2DYJA

Crystal structure of ribosome-binding factor a from thermus thermophilus hb8
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
91
structure length
91
Chain Sequence
GKAHLEAQLKRALAEEIQALEDPRLFLLTVEAVRLSKDGSVLSVYVEAFREEEGALRALSRAERRLVAALARRVRMRRLPRLEFLPWRASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural aspects of RbfA action during small ribosomal subunit assembly.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords Ribosome-binding factor A
total genus 28
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2dyjA00
4LF9C 1J5EC 2UXDC 5IWAC 4DR4C 4DUZC 1WH9A 4DR5C 1MKYA 1K0RA 4MTNA 5A2QD 2EGTA 4LFAC 1XNRC 3CJEA 1HNWC 3J80D 2UU9C 3R9WA 4MH4A 2BJOA 3EERA 1N2FA 4NOZA 4DV2C 4X62C 4AQYC 4JI0C 3T1HC 1IBLC 4DR7C 1N32C 4JI8C 3IEUA 4JV5C 4NXNC 1IBMC 2XR1A 2E8EA 5BR8C 4JI2C 4B3RC 1N33C 3GKUA 2VQFC 4DV3C 1FJGC 3LUSA 1XMQC 1HR0C 4X65C 4DR1C 4K0KC 2UUBC 1UKKA 2ASBA 4XX2A 1NYEA 1N34C 2UUCC 1QWIA 2E5LC 2CY1A 4KHPC 4JI7C 2YCBA 4JI1C 4DV4C 3AF5A 2F4VC 1ZB9A 1VLAA 4LF5C 2ATWA 5IT9D 1USPA 2E7GA 4DR2C 4NXMC 3IEVA 2D7VA 2ONFA 1XMOC 4LFBC 4LF4C 1HNZC 1LQLA 1XNQC 4X66C 1PA4A 1WF3A 2HJGA 3AF6A 4LF6C 2UXBC 4DCTA 2CXCA 1USPB 4DV7C 1I94C 3I07A 2ZM6C 4GKJC 4YY3C 2UUAC 4YHHC 1ML8A 1L2FA 1ZB8A 3T1YC 2HHHC 4LF7C 4DR3C 4DCSA 1KKGA 1HH2P 2UXCC 2PN2A 4DV5C 4JYAC 2DYJA 4DR6C 1EGAA 5FLXD 4JI3C 1IBKC 3R9XA 1JOSA 2E8CA 3J81D 2KZFA 2OPLA 2PT7G 2OPLB 1N36C 4DV6C 4DV1C 4LF8C 4DCVA 4DV0C 4LFCC 3JAMD 2VQEC 4DCUA 4JI4C 4OX9C 1HNXC 5LMUC 4GKKC 4DUYC 2JMPA 3OTOC 4X64C 5LMNC 4B3MC 4BSZA 4JI5C 4B3SC 4B3TC 4JI6C 2E8FA 2QL8A
chains in the Genus database with same CATH superfamily
1O93A 1J5EC 1WH9A 4DR5C 4TPSB 1K0RA 2PROA 2EGTA 1XNRC 3CJEA 3J80D 2UU9C 3UX3A 2BJOA 4DV2C 1N2FA 3T1HC 1IBLC 4DR7C 4PZPA 5A19A 4GXQA 5K8FA 3K6RA 4BCAA 3H2TA 3I08A 4JI2C 2P2BA 1XHJA 4B3RC 3NYQA 2VQFC 3UOWA 3FCCA 5JRHA 1WCJA 1XMQC 1HR0C 4K0KC 4DR1C 2P2FA 1N34C 1MDBA 1QWIA 4ISBA 2D1SA 3RG2A 4L4QA 1ZB9A 5ADZA 5IT9D 2E7GA 3VNQA 3FCEA 3PESA 3KXWA 3CW9A 4D4GA 4LF4C 1HNZC 1LQLA 1XNQC 4X66C 1PA4A 1P4EA 4RVNA 1V25A 2M5OA 3GR1A 2CXCA 1USPB 2YX1A 4PHTA 4K0BA 3I07A 5T8TA 2D28C 4D57A 1ML8A 1XRBA 2HHHC 4DR3C 4RVOA 5AE1A 1KKGA 3UX2A 3ETCA 4DV5C 4JYAC 4KTTA 4DR6C 1EGAA 3B7WA 1IBKC 2E8CA 3J81D 1ULTA 4HPVA 1MXAA 2E0GA 2YWCA 1QM4A 4LF8C 3N54B 4LFCC 5GTDA 3JAMD 4DCUA 3E7WA 4DUYC 1PG4A 2P20A 5KYVA 3ETOA 4BSZA 2V7BA 2QL8A 5H9UA 1TH5A 2JNVA 4LF9C 5IWAC 1MKYA 2P2JA 1AMUA 3R9WA 4MH4A 2MCQA 3N2QA 4AQYC 4X62C 4JI0C 2WD9A 2Y4OA 4JI8C 3IEUA 2D1TA 3IPLA 4JV5C 4L2ZA 4NXNC 2XR1A 5BR8C 3S82A 4OXIA 2D27A 3GKUA 3AY0A 4R0MA 5IFIA 3LUSA 1PG3A 2KDNA 1O9TA 1MXCA 4LF5C 2ATWA 1LCIA 1XMOC 4IR7A 3A26A 4G36A 2HJGA 4KTVA 5BSRA 2P2QA 3DLPX 3LNOA 4DV7C 1I94C 5E7QA 4RMNA 2ZM6C 2DHMA 3DHVA 4YHHC 3VNSA 4ZJZA 3T1YC 1RY2A 4GS5A 5BSWA 4DCSA 4FUQA 1HH2P 4DG9A 1FUGA 2DYJA 2WP0C 2QVYX 5FLXD 1MD9A 1JOSA 2KZFA 1P4EC 2MMAB 3TUFA 4ODJA 5CZVA 4JI4C 4ZLPA 4GKKC 4B3SC 4B3TC 4BC9A 4GXRA 4FUTA 3TDEA 2UXDC 5BSUA 4I9FA 4MTNA 5A2QD 4RLFA 3SO4A 4LFAC 2D1RA 1PU1A 3LNVA 1VEHA 3NPDA 3A9VA 3EERA 4NOZA 4RM3A 3L95X 1N32C 5K85A 4JM1A 3DAYA 3IMLA 4BC7A 4R1LA 1N33C 3RV2A 2P2MA 3L8CA 4DV3C 5T8SA 1BA3A 3UZ0A 3CQ2A 1XS3A 4WS9A 1UKKA 2UUBC 2ASBA 2VZEA 4XX2A 2E5LC 5BSTA 4KHPC 4JI7C 2YWBA 4DV4C 3AF5A 1VLAA 1USPA 2Z51A 3NYRA 4NXMC 3IEVA 2ONFA 4LFBC 3AF6A 2UXBC 4DCTA 2D1QA 1XRCA 1XRAA 5LCIA 4GKJC 3PBKA 2UUAC 3CQ3A 4I9GA 1ZB8A 3TQIA 2QW0X 5CZXA 2UXCC 5AE2A 2PN2A 3E7XA 2NCLA 3LGXA 1GPMA 2ZZMA 4JI3C 5KYTA 3R9XA 2AYAA 4BBYA 2OPLA 2OPLB 4DV6C 3GPCA 3TR3A 1M6XC 2P02A 4RM2A 4DCVA 4DV0C 5AE3A 5BSVA 2VQEC 5A1IA 3G7SA 1HNXC 2BH1X 5LMUC 5A1GA 4FTFA 1T5DX 4IZ6A 2JMPA 3OTOC 2Y27A 3GR0A 2CU6A 4B3MC 4JI5C 2VSQA 4JI6C 1FLOA 4DR4C 4DUZC 3A9UA 3A4IA 1HNWC 4PUGA 1RG9A 1YJ7A 3CW8X 1O90A 2KZ0A 4R1MA 5BURA 4DG8A 5BSMA 1P7LA 3EQ6A 3CQ1A 1NY8A 4RLQA 1IBMC 2QVZX 4PUIA 2E8EA 1MXBA 3PROC 4OYCA 1FJGC 2ZZNA 4X65C 1NYEA 2UUCC 2Y4NA 3LAXA 2CY1A 4G37A 2YCBA 4JI1C 2F4VC 2QVXX 2OBVA 4G1IA 4DR2C 5BUQA 2D7VA 2M5HA 2MM9A 4D4IA 3VNRA 5DV9A 1WF3A 4LE5A 4LF6C 1M6XA 1O92A 4NDNA 4YY3C 4PUHA 3O2EA 1L2FA 4LF7C 2DPLA 1V60A 3A25A 4EATA 4PROC 4L7IA 1IB8A 4WV3A 3UEBA 2PT7G 1N36C 5BUSA 4DV1C 3R44A 2OO4A 1T5HX 4OX9C 1V26A 3C5EA 4U5YD 5KEIA 3NI2A 4X64C 5LMNC 1MDFA 1UWDA 4D56A 2E8FA
chains in the Genus database with same CATH topology
1O93A 1J5EC 1WH9A 4DR5C 4TPSB 1K0RA 2PROA 2EGTA 1XNRC 3CJEA 3J80D 2UU9C 2BJOA 4DV2C 1N2FA 3T1HC 1IBLC 4DR7C 4PZPA 5A19A 4GXQA 5K8FA 4BCAA 3H2TA 3I08A 4JI2C 2P2BA 4B3RC 3NYQA 2VQFC 3UOWA 3FCCA 5JRHA 1XMQC 1HR0C 4K0KC 4DR1C 2P2FA 1N34C 1MDBA 1QWIA 4ISBA 2D1SA 3RG2A 4L4QA 1ZB9A 5ADZA 5IT9D 2E7GA 3VNQA 3FCEA 3PESA 3KXWA 3CW9A 4D4GA 4LF4C 1HNZC 1LQLA 1XNQC 4X66C 1PA4A 4RVNA 1V25A 3GR1A 2CXCA 1USPB 4PHTA 4K0BA 3I07A 5T8TA 2D28C 4D57A 1ML8A 1XRBA 2HHHC 4DR3C 4RVOA 5AE1A 1KKGA 3ETCA 4DV5C 4JYAC 4KTTA 4DR6C 1EGAA 3B7WA 1IBKC 2E8CA 3J81D 1ULTA 4HPVA 1MXAA 2E0GA 2YWCA 1QM4A 4LF8C 3N54B 4LFCC 5GTDA 3JAMD 4DCUA 3E7WA 4DUYC 1PG4A 2P20A 5KYVA 3ETOA 4BSZA 2V7BA 2QL8A 5H9UA 4LF9C 5IWAC 1MKYA 2P2JA 1AMUA 3R9WA 4MH4A 3N2QA 4AQYC 4X62C 4JI0C 2WD9A 2Y4OA 4JI8C 3IEUA 2D1TA 3IPLA 4JV5C 4L2ZA 4NXNC 2XR1A 5BR8C 3S82A 4OXIA 2D27A 3GKUA 4R0MA 5IFIA 3LUSA 1PG3A 1O9TA 1MXCA 4LF5C 2ATWA 1LCIA 1XMOC 4IR7A 4G36A 2HJGA 4KTVA 5BSRA 2P2QA 3DLPX 4DV7C 1I94C 5E7QA 4RMNA 2ZM6C 3DHVA 4YHHC 3VNSA 4ZJZA 3T1YC 1RY2A 4GS5A 5BSWA 4DCSA 4FUQA 1HH2P 4DG9A 1FUGA 2DYJA 2WP0C 2QVYX 5FLXD 1MD9A 1JOSA 2KZFA 3TUFA 4ODJA 5CZVA 4JI4C 4ZLPA 4GKKC 4B3SC 4B3TC 4BC9A 4GXRA 4FUTA 3TDEA 2UXDC 5BSUA 4I9FA 4MTNA 5A2QD 4RLFA 3SO4A 4LFAC 2D1RA 3LNVA 3NPDA 3A9VA 3EERA 4NOZA 4RM3A 3L95X 1N32C 5K85A 4JM1A 3DAYA 3IMLA 4BC7A 4R1LA 1N33C 3RV2A 2P2MA 3L8CA 4DV3C 5T8SA 1BA3A 3UZ0A 4WS9A 1UKKA 2UUBC 2ASBA 2VZEA 4XX2A 2E5LC 5BSTA 4KHPC 4JI7C 2YWBA 4DV4C 3AF5A 1VLAA 1USPA 3NYRA 4NXMC 3IEVA 2ONFA 4LFBC 3AF6A 2UXBC 4DCTA 2D1QA 1XRCA 1XRAA 4GKJC 3PBKA 2UUAC 4I9GA 1ZB8A 3TQIA 2QW0X 5CZXA 2UXCC 5AE2A 2PN2A 3E7XA 3LGXA 1GPMA 4JI3C 5KYTA 3R9XA 2AYAA 4BBYA 2OPLA 2OPLB 4DV6C 3GPCA 2P02A 4RM2A 4DCVA 4DV0C 5AE3A 5BSVA 2VQEC 5A1IA 3G7SA 1HNXC 2BH1X 5LMUC 5A1GA 4FTFA 1T5DX 4IZ6A 2JMPA 3OTOC 2Y27A 3GR0A 4B3MC 4JI5C 2VSQA 4JI6C 4DR4C 4DUZC 3A9UA 3A4IA 1HNWC 1RG9A 1YJ7A 3CW8X 1O90A 4R1MA 5BURA 4DG8A 5BSMA 1P7LA 3EQ6A 1IBMC 4RLQA 2QVZX 2E8EA 1MXBA 3PROC 4OYCA 1FJGC 4X65C 1NYEA 2UUCC 2Y4NA 3LAXA 2CY1A 4G37A 2YCBA 4JI1C 2F4VC 2QVXX 2OBVA 4G1IA 4DR2C 5BUQA 2D7VA 4D4IA 3VNRA 5DV9A 1WF3A 4LE5A 4LF6C 1O92A 4NDNA 4YY3C 1L2FA 4LF7C 2DPLA 4EATA 4PROC 4L7IA 4WV3A 2PT7G 1N36C 5BUSA 4DV1C 3R44A 2OO4A 1T5HX 4OX9C 1V26A 3C5EA 4U5YD 5KEIA 3NI2A 4X64C 5LMNC 1MDFA 4D56A 2E8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 C;  1J5E C;  2UXD C;  5IWA C;  4DR4 C;  4DUZ C;  1WH9 A;  4DR5 C;  1MKY A;  1K0R A;  4MTN A;  5A2Q D;  2EGT A;  4LFA C;  1XNR C;  3CJE A;  1HNW C;  3J80 D;  2UU9 C;  3R9W A;  4MH4 A;  2BJO A;  3EER A;  1N2F A;  4NOZ A;  4DV2 C;  4X62 C;  4AQY C;  4JI0 C;  3T1H C;  1IBL C;  4DR7 C;  1N32 C;  4JI8 C;  3IEU A;  4JV5 C;  4NXN C;  1IBM C;  2XR1 A;  2E8E A;  5BR8 C;  4JI2 C;  4B3R C;  1N33 C;  3GKU A;  2VQF C;  4DV3 C;  1FJG C;  3LUS A;  1XMQ C;  1HR0 C;  4X65 C;  4DR1 C;  4K0K C;  2UUB C;  1UKK A;  2ASB A;  4XX2 A;  1NYE A;  1N34 C;  2UUC C;  1QWI A;  2E5L C;  2CY1 A;  4KHP C;  4JI7 C;  2YCB A;  4JI1 C;  4DV4 C;  3AF5 A;  2F4V C;  1ZB9 A;  1VLA A;  4LF5 C;  2ATW A;  5IT9 D;  1USP A;  2E7G A;  4DR2 C;  4NXM C;  3IEV A;  2D7V A;  2ONF A;  1XMO C;  4LFB C;  4LF4 C;  1HNZ C;  1LQL A;  1XNQ C;  4X66 C;  1PA4 A;  1WF3 A;  2HJG A;  3AF6 A;  4LF6 C;  2UXB C;  4DCT A;  2CXC A;  1USP B;  4DV7 C;  1I94 C;  3I07 A;  2ZM6 C;  4GKJ C;  4YY3 C;  2UUA C;  4YHH C;  1ML8 A;  1L2F A;  1ZB8 A;  3T1Y C;  2HHH C;  4LF7 C;  4DR3 C;  4DCS A;  1KKG A;  1HH2 P;  2UXC C;  2PN2 A;  4DV5 C;  4JYA C;  2DYJ A;  4DR6 C;  1EGA A;  5FLX D;  4JI3 C;  1IBK C;  3R9X A;  1JOS A;  2E8C A;  3J81 D;  2KZF A;  2OPL A;  2PT7 G;  2OPL B;  1N36 C;  4DV6 C;  4DV1 C;  4LF8 C;  4DCV A;  4DV0 C;  4LFC C;  3JAM D;  2VQE C;  4DCU A;  4JI4 C;  4OX9 C;  1HNX C;  5LMU C;  4GKK C;  4DUY C;  2JMP A;  3OTO C;  4X64 C;  5LMN C;  4B3M C;  4BSZ A;  4JI5 C;  4B3S C;  4B3T C;  4JI6 C;  2E8F A;  2QL8 A; 
#chains in the Genus database with same CATH topology
 1O93 A;  1J5E C;  1WH9 A;  4DR5 C;  4TPS B;  1K0R A;  2PRO A;  2EGT A;  1XNR C;  3CJE A;  3J80 D;  2UU9 C;  3UX3 A;  2BJO A;  4DV2 C;  1N2F A;  3T1H C;  1IBL C;  4DR7 C;  4PZP A;  5A19 A;  4GXQ A;  5K8F A;  3K6R A;  4BCA A;  3H2T A;  3I08 A;  4JI2 C;  2P2B A;  1XHJ A;  4B3R C;  3NYQ A;  2VQF C;  3UOW A;  3FCC A;  5JRH A;  1WCJ A;  1XMQ C;  1HR0 C;  4K0K C;  4DR1 C;  2P2F A;  1N34 C;  1MDB A;  1QWI A;  4ISB A;  2D1S A;  3RG2 A;  4L4Q A;  1ZB9 A;  5ADZ A;  5IT9 D;  2E7G A;  3VNQ A;  3FCE A;  3PES A;  3KXW A;  3CW9 A;  4D4G A;  4LF4 C;  1HNZ C;  1LQL A;  1XNQ C;  4X66 C;  1PA4 A;  1P4E A;  4RVN A;  1V25 A;  2M5O A;  3GR1 A;  2CXC A;  1USP B;  2YX1 A;  4PHT A;  4K0B A;  3I07 A;  5T8T A;  2D28 C;  4D57 A;  1ML8 A;  1XRB A;  2HHH C;  4DR3 C;  4RVO A;  5AE1 A;  1KKG A;  3UX2 A;  3ETC A;  4DV5 C;  4JYA C;  4KTT A;  4DR6 C;  1EGA A;  3B7W A;  1IBK C;  2E8C A;  3J81 D;  1ULT A;  4HPV A;  1MXA A;  2E0G A;  2YWC A;  1QM4 A;  4LF8 C;  3N54 B;  4LFC C;  5GTD A;  3JAM D;  4DCU A;  3E7W A;  4DUY C;  1PG4 A;  2P20 A;  5KYV A;  3ETO A;  4BSZ A;  2V7B A;  2QL8 A;  5H9U A;  1TH5 A;  2JNV A;  4LF9 C;  5IWA C;  1MKY A;  2P2J A;  1AMU A;  3R9W A;  4MH4 A;  2MCQ A;  3N2Q A;  4AQY C;  4X62 C;  4JI0 C;  2WD9 A;  2Y4O A;  4JI8 C;  3IEU A;  2D1T A;  3IPL A;  4JV5 C;  4L2Z A;  4NXN C;  2XR1 A;  5BR8 C;  3S82 A;  4OXI A;  2D27 A;  3GKU A;  3AY0 A;  4R0M A;  5IFI A;  3LUS A;  1PG3 A;  2KDN A;  1O9T A;  1MXC A;  4LF5 C;  2ATW A;  1LCI A;  1XMO C;  4IR7 A;  3A26 A;  4G36 A;  2HJG A;  4KTV A;  5BSR A;  2P2Q A;  3DLP X;  3LNO A;  4DV7 C;  1I94 C;  5E7Q A;  4RMN A;  2ZM6 C;  2DHM A;  3DHV A;  4YHH C;  3VNS A;  4ZJZ A;  3T1Y C;  1RY2 A;  4GS5 A;  5BSW A;  4DCS A;  4FUQ A;  1HH2 P;  4DG9 A;  1FUG A;  2DYJ A;  2WP0 C;  2QVY X;  5FLX D;  1MD9 A;  1JOS A;  2KZF A;  1P4E C;  2MMA B;  3TUF A;  4ODJ A;  5CZV A;  4JI4 C;  4ZLP A;  4GKK C;  4B3S C;  4B3T C;  4BC9 A;  4GXR A;  4FUT A;  3TDE A;  2UXD C;  5BSU A;  4I9F A;  4MTN A;  5A2Q D;  4RLF A;  3SO4 A;  4LFA C;  2D1R A;  1PU1 A;  3LNV A;  1VEH A;  3NPD A;  3A9V A;  3EER A;  4NOZ A;  4RM3 A;  3L95 X;  1N32 C;  5K85 A;  4JM1 A;  3DAY A;  3IML A;  4BC7 A;  4R1L A;  1N33 C;  3RV2 A;  2P2M A;  3L8C A;  4DV3 C;  5T8S A;  1BA3 A;  3UZ0 A;  3CQ2 A;  1XS3 A;  4WS9 A;  1UKK A;  2UUB C;  2ASB A;  2VZE A;  4XX2 A;  2E5L C;  5BST A;  4KHP C;  4JI7 C;  2YWB A;  4DV4 C;  3AF5 A;  1VLA A;  1USP A;  2Z51 A;  3NYR A;  4NXM C;  3IEV A;  2ONF A;  4LFB C;  3AF6 A;  2UXB C;  4DCT A;  2D1Q A;  1XRC A;  1XRA A;  5LCI A;  4GKJ C;  3PBK A;  2UUA C;  3CQ3 A;  4I9G A;  1ZB8 A;  3TQI A;  2QW0 X;  5CZX A;  2UXC C;  5AE2 A;  2PN2 A;  3E7X A;  2NCL A;  3LGX A;  1GPM A;  2ZZM A;  4JI3 C;  5KYT A;  3R9X A;  2AYA A;  4BBY A;  2OPL A;  2OPL B;  4DV6 C;  3GPC A;  3TR3 A;  1M6X C;  2P02 A;  4RM2 A;  4DCV A;  4DV0 C;  5AE3 A;  5BSV A;  2VQE C;  5A1I A;  3G7S A;  1HNX C;  2BH1 X;  5LMU C;  5A1G A;  4FTF A;  1T5D X;  4IZ6 A;  2JMP A;  3OTO C;  2Y27 A;  3GR0 A;  2CU6 A;  4B3M C;  4JI5 C;  2VSQ A;  4JI6 C;  1FLO A;  4DR4 C;  4DUZ C;  3A9U A;  3A4I A;  1HNW C;  4PUG A;  1RG9 A;  1YJ7 A;  3CW8 X;  1O90 A;  2KZ0 A;  4R1M A;  5BUR A;  4DG8 A;  5BSM A;  1P7L A;  3EQ6 A;  3CQ1 A;  1NY8 A;  4RLQ A;  1IBM C;  2QVZ X;  4PUI A;  2E8E A;  1MXB A;  3PRO C;  4OYC A;  1FJG C;  2ZZN A;  4X65 C;  1NYE A;  2UUC C;  2Y4N A;  3LAX A;  2CY1 A;  4G37 A;  2YCB A;  4JI1 C;  2F4V C;  2QVX X;  2OBV A;  4G1I A;  4DR2 C;  5BUQ A;  2D7V A;  2M5H A;  2MM9 A;  4D4I A;  3VNR A;  5DV9 A;  1WF3 A;  4LE5 A;  4LF6 C;  1M6X A;  1O92 A;  4NDN A;  4YY3 C;  4PUH A;  3O2E A;  1L2F A;  4LF7 C;  2DPL A;  1V60 A;  3A25 A;  4EAT A;  4PRO C;  4L7I A;  1IB8 A;  4WV3 A;  3UEB A;  2PT7 G;  1N36 C;  5BUS A;  4DV1 C;  3R44 A;  2OO4 A;  1T5H X;  4OX9 C;  1V26 A;  3C5E A;  4U5Y D;  5KEI A;  3NI2 A;  4X64 C;  5LMN C;  1MDF A;  1UWD A;  4D56 A;  2E8F A; 
#chains in the Genus database with same CATH homology
 1O93 A;  1J5E C;  1WH9 A;  4DR5 C;  4TPS B;  1K0R A;  2PRO A;  2EGT A;  1XNR C;  3CJE A;  3J80 D;  2UU9 C;  2BJO A;  4DV2 C;  1N2F A;  3T1H C;  1IBL C;  4DR7 C;  4PZP A;  5A19 A;  4GXQ A;  5K8F A;  4BCA A;  3H2T A;  3I08 A;  4JI2 C;  2P2B A;  4B3R C;  3NYQ A;  2VQF C;  3UOW A;  3FCC A;  5JRH A;  1XMQ C;  1HR0 C;  4K0K C;  4DR1 C;  2P2F A;  1N34 C;  1MDB A;  1QWI A;  4ISB A;  2D1S A;  3RG2 A;  4L4Q A;  1ZB9 A;  5ADZ A;  5IT9 D;  2E7G A;  3VNQ A;  3FCE A;  3PES A;  3KXW A;  3CW9 A;  4D4G A;  4LF4 C;  1HNZ C;  1LQL A;  1XNQ C;  4X66 C;  1PA4 A;  4RVN A;  1V25 A;  3GR1 A;  2CXC A;  1USP B;  4PHT A;  4K0B A;  3I07 A;  5T8T A;  2D28 C;  4D57 A;  1ML8 A;  1XRB A;  2HHH C;  4DR3 C;  4RVO A;  5AE1 A;  1KKG A;  3ETC A;  4DV5 C;  4JYA C;  4KTT A;  4DR6 C;  1EGA A;  3B7W A;  1IBK C;  2E8C A;  3J81 D;  1ULT A;  4HPV A;  1MXA A;  2E0G A;  2YWC A;  1QM4 A;  4LF8 C;  3N54 B;  4LFC C;  5GTD A;  3JAM D;  4DCU A;  3E7W A;  4DUY C;  1PG4 A;  2P20 A;  5KYV A;  3ETO A;  4BSZ A;  2V7B A;  2QL8 A;  5H9U A;  4LF9 C;  5IWA C;  1MKY A;  2P2J A;  1AMU A;  3R9W A;  4MH4 A;  3N2Q A;  4AQY C;  4X62 C;  4JI0 C;  2WD9 A;  2Y4O A;  4JI8 C;  3IEU A;  2D1T A;  3IPL A;  4JV5 C;  4L2Z A;  4NXN C;  2XR1 A;  5BR8 C;  3S82 A;  4OXI A;  2D27 A;  3GKU A;  4R0M A;  5IFI A;  3LUS A;  1PG3 A;  1O9T A;  1MXC A;  4LF5 C;  2ATW A;  1LCI A;  1XMO C;  4IR7 A;  4G36 A;  2HJG A;  4KTV A;  5BSR A;  2P2Q A;  3DLP X;  4DV7 C;  1I94 C;  5E7Q A;  4RMN A;  2ZM6 C;  3DHV A;  4YHH C;  3VNS A;  4ZJZ A;  3T1Y C;  1RY2 A;  4GS5 A;  5BSW A;  4DCS A;  4FUQ A;  1HH2 P;  4DG9 A;  1FUG A;  2DYJ A;  2WP0 C;  2QVY X;  5FLX D;  1MD9 A;  1JOS A;  2KZF A;  3TUF A;  4ODJ A;  5CZV A;  4JI4 C;  4ZLP A;  4GKK C;  4B3S C;  4B3T C;  4BC9 A;  4GXR A;  4FUT A;  3TDE A;  2UXD C;  5BSU A;  4I9F A;  4MTN A;  5A2Q D;  4RLF A;  3SO4 A;  4LFA C;  2D1R A;  3LNV A;  3NPD A;  3A9V A;  3EER A;  4NOZ A;  4RM3 A;  3L95 X;  1N32 C;  5K85 A;  4JM1 A;  3DAY A;  3IML A;  4BC7 A;  4R1L A;  1N33 C;  3RV2 A;  2P2M A;  3L8C A;  4DV3 C;  5T8S A;  1BA3 A;  3UZ0 A;  4WS9 A;  1UKK A;  2UUB C;  2ASB A;  2VZE A;  4XX2 A;  2E5L C;  5BST A;  4KHP C;  4JI7 C;  2YWB A;  4DV4 C;  3AF5 A;  1VLA A;  1USP A;  3NYR A;  4NXM C;  3IEV A;  2ONF A;  4LFB C;  3AF6 A;  2UXB C;  4DCT A;  2D1Q A;  1XRC A;  1XRA A;  4GKJ C;  3PBK A;  2UUA C;  4I9G A;  1ZB8 A;  3TQI A;  2QW0 X;  5CZX A;  2UXC C;  5AE2 A;  2PN2 A;  3E7X A;  3LGX A;  1GPM A;  4JI3 C;  5KYT A;  3R9X A;  2AYA A;  4BBY A;  2OPL A;  2OPL B;  4DV6 C;  3GPC A;  2P02 A;  4RM2 A;  4DCV A;  4DV0 C;  5AE3 A;  5BSV A;  2VQE C;  5A1I A;  3G7S A;  1HNX C;  2BH1 X;  5LMU C;  5A1G A;  4FTF A;  1T5D X;  4IZ6 A;  2JMP A;  3OTO C;  2Y27 A;  3GR0 A;  4B3M C;  4JI5 C;  2VSQ A;  4JI6 C;  4DR4 C;  4DUZ C;  3A9U A;  3A4I A;  1HNW C;  1RG9 A;  1YJ7 A;  3CW8 X;  1O90 A;  4R1M A;  5BUR A;  4DG8 A;  5BSM A;  1P7L A;  3EQ6 A;  1IBM C;  4RLQ A;  2QVZ X;  2E8E A;  1MXB A;  3PRO C;  4OYC A;  1FJG C;  4X65 C;  1NYE A;  2UUC C;  2Y4N A;  3LAX A;  2CY1 A;  4G37 A;  2YCB A;  4JI1 C;  2F4V C;  2QVX X;  2OBV A;  4G1I A;  4DR2 C;  5BUQ A;  2D7V A;  4D4I A;  3VNR A;  5DV9 A;  1WF3 A;  4LE5 A;  4LF6 C;  1O92 A;  4NDN A;  4YY3 C;  1L2F A;  4LF7 C;  2DPL A;  4EAT A;  4PRO C;  4L7I A;  4WV3 A;  2PT7 G;  1N36 C;  5BUS A;  4DV1 C;  3R44 A;  2OO4 A;  1T5H X;  4OX9 C;  1V26 A;  3C5E A;  4U5Y D;  5KEI A;  3NI2 A;  4X64 C;  5LMN C;  1MDF A;  4D56 A;  2E8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...