1USPA

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
137
structure length
137
Chain Sequence
NVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPADSTITARVGLQKAGLAFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 31
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspA02
4JYAC 4NBAA 4A3II 2PN2A 4X64C 1L2FA 4A3JI 4JI8C 4A3EI 4JI3C 4LFCC 4A93I 1PFTA 4DR6C 3CQZI 5FLXD 4A3DI 3PO3S 3IEVA 5LMNC 2F4OA 4DUYC 1VLAA 4B3RC 3GTKI 2E8CA 4K0KC 4DV4C 1DL6A 2AKLA 4AQYC 1FJGC 4JI5C 4NBBA 4X6AI 2YCBA 3S1NI 1WH9A 4A3LI 4LFAC 4DV1C 1UKKA 3RZDI 4MH4A 3RZOI 4A3GI 3GTMI 2E7GA 3T1HC 2ONFA 2E8FA 4JI7C 4OX9C 2E2II 1I50I 3GKQA 2R7ZI 1YUAA 4XX2A 3S16I 1WF3A 4DV3C 3I07A 4NB9A 5IT9D 2B63I 1Y1VI 1USPA 3GTMS 4DR1C 4JI4C 2NVQI 3I4MI 4DR5C 4NBHA 2VUMI 3I4NI 4GKJC 1TWCI 3FKII 1HNWC 2DE5A 2E5LC 2UXBC 1J5EC 3S1QI 4DCUA 2DE6A 2QL8A 2NVYI 1XNQC 5C44I 1N34C 4X65C 1TWHI 2HJGA 3GTLI 2P3YA 2KZFA 2UUCC 1SFOI 4DV6C 3LUSA 1WCMI 5A2QD 2RBLA 4NBFA 1XMQC 1HH2P 3GTJI 1NUIA 3OTOC 1N33C 4GKKC 4QTUA 4DCVA 3CJEA 4NXMC 1RLYA 4DCTA 4A3KI 1Y1WI 5FLMI 1JOSA 4DV0C 5C3EI 1WW9A 3S1RI 1X3WA 1MKYA 2F4VC 5BR8C 4X62C 4A3FI 1I94C 3GTOI 3GKUA 4NBEA 3HOYI 3R9XA 4B3TC 3HOWI 4KHPC 2JR6A 3H3VJ 4NBDA 4JI0C 5C4XI 4DUZC 2YU9I 3T1YC 3GCFA 1LQLA 4A3MI 2R92I 4DR7C 2VQFC 4JI2C 2D7VA 2VQEC 4DV5C 2ATWA 1HNZC 1XNRC 2DE7A 1TFIA 1N36C 4LF7C 4NXNC 3J81D 2E8EA 4DV2C 2J6AA 3AF5A 3H0GI 4BBSI 2JA6I 2JA7I 4Y7NI 4JI6C 3ESWA 3PO2I 1NYEA 4B3SC 1L1OC 1Y1VS 2PK7A 1TWFI 1USPB 5IP9I 1PA4A 5IP7I 4LF6C 4JV5C 3S2HI 3Q87A 4X66C 2UXDC 2OPLB 3VMGA 4LF9C 4BSZA 1TWAI 3GTGI 3S15I 1QYPA 3HOUI 1KKGA 2JNYA 3JAMD 4LFBC 2NVXI 4NBCA 1TWGI 3M3YI 4DV7C 3HOXI 3R9WA 1HR0C 1ZB9A 4YHHC 3VMHA 2EGTA 4Y52I 2JMPA 1IBMC 3S14I 3J80D 2JA8I 2F4MA 3VB9A 4LF5C 3S2DI 1N32C 2NVTI 3S17I 2HF1A 1EGAA 1XMOC 4NBGA 4BBRI 4LF4C 3HOZI 5C4JI 3M4OI 4YY3C 4MTNA 1QWIA 1I3QI 2CY1A 4DR4C 5LMUC 2CXCA 3AF6A 4BXXI 2KPIA 4B3MC 1ZB8A 1IBKC 4BY1I 4BY7I 2BJOA 2E2JI 2DYJA 4A3BI 2UU9C 3HOVI 2ZM6C 3GTPI 3S1MI 2UUAC 2HHHC 2JS4A 1HNXC 1K0RA 2K5RA 1RO4A 3VMIA 4DR3C 4A3CI 4NOZA 4NB8A 2UUBC 3GTQI 4DCSA 4QTTA 5CM2M 1K83I 2OPLA 5IWAC 3IEUA 3D6WA 2JA5I 3K7AI 2E2HI 1I6HI 1X3ZA 2XR1A 2UXCC 1ML8A 1N2FA 4JI1C 2R93I 4LF8C 3EERA 1IBLC 3U50C 3PO3I 4DR2C 2ASBA 1R9TI 2PT7G
chains in the Genus database with same CATH superfamily
3CPWZ 4JYAC 4MRIA 1P7LA 4BC7A 1QVGY 4RVFA 1VQKZ 1VQ71 1O90A 4NBAA 4A3II 2YWCA 3G6EZ 2PN2A 4X64C 1L2FA 4A3JI 3TDEA 5KEIA 3NH5A 4JI8C 4A3EI 4JI3C 4LFCC 4A93I 1FLOA 1Q821 5KYTA 1PFTA 2YX1A 4DR6C 5GTDA 3CC41 3CQZI 1IB8A 5FLXD 1IBMC 4A3DI 5BSTA 3PO3S 2D27A 2QR1B 2VPXA 4DK1A 3IEVA 5LMNC 2OTL1 2F4OA 2OTJZ 2ZZNA 4DUYC 1RQFA 1VLAA 1Q822 3KIHA 4B3RC 4HGZA 4E33A 2KI7B 3GTKI 2E8CA 4K0KC 1TH5A 2KDNA 4R1MA 4DV4C 1DL6A 4FTFA 2AKLA 1YITZ 2OO4A 4AQYC 1FJGC 4JI5C 1YJW1 4NBBA 4ZLPA 4DGLA 4AYBA 4X6AI 2YCBA 3A4IA 3S1NI 3NDIA 1WH9A 4LE5A 4D57A 2NAPA 4A3LI 3CCQ1 5D1OB 4DV1C 3I561 4LFAC 4BC9A 5T64A 1UKKA 5A1IA 2M6NA 3RZDI 2P2FA 4MH4A 3RZOI 4A3GI 1M6XA 3GTMI 1RY2A 3G4SZ 3CC21 2QW0X 3NDJA 3CME1 1P4EC 3K6RA 2E7GA 3T1HC 3I55Z 4MD9A 3PBKA 2ONFA 2E8FA 1X0TA 2QVZX 4JI7C 4OX9C 2E2II 1VQ91 1I50I 3NPDA 2Y0SA 1VQMZ 3GKQA 2R7ZI 1K9M1 1YUAA 2OZKA 1XRBA 1S7MA 1WJ2A 4KTTA 4XX2A 2M5HA 1P4EA 3S16I 1WF3A 4HH4A 4RVDA 2V8IA 5AN9F 1VQ6Z 2RIQA 4DV3C 3I07A 2VPZA 5A2Qf 3P5JB 4BCAA 5T67A 1M1K2 5T8SA 3QWUA 4ZJZA 4NB9A 5IT9D 1K9M2 2B63I 3UX2A 2W03A 4S1TA 1XHJA 3VNSA 1Y1VI 1JWHC 1USPA 3GTMS 4OXIA 4RVOA 4DR1C 4JI4C 1VQPZ 1MXAA 4I9GA 2NVQI 2WB1A 5E7QA 3I4MI 4IR7A 1QF8A 1VQLZ 3CXCZ 4OYCA 2MCQA 1O9TA 2JIOA 1Q811 3TR3A 4DR5C 4NBHA 2VUMI 4CL1A 1FDIA 3I4NI 1TWCI 2LEXA 4GKJC 3FKII 5BSVA 1HNWC 2V8JA 4E2YA 4E2WA 2DE5A 3CPWY 2E5LC 2UXBC 3TQIA 3CCJZ 5CZXA 5K8FA 1J5EC 2QRDB 5LCIA 3IMLA 3S1QI 4DCUA 2DE6A 1RO0A 2LFUA 1PU1A 2QL8A 1W2BY 5BUQA 2NVYI 1XNQC 5C44I 1N34C 1N8R1 1VQ7Z 4X65C 1AMUA 3I08A 3BG0B 1TWHI 2HJGA 3GTLI 2JNVA 2P3YA 4G36A 2KZFA 1RNIA 1NP6A 4FUTA 2UUCC 1SFOI 2DHMA 5K85A 4DV6C 3LUSA 2VPYA 1WCMI 3UZ0A 5A2QD 1ZH1A 2W04A 3CC4Z 5T6BA 1XRAA 3RV2A 2RBLA 1UWDA 4NBFA 2P2BA 2WP0C 5A2Qb 3L8CA 1PG3A 1XMQC 1HH2P 2OTLZ 5H9UA 2JIPA 3GTJI 3D9XA 5A19A 5AE3A 3EQ6A 1NUIA 3CD61 4NH1C 4L2ZA 3OTOC 1BA3A 1PG4A 2BH1X 1T5HX 3TE5B 4RM3A 4G37A 1N33C 4GKKC 2P2JA 2Q4ZA 4QTUA 1YJWZ 1W2BZ 4DCVA 2R6MA 3CJEA 2GTHA 4TNUA 1RLYA 4ODJA 4NXMC 4DCTA 2YWBA 3N54B 3C5EA 3CCQZ 1Z03A 3I56Z 4A3KI 4D4IA 1Y1WI 5FLMI 1JOSA 3J7A4 4DV0C 1KC81 3GR0A 5C3EI 2D1QA 1WW9A 1YUKA 3CC2Z 3CMEZ 2JIMA 3S1RI 3CCV1 5D1OA 4L4QA 1X3WA 1MKYA 4BBYA 2F4VC 5BR8C 4X62C 4A3FI 1I94C 3CCE1 1VQ9Z 4RVNA 2QLVB 3GTOI 3GKUA 4NBEA 1KC82 3UX3A 3HOYI 3R9XA 1Q16A 3MONA 1MXCA 3D2LA 4B3TC 1YIJ1 3S82A 3HOWI 3CW9A 4FUQA 4KHPC 2JR6A 3J81f 2VF1A 2P2MA 1QVFY 2Z51A 3CW8X 4RLFA 1K732 3H3VJ 2OOXB 4NBDA 2QRCB 3UOWA 4JI0C 5C4XI 3J80b 4RVGA 1NY8A 4DG8A 3G711 3ETCA 3CXCY 3BG1B 4DUZC 2YU9I 3T1YC 4NDNA 1LCIA 1V25A 2Y4OA 3GCFA 1LQLA 4A3MI 4RMNA 2R92I 1M1K1 3FQQA 2D28C 4DR7C 1SIWA 2VQFC 1Q7Y1 1V60A 4K0BA 2AYAA 4JI2C 3DHVA 2P2QA 2D7VA 1YHQ1 4R1LA 4GXRA 2VQEC 2Y4NA 4WV3A 4DV5C 1K8A1 4KTVA 2ATWA 5AE1A 3A25A 1HNZC 1WIIA 1VEHA 1XNRC 1Q7Y2 1KD12 4L7IA 2DE7A 1YJ7A 4MD8A 3CCU1 1QVFZ 2ZZMA 2GU2A 1TFIA 3VTNA 1N36C 4LF7C 1Y8CA 3DAYA 1K8A2 2QA41 1QM4A 4NXNC 2M5OA 2QKDA 3J81D 3OW2Z 3VNRA 2E8EA 1XS3A 2JIRA 2VUGA 2D1TA 4DV2C 1RO2A 2J6AA 3CCM1 3AF5A 3H0GI 4BBSI 5CZVA 3J81b 2V8KA 1VQ5Z 2G2KA 2JA6I 3CQ2A 3E7XA 1M902 3JAMf 1YJN1 4PHTA 2JA7I 4Y7NI 2GTIA 2IV2X 2QEX1 1JJ2Z 3CD6Z 3ESWA 2MM9A 2RHBA 3PO2I 1NYEA 1AA6A 3LGXA 4JI6C 4B3SC 2JMOA 1L1OC 1Y1VS 3GPCA 2AYDA 4MD7A 4MONA 4MXUA 2PK7A 1YI21 4IZ6A 1TWFI 1USPB 3F3PC 3B7WA 5IP9I 2M48A 1QXFA 3MZLB 1PA4A 5IP7I 4LF6C 5FLXf 4RV9A 2MMAB 3J80f 4JV5C 4PUGA 3S2HI 1VQ51 2WAQA 4D4GA 2H85A 3Q87A 2P02A 4X66C 5AE2A 3CCVZ 2UXDC 4D56A 1ULTA 2OPLB 1P9NA 2D1SA 2Q51A 1WCJA 3A9VA 3IX0A 3VMGA 4G1IA 4LF9C 4BSZA 1TWAI 4R0MA 2IZ3A 3CCEZ 3GTGI 5DV9A 2JIQA 4PZPA 3S15I 1Q861 4NFRA 2RPRA 1QYPA 3HOUI 2VZEA 3G7SA 1KKGA 1YIJZ 2V7BA 2JNYA 1O92A 3JAMD 4E30A 4LFBC 1Q862 2NVXI 4PROC 4NBCA 3G71Z 3CMAZ 3FQMA 3CCL1 1TWGI 1NJI2 3M3YI 3A26A 3JAMb 4DV7C 3NYRA 3HOXI 3R9WA 4EATA 1K731 4PUHA 1HR0C 1ZB9A 4GXQA 1XRCA 2V3VA 5D1PA 3F3FC 3E7WA 1S721 4RM2A 4YHHC 3TUFA 1T5DX 3VMHA 2EGTA 4EWCA 4Y52I 2JMPA 4ISBA 5JRHA 3S14I 2Y27A 3J80D 2JA8I 4E32A 1FDOA 2CU6A 1YHQZ 1KQSZ 2F4MA 3VB9A 4LF5C 3CC7Z 2QVXX 4HPVA 3S2DI 1O93A 1FUGA 1M6XC 5FLXb 4E2ZA 1N32C 3IPLA 5IT9f 2NVTI 1VQK1 3S17I 3LAXA 1RG9A 3LNOA 3CMA1 3PESA 2PMZA 3EEDA 5BUSA 2HF1A 3CCUZ 3MZKB 1EGAA 3RG2A 3G6E1 4I9FA 2QVYX 3ETOA 3OW2Y 1XMOC 4NBGA 1YJ9Z 2QA4Z 1QVGZ 3CQ1A 4RVHA 4BBRI 4LF4C 2VPWA 1KD11 3HOZI 4RLQA 5C4JI 1VQ8Z 3M4OI 4WS9A 2OOYB 4YY3C 4MTNA 4HGYA 1QWIA 1I3QI 3CCMZ 1JJ2Y 1WZNA 1Z02A 2CY1A 4DR4C 3CC71 1MXBA 2OTJ1 5LMUC 3T4NB 5BSMA 1MDFA 4E31A 2CXCA 1YJNZ 1VQNZ 2KZ0A 4GS5A 2OBVA 3AF6A 2QEXZ 1YIT1 4BXXI 2KPIA 5LL6f 4B3MC 1ZB8A 1IBKC 5T8TA 5BSRA 4BY1I 4BY7I 3FCEA 1YJ91 2ZAEB 2P20A 2BJOA 2E2JI 2DYJA 4A3BI 2UU9C 1M901 3HOVI 1YI2Z 2ZM6C 3KXWA 3GTPI 1VQOZ 3S1MI 2P28A 2DPLA 2UUAC 2JUBA 2E7ZA 3GR1A 2O4HA 1VQ81 2VSQA 5ADZA 1KRLA 2JS4A 3AY0A 2HHHC 3CCRZ 1VQ4Z 1HNXC 3G4S1 1K0RA 2E0GA 2K5RA 4JM1A 1RO4A 1GPMA 3VMIA 4DR3C 3I551 5KYVA 4A3CI 1VQN1 4NOZA 2IZ4A 4NB8A 2YADA 2QREB 2V45A 3CQ3A 3UEBA 5BURA 2UUBC 3GTQI 3NH4A 4DCSA 5IT9b 3IFUA 4QTTA 5CM2M 3NYQA 3HKZA 1VQM1 4PUIA 3CCSZ 1K83I 2I3CA 3TDHB 2E9HA 2PROA 2OPLA 3PROC 5IWAC 3IF8A 2D1RA 3IR7A 1VQ61 1VQO1 3IEUA 2NCLA 3SO4A 2HU9A 3D6WA 1MD9A 4DQYB 2JA5I 3VNQA 3DLPX 3K7AI 2E2HI 1I6HI 3O2EA 1X3ZA 4RS4A 3CCR1 1VQ41 1Q812 4DG9A 3A9UA 5A1GA 3L95X 3NH8A 1VQP1 2XR1A 2UXCC 1ML8A 2RT9A 3CCLZ 3N2QA 1N2FA 3FCCA 2K3RA 2O53A 4JI1C 4E2XA 2R93I 1VQL1 3LNVA 4LF8C 3EERA 3NFZA 3CCS1 4U5YD 1KQSY 1IBLC 3R44A 1S72Z 3U50C 3PO3I 3H2TA 1V26A 1MDBA 3CCJ1 2PM9A 1N8R2 5IFIA 4DR2C 1NJI1 2WD9A 1Z01A 1R9TI 2ASBA 4TPSB 3NI2A 3KIFA 2LIYA 5BSUA 2PT7G 5BSWA
chains in the Genus database with same CATH topology
3CPWZ 4JYAC 4MRIA 1P7LA 4BC7A 1QVGY 4RVFA 1VQKZ 1VQ71 1O90A 4NBAA 4A3II 2YWCA 3G6EZ 2PN2A 4X64C 1L2FA 4A3JI 3TDEA 5KEIA 3NH5A 4JI8C 4A3EI 4JI3C 4LFCC 4A93I 1Q821 5KYTA 1PFTA 4DR6C 5GTDA 3CC41 3CQZI 5FLXD 1IBMC 4A3DI 5BSTA 3PO3S 2D27A 2QR1B 4DK1A 3IEVA 5LMNC 2OTL1 2F4OA 2OTJZ 4DUYC 1RQFA 1VLAA 1Q822 3KIHA 4B3RC 4HGZA 4E33A 2KI7B 3GTKI 2E8CA 4K0KC 4R1MA 4DV4C 1DL6A 4FTFA 2AKLA 1YITZ 2OO4A 4AQYC 1FJGC 4JI5C 1YJW1 4NBBA 4ZLPA 4DGLA 4AYBA 4X6AI 2YCBA 3A4IA 3S1NI 3NDIA 1WH9A 4LE5A 4D57A 4A3LI 3CCQ1 5D1OB 4DV1C 3I561 4LFAC 4BC9A 5T64A 1UKKA 5A1IA 2M6NA 3RZDI 2P2FA 4MH4A 3RZOI 4A3GI 3GTMI 1RY2A 3G4SZ 3CC21 2QW0X 3NDJA 3CME1 2E7GA 3T1HC 3I55Z 4MD9A 3PBKA 2ONFA 2E8FA 1X0TA 2QVZX 4JI7C 4OX9C 2E2II 1VQ91 1I50I 3NPDA 2Y0SA 1VQMZ 3GKQA 2R7ZI 1K9M1 1YUAA 2OZKA 1XRBA 1S7MA 4KTTA 4XX2A 3S16I 1WF3A 4HH4A 4RVDA 2V8IA 5AN9F 1VQ6Z 2RIQA 4DV3C 3I07A 5A2Qf 3P5JB 4BCAA 5T67A 1M1K2 5T8SA 3QWUA 4ZJZA 4NB9A 5IT9D 1K9M2 2B63I 2W03A 4S1TA 3VNSA 1Y1VI 1JWHC 1USPA 3GTMS 4OXIA 4RVOA 4DR1C 4JI4C 1VQPZ 1MXAA 4I9GA 2NVQI 2WB1A 5E7QA 3I4MI 4IR7A 1QF8A 1VQLZ 3CXCZ 4OYCA 1O9TA 1Q811 4DR5C 4NBHA 2VUMI 4CL1A 3I4NI 4GKJC 1TWCI 3FKII 5BSVA 1HNWC 2V8JA 4E2YA 4E2WA 2DE5A 3CPWY 2E5LC 2UXBC 3TQIA 3CCJZ 5CZXA 5K8FA 1J5EC 2QRDB 3IMLA 3S1QI 4DCUA 2DE6A 1RO0A 2LFUA 2QL8A 1W2BY 5BUQA 2NVYI 1XNQC 5C44I 1N34C 1N8R1 1VQ7Z 4X65C 1AMUA 3I08A 3BG0B 1TWHI 2HJGA 3GTLI 2P3YA 4G36A 2KZFA 1RNIA 1NP6A 4FUTA 2UUCC 1SFOI 5K85A 4DV6C 3LUSA 1WCMI 3UZ0A 5A2QD 1ZH1A 2W04A 3CC4Z 5T6BA 1XRAA 3RV2A 2RBLA 4NBFA 2P2BA 2WP0C 5A2Qb 3L8CA 1PG3A 1XMQC 1HH2P 2OTLZ 5H9UA 3GTJI 3D9XA 5A19A 5AE3A 3EQ6A 1NUIA 3CD61 4NH1C 4L2ZA 3OTOC 1BA3A 1PG4A 2BH1X 1T5HX 3TE5B 4RM3A 4G37A 1N33C 4GKKC 2P2JA 2Q4ZA 4QTUA 1YJWZ 1W2BZ 4DCVA 2R6MA 3CJEA 2GTHA 4TNUA 1RLYA 4ODJA 4NXMC 4DCTA 2YWBA 3N54B 3C5EA 3CCQZ 1Z03A 3I56Z 4A3KI 4D4IA 1Y1WI 5FLMI 1JOSA 3J7A4 4DV0C 1KC81 3GR0A 5C3EI 2D1QA 1WW9A 1YUKA 3CC2Z 3CMEZ 3S1RI 3CCV1 5D1OA 4L4QA 1X3WA 1MKYA 4BBYA 2F4VC 5BR8C 4X62C 4A3FI 1I94C 3CCE1 1VQ9Z 4RVNA 2QLVB 3GTOI 3GKUA 4NBEA 1KC82 3HOYI 3R9XA 3MONA 1MXCA 4B3TC 1YIJ1 3S82A 3HOWI 3CW9A 4FUQA 4KHPC 2JR6A 3J81f 2VF1A 2P2MA 1QVFY 3CW8X 4RLFA 1K732 3H3VJ 2OOXB 4NBDA 2QRCB 3UOWA 4JI0C 5C4XI 3J80b 4RVGA 4DG8A 3G711 3ETCA 3CXCY 3BG1B 4DUZC 2YU9I 3T1YC 4NDNA 1LCIA 1V25A 2Y4OA 3GCFA 1LQLA 4A3MI 2R92I 1M1K1 3FQQA 2D28C 4DR7C 2VQFC 1Q7Y1 4K0BA 2AYAA 4JI2C 3DHVA 2P2QA 2D7VA 1YHQ1 4R1LA 4GXRA 2VQEC 2Y4NA 4WV3A 4DV5C 1K8A1 4KTVA 2ATWA 5AE1A 1HNZC 1WIIA 1XNRC 1Q7Y2 1KD12 4L7IA 2DE7A 1YJ7A 4MD8A 3CCU1 1QVFZ 2GU2A 1TFIA 3VTNA 1N36C 4LF7C 3DAYA 1K8A2 2QA41 1QM4A 4NXNC 2QKDA 3J81D 3OW2Z 3VNRA 2E8EA 2VUGA 2D1TA 4DV2C 1RO2A 2J6AA 3CCM1 3AF5A 3H0GI 4BBSI 5CZVA 3J81b 2V8KA 1VQ5Z 2G2KA 2JA6I 3E7XA 1M902 3JAMf 1YJN1 4PHTA 2JA7I 4Y7NI 2GTIA 2QEX1 1JJ2Z 3NYRA 3CD6Z 3ESWA 3LGXA 2RHBA 3PO2I 1NYEA 4RMNA 4JI6C 4B3SC 2JMOA 1L1OC 1Y1VS 3GPCA 4MD7A 4MONA 4MXUA 2PK7A 1YI21 4IZ6A 1TWFI 1USPB 3F3PC 3B7WA 5IP9I 2M48A 1PA4A 3MZLB 5IP7I 4LF6C 5FLXf 4RV9A 3J80f 4JV5C 3S2HI 1VQ51 2WAQA 4D4GA 2H85A 3Q87A 2P02A 4X66C 5AE2A 3CCVZ 2UXDC 4D56A 1ULTA 2OPLB 1P9NA 2D1SA 2Q51A 3A9VA 3IX0A 3VMGA 4G1IA 4LF9C 4BSZA 1TWAI 4R0MA 2IZ3A 3CCEZ 3GTGI 5DV9A 4PZPA 3S15I 1Q861 4NFRA 2RPRA 1QYPA 3HOUI 2VZEA 3G7SA 1KKGA 1YIJZ 2V7BA 2JNYA 1O92A 3JAMD 4E30A 4LFBC 1Q862 2NVXI 4PROC 4NBCA 3G71Z 3CMAZ 3FQMA 3CCL1 1TWGI 1NJI2 3M3YI 3JAMb 4DV7C 3HOXI 3R9WA 4EATA 1K731 1HR0C 1ZB9A 4GXQA 1XRCA 5D1PA 3E7WA 3F3FC 1S721 4RM2A 4YHHC 3TUFA 1T5DX 3VMHA 2EGTA 4EWCA 4Y52I 2JMPA 4ISBA 5JRHA 3S14I 2Y27A 3J80D 2JA8I 4E32A 1YHQZ 1KQSZ 2F4MA 3VB9A 4LF5C 3CC7Z 2QVXX 4HPVA 3S2DI 1O93A 1FUGA 5FLXb 4E2ZA 1N32C 3IPLA 5IT9f 2NVTI 1VQK1 3S17I 3LAXA 1RG9A 3CMA1 3PESA 2PMZA 3EEDA 5BUSA 2HF1A 3CCUZ 3MZKB 1EGAA 3RG2A 3G6E1 4I9FA 2QVYX 3ETOA 3OW2Y 1XMOC 4NBGA 1YJ9Z 2QA4Z 1QVGZ 4RVHA 4BBRI 4LF4C 1KD11 3HOZI 4RLQA 5C4JI 1VQ8Z 3M4OI 4WS9A 2OOYB 4YY3C 4MTNA 4HGYA 1QWIA 1I3QI 3CCMZ 1JJ2Y 2CY1A 1Z02A 4DR4C 3CC71 1MXBA 2OTJ1 5LMUC 3T4NB 5BSMA 1MDFA 4E31A 2CXCA 1YJNZ 1VQNZ 4GS5A 2OBVA 3AF6A 2QEXZ 1YIT1 4BXXI 2KPIA 5LL6f 4B3MC 1ZB8A 1IBKC 5T8TA 5BSRA 4BY1I 4BY7I 3FCEA 1YJ91 2ZAEB 2P20A 2BJOA 2E2JI 2DYJA 4A3BI 2UU9C 1M901 3HOVI 1YI2Z 2ZM6C 3KXWA 3GTPI 1VQOZ 3S1MI 2P28A 2DPLA 2UUAC 2JUBA 3GR1A 2O4HA 1VQ81 2VSQA 5ADZA 1KRLA 2JS4A 2HHHC 3CCRZ 1VQ4Z 1HNXC 3G4S1 1K0RA 2E0GA 2K5RA 4JM1A 1RO4A 1GPMA 3VMIA 4DR3C 3I551 5KYVA 4A3CI 1VQN1 4NOZA 2IZ4A 4NB8A 2YADA 2QREB 2UUBC 5BURA 3GTQI 3NH4A 4DCSA 5IT9b 3IFUA 4QTTA 5CM2M 3NYQA 3HKZA 1VQM1 3CCSZ 1K83I 2I3CA 3TDHB 2E9HA 2PROA 2OPLA 3PROC 5IWAC 3IF8A 2D1RA 1VQ61 1VQO1 3IEUA 3SO4A 2HU9A 3D6WA 1MD9A 4DQYB 2JA5I 3VNQA 3DLPX 3K7AI 2E2HI 1I6HI 1X3ZA 4RS4A 3CCR1 1VQ41 1Q812 4DG9A 3A9UA 5A1GA 3L95X 3NH8A 1VQP1 2XR1A 2UXCC 1ML8A 2RT9A 3CCLZ 3N2QA 1N2FA 3FCCA 2K3RA 2O53A 4JI1C 4E2XA 2R93I 1VQL1 3LNVA 4LF8C 3EERA 3NFZA 3CCS1 4U5YD 1KQSY 1IBLC 3R44A 1S72Z 3U50C 3PO3I 3H2TA 1V26A 1MDBA 3CCJ1 2PM9A 1N8R2 5IFIA 4DR2C 1NJI1 2WD9A 1Z01A 1R9TI 2ASBA 4TPSB 3NI2A 3KIFA 2LIYA 5BSUA 2PT7G 5BSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA C;  4NBA A;  4A3I I;  2PN2 A;  4X64 C;  1L2F A;  4A3J I;  4JI8 C;  4A3E I;  4JI3 C;  4LFC C;  4A93 I;  1PFT A;  4DR6 C;  3CQZ I;  5FLX D;  4A3D I;  3PO3 S;  3IEV A;  5LMN C;  2F4O A;  4DUY C;  1VLA A;  4B3R C;  3GTK I;  2E8C A;  4K0K C;  4DV4 C;  1DL6 A;  2AKL A;  4AQY C;  1FJG C;  4JI5 C;  4NBB A;  4X6A I;  2YCB A;  3S1N I;  1WH9 A;  4A3L I;  4LFA C;  4DV1 C;  1UKK A;  3RZD I;  4MH4 A;  3RZO I;  4A3G I;  3GTM I;  2E7G A;  3T1H C;  2ONF A;  2E8F A;  4JI7 C;  4OX9 C;  2E2I I;  1I50 I;  3GKQ A;  2R7Z I;  1YUA A;  4XX2 A;  3S16 I;  1WF3 A;  4DV3 C;  3I07 A;  4NB9 A;  5IT9 D;  2B63 I;  1Y1V I;  1USP A;  3GTM S;  4DR1 C;  4JI4 C;  2NVQ I;  3I4M I;  4DR5 C;  4NBH A;  2VUM I;  3I4N I;  4GKJ C;  1TWC I;  3FKI I;  1HNW C;  2DE5 A;  2E5L C;  2UXB C;  1J5E C;  3S1Q I;  4DCU A;  2DE6 A;  2QL8 A;  2NVY I;  1XNQ C;  5C44 I;  1N34 C;  4X65 C;  1TWH I;  2HJG A;  3GTL I;  2P3Y A;  2KZF A;  2UUC C;  1SFO I;  4DV6 C;  3LUS A;  1WCM I;  5A2Q D;  2RBL A;  4NBF A;  1XMQ C;  1HH2 P;  3GTJ I;  1NUI A;  3OTO C;  1N33 C;  4GKK C;  4QTU A;  4DCV A;  3CJE A;  4NXM C;  1RLY A;  4DCT A;  4A3K I;  1Y1W I;  5FLM I;  1JOS A;  4DV0 C;  5C3E I;  1WW9 A;  3S1R I;  1X3W A;  1MKY A;  2F4V C;  5BR8 C;  4X62 C;  4A3F I;  1I94 C;  3GTO I;  3GKU A;  4NBE A;  3HOY I;  3R9X A;  4B3T C;  3HOW I;  4KHP C;  2JR6 A;  3H3V J;  4NBD A;  4JI0 C;  5C4X I;  4DUZ C;  2YU9 I;  3T1Y C;  3GCF A;  1LQL A;  4A3M I;  2R92 I;  4DR7 C;  2VQF C;  4JI2 C;  2D7V A;  2VQE C;  4DV5 C;  2ATW A;  1HNZ C;  1XNR C;  2DE7 A;  1TFI A;  1N36 C;  4LF7 C;  4NXN C;  3J81 D;  2E8E A;  4DV2 C;  2J6A A;  3AF5 A;  3H0G I;  4BBS I;  2JA6 I;  2JA7 I;  4Y7N I;  4JI6 C;  3ESW A;  3PO2 I;  1NYE A;  4B3S C;  1L1O C;  1Y1V S;  2PK7 A;  1TWF I;  1USP B;  5IP9 I;  1PA4 A;  5IP7 I;  4LF6 C;  4JV5 C;  3S2H I;  3Q87 A;  4X66 C;  2UXD C;  2OPL B;  3VMG A;  4LF9 C;  4BSZ A;  1TWA I;  3GTG I;  3S15 I;  1QYP A;  3HOU I;  1KKG A;  2JNY A;  3JAM D;  4LFB C;  2NVX I;  4NBC A;  1TWG I;  3M3Y I;  4DV7 C;  3HOX I;  3R9W A;  1HR0 C;  1ZB9 A;  4YHH C;  3VMH A;  2EGT A;  4Y52 I;  2JMP A;  1IBM C;  3S14 I;  3J80 D;  2JA8 I;  2F4M A;  3VB9 A;  4LF5 C;  3S2D I;  1N32 C;  2NVT I;  3S17 I;  2HF1 A;  1EGA A;  1XMO C;  4NBG A;  4BBR I;  4LF4 C;  3HOZ I;  5C4J I;  3M4O I;  4YY3 C;  4MTN A;  1QWI A;  1I3Q I;  2CY1 A;  4DR4 C;  5LMU C;  2CXC A;  3AF6 A;  4BXX I;  2KPI A;  4B3M C;  1ZB8 A;  1IBK C;  4BY1 I;  4BY7 I;  2BJO A;  2E2J I;  2DYJ A;  4A3B I;  2UU9 C;  3HOV I;  2ZM6 C;  3GTP I;  3S1M I;  2UUA C;  2HHH C;  2JS4 A;  1HNX C;  1K0R A;  2K5R A;  1RO4 A;  3VMI A;  4DR3 C;  4A3C I;  4NOZ A;  4NB8 A;  2UUB C;  3GTQ I;  4DCS A;  4QTT A;  5CM2 M;  1K83 I;  2OPL A;  5IWA C;  3IEU A;  3D6W A;  2JA5 I;  3K7A I;  2E2H I;  1I6H I;  1X3Z A;  2XR1 A;  2UXC C;  1ML8 A;  1N2F A;  4JI1 C;  2R93 I;  4LF8 C;  3EER A;  1IBL C;  3U50 C;  3PO3 I;  4DR2 C;  2ASB A;  1R9T I;  2PT7 G; 
#chains in the Genus database with same CATH topology
 3CPW Z;  4JYA C;  4MRI A;  1P7L A;  4BC7 A;  1QVG Y;  4RVF A;  1VQK Z;  1VQ7 1;  1O90 A;  4NBA A;  4A3I I;  2YWC A;  3G6E Z;  2PN2 A;  4X64 C;  1L2F A;  4A3J I;  3TDE A;  5KEI A;  3NH5 A;  4JI8 C;  4A3E I;  4JI3 C;  4LFC C;  4A93 I;  1FLO A;  1Q82 1;  5KYT A;  1PFT A;  2YX1 A;  4DR6 C;  5GTD A;  3CC4 1;  3CQZ I;  1IB8 A;  5FLX D;  1IBM C;  4A3D I;  5BST A;  3PO3 S;  2D27 A;  2QR1 B;  2VPX A;  4DK1 A;  3IEV A;  5LMN C;  2OTL 1;  2F4O A;  2OTJ Z;  2ZZN A;  4DUY C;  1RQF A;  1VLA A;  1Q82 2;  3KIH A;  4B3R C;  4HGZ A;  4E33 A;  2KI7 B;  3GTK I;  2E8C A;  4K0K C;  1TH5 A;  2KDN A;  4R1M A;  4DV4 C;  1DL6 A;  4FTF A;  2AKL A;  1YIT Z;  2OO4 A;  4AQY C;  1FJG C;  4JI5 C;  1YJW 1;  4NBB A;  4ZLP A;  4DGL A;  4AYB A;  4X6A I;  2YCB A;  3A4I A;  3S1N I;  3NDI A;  1WH9 A;  4LE5 A;  4D57 A;  2NAP A;  4A3L I;  3CCQ 1;  5D1O B;  4DV1 C;  3I56 1;  4LFA C;  4BC9 A;  5T64 A;  1UKK A;  5A1I A;  2M6N A;  3RZD I;  2P2F A;  4MH4 A;  3RZO I;  4A3G I;  1M6X A;  3GTM I;  1RY2 A;  3G4S Z;  3CC2 1;  2QW0 X;  3NDJ A;  3CME 1;  1P4E C;  3K6R A;  2E7G A;  3T1H C;  3I55 Z;  4MD9 A;  3PBK A;  2ONF A;  2E8F A;  1X0T A;  2QVZ X;  4JI7 C;  4OX9 C;  2E2I I;  1VQ9 1;  1I50 I;  3NPD A;  2Y0S A;  1VQM Z;  3GKQ A;  2R7Z I;  1K9M 1;  1YUA A;  2OZK A;  1XRB A;  1S7M A;  1WJ2 A;  4KTT A;  4XX2 A;  2M5H A;  1P4E A;  3S16 I;  1WF3 A;  4HH4 A;  4RVD A;  2V8I A;  5AN9 F;  1VQ6 Z;  2RIQ A;  4DV3 C;  3I07 A;  2VPZ A;  5A2Q f;  3P5J B;  4BCA A;  5T67 A;  1M1K 2;  5T8S A;  3QWU A;  4ZJZ A;  4NB9 A;  5IT9 D;  1K9M 2;  2B63 I;  3UX2 A;  2W03 A;  4S1T A;  1XHJ A;  3VNS A;  1Y1V I;  1JWH C;  1USP A;  3GTM S;  4OXI A;  4RVO A;  4DR1 C;  4JI4 C;  1VQP Z;  1MXA A;  4I9G A;  2NVQ I;  2WB1 A;  5E7Q A;  3I4M I;  4IR7 A;  1QF8 A;  1VQL Z;  3CXC Z;  4OYC A;  2MCQ A;  1O9T A;  2JIO A;  1Q81 1;  3TR3 A;  4DR5 C;  4NBH A;  2VUM I;  4CL1 A;  1FDI A;  3I4N I;  1TWC I;  2LEX A;  4GKJ C;  3FKI I;  5BSV A;  1HNW C;  2V8J A;  4E2Y A;  4E2W A;  2DE5 A;  3CPW Y;  2E5L C;  2UXB C;  3TQI A;  3CCJ Z;  5CZX A;  5K8F A;  1J5E C;  2QRD B;  5LCI A;  3IML A;  3S1Q I;  4DCU A;  2DE6 A;  1RO0 A;  2LFU A;  1PU1 A;  2QL8 A;  1W2B Y;  5BUQ A;  2NVY I;  1XNQ C;  5C44 I;  1N34 C;  1N8R 1;  1VQ7 Z;  4X65 C;  1AMU A;  3I08 A;  3BG0 B;  1TWH I;  2HJG A;  3GTL I;  2JNV A;  2P3Y A;  4G36 A;  2KZF A;  1RNI A;  1NP6 A;  4FUT A;  2UUC C;  1SFO I;  2DHM A;  5K85 A;  4DV6 C;  3LUS A;  2VPY A;  1WCM I;  3UZ0 A;  5A2Q D;  1ZH1 A;  2W04 A;  3CC4 Z;  5T6B A;  1XRA A;  3RV2 A;  2RBL A;  1UWD A;  4NBF A;  2P2B A;  2WP0 C;  5A2Q b;  3L8C A;  1PG3 A;  1XMQ C;  1HH2 P;  2OTL Z;  5H9U A;  2JIP A;  3GTJ I;  3D9X A;  5A19 A;  5AE3 A;  3EQ6 A;  1NUI A;  3CD6 1;  4NH1 C;  4L2Z A;  3OTO C;  1BA3 A;  1PG4 A;  2BH1 X;  1T5H X;  3TE5 B;  4RM3 A;  4G37 A;  1N33 C;  4GKK C;  2P2J A;  2Q4Z A;  4QTU A;  1YJW Z;  1W2B Z;  4DCV A;  2R6M A;  3CJE A;  2GTH A;  4TNU A;  1RLY A;  4ODJ A;  4NXM C;  4DCT A;  2YWB A;  3N54 B;  3C5E A;  3CCQ Z;  1Z03 A;  3I56 Z;  4A3K I;  4D4I A;  1Y1W I;  5FLM I;  1JOS A;  3J7A 4;  4DV0 C;  1KC8 1;  3GR0 A;  5C3E I;  2D1Q A;  1WW9 A;  1YUK A;  3CC2 Z;  3CME Z;  2JIM A;  3S1R I;  3CCV 1;  5D1O A;  4L4Q A;  1X3W A;  1MKY A;  4BBY A;  2F4V C;  5BR8 C;  4X62 C;  4A3F I;  1I94 C;  3CCE 1;  1VQ9 Z;  4RVN A;  2QLV B;  3GTO I;  3GKU A;  4NBE A;  1KC8 2;  3UX3 A;  3HOY I;  3R9X A;  1Q16 A;  3MON A;  1MXC A;  3D2L A;  4B3T C;  1YIJ 1;  3S82 A;  3HOW I;  3CW9 A;  4FUQ A;  4KHP C;  2JR6 A;  3J81 f;  2VF1 A;  2P2M A;  1QVF Y;  2Z51 A;  3CW8 X;  4RLF A;  1K73 2;  3H3V J;  2OOX B;  4NBD A;  2QRC B;  3UOW A;  4JI0 C;  5C4X I;  3J80 b;  4RVG A;  1NY8 A;  4DG8 A;  3G71 1;  3ETC A;  3CXC Y;  3BG1 B;  4DUZ C;  2YU9 I;  3T1Y C;  4NDN A;  1LCI A;  1V25 A;  2Y4O A;  3GCF A;  1LQL A;  4A3M I;  4RMN A;  2R92 I;  1M1K 1;  3FQQ A;  2D28 C;  4DR7 C;  1SIW A;  2VQF C;  1Q7Y 1;  1V60 A;  4K0B A;  2AYA A;  4JI2 C;  3DHV A;  2P2Q A;  2D7V A;  1YHQ 1;  4R1L A;  4GXR A;  2VQE C;  2Y4N A;  4WV3 A;  4DV5 C;  1K8A 1;  4KTV A;  2ATW A;  5AE1 A;  3A25 A;  1HNZ C;  1WII A;  1VEH A;  1XNR C;  1Q7Y 2;  1KD1 2;  4L7I A;  2DE7 A;  1YJ7 A;  4MD8 A;  3CCU 1;  1QVF Z;  2ZZM A;  2GU2 A;  1TFI A;  3VTN A;  1N36 C;  4LF7 C;  1Y8C A;  3DAY A;  1K8A 2;  2QA4 1;  1QM4 A;  4NXN C;  2M5O A;  2QKD A;  3J81 D;  3OW2 Z;  3VNR A;  2E8E A;  1XS3 A;  2JIR A;  2VUG A;  2D1T A;  4DV2 C;  1RO2 A;  2J6A A;  3CCM 1;  3AF5 A;  3H0G I;  4BBS I;  5CZV A;  3J81 b;  2V8K A;  1VQ5 Z;  2G2K A;  2JA6 I;  3CQ2 A;  3E7X A;  1M90 2;  3JAM f;  1YJN 1;  4PHT A;  2JA7 I;  4Y7N I;  2GTI A;  2IV2 X;  2QEX 1;  1JJ2 Z;  3CD6 Z;  3ESW A;  2MM9 A;  2RHB A;  3PO2 I;  1NYE A;  1AA6 A;  3LGX A;  4JI6 C;  4B3S C;  2JMO A;  1L1O C;  1Y1V S;  3GPC A;  2AYD A;  4MD7 A;  4MON A;  4MXU A;  2PK7 A;  1YI2 1;  4IZ6 A;  1TWF I;  1USP B;  3F3P C;  3B7W A;  5IP9 I;  2M48 A;  1QXF A;  3MZL B;  1PA4 A;  5IP7 I;  4LF6 C;  5FLX f;  4RV9 A;  2MMA B;  3J80 f;  4JV5 C;  4PUG A;  3S2H I;  1VQ5 1;  2WAQ A;  4D4G A;  2H85 A;  3Q87 A;  2P02 A;  4X66 C;  5AE2 A;  3CCV Z;  2UXD C;  4D56 A;  1ULT A;  2OPL B;  1P9N A;  2D1S A;  2Q51 A;  1WCJ A;  3A9V A;  3IX0 A;  3VMG A;  4G1I A;  4LF9 C;  4BSZ A;  1TWA I;  4R0M A;  2IZ3 A;  3CCE Z;  3GTG I;  5DV9 A;  2JIQ A;  4PZP A;  3S15 I;  1Q86 1;  4NFR A;  2RPR A;  1QYP A;  3HOU I;  2VZE A;  3G7S A;  1KKG A;  1YIJ Z;  2V7B A;  2JNY A;  1O92 A;  3JAM D;  4E30 A;  4LFB C;  1Q86 2;  2NVX I;  4PRO C;  4NBC A;  3G71 Z;  3CMA Z;  3FQM A;  3CCL 1;  1TWG I;  1NJI 2;  3M3Y I;  3A26 A;  3JAM b;  4DV7 C;  3NYR A;  3HOX I;  3R9W A;  4EAT A;  1K73 1;  4PUH A;  1HR0 C;  1ZB9 A;  4GXQ A;  1XRC A;  2V3V A;  5D1P A;  3F3F C;  3E7W A;  1S72 1;  4RM2 A;  4YHH C;  3TUF A;  1T5D X;  3VMH A;  2EGT A;  4EWC A;  4Y52 I;  2JMP A;  4ISB A;  5JRH A;  3S14 I;  2Y27 A;  3J80 D;  2JA8 I;  4E32 A;  1FDO A;  2CU6 A;  1YHQ Z;  1KQS Z;  2F4M A;  3VB9 A;  4LF5 C;  3CC7 Z;  2QVX X;  4HPV A;  3S2D I;  1O93 A;  1FUG A;  1M6X C;  5FLX b;  4E2Z A;  1N32 C;  3IPL A;  5IT9 f;  2NVT I;  1VQK 1;  3S17 I;  3LAX A;  1RG9 A;  3LNO A;  3CMA 1;  3PES A;  2PMZ A;  3EED A;  5BUS A;  2HF1 A;  3CCU Z;  3MZK B;  1EGA A;  3RG2 A;  3G6E 1;  4I9F A;  2QVY X;  3ETO A;  3OW2 Y;  1XMO C;  4NBG A;  1YJ9 Z;  2QA4 Z;  1QVG Z;  3CQ1 A;  4RVH A;  4BBR I;  4LF4 C;  2VPW A;  1KD1 1;  3HOZ I;  4RLQ A;  5C4J I;  1VQ8 Z;  3M4O I;  4WS9 A;  2OOY B;  4YY3 C;  4MTN A;  4HGY A;  1QWI A;  1I3Q I;  3CCM Z;  1JJ2 Y;  1WZN A;  1Z02 A;  2CY1 A;  4DR4 C;  3CC7 1;  1MXB A;  2OTJ 1;  5LMU C;  3T4N B;  5BSM A;  1MDF A;  4E31 A;  2CXC A;  1YJN Z;  1VQN Z;  2KZ0 A;  4GS5 A;  2OBV A;  3AF6 A;  2QEX Z;  1YIT 1;  4BXX I;  2KPI A;  5LL6 f;  4B3M C;  1ZB8 A;  1IBK C;  5T8T A;  5BSR A;  4BY1 I;  4BY7 I;  3FCE A;  1YJ9 1;  2ZAE B;  2P20 A;  2BJO A;  2E2J I;  2DYJ A;  4A3B I;  2UU9 C;  1M90 1;  3HOV I;  1YI2 Z;  2ZM6 C;  3KXW A;  3GTP I;  1VQO Z;  3S1M I;  2P28 A;  2DPL A;  2UUA C;  2JUB A;  2E7Z A;  3GR1 A;  2O4H A;  1VQ8 1;  2VSQ A;  5ADZ A;  1KRL A;  2JS4 A;  3AY0 A;  2HHH C;  3CCR Z;  1VQ4 Z;  1HNX C;  3G4S 1;  1K0R A;  2E0G A;  2K5R A;  4JM1 A;  1RO4 A;  1GPM A;  3VMI A;  4DR3 C;  3I55 1;  5KYV A;  4A3C I;  1VQN 1;  4NOZ A;  2IZ4 A;  4NB8 A;  2YAD A;  2QRE B;  2V45 A;  3CQ3 A;  3UEB A;  5BUR A;  2UUB C;  3GTQ I;  3NH4 A;  4DCS A;  5IT9 b;  3IFU A;  4QTT A;  5CM2 M;  3NYQ A;  3HKZ A;  1VQM 1;  4PUI A;  3CCS Z;  1K83 I;  2I3C A;  3TDH B;  2E9H A;  2PRO A;  2OPL A;  3PRO C;  5IWA C;  3IF8 A;  2D1R A;  3IR7 A;  1VQ6 1;  1VQO 1;  3IEU A;  2NCL A;  3SO4 A;  2HU9 A;  3D6W A;  1MD9 A;  4DQY B;  2JA5 I;  3VNQ A;  3DLP X;  3K7A I;  2E2H I;  1I6H I;  3O2E A;  1X3Z A;  4RS4 A;  3CCR 1;  1VQ4 1;  1Q81 2;  4DG9 A;  3A9U A;  5A1G A;  3L95 X;  3NH8 A;  1VQP 1;  2XR1 A;  2UXC C;  1ML8 A;  2RT9 A;  3CCL Z;  3N2Q A;  1N2F A;  3FCC A;  2K3R A;  2O53 A;  4JI1 C;  4E2X A;  2R93 I;  1VQL 1;  3LNV A;  4LF8 C;  3EER A;  3NFZ A;  3CCS 1;  4U5Y D;  1KQS Y;  1IBL C;  3R44 A;  1S72 Z;  3U50 C;  3PO3 I;  3H2T A;  1V26 A;  1MDB A;  3CCJ 1;  2PM9 A;  1N8R 2;  5IFI A;  4DR2 C;  1NJI 1;  2WD9 A;  1Z01 A;  1R9T I;  2ASB A;  4TPS B;  3NI2 A;  3KIF A;  2LIY A;  5BSU A;  2PT7 G;  5BSW A; 
#chains in the Genus database with same CATH homology
 3CPW Z;  4JYA C;  4MRI A;  1P7L A;  4BC7 A;  1QVG Y;  4RVF A;  1VQK Z;  1VQ7 1;  1O90 A;  4NBA A;  4A3I I;  2YWC A;  3G6E Z;  2PN2 A;  4X64 C;  1L2F A;  4A3J I;  3TDE A;  5KEI A;  3NH5 A;  4JI8 C;  4A3E I;  4JI3 C;  4LFC C;  4A93 I;  1Q82 1;  5KYT A;  1PFT A;  4DR6 C;  5GTD A;  3CC4 1;  3CQZ I;  5FLX D;  1IBM C;  4A3D I;  5BST A;  3PO3 S;  2D27 A;  2QR1 B;  4DK1 A;  3IEV A;  5LMN C;  2OTL 1;  2F4O A;  2OTJ Z;  4DUY C;  1RQF A;  1VLA A;  1Q82 2;  3KIH A;  4B3R C;  4HGZ A;  4E33 A;  2KI7 B;  3GTK I;  2E8C A;  4K0K C;  4R1M A;  4DV4 C;  1DL6 A;  4FTF A;  2AKL A;  1YIT Z;  2OO4 A;  4AQY C;  1FJG C;  4JI5 C;  1YJW 1;  4NBB A;  4ZLP A;  4DGL A;  4AYB A;  4X6A I;  2YCB A;  3A4I A;  3S1N I;  3NDI A;  1WH9 A;  4LE5 A;  4D57 A;  4A3L I;  3CCQ 1;  5D1O B;  4DV1 C;  3I56 1;  4LFA C;  4BC9 A;  5T64 A;  1UKK A;  5A1I A;  2M6N A;  3RZD I;  2P2F A;  4MH4 A;  3RZO I;  4A3G I;  3GTM I;  1RY2 A;  3G4S Z;  3CC2 1;  2QW0 X;  3NDJ A;  3CME 1;  2E7G A;  3T1H C;  3I55 Z;  4MD9 A;  3PBK A;  2ONF A;  2E8F A;  1X0T A;  2QVZ X;  4JI7 C;  4OX9 C;  2E2I I;  1VQ9 1;  1I50 I;  3NPD A;  2Y0S A;  1VQM Z;  3GKQ A;  2R7Z I;  1K9M 1;  1YUA A;  2OZK A;  1XRB A;  1S7M A;  4KTT A;  4XX2 A;  3S16 I;  1WF3 A;  4HH4 A;  4RVD A;  2V8I A;  5AN9 F;  1VQ6 Z;  2RIQ A;  4DV3 C;  3I07 A;  5A2Q f;  3P5J B;  4BCA A;  5T67 A;  1M1K 2;  5T8S A;  3QWU A;  4ZJZ A;  4NB9 A;  5IT9 D;  1K9M 2;  2B63 I;  2W03 A;  4S1T A;  3VNS A;  1Y1V I;  1JWH C;  1USP A;  3GTM S;  4OXI A;  4RVO A;  4DR1 C;  4JI4 C;  1VQP Z;  1MXA A;  4I9G A;  2NVQ I;  2WB1 A;  5E7Q A;  3I4M I;  4IR7 A;  1QF8 A;  1VQL Z;  3CXC Z;  4OYC A;  1O9T A;  1Q81 1;  4DR5 C;  4NBH A;  2VUM I;  4CL1 A;  3I4N I;  4GKJ C;  1TWC I;  3FKI I;  5BSV A;  1HNW C;  2V8J A;  4E2Y A;  4E2W A;  2DE5 A;  3CPW Y;  2E5L C;  2UXB C;  3TQI A;  3CCJ Z;  5CZX A;  5K8F A;  1J5E C;  2QRD B;  3IML A;  3S1Q I;  4DCU A;  2DE6 A;  1RO0 A;  2LFU A;  2QL8 A;  1W2B Y;  5BUQ A;  2NVY I;  1XNQ C;  5C44 I;  1N34 C;  1N8R 1;  1VQ7 Z;  4X65 C;  1AMU A;  3I08 A;  3BG0 B;  1TWH I;  2HJG A;  3GTL I;  2P3Y A;  4G36 A;  2KZF A;  1RNI A;  1NP6 A;  4FUT A;  2UUC C;  1SFO I;  5K85 A;  4DV6 C;  3LUS A;  1WCM I;  3UZ0 A;  5A2Q D;  1ZH1 A;  2W04 A;  3CC4 Z;  5T6B A;  1XRA A;  3RV2 A;  2RBL A;  4NBF A;  2P2B A;  2WP0 C;  5A2Q b;  3L8C A;  1PG3 A;  1XMQ C;  1HH2 P;  2OTL Z;  5H9U A;  3GTJ I;  3D9X A;  5A19 A;  5AE3 A;  3EQ6 A;  1NUI A;  3CD6 1;  4NH1 C;  4L2Z A;  3OTO C;  1BA3 A;  1PG4 A;  2BH1 X;  1T5H X;  3TE5 B;  4RM3 A;  4G37 A;  1N33 C;  4GKK C;  2P2J A;  2Q4Z A;  4QTU A;  1YJW Z;  1W2B Z;  4DCV A;  2R6M A;  3CJE A;  2GTH A;  4TNU A;  1RLY A;  4ODJ A;  4NXM C;  4DCT A;  2YWB A;  3N54 B;  3C5E A;  3CCQ Z;  1Z03 A;  3I56 Z;  4A3K I;  4D4I A;  1Y1W I;  5FLM I;  1JOS A;  3J7A 4;  4DV0 C;  1KC8 1;  3GR0 A;  5C3E I;  2D1Q A;  1WW9 A;  1YUK A;  3CC2 Z;  3CME Z;  3S1R I;  3CCV 1;  5D1O A;  4L4Q A;  1X3W A;  1MKY A;  4BBY A;  2F4V C;  5BR8 C;  4X62 C;  4A3F I;  1I94 C;  3CCE 1;  1VQ9 Z;  4RVN A;  2QLV B;  3GTO I;  3GKU A;  4NBE A;  1KC8 2;  3HOY I;  3R9X A;  3MON A;  1MXC A;  4B3T C;  1YIJ 1;  3S82 A;  3HOW I;  3CW9 A;  4FUQ A;  4KHP C;  2JR6 A;  3J81 f;  2VF1 A;  2P2M A;  1QVF Y;  3CW8 X;  4RLF A;  1K73 2;  3H3V J;  2OOX B;  4NBD A;  2QRC B;  3UOW A;  4JI0 C;  5C4X I;  3J80 b;  4RVG A;  4DG8 A;  3G71 1;  3ETC A;  3CXC Y;  3BG1 B;  4DUZ C;  2YU9 I;  3T1Y C;  4NDN A;  1LCI A;  1V25 A;  2Y4O A;  3GCF A;  1LQL A;  4A3M I;  2R92 I;  1M1K 1;  3FQQ A;  2D28 C;  4DR7 C;  2VQF C;  1Q7Y 1;  4K0B A;  2AYA A;  4JI2 C;  3DHV A;  2P2Q A;  2D7V A;  1YHQ 1;  4R1L A;  4GXR A;  2VQE C;  2Y4N A;  4WV3 A;  4DV5 C;  1K8A 1;  4KTV A;  2ATW A;  5AE1 A;  1HNZ C;  1WII A;  1XNR C;  1Q7Y 2;  1KD1 2;  4L7I A;  2DE7 A;  1YJ7 A;  4MD8 A;  3CCU 1;  1QVF Z;  2GU2 A;  1TFI A;  3VTN A;  1N36 C;  4LF7 C;  3DAY A;  1K8A 2;  2QA4 1;  1QM4 A;  4NXN C;  2QKD A;  3J81 D;  3OW2 Z;  3VNR A;  2E8E A;  2VUG A;  2D1T A;  4DV2 C;  1RO2 A;  2J6A A;  3CCM 1;  3AF5 A;  3H0G I;  4BBS I;  5CZV A;  3J81 b;  2V8K A;  1VQ5 Z;  2G2K A;  2JA6 I;  3E7X A;  1M90 2;  3JAM f;  1YJN 1;  4PHT A;  2JA7 I;  4Y7N I;  2GTI A;  2QEX 1;  1JJ2 Z;  3NYR A;  3CD6 Z;  3ESW A;  3LGX A;  2RHB A;  3PO2 I;  1NYE A;  4RMN A;  4JI6 C;  4B3S C;  2JMO A;  1L1O C;  1Y1V S;  3GPC A;  4MD7 A;  4MON A;  4MXU A;  2PK7 A;  1YI2 1;  4IZ6 A;  1TWF I;  1USP B;  3F3P C;  3B7W A;  5IP9 I;  2M48 A;  1PA4 A;  3MZL B;  5IP7 I;  4LF6 C;  5FLX f;  4RV9 A;  3J80 f;  4JV5 C;  3S2H I;  1VQ5 1;  2WAQ A;  4D4G A;  2H85 A;  3Q87 A;  2P02 A;  4X66 C;  5AE2 A;  3CCV Z;  2UXD C;  4D56 A;  1ULT A;  2OPL B;  1P9N A;  2D1S A;  2Q51 A;  3A9V A;  3IX0 A;  3VMG A;  4G1I A;  4LF9 C;  4BSZ A;  1TWA I;  4R0M A;  2IZ3 A;  3CCE Z;  3GTG I;  5DV9 A;  4PZP A;  3S15 I;  1Q86 1;  4NFR A;  2RPR A;  1QYP A;  3HOU I;  2VZE A;  3G7S A;  1KKG A;  1YIJ Z;  2V7B A;  2JNY A;  1O92 A;  3JAM D;  4E30 A;  4LFB C;  1Q86 2;  2NVX I;  4PRO C;  4NBC A;  3G71 Z;  3CMA Z;  3FQM A;  3CCL 1;  1TWG I;  1NJI 2;  3M3Y I;  3JAM b;  4DV7 C;  3HOX I;  3R9W A;  4EAT A;  1K73 1;  1HR0 C;  1ZB9 A;  4GXQ A;  1XRC A;  5D1P A;  3E7W A;  3F3F C;  1S72 1;  4RM2 A;  4YHH C;  3TUF A;  1T5D X;  3VMH A;  2EGT A;  4EWC A;  4Y52 I;  2JMP A;  4ISB A;  5JRH A;  3S14 I;  2Y27 A;  3J80 D;  2JA8 I;  4E32 A;  1YHQ Z;  1KQS Z;  2F4M A;  3VB9 A;  4LF5 C;  3CC7 Z;  2QVX X;  4HPV A;  3S2D I;  1O93 A;  1FUG A;  5FLX b;  4E2Z A;  1N32 C;  3IPL A;  5IT9 f;  2NVT I;  1VQK 1;  3S17 I;  3LAX A;  1RG9 A;  3CMA 1;  3PES A;  2PMZ A;  3EED A;  5BUS A;  2HF1 A;  3CCU Z;  3MZK B;  1EGA A;  3RG2 A;  3G6E 1;  4I9F A;  2QVY X;  3ETO A;  3OW2 Y;  1XMO C;  4NBG A;  1YJ9 Z;  2QA4 Z;  1QVG Z;  4RVH A;  4BBR I;  4LF4 C;  1KD1 1;  3HOZ I;  4RLQ A;  5C4J I;  1VQ8 Z;  3M4O I;  4WS9 A;  2OOY B;  4YY3 C;  4MTN A;  4HGY A;  1QWI A;  1I3Q I;  3CCM Z;  1JJ2 Y;  2CY1 A;  1Z02 A;  4DR4 C;  3CC7 1;  1MXB A;  2OTJ 1;  5LMU C;  3T4N B;  5BSM A;  1MDF A;  4E31 A;  2CXC A;  1YJN Z;  1VQN Z;  4GS5 A;  2OBV A;  3AF6 A;  2QEX Z;  1YIT 1;  4BXX I;  2KPI A;  5LL6 f;  4B3M C;  1ZB8 A;  1IBK C;  5T8T A;  5BSR A;  4BY1 I;  4BY7 I;  3FCE A;  1YJ9 1;  2ZAE B;  2P20 A;  2BJO A;  2E2J I;  2DYJ A;  4A3B I;  2UU9 C;  1M90 1;  3HOV I;  1YI2 Z;  2ZM6 C;  3KXW A;  3GTP I;  1VQO Z;  3S1M I;  2P28 A;  2DPL A;  2UUA C;  2JUB A;  3GR1 A;  2O4H A;  1VQ8 1;  2VSQ A;  5ADZ A;  1KRL A;  2JS4 A;  2HHH C;  3CCR Z;  1VQ4 Z;  1HNX C;  3G4S 1;  1K0R A;  2E0G A;  2K5R A;  4JM1 A;  1RO4 A;  1GPM A;  3VMI A;  4DR3 C;  3I55 1;  5KYV A;  4A3C I;  1VQN 1;  4NOZ A;  2IZ4 A;  4NB8 A;  2YAD A;  2QRE B;  2UUB C;  5BUR A;  3GTQ I;  3NH4 A;  4DCS A;  5IT9 b;  3IFU A;  4QTT A;  5CM2 M;  3NYQ A;  3HKZ A;  1VQM 1;  3CCS Z;  1K83 I;  2I3C A;  3TDH B;  2E9H A;  2PRO A;  2OPL A;  3PRO C;  5IWA C;  3IF8 A;  2D1R A;  1VQ6 1;  1VQO 1;  3IEU A;  3SO4 A;  2HU9 A;  3D6W A;  1MD9 A;  4DQY B;  2JA5 I;  3VNQ A;  3DLP X;  3K7A I;  2E2H I;  1I6H I;  1X3Z A;  4RS4 A;  3CCR 1;  1VQ4 1;  1Q81 2;  4DG9 A;  3A9U A;  5A1G A;  3L95 X;  3NH8 A;  1VQP 1;  2XR1 A;  2UXC C;  1ML8 A;  2RT9 A;  3CCL Z;  3N2Q A;  1N2F A;  3FCC A;  2K3R A;  2O53 A;  4JI1 C;  4E2X A;  2R93 I;  1VQL 1;  3LNV A;  4LF8 C;  3EER A;  3NFZ A;  3CCS 1;  4U5Y D;  1KQS Y;  1IBL C;  3R44 A;  1S72 Z;  3U50 C;  3PO3 I;  3H2T A;  1V26 A;  1MDB A;  3CCJ 1;  2PM9 A;  1N8R 2;  5IFI A;  4DR2 C;  1NJI 1;  2WD9 A;  1Z01 A;  1R9T I;  2ASB A;  4TPS B;  3NI2 A;  3KIF A;  2LIY A;  5BSU A;  2PT7 G;  5BSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...