2DYJA

Crystal structure of ribosome-binding factor a from thermus thermophilus hb8
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
91
structure length
91
Chain Sequence
GKAHLEAQLKRALAEEIQALEDPRLFLLTVEAVRLSKDGSVLSVYVEAFREEEGALRALSRAERRLVAALARRVRMRRLPRLEFLPWRASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural aspects of RbfA action during small ribosomal subunit assembly.
pubmed doi rcsb
molecule keywords Ribosome-binding factor A
molecule tags Ribosomal protein
source organism Thermus thermophilus
total genus 28
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2dyjA00
1UKKA 4JI1C 4DV0C 4DR4C 4DV4C 1L2FA 4X64C 1HNXC 1N2FA 4DCVA 1MKYA 2PN2A 1XMQC 4BSZA 4OX9C 2DYJA 1K0RA 1ZB9A 2CY1A 4X62C 3AF6A 2E8EA 4YY3C 2EGTA 1I94C 3R9WA 4DUZC 2XR1A 2YCBA 3OTOC 3JAMD 4JYAC 4X65C 4B3SC 5IWAC 3IEVA 2ASBA 2OPLA 4AQYC 4LFBC 2HJGA 2E8FA 4K0KC 4B3TC 1XNQC 1XNRC 2QL8A 1IBMC 4DUYC 4DCSA 4DR6C 4JV5C 1USPB 4DV5C 2UXBC 2VQFC 4JI8C 3J81D 4DR3C 1IBKC 3AF5A 4MH4A 4JI7C 1HH2P 2OPLB 5FLXD 1WH9A 5LMNC 2F4VC 2UUAC 2UU9C 2PT7G 2ZM6C 4DV7C 1HNZC 3EERA 2CXCA 4MTNA 4KHPC 4NXNC 4B3MC 3T1YC 2D7VA 1N36C 1WF3A 3J80D 1JOSA 2UXCC 2E7GA 4YHHC 4GKKC 2UUCC 4DV2C 2ATWA 3T1HC 4XX2A 1J5EC 2ONFA 2E5LC 4LF8C 4DCUA 1FJGC 3IEUA 1EGAA 4B3RC 2JMPA 1HNWC 3I07A 5LMUC 2UUBC 4JI4C 1PA4A 4DR1C 1HR0C 2UXDC 3R9XA 1KKGA 4LF4C 4JI0C 1ML8A 3CJEA 4DV3C 2BJOA 1LQLA 1QWIA 4DV1C 4JI5C 1N32C 4NXMC 2VQEC 4LF7C 3LUSA 4NOZA 2HHHC 4JI6C 4X66C 4DR7C 1USPA 4LFCC 4DR5C 4DR2C 4LFAC 1N33C 3GKUA 2E8CA 4DCTA 1VLAA 4JI2C 1NYEA 1IBLC 4DV6C 4JI3C 4GKJC 4LF6C 5A2QD 1N34C 1ZB8A 5IT9D 2KZFA 5BR8C 4LF9C 4LF5C 1XMOC
chains in the Genus database with same CATH superfamily
2P2JA 4WS9A 1O90A 1HNXC 2P02A 3PROC 2M5HA 1PG3A 4JM1A 4D56A 2KZ0A 3CW9A 3R9WA 4PUIA 2XR1A 4GS5A 2YCBA 4L2ZA 4FUQA 3UZ0A 3IEVA 5CZXA 3CW8X 1V25A 2HJGA 4RLQA 2E8FA 3RG2A 3CQ3A 1FUGA 2QL8A 3DAYA 5ADZA 4D57A 5BUSA 4JV5C 4OXIA 3LAXA 2P2QA 3K6RA 4DR3C 1IBKC 1MXCA 4MH4A 3O2EA 5FLXD 1AMUA 3A9VA 2D1SA 3LNVA 2UU9C 1ULTA 2D1QA 5A19A 4K0BA 2QVXX 4KHPC 4B3MC 4KTVA 3J80D 1P7LA 2UUCC 4RMNA 1M6XC 4U5YD 4D4IA 3ETCA 4DCUA 3IEUA 1EGAA 5K8FA 3FCCA 3L95X 1XRCA 2V7BA 4JI4C 1HR0C 1KKGA 3CJEA 2BJOA 1QWIA 2D28C 4LF7C 4GXQA 4TPSB 5AE1A 2Y4NA 4DR2C 4R1MA 4R1LA 4LFAC 3GKUA 2E8CA 1XRAA 4FUTA 3UOWA 1O9TA 1M6XA 1PU1A 4ODJA 2PROA 1IBLC 4EATA 2D27A 1ZB8A 5BR8C 4LF5C 1XMOC 2ZZMA 1UKKA 4JI1C 4RM2A 4DV4C 5T8TA 2MM9A 3VNRA 1N2FA 1XMQC 1ZB9A 2CY1A 3AF6A 2E8EA 4YY3C 2CU6A 1I94C 1YJ7A 4DUZC 3OTOC 4KTTA 1TH5A 2QVYX 4K0KC 4B3TC 1XNQC 2JNVA 1IBMC 2Z51A 4DG8A 5A1GA 1USPB 3A26A 3A9UA 3A25A 3J81D 3KXWA 3NPDA 3AF5A 4JI7C 1RY2A 5BSRA 1MD9A 2UUAC 4L7IA 5K85A 2ZM6C 4DV7C 3EERA 3UX3A 3S82A 4NXNC 2D7VA 1WF3A 1JOSA 3LNOA 4D4GA 3TDEA 4IR7A 4GKKC 3LGXA 1GPMA 3RV2A 1XS3A 3T1HC 4FTFA 4PROC 1J5EC 2ONFA 3I07A 2UUBC 3IMLA 2DHMA 4GXRA 2UXDC 5LCIA 5KEIA 3R9XA 4LF4C 1N32C 1ML8A 3EQ6A 2VQEC 2P2FA 4NOZA 2HHHC 3SO4A 4DR5C 2Y27A 3NI2A 5BSUA 5BSWA 3PESA 5DV9A 4NDNA 5BSMA 2WD9A 1NYEA 4GKJC 5A2QD 2KZFA 2QW0X 4DR4C 1L2FA 5GTDA 4G1IA 2ZZNA 4DCVA 1MKYA 2PN2A 4BSZA 2DYJA 4WV3A 3IPLA 3CQ1A 3C5EA 3JAMD 1P4EC 2AYAA 4X65C 4B3SC 4BBYA 2VSQA 3ETOA 3UX2A 1MXBA 3NYQA 5BUQA 4DUYC 5T8SA 1FLOA 4DR6C 2M5OA 2UXBC 4LE5A 1T5DX 2QVZX 4ZLPA 2P20A 1HH2P 5A1IA 1WH9A 3GR1A 1P4EA 5LMNC 2PT7G 5JRHA 2BH1X 1O93A 2CXCA 3T1YC 3I08A 1N36C 2P2BA 2E7GA 4YHHC 2ATWA 4IZ6A 4LF8C 1FJGC 5AE3A 4BC7A 2JMPA 5LMUC 4RM3A 3DHVA 3E7WA 1PA4A 4JI0C 4DV3C 1LQLA 5E7QA 4DV1C 4RVOA 3AY0A 3DLPX 1V26A 3TUFA 3N2QA 4JI6C 4X66C 1UWDA 4HPVA 1QM4A 1MDFA 1MDBA 2MMAB 2OBVA 3FCEA 3GPCA 1VLAA 4DCTA 4ZJZA 4BC9A 4PZPA 4DV6C 4JI3C 2E0GA 3E7XA 4LF6C 3TR3A 1N34C 2VZEA 5IT9D 5KYVA 3R44A 3NYRA 4DV0C 1BA3A 5BSVA 4X64C 1VEHA 2YX1A 4ISBA 2Y4OA 4OX9C 1K0RA 1XRBA 4X62C 2D1TA 2EGTA 3L8CA 4JYAC 5BSTA 2MCQA 2YWCA 3CQ2A 5KYTA 5IWAC 2ASBA 2OPLA 4L4QA 4AQYC 5BURA 4LFBC 1NY8A 4R0MA 1XNRC 1IB8A 4OYCA 4DCSA 3H2TA 4DV5C 2VQFC 1WCJA 2D1RA 4G36A 4JI8C 1MXAA 2DPLA 4PHTA 4I9GA 2OPLB 1V60A 2F4VC 2NCLA 3PBKA 1HNZC 4MTNA 3A4IA 2KDNA 4BCAA 1XHJA 2WP0C 2UXCC 1PG4A 4RVNA 4DV2C 4RLFA 4XX2A 2E5LC 4B3RC 3B7WA 1HNWC 5H9UA 4DR1C 1T5HX 4JI5C 4G37A 5CZVA 4NXMC 3TQIA 4DG9A 4I9FA 3LUSA 3UEBA 4DR7C 1USPA 4LFCC 1RG9A 3GR0A 2YWBA 2P2MA 3VNSA 1N33C 4PUGA 5IFIA 3N54B 4JI2C 4PUHA 2OO4A 3G7SA 1LCIA 1O92A 3VNQA 4LF9C 5AE2A
chains in the Genus database with same CATH topology
2P2JA 4WS9A 1O90A 1HNXC 2P02A 3PROC 1PG3A 4JM1A 4D56A 3CW9A 3R9WA 2XR1A 4GS5A 2YCBA 4L2ZA 4FUQA 3UZ0A 3IEVA 5CZXA 3CW8X 1V25A 2HJGA 4RLQA 2E8FA 3RG2A 1FUGA 2QL8A 3DAYA 5ADZA 4D57A 5BUSA 4JV5C 4OXIA 3LAXA 2P2QA 4DR3C 1IBKC 1MXCA 4MH4A 5FLXD 1AMUA 3A9VA 2D1SA 3LNVA 2UU9C 1ULTA 2D1QA 5A19A 4K0BA 2QVXX 4KHPC 4B3MC 4KTVA 3J80D 1P7LA 2UUCC 4RMNA 4U5YD 4D4IA 3ETCA 4DCUA 3IEUA 1EGAA 5K8FA 3FCCA 3L95X 1XRCA 2V7BA 4JI4C 1HR0C 1KKGA 3CJEA 2BJOA 1QWIA 2D28C 4LF7C 4GXQA 4TPSB 5AE1A 2Y4NA 4DR2C 4R1MA 4R1LA 4LFAC 3GKUA 2E8CA 1XRAA 4FUTA 3UOWA 1O9TA 4ODJA 1IBLC 2PROA 4EATA 2D27A 1ZB8A 5BR8C 4LF5C 1XMOC 1UKKA 4JI1C 4RM2A 4DV4C 5T8TA 3VNRA 1N2FA 1XMQC 1ZB9A 2CY1A 3AF6A 2E8EA 4YY3C 1I94C 1YJ7A 4DUZC 3OTOC 4KTTA 2QVYX 4K0KC 4B3TC 1XNQC 1IBMC 4DG8A 5A1GA 1USPB 3A9UA 3J81D 3KXWA 3NPDA 3AF5A 4JI7C 1RY2A 5BSRA 1MD9A 2UUAC 4L7IA 5K85A 2ZM6C 4DV7C 3EERA 3S82A 4NXNC 2D7VA 1WF3A 1JOSA 4D4GA 3TDEA 4IR7A 4GKKC 3LGXA 1GPMA 3RV2A 3T1HC 4FTFA 4PROC 1J5EC 2ONFA 3I07A 2UUBC 3IMLA 4GXRA 2UXDC 5KEIA 3R9XA 4LF4C 1N32C 1ML8A 3EQ6A 2VQEC 2P2FA 4NOZA 2HHHC 3SO4A 4DR5C 2Y27A 3NI2A 5BSUA 5BSWA 3PESA 5DV9A 4NDNA 5BSMA 2WD9A 1NYEA 4GKJC 5A2QD 2KZFA 2QW0X 4DR4C 1L2FA 5GTDA 4G1IA 4DCVA 1MKYA 2PN2A 4BSZA 2DYJA 4WV3A 3IPLA 3C5EA 3JAMD 2AYAA 4X65C 4B3SC 4BBYA 2VSQA 3ETOA 1MXBA 3NYQA 5BUQA 4DUYC 5T8SA 4DR6C 2UXBC 4LE5A 1T5DX 2QVZX 4ZLPA 2P20A 1HH2P 5A1IA 1WH9A 3GR1A 5LMNC 2PT7G 5JRHA 2BH1X 1O93A 2CXCA 3T1YC 3I08A 1N36C 2P2BA 2E7GA 4YHHC 2ATWA 4IZ6A 4LF8C 1FJGC 5AE3A 4BC7A 2JMPA 5LMUC 4RM3A 3DHVA 3E7WA 1PA4A 4DV3C 4JI0C 4DV1C 1LQLA 5E7QA 4RVOA 3DLPX 1V26A 3TUFA 3N2QA 4JI6C 4X66C 4HPVA 1QM4A 1MDFA 1MDBA 2OBVA 3FCEA 3GPCA 1VLAA 4DCTA 4ZJZA 4BC9A 4PZPA 4DV6C 4JI3C 2E0GA 3E7XA 4LF6C 1N34C 2VZEA 5IT9D 5KYVA 3R44A 3NYRA 4DV0C 1BA3A 5BSVA 4X64C 4ISBA 2Y4OA 4OX9C 1K0RA 1XRBA 4X62C 2D1TA 2EGTA 3L8CA 4JYAC 5BSTA 2YWCA 5KYTA 5IWAC 2ASBA 2OPLA 4L4QA 4AQYC 5BURA 4LFBC 4R0MA 1XNRC 4OYCA 4DCSA 3H2TA 4DV5C 2VQFC 2D1RA 4G36A 4JI8C 1MXAA 2DPLA 4PHTA 4I9GA 2OPLB 2F4VC 3PBKA 1HNZC 4MTNA 3A4IA 4BCAA 2WP0C 2UXCC 1PG4A 4RVNA 4DV2C 4RLFA 4XX2A 2E5LC 4B3RC 3B7WA 1HNWC 5H9UA 4DR1C 1T5HX 4JI5C 4G37A 5CZVA 4NXMC 3TQIA 4DG9A 4I9FA 3LUSA 4DR7C 1USPA 4LFCC 1RG9A 3GR0A 2YWBA 2P2MA 3VNSA 1N33C 5IFIA 3N54B 4JI2C 2OO4A 3G7SA 1LCIA 1O92A 3VNQA 4LF9C 5AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UKK A;  4JI1 C;  4DV0 C;  4DR4 C;  4DV4 C;  1L2F A;  4X64 C;  1HNX C;  1N2F A;  4DCV A;  1MKY A;  2PN2 A;  1XMQ C;  4BSZ A;  4OX9 C;  2DYJ A;  1K0R A;  1ZB9 A;  2CY1 A;  4X62 C;  3AF6 A;  2E8E A;  4YY3 C;  2EGT A;  1I94 C;  3R9W A;  4DUZ C;  2XR1 A;  2YCB A;  3OTO C;  3JAM D;  4JYA C;  4X65 C;  4B3S C;  5IWA C;  3IEV A;  2ASB A;  2OPL A;  4AQY C;  4LFB C;  2HJG A;  2E8F A;  4K0K C;  4B3T C;  1XNQ C;  1XNR C;  2QL8 A;  1IBM C;  4DUY C;  4DCS A;  4DR6 C;  4JV5 C;  1USP B;  4DV5 C;  2UXB C;  2VQF C;  4JI8 C;  3J81 D;  4DR3 C;  1IBK C;  3AF5 A;  4MH4 A;  4JI7 C;  1HH2 P;  2OPL B;  5FLX D;  1WH9 A;  5LMN C;  2F4V C;  2UUA C;  2UU9 C;  2PT7 G;  2ZM6 C;  4DV7 C;  1HNZ C;  3EER A;  2CXC A;  4MTN A;  4KHP C;  4NXN C;  4B3M C;  3T1Y C;  2D7V A;  1N36 C;  1WF3 A;  3J80 D;  1JOS A;  2UXC C;  2E7G A;  4YHH C;  4GKK C;  2UUC C;  4DV2 C;  2ATW A;  3T1H C;  4XX2 A;  1J5E C;  2ONF A;  2E5L C;  4LF8 C;  4DCU A;  1FJG C;  3IEU A;  1EGA A;  4B3R C;  2JMP A;  1HNW C;  3I07 A;  5LMU C;  2UUB C;  4JI4 C;  1PA4 A;  4DR1 C;  1HR0 C;  2UXD C;  3R9X A;  1KKG A;  4LF4 C;  4JI0 C;  1ML8 A;  3CJE A;  4DV3 C;  2BJO A;  1LQL A;  1QWI A;  4DV1 C;  4JI5 C;  1N32 C;  4NXM C;  2VQE C;  4LF7 C;  3LUS A;  4NOZ A;  2HHH C;  4JI6 C;  4X66 C;  4DR7 C;  1USP A;  4LFC C;  4DR5 C;  4DR2 C;  4LFA C;  1N33 C;  3GKU A;  2E8C A;  4DCT A;  1VLA A;  4JI2 C;  1NYE A;  1IBL C;  4DV6 C;  4JI3 C;  4GKJ C;  4LF6 C;  5A2Q D;  1N34 C;  1ZB8 A;  5IT9 D;  2KZF A;  5BR8 C;  4LF9 C;  4LF5 C;  1XMO C; 
#chains in the Genus database with same CATH topology
 2P2J A;  4WS9 A;  1O90 A;  1HNX C;  2P02 A;  3PRO C;  2M5H A;  1PG3 A;  4JM1 A;  4D56 A;  2KZ0 A;  3CW9 A;  3R9W A;  4PUI A;  2XR1 A;  4GS5 A;  2YCB A;  4L2Z A;  4FUQ A;  3UZ0 A;  3IEV A;  5CZX A;  3CW8 X;  1V25 A;  2HJG A;  4RLQ A;  2E8F A;  3RG2 A;  3CQ3 A;  1FUG A;  2QL8 A;  3DAY A;  5ADZ A;  4D57 A;  5BUS A;  4JV5 C;  4OXI A;  3LAX A;  2P2Q A;  3K6R A;  4DR3 C;  1IBK C;  1MXC A;  4MH4 A;  3O2E A;  5FLX D;  1AMU A;  3A9V A;  2D1S A;  3LNV A;  2UU9 C;  1ULT A;  2D1Q A;  5A19 A;  4K0B A;  2QVX X;  4KHP C;  4B3M C;  4KTV A;  3J80 D;  1P7L A;  2UUC C;  4RMN A;  1M6X C;  4U5Y D;  4D4I A;  3ETC A;  4DCU A;  3IEU A;  1EGA A;  5K8F A;  3FCC A;  3L95 X;  1XRC A;  2V7B A;  4JI4 C;  1HR0 C;  1KKG A;  3CJE A;  2BJO A;  1QWI A;  2D28 C;  4LF7 C;  4GXQ A;  4TPS B;  5AE1 A;  2Y4N A;  4DR2 C;  4R1M A;  4R1L A;  4LFA C;  3GKU A;  2E8C A;  1XRA A;  4FUT A;  3UOW A;  1O9T A;  1M6X A;  1PU1 A;  4ODJ A;  2PRO A;  1IBL C;  4EAT A;  2D27 A;  1ZB8 A;  5BR8 C;  4LF5 C;  1XMO C;  2ZZM A;  1UKK A;  4JI1 C;  4RM2 A;  4DV4 C;  5T8T A;  2MM9 A;  3VNR A;  1N2F A;  1XMQ C;  1ZB9 A;  2CY1 A;  3AF6 A;  2E8E A;  4YY3 C;  2CU6 A;  1I94 C;  1YJ7 A;  4DUZ C;  3OTO C;  4KTT A;  1TH5 A;  2QVY X;  4K0K C;  4B3T C;  1XNQ C;  2JNV A;  1IBM C;  2Z51 A;  4DG8 A;  5A1G A;  1USP B;  3A26 A;  3A9U A;  3A25 A;  3J81 D;  3KXW A;  3NPD A;  3AF5 A;  4JI7 C;  1RY2 A;  5BSR A;  1MD9 A;  2UUA C;  4L7I A;  5K85 A;  2ZM6 C;  4DV7 C;  3EER A;  3UX3 A;  3S82 A;  4NXN C;  2D7V A;  1WF3 A;  1JOS A;  3LNO A;  4D4G A;  3TDE A;  4IR7 A;  4GKK C;  3LGX A;  1GPM A;  3RV2 A;  1XS3 A;  3T1H C;  4FTF A;  4PRO C;  1J5E C;  2ONF A;  3I07 A;  2UUB C;  3IML A;  2DHM A;  4GXR A;  2UXD C;  5LCI A;  5KEI A;  3R9X A;  4LF4 C;  1N32 C;  1ML8 A;  3EQ6 A;  2VQE C;  2P2F A;  4NOZ A;  2HHH C;  3SO4 A;  4DR5 C;  2Y27 A;  3NI2 A;  5BSU A;  5BSW A;  3PES A;  5DV9 A;  4NDN A;  5BSM A;  2WD9 A;  1NYE A;  4GKJ C;  5A2Q D;  2KZF A;  2QW0 X;  4DR4 C;  1L2F A;  5GTD A;  4G1I A;  2ZZN A;  4DCV A;  1MKY A;  2PN2 A;  4BSZ A;  2DYJ A;  4WV3 A;  3IPL A;  3CQ1 A;  3C5E A;  3JAM D;  1P4E C;  2AYA A;  4X65 C;  4B3S C;  4BBY A;  2VSQ A;  3ETO A;  3UX2 A;  1MXB A;  3NYQ A;  5BUQ A;  4DUY C;  5T8S A;  1FLO A;  4DR6 C;  2M5O A;  2UXB C;  4LE5 A;  1T5D X;  2QVZ X;  4ZLP A;  2P20 A;  1HH2 P;  5A1I A;  1WH9 A;  3GR1 A;  1P4E A;  5LMN C;  2PT7 G;  5JRH A;  2BH1 X;  1O93 A;  2CXC A;  3T1Y C;  3I08 A;  1N36 C;  2P2B A;  2E7G A;  4YHH C;  2ATW A;  4IZ6 A;  4LF8 C;  1FJG C;  5AE3 A;  4BC7 A;  2JMP A;  5LMU C;  4RM3 A;  3DHV A;  3E7W A;  1PA4 A;  4JI0 C;  4DV3 C;  1LQL A;  5E7Q A;  4DV1 C;  4RVO A;  3AY0 A;  3DLP X;  1V26 A;  3TUF A;  3N2Q A;  4JI6 C;  4X66 C;  1UWD A;  4HPV A;  1QM4 A;  1MDF A;  1MDB A;  2MMA B;  2OBV A;  3FCE A;  3GPC A;  1VLA A;  4DCT A;  4ZJZ A;  4BC9 A;  4PZP A;  4DV6 C;  4JI3 C;  2E0G A;  3E7X A;  4LF6 C;  3TR3 A;  1N34 C;  2VZE A;  5IT9 D;  5KYV A;  3R44 A;  3NYR A;  4DV0 C;  1BA3 A;  5BSV A;  4X64 C;  1VEH A;  2YX1 A;  4ISB A;  2Y4O A;  4OX9 C;  1K0R A;  1XRB A;  4X62 C;  2D1T A;  2EGT A;  3L8C A;  4JYA C;  5BST A;  2MCQ A;  2YWC A;  3CQ2 A;  5KYT A;  5IWA C;  2ASB A;  2OPL A;  4L4Q A;  4AQY C;  5BUR A;  4LFB C;  1NY8 A;  4R0M A;  1XNR C;  1IB8 A;  4OYC A;  4DCS A;  3H2T A;  4DV5 C;  2VQF C;  1WCJ A;  2D1R A;  4G36 A;  4JI8 C;  1MXA A;  2DPL A;  4PHT A;  4I9G A;  2OPL B;  1V60 A;  2F4V C;  2NCL A;  3PBK A;  1HNZ C;  4MTN A;  3A4I A;  2KDN A;  4BCA A;  1XHJ A;  2WP0 C;  2UXC C;  1PG4 A;  4RVN A;  4DV2 C;  4RLF A;  4XX2 A;  2E5L C;  4B3R C;  3B7W A;  1HNW C;  5H9U A;  4DR1 C;  1T5H X;  4JI5 C;  4G37 A;  5CZV A;  4NXM C;  3TQI A;  4DG9 A;  4I9F A;  3LUS A;  3UEB A;  4DR7 C;  1USP A;  4LFC C;  1RG9 A;  3GR0 A;  2YWB A;  2P2M A;  3VNS A;  1N33 C;  4PUG A;  5IFI A;  3N54 B;  4JI2 C;  4PUH A;  2OO4 A;  3G7S A;  1LCI A;  1O92 A;  3VNQ A;  4LF9 C;  5AE2 A; 
#chains in the Genus database with same CATH homology
 2P2J A;  4WS9 A;  1O90 A;  1HNX C;  2P02 A;  3PRO C;  1PG3 A;  4JM1 A;  4D56 A;  3CW9 A;  3R9W A;  2XR1 A;  4GS5 A;  2YCB A;  4L2Z A;  4FUQ A;  3UZ0 A;  3IEV A;  5CZX A;  3CW8 X;  1V25 A;  2HJG A;  4RLQ A;  2E8F A;  3RG2 A;  1FUG A;  2QL8 A;  3DAY A;  5ADZ A;  4D57 A;  5BUS A;  4JV5 C;  4OXI A;  3LAX A;  2P2Q A;  4DR3 C;  1IBK C;  1MXC A;  4MH4 A;  5FLX D;  1AMU A;  3A9V A;  2D1S A;  3LNV A;  2UU9 C;  1ULT A;  2D1Q A;  5A19 A;  4K0B A;  2QVX X;  4KHP C;  4B3M C;  4KTV A;  3J80 D;  1P7L A;  2UUC C;  4RMN A;  4U5Y D;  4D4I A;  3ETC A;  4DCU A;  3IEU A;  1EGA A;  5K8F A;  3FCC A;  3L95 X;  1XRC A;  2V7B A;  4JI4 C;  1HR0 C;  1KKG A;  3CJE A;  2BJO A;  1QWI A;  2D28 C;  4LF7 C;  4GXQ A;  4TPS B;  5AE1 A;  2Y4N A;  4DR2 C;  4R1M A;  4R1L A;  4LFA C;  3GKU A;  2E8C A;  1XRA A;  4FUT A;  3UOW A;  1O9T A;  4ODJ A;  1IBL C;  2PRO A;  4EAT A;  2D27 A;  1ZB8 A;  5BR8 C;  4LF5 C;  1XMO C;  1UKK A;  4JI1 C;  4RM2 A;  4DV4 C;  5T8T A;  3VNR A;  1N2F A;  1XMQ C;  1ZB9 A;  2CY1 A;  3AF6 A;  2E8E A;  4YY3 C;  1I94 C;  1YJ7 A;  4DUZ C;  3OTO C;  4KTT A;  2QVY X;  4K0K C;  4B3T C;  1XNQ C;  1IBM C;  4DG8 A;  5A1G A;  1USP B;  3A9U A;  3J81 D;  3KXW A;  3NPD A;  3AF5 A;  4JI7 C;  1RY2 A;  5BSR A;  1MD9 A;  2UUA C;  4L7I A;  5K85 A;  2ZM6 C;  4DV7 C;  3EER A;  3S82 A;  4NXN C;  2D7V A;  1WF3 A;  1JOS A;  4D4G A;  3TDE A;  4IR7 A;  4GKK C;  3LGX A;  1GPM A;  3RV2 A;  3T1H C;  4FTF A;  4PRO C;  1J5E C;  2ONF A;  3I07 A;  2UUB C;  3IML A;  4GXR A;  2UXD C;  5KEI A;  3R9X A;  4LF4 C;  1N32 C;  1ML8 A;  3EQ6 A;  2VQE C;  2P2F A;  4NOZ A;  2HHH C;  3SO4 A;  4DR5 C;  2Y27 A;  3NI2 A;  5BSU A;  5BSW A;  3PES A;  5DV9 A;  4NDN A;  5BSM A;  2WD9 A;  1NYE A;  4GKJ C;  5A2Q D;  2KZF A;  2QW0 X;  4DR4 C;  1L2F A;  5GTD A;  4G1I A;  4DCV A;  1MKY A;  2PN2 A;  4BSZ A;  2DYJ A;  4WV3 A;  3IPL A;  3C5E A;  3JAM D;  2AYA A;  4X65 C;  4B3S C;  4BBY A;  2VSQ A;  3ETO A;  1MXB A;  3NYQ A;  5BUQ A;  4DUY C;  5T8S A;  4DR6 C;  2UXB C;  4LE5 A;  1T5D X;  2QVZ X;  4ZLP A;  2P20 A;  1HH2 P;  5A1I A;  1WH9 A;  3GR1 A;  5LMN C;  2PT7 G;  5JRH A;  2BH1 X;  1O93 A;  2CXC A;  3T1Y C;  3I08 A;  1N36 C;  2P2B A;  2E7G A;  4YHH C;  2ATW A;  4IZ6 A;  4LF8 C;  1FJG C;  5AE3 A;  4BC7 A;  2JMP A;  5LMU C;  4RM3 A;  3DHV A;  3E7W A;  1PA4 A;  4DV3 C;  4JI0 C;  4DV1 C;  1LQL A;  5E7Q A;  4RVO A;  3DLP X;  1V26 A;  3TUF A;  3N2Q A;  4JI6 C;  4X66 C;  4HPV A;  1QM4 A;  1MDF A;  1MDB A;  2OBV A;  3FCE A;  3GPC A;  1VLA A;  4DCT A;  4ZJZ A;  4BC9 A;  4PZP A;  4DV6 C;  4JI3 C;  2E0G A;  3E7X A;  4LF6 C;  1N34 C;  2VZE A;  5IT9 D;  5KYV A;  3R44 A;  3NYR A;  4DV0 C;  1BA3 A;  5BSV A;  4X64 C;  4ISB A;  2Y4O A;  4OX9 C;  1K0R A;  1XRB A;  4X62 C;  2D1T A;  2EGT A;  3L8C A;  4JYA C;  5BST A;  2YWC A;  5KYT A;  5IWA C;  2ASB A;  2OPL A;  4L4Q A;  4AQY C;  5BUR A;  4LFB C;  4R0M A;  1XNR C;  4OYC A;  4DCS A;  3H2T A;  4DV5 C;  2VQF C;  2D1R A;  4G36 A;  4JI8 C;  1MXA A;  2DPL A;  4PHT A;  4I9G A;  2OPL B;  2F4V C;  3PBK A;  1HNZ C;  4MTN A;  3A4I A;  4BCA A;  2WP0 C;  2UXC C;  1PG4 A;  4RVN A;  4DV2 C;  4RLF A;  4XX2 A;  2E5L C;  4B3R C;  3B7W A;  1HNW C;  5H9U A;  4DR1 C;  1T5H X;  4JI5 C;  4G37 A;  5CZV A;  4NXM C;  3TQI A;  4DG9 A;  4I9F A;  3LUS A;  4DR7 C;  1USP A;  4LFC C;  1RG9 A;  3GR0 A;  2YWB A;  2P2M A;  3VNS A;  1N33 C;  5IFI A;  3N54 B;  4JI2 C;  2OO4 A;  3G7S A;  1LCI A;  1O92 A;  3VNQ A;  4LF9 C;  5AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...