2DYJA

Crystal structure of ribosome-binding factor a from thermus thermophilus hb8
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
91
structure length
91
Chain Sequence
GKAHLEAQLKRALAEEIQALEDPRLFLLTVEAVRLSKDGSVLSVYVEAFREEEGALRALSRAERRLVAALARRVRMRRLPRLEFLPWRASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural aspects of RbfA action during small ribosomal subunit assembly.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords Ribosome-binding factor A
total genus 28
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2dyjA00
4DV6C 1KKGA 3IEUA 1IBLC 4JI8C 1XMOC 4NXMC 1IBMC 4JI6C 4YHHC 4DV2C 4B3SC 4OX9C 3R9WA 4DR1C 1HR0C 4AQYC 5BR8C 1L2FA 2XR1A 3T1YC 3AF5A 4DUZC 1XMQC 4B3RC 1IBKC 1N32C 2E8EA 4DR6C 1I94C 2KZFA 2E5LC 4X64C 4DV7C 2E8CA 3J81D 1XNRC 2UUCC 4DR3C 4DV4C 4X66C 4DV1C 2VQEC 1NYEA 5FLXD 1J5EC 3AF6A 4DV0C 4NXNC 3T1HC 4DCSA 1WF3A 4LF5C 1ZB8A 1N34C 1HNZC 1ZB9A 1FJGC 2EGTA 4K0KC 1JOSA 3I07A 2ONFA 4JI7C 1N36C 3EERA 3JAMD 4BSZA 4LFBC 2UUAC 3IEVA 5LMUC 5A2QD 2OPLB 4YY3C 2UU9C 4GKJC 4DR4C 1UKKA 5LMNC 4GKKC 2HHHC 1USPA 3R9XA 1USPB 1EGAA 2VQFC 4LF4C 2UXBC 2UXDC 2JMPA 4JI4C 2ZM6C 2BJOA 3J80D 4NOZA 4DR7C 4JV5C 2UXCC 1XNQC 1K0RA 2YCBA 2E7GA 2PT7G 2CY1A 1N2FA 2HJGA 4JI2C 1HNWC 2QL8A 4LF6C 2ASBA 4LF7C 4LF8C 1ML8A 4JI5C 4JI3C 4B3TC 2F4VC 4MH4A 2D7VA 3CJEA 4LF9C 1LQLA 4MTNA 4XX2A 4B3MC 1QWIA 1HNXC 4DR2C 4LFAC 1PA4A 3LUSA 2CXCA 3GKUA 5IWAC 2UUBC 4LFCC 4DCVA 4X65C 4X62C 2DYJA 4DCTA 4KHPC 4DUYC 4DR5C 1N33C 4JI1C 1MKYA 1WH9A 2OPLA 4JI0C 3OTOC 4DV3C 2PN2A 4DV5C 5IT9D 2E8FA 4JYAC 1VLAA 2ATWA 4DCUA 1HH2P
chains in the Genus database with same CATH superfamily
4RLQA 1IBLC 5K8FA 4G37A 4FTFA 5GTDA 3A25A 4GXRA 1HR0C 1O93A 4RM2A 5BR8C 3A26A 1AMUA 1XMQC 4B3RC 3TUFA 3A9VA 4PHTA 2E5LC 4D56A 2NCLA 3DHVA 3RG2A 1NYEA 5BSUA 3DLPX 3AF6A 3LNOA 4DCSA 2P2BA 1MDFA 2P2QA 1XS3A 3UX2A 4LF5C 1N34C 2MCQA 4RLFA 1XRCA 4U5YD 5CZXA 4BSZA 1YJ7A 5LMUC 2VSQA 2VZEA 2HHHC 1USPA 1WCJA 1VEHA 4WV3A 4LF4C 5BSMA 2BJOA 3K6RA 4FUTA 3CQ2A 2UXCC 4ODJA 3R44A 3A4IA 2PT7G 2HJGA 1HNWC 4LF6C 3UEBA 5CZVA 1IB8A 4JM1A 4MH4A 3CJEA 4PUHA 5AE3A 3O2EA 1LQLA 4MTNA 2Y4OA 1RG9A 4IR7A 1QWIA 1HNXC 4LFAC 1PA4A 3GKUA 2ZZMA 3G7SA 4DCTA 4ZLPA 3CW8X 4DUYC 1PG4A 5KYTA 1MKYA 1WH9A 2D1QA 4JI0C 4DG9A 2E8FA 4JYAC 1PG3A 1KKGA 4LE5A 4NXMC 2YX1A 3ETCA 4YHHC 4DV2C 2E0GA 3R9WA 1MXCA 4AQYC 2XR1A 3T1YC 4DUZC 4PROC 4OYCA 1IBKC 5DV9A 4KTVA 4KTTA 4BC7A 4PUGA 4ZJZA 1NY8A 2P2JA 2E8CA 5BSTA 3J81D 4WS9A 1XNRC 4DV4C 4RVOA 1P7LA 4DV1C 5T8TA 4D57A 4DV0C 4NXNC 3T1HC 2DPLA 3LAXA 5KEIA 5A19A 4L7IA 1V25A 3A9UA 5LCIA 2JNVA 3EQ6A 2OPLB 4DR4C 5KYVA 4D4GA 3KXWA 4GKKC 3R9XA 3UZ0A 5BSWA 1USPB 1EGAA 3VNSA 1BA3A 2D27A 3I08A 1RY2A 2JMPA 2D1RA 5H9UA 2P2FA 3L8CA 1PU1A 2E7GA 1FUGA 3B7WA 3LGXA 4GS5A 2ASBA 2DHMA 1M6XA 4LF8C 3DAYA 4JI3C 4B3TC 3C5EA 2D7VA 3GR1A 2OBVA 4XX2A 1V60A 5AE2A 4D4IA 5IWAC 3UOWA 4DCVA 3VNQA 4GXQA 2DYJA 4TPSB 4L4QA 5BUQA 3H2TA 3E7XA 1UWDA 2D1SA 4IZ6A 4DCUA 1HH2P 4DV6C 3IEUA 4JI8C 2MM9A 4JI6C 4B3SC 3RV2A 4HPVA 3SO4A 1FLOA 1MDBA 5IFIA 3AF5A 2AYAA 2YWBA 5ADZA 3TDEA 2Z51A 4DR6C 4PZPA 2KZFA 4X64C 3CW9A 3VNRA 2UUCC 4PUIA 5BURA 2P20A 1J5EC 4K0BA 2BH1X 1P4EC 1WF3A 3PROC 3FCCA 3S82A 1MXBA 2M5OA 1ZB9A 1FJGC 2EGTA 3FCEA 4K0KC 2ONFA 2QW0X 1XHJA 1V26A 1O9TA 2V7BA 3IEVA 5A2QD 2UU9C 4GKJC 3TR3A 4EATA 5LMNC 1MD9A 2UXDC 1QM4A 2KZ0A 2ZM6C 3NYQA 2OO4A 3ETOA 3TQIA 4R0MA 1XNQC 2YCBA 1M6XC 2QVZX 3NYRA 2P02A 4LF7C 2Y4NA 2QVYX 1ML8A 4JI5C 2F4VC 4LF9C 1MXAA 4RMNA 4B3MC 1P4EA 3CQ3A 3PESA 4DR2C 5AE1A 2CXCA 4LFCC 2PROA 2WD9A 4X62C 4I9FA 4G36A 5E7QA 3CQ1A 3UX3A 1N33C 3L95X 4BBYA 4RM3A 1VLAA 5BUSA 4R1MA 1XMOC 4BC9A 1IBMC 3GR0A 3AY0A 4OX9C 4DR1C 1L2FA 2P2MA 3IPLA 3NI2A 2E8EA 1N32C 3LNVA 2D28C 1I94C 4DV7C 4R1LA 5K85A 4DR3C 4X66C 4NDNA 5A1GA 2VQEC 3N2QA 5FLXD 1O92A 4FUQA 3NPDA 3IMLA 1XRBA 1ZB8A 5JRHA 1T5HX 1HNZC 2D1TA 4OXIA 2MMAB 1TH5A 1JOSA 3I07A 4JI7C 1N36C 3EERA 3JAMD 4LFBC 2UUAC 4YY3C 2QVXX 2YWCA 2KDNA 5A1IA 1UKKA 3PBKA 2ZZNA 5BSVA 1XRAA 2VQFC 2UXBC 4JI4C 3J80D 4I9GA 4NOZA 5T8SA 4DR7C 4JV5C 4G1IA 1K0RA 2CY1A 1N2FA 4JI2C 4ISBA 2QL8A 3GPCA 1ULTA 1T5DX 2CU6A 2WP0C 4DG8A 2M5HA 4BCAA 3N54B 3E7WA 1LCIA 3LUSA 4L2ZA 2UUBC 4X65C 4KHPC 1O90A 4DR5C 2Y27A 4JI1C 2OPLA 3OTOC 4DV3C 2PN2A 4DV5C 1GPMA 5IT9D 2ATWA 4RVNA 5BSRA
chains in the Genus database with same CATH topology
4RLQA 1IBLC 5K8FA 4G37A 4FTFA 5GTDA 4GXRA 1HR0C 1O93A 4RM2A 5BR8C 1AMUA 1XMQC 4B3RC 3TUFA 3A9VA 4PHTA 2E5LC 4D56A 3DHVA 3RG2A 1NYEA 5BSUA 3DLPX 3AF6A 4DCSA 2P2BA 1MDFA 2P2QA 4LF5C 1N34C 4RLFA 1XRCA 4U5YD 5CZXA 4BSZA 1YJ7A 5LMUC 2VSQA 2VZEA 2HHHC 1USPA 4WV3A 4LF4C 5BSMA 2BJOA 4FUTA 2UXCC 4ODJA 3R44A 3A4IA 2PT7G 2HJGA 1HNWC 4LF6C 5CZVA 4JM1A 4MH4A 3CJEA 5AE3A 1LQLA 4MTNA 2Y4OA 1RG9A 4IR7A 1QWIA 1HNXC 4LFAC 1PA4A 3GKUA 3G7SA 4DCTA 4ZLPA 3CW8X 4DUYC 1PG4A 5KYTA 1MKYA 1WH9A 2D1QA 4JI0C 4DG9A 2E8FA 4JYAC 1PG3A 1KKGA 4LE5A 4NXMC 3ETCA 4YHHC 4DV2C 2E0GA 3R9WA 1MXCA 4AQYC 2XR1A 3T1YC 4DUZC 4PROC 4OYCA 1IBKC 5DV9A 4KTVA 4KTTA 4BC7A 4ZJZA 2P2JA 2E8CA 5BSTA 3J81D 4WS9A 1XNRC 4DV4C 4RVOA 1P7LA 4DV1C 5T8TA 4D57A 4DV0C 4NXNC 3T1HC 2DPLA 3LAXA 5KEIA 5A19A 4L7IA 1V25A 3A9UA 3EQ6A 2OPLB 4DR4C 5KYVA 4D4GA 3KXWA 4GKKC 3R9XA 3UZ0A 5BSWA 1USPB 1EGAA 3VNSA 1BA3A 2D27A 3I08A 1RY2A 2JMPA 2D1RA 5H9UA 2P2FA 3L8CA 2E7GA 1FUGA 3B7WA 3LGXA 4GS5A 2ASBA 4LF8C 3DAYA 4JI3C 4B3TC 3C5EA 2D7VA 3GR1A 2OBVA 4XX2A 5AE2A 4D4IA 5IWAC 3UOWA 4DCVA 3VNQA 4GXQA 2DYJA 4TPSB 4L4QA 5BUQA 3H2TA 3E7XA 2D1SA 4IZ6A 4DCUA 1HH2P 4DV6C 3IEUA 4JI8C 4JI6C 4B3SC 3RV2A 4HPVA 3SO4A 1MDBA 5IFIA 3AF5A 2AYAA 2YWBA 5ADZA 3TDEA 4DR6C 4PZPA 2KZFA 4X64C 3CW9A 3VNRA 2UUCC 5BURA 2P20A 1J5EC 4K0BA 2BH1X 1WF3A 3PROC 3FCCA 3S82A 1MXBA 1ZB9A 1FJGC 2EGTA 3FCEA 4K0KC 2ONFA 2QW0X 1V26A 1O9TA 2V7BA 3IEVA 5A2QD 2UU9C 4GKJC 4EATA 5LMNC 1MD9A 2UXDC 1QM4A 2ZM6C 3NYQA 2OO4A 3ETOA 3TQIA 4R0MA 1XNQC 2YCBA 2QVZX 3NYRA 2P02A 4LF7C 2Y4NA 2QVYX 1ML8A 4JI5C 2F4VC 4LF9C 1MXAA 4RMNA 4B3MC 3PESA 4DR2C 5AE1A 2CXCA 4LFCC 2PROA 2WD9A 4X62C 4I9FA 4G36A 5E7QA 1N33C 3L95X 4BBYA 4RM3A 1VLAA 5BUSA 4R1MA 1XMOC 4BC9A 1IBMC 3GR0A 4OX9C 4DR1C 1L2FA 2P2MA 3IPLA 3NI2A 2E8EA 1N32C 3LNVA 2D28C 1I94C 4DV7C 4R1LA 5K85A 4DR3C 4X66C 4NDNA 5A1GA 2VQEC 3N2QA 5FLXD 1O92A 4FUQA 3NPDA 3IMLA 1XRBA 1ZB8A 5JRHA 1T5HX 1HNZC 2D1TA 4OXIA 1JOSA 3I07A 4JI7C 1N36C 3EERA 3JAMD 4LFBC 2UUAC 4YY3C 2QVXX 2YWCA 5A1IA 1UKKA 3PBKA 5BSVA 1XRAA 2VQFC 2UXBC 4JI4C 3J80D 4I9GA 4NOZA 5T8SA 4DR7C 4JV5C 4G1IA 1K0RA 2CY1A 1N2FA 4JI2C 4ISBA 2QL8A 3GPCA 1ULTA 1T5DX 2WP0C 4DG8A 4BCAA 3N54B 3E7WA 1LCIA 3LUSA 4L2ZA 2UUBC 4X65C 4KHPC 1O90A 4DR5C 2Y27A 4JI1C 2OPLA 3OTOC 4DV3C 2PN2A 4DV5C 1GPMA 5IT9D 2ATWA 4RVNA 5BSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 C;  1KKG A;  3IEU A;  1IBL C;  4JI8 C;  1XMO C;  4NXM C;  1IBM C;  4JI6 C;  4YHH C;  4DV2 C;  4B3S C;  4OX9 C;  3R9W A;  4DR1 C;  1HR0 C;  4AQY C;  5BR8 C;  1L2F A;  2XR1 A;  3T1Y C;  3AF5 A;  4DUZ C;  1XMQ C;  4B3R C;  1IBK C;  1N32 C;  2E8E A;  4DR6 C;  1I94 C;  2KZF A;  2E5L C;  4X64 C;  4DV7 C;  2E8C A;  3J81 D;  1XNR C;  2UUC C;  4DR3 C;  4DV4 C;  4X66 C;  4DV1 C;  2VQE C;  1NYE A;  5FLX D;  1J5E C;  3AF6 A;  4DV0 C;  4NXN C;  3T1H C;  4DCS A;  1WF3 A;  4LF5 C;  1ZB8 A;  1N34 C;  1HNZ C;  1ZB9 A;  1FJG C;  2EGT A;  4K0K C;  1JOS A;  3I07 A;  2ONF A;  4JI7 C;  1N36 C;  3EER A;  3JAM D;  4BSZ A;  4LFB C;  2UUA C;  3IEV A;  5LMU C;  5A2Q D;  2OPL B;  4YY3 C;  2UU9 C;  4GKJ C;  4DR4 C;  1UKK A;  5LMN C;  4GKK C;  2HHH C;  1USP A;  3R9X A;  1USP B;  1EGA A;  2VQF C;  4LF4 C;  2UXB C;  2UXD C;  2JMP A;  4JI4 C;  2ZM6 C;  2BJO A;  3J80 D;  4NOZ A;  4DR7 C;  4JV5 C;  2UXC C;  1XNQ C;  1K0R A;  2YCB A;  2E7G A;  2PT7 G;  2CY1 A;  1N2F A;  2HJG A;  4JI2 C;  1HNW C;  2QL8 A;  4LF6 C;  2ASB A;  4LF7 C;  4LF8 C;  1ML8 A;  4JI5 C;  4JI3 C;  4B3T C;  2F4V C;  4MH4 A;  2D7V A;  3CJE A;  4LF9 C;  1LQL A;  4MTN A;  4XX2 A;  4B3M C;  1QWI A;  1HNX C;  4DR2 C;  4LFA C;  1PA4 A;  3LUS A;  2CXC A;  3GKU A;  5IWA C;  2UUB C;  4LFC C;  4DCV A;  4X65 C;  4X62 C;  2DYJ A;  4DCT A;  4KHP C;  4DUY C;  4DR5 C;  1N33 C;  4JI1 C;  1MKY A;  1WH9 A;  2OPL A;  4JI0 C;  3OTO C;  4DV3 C;  2PN2 A;  4DV5 C;  5IT9 D;  2E8F A;  4JYA C;  1VLA A;  2ATW A;  4DCU A;  1HH2 P; 
#chains in the Genus database with same CATH topology
 4RLQ A;  1IBL C;  5K8F A;  4G37 A;  4FTF A;  5GTD A;  3A25 A;  4GXR A;  1HR0 C;  1O93 A;  4RM2 A;  5BR8 C;  3A26 A;  1AMU A;  1XMQ C;  4B3R C;  3TUF A;  3A9V A;  4PHT A;  2E5L C;  4D56 A;  2NCL A;  3DHV A;  3RG2 A;  1NYE A;  5BSU A;  3DLP X;  3AF6 A;  3LNO A;  4DCS A;  2P2B A;  1MDF A;  2P2Q A;  1XS3 A;  3UX2 A;  4LF5 C;  1N34 C;  2MCQ A;  4RLF A;  1XRC A;  4U5Y D;  5CZX A;  4BSZ A;  1YJ7 A;  5LMU C;  2VSQ A;  2VZE A;  2HHH C;  1USP A;  1WCJ A;  1VEH A;  4WV3 A;  4LF4 C;  5BSM A;  2BJO A;  3K6R A;  4FUT A;  3CQ2 A;  2UXC C;  4ODJ A;  3R44 A;  3A4I A;  2PT7 G;  2HJG A;  1HNW C;  4LF6 C;  3UEB A;  5CZV A;  1IB8 A;  4JM1 A;  4MH4 A;  3CJE A;  4PUH A;  5AE3 A;  3O2E A;  1LQL A;  4MTN A;  2Y4O A;  1RG9 A;  4IR7 A;  1QWI A;  1HNX C;  4LFA C;  1PA4 A;  3GKU A;  2ZZM A;  3G7S A;  4DCT A;  4ZLP A;  3CW8 X;  4DUY C;  1PG4 A;  5KYT A;  1MKY A;  1WH9 A;  2D1Q A;  4JI0 C;  4DG9 A;  2E8F A;  4JYA C;  1PG3 A;  1KKG A;  4LE5 A;  4NXM C;  2YX1 A;  3ETC A;  4YHH C;  4DV2 C;  2E0G A;  3R9W A;  1MXC A;  4AQY C;  2XR1 A;  3T1Y C;  4DUZ C;  4PRO C;  4OYC A;  1IBK C;  5DV9 A;  4KTV A;  4KTT A;  4BC7 A;  4PUG A;  4ZJZ A;  1NY8 A;  2P2J A;  2E8C A;  5BST A;  3J81 D;  4WS9 A;  1XNR C;  4DV4 C;  4RVO A;  1P7L A;  4DV1 C;  5T8T A;  4D57 A;  4DV0 C;  4NXN C;  3T1H C;  2DPL A;  3LAX A;  5KEI A;  5A19 A;  4L7I A;  1V25 A;  3A9U A;  5LCI A;  2JNV A;  3EQ6 A;  2OPL B;  4DR4 C;  5KYV A;  4D4G A;  3KXW A;  4GKK C;  3R9X A;  3UZ0 A;  5BSW A;  1USP B;  1EGA A;  3VNS A;  1BA3 A;  2D27 A;  3I08 A;  1RY2 A;  2JMP A;  2D1R A;  5H9U A;  2P2F A;  3L8C A;  1PU1 A;  2E7G A;  1FUG A;  3B7W A;  3LGX A;  4GS5 A;  2ASB A;  2DHM A;  1M6X A;  4LF8 C;  3DAY A;  4JI3 C;  4B3T C;  3C5E A;  2D7V A;  3GR1 A;  2OBV A;  4XX2 A;  1V60 A;  5AE2 A;  4D4I A;  5IWA C;  3UOW A;  4DCV A;  3VNQ A;  4GXQ A;  2DYJ A;  4TPS B;  4L4Q A;  5BUQ A;  3H2T A;  3E7X A;  1UWD A;  2D1S A;  4IZ6 A;  4DCU A;  1HH2 P;  4DV6 C;  3IEU A;  4JI8 C;  2MM9 A;  4JI6 C;  4B3S C;  3RV2 A;  4HPV A;  3SO4 A;  1FLO A;  1MDB A;  5IFI A;  3AF5 A;  2AYA A;  2YWB A;  5ADZ A;  3TDE A;  2Z51 A;  4DR6 C;  4PZP A;  2KZF A;  4X64 C;  3CW9 A;  3VNR A;  2UUC C;  4PUI A;  5BUR A;  2P20 A;  1J5E C;  4K0B A;  2BH1 X;  1P4E C;  1WF3 A;  3PRO C;  3FCC A;  3S82 A;  1MXB A;  2M5O A;  1ZB9 A;  1FJG C;  2EGT A;  3FCE A;  4K0K C;  2ONF A;  2QW0 X;  1XHJ A;  1V26 A;  1O9T A;  2V7B A;  3IEV A;  5A2Q D;  2UU9 C;  4GKJ C;  3TR3 A;  4EAT A;  5LMN C;  1MD9 A;  2UXD C;  1QM4 A;  2KZ0 A;  2ZM6 C;  3NYQ A;  2OO4 A;  3ETO A;  3TQI A;  4R0M A;  1XNQ C;  2YCB A;  1M6X C;  2QVZ X;  3NYR A;  2P02 A;  4LF7 C;  2Y4N A;  2QVY X;  1ML8 A;  4JI5 C;  2F4V C;  4LF9 C;  1MXA A;  4RMN A;  4B3M C;  1P4E A;  3CQ3 A;  3PES A;  4DR2 C;  5AE1 A;  2CXC A;  4LFC C;  2PRO A;  2WD9 A;  4X62 C;  4I9F A;  4G36 A;  5E7Q A;  3CQ1 A;  3UX3 A;  1N33 C;  3L95 X;  4BBY A;  4RM3 A;  1VLA A;  5BUS A;  4R1M A;  1XMO C;  4BC9 A;  1IBM C;  3GR0 A;  3AY0 A;  4OX9 C;  4DR1 C;  1L2F A;  2P2M A;  3IPL A;  3NI2 A;  2E8E A;  1N32 C;  3LNV A;  2D28 C;  1I94 C;  4DV7 C;  4R1L A;  5K85 A;  4DR3 C;  4X66 C;  4NDN A;  5A1G A;  2VQE C;  3N2Q A;  5FLX D;  1O92 A;  4FUQ A;  3NPD A;  3IML A;  1XRB A;  1ZB8 A;  5JRH A;  1T5H X;  1HNZ C;  2D1T A;  4OXI A;  2MMA B;  1TH5 A;  1JOS A;  3I07 A;  4JI7 C;  1N36 C;  3EER A;  3JAM D;  4LFB C;  2UUA C;  4YY3 C;  2QVX X;  2YWC A;  2KDN A;  5A1I A;  1UKK A;  3PBK A;  2ZZN A;  5BSV A;  1XRA A;  2VQF C;  2UXB C;  4JI4 C;  3J80 D;  4I9G A;  4NOZ A;  5T8S A;  4DR7 C;  4JV5 C;  4G1I A;  1K0R A;  2CY1 A;  1N2F A;  4JI2 C;  4ISB A;  2QL8 A;  3GPC A;  1ULT A;  1T5D X;  2CU6 A;  2WP0 C;  4DG8 A;  2M5H A;  4BCA A;  3N54 B;  3E7W A;  1LCI A;  3LUS A;  4L2Z A;  2UUB C;  4X65 C;  4KHP C;  1O90 A;  4DR5 C;  2Y27 A;  4JI1 C;  2OPL A;  3OTO C;  4DV3 C;  2PN2 A;  4DV5 C;  1GPM A;  5IT9 D;  2ATW A;  4RVN A;  5BSR A; 
#chains in the Genus database with same CATH homology
 4RLQ A;  1IBL C;  5K8F A;  4G37 A;  4FTF A;  5GTD A;  4GXR A;  1HR0 C;  1O93 A;  4RM2 A;  5BR8 C;  1AMU A;  1XMQ C;  4B3R C;  3TUF A;  3A9V A;  4PHT A;  2E5L C;  4D56 A;  3DHV A;  3RG2 A;  1NYE A;  5BSU A;  3DLP X;  3AF6 A;  4DCS A;  2P2B A;  1MDF A;  2P2Q A;  4LF5 C;  1N34 C;  4RLF A;  1XRC A;  4U5Y D;  5CZX A;  4BSZ A;  1YJ7 A;  5LMU C;  2VSQ A;  2VZE A;  2HHH C;  1USP A;  4WV3 A;  4LF4 C;  5BSM A;  2BJO A;  4FUT A;  2UXC C;  4ODJ A;  3R44 A;  3A4I A;  2PT7 G;  2HJG A;  1HNW C;  4LF6 C;  5CZV A;  4JM1 A;  4MH4 A;  3CJE A;  5AE3 A;  1LQL A;  4MTN A;  2Y4O A;  1RG9 A;  4IR7 A;  1QWI A;  1HNX C;  4LFA C;  1PA4 A;  3GKU A;  3G7S A;  4DCT A;  4ZLP A;  3CW8 X;  4DUY C;  1PG4 A;  5KYT A;  1MKY A;  1WH9 A;  2D1Q A;  4JI0 C;  4DG9 A;  2E8F A;  4JYA C;  1PG3 A;  1KKG A;  4LE5 A;  4NXM C;  3ETC A;  4YHH C;  4DV2 C;  2E0G A;  3R9W A;  1MXC A;  4AQY C;  2XR1 A;  3T1Y C;  4DUZ C;  4PRO C;  4OYC A;  1IBK C;  5DV9 A;  4KTV A;  4KTT A;  4BC7 A;  4ZJZ A;  2P2J A;  2E8C A;  5BST A;  3J81 D;  4WS9 A;  1XNR C;  4DV4 C;  4RVO A;  1P7L A;  4DV1 C;  5T8T A;  4D57 A;  4DV0 C;  4NXN C;  3T1H C;  2DPL A;  3LAX A;  5KEI A;  5A19 A;  4L7I A;  1V25 A;  3A9U A;  3EQ6 A;  2OPL B;  4DR4 C;  5KYV A;  4D4G A;  3KXW A;  4GKK C;  3R9X A;  3UZ0 A;  5BSW A;  1USP B;  1EGA A;  3VNS A;  1BA3 A;  2D27 A;  3I08 A;  1RY2 A;  2JMP A;  2D1R A;  5H9U A;  2P2F A;  3L8C A;  2E7G A;  1FUG A;  3B7W A;  3LGX A;  4GS5 A;  2ASB A;  4LF8 C;  3DAY A;  4JI3 C;  4B3T C;  3C5E A;  2D7V A;  3GR1 A;  2OBV A;  4XX2 A;  5AE2 A;  4D4I A;  5IWA C;  3UOW A;  4DCV A;  3VNQ A;  4GXQ A;  2DYJ A;  4TPS B;  4L4Q A;  5BUQ A;  3H2T A;  3E7X A;  2D1S A;  4IZ6 A;  4DCU A;  1HH2 P;  4DV6 C;  3IEU A;  4JI8 C;  4JI6 C;  4B3S C;  3RV2 A;  4HPV A;  3SO4 A;  1MDB A;  5IFI A;  3AF5 A;  2AYA A;  2YWB A;  5ADZ A;  3TDE A;  4DR6 C;  4PZP A;  2KZF A;  4X64 C;  3CW9 A;  3VNR A;  2UUC C;  5BUR A;  2P20 A;  1J5E C;  4K0B A;  2BH1 X;  1WF3 A;  3PRO C;  3FCC A;  3S82 A;  1MXB A;  1ZB9 A;  1FJG C;  2EGT A;  3FCE A;  4K0K C;  2ONF A;  2QW0 X;  1V26 A;  1O9T A;  2V7B A;  3IEV A;  5A2Q D;  2UU9 C;  4GKJ C;  4EAT A;  5LMN C;  1MD9 A;  2UXD C;  1QM4 A;  2ZM6 C;  3NYQ A;  2OO4 A;  3ETO A;  3TQI A;  4R0M A;  1XNQ C;  2YCB A;  2QVZ X;  3NYR A;  2P02 A;  4LF7 C;  2Y4N A;  2QVY X;  1ML8 A;  4JI5 C;  2F4V C;  4LF9 C;  1MXA A;  4RMN A;  4B3M C;  3PES A;  4DR2 C;  5AE1 A;  2CXC A;  4LFC C;  2PRO A;  2WD9 A;  4X62 C;  4I9F A;  4G36 A;  5E7Q A;  1N33 C;  3L95 X;  4BBY A;  4RM3 A;  1VLA A;  5BUS A;  4R1M A;  1XMO C;  4BC9 A;  1IBM C;  3GR0 A;  4OX9 C;  4DR1 C;  1L2F A;  2P2M A;  3IPL A;  3NI2 A;  2E8E A;  1N32 C;  3LNV A;  2D28 C;  1I94 C;  4DV7 C;  4R1L A;  5K85 A;  4DR3 C;  4X66 C;  4NDN A;  5A1G A;  2VQE C;  3N2Q A;  5FLX D;  1O92 A;  4FUQ A;  3NPD A;  3IML A;  1XRB A;  1ZB8 A;  5JRH A;  1T5H X;  1HNZ C;  2D1T A;  4OXI A;  1JOS A;  3I07 A;  4JI7 C;  1N36 C;  3EER A;  3JAM D;  4LFB C;  2UUA C;  4YY3 C;  2QVX X;  2YWC A;  5A1I A;  1UKK A;  3PBK A;  5BSV A;  1XRA A;  2VQF C;  2UXB C;  4JI4 C;  3J80 D;  4I9G A;  4NOZ A;  5T8S A;  4DR7 C;  4JV5 C;  4G1I A;  1K0R A;  2CY1 A;  1N2F A;  4JI2 C;  4ISB A;  2QL8 A;  3GPC A;  1ULT A;  1T5D X;  2WP0 C;  4DG8 A;  4BCA A;  3N54 B;  3E7W A;  1LCI A;  3LUS A;  4L2Z A;  2UUB C;  4X65 C;  4KHP C;  1O90 A;  4DR5 C;  2Y27 A;  4JI1 C;  2OPL A;  3OTO C;  4DV3 C;  2PN2 A;  4DV5 C;  1GPM A;  5IT9 D;  2ATW A;  4RVN A;  5BSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...