2Y27A

Crystal structure of paak1 in complex with atp from burkholderia cenocepacia
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
LEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGTTGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords PHENYLACETATE-COENZYME A LIGASE
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
total genus 149
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y27A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y27A01
4DG9A 3DAYA 5BUQA 4R1LA 5IFIA 4D57A 1T5HX 2P2BA 3C5EA 3R44A 3ETCA 2WD9A 1MDBA 4RM3A 4D4GA 4DG8A 3KXWA 3DHVA 4RMNA 1PG3A 3VNRA 1AMUA 3LNVA 3LAXA 3FCCA 4R0MA 4OYCA 4W8OA 3PBKA 5E7QA 2P20A 2Y27A 3A9UA 3VNQA 3QYAA 1PG4A 5D6NA 4D56A 2QVXX 4D4HA 3T5AA 5BSTA 4G36A 1ULTA 5BUSA 3L8CA 3IERA 2D1RA 4IR7A 3U17A 5KYVA 4GR5A 3WV5A 2P2MA 4GR4A 3IEPA 3O83A 3RIXA 3WV4A 3E7XA 2QVZX 2P2FA 4RLFA 4LGCA 3WVNA 4RLQA 3CW9A 4RM2A 2Y4OA 1MD9A 4ZJZA 4FUTA 4ISBA 3T5BA 3IPLA 4GXRA 5JRHA 2VSQA 2D1TA 5BSWA 3IVRA 3IESA 3T5CA 4RVOA 4R1MA 3NI2A 3TSYA 4M46A 3DLPX 2VZEA 5K8FA 5KYTA 3EQ6A 5BSUA 4WV3A 3O84A 3FCEA 1T5DX 2QVYX 3VNSA 4PZPA 5BSRA 4EATA 3ITEA 3U16A 1LCIA 2P2JA 4GS5A 3B7WA 5GTDA 5KEIA 2V7BA 4D4IA 1V25A 1RY2A 5DWVA 1BA3A 3A9VA 4U5YD 5BSVA 4OXIA 5K85A 3G7SA 4GXQA 3O82A 3CW8X 3LGXA 3E53A 2QW0X 1YJ7A 5BURA 2P2QA 2Y4NA 3NYRA 4G37A 3E7WA 2D1SA 2D1QA 4E5DA 4IZ6A 1V26A 3RG2A 1MDFA 4RVNA 4FUQA 3NYQA 5DV9A 5BSMA 3GPCA
chains in the Genus database with same CATH superfamily
1ECFA 2BFOA 2E4WA 2PS1A 3BYZA 4QDOA 2VH1A 5AM0A 5I9IA 1UIRA 1ZOSA 1EFPB 5THKA 1HFKA 3A1SA 4OBBA 5EJ6A 1ESDA 3ZH9B 3Q8MA 4R8MA 2XMRA 4P4SB 1T4DA 3UKDA 5CVTA 1X74A 2VNAA 3VOBA 3G89A 1HV8A 1E2JA 3H86A 4NCHA 1G59A 3B6MA 4E1VA 3P94A 2Y76A 2WFAA 2Z2YA 3LLUA 1ACLA 1QOZA 4KH0A 4LS3A 4L50A 4FDUA 4FFWA 1HYGA 4UZSA 4A7PA 4Z7QB 5F98A 5JHHB 4XARA 3WYFA 1UWDA 4G1BA 2C98A 1E6EA 3ENWA 4FDMA 4GWGA 3VNQA 2IBTA 3K70B 3KLBA 3UM9A 3OJLA 4G1CA 1NF3A 4P86A 5SYMA 1G7CA 4XIYA 4O6VA 2W22A 1UPXA 3GFSA 2GD1O 4AT1A 3CZRA 4QWWA 4J1QA 2PDAA 5ELXA 3P2KA 4M6WA 4Y98A 4H7JA 1LTHR 3FPBA 3LNCA 2CXCA 1ZLYA 5LP6C 2CV2A 1FYWA 4PEVA 3IP8A 1AKQA 1T5BA 3CZMA 2QR5A 3OLQA 4HBZA 5JS2A 3KXPA 4RVFA 4DARA 3BGVA 4RY0A 5B30A 4CXMA 1H2HA 3DWFA 4KO2S 5ALMA 2ECOA 3EQ8A 4LI3X 2PLFA 1X7XB 5EE5B 3V8QA 2VQFB 3S2SA 1MEEA 2JVJA 5I5GA 4UUOA 3UK7A 4FT2A 4GFDA 4B47A 1Z47A 3U56A 2G67A 5EWMB 1ECBA 2VUSA 1KJ8A 3ZZUA 1KYVA 1QR6A 1FQKA 2I3ZA 4M1SA 1UFQA 4AJEA 2RCNA 2VT3A 1K7CA 1VGVA 2GZ2A 1M2KA 3O4FA 3UK2A 1GXSA 3TNJA 1ZN7A 3AM3A 3PDIA 1J20A 3VBEA 3N2EA 2I71A 4M0EA 4QOSA 1QO9A 2AUMA 4OQZA 5BORA 3C14C 3DZIA 3JZMA 3NOVA 3W6NA 3LWBA 3EJ6A 3DE7X 4BLRA 1G60A 2ZQ5A 2TSYB 4PX2A 4AN0A 3MCZA 2D6FA 2B83A 4DNOA 1P2BA 1N2CE 3AUKA 4ZTUB 4RMHA 4MA4A 2HHHC 1UQUA 2XE8A 3F67A 4WVLA 1N5OX 3KPYA 3H42B 1ZJ5A 3P9SA 1FNMA 3BK1A 2VJBA 2XWSA 3K8QA 5EPUA 3RVMA 1E2NA 1NZJA 2I1VB 4J7XA 4NBWA 1TUBB 3WX0A 1DIAA 4PO1A 3DP9A 4QUGA 4F4HA 5IFLA 2G71A 4MS3A 1W29A 1E5VA 1SEVA 2Z4RA 4Q02A 2XGOA 4TL6A 5TB5A 4RTLA 5C4IA 1EWYA 4IGFA 3ZBQA 1CZUA 2F1JA 3EVFA 3ISTA 3LZDA 1W2HA 1OX6A 1ZMOA 3KD3A 1RE0A 5KWEA 1J8VA 2IV3A 4OTZA 3IO3A 1R6TA 1ZIXA 1N9KA 5LP6F 1XGKA 4RD4A 1E61A 2GKSA 5FBZA 5JMOA 3DONA 4L28A 4PY2A 4KITB 5CH3A 3C7AA 3K7EA 16PKA 2G76A 4G37A 1Q6ZA 3MWEB 2NYVA 3C6XA 3GJQA 5AUQA 3WLRA 4F3CA 1SUSA 1GDHA 4PYLA 5CFPA 3F6SA 2VQ6A 3HFJA 4RHXA 4Q9LA 2L69A 2FEAA 1U80A 4H1TA 3SG0A 1H6BA 3FA2A 3QYFA 4N6OA 2YV2A 2JBHA 4F6RB 4X24A 3PSAA 4PG8A 1HE5A 3IKLA 5EZYA 4WXHA 4H2DA 1IMOA 4WBNB 3LD9A 3PFGA 2UYOA 5EP1A 3UPDA 4GQIA 3HK2A 5MHTA 1E9AA 1ZI6A 1H3NA 5FPSA 1OD6A 2BH9A 3N58A 3OEHA 3AL2A 4NU8X 5DYNA 1ZP6A 2NQ2C 3BXGA 4W5NA 1U0GA 3KZOA 1DQYA 3REGA 1DX9A 1A2KC 1GPYA 4OJMX 1QHHB 1QU3A 4PLVA 2PMDA 1VIYA 1CHDA 1H9BA 2HEGA 3FTNA 3WK8A 3WQSB 3THWA 3THXB 3RAFC 1F0YA 4NJEA 3V1YA 4QZVA 3D4NA 2PKXA 4K1XA 2AJDA 4ND4A 2RJNA 1W4LA 3GT7A 2IITA 4CU2A 1G41A 1C3OA 4NJOA 2QE6A 5F76A 4M8KA 4L4YA 2A1TR 4ITUA 3O1IC 1DHTA 1Z2NX 4GP7A 4HN4B 4ESVA 5L3QB 2PMCA 2AOVA 4RL6A 3G0GA 5HPYB 3GFQA 3K1JA 1HRKA 2EXXA 1O5OA 3C8MA 3OIYA 4FMBB 2A67A 4L78A 4B81A 2R8EA 4J7AA 3T3DA 1RP1A 1L8QA 1YJCA 1EVKA 3S8YA 3CEHA 3CBGA 4LXGA 3VO9A 4UUAA 1PK8A 4YUWA 2EGTA 5CTAA 2R3SA 3LLSA 4GMKA 4UNRA 4GZMA 1MUUA 3HBLA 7GPBA 1SUFA 4JYMA 1X7ZA 2YZGA 3GLHA 5ADZA 5K0LA 5SYNA 4J03A 5JAUA 4HYEA 4KPUB 2AEJA 1OFUX 1U2DA 2CNKA 5IAJA 3KOMA 5AW6A 4NOJA 5FUBA 1CXZA 2O3TA 4KBGA 4OQNA 3Q0EA 2YIMA 4O08A 1H2XA 3PUVA 4TV8A 1WLSA 2H2HA 4GE0A 4TPKA 1TGVA 2NN3C 4BC0A 4JASB 4RIEA 4WRRA 1ZD3A 4CCSA 4GP6A 4GXNA 3NATA 1RWVA 1RHRA 1YRQA 3DXXA 3R5KA 5JXJA 4HNUA 3ZD9A 2ECFA 2WI8A 4YS6A 5F78A 5C53B 3VKHA 1Z34A 2HMYB 5C8YA 3CLHA 3ZGYA 5FI5A 4DUGD 4OQQA 3X1MA 1UFKA 2CCJA 3MHTA 3CPEA 2MR6A 4WDRA 4DW8A 1E0AA 3V7WA 1KVTA 4EP1A 2JLUA 1PP4A 5KCMA 1QPBA 3ZZ1A 4RW0A 4EI2A 1J2YA 1AH2A 4JX9A 4WN3A 4E1BA 4XCQA 1ISFA 1WPGA 2DPLA 4TV9F 4PX9A 3K0EA 4HX5A 3E5MA 4F60A 4B6JA 5MDHA 1UKCA 1P0CA 1S2LA 3C6QA 3EHDA 2FQ1A 3EGDA 3ZU4A 1R6VA 5B58C 1DXQA 1JHQA 1N6PA 1YRYE 1E96A 1Z2PX 4R1SA 4X8OA 3TKYA 2IOYA 1ZUIA 4RA6A 5HS6A 4HQOA 5K4AA 3LECA 3SIPA 4CKEB 1E1KA 3ZDCA 2A9FA 2Y1CA 2JHFA 3EH1A 2DCMA 3QE0A 4J7UA 2L0XA 3RBXA 1HT3A 4FXPA 2QTNA 1HEYA 2AL7A 3T5GA 4YP9A 5JMWA 1IZ8A 1TYZA 4S2UA 3BCSA 3T5TA 1JV2B 2QW1A 1QIMA 3NNDA 2HZ7A 2P78A 2ORVA 4G5FA 3P26A 2GSWA 4JJ6A 5T6MA 4DQ0A 2ZRGA 3HA2A 4X63A 3M1AA 2BC9A 2CYBA 3PQ6A 1SWVA 1QVAA 1E1QD 2JKVA 2NT3A 3DB2A 4NECA 4R8RA 1ODLA 4UVIA 5HUJA 5LKRA 1UXGA 1EVZA 3KXDA 4E51A 2H3EA 5IUJC 2DY0A 4NCXA 4DLYA 3LQQA 5H9WA 5HKLA 7ADHA 1JKIA 1B6RA 1G18A 1X8KA 1YI1A 4MI3A 3DHVA 2FPGA 2CJWA 2OFPA 1CEQA 1KKUA 3BWEA 3DKVA 3HKEA 3I32A 4ZRMA 4OSPA 4QXQA 1PEDA 2JA2A 5A1IA 1EX6A 4ER3A 9ATCA 1BQ4A 5TQ2A 1XXLA 2PIAA 2VP4A 2Y27A 1C8LA 3Q85A 4NBSA 1XTVA 4EGSA 2Q6OA 3OZGA 4NDAA 4U3JA 5JZ9A 3QSYA 1VSQA 1WVIA 3G8BA 1UOEA 1SAYA 5EHNA 2YRXA 5JJCA 3ZOZA 5I7EA 1PKEA 4M8NE 1TCAA 5I7HA 2V55B 5M5BA 2JHCA 3BQNB 2C3MA 3B3QA 2FOXA 4XSVA 1KHHA 1B8PA 1Y42X 3HR8A 4EVQA 1ZX1A 4B4KA 1UF9A 2E4XA 4YUZA 2EKQA 4P58A 4GR4A 5IBQA 1UMBA 4BEJA 4AM8A 2MYUA 1EP3B 1PZMA 3FRJA 3HKCB 2OAP1 1NR5A 1MABB 2GJAA 3RH0A 4UE2A 4F3KA 4JLOA 4JI2C 5YASA 2IHBA 3GVPA 1ZI9A 3GFOA 1EG2A 1T3ZA 5C31A 3CW9A 3QE4A 2FFAA 4IHJB 3RASA 4X92A 1CF2O 3FPHA 2GLTA 1N8KA 5E4YA 3U3RA 4RDXA 5JISA 1ZH6A 2FPSA 4LXXA 1EVJA 4J0FA 3REOA 3SXJA 4G0WA 3FLMA 2R2AA 2ZYDA 3L93A 4MJLA 1ZMXA 4MW6A 4MULA 5F3DA 3ZWBA 1JH9A 1PR4A 1B76A 1TJYA 3ZQ6A 5C7YA 4JHXA 3SR3A 4KRFA 4FSDA 4EYQA 3Q1KA 2PXHA 2PNFA 3U7JA 3ELUA 3OJXA 1E89A 1XVUA 2V0NA 1I51A 4MV0A 3K1YA 1A7KA 1CNMA 3AEKA 1OYWA 1QHEA 1QF7A 3IAXA 4JJIA 1B3RA 3GDWA 3TGPA 3GBSA 1Z5GA 2R8YA 1ZXBA 3FDJA 2V6GA 2ANBA 1YDHA 3CUYA 1XMIA 2HLNA 1T9ZA 2VDUE 3CX3A 4GH5A 3G9XA 1OU4A 4MEBA 4BJHB 3B1VA 2G1UA 3MELA 5AHRA 5AR1A 1GFZA 5KQSA 3A9TA 1NI5A 2QRVA 4MZXA 1ZD8A 2OHVA 3DW3X 5LZ9A 1DQPA 1ANKA 2P2NA 2VTVA 3F6PA 4QQRA 2ENWA 4O2AB 4BXOB 5DSXA 3EFOA 1PQ4A 3SC6A 3DOHA 3G2HA 3ZUGA 4M99A 1YHNA 1U31A 5AVRA 5HM6A 4XOUA 3TVTA 4DLRA 3SF0A 1YB6A 4RK0A 5FOQA 5HJ7A 5JCXA 4Q03A 2OCBA 4R0NA 4BB5A 2ZIXB 3LK7A 3IPXA 2F3RA 1XYYA 3DE1X 3VTKA 4LJ9A 4IHQA 1HE8B 3HFSA 1FX1A 1BS1A 2QLLA 2WOOA 4Z2YA 3MPUA 3PX7A 2O2ZA 1FXWA 2UUCB 3FAZA 1TM3E 1XU9A 1QH8B 2F17A 3B9RA 4LBVA 4BYMA 1MZPA 3MS7A 1Y8RB 4KGDA 4E5KA 1CUCA 1LQTA 3GUVA 4ZXPA 3B6KA 4LRSB 1UJ4A 3K3PA 3HC7A 4R2XA 4D8WA 1CUHA 3ERCA 5IAEA 1M2OA 2FSUA 2HMUA 4ITRC 4QBKA 3ZNQA 1Q7TA 4F2HA 5LCIA 2GPJA 2PXAA 4BNDA 2WWFA 2P2BA 1QIGA 3QHQA 3RS9A 3EEYA 2DE0X 2OUIA 4BTLA 4MVJH 2H7CA 4XGQA 4Z53A 3AR3A 4UUMA 4YUVA 3E27A 3CE6A 5J2UF 5EAIA 3TLBA 2NU8A 5AKGA 3P4YA 1PL6A 3II6X 1ZWLA 1JT2A 2FW7A 3IUSA 4KGVA 5LXTA 3BMNB 5B1DA 4TXHA 1ZJ4A 4QYIA 4K0KC 1DRVA 1JXQA 3H2KA 5FNZA 3WDMA 3W2IA 5BSHA 5BW5A 4HGZA 2IHNA 2I2CA 3N28A 3QLJA 4PGGA 4WXYB 2KE5A 1GG2A 5ALKA 3DLCA 2OGSA 4GYJA 5ILQA 5IS2A 1P6XA 1KNQA 1Y33E 1QO0D 3QXGA 1NUTA 1UADA 1JLKA 3FMVA 1CUGA 3C6YA 3IH5A 1E4VA 1FNDA 4DR4C 3DC2A 4IMIB 1NN3A 1ODJA 3KJHA 2X0KA 3JPWA 3NBUA 4LJSA 2AFRA 2X3UA 4XJVA 1C0IA 3QE9Y 1SXPA 2EFYA 4RAQA 4OYYA 4Z0PA 3OCUA 3ZJVA 4JI7C 2YMQA 1XTZA 3L95X 3GRVA 4G81A 3IMEA 3WV5A 3IXLA 3U80A 4HDSA 4EO7A 4D9MA 3TTTA 1TQHA 5HZKA 3R3SA 1UC8A 3IQIX 3R6WA 2PTHA 2X7XA 3DEAA 1FP6A 1YK0A 1OCEA 2BBOA 4AUKA 3FJOA 2Q62A 2Z4TA 3PQ4A 4NZ9A 5TMPA 3LCUA 2GQ0A 3RM3A 5B64A 3FYDA 5EP4A 4I0WB 3UXMA 1VB3A 1AGPA 4HNSA 1SXJC 1EIZA 2HW8A 1FY2A 3F5SA 4A8TA 2QL7A 2EKDA 1L6RA 3AI3A 4CWAA 1AKRA 4I6JA 2NZVG 5EMHA 2CVQA 5I9TA 3WGUA 4HDOB 1CD5A 4KU4A 1Y6QA 4MB2A 5EHIA 3PB3A 5G4KB 1DHRA 4URZR 5JRJA 1NMZA 1Z7EA 1YCHA 1GLNA 1OBHA 2YJTD 1F1JA 3QX7A 4N5MA 1L5SA 1YRWA 2XD4A 3A6DA 2ZBDA 3PNOA 3HYLA 3RODA 1XR3A 3OURA 4BEVA 3V46A 1X1TA 4MINA 4LSZA 3W7VA 3JD1A 1F4LA 4N54A 4LEIA 4AF8A 1GAXA 1B6SA 3AH8A 1IBMC 2BGWA 4HNGA 2BRUC 3IILA 4UTOA 5F2EA 4MOWA 2X0FA 2E0IA 2VDMB 2PMEA 1WB9A 2IYEA 2HWWA 3EZYA 4PLYA 1L4UA 3UF0A 1QP8A 2W00A 2X8LA 3N53A 2CHGA 1Y63A 1S9HA 2IHKA 1H5UA 2Q5IA 2V54A 2AN1A 1QF6A 4M37A 1TMYA 1FJ2A 2GBFA 3KZCA 5AOAA 3Q7RA 3SGLA 4DMRA 1JR6A 1FFWA 4KXVA 3MIZA 3CRVA 4MXDA 5AW7A 2O5VA 4PSDA 1IWPB 1FNBA 1T1JA 3SZMA 4I1SA 2C59A 4YRQA 2GZ1A 1XELA 3CQ3A 4A4DA 1ZQ9A 1HYHA 3LK6A 3RV2A 4Y2QA 4I9HA 3BGWA 2QL9A 4O2BA 3QFCA 5DE3A 2X1MA 1CIJA 4CM9A 5BUCA 1O8CA 4WZAA 1KJNA 4REMA 1SA0B 2WWVD 1QS0B 2PX0A 5DV9A 1DJOA 4Z3KA 1DADA 4P3KA 4OLFA 1I6KA 1ULUA 4C3UA 1O3YA 1YR6A 4PHFA 3ROMA 5I47A 4OEHA 5LJLA 5LM3A 3MRTA 2GN4A 3NJ8A 4TX1A 3T1TA 1MU0A 4UPEA 5CX4A 3U81A 4YR7A 5L53A 4IOKA 4MA0A 2GXSA 3U0BA 1UQRA 3R3YA 4OH7A 4RK5A 4TTAA 1P39A 1OIWA 2JLVA 4EBBA 1GPLA 3VRHA 1SEPA 3DBHB 4EM6A 3FVWA 1JR3D 1AHIA 3AHHA 5CGZA 1ZVJA 2CNBA 1DARA 1XEXA 3QKRA 4MV9A 1M0SA 4QDZA 4PQFA 2YFHA 1D2MA 2P20A 1IB0A 2Q9CA 1E8NA 4XGNA 2JH8A 4Y1RB 4D4KA 4NCNA 3IVMA 4LRXA 1XL0A 2I7TA 4CLEA 1MFZA 1J39A 4AKSA 1C8BA 4XPIB 5IAAA 3PX2A 2P5TB 4IAOA 2Q1WA 1TJNA 5JPCA 1EUQA 2H63A 3OZWA 3KZMA 4ERNA 2YWCA 2AHRA 1DC7A 1W8IA 1MAAA 3A10A 2A35A 4IZHA 3H75A 2NXCA 4JI8C 3RD5A 3WL7A 4JMPA 2WW8A 3BHIA 3NUZA 1DRUA 7MHTA 2IH2A 2F4VC 3DHEA 4KNVA 1D7AA 1WXHA 2HBQA 4EHBA 2XB4A 1Q15A 1A5ZA 1SRQA 5FBVB 3AF1A 4NMXB 3EZ7A 3T95A 4BFXA 3CSDA 4FC6A 1TTHA 2YIDA 4OLHA 4HYYA 3G1WA 1PWEA 2TYSB 5BW8A 1PV4A 3K96A 1A27A 3H2YA 4EMUA 4GL2A 4RK7A 2OXTA 3G2KA 3R6TA 4NDZA 1KDYA 4F8EA 1XP5A 4P9NA 1IBCA 1W5AA 2GRJA 3RUAA 4IIBA 1P1KA 1IEXA 3V4RA 2E85A 2WSLA 5LD2B 3M4ZA 1EPUA 3BH7A 3ZC3A 2NV2B 3UN1A 2D2IA 1N3BA 4E46A 1K4MA 3PCTA 3EA5A 4LC9A 3VTZA 2GK7A 3PCRB 4EFDA 3ETJA 1CJVC 2KBFA 2X1VA 4HEQA 3ER9A 2FFJA 1FMTA 4PGMA 4WXPA 3NHBA 2EEZA 4MZDA 2FPMA 1T9HA 2GZRA 1Y9AA 3HBMA 1EQAA 5CGQB 4EPYA 3B1ZA 3VZRA 1VLJA 3P52A 1BNCA 2CFIA 1TU4A 2V97A 2HPAA 2VJLA 2ZBQA 3CNLA 4BV2A 4Q3EA 2WJZB 1UOOA 3H13A 4F3RA 2WNSA 4CMBA 5SYAA 2PN1A 1IXKA 1EXWA 1GRCA 1JSLA 2ZJAA 4RFVA 3WKCA 4JI6C 4AMVA 3JU3A 1MO6A 4YJ2F 3LT1A 4FGJA 4R4JA 5ER9A 4JD5A 5HBRA 3RUEA 2G8NA 3QPBA 3U9TA 4NEHB 1BA3A 3FIJA 2OECA 4QVKA 4PRZA 2O54A 1JSZA 4FSHA 3M33A 4MQ4A 5ECDA 3AHEA 3H99A 4HXYA 3UZUA 3ZU3A 2XXAB 1KPHA 1FP1D 3K05A 4XYMA 1X38A 4DWVA 5JEEA 3LDAA 4DR6B 3H5OA 1TFRA 4N49A 1SG6A 1OX4B 4MUKA 1IUKA 1ZW1A 4F7WA 2F8MA 4BO2A 1RRGA 1KI1A 4US2R 3ND5A 4BNLA 4F5ZA 4RIIA 1M6XC 3MS4A 4BMZA 1YKFA 5H68A 5FF9A 1U0LA 3D2AA 4ENRA 1U8ZA 3HR7A 4OF4A 1U7ZA 4HUTA 2IXFA 3LM8A 5K99A 1FQJA 2QYOA 2V7GA 3PE4A 4QXPA 3EN0A 3NUGA 4MUHA 1YJAA 2JRLA 3H04A 4MRNA 4TUYB 2H16A 4UVGA 2BZ1A 4DXDA 2VHWA 4I5IA 2BZSA 2CF5A 3AJAA 3FSJX 1WE2A 1XDDA 3IVAA 4QT0A 4WUTA 4RMNA 4JYAC 1QF9A 1NUAA 3L8HA 2DHDA 3EGCA 4WKBA 3PQDA 3U3KA 3ES9A 3KQOA 4I5DA 3BF7A 3L1KA 3BHJA 2BBSA 4R5HA 3UW3A 1OBCA 1OROA 2PYZA 4DIKA 4C20A 1H94A 2XQKA 4B44A 2QE7D 4G41A 2EHDA 1G5TA 3VXKA 4NDNA 2F64A 2WIFA 2CCGA 3TINA 4F2PA 2EDCA 1U6KA 2I29A 4OHMA 4QLBA 4JB3A 4MMXB 2P77A 3G0CA 1AHPA 3JQ9A 1JVNA 1U9IA 1EJ6A 4G09A 4INZA 4TT3D 5AKIA 5DRYA 1XPRA 2O2YA 3IB6A 3OD5A 1Z5UA 1J06A 4N3CA 2I54A 5K4HA 5ADUS 3VR6D 1IG0A 4GD3Q 2R6GA 1WNFA 3ZS8A 3AKEA 2WRZA 1BMFA 1VE3A 3BWYA 1JTFA 3SZRA 4BO8A 5IT4A 2JI7A 3QU5A 4ZI2A 5EJ2A 1A4UA 2VOEA 3H5TA 2FWRA 4BO1A 1CRPA 3WICA 1QH1B 2DCUA 3N2IA 5L8VA 1B1CA 4NH0A 3UJAA 1C1DA 5H0IA 2EJWA 4DHEA 3OZBA 2A5FA 1QP4A 2LDBA 4I4IA 2WG0A 2P6MA 1GTSA 1LBHA 4XVHA 2WVGA 3ZE9A 3IAAA 3FLEA 1DGQA 4BRWA 3STVA 1EFCA 3FTCA 3K72B 1Y1KE 2H9AA 1FDUA 4WX2B 3B9BA 4YRPA 5T64A 3VPGA 1Y81A 2HJRA 1U99A 3TQTA 4MCAA 4UQPA 1H2WA 2WAXA 5JC1A 3T8YA 1NPDA 2Z9DA 3LCRA 3RRYA 2NVOA 1FU4A 2VYNA 2NP7A 2J3JA 5HMLA 2PPLA 1DAEA 1OI3A 2YV5A 1ZICA 3A2KA 2WM8A 3DBRA 3OZCA 2BL4A 2FWMX 3SO4A 2VJNA 3VU9A 1E5TA 4DRXA 3KLNA 2HA0A 4BVGA 2QXUA 3ZU6A 3ZKWA 1LSUA 4HGYA 4LI0A 5FV4A 5AO9A 3VNSA 1E6UA 4CMJA 1D1QA 1LK0A 1VE7A 4O3MA 2ZIFA 2YFYA 3CX4A 5JWRA 1U9YA 1UPAA 4EL5A 4YPFA 3O21A 1MA3A 1P2GA 2L2QA 4ZDIA 5BY2A 3AFHA 2AKEA 3AERB 3OCZA 3LQFA 4JBYA 1T9DA 3IQHX 2XCLA 4JLNA 3V8EA 1VFNA 4HG2A 1JHRA 3BM5A 4NSNA 4REQB 1IY1A 1SCJA 1HOXA 1Z16A 4FZ3A 4MR7B 2Q3JA 1G98A 2XXBA 1XB2A 1RPJA 3M9LA 5DHRA 2QTZA 2AN9A 4KVFA 1FP4A 1GGJA 3KRTA 4M0PA 2ZUUA 5DNAA 3GAFA 1XDSA 5DBEX 3UMCA 1MX1A 3W5HA 1LPMA 1WTCA 5MN6A 3ILVA 3L05A 2NGRA 1YCFA 3KQTA 1S0UA 3N0WA 7REQB 3VR5A 4OP2A 3MTAA 4D26A 1HE2A 3I01A 6YASA 1PR2A 3NRBA 2EX4A 3BWDD 3HPRA 3JARB 2VIIA 3SBEA 4IKPA 4ZVTA 3WYNA 3CX6A 1POWA 3WIEA 4C4ZA 1V2HE 2JGAA 4QA9A 1RKQA 5ITSA 3ND7A 3OOWA 2GAAA 1S5PA 1XS3A 2C5LA 3NQ41 4WZAE 2SBTA 4J0JA 2FZ4A 2XT0A 1RC1A 2AQ8A 4LSMA 4PZ0A 4GBGA 1X1QA 3L0ZA 4U5XA 2YXLA 3KQHA 4YGXB 1K98A 2VAMA 2HPZA 3DDHA 4IDFA 1E59A 1BDMA 1KU0A 5AVKA 6REQB 2X14A 3TUJC 1WMBA 2MWMA 2WQZA 3CGWA 3FNGA 4K6GA 5DOVA 3KQPA 5TNXA 3UJDA 4DCJA 4K9LA 4CHGA 3MRXA 1J8DA 5KOJB 4R7TA 3LBIA 2RK3A 3EGOA 4Q3LA 3GKUA 1YZLA 4GC9A 1JYEA 3PQEA 3ZLBA 4YRGA 1JFVA 2G1PA 4YRFA 5HTKA 1H2BA 2WOJA 1C4XA 5A4MS 2ZXEA 4LC1A 2H06A 2FSPA 3PL1A 5JYEA 2PQ6A 2J41A 3O31A 5JAIA 2EQBA 2RGBA 3NBYC 1QIJA 4D98A 2XOXA 1ZAYA 4C2TA 4GRIA 4LYJA 3Q1LA 5FPKA 3G1TA 3RPEA 3UPUA 5ICGA 2H2GA 5BT9A 3WBKA 2RB5A 4GR5A 4N4AA 1Y6JA 2CHEA 3CRMA 4HGOA 4BOYA 3WIDA 2R1VB 3PGJA 4F38A 2CXQA 1J24A 3TXYA 1QJCA 4RHYA 1SCQA 3UMJA 2P3OA 5J2TB 3AXSA 1K63A 4EEZA 4FUTA 1N3LA 2N1BA 2PL1A 1VRWA 4LDRA 4YJHA 3TW8A 3PZBA 3DXFA 4MV5A 4CEIB 4M9ZA 1T2UA 2W11A 1OXBB 4C87A 1PHRA 2C95A 2VSOA 2HT6A 4F71A 2V7EA 3S2EA 2G9UA 4IEIA 4M76B 4DEYA 2KB0A 3DYBA 3LIPA 5EP2A 3EDRA 3OM9A 4JSTA 2OY0A 2NNLD 4HQNA 4NK4A 4NPHA 1KMNA 2QMEA 5FPQA 3D2BA 4U4AA 2VDRB 5HF6A 5BWNA 1WU7A 4H7EA 5KVCA 2FHSA 4I8XA 4EF4A 2XSZA 4HI0E 3DKKA 2DWUA 5AOCA 2WLSA 4B6RA 3TL6A 1SBYA 3ND9A 1DRKA 1P73A 1U8AA 3KDSE 4BLTA 2JI4A 4XIIA 1DMRA 4B8ZA 2EERA 3NBZC 2AYAA 1X1BA 2XGGA 4QSHA 4ZOLA 3WGZA 5P21A 4Y2VA 1F48A 4I81A 4UEOA 5DP2A 3F5FA 1KEVA 3RS4A 4RIGA 1E1CB 2WP0C 3TJMA 1BDJA 3OX2A 3QH4A 1SHTX 4QATA 5IF3A 5CAEB 1THGA 2SCUB 4M9UA 1RXUA 3OQ6A 5KREA 2ODNA 4PG4A 3O8RA 3FTEA 1FSPA 4ZHQF 1BTOA 1TKBA 3QVGA 1DO0A 2FY8A 1G2IA 2IYTA 3N0RA 4FOOA 1CLEA 1G63A 2R5NA 3OIGA 4OXQA 4R9SA 4UXIA 4MGYR 2E2WA 2JLQA 2ZBRA 2QUHA 1H3FA 2UZ1B 5AOVA 3SZGA 3O26A 4CMHA 3BCHA 2FF5A 2VI5A 3IGFA 1CDZA 2ZGVA 2IV7A 2FP4A 4RPKA 1J0XO 4RJIA 5KSWB 1TI7A 1SVWA 3F73A 1S02A 2PS0A 5L95A 1ZJJA 3E8SA 1IXZA 1SKYB 3COYA 3EZ2A 4FPXA 4CTOA 3AT1A 4W5JA 3CTPA 2IYNA 5L3SB 4LY3A 2GXQA 3NNNA 3Q87B 1PA4A 1TT5A 4Z7JA 3W9SA 2VUUA 3QV2A 1ZITA 3LI2A 2AFVA 4LG1A 3A9WA 2PE5A 3F2IA 3K5WA 1JJBA 4MGZR 2XIQA 3FNRA 4ASUD 2JLXA 2FEWB 3IDSA 1OXKB 3PHHA 1CR4A 5G4LA 3U19A 1KGSA 1WO8A 4FCWA 3PIIA 2ZAYA 2OWEA 3LUHA 3IAS6 4BGUA 2FNAA 2JI6A 2XUPA 3TAXA 1XEWY 1MAWA 4GX1A 1TB4A 1DBPA 4UUPA 5IF9A 1C30B 1Z5OA 1KE2A 5FTMA 3K6SB 4GLBA 3L1VA 4IKEA 1LLCA 1K7FB 4DYVA 2ZDHA 4NDNE 5TEVA 2CJFA 1DC8A 2RC5A 1SRRA 5JTTA 1GFIA 3DHNA 4R8VA 3KVNA 4Y2HA 5L7TA 4EB3A 4MEAA 2P2MA 4ZYYA 4BAUA 2F7SA 3BWVA 1PG0A 3SYKA 2HM7A 2Q0HA 2WD7A 3FNIA 2NPFA 3RYFA 2HAEA 3PKZA 3TW4A 3V1TC 4R1OA 1A97A 4RPCA 4RLFA 3TQFA 1N25A 3NHRA 2W2LA 4HDRA 5ALPA 5J1TB 2ILTA 2QM7A 4ZOBA 1VCNA 3OQPA 4NE2A 2R9VA 3R9WA 1XJQA 2J7PD 3TDEA 2XKJE 2ZBEA 1DC6A 1KI8A 3AUXA 2R66A 4B3JA 4YCAA 5CH5A 4OYLA 5COQA 1FRVA 2A59A 4FFLA 4MGKR 2QY6A 4K87A 1PJAA 5HIJA 5GZ3A 3F3KA 3OCVA 2B3TA 3WIUA 2IYQA 3DOJA 1W47A 5L4SA 2NQTA 4NFHA 4Y6QA 2JDID 4V2IA 5H5JA 3UT0A 5KC9A 1DIBA 3ONDA 4WKGA 4CQMB 1PLLA 3KPJA 4HNAA 4LY9A 1L1QA 4WOKA 2FDCA 4GPD1 1GN8A 5CG1A 4IIYA 4EUKA 3VR1A 2P3SA 2PQ2A 4RF2A 2I4RA 2EZ9A 1ZCJA 3GYBA 2H1LA 3CG4A 5LYJA 4KAAA 1Q2XA 4AKHA 2I9PA 3VU0A 3N2GB 3ANMA 1ZA1A 2J30A 3N0XA 5TGTA 1JKJA 3AEQB 2UU9C 1KH2A 1ADBA 3NS7A 1QP0A 5ETJA 3VYRB 1GKYA 3DFKA 3F96A 1K8ZB 3INGA 2QSZA 3KXLA 5IAOA 2HMVA 1EB9A 2REBA 4Q48A 3F6YA 4BKOA 1EH5A 1YAHA 3C1OA 2HSEA 1LDMA 2QXTA 5GJBA 1JB1A 2BGUA 1H6AA 1Z0UA 5B3KA 2VQEB 4AY2A 1P31A 5BMOA 2I78A 1MQSA 2E6UX 4JGIA 5DGDA 5BNFA 5DISB 3UJNA 2NP6A 2PKRA 2ECQA 3FROA 4MMZB 1SQ0A 4A9AA 3GX1A 3WNBA 1ENOA 1O7JA 1Z0KA 3EQ7A 3SF8A 3KOXA 3MB8A 3PT5A 3G13A 3FPFA 1D2EA 3UXEA 4LMPA 4AWAA 5JZOA 1C2TA 2VUTA 4YRIA 4PZYA 4GMXA 4G65A 3N7UA 2PUDA 4OJQA 1RZ3A 3W8FA 1OH6A 1T8RA 4PM4A 3GGCA 4LOAA 3RGGA 4NFLA 5M04A 3ZWPA 1IVNA 4XB1A 1J9GA 1A9QA 2FWAA 4HPVA 2Q1UA 2XNJA 3EG9A 5FFMA 1G20B 1XI2A 3NORA 4J07A 2VT6A 3DLHA 2I6FA 1BXGA 1XQWA 1XRJA 4R81A 2FSVA 4K86A 1T24A 5JLJA 4B4VA 1TFUA 2NU7B 3A11A 1KJYA 2PH1A 3PQ3A 4URFA 5BW4A 1KY4A 1LB1B 3S44A 4BJ3A 1QHNA 5KWJA 2OBMA 2YYYA 3DR5A 2FWJA 1E8MA 1EVEA 3HVKA 3QVJA 3BGSA 4G36A 1XK6A 3BXXA 3EIFA 4YWJA 2WAYA 4CT0A 5JWOA 1KKMA 2YYSA 1XDZA 4XX0B 4INJA 3ZD8A 1YAJA 1NNLA 3TOCA 3T9DA 1CYEA 1VBFA 2J5BA 1K5HA 4HPJB 3P9PA 4K9MA 1NQ5A 2VHCA 3HQ4O 1Q1GA 4Q93A 1QYDA 3RIMA 4PPNA 5IKEA 3EXEB 3O38A 1IN6A 2V8OA 3HGTA 2Z8XA 5CFOA 4DV6B 1E5QA 1N0HA 3RK4A 1JXMA 3R0IA 2PVPA 2QUBA 2RKOA 2WC1A 3FSGD 3FX2A 3KU1A 4PGFA 1D1TA 3KSRA 3SSNA 4DV1B 2RGDA 1Q0LA 1OLSB 1A5AB 1SOMA 3CSSA 3RDPA 1NV9A 4KMMA 3DR3A 4UNIA 1COWA 2B36A 1PTJA 4ZJZA 4GI2A 4JX8A 4XWAA 4K6KA 5ALFA 1Y3FE 4Z4GA 1D0SA 3OEYA 5AW0A 1KTIA 1R64A 4LF8C 2BW0A 1M2NA 1PDVA 2BKUA 1NOKA 3K9CA 5LQRA 1KQFA 2P4EA 4DXAA 4ZEMA 3P9RA 3FYHA 3QBTA 1WF3A 1SUBA 2F1OA 1WSBA 2OCIA 4LE1A 1RQLA 5DT9A 1E0JA 3DUWA 5IT9A 1E5DA 4AG3A 5LZ2A 4HLDA 3V7YA 5LOVB 1ORDA 2E4VA 1E4YA 5AJUA 2UZAA 1G291 3MYYA 3LY7A 3C1UA 2FPRA 3RFUA 1YL6A 3CRNA 3G7NA 4G56A 3A1TA 1C0EA 2IC5A 1HFEL 5ICSA 1FRFS 1NW4A 1XTIA 5AW4A 1LPBB 2FPIA 3EAGA 1CIVA 4IF4A 1IOZA 5DSTA 1UBOS 2A14A 1FS6A 3MF4A 5AKKA 3ZV7A 4OQXA 3QEBZ 4HATA 4H0NA 3K92A 3KYDB 2X0NA 1FYXA 4MIOA 4ZT5A 3MGAA 1PBNA 2BFFB 1W88B 4ZC8A 3AVVA 3T61A 5CT9A 3DB1A 1EWTA 3IR6A 1TCVA 2ATEA 1P45A 2ZBFA 3EMDA 3PC8A 4WXRA 4AY4A 4CLRB 4DF3A 4WCFA 4EB6B 4F06A 5EMLA 4WJLA 4AQYB 1WW2A 2ORYA 1W8DA 3NM4A 1Y5IA 3E53A 2YTZA 2GK3A 2QRNA 1ISIA 1GPH1 1G42A 1V8DA 1T9GR 3D8TA 5A2QD 2HF7A 3H9QA 3ORQA 5TT1A 3UUGA 2ZVDA 1FEZA 1U63A 4OG2A 2WAMA 1RNLA 2NOAA 2WHEA 3Q8KA 4RVNA 5FI3A 2R00A 2VJMB 5HCUA 2XW6A 2XCTB 1BX1A 3U4DA 3HB1A 3TRFA 3WK5A 1ZFNA 4P35A 3EIUA 2QI9C 1IHXA 4N5LA 5E4TA 4ONEA 1VBNA 5LDDC 5D01A 3FMOB 1II8A 2R6R1 4NCJA 3TYXA 4MP8A 2R85A 4DUPA 2BMJA 4DDKA 1IY0A 1GR0A 2HF2A 1G7TA 2AXQA 3HJTA 1WQ3A 5EMNA 3K2BA 4Z6KA 3HJNA 1XNQC 2BFBB 4N12A 4W8HA 5IBPA 2ORIA 3L8GA 1EBBA 1KI6B 2HA3A 4IG4A 5K20A 2BISA 4CIWA 2WT8A 3AMVA 1J22A 3HEBA 3IDOA 4BNGA 2XDQA 4FR0A 2HJHA 4M7PA 3UAZA 2IPOA 4GECA 4K40A 3SHTA 1W36B 2ZR9A 3RU3A 2E55A 1E9FA 2OZKA 4QO8A 1RI3A 1OZFA 1UZAA 2IY7A 4Q3OA 2CHUA 1G2PA 2CFCA 2G5PA 3QU4A 4EPVA 3RR2A 1F8GA 4XYLA 3IKJA 4BMDA 3PZRA 1EFVA 1Y3AA 4F7DA 3EEFA 3ZW7A 4HWKA 1ZUHA 3B2EA 2NU9A 1RCUA 1JQJC 1WZNA 2E18A 3IEPA 2XGMA 4PANA 3JQRA 4RKFA 1U2EA 4DLNA 2Q8NA 3IQFA 5CUQA 1EI9A 3ZHOA 3PDWA 4AKEA 3A6PC 1FJGB 3QX8A 3U1BA 2WF5A 1EE2A 1WKBA 2IXTA 3ENVA 4Q5IA 3ZCVA 1B73A 1VYVA 1EZ4A 1HNNA 2HDHA 2WWRA 4NH4A 2MCQA 3UUFA 4QODA 5DPMA 1A8UA 4KV9A 2ZRAA 3WRYC 2NSJA 3EOZA 3HGMA 1AKUA 3ZY6A 1EFDN 4POOA 1U0EA 4R9UC 2V0GA 2HJVA 3H11A 4XPZA 1UJBA 1XKQA 4NV3A 3QQ5A 2G9VA 5EA2A 5DTIA 3ZI4A 5K5EA 2Q3DA 1SZPA 3SWWA 2QRLA 2ZRQA 2X8JA 3KVYA 3WQHA 5LVAA 5HCIA 1EUZA 1BCRA 4MQEB 2AUTA 1X7GA 5AJVB 5LBUA 3VNAA 5KWVA 2QLBA 1WR8A 2AXEA 3O8QB 1KZ1A 1SVMA 2VWGA 4PR0A 1GPBA 2A0FA 2LW7A 4Z8XA 3NPMA 5E9QA 1PT5A 3NM5A 3WGQA 4LOJA 4NU0A 4DGQA 2JHPA 3AEYA 3RBVA 4A2WA 4C89A 2HRQA 4M9CA 3EXHA 4X6UA 4YRRA 2PZ8A 2X2PA 2YWFA 3E2IA 3IAHA 1JB9A 3MUOA 4ZYXA 3O47A 1ECLA 1FP2A 1PHPA 4H4CA 2FUNB 5FA8A 2RGXA 3TR5A 5DWVA 3WY9A 5CA1F 1P7YA 2XF2A 1XO1A 5HNKA 4HUJA 1JX6A 4KL8S 2OQRA 1YB2A 2Q29A 2UVQA 3GLKA 3UQZA 1WBBA 1HXHA 1GM5A 4FDLA 1P62B 4KOEC 2IU3A 3TBFA 1GIAA 4YCBA 3VTFA 4AD8A 2AT1A 3EOBI 5IYZF 1QPGA 5KTPA 2F62A 3K2IA 2DQKA 1GFSA 2PKQO 2R1TB 3PHGA 1KEEA 1S8NA 3O1HB 3KT6A 5TQ0B 1O6BA 5KVAA 4M2LA 4M22A 3A1UA 4JC8A 4JKYA 3C5WP 3RG2A 3GC6A 2E49A 2NO7A 4AY3A 1JWBB 4HNQA 2JGFA 3IEXA 3AZQA 3H8JA 4WK4B 4X20A 4RD2A 4UU1A 3D8HA 2DJIA 1JLSA 1NVVQ 4CF5A 4ZIRB 3CVUA 3GJTA 1EFLA 1ZAKA 1P5FA 3BXPA 3PRYA 1AU9A 1JDTA 3G0IA 2WMYA 3GQBA 3BJMA 3CLRD 3TR3A 4FZJA 4C2AA 4YAGA 3ZNOA 4FR5A 3PEYA 2DLDA 4EG4A 2Z08A 2P02A 3BGOS 3NEYA 4Q3KA 4EHIA 1ID1A 3K5HA 4K9SA 5DYWA 2WB2A 2GARA 4W63A 2A33A 3RTCA 1ZC4A 3KQWA 2QTWB 2ZROA 4MICA 2QTCA 3DTVA 5T5QA 2C4HA 3CF2A 3HVJA 3H2BA 2F8SA 2QJWA 2C5SA 1SPXA 4MUAA 3L8YA 3HSYA 1XZJA 3HCDA 3RAGA 4F1WA 2Q5OA 2OC9A 4UU0A 4QUEA 1GUBA 1XRNA 4E5VA 2WR8A 1AKVA 4L15A 1YFKA 2VK8A 1LVGA 1DOAA 2W0MA 4P7FA 4TYNA 1UKBA 2X3YA 1XBTA 4MJ3A 2JG3A 3CWCA 3B3AA 5A9SA 2PIDA 3RUHA 2QTMA 2Z0MA 3UMRA 3N8IA 4R3UC 4DAEA 5CMLA 1N9ZA 1VHTA 2FMKA 1IEQA 1ZCAA 5DGTA 2R5WA 5AI4A 8MHTA 2D8MA 1MX3A 1ZCZA 2ZQYA 2OPHA 1SVSA 2GTPA 2VYQA 2ZI7A 4ZOAA 3WE7A 4P7JA 4BY9E 1T29A 3PQFA 1LI5A 1J99A 3IAM6 1OE0A 3RS2A 2Y05A 5ERYA 4J9UE 3LXXA 2O7SA 2PGLA 1HQDA 4IH9A 5E1MA 3CPJB 4O0LA 2NV0A 2ZBUA 3LX4A 3MEQA 1Y5RA 1R10A 1PJCA 4KX5A 4CTKA 2QN6A 3SEZA 1OTXA 5BQXA 1MG5A 3FWKA 4U7WA 3B70A 5HEKA 1GPUA 4O59O 4TV9B 5A5EA 4IDQA 3T0IA 4HSEA 1AK1A 4I5EA 4ZCIA 2PUVA 2VR1A 2XQGA 4U7TB 3MWDB 3RARA 1SVOA 1YZUA 4ZO9A 3S2GA 2NXNA 4L7VA 3DHYA 1ZKMA 4F56A 2EJTA 4WV3A 1R0WA 2IZOA 2Q9UA 4PTLA 1KOJA 2CU6A 4FBMA 4JAVC 4C7BA 4V1CA 5BSRA 4JI5C 1EGVB 3OICA 5DXFA 1PZHA 5B7PA 3U09A 1N7HA 2HREA 4Y6RA 3KQQA 1NJ8A 4XWWA 2I03A 1E7QA 1E9EA 3FOEC 2PH3A 2Q7XA 2NW6A 2OVBA 3PJGA 2OFFA 2X22A 3EIQA 1OLXB 1N5MA 4FFBB 2IZ6A 5E4JA 1F06A 2B7CA 3UHJA 1E2DA 4HSGA 5ENDA 2H5EA 2R7KA 3RWOA 4ZVLA 3B53X 4C4PA 2V58A 1HM5A 4L9SA 2VNHA 4JQSA 3QSGA 1P9RA 1QANA 4JZYA 2P8JA 2HF8A 2QTFA 1ESNA 3OZEA 4IYJA 4M8LA 3EMVA 2WFMA 3W5JA 5IJ0A 5DRTA 2FW6A 3LY5A 4LHXA 2QNBA 4KK4A 4RJKA 2BVNA 2QD1A 5CVUA 3W9UA 1F8XA 1ORIA 4DT1A 3V3KA 2FZEA 4FZ5A 1R1DA 1SD2A 3G2MA 5IEJA 2IXGA 1AB5A 5I9LA 4FSXA 4OMDA 1QYVA 2WVJA 5C5CA 5BVGB 1NMXA 1KK2A 3ZWNA 2O0KA 2H31A 4HXFB 5ALUA 2BDUA 1SG0A 3WYAA 2AR9A 4OMFG 3DFFA 4U2GA 5CPFA 3R76A 7YASA 3C98A 1PR1A 4IMJB 1DAMA 1OI4A 3QU9A 1XMQC 3WYEA 1LFDB 1XAJA 3WMWA 3EIEA 3H9GA 2IXAA 5F1OA 1AF4A 1S96A 5ESRA 3AM5A 3AO0B 1YS4A 4TLCA 1VHJA 4H4DA 4RM3A 2BGKA 1XVLA 1K89A 2W4QA 1XRAA 3K53A 4XTCS 3L8MA 4O25A 4ZMSA 1CBUA 2GXAA 3ZZ0A 2UXBB 3I1JA 5JCJA 3TLZA 4L6AA 3OQNA 2XUHA 4PQRA 4LVOA 3BXEA 4YHHB 4D42A 1BU5A 3IQEA 1TZJA 2B7LA 2OG2A 4UAJA 4TGLA 3OMLA 4LCJA 1WY5A 2H9IA 2JGJA 3DAHA 4JUDX 2Y2UA 4CL2A 4YDQA 4NZYA 1RACA 1A04A 2FHPA 5CB0A 3ZLVA 2UAGA 1NFRA 2REQA 1QE3A 4X45A 3PKJA 3R0VA 1P18A 2ALJA 5GJWC 4HDMA 3JALA 4DWWA 1QC5B 1IM5A 2VPXA 1FVFA 1YI8A 3CXUA 4IJUA 1UDRA 2IYZA 1QAMA 2VS1A 1ZH8A 2W5UA 3KEGA 4HK4A 3J81A 4X91A 1UK8A 4BFLA 4Y3UA 2V9ZA 3LZCA 3PI7A 1SPBS 2NZJA 2XVZA 5DH9A 3LC2O 4AUNA 4P6VF 2Q4BA 3HUFA 1Z4QA 5K09A 3S7TA 3FKJA 3HO6A 2RC6A 3HDTA 5KJFA 3A3KA 1M5TA 4IH4A 3H4IA 2ZYTX 1GZDA 4EB8A 3WLFA 3EISA 5CVVA 2QY9A 5J40A 5JSZA 2VCEA 4FR2A 4FS8A 2NUPB 3LIIA 4MTLA 4ZVMA 5JDIA 5E4FA 4GBED 2GZMA 1BQEA 3CVVA 2VUHB 1XXHB 5BQ5A 5AYVA 1RZRA 5ALWA 4OU4A 4JUIA 1LZLA 2HCFA 2PANA 1G38A 1V6SA 1XTTA 1OUMA 1PWYE 2IA5A 2ZYIA 5CIYA 4A2CA 2Z2KA 3B89A 1A9YA 2UXDC 3GJ0A 2OO4A 3MJRA 4KYVA 3VO8A 4BNZA 3CCCA 2EP5A 2P2SA 4JXJA 4YUYA 2HWUA 2REXB 4IW3B 4AZWA 1JEDA 4D4JA 5AI0A 3C3WA 2I8LA 1SVIA 4V39A 4E6EA 5LQSA 3ZIUA 1NE7A 4X1YB 2PJZA 3AUSA 2DPXA 3UFBA 5EJFA 3KJZA 1C2YA 2HBZA 2D7DA 5EQDA 4QXRA 2NTVA 1LK7A 5U4QA 4ZTZB 2C9BA 4FKZA 4EGFA 1Y8AA 2BFCB 3FAKA 1U8YA 4KACA 2FR8A 4UM8B 5IVDA 3DQZA 1J0DA 1PJSA 2E9SA 1P4EC 3NHYA 4Q7EA 4CDRA 1Y7LA 2J5RA 3E05A 4RDIA 1B8UA 5L6MB 2HZBA 3VM6A 1V96A 2VXYA 4OX9Y 1P1JA 1CETA 1A7AA 2WE8A 3WFZA 2QLFA 4BO7A 3LDUA 4E1AA 5C46F 2W9XA 2D2XA 3CF4A 1E3WB 3VJMA 2XWBF 4BECA 4B3TC 5JADA 3SFTA 1B0PA 3EF1A 1JIJA 3CVXA 2NYUA 1LUAA 4N5DA 2GCPA 3I6BA 3G9QA 1QYIA 2XQFA 1NX6A 1XWWA 2NO6A 4L8WB 3K6JA 5AUOB 3E1GA 3W7BA 1BN7A 2EFCB 4CTMA 2XGJA 4LYYA 4X97A 2C8JA 3QMPA 1E1NA 5BMVF 1ICEA 1Y9EA 2PWPA 3VR4H 1LPSA 3KO8A 1MDBA 1T2AA 5KX5F 4G1UC 2YFKA 5FQOA 4GX2A 1SCUB 3T1YB 4BU0A 2VHUA 4A8JA 1MH9A 3LY9A 3C87A 3PROC 1T6BY 1VYTA 4R0MA 4J43A 5AK4A 2E5WA 1VMKA 3OZUA 1NLFA 3NANA 4YBRA 2PUHA 1U1EA 4KR2A 4TS4A 3WK9A 1G1MA 2X0JA 4RZ3A 3GNQA 3WHIA 4BFVA 3L5KA 4KQ2A 3N5KA 5ADVA 3K71B 3SKVA 1CLUA 3D3EA 1TIBA 2O8BB 4JBHA 3GNTA 3VKVA 2ZSIA 1FTSA 1W35A 3DKIA 4HUQA 5T6BA 3BMOA 1V1RA 4FYWA 2YY6A 1FBTA 2OPLB 2Q2WA 5B6JA 4MH4A 1Z7GA 1L7EA 1NT4A 2BM1A 5CFRA 3IHLA 1DAIA 1F2UB 5JG7A 1XZHA 1ODFA 3DLTA 1OFTA 3HR4A 5C4GB 1JTVA 4E7OA 3RTBA 3V1UA 2BGIA 3KQVA 2JH9A 4ZAFA 4FKMA 3UCEA 4Q7QA 2WTNA 3CO5A 3AC0A 5CT8A 4FQ8A 1F8UA 1YB1A 3B60A 3GGDA 1DBVO 4LA4A 1ZD2P 2A9RA 4K0KB 2P7HA 1GN9A 3W2GA 3RTGA 2NM0A 4XOIA 3GEIA 2WE7A 3TD6A 4R2LA 1W44A 4YRAA 4YR9A 4AW9A 2WWTA 3E15A 1M2WA 2GRAA 4GKKB 3LPMA 3GVCA 4MWTA 3WWDA 1XTUA 2MSCB 3B9PA 1B93A 4YV0A 3OE7A 3DOCA 4TWZA 3BZUA 3WK4A 2LZ0A 1PVOA 4QGGA 3CGGA 3RVJA 5H9VA 4HB0A 1XKLA 4KN5A 1OJ7A 5IWAB 3A6JA 3QNMA 2AG6A 1L7PA 3PGKA 1CE8A 5KKNB 1GNLA 3QKUA 2RHHA 1YS2X 4RMIA 2EIXA 2QW8A 4O02B 4ZOQI 4LUCA 3CBQA 3NG1A 2YYZA 3W9BA 4IDGA 4GP9A 1PSWA 1H1LA 1B00A 4OHVA 2FWBA 3QX3A 5E9JA 3UYLA 4OD0A 1YZTA 5DMXA 2V7BA 1FQWA 1U2SA 1O92A 5E7IA 1PT6A 1PAUA 1BWRA 2C4WA 3ILSA 5HF5A 5JAHA 1ODIA 3DCYA 4TQAA 3ILYA 2EDAA 4ND3A 4J16C 1IOLA 1DFIA 3IAFA 3VPFA 1UM9B 2Q3CA 1Z56C 4ZJUA 3CW8X 3MJHA 1G3IA 3HJGA 3L01A 2RHTA 1WXIA 2D0IA 4NMWA 1B6GA 2FSSA 4B2LA 2XYRA 4FS3A 2A9QA 3FCSB 3OT1B 1MXBA 4HDKB 5IU6A 4JSRA 2G08A 5K3FB 4MLZA 2D1SA 4FLMA 2WIBA 4HF7A 3S8MA 2VPZA 3UCXA 1R5BA 4DMUB 4EEKA 4N76A 1MDFA 3TTWA 4PC6A 3JR7A 3MUNA 2UYHA 4B2IA 2LV8A 4OY3A 4Q21A 1QMGA 1N2SA 4EJFA 2PD3A 2IH4A 4NCAA 1NP7A 2RCYA 1BCSB 3A1WA 3ENNA 4FFMA 4M87A 2ZJ8A 1I1QB 1QHFA 4XB2A 4D92A 2ERXA 2E5LC 3ESDA 1U4OA 3U0VA 3CT6A 1Z35A 4D6PA 4Q1AA 3L3BA 4UHCA 3ANSA 1U7PA 4NS1A 2JLAA 4KXNA 5DBFA 4FYPA 4JEMA 5EKTA 2YJZA 2G5CA 2H1RA 3LUDA 3KUXA 1YRLA 4X62C 2IEGA 3LBFA 4HWPA 4OHZA 1PKXA 1ULSA 1G7RA 1PJBA 1LBSA 2Q4RA 4S1PA 5GOTA 2OO5A 1A77A 3TSAA 4D80A 3QG1A 3R0XA 4B6QA 3AHIA 8ATCA 4V02A 2VTDA 3RF7A 2Y1FA 1FUYB 1WH9A 3QUAA 1UBNA 4YO7A 2D62A 2ZSJA 3PPYA 1DO2A 3OESA 1O9GA 2ZIZA 3CHYA 5KO2A 2J8ZA 3HFRA 3S29A 4JC0A 4Q3BA 2AOWA 2OGZA 2JLCA 3HCWA 2HK9A 3HY4A 5E7MA 3ZLJA 1PNQA 5ESWA 3ER8A 1FMCA 2O50A 5BSTA 5BV0A 4J3JA 2R62A 4ZODA 5J4VA 3LX6A 2GAFA 2BHNA 2FGJA 2ZYHA 1RWXA 4ND2A 3QEKA 1Q22A 2RH5A 2FZVA 2GJSA 2AKAB 2FW0A 2ZI4A 3LP6A 2OAGA 4IS3A 3A70A 4BN0A 1MJGA 3KSBC 1BAPA 3SQXA 1AN9A 4LHSA 4TWIA 1ADGA 3M5WA 3OWXA 3MJFA 3VOAA 8ABPA 1U4SA 3PC4A 1HR0C 2RGYA 2WJJA 2EBFX 5KYUB 4BVHA 1JVSA 3NVDA 1BHO1 1NW6A 4PG5A 3HFGA 4UTZA 4ZP1A 1A3CA 2VF7A 4HLUC 3JAKA 4I55A 2PUBA 1Z4PX 3M6FA 1LVHA 1BEEA 1CPYA 3EASA 4KQ9A 4ZARA 5FPTA 4XQEA 4DVJA 2BFEB 1T5SA 4EENA 4ZMBA 4QRDA 1DOHA 1Y1RA 4ZI7A 3TNYA 4AP9A 3IOBA 2II6A 5EZ6B 1MB3A 2JFHA 4UCXA 4V03A 2EKLA 1UH5A 2B4KA 3BE6A 3GRUA 3T1QA 3HTXA 4OJYA 3BCRA 1ZK0A 5AXDA 2OAEA 1VSBA 4JVLA 2KZFA 2JARA 2GFHA 1BGWA 4JVOA 1IZ7A 3VZPA 4F4FA 3O0TA 4J0IA 4JBIA 1VHLA 1IXRC 5IXSA 4JI8B 1BKDR 2VAPA 5H4HA 1V1MB 3N70A 5JCOC 2R6ZA 2AOUB 3UMSA 3ZZMA 5DYYA 2GBGA 3T7IA 2IE0A 4ESEA 4TSFA 3R3VA 5AKEA 4MRSA 4YCMA 3GLRA 1GL7A 1AV7A 3CISA 1XKTA 4I4TF 1PLKA 3AR5A 1V37A 2XE4A 2R1UA 3DE6X 1BMTA 3SJBA 4BATA 2AE1A 2XTMA 2O8NA 3T4XA 4C6TA 1C9YA 5EJEA 5JQGA 1N0WA 2JCSA 4DA8A 1MT3A 2GM9A 3N8KA 3I8OA 3QI7A 4U6QA 2P9JA 4BBJA 1TEZA 2FN7A 3O8OA 2BTEA 5J3JA 4OYRA 2Q0QA 5BPFA 3M0EA 3D2LA 4YJ3A 1LNZA 1NF9A 2CLLB 3V34A 4ZGWA 1A88A 4DSNA 2D8AA 4P5EA 4CKBB 3CNQS 3TXAA 3MJTA 2Q3FA 2V7WA 4DLAA 3RRXA 1ZB8A 3LLCA 3IJ5A 2G6TA 2XADA 1G8SA 2O48X 5ALGA 3TBKA 2VDWA 4UZEA 4OKIA 4E88A 4JI4B 1YVRA 2ZJ1A 3VNUA 1N7GA 2BUAA 1C7ZA 1KY2A 3NONA 5CXXA 1IJBA 2ATCA 4Y6OA 1RC8A 2C7BA 1BJKA 2XBMA 3D0KA 2BEVA 3Q72A 3W6UA 3IVGA 4UM5A 4NXMC 3DT8A 5D3ZA 4M60A 1DCFA 4B6GA 3EE6A 4NPCA 3TLJA 1GGFA 1KJZA 4JKOA 3TEMA 5L9AA 2GUWA 5UKDA 1B26A 1V4VA 4P84A 4YAKA 1BGVA 3USZA 4Y2PA 1USIA 3BAZA 1NVUQ 4PG7A 1SXIA 1N6LA 1S7GA 3FYUA 4RIFA 4ARZA 3HKBB 4D5EA 4LFAC 5KYWB 2H4FA 3L6CA 4KR9A 3M2TA 1HH4A 2VQ3A 4OHUA 1I3NA 3F4LA 3I83A 4ZHSA 5FH9A 4TYWA 5IDQA 5DSZA 3JYPA 1KEKA 4KRYA 2OO7A 3SQMA 1L7QA 3M6XA 3L7IA 4OK3A 3CFYA 1L5HA 4D56A 5BYJA 3KQKA 4ZGBA 2I33A 2Z56A 3AHFA 2EWVA 3YASA 4F96A 3EDCA 5IUKC 5LQUA 3TQRA 2BGMA 2PPVA 5JRZA 2DPYA 2ZUDA 5EOVA 3TIFA 4MQUA 1FNSA 4XX1A 4ZCQA 2WQ6A 4KHPC 3T34A 2D7VA 2BE7A 2D2FA 1EP1B 3L7NA 3WA7A 4PLGA 2VHEA 2GF0A 1Z0AA 2HSJA 2OV8A 1HH2P 3S55A 2HJ9A 1XLVA 4MV4A 4DLKA 3ENKA 1PUIA 2CL0X 1A8QA 4P4NA 1O4VA 1EFPA 2RHWA 4RM2A 3QM1A 1I10A 4K9KA 4NRDA 1SXHA 1GQRA 4YYZA 4B82A 4MKRA 2ZJ4A 5IJ9B 2R6FA 3U3XA 2XOKA 4YJFA 3GPLA 5FOUA 2AC2A 1FA9A 1BE1A 1EE9A 1AHHA 2L42A 1HDXA 3EA4A 1ZPDA 3GHHA 4N01A 5EMKA 4JP3A 3FGOA 4HAVA 4NVRA 5LIPA 4DBLE 2XCUA 1ISRA 1Z4JA 1ZS9A 1A8IA 1BYIA 3M9WA 3PDUA 4MHOA 2B7BA 1TRKA 2AYYA 4MIKA 5KC8A 1RKBA 5B3AA 1ZGAA 1GCGA 4C2UA 3KBOA 4UOZA 4DJFC 2WSMA 3ZHVA 2I80A 3KKLA 3OCWA 1ITZA 1Q17A 3FUVA 3KFLA 5ITZB 5GQSA 3TM4A 1D6JA 1S6YA 3ZDAA 5CYOA 3AKZA 4JLPA 2X9GA 1TM4E 3PGXA 5SZKB 3WBFA 4EKYA 1NLZA 2G3YA 4FILA 1FDSA 1KZ4A 3KT3A 2D7JA 4AKGA 1O6CA 1U65A 1NRJB 4XKJA 1G8MA 3FOAA 5FTWA 1YC5A 5T3UA 3UT5B 4IL5A 2C5EA 4PONA 3ZE7A 1D9ZA 4WA7A 1NASA 4B80A 3AR6A 5KVSA 2QQGA 4B09A 2PHZA 1N8TA 1P9OA 1XQ9A 1X7XA 2GNPA 4OQDA 2ZRMA 3D9QX 2IOFA 2IUYA 3X2SA 1IN1A 3HY3A 5EWMA 5KNCH 2YN0A 1FMLA 3LNTA 5KNDH 3TXXA 2QSUA 4B5KA 3A0RB 3G2IA 5CNIA 4ZAXA 4UJ5A 1DAFA 2FF7A 4WS9A 2C4MA 2ENUA 3A6HA 3PLAE 4EYOA 3U3OA 1KVSA 4MYRA 4ZA2A 2XE7A 3JZDA 1J00A 8ADHA 4FUQA 4ZVVA 2IYRA 4V0NA 3LGSA 3E9RA 2GYYA 2FR1A 1V35A 2G7ZA 3B3GA 3A06A 3HXQA 4BFYA 5HR5A 2HXYA 2GMWA 4F2WA 4JUFA 1SC3A 3FHJA 3DMHA 1CVLA 3PFCA 1JDJA 1LLUA 3JATB 4RGBA 1P72A 3QG5A 2IU0A 3PUIA 4Y6GB 2Q4DA 4DREA 3UEOA 3OFSA 2FMFA 4WT7A 1FMJA 2Y9PB 5EZYF 3FETA 4OCZA 3KXWA 1MGOA 1RHUA 3SXUB 4UVDA 2VTEA 4YAUA 1IQPA 4EKEA 1NOIA 3VV3A 1OJLA 3PVSA 2PT7G 1TUBA 5A71A 1N1MA 1BMFD 4NBTA 5JSUA 2O8DB 3DVAB 1P1HA 3D8UA 3KJXA 5EQJB 3V8PA 4NHEA 1V8OA 3EWSA 1I14A 1B16A 1JLRA 2G82A 1W75A 4DR7C 3AY7A 1CTQA 1RT9A 3I01M 1VOTA 4FDVA 5HFJA 3I34X 3LT0A 4OAPA 4DIMA 5DLEA 3BT7A 1AKWA 3P0HA 1WM1A 2DC1A 3EDYA 3PHCA 5EN4A 3GFFA 4GIBA 1NVTA 2D1RA 4PLZA 5CBPB 3B82A 4Y2GA 3GAZA 1N9GA 4CVNA 2PSJA 1NQTA 1ZZGA 3GVXA 3MWEA 1NGSA 1BKSB 4UTNA 1OZ0A 2ZCJA 4NBLA 4II3A 4L3VA 2OOSA 5LBTA 5KTKA 2GCOA 2VYND 3R5TA 1ZRNA 4XW2A 1D6NA 4UATA 3T12A 1PSZA 3G2OA 5EKSA 4F6RA 1TAUA 3PFKA 4CKZA 2XVYA 2EKPA 1MN6A 3H5NA 4EJ2A 5K0TA 2O2SA 1BKYA 3IFSA 1E3JA 3IP3A 3NHAA 4Z4FA 1XRQA 5IMSA 1M34B 2JD1A 3HU2A 4P98A 5JZMA 3HWX1 3SYMA 2FAXA 3OJEA 4B75A 3HB7A 1A8HA 1KC3A 2JRCA 2WVHA 4N1AA 1ZD9A 5FI1B 5BN4B 5HXAA 2CLEB 3JYLA 2P5SA 5G0VA 1YVUA 1HTTA 1XTBA 1EFTA 1ODSA 4KXMA 4TXLA 4A0SA 3IKTA 3HL0A 5KHOC 2FG5A 2HU8A 3AB8A 2J3KA 1RBZA 1E7YA 2Q49A 5D1HA 4TV8F 4WLUA 1VLLA 4BLPA 4GGMX 3EPPA 2CT8A 2ZAMA 3FWYA 4F0JA 5ELLA 2AVDA 3S0JA 1IM2A 1KAHA 1E2PA 4JB8A 4E08A 4C14A 3R9XB 3E9NA 1A2OA 4Q19A 4UKDA 2QLTA 3BFPA 4QYSA 3FN4A 5BYKA 3WMFA 2QENA 3LVFO 2V5UA 3GO4A 3HBFA 5BYAA 5L3QA 1SFRA 3ORFA 2X0DA 2IUTA 1U8CB 2G0NA 3BQ9A 1CR1A 5J2UA 3VR5D 1D5WA 1RXYA 2D1FA 2RIRA 5LL6P 3RKRA 3ZVLA 2XCSB 1DVRA 1OI2A 4ABYA 2K4MA 4NL4H 3ITKA 2NT4A 3V2UA 3NHSA 2LR0A 3C3DA 1JU3A 5SY9A 4NICA 1IL0A 2ZU0C 3EW9A 3FDZA 3QU2A 5FULA 5TMEA 1UBUS 4EFKA 2PUCA 1GGEA 2ZYSA 2D1QA 3D02A 4J7CA 1O5IA 5EJIA 2H5IA 1GA1A 2JIRA 4JOSA 4QPNA 5LZ7A 2W83A 2CBGA 2X42A 3BZBA 1A1VA 4LK2A 4G0ZA 1Q7CA 4JYZA 4L0CA 2B4YA 4CM7A 4F4IA 1MG0A 3AINA 1IG3A 4UPDA 2FB9A 5TJ9A 5REQA 1XG5A 3C3AA 5IN5A 3KR0A 2CFTA 4LECA 1PJZA 4B0OA 4MS4B 5IVHA 1ZJYA 2E4ZA 3F1LA 4OVKA 3C39A 4B4UA 1WETA 2C04A 2WMDA 1ONSA 5A4AA 1BGXT 2X2OA 1EHCA 2YZMA 3GZ4A 1K5GA 1ORHA 2ATXA 4CMIA 3RWBA 5C18A 3ZW8A 2R6HA 4FBGA 4JYPA 5FORA 2A0XA 5K05A 5DM4A 4D4MA 2IUFA 2CLFB 1DUIA 2OV3A 2COEA 3DC7A 1GPDG 3QHPA 3CU5A 4OYCA 3G5AA 3IJRA 5DHAA 4E2FA 1K5DA 3VAAA 1OT5A 2AV6A 2D13A 2XITA 2Q3EA 2PGOA 3EAQA 3JW8A 4JA0A 1CUWA 4J1TC 3V4VB 4KR3A 3RU7A 1E32A 3QVSA 4Y0AA 3WGJA 3IS3A 4JEHA 2MYTA 1E7MA 2W58A 5L3ZA 2OBLA 3PGA1 1ULTA 3TTUA 2XAUA 5FR1A 1EM6A 5ALIA 3NWOA 5E2AA 3MN1A 2EJVA 1WXEA 1EWVA 1FC0A 4TWJA 3BC1A 3QPAA 4WVFA 2OCDA 1U3FA 2IHUA 2FRVA 1ZH0A 3CUTA 1KNXA 3FD8A 4JXZA 3DDWA 2A57A 3VDQA 2AE2A 2W4IA 2QJOA 3EUAA 4H1VA 4RTMA 1N57A 1I94C 1I1HA 2OBNA 3KHSA 4QU8A 4LF9B 1FE8A 1Z25A 4Q1BA 3M3PA 2AMFA 1A4IA 1G5HA 2TS1A 2R8ZA 3DTYA 1AC5A 4KO4S 1H2YA 1L7RA 2NLOA 1YTUA 1BX0A 3PFBA 2RK6A 1KO7A 4NENB 3PGMA 2HB6A 4XDHA 4B43A 3T5BA 2XSZD 1ZMRA 3GOQA 1QRAA 2WEKA 3SVZA 2HGSA 3TOXA 2O1XA 1Z8NA 3Q10A 4RZXA 5K45A 3OLVA 3W06A 3NAQA 3F0TA 4UW9A 3P45A 3BWCA 3ORHA 5JMTA 2X6TA 4FCVA 2H1HA 2CBZA 4MRMA 4RUKA 1N6OA 1XNRC 5EIWA 3UGJA 5CYPA 3OJCA 1PTKA 4DV4C 1QCDA 2CUTA 3G8CA 5DXJA 4CUJA 4DV0B 2QAIA 3T94A 2F1HA 3U4QB 4OHOA 4BCCA 4I1PA 2WBLC 1E0DA 4V1CI 3MCVA 4D44A 5I7WA 5J1SB 4LTNA 4PIPA 4KFCA 4UZFA 1NVFA 2G8LA 4MQLA 3V7FA 2EL9A 2E87A 4MVJA 4Y8VA 4RTSA 4KGXA 5EXXA 1VE1A 4HXEB 3F6CA 4GOOD 2BI8A 4KWHA 1OKKA 2RBGA 1VHWA 3HKCA 1NXXA 2A9VA 2WYHA 3L0SA 1S2DA 4RTJA 1T1RA 4EQ6B 5FFNA 2P6RA 1LJUA 2XDWA 2AWNA 4OJTA 4X71A 2Q4OA 3RC2A 4CQLA 3AOGA 4DMLA 1K0FA 2ILVA 2K6GA 2AC4A 2Q2QA 3SQOA 4Q4JB 3PWZA 4QTTB 5JW6A 1JJVA 4AS2A 5CEJA 4MR8B 2PZGA 1FYEA 2QGZA 1XV5A 2DUJA 3TS1A 3IRUA 1GZ3A 4IJMA 1FFYA 2XUFA 1RQRA 4RVHA 3GLIB 1F12A 3V8BA 1K8XB 3UMVA 1OTYA 4E30A 1Q14A 4QO7A 3ZHUA 4TWRA 1FXWF 1XIVA 4D8UA 2W6PA 3UOGA 3CWQA 5HMMA 2ZZMA 2HWXA 4TLEA 1N2EA 1TYDE 1GV0A 1ZUD1 2A7QA 2RI6A 3DJYA 4K05A 4XGKA 3L1HA 1ENYA 2JH3A 3CINA 5FTKA 4ISCA 1NVAA 3R8FA 2A94A 3LPNA 1NQWA 2FPPB 4FGSA 1WS6A 2DP4E 2UVPA 3HJHA 4AC9A 4EJ6A 1APBA 1L4YA 2B8WA 1KZYC 4BNXA 1B8OA 3F7TA 3P9YA 3C8UA 2O57A 3FPEA 4AULA 4BQOA 1R3DA 2D7CA 3EXFA 3H05A 1ZH4A 4B7ZA 5KPDA 4LRQA 4URVR 5LXTF 3C5VA 3OUUA 2P1DA 5D7NA 4YREA 1L7BA 2GF2A 2JJQA 2JLSA 3QTBA 4O2AA 1SHKA 4RJ2A 2DQZA 5E9AA 1J0CA 3HMQA 3UWKA 2N47A 1RXCA 1ZR2A 4DWOA 4ZCRA 3DLBA 1J42A 2W2LD 1TQ4A 1RIFA 1XYGA 4MRVA 2FP3A 1RJDA 3HCBA 3VC2A 3WNZA 2ZIXA 3MZ0A 3ZTTA 2QUZA 4K2AA 2IQ5A 2X4GA 2M6RA 3NHFA 2JGDB 5KAPA 3MD0A 4C06A 2P4UA 2PL3A 3ORYA 1PT9A 5IC5A 3WYDA 4LBWA 1PT7A 2CZQA 2OLJA 3R2JA 1Y8RA 4C7JA 4KJZA 1JXAA 1R12A 3QLUA 5H81A 5TPWB 9LDBA 4F6CA 4LOLA 3QVOA 4TYPA 1JQAA 3F97A 3EC2A 4YTEA 4AIIA 3EOAI 3V42A 2XYVA 3T54A 2R44A 1W4BA 2GB4A 4GXRA 1JKXA 2RHCA 2XBLA 2IP4A 3TD9A 3NM6B 3JZFA 3A3NA 1HQYE 2FSIA 2LIPA 3FCAA 4L2IB 4QARA 3O0DA 1GGVA 1WEKA 3BMNA 3C8DA 2OV4A 4QDJA 3NI2A 1SU4A 1Z2AA 4C4OA 1Q91A 3W8NA 3QE2A 3E5HA 3AR2A 2GUGA 3RUDA 5H8WA 3SHWA 3U26A 4FMDF 3F9CA 1NIJA 4K9DA 3P1JA 1RG9A 1QG6A 4M8IA 4QECA 4J0KA 5SV2A 1WSWA 4MUIA 4YECA 2F2TA 3LYUA 4IVNA 2Q5CA 5K3BA 3RVRA 4B6FA 5JJKA 4E14A 1U8UA 2I4LA 2IZ7A 1CUDA 3QEJA 1NKTA 4BNIA 2SHKA 3A2NA 1WD5A 3JTEA 1Y89A 1R8JA 1PFVA 2ERYA 2QRGA 3KJGA 3OMWA 5FADA 4YMTA 4BKMA 1O0CA 4P54A 3HU1A 5I5EA 2VAXA 2GD6A 3JWGA 3I45A 4DEVA 2OVFA 3KXKA 3C6KA 3KXIA 5EI5A 1JEEA 2FPKA 5CJJA 1Z18A 3TGWA 4IJKA 6ABPA 1UBKS 3CF0A 3TB4A 4B3RC 5EIXA 3BVPA 3HBJA 3M6VA 5LDGA 4NF2A 3H19A 1VPDA 1H4VB 3ESXA 4GXTA 4MVCA 3QF4B 3Q9LA 4A6DA 2FEKA 2Q2NA 2ZT8A 1RMYA 2CMHA 2GLXA 2QP3A 2SKEA 5CM2Z 1MX9A 3RIEA 4C7VA 1GCUA 4GI1A 3JVDA 4O2BF 4YLGA 5BSMA 1EP2B 2OXFA 1P2SA 2P9TA 2WDZA 3M6IA 4J6EA 5LA6F 5BR7A 3DL2A 3RG8A 1IEVA 3UJHA 4Y1GA 1C7JA 2FYTA 2IEYA 3UAVA 3VPHA 4CM4B 2YBDA 1RYYA 1G5IA 1MFPA 4YUXA 2ZJ3A 4JBWA 2YZNA 1Q0UA 3LBNA 5EQTA 4DS3A 5EPOA 4CT4B 2RG1A 1QG0A 4BZXA 2AB0A 5JYDA 1PJ3A 3L7AA 1KAOA 2AR7A 4M0DA 1KEUA 5AICA 4CL0A 4OHYA 1TCUA 1BVYF 2GO7A 2YZ2A 1UKYA 3KJFA 3KL2A 1XP8A 4FGZA 5G0WA 1CRZA 1AZTA 4EMTA 1UCFA 3AFNA 4ROSA 4CI9A 1USGA 4QG3A 4MS1B 2WT4A 3GHYA 3NTXA 4K9RA 5M29A 4AJ9A 4DA9A 4NZNA 3U7FB 1W7AA 1IQ0A 1ZUWA 2KWIA 3HHPA 3E4DA 3O75A 1YZHA 2XCOA 3QKTA 5CEEA 3V4SA 3QBEA 4A0RA 3AR7A 1PN3A 1DB3A 2I87A 2P1RA 5JI3E 4Z2AA 3O9ZA 4P7BA 3DMTA 2FEXA 3R41A 4H7FA 4MQMA 1WW8A 3GXBA 3CVWA 3E03A 4DUZB 3MGCA 1COWD 4KLNA 1TUIA 2AH5A 1E6MA 1PGQA 4L5IA 4Y0NA 2DG2A 4LE2A 4OMUA 5CG2A 3F78A 3G6WA 1GZ5A 1ISMA 2AW5A 2HX1A 3OCCA 4LJAA 5EERA 3TEFA 3O83A 4DV7C 2JIZA 4OQEA 1SA0A 1EWRA 4W5RA 3ZE8A 1PK7A 1PNOA 5IH7A 1GRRA 1VLHA 4XIGS 5K3EA 3DE3X 5IT9D 1QJ4A 4HLCA 4LNUA 3E9DA 4PF1A 5G0SA 3AV3A 5I8WA 2J4CA 2J3EA 3IR7A 4C1BA 3E7FA 3H4MA 4GWKA 4ILEA 4DWJA 3QA3E 3RSCA 1HLPA 3QGMA 3NDBB 1OPRA 4RTPA 2GDJA 4JV5B 1UFOA 1ZJ6A 3HB5X 4KV7A 4YACA 3TZQA 2WUDA 4AO6A 4DABA 3U3JA 5C9ZA 3Q7PA 3IUMA 4RULA 2P6PA 5FCDA 3I23A 3L0BA 2RHGB 3AOEA 4GL4A 4D3SA 3PA6A 4LOKA 3DLPX 3T3EA 1JLLA 4AL4A 3S5JA 3VNBA 2HH9A 4D46A 1YWGO 1Z13A 2FUEA 4BSZA 2ASVA 3DXYA 4OQMA 2DBRA 1P60A 3B5JA 5GGYA 1PGPA 2ZI9A 1JIVA 2I22A 2CKMA 2PCLA 1SM4A 3D7MA 2OD9A 2O7QA 3IBTA 1T5DX 5DEIA 1EDEA 5IYZB 3T7EA 3JS5A 3OIUA 1Q1EA 2QIPA 1A9PA 2VJCA 1M1YB 4JXKA 2GYVA 2VK4A 2WTBA 3Q7SA 3A8TA 1VG8A 1K2VN 1FLOA 4LF5C 3JQ7A 3U4IA 4URUR 4BKQA 2DETA 2F48A 1XA3A 4GVXA 1UBFA 4C7MA 1FTYA 1U9IC 2BM9A 4HDNA 2I5PO 3GR0A 2W37A 4CYMA 3L1UA 1V4NA 4A26A 2WTAA 4J29A 4DZZA 3ZGNA 4OXIA 4JP2A 2JBWA 4JI0C 3LQ1A 4R84A 3U7IA 1N36B 3X1JA 2M98A 2PUTA 2ZIEA 4QBGB 4YRZA 5LMUC 4MVJE 5HE9A 4YY3C 2C1XA 1GPWB 3BXHA 2WZBA 3H6KA 4BWYA 2CE7A 2B9EA 4F3YA 4UHDA 5TMDA 4KXQA 4KYUA 1UXKA 2ZWIA 2PUAA 2BM0A 4ZZ3A 5E8JA 5E6RB 1X1SA 2DLNA 2QPLA 4MCJA 4PHTA 2I4IA 4Q39A 4I9UA 1A5BB 1ZK3A 5IFIA 1IK6A 3ECSA 2Q8PA 3GUZA 9ABPA 2I2FA 3FVTA 1H22A 4E4RA 2KM1A 2P40A 5B1EA 3HV0A 1I7SB 4I1UA 4N5IX 2Q8QA 3HWSA 1G8PA 1YGPA 1T0JB 4X54A 4B5LA 1UBLS 1X80B 3ESRA 4ENTA 3LQYA 4Q0MA 1I2BA 5B58T 4Z4HA 3FJYA 2EX0A 4U2KA 4ENPA 3T0GA 1QYRA 2EAUA 4QTYA 5J43A 4BFWA 4QT4A 1HWYA 4A8PA 1D1PA 2Q0SA 2QL8A 5JEDA 4AXXA 1YT5A 2BGJA 2J9FB 2FI1A 2PO5A 3GGSA 4CE6A 5EHXA 4Q4HB 4GOXA 5K0GA 3NWJA 3QUQA 4FZRA 2DH6A 2GASA 3THOA 5C7OO 1TTQB 3GOHA 3PXAA 4DRZA 5IC4A 4HZUB 2I3AA 1CY1A 2I6SA 3GPDG 3L7BA 3NYWA 1FW8A 2FG7C 2Q5HA 2Y1EA 5EE9A 4OA5A 3TQSA 2AHOA 1GA6A 1RWPA 4JI3C 2Z6QA 4DDWA 3OPYB 2FOIA 4PNZA 4XR9A 2Q21A 4D81A 2C9CA 3M5DA 3ONFA 4KVAA 4UM7A 3N76A 1G8KA 2WTMA 1VDZA 3LZ6A 1MC1A 5CDSA 1PZFA 1KSGA 1LPOA 3AWDA 2PMWB 3RSLA 3WZ2A 1UJ6A 3GFTA 3M7IA 2NO0A 1BQ3A 2IS6A 1QU2A 2D0OB 4YDHB 1YB5A 2MJLA 3M1IA 2ZFUA 1L5RA 3HB9A 1N92A 2DVMA 1AKEA 2DKNA 4HO1X 4A2PA 2XRFA 4B3BA 4GX5A 1Q16A 5A9TA 2XXJA 2A3RA 3B2QA 1F38A 2EFDB 2FX5A 3ESYA 3LH5A 1S8AA 1G8YA 2G1AA 2P6UA 3C41J 4O1MA 1L8LA 4YEDA 5KTMA 2J07A 4BZPA 1U9JA 2YJ4A 2WF6A 3IPCA 2C88A 4BFZA 2FQQA 4DSUA 1BE0A 2J0QA 3Q3IA 4DV5C 1JA0A 1FLAA 1H2EA 1H0HA 1OWPA 2QJFA 3COZA 2H11A 3AM4A 3B6JA 3H84A 3SMQA 3LL7A 3FOZA 1E9SA 3UAWA 1WCJA 4ZLPA 3OPMA 5LZ8A 3N2ZB 4OXKA 4B8YA 4GW3A 4ZMRA 1TZKA 2FW1A 3DW1X 4RKRA 2CNDA 1MZVA 5H3CA 2E3JA 1BZYA 4IUBS 4XYGA 4AWBA 3ANYB 4LY0A 4YCNA 3FVVA 3D7RA 3CZ5A 2H2IA 1Y6GA 4NJMA 4W5WA 4HEHA 3EEOA 1M6HA 2R25B 2XUJA 3WL8A 2GN0A 4FLFA 4RZSA 2HCBA 4ZDWA 4A6XA 1DT5A 1VI5A 2W2KB 2QD2A 3NP7A 1S2OA 4M0KA 1V41E 5JSFA 1WKVA 4PZAA 1IBLB 1QRTA 1JQKA 3C4VA 1E2UA 4Q9KA 1SIOA 3SBDA 1FXSA 2G6BA 4UD2A 4AJNA 4PRLA 2Q99A 4A03A 4WAUA 2KLBA 3FYCA 3H2JA 2VJPA 4J0EA 1YQWA 1TJ3A 4Z9BA 4DJAA 1WCIB 5F2OA 3GCDA 3VAYA 2VG8A 2FSHA 2PRZA 3D6FA 5TS3A 4Z54A 4BX9A 4TKMA 1DWQA 3IDZA 1PZGA 1TVKB 3A9CA 4YI3A 1RXVA 3DTVD 3EXG1 3LYHA 4H77A 4WE3A 1HI9A 1MXHA 5L51A 3ZVRA 2MYPA 4R1LA 1VBKA 2J9GA 1JXOA 1U11A 3QIVA 4MI6A 1JYFA 3W4JA 5K8UA 3STYA 2O7NA 2FQYA 2YKGA 2YVQA 4FFPA 5PGMA 3V7NA 1XZGA 5CYFA 3O92A 3UMBA 1AS2A 1KF0A 4JR1A 1A98A 1WQ4A 5EEHA 4I8DA 5DM70 3AERA 3DL7A 1ORTA 5D84A 3R23A 4FGKA 1O96B 5EPEA 3T3IA 1JFRA 4R5MA 1UKZA 2SECE 3OT4A 3MTIA 2IW1A 4CUKA 2H6EA 4MR7A 1YS9A 4LMRA 3EPLA 1L3CA 1WV1A 2YWJA 3U60B 1P91A 2ZXFA 4WJKB 5BQOA 2OB1A 4KFTA 3RJZA 3N2NA 5FQNA 4C6RA 4E5NA 3Q11A 4RDCA 4P4UA 2GK4A 1QQ7A 3UAXA 4K03A 5DLPA 5DNVA 4OP1A 2QZZA 3DMNA 1WCV1 2W6QA 2YV3A 4RL4A 2A6PA 3D54D 3LYAA 2C3UA 3FR7A 4DR1B 2O5CA 2QDXA 3N2QA 2WNIA 4JVMA 1KYWA 1E64A 4E21A 4C88A 1XRMA 1VSVA 3P4XA 4Y9TA 2H9YA 3WV4A 2Q1SA 3JY6A 5I9MA 2VDKB 1FUGA 3BB1A 1USPA 3U2QA 4AZ0A 2O7RA 4X5OA 1PL0A 2XWQA 1FUEA 3ASUA 1XMOB 1N75A 1CK4A 2EGUA 3L6DA 3ZXUB 2XLCA 1IOVA 1HLGA 3NT4A 1OOEA 3FI0A 4X3CA 1RKXA 1WDTA 3V6MA 4PS0A 5A02A 1W96A 1FIUA 3S82A 3EARA 4ZVOA 2Z98A 5HUHA 4H1WA 3PL5A 2ZQZA 1JMVA 2PRKA 3KELA 4XM1A 3C3PA 5TX7A 3W5UA 3WC4A 2EZ4A 5B4VA 2ZUCA 4IY1A 1GFWA 2VPYA 3C3EA 1CR2A 5MGBA 3WHKA 3KQMA 4J4BA 4QXMA 5CCDA 4MRRA 3GN1A 1AQUA 1AXRA 1HFWA 3DYVA 1D9XA 4FW8A 1LLFA 3ETOA 1CY6A 1NUSA 1JEQA 4I4NA 4U7PB