A 1XRMA 4ZRDA 3D8BA 2DXIA 3HDHA 4UVEA 4QRHA 3L4EA 4ZC1A 4P7FA 2X0NA 4LFCB 5AOCA 1PNTA 5K0ZA 4YIHA 4ZCIA 3A6ZA 3N0VA 1NI4A 4TVBA 4YA6A 3V4SA 5DSZA 2ECQA 4GI3A 5JZ9A 2Q5LA 1RSZA 3WJAA 5LJLA 1GO2A 1A2BA 1X42A 3OU6A 1ISMA 4UDXX 2NSDA 4YUXA 2J09A 4FYVA 4QDUA 5KJEA 2P68A 2CBGA 3PHGA 2NV2B 3DKPA 3IP5A 5G53C 5TF0A 2FN3A 5BOSA 3H2SA 1T34A 4UNRA 3C5WP 4FKMA 3RFCA 2WUGA 4FGKA 1TM5E 3KOXA 4IDOA 4WY5A 3RSCA 2C9ZA 3FLEA 1BVHA 3ULKA 5JSKA 3NATA 2GHQA 4JI3C 1GZ3A 1SELA 5AE1A 1IRXA 3CC8A 5A0FA 3CH6A 5EZ6B 4CM5A 4KBGA 4QZVA 5KKNB 1N77A 3PC8A 3ZIUA 1FMJA 3IHLA 2WRZA 3BTSA 4B85A 1UXJA 2QX7A 2XD9A 1EK2A 5DYTA 2G7MC 3IOEA 3DGEC 2P6RA 1YA8A 4O2RA 4AAYA 1IMOA 2DBYA 2E85A 3RAGA 5B3KA 4ERXA 4W9MC 3PI7A 4W5QA 1SKUA 1AVTA 2Q6LA 4TX1A 4X6XA 3N53A 3GQBA 5FLEX 5IUNC 2AB0A 4RS3A 1OLSB 3AR6A 1FYVA 1RQGA 3NGMA 1EQUA 1BKDR 4NCJA 5D5HA 5D00A 3H97A 5BY2A 4WRRA 4E13A 3W1EA 5J2TF 4X7BA 3H99A 2ZI3A 1KMHB 1I13A 2H65A 1UAYA 3AUJB 3R3JA 5JV5A 2H1FA 4DLKA 1FRZA 3X1JA 4MRAA 4OHRA 2HNKA 3C3YA 3QBEA 1KI6B 1GITA 5FQNA 3EQ8A 1RDFA 2A0YA 3UKOA 3X1YA 4DDHA 1O9BA 1V7PC 3GPCA 2ZOSA 1DPGA 5GTDA 3IQGX 3A0UA 3DBHB 1YZKA 5BW6B 3FYUB 1DINA 1NIPA 2A88A 4JV5C 2Z6QA 1GKKA 2XITA 3GBPA 1LI7A 4WKPA 1DHTA 3TAUA 4Z4EA 4CLOA 2F8SA 2IDJA 1JB1A 2I4MA 1QG0A 2PH5A 4BC0A 3SF0A 2QPOA 3G9TA 5K0LA 5C1PA 4HNRA 4B0OA 1OWMA 3S1AB 1EEXB 1KU0A 5C5EA 1Y0BA 5DSXA 3OJLA 3L0ZA 5EHXA 3PJRA 3Q8KA 2ZM5A 4I3GA 2LIVA 1BHO1 3L84A 4JI1B 3FCCA 3TQOA 2DLDA 2D1RA 3T5BA 5CXXA 5FBHA 3Q8LA 1FTNA 1OX5A 2GZSA 2G5CA 4WZAB 2RKWA 5L7TA 4MWTA 2P2CA 4QODA 4BNLA 1EWYA 4XWYA 3EFEA 4FHDA 3B20A 4LEIA 1L9KA 5ISMA 4BNWA 5EQDA 3EPJA 4FFMA 3ZU6A 2CB9A 3DTTA 1NMEA 2W58A 2YZ7A 2ZWOA 2JGMA 3GPDG 2H4WA 2MOKA 1U0GA 4QU0A 4J16A 2G76A 3GEIA 2F48A 1ZY2A 2W6ZA 1YVRA 4FEGA 1DI0A 1OTXA 1PS8A 4G1MB 1OYVA 4LE0A 4ZXFA 3EIQA 3K1ZA 1Z0DA 4XFJA 1RE1A 1WXDA 1VKRA 1PS0A 3VXKA 4A8TA 1U8CB 1RMTA 5EHQA 4PIMA 4KQHA 1O2DA 3VU1A 2DUJA 4UATA 4KRFA 2DHQA 2Y1KA 2QAIA 4J7AA 3V8BA 4UTZA 1FFBA 1I3MA 3BXGA 4IXWA 1DTSA 4TWIA 3ZWWA 4DN6A 3IQZA 3ZH2A 3ZJYA 2ZQYA 2BV3A 2O06A 2NU7A 3AOGA 4GKKC 2SCUA 2YXEA 1UBTS 4UUAA 3UHOA 2QL8A 1EZ1A 3BEOA 3OIWA 1LPMA 2JS7A 1WH9A 2PXXA 3UYLA 4Q1FA 4TS3A 2OZLA 1OGIA 1MABB 1WL8A 2XCOA 1F17A 3HYTA 2P9JA 2YIVX 3M6MD 4GBMA 4KUEA 5EKDA 4ODIA 3Q3EA 3HM9A 4FXPA 3NEYA 1GNLA 3HHPA 3K9GA 4XE5A 5DWQA 1NKVA 2NUTB 4H1WA 1OOEA 1XF1A 2GKSA 3R8XA 3BFPA 5IT0A 3CZQA 3HZOA 4ZALA 3RIEA 5J2TB 1G4AE 1FUIA 1RIIA 5JNLA 1X3LA 1P60A 1R3UA 3K6SA 1IBSA 3SR0A 3D2BA 1ZH4A 5ELMA 4Z9BA 3W9SA 4A0RA 4RTMA 5IM4A 3ETJA 2VJMB 3BAZA 3H6GA 4Q01A 4XA8A 2IZZA 5K0FA 2RHTA 2V5UA 3EYAA 1B8VA 3QE4A 4GWLA 1TLLA 4JP3A 4TROA 3DR5A 1OZHA 2FUEA 5E6UA 4CGYA 4KPUB 1E5LA 1KK0A 3HO8A 4OQPA 4LRWA 1X13A 1R0KA 3PYLA 3HCPA 3IPLA 1K6MA 3BF8A 1ZK3A 4RFLA 1SKBA 4DCNA 1SM4A 3BA1A 3ZNOA 3RHSA 2B83A 1M6XC 4U8GA 4N6NA 4FUQA 3D7SA 1JN0A 1KFBB 4BL5A 1KJ9A 1FNMA 3EC1A 4FGWA 5ESWA 4HWGA 2J46A 4YPFA 5B7GA 1N34B 2Q7XA 1VIMA 3JQAA 1JHPA 2RGYA 4XGKA 5C32A 4YDQA 2FPLA 2FWBA 5A4FS 3CTPA 4JITA 2O3JA 3CLSC 3FYHA 3WGNA 3U61B 4XQGA 4ZRNA 4ZZ2A 2EW8A 3IP3A 2DHCA 1E9BA 1QF9A 3LPAA 4AECA 4EA9A 4QFDA 1KYYA 2X2FA 4E3WA 4CGZA 1CCWA 3K5IA 3GH1A 4I8XA 4WGGA 2PUJA 3LCRA 2W2PA 1FP2A 5F2EA 2GK4A 1O03A 1ULHA 2FEPA 2GPYA 2BDEA 5JMOA 1KJQA 2BM9A 2JGKA 2PCLA 4H3SA 3ETEA 4QXRA 2FQ1A 1IY0A 4RK6A 4C20A 3C3EA 4DG9A 5EJ4A 2V7TA 3GUZA 3AYZB 5LQNA 2AZMA 3OM1A 4G9EA 5BSKA 2L19A 1NR7A 4D96A 1U6IA 2NLOA 4R0MA 3HB7A 3IIMA 4UDYX 5CNJA 1H4TA 2IXDA 1JQKA 3EGIA 3KJGA 1UQRA 4TL6A 1O87A 3UT6A 3WKDA 1G8YA 2FA9A 3LDFA 2LZ0A 4IWXA 1ILWA 4RXTA 4Q1VA 4K87A 4B9AA 2BKEA 4AX4A 4FX5A 4CEJB 2A14A 1TFUA 1I6MA 3KB6A 4ZLPA 3E22A 3QNMA 3W9UA 3STXA 1Z33A 2PM8A 4TTIA 4AF7A 4DDKA 3FDZB 2QKYA 3CVUA 5IRCD 4G3XA 3ZHBA 1KYVA 3NRCA 1K8ZB 3CFYA 3DDWA 1JLRA 1I7LA 2PRKA 3BB4A 3PQ6A 3UYKA 2Z3VA 3H0EA 4IYRA 3UFXA 1E2LA 2G0TA 2JFGA 2ZRIA 5IFIA 3JWJA 3OKCA 2V7WA 3FJOA 1Y4ZA 5CA0F 3TR6A 3W8NA 1GUDA 3KZKA 3T1HC 3VYUB 3P97A 1YQDA 1A5ZA 4E94A 8AT1A 4DNXA 5KDOA 3FE2A 1IAQA 1W5BA 4KI0A 4O59O 4LF6B 2GN0A 3CIFA 4MB6A 3G0HA 5DM0A 4IDEA 1TUBB 4FD3A 3THYB 4B82A 1P4SA 3A6GA 2V59A 4G5XA 2H00A 4R8SA 4B4DA 3EQZA 2R6GA 3IMKA 1X86B 3BXHA 1Q6YA 2A5JA 3GFQA 4EEZA 4D9GA 1JI0A 5H9VA 4OAOA 1L1RA 3SVZA 3CUVA 3WIVA 2VDUE 1GY8A 5EFZA 2YWJA 1R6DA 1LPBB 1XJ5A 4V0QA 3SJBA 4YP1A 4ARVA 4NONA 4DLRA 3RANA 2PWAA 4Q48A 2XRYA 3ENVA 5JSHA 5E4JA 1J8YF 3GEEA 3N9IA 1J07A 1RXWA 1HKUA 3ZTTA 3BMNA 4M46A 4JEIA 4JHLA 4YJ2A 4QL3A 1P29A 1VBNA 2QYTA 4RLHA 2I65A 1VGVA 1HOXA 2D1FA 2W6PA 4L0DA 5BSUA 4WKNA 5F4ZA 5H7XA 5L7WA 5KSWB 3SQLA 5KOYA 5L3SA 3J80D 3AEYA 4Z99A 5IG2A 4G37A 2SECE 2B21A 1B1CA 5DK6A 3O3OB 6NULA 5HUQA 4G0XA 4NV3A 1WLSA 2O59A 4NV0A 3RKUA 4KVGA 4UQPA 1VSQA 3EIFA 3U3DA 2PBZA 1U5BA 3W3ZB 3HFRA 2ZI4A 3R76A 1T6ZA 2O8FA 1RXUA 3CXRA 3VJMA 1P18A 4BBZA 2XUDA 4UU0A 5B37A 1UPUA 2FOIA 2FQYA 3N2LA 3Q5GA 1G8PA 4NXMC 5K20A 5KCZA 3ZVKA 4ON9A 4MAFA 2MCQA 4CG1A 1JT9A 3BT7A 3QUTA 3UUFA 2A58A 1JEQB 1Y9EA 2B98A 2PMDA 4HAIA 5ALWA 3TQQA 4A1OA 1A88A 2XKAA 3PC8C 3NZEA 1GU7A 3BE4A 3DB2A 1I3NA 1YBMA 2ZU0C 3MN1A 2KDNA 2JZNA 3I01M 4E12A 1UP4A 4MV0A 3CINA 1HUQA 2EW2A 5TMPA 2XQFA 3GRKA 5FHQA 1SJ9A 4KOEC 4L2IA 1RHQA 1DFGA 1W2HA 2QGZA 1WD7A 4EVQA 1B8PA 2HF7A 3D54D 5JNUA 1T13A 2NO4A 2IIPA 1AF7A 5DT9A 2VT2A 1HE5A 1JI3A 4ZQCB 2I6QA 5DYNA 1JVNA 2AOUB 3JQQA 1BMFD 1XA3A 4U00A 2FSVA 3WV4A 4AT1A 3P2JA 5IKOA 2DBRA 5CA0B 4GKKB 4RKEA 3ZGNA 4AKSA 2VH1A 4D45A 1V6AA 4JIGA 3HKBB 3RS3A 1NF2A 4Z4CA 1O08A 1U3DA 3DO5A 3GIWA 2CW5A 4GXNA 4WCFA 3TNLA 5EXDA 3J80A 4ACBA 4KE9A 2B4KA 5K5EA 3D0KA 4K0BA 2E18A 2FKNA 4DV1B 3TOVA 3TWOA 4MGEA 3UT5B 5A1JA 5E7MA 4MDEA 1AS3A 1J2TA 1CWUA 1V16A 2VN8A 2F3UA 1Q7TA 3LF1A 4N7BA 4OYYA 1J9GA 4FZ3A 4K9SA 3IRVA 2PD6A 2YXLA 4B6SA 5K7SA 4DR7C 2P3QA 1PNRA 4TMYA 3KXKA 3CG4A 3ZLJA 3G5LA 2OBMA 3OFND 4UTVA 5JR3A 2BRUA 4OI4A 4R2MA 4ESHA 2R7KA 5EIHA 2UZ0A 3A6EA 5EZ5A 5LYJF 1PG3A 1TZBA 2Q3EA 5F4BA 1G8SA 3HEAA 4PYIA 4UTNA 4B2LA 5I7UA 4S0ZA 5KUTA 4U39A 4UXHA 2C29D 4I0WB 4CMIA 4CR6A 2HADA 4DR4C 4BVAA 4EIWA 2HRQA 2NOAA 4TMKA 2GXAA 1Y5MA 4Q19A 4DQLA 3VNBA 1FFGA 4RC9A 1R3DA 3T1VA 1RYZA 1QV9A 3FMVA 5AJHA 4BMSA 1GM5A 3ZHOA 4DT1B 3OWHA 3WAGA 3Q3IA 2M1ZA 1OWLA 4ZEMA 2FX3A 1KYTA 4FT4A 3KB1A 1TGYA 4NOLA 4YI5A 5A9RA 1R27A 2I2CA 3O83A 4LHXA 1BMFA 2FJUA 1T6YA 1ZUNB 2G63A 2E8EA 1WXIA 4P4NA 5F3WB 5FTLA 4GC5A 1GQQA 2PXCA 4JXKA 3F5QA 1FP4A 1U02A 4I5IA 3E4DA 5FDFA 4EO4A 2B1RA 3GYGA 4MTCA 1OT3A 1RM0A 3QNWA 4RJLA 1J23A 3FPLA 5A6SB 1MOSA 2P67A 1ZDMA 4WKOA 3L95X 1SBNE 2ZYVX 3KVNA 2LRHA 4G2NA 5KOJB 4PX5A 4B3RB 4G5OA 1TO2E 2VP4A 4A9AA 3ODPA 3BL8A 4YFYA 1H8ED 2OCGA 4FFNA 1Z5ZA 4N6OA 3KLMX 3O1LA 5K0EA 2O7VA 3MJTA 2FE4A 1G2PA 4EJSB 2F1JA 4OJKA 2QTHA 3DHWC 2NMVA 1AF4A 1E2FA 3KUKA 4Y2UA 1LX7A 3OFNA 2Y0CA 5LLTA 2XCRB 3WC4A 4N1AA 5K3FB 1WZIA 1RS0A 1H0KA 1XWIA 1SKQA 4AXBA 3HDJA 1EPUA 3T3OA 3RYIB 3UANA 4IBOA 4MYRA 4Q18A 1CQJA 4BN4A 1X87A 2GK7A 5DHFA 2AF3C 1WWKA 4AFNA 3N2KB 4BDTA 3KT8A 2XT6A 3VR5D 1Z06A 4ZDWA 3BWYA 3HCBA 4L6CA 2E5FA 1HE1C 4L85A 4BWFB 2WLTA 3DC7A 3WKCA 3ZZNA 3DPSA 3K72B 2BKXA 3H2GA 4KQGA 4C21A 3T1HB 3JS5A 1MG0A 1OI2A 3EQ9A 3GZTB 1B6TA 3HADA 4EYSA 4QDXA 2R1VA 4FI3C 3GX1A 1O7JA 4BJHB 1N4DA 4YRNA 2Q7OE 5TLSA 4L3VA 4QLOA 2VZEA 3AZPA 4JDPA 1IYZA 4DBLC 3V1MA 4KAJA 4CG3A 5LYJB 3F6CA 4EYKA 4M76B 3NWJA 5LMNC 1L7BA 4DXDA 3GZNA 4J2TA 1EINA 1OXTA 1B41A 1UJBA 2H31A 2IJGX 3RHTA 1UMBB 3KVYA 2M6SA 3OUTA 1WVMA 3WYEA 2VIIA 1RC1A 4UFOA 1KYWA 4FP9A 2VATA 2BMWA 3HFJA 5D3QA 1JG2A 4YRCA 3KT3A 5D3ZA 3ZI7A 1WLYA 2D0DA 2QLNA 4YNBA 3O8QB 4L22A 4ND2A 3COYA 5CEEA 2I6UA 4BE4A 1D5CA 3LF2A 4GU5A 4HP8A 4KO2S 2WKWA 2PROA 3L46A 4QDKA 3DPIA 2H1HA 3AUXA 4BKPA 4EBFA 3HGTA 3A27A 1EX1A 2DT8A 2NYUA 1GPDG 4GOJA 4RQBA 3VO8A 4CM9D 3GT7A 3ZCRA 4WN9A 2GA8A 2R65A 5BQOA 1NI4B 5KO2A 1A76A 1ZCAA 1KZ1A 5L45A 5KSYA 3UJ6A 1N25A 3WGIA 2H52A 2FZ4A 2O2EA 2NO0A 4MPJA 1N2CE 1U98A 1ZCBA 1E4EA 4XJSA 4EI9A 4MKFA 5BOSB 1FPQA 1P7PA 2FW6A 2PQ6A 3COWA 2Y4OA 3ZLVA 1WR8A 5JC8A 4JD5A 2VWQA 4TRRA 4JI5C 2XTNA 3LLVA 2OO5A 4PQEA 2FEKA 1IQUA 3HMKA 2VBGA 3KYDB 3P5BA 3Q10A 4JKYA 2YS7A 4BQRA 4DNFA 4NXMB 1IPHA 2Q1XA 5E3IA 2W70A 1AQUA 3QE2A 4O4IA 3TR0A 2XHEA 3PXEA 5LBUA 3U37A 4QXAA 5DCWA 3MHTA 2GMWA 1Z8HA 5BVHA 3UZUA 1JLHA 1FQKA 2ECFA 3LIIA 2PT5A 3CCBA 3PQ2A 4KPFC 3I32A 3GLFE 1W4CA 5K8UA 5JWHA 2Z9DA 2ZJ8A 1TZ2A 3PGVA 4CL8A 1C3JA 4F2WA 1LQUA 1P0QA 3U4GA 5EE5B 2R6JA 4ASUA 1K86A 2PGDA 3PD0A 4JUFA 1C9NA 3RHZA 3W2FA 1JE1A 4KQ2A 2HK6A 4LOLA 3THWA 1TM1E 5EJ5A 1N2SA 1XRRA 3MT8A 2R86A 3NQ41 1D4AA 2ERXA 4QEZA 1DS6A 4XVQA 3NOXA 2G4CA 1XCGB 1QTRA 5JMWA 1UDXA 3SY8A 1SD1A 1BCRA 1N0IA 3D6VA 3K5WA 3PPWA 1C30B 2HSGA 3QVGA 4MUMA 5EXTA 3JPYA 1W59A 3STWA 4BGEA 4MCHA 1SG6A 1T1GA 3FCOA 5IM4F 3IEVA 3D1LA 5HMLA 1U0EA 2CHVA 1NMXA 2QR3A 4CM9A 3B36A 1IN6A 1O6CA 3K8OE 1HDRA 4QTTB 3GRVA 4C4TA 5AMXA 2A3RA 2OK8A 2V5VA 2XWSA 4G07A 4GBJA 1JIUA 1DKPA 1NRJB 3ZK7A 1D4FA 4CLOB 3VVLA 3DYIA 3LUDA 3NXSA 4LKRA 2ID4A 4YCBA 2HV8A 1SQSA 2BHSA 4B6QA 3RC8A 4O63O 5AM2A 4GI1A 1K9SA 3EXHC 3PIIA 2YJ4A 4ZK6A 3DW1X 5K85A 4FI3F 3HCAA 2QA5A 3GCDA 4PGAA 3OZBA 4ZT7A 2J85A 2RC6A 4NZ9A 5DP1A 4BMDA 4EMBA 2PMKA 5IU6A 1CRLA 1SXGA 1E8MA 4HLCA 2DKNA 4OSOA 4MIEA 3H42B 5B1HA 3GDWA 1OI3A 2NPFA 2QR5A 1YVPA 1F14A 4ES6A 3GT3A 1RRMA 4BO7A 4I4CA 1OZFA 5K6TA 3L43A 2VHVA 5B4UA 3MTBA 2NZ2A 5LKAA 4DR4B 5IKPA 4UNSA 1RYHA 2WK1A 3QQPA 1KE1A 3UK6A 4BKUA 3H9UA 2Z98A 5A04A 2WOOA 1XMOC 3VO9A 4GBGA 1IHXA 1WDKA 2KS6A 4JSYA 1J2JA 2DBZA 1O54A 2G06A 2Z8ZA 4K8OA 3IUEA 4NMLA 2H7XA 2VA9A 2QYHA 4AMGA 3BPSA 4BO9A 1PTKA 1JS1X 1W87A 4AIIA 4D8TA 3DAHA 1Z2CA 2F1RA 1YQQA 3L1UA 1EP3B 1QORA 5AVWA 1OVGA 1H69A 2FMKA 2FW8A 2JIPA 2EKBA 1I4OA 1VMDA 2GAAA 2R7MA 3FBGA 2QZJA 4JASB 5CG1A 4O4JF 1KZHA 3T8YA 4PU0A 4H6XA 2XCLA 2FZGA 2NU7B 2FZKA 4ODJA 2FSVC 2NT3A 1FTWA 2X5OA 3IBCA 3OX2A 1XZCA 3A2NA 1T4CA 4LXXA 3IEKA 4K6GA 4P58A 4DV0B 2O5CA 2NSLA 3UM9A 4DMHA 1BGVA 3FTDA 2OZLB 2H4FA 3P0EA 4EMTA 1GOTA 2V7UA 5JSUA 1K6EA 3PFHA 1UOPA 4WCFC 5KSPA 5IYZA 3I2GA 3CZ5A 1RABA 4IDDA 1F0PA 1VJGA 3WNQA 1NRIA 1OFUA 4ZHQF 6YASA 3L0YA 5E9AA 4ZZIA 1UDBA 1BN7A 1TE2A 3KKKA 4BFWA 4DMLA 4BGDA 4V0LA 4FHZA 2QTVB 1XTQA 3KDAA 3S82A 4Q9IA 1HDOA 4FDMA 2OHIA 4ZEOA 2HREA 2HBYA 2QV0A 1L7NA 4WVLA 2GZ1A 1W88A 2A9PA 3D4IA 2ACKA 5ALEA 1T0HB 3OPYI 5FV4A 1OLXA 1ORWA 4S35A 4QKQA 1K89A 1SC9A 2BRUC 3OPYA 5E6UB 1JWAB 1NDQA 3WB1A 2D8MA 1OZAA 2B2XA 2V4MA 1RBQA 2D74A 2ODPA 3FNFA 4TLLB 3GI1A 1EK1A 1CUDA 3TXAA 3P9CA 3GFSA 3KKQA 2AXEA 1JZTA 3AM5A 3LT4A 4YAJA 1CEQA 1B26A 3V8RA 2J33A 2XOEA 2YKGA 3UK0A 1E62A 4ZHSA 1HFJA 4YP0A 2I8CA 2J5KA 1KQOA 1THGA 4A3SA 5K8FA 2EEZA 3CLTD 1PGJA 1TQ8A 3FH0A 3GT0A 4G0QA 3HPRA 3FROA 3IIIA 1U7WA 3W3AD 1RD4A 1EFUA 1UZMA 1Y6GA 1R8JA 2E0IA 4A5SA 4ZK2A 1UL1X 3LT2A 4X62B 4U9HS 4Y9TA 5T3UA 4ZC8A 3RC3A 3LUHA 4CYMA 1W75A 2H0RA 4MWOA 3W5IA 2X0KA 5TV2A 3U1VA 3TKYA 4WLNA 4F72A 3OCYA 3OOHA 4HMPA 2V9CA 4UNNA 3V1UA 1USUA 2WUFA 1YQTA 4WESA 2XNDA 4ZVUA 2PKEA 3LY7A 5B3LA 4YRIA 1ZGCA 2ROQA 3UWDA 3MHPA 4IZ6A 1OH8A 4YUYA 1JPVA 4MR7A 1DX9A 3SX2A 4ZYWA 3K53A 1EVJA 1P8JA 4OQXA 2H2WA 5CIQA 3ZY3A 3F1KA 2VUHB 1O8BA 1PJ8A 4QE3A 1R0LA 5HCNA 2QL5A 1HE4A 1WRBA 4ZRMA 2PS3A 2GWRA 1KWKA 2DUMA 2FZCA 3IT2A 3BHIA 1Z0UA 4O4JB 4UOQA 4BDSA 2ZDHA 4BBJA 2H3HA 1JALA 2FPPB 5AOVA 1C8KA 4B71A 4F6RA 4N0DA 3EUWA 3DXFA 3E22B 4U7TB 5BN4B 1GL7A 4LWOA 2D0IA 4QJ3A 3FN4A 2BFWA 1NBOA 4N01A 4JFAA 1E64A 2WY2D 2DOKA 3EA4A 3I4LA 2IHBA 2MMCA 1D2AA 4HL6A 4B9EA 2VT6A 4ZHQB 3ACDA 3GGCA 4INAA 4B46A 4R84A 3MS2A 3UFXB 3VHXB 4JELA 2VXBA 4Y0NA 5G1PA 3G49A 3T3DA 4E5MA 1ZJJA 3KTAA 3O8DA 5E2BA 1Q44A 5C7IO 2Y8EA 4JBWA 5DVZA 2X3FA 1FYFA 1CY1A 2DCUA 2GLUA 2YOHA 3Q8XB 2Y93A 3ZTYA 5KSZA 2PUBA 3W3AA 4DQKA 1L8QA 4F5YA 1NVMB 3H5NA 1W52X 4MW7A 1TZCA 2D2IA 3UUWA 2F9MA 1ONBA 3L7MA 3KJIA 3KR0A 1XTKA 3ZN2A 1N2OA 3OQHA 2BEUA 4MJXA 5ADUS 1UADA 3L8CA 3TEJA 2XMBA 1Y1LA 3L6RA 4LGMA 3TIIA 2NU9B 3ZHVA 5BSGA 4N65A 4NBUA 2VDJA 1RC0A 1I3KA 1TYAE 3FVQA 2FF7A 3GLSA 2MSEB 5CPFA 1JHOA 4WUVA 5F5LA 1YAJA 1FY2A 1H2RS 1PG2A 1UBGA 2CJXA 2FWAA 4G56A 2EBFX 4HYEA 3VJKA 4A0QA 1SUBA 2FP4B 1DQSA 3GL9A 1ZLXA 4CU2A 2D2XA 2XGOA 4LI3X 2XKKA 4I5GA 3GFVA 3TOXA 3K09C 4DKXA 1AQLA 1ESEA 3SBDA 1JJFA 3RS7A 1JIQA 1QRAA 1YONA 2FFHA 1T2DA 2CXUA 2CJYA 2HO5A 1E2IA 3KAKA 3IKMB 3SDBA 2HTFA 1ECLA 3ZHRA 4C88A 5L3SB 1IOLA 3N28A 4UTOA 4BZQA 4UE2A 1X1TA 1PQPA 1TNDA 4GKJC 3WKEA 4RK5A 4DA8A 1DQZA 1X1AA 4TUYA 2BEJA 2P6UA 4OHVA 5ERGB 4ETNA 1U5BB 2ORED 2Q1SA 5TXGA 1GUBA 1H4SA 3U09A 2O8FB 3R6LA 4OVKA 3RUPA 4NU8X 4Y67A 4J0KA 5DU2A 3T9FA 3OZEA 3FUUA 1XZAA 1DAFA 1T9GR 5FQOA 1DCMA 1G20B 1TYEB 4MYDA 1MHTA 2P2QA 1H5NA 3C3AA 1E9VA 1Z6QA 1M6YA 2O1XA 1QHGA 2IZ6A 4FGZA 1NI3A 1P19A 1L5VA 4JUIA 5EP4A 4D43A 3AFGA 5JY6A 1DU4A 4MHOA 1IXRC 1ZWKA 5CZVA 4MGIR 1E2MA 3KBOA 3E9EA 3GCGA 3HP7A 3AY6A 3P9SA 4NH4A 1XMPA 2O05A 4Q3AA 3S0JA 1GARA 4ZOLF 4PLVA 5JS2A 3V2GA 5AK6A 1YFLA 1B43A 1KO1A 3FOZA 5A4DA 3CNNA 4DA0A 1N33C 4Z2YA 2JNVA 4YP5A 2VT7A 3UK2A 2QXUA 3KKEA 4IVPA 4C0SA 1BA2A 2P7HA 4DQVA 4BB9A 2EQ5A 4LYGA 1TPYA 2IPLA 3GOHA 2YICA 1P2GA 5F33A 4DNQA 5B1YA 2ZVDA 4LTNA 4E14A 1U6KA 3QTBA 4BFCA 5K99A 1D4ZA 2QRLA 4TWZA 4XUGB 1VJ1A 4J4HA 2AI1A 5C8YA 2YFYA 4GRAA 2YDXA 4WCFB 2AFIE 2PA0A 2N0SA 2MTBA 5KWJA 3TR3A 5DBFA 1GFWA 3R7WA 4L3OA 3I58A 2FQWA 3HE3A 4FEYA 1GAWA 5EIBD 4BTLA 2R47A 1L7PA 4O1IA 2OFFA 5JNTA 4RVUA 3QSGA 1PLLA 4LJ9A 4OK5A 1Z7GA 3NRJA 3GKUA 4RESA 3LHKA 3ANXA 4DR3B 2NSJA 2YVUA 2OBYA 1H3EA 1JLMA 3I0ZA 3FFWA 4KTTA 2XUPA 2WT9A 3E7WA 3C3KA 1DC5A 2YZMA 3STTA 5C8ZA 2VP3A 2R5WA 3V00A 4D3XA 1DWPA 1ZB9A 1Z28A 3P9ZA 4GOXA 4N3NA 1V4VA 4DLNA 4M9QA 4AUEA 2QM3A 4PAOA 1F1JA 1Q2XA 4NJEA 4XLLA 3H1PA 3T5DA 2OPLB 1G8JA 3WSVA 3RSSA 3H9CA 3LZCA 2AUNA 1B7GO 3NKLA 3LUGA 4YWJA 2YJZA 4M0CA 2VZ9A 1IQ0A 1NP6A 4P1ZA 1QE0A 3BD7A 3MJCA 1KSHA 1O9TA 1GA1A 3C4VA 4MXDA 4W8GA 5GWXA 1Y8AA 3WRYA 2DCMA 2P8SA 2EARA 3L9WA 2D54A 3PUWA 1M1YA 3B51X 4MQFA 4UQOA 4IS3A 4RVOA 2LXNA 5ECGC 5ESXA 3UGJA 1LBQA 1GQ2A 1W581 1GGHA 2Z04A 3L2OB 5TARA 1KY5A 2Z08A 4KMSA 4W1QA 4GWKA 4F3CA 2X5JO 2Q5QA 5FPYA 4IX9A 1PLKA 2FW9A 2VOJA 4K9KA 1KJWA 3DVQX 3UXMA 4MVJP 2GX6A 3A3NA 1NNSA 2X4DA 4AYTA 4KR3A 4FW9A 4OHKA 5IC4A 3IHKA 1FP4B 1E1CB 1CW2B 1THTA 1YCHA 1O94C 2BELA 2QUKA 5DGCA 5I9NA 1JSCA 1WY7A 1JR6A 4Z1OA 1IM8A 4ND5A 3WFJA 4YCLA 1G19A 2WKSA 3PNVA 1TM7E 5C52B 3DBLA 3GW8A 2HRRA 4ZOLB 4RJJA 5HYVA 2IW3A 4OXIA 4BLQA 2D2VA 5BSEA 2V7BA 2PSJA 2QTCA 2OSVA 3U4AA 2QTWB 1T8UA 1YE8A 1ONSA 2QRGA 2JFYA 4INJA 4Y30A 5DCUA 1J2UA 2CZGA 3OCVA 2YV5A 1BTOA 3E18A 3D6AA 1TVMA 1CUXA 1ZUIA 4L57A 2O7NA 4MA5A 2WVGA 1MC8A 1VIDA 3UTCA 4EF4A 2QP4A 3N5CA 3RVQA 4AWBA 1CZRA 1QH8B 4PYJA 5FFNA 3C3PA 2ET6A 3SFZA 4XSHA 1JIIA 1MV5A 2I66A 3WDLA 1KGDA 1V2GA 4J91A 1ANKA 3BZWA 4XIYA 521PA 3VR4H 5IVPA 5KYVA 1ACLA 4LMBA 4MWCA 5TPWB 1IY8A 3KZXA 3V7UA 1C9YA 4H27A 3A31A 3WO1A 1IONA 4LVNA 3NVKI 1USWA 2VQEB 4D1YA 2WWXA 5CDFA 2DM6A 2IX3A 3GROA 1K7EB 1GGEA 4PCLA 4PEVA 5ITWA 1VIVA 3NTLA 5BYJA 2DY0A 1ZOSA 3EVZA 4Y8VA 4NULA 4RQAA 5TGTA 1U9YA 1V6SA 5IABA 4NNPA 2R1VB 5KYWA 3EDCA 1QE3A 4TMVA 1AA6A 1GFSA 3T7CA 5GIPE 4CIXA 1GG2A 1OB2A 4X44A 4XIGS 5JROA 4D9KA 3WLRA 4CBVA 5C7LO 5I4CA 3ERCA 1QTNA 4DUZC 1HEUA 1HH4A 2IZ7A 5D5QA 3CEAA 4A03A 1CZKA 1Q0LA 9LDBA 3GZNB 1M7BA 4INPA 3LXRA 4TYMA 3LHIA 1P1HA 1ZS9A 1PZEA 2CK3D 4KLCA 3WGLA 2OZVA 5TT1A 5C53B 3EVEA 4XJXA 3ROPA 4URFA 4P38A 1JA9A 4UNQA 3RVBA 2B7CA 1C4KA 3S1LA 2OB1A 2VK4A 3IUQA 3Q3JB 4PAMA 2VUSA 4PE5B 3ORYA 1QIMA 1CR1A 5HPYB 3DP7A 1GSIA 3I28A 5BMVA 2R66A 4HPWA 1E8DA 1MO4A 2XY4A 3HI6A 3RT7A 1JA0A 3NDBB 2YJ6A 5CD9A 1NBMD 4WN9B 5KKAA 5JPCA 4UCFA 1FLNA 3EY9A 3NHMA 3I9OA 1FSGA 3DLBA 4ILEA 1I10A 4IDAA 2FVYA 1SIUA 3RB8A 5PGMA 3T0FA 2B7BA 1NW9B 3NVDA 5SZJA 1E4EB 1YS4A 1Z73A 2XA1A 1NLZA 2R60A 3R20A 1GPWB 4FBGA 5BSFA 1SAYA 3ZJTA 4QGHA 1X92A 3Q1LA 4IH1A 2B1QA 1B0ZA 5HA5A 4BCBA 4J1NA 3ITDA 2HRBA 1OT5A 4KVAA 4MQEA 3VR4D 5CK5A 3W6ZA 5IJ0A 3U19A 4UUQA 1BQ4A 1I1NA 3NAZA 3U44A 5E2AA 1IHPA 1PR9A 5LBIA 5ED4A 1WMAA 2FUG1 4CR8A 1R6BX 1DOHA 3UWSA 1SCQA 4HJRA 1OXUA 1JMYA 1TZKA 2PH3A 5IMBA 3PG5A 4X92A 4GPZA 5TB5A 3QSYA 2WA2A 2P78A 4R2JA 4R9UC 1SCNE 3C7DB 3ZD8A 1J5PA 5BNFA 1TJNA 2B25A 1ST3A 2NZXA 3MQ2A 4UBJA 1WDTA 3R7AA 2K87A 2IUFA 3G0IA 1GZDA 4ZVSA 3AQ4A 4EHJA 3EX7C 1G4UR 3VTFA 1CF4A 5JFGA 3BGDA 2VXYA 2DBQA 3EZ2A 4L76A 4IM7A 5IYZF 2OC9A 4AY6A 1N33B 2CK3A 2R2AA 1KRHA 2BDUA 5LIRA 1YRQA 2ZUUA 4HUQA 3THWB 1KEKA 3R09A 4AP5A 1VPDA 3GUUA 6Q21A 1OFVA 3C8HA 4B3BA 5U9CA 3RAFC 3EXG2 5JAQA 1TVKA 2FWNA 2QMQA 1DOZA 2Y1EA 2KB0A 4LZAA 4AS2A 1ZWLA 2JEYA 4JUBA 4C2TA 5D3MA 1EVKA 4P81A 1ZU4A 1BCRB 3WGHA 2WVHA 4WLEA 3VDXA 3QVGB 3SBOA 4D9HA 4EPYA 4TKVA 2ZBVA 2OPHA 3COVA 1P7LA 2GPJA 4FYWA 3WE7A 1NBMA 4QUEA 2YHAA 1E3IA 3N54B 2BFMA 1E9FA 2A86A 3KKLA 1KF0A 2R8OA 1UZAA 3AR8A 4TLCA 3RYCA 5GM1A 3OSZA 3SU8A 4KQFA 2UVQA 4YS6A 3AESA 4US1R 3TTUA 3GP3A 3QBJA 3JQCA 4ZAWA 3VR4A 5KPDA 2FN7A 3PWTA 2HNAA 3D0QA 1N9KA 3DVSX 3ILHA 2ZE5A 2AD1A 3ESBA 4P31A 5DPMA 3SYLA 1C2YA 4E5YA 4HVLA 1Q84A 1CUGA 5LSAA 1C81A 3D8RA 1M73E 3RUFA 1FRQA 1PFGA 2WSMA 2RARA 3B3QA 5REQA 3EA5A 2HPVA 4UZEA 1Y4AE 4WY2A 3UZ0A 4PQYA 3UMVA 3W2TA 2JKYA 2JKVA 3KHUA 4PFSA 5K1ZA 2P5TB 3E9QA 3G2HA 4C14A 5EE0A 3QMMA 5EINA 3S29A 3VZDA 2WB2A 2AMLA 2QN2A 3FTEA 2JGAA 2WI8A 2C98A 4DIOA 5KTRA 3BCRA 1JAYA 3TFWA 1PZMA 4YHBA 2WE8A 1E3WB 3U16A 4FYHA 1MXFA 2H18A 1RG9A 3DFMA 2C92A 1CNEA 4GZMA 3IL2A 2BGMA 5LLDA 1AUXA 3U7GA 1KEZA 4G0OA 1KJ8A 2NG1A 1CVIA 4B3MC 1F6WA 1QC5A 3OCZA 5TGZA 2IHNA 1MDBA 4XB6B 1CPYA 1NYLA 3SI7A 4PQGA 5IN5A 2ZUDA 4UMDA 2P2BA 2PR2A 1KQGA 1X39A 2ZROA 1HNXB 4QUJA 4C4SA 3M8KA 3HRKA 3EFOA 4LYYA 1CF2O 4B83A 4CKXA 3VYRB 4G1BA 5LQJA 1YTUA 3I05A 3PLAE 2R7AA 1A5TA 1G5QA 1T4CB 1LC0A 1ESNA 1YQWA 2OCYC 5HKAA 3BBPA 3U4DA 3TTXA 1X1SA 4FN5A 2X19A 3GCZA 3Q15C 4I4TA 5IYZB 2C9YA 2AL7A 5FBRB 3I8XA 4TT8A 2JASA 5FEMA 4HNVA 4HNTA 3ICCA 3JAMA 1UXIA 3NBAA 1SCDA 1VA5A 1O4WA 4OM7A 4MR8A 1VCMA 1NC1A 4IDFA 3D4OA 4WKGA 1V8FA 1PR1A 1N2EA 1V41E 4NHEA 1H23A 2RHCA 3PUVA 5BWOA 4B0PA 4L3WA 1TJPB 1H6CA 3CS3A 3BBLA 5JI2E 1IEXA 4RQUA 2RC5A 2HUNA 2KMLA 4FFWA 5ALFA 1WSAA 5IT4A 1MRSA 2GARA 2BH1X 1P4AA 2RAPA 4BLWA 4LW8A 4I99A 3OPYB 2VRNA 3FLBA 1C3EA 4W5OA 3HA7A 2AZDA 1MIOA 1KZ6A 2BTEA 2PKQP 3M9XA 4XGIA 1G9XA 2D5CA 2IP4A 1A8SA 2QT0A 3T06B 5JISA 3IOBA 4ETWA 3JALA 1Q17A 2HMTA 3VVBA 1RXCA 5H5JA 4U8HA 1QCZA 4L16A 1YFKA 1AY0A 2J6CA 1SZJG 1YNOA 3CLUD 3WRYC 5BT9A 1OC4A 1LDEA 5A4KA 3QY0A 1U0TA 4EKYA 4REQB 2ZE6A 4ZYUA 3OT4A 2A0UA 5JQGA 4L2ZA 2X9LA 4JJKA 5E0KB 5BR8B 2C61A 4PAQA 1GPYA 2WMNB 2NN3C 3WYCA 1WCJA 3PFIA 5CP8A 3A4TA 3E2PA 3VDNB 4C5BA 4DUZB 3M6AA 1U1FA 4QREA 5AKZA 3RVPA 4B6JA 4MMZB 4R7TA 1EE9A 4U9UA 4YRZA 3SR3A 2C3PA 5EZYF 4EGFA 3SC2A 1UCFA 2Q1UA 3AIIA 3GJ8A 4BVGA 5FWDA 4A6XA 3P2YA 1GKYA 1G98A 1PVVA 3HDQA 3R5TA 4TUYF 1YJ7A 1XRBA 2FK8A 2IHZA 4WESB 2LCQA 2FDRA 3C7KA 1YR2A 2FJ0A 4C0HA 4B3TC 2YIMA 1S3SA 4K03A 1MC1A 3QTTA 1HTBA 1HT2E 4W8OA 2DUNA 2XF2A 3T5TA 4QT0A 1O57A 3ZHTA 1G7RA 4RSGA 4LGCA 3S2YA 1OUMA 2JDID 3OP4A 3TCKA 1VMKA 2WYHA 1DVRA 2P0EA 3AI7A 4JXJA 3WGMA 1IOVA 1GPKA 1QHHA 1ABFA 3UAYA 4TV8F 3IVGA 1T2FA 1T6XA 3NDJA 2PX4A 3VZQA 4ITRC 4G5GA 1NXQA 5GY7A 1KDPA 4F6RB 4BP8A 5T4EA 2KQUA 1Q1AA 1TQ6A 2C59A 2F67A 3TFQA 1PF7E 1AS2A 2JZOA 4GXQA 2XNSA 2GM4A 1CBUA 2O2CA 3OETA 5CH8A 3TEMA 5COQA 4TTRA 3RC7A 2GCGA 1PGNA 1IJKA 3KLNA 5HMMA 1HGXA 3INTA 5BWBA 1ZMBA 1GCIA 3FZYA 3UAGA 1Z2OX 1UC8A 1L4NA 5G3ZA 4U2DA 3B78A 2WWFA 5ITZA 3UHPA 3QZUA 5E95A 1OGJA 1TA4A 3FIUA 4MZXA 1IOWA 4RK4A 2M6KA 2GF2A 2FVXA 2ODAA 2Z5FA 3DDUA 4I36A 2NXCA 3DFZA 2EZ9A 5C8YF 5ALPA 3HYNA 2VJOA 1BWSA 3QMWA 3R7SA 3TTSA 3T12A 1U8FO 2I2WA 1E6UA 4EGSA 1FYDA 3AFIA 4H77A 5FHRA 1SCAA 2BEUB 2HBZA 3N7AA 4JT4A 4Z2AA 1OH6A 3IODA 4FU0A 1C7JA 4KPEC 1Z4LA 2VAWA 2VXOA 3NONA 1TIKA 3FRIA 3ZCTA 2J87A 3UPTA 1U9CA 3HVHA 4I7EA 3KLBA 1UBHS 4W8HA 3ZE0B 1W36C 4G5YA 1XZ8A 1XMVA 3EASA 3PGLA 2BISA 4L8YA 3K8ZA 3E0XA 4FHEA 4TLDA 1VMEA 4D8YA 4D9IA 3WFZA 1FTGA 2JDIA 4GYWA 4Q82A 1P33A 2WFAA 1K6IA 2KI5A 4DC9A 5LQRA 4FFLA 4CKBA 4HLQB 4MGZR 3CJTA 4HYTA 1G7SA 1QOQB 2BBSA 1WW2A 1OYWA 1VMIA 1KFJB 4U7WA 4Y7DA 2ZIWB 3HB4X 4JI2C 3BGIA 4DRXA 5JBIA 1AQJA 5EZYB 2BE7A 2FY8A 1PW7A 5IT9D 2H9YA 3FR7A 3LP6A 1X19A 2CWDA 1WTAA 1V7CA 4TUYB 5J47A 1KJZA 1BU5A 4J0GA 4MIOA 2F2TA 1L7RA 1SHTX 1P75A 4O3FA 1P1FA 1Y1QA 5IVIA 2HDWA 2PK3A 3PQEA 5ICSA 3AY3A 1CC1S 4LFBB 3OZSA 4U7DA 1OH7A 4F5DA 3JZFA 5CT8A 2QG4A 2IUTA 6CHYA 3DL0A 4RVFA 4HG2A 2GBPA 3R5SA 4JEMA 4MGHA 5ALXA 1ZMXA 1IM5A 3EB9A 4IKOA 4NRDA 3F47A 4JYBA 4KFCA 1STOA 4IIDA 5IS2A 2P4UA 3I76A 4TV8B 1SIBE 2QMYA 2SKCA 3B48A 3E3MA 3QOWA 4YH1A 5KJ6A 4KFUA 1TCCA 1V7ZA 2BGWA 4IGEA 1C2TA 1RHJA 4QPCA 1X38A 3OZ7A 3RYCB 3H87A 5AVJA 1QJ4A 5I7AA 3ZDEA 3BQ9A 2BSAA 2EHDA 4YRRA 1K4MA 4B1FA 4E08A 1TADA 3DQZA 2VBCA 3HNPA 5CLQA 2JGJA 1A27A 1XZEA 2AR9A 2I3ZA 2ESRA 3SVLA 4HR7A 3BILA 3U7FB 2VRWA 4DR6B 3QGMA 3VNSA 3GZJA 2YBEA 5KBYA 3IS3A 3DUFB 1ZR4A 2QB5A 1L7AA 2F8MA 2IZ5A 5DLEA 2BR4A 3HY3A 5BUCA 1OXVA 1X94A 3ZWMA 2FSGA 1E60A 2ODNA 3M34A 3NBFA 3GJ5A 5FL7A 4QD3A 4WK6A 5EY5B 3X2EA 4ZD6A 5C8YB 5CB4F 5ER6A 3A06A 3TI9A 2VR1A 1CLUA 2PMFA 3VR2A 5FWXA 4AF8A 2J7PD 2JI9A 2UV8A 3U7EB 3MCAA 3EGCA 1CKEA 2HMAA 4PNPA 4Q03A 2IU3A 1I6LA 2G17A 2GBLC 2JCXA 2VF8A 3PKJA 1V3TA 4P35A 4QYTA 2OBNA 5IJAA 3RBAA 4E5VA 2AC2A 1I51A 1KBQA 4FN4A 5EHZA 5FFMA 2QIOA 4DMGA 4JU8A 5BWCA 3ER8A 5BT8A 1I2AA 4MJ7A 1TKAA 3B5IA 3A4NA 5DTEA 3VHQA 5IH3A 1D1PA 4C08A 1KI9A 2O6LA 1NR5A 5G1OA 1N3IA 3PS9A 1GDHA 4MK4A 1TZMA 4DSTA 1BXGA 1ZD8A 3LBIA 5FTKA 4TWBA 4HGPA 1W6UA 4BECA 3H4VA 4PSAA 2ZEJA 1G6Q1 1EKXA 1RWXA 2CSUA 2HWYA 1CZOA 4ARSA 2FN8A 1XZMA 2EKPA 5AQ1A 4UHEA 2D1QA 1UXHA 3U3ZA 4CM8B 1KJIA 2Q41A 4BO1A 4MQFB 4TXNA 4DEXA 5LJIA 3HB9A 2G1AA 1OFTA 5KINB 4C30A 1CQIA 2WTEA 5L4LA 1ZESA 2REXB 3KE9A 4IXTA 3VZBA 3FUXA 3ME5A 3TGPA 2HWUA 3ZY2A 4CIAA 1ZK4A 2OCIA 2DY1A 4LRUA 4D3ZA 1GG8A 5BMVF 1G5IA 2PXAA 3MA0A 4N49A 3C97A 3TRDA 1KRXA 2OQIA 4GYJA 2VPZA 3FWPA 3A1EA 2EG5A 5CCDA 2O8DA 1ULZA 1ZN7A 5FI0B 1JSZA 3MXTA 5AXCA 5F64A 4BRZA 1RYFA 1VYTA 2VSNA 1RXIA 4EO7A 5LD2B 1Q0ZA 2BFEB 3MFYA 2TS1A 2XMZA 4D97A 2JLYA 5CVEA 4G0PA 1FDUA 3UUGA 3ZH9B 3DAYA 1E96A 2J7PA 4Q3LA 4CV1A 2OLEA 1CJCA 4WL0A 4Y6RA 3K0CA 5KCMA 2QSYA 2O3TA 4DLSA 4B3TB 4C0AC 1DC7A 2XAAA 3I6YA 1RQLA 4L6AA 4RIGA 3AR9A 3W1WA 3RV2A 4YLEA 4BO0A 4TGLA 3GMIA 1DBRA 5CDYA 4XARA 1QHEA 4BMOB 1MG5A 1XTBA 3T7TA 1TK2A 5AUNB 4YO8A 4IL5A 2HSEA 5AVZA 1OBHA 4Q9AA 3OZTA 2O0LA 4E6EA 4I2NA 2XB4A 1TTTA 1P3Y1 1T35A 4RCYA 2V96A 4D99A 1Y8RA 2AH5A 2C31A 4NEHB 421PA 1ZN2A 2V74B 2WV7A 4IDHA 4OEHA 4W9NA 3PX3A 4ZEXA 4EKGA 3ANLA 3HXTA 4GLBA 4EB8A 2ORWA 4YLYA 1Z0ZA 3AERA 5IAJA 5DX8A 1TMOA 3CZMA 4A27A 5HHTA 4K6MA 4KQCA 5U4XA 3RS0A 3HXOA 3F6PA 4WFQA 1PBNA 3I9NA 2ZTVA 4R16A 2W42A 3BN3A 3TCNA 4O2AA 1Q0HA 1EFHA 3I04A 1XP5A 3EIOA 5E4TA 1O6FA 5IAEA 2FEOA 1ZQ1A 2P4EA 5ALGA 3HVRA 4MVWA 1MA0A 4WJKB 3A1VA 3DFUA 2DYKA 1FC0A 3JD4A 3SGLA 2AKAB 1CLEA 4XIFA 1I2CA 3FJYA 3PC2A 5BR1A 1TKCA 1R9MA 3D6MA 4HLNA 1C9JA 3IQDB 4RADA 1KH1A 1QKIA 1SXJA 4EY8A 1LNZA 2N9UA 1ORDA 1AMOA 1V3VA 2OZKA 3RVLA 1NT4A 4BNJA 5DNYB 2BLNA 3GRCA 4OK6A 1T2VA 4QBKA 3ZI0A 4EG1A 4R2KA 5IZ4A 3LBAA 4DR5B 1OB5A 1XBTA 3PL1A 1H0RA 4MMXB 2QLBA 4PANA 4YQFA 1BHQ1 1LSJA 3GB9A 2XWPA 2IPXA 2B4YA 3TLGB 5AVUA 4Q6WA 4DANA 3OKFA 1XLTC 4NU0A 2R6R1 1LK0A 3V34A 3N59A 4F11A 5BMVB 1Z4PX 3ONFA 4J76A 3DZGA 1XF9A 1CJVC 3I0NA 5K51A 4XQ9A 3PDHA 3LPMA 4G1VA 3OC6A 1MAUA 3FUWA 1WMBA 4JBGA 4ALLA 3IJPA 1KA9H 1XXHA 3ZJVA 4PLYA 1SEVA 4OQMA 2R8EA 2ZJ2A 1Z63A 2FZLA 2HPZA 3CX4A 1XNGA 1HQYE 3PZRA 2JEZA 1L7VC 1JBEA 1YRWA 1D1SA 1BKYA 1XA4A 4KX5A 1NT2A 1OA0A 2WP0A 1A8IA 3JQ7A 2X0DA 4MQEB 1PHPA 3NB0A 1LF0A 1A82A 2COKA 4ETIA 2EGGA 1P72A 5IJ0B 5J59A 3CLUC 3HUUA 4FHGA 5KU1A 3U44B 1YZ3A 4EA7A 2I78A 1E69A 1MNQA 1XCBA 3MCUA 1OH5A 4RNCA 3A9WA 1N5DA 1NM5A 2ISQA 1DCTA 2GM5A 1RLUA 3WGOA 4AWXA 2VJLA 4YX9A 1NFQA 5CK4A 1E94E 4UAJA 3JQFA 3X1XA 1ZGHA 2FLKA 3KT0A 4DUGD 1CVRA 1XWWA 4PUIA 1B3BA 3F98A 1TH5A 1VFPA 4HH3C 4QNRA 3WLPA 1WXHA 4U6NA 2O5VA 3VPSA 5CCEA 3MS4A 1S9HA 1SRRA 1L6RA 2BFPA 3IUMA 2X42A 4YDRA 4BAZA 4ZV9A 1F4VA 1IJBA 2XDWA 1ADJA 2B5WA 1USIA 4P32A 5ITSA 4X91A 4BO3A 5AVKA 3RFTA 3UGTA 1TVKB 3ZLBA 3SLGA 3K92A 4HMQA 1WX1A 5CEJA 2G1UA 5D3MB 4FDVA 3UF0A 1LDMA 1DKOA 4TKVB 1VKZA 2P90A 3W34A 3K16A 1CY0A 3I9LA 4JNCA 3KDSE 2AXQA 2WF9A 2WHEA 3K8YA 2JFQA 4JLOA 3PNOA 1NN1A 4KKVA 3L0IB 3OTWA 4YBZA 4ZREA 4B2PA 4PNEA 1Z4KA 2CVQA 5BUQA 1ZD4A 1U7DA 4ALNA 4LOJA 1QGUB 2AJ8A 2O0JA 4PRYA 3KAQA 3F78A 1NTOA 4MWBA 1RNLA 3E1KA 2BP7B 3AESB 1NVVQ 3SSOA 1JSXA 3J7AC 1JR3D 4PC6A 1H0SA 2GHTA 2R48A 4JY7A 4M9CA 5FTMA 4Y2YA 3D59A 4MS3A 3R9KA 1BA3A 3S7TA 5NLLA 2BW0A 3P2EA 4KO1S 5HILA 2J32A 1QPGA 4FCCA 4OYHA 1V9LA 1DUSA 3I09A 5HG0A 5REQB 2VDNB 5H0IA 3BSYA 4BQQA 1CZLA 3WVNA 4EUFA 3O4VA 4UKDA 1GL6A 1W9MA 4K9MA 3EXEB 4X00A 1G7TA 3CY6A 5F7JA 3S8YA 3V6MA 1XMXA 1MVLA 3ELUA 4IF6A 4IHJA 3ADDA 1A8QA 1CULC 5ITVA 3LC1O 3LQRA 3IURA 2QLLA 3LDHA 1IOZA 1UC9A 4PHGA 3L6UA 4S1VA 2YY7A 1KERA 1IZ8A 1OBCA 1T5LA 1OA1A 3CUEF 4CF7A 3CVXA 3F6EX 5CTAA 5LZ2A 4IP0A 3LOUA 4KTVA 1MRZA 2H7YA 2I7CA 2NXJA 4EW2A 2XB2A 4FE7A 4RKYA