1USPA

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
137
structure length
137
Chain Sequence
NVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPADSTITARVGLQKAGLAFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
total genus 31
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspA02
4JI6C 2UXCC 3HOXI 4NXNC 4JI0C 3PO3S 4JI3C 4DR4C 4GKKC 5IP9I 4Y52I 2VUMI 3VB9A 3I4MI 2F4OA 2ZM6C 4B3SC 1R9TI 4MTNA 4JI5C 4LF4C 2JNYA 2JR6A 1K0RA 4A3FI 3T1YC 2E8EA 3HOWI 4NB9A 4BY1I 4DV4C 3GKQA 2KZFA 2ASBA 1USPB 1PA4A 2HJGA 2JMPA 2NVYI 1IBKC 2JA5I 3S1NI 4DCUA 4DCSA 3AF6A 3I07A 3D6WA 1WH9A 1L2FA 3Q87A 5C4JI 4A3CI 1XMOC 1N36C 1IBMC 2J6AA 1SFOI 3PO2I 4B3MC 4B3TC 3S14I 3CQZI 1MKYA 3HOUI 1X3ZA 3VMIA 1X3WA 4JI4C 1I94C 1HNWC 2RBLA 1N33C 4NBGA 1LQLA 3S1QI 2D7VA 2NVQI 1VLAA 3S16I 4A3GI 2HHHC 2JA8I 4B3RC 4JV5C 4QTTA 5CM2M 2OPLA 4BY7I 2K5RA 1J5EC 1YUAA 1TWGI 4QTUA 3GTOI 3HOZI 2OPLB 4LF6C 4AQYC 3S15I 4YY3C 1I3QI 4GKJC 3S17I 3AF5A 4JI2C 4DCTA 2UU9C 4DV1C 3I4NI 2UUBC 4BXXI 3RZDI 3S1MI 1WCMI 4LFBC 2F4VC 1I50I 4BBSI 1N34C 4XX2A 4NBAA 2AKLA 3M3YI 2VQEC 4JYAC 4NBHA 1Y1VS 1QWIA 1I6HI 3GKUA 4JI7C 2UUCC 1NUIA 4X65C 4A3JI 3CJEA 3H0GI 4NBEA 2E7GA 4NBBA 4NBFA 1XNRC 5C4XI 2DE6A 1HR0C 3GTLI 4X6AI 4JI1C 2UXDC 2F4MA 2R7ZI 5FLMI 4K0KC 1KKGA 3M4OI 4DV0C 1DL6A 1HNZC 3S1RI 5IP7I 2NVTI 3IEUA 2VQFC 1TWHI 3S2DI 1JOSA 1UKKA 4DR5C 3R9WA 1ZB9A 4A3II 1WF3A 4KHPC 2QL8A 4A3EI 4NBDA 1RLYA 1ZB8A 4A3KI 5BR8C 3ESWA 4X62C 1N32C 2KPIA 2E8CA 5C3EI 3EERA 2R92I 4Y7NI 2DE7A 3GTJI 4DR2C 5IT9D 1HNXC 1Y1WI 2E5LC 4LF9C 3PO3I 2DYJA 4LFAC 4LF8C 2DE5A 3GTMI 1TFIA 1TWFI 5IWAC 1FJGC 1PFTA 4JI8C 4A93I 3JAMD 4DV3C 1WW9A 3GCFA 4LF7C 2BJOA 2B63I 3LUSA 3RZOI 1TWCI 4MH4A 2YU9I 2PT7G 4DUYC 1IBLC 3T1HC 1N2FA 2R93I 4DV6C 3K7AI 3GTQI 4A3MI 1L1OC 2UUAC 5C44I 4DCVA 2JA7I 1ML8A 4BSZA 1Y1VI 1XNQC 2NVXI 4NXMC 1QYPA 2E2HI 4YHHC 2E2JI 2XR1A 2PK7A 3GTPI 2YCBA 2CXCA 4NBCA 2PN2A 2ONFA 5FLXD 4A3LI 3FKII 4X66C 5LMUC 1USPA 4DR1C 4BBRI 1NYEA 4A3BI 3OTOC 4LFCC 2ATWA 3J80D 1EGAA 4NOZA 4DUZC 3S2HI 4DV7C 3R9XA 5A2QD 2EGTA 4DV5C 3U50C 3VMHA 4X64C 4DR6C 3HOVI 3J81D 2CY1A 1K83I 1TWAI 2HF1A 2E2II 3HOYI 4A3DI 2E8FA 3GTKI 1HH2P 1RO4A 4LF5C 3GTGI 3IEVA 4NB8A 3GTMS 1XMQC 4DR7C 2UXBC 2P3YA 2JA6I 5LMNC 3VMGA 3H3VJ 4DV2C 2JS4A 4OX9C 4DR3C
chains in the Genus database with same CATH superfamily
3IX0A 4JI3C 3CCLZ 1VQNZ 5BSUA 5IP9I 3D2LA 3VB9A 2F4OA 2ZM6C 5K85A 1R9TI 4DG9A 4MTNA 1YUKA 2JR6A 1YJ9Z 4BY1I 4U5YD 2JMOA 3GPCA 1M6XA 2HJGA 2JMPA 2RPRA 4TNUA 3DLPX 3CCR1 2Q51A 3CMA1 4RLQA 1VQK1 2LFUA 3E7WA 3QWUA 1L2FA 3Q87A 4A3CI 1LCIA 1GPMA 4PUIA 1SFOI 3L95X 1O93A 3S14I 1MKYA 1VQPZ 3HOUI 1X3ZA 1HNWC 1I94C 1N33C 3CCJZ 3G711 4D56A 2QEXZ 2V8JA 3S16I 4D4IA 4QTTA 5CM2M 5AN9F 4BY7I 3I55Z 4E33A 2IZ3A 3NH4A 2M6NA 1MD9A 1TWGI 4D4GA 3LGXA 3TUFA 1QM4A 1ZH1A 1I3QI 4PZPA 1YJN1 3CQ1A 2UU9C 3VTNA 2P20A 2QRDB 4BXXI 1WCMI 2F4VC 1M902 2VSQA 3PROC 1WIIA 4E2YA 3M3YI 2MCQA 1Y1VS 2P02A 4D57A 4X65C 3TR3A 3CJEA 3TDEA 4NBBA 1TH5A 5T64A 1YJ7A 4X6AI 2MM9A 4JI1C 2UXDC 3NI2A 1XHJA 1KKGA 1YHQ1 2WD9A 2ZZMA 3NDIA 1HNZC 3S1RI 1FDIA 2V45A 2JIOA 1RG9A 3FCCA 4A3II 1WF3A 5AE2A 2QL8A 4NBDA 1M6XC 1ZB8A 1T5DX 5BR8C 1Q822 3CD6Z 2KPIA 4S1TA 5C3EI 4BC7A 4DR2C 1P7LA 1HNXC 2O53A 2IV2X 3PO3I 2QA41 4LF8C 1VQ6Z 2DE5A 1FJGC 3G6EZ 1M901 2ZAEB 4JI8C 2D28C 1WW9A 5IT9f 2B63I 3RZOI 3LUSA 1TWCI 5D1PA 4MRIA 3CCMZ 4ZJZA 3J81f 1BA3A 3DHVA 4E32A 1K8A2 3T1HC 4E31A 1YIT1 4PHTA 2HU9A 4NFRA 3GTQI 1L1OC 4DCVA 4RLFA 3CPWZ 4CL1A 4GXRA 2E2JI 4K0BA 3PESA 2CXCA 2GTIA 2QVXX 4X66C 5KYTA 3OTOC 3CC41 2OOXB 2QA4Z 3O2EA 4GKJC 3HOVI 5A2Qb 2JUBA 1W2BZ 4E30A 3GTGI 2M48A 3J7A4 2P2FA 1XRBA 4I9FA 3CC4Z 2P3YA 4PUHA 4DR7C 1Q16A 2UXBC 1V26A 1QXFA 1PG4A 3C5EA 3F3PC 4JI0C 4NXNC 1Q862 1KC81 1QVFY 3FCEA 1KD12 1KD11 3I4MI 4MD7A 4B3SC 4I9GA 1YITZ 1W2BY 1NP6A 2JNYA 2RIQA 3LNVA 1K0RA 1V25A 4RM2A 2DHMA 5LCIA 2QEX1 3CXCZ 5T8SA 1P4EC 4ODJA 2ASBA 3CCVZ 5BSWA 2JA5I 5A1IA 3L8CA 2I3CA 1IBMC 2Y27A 3PO2I 1YJNZ 2QVZX 4MD9A 4B3TC 3CMAZ 3CQZI 2YWCA 3VMIA 1JJ2Z 2RBLA 1VEHA 2CU6A 1LQLA 1VQ81 2D7VA 2NVQI 2GTHA 5K8FA 4JV5C 2QVYX 1O92A 5A19A 1JWHC 2RHBA 4RS4A 2WP0C 1O9TA 4AQYC 1K731 1QVFZ 3S17I 2Y4OA 3IR7A 3B7WA 4R1MA 4DGLA 1AA6A 3RV2A 3RZDI 3NYQA 1VQ9Z 4PUGA 1I50I 4BBSI 4BCAA 4NBAA 1RO2A 1VQ41 4JYAC 1QWIA 1I6HI 5H9UA 4TPSB 4KTTA 1NUIA 1VQO1 5T6BA 4EWCA 4A3JI 4OXIA 4R0MA 3H0GI 1Q821 2QW0X 2ZZNA 5T67A 2E7GA 4NBFA 4DR3C 1HR0C 2JNVA 5LL6f 2F4MA 2R7ZI 4RVFA 5FLMI 4K0KC 3KIFA 4DV0C 2V8KA 1YJW1 5BUSA 1Z01A 5IP7I 3UEBA 2NVTI 1Q7Y2 2OTL1 1TWHI 3S2DI 1UKKA 3NH8A 3IPLA 1ZB9A 2WB1A 2P2JA 4DG8A 3J80b 4G37A 4A3EI 3RG2A 2YADA 4E2WA 1FUGA 4X62C 2E8CA 3E7XA 3IF8A 3TDHB 3EERA 1Q811 4Y7NI 3NPDA 1VQ71 4RVOA 1Y1WI 1NY8A 5JRHA 4KTVA 4LFAC 1FDOA 4LE5A 3NYRA 1PFTA 1PG3A 4A93I 5ADZA 4DV3C 3GCFA 3CMEZ 2BJOA 1VQ7Z 1Q7Y1 2YU9I 4DQYB 2VUGA 4BC9A 2QKDA 3NH5A 1FLOA 1N2FA 4DV6C 3K7AI 3A4IA 4NDNA 4A3MI 5BUQA 5C44I 2NAPA 3R44A 4YHHC 5IT9b 3J80D 3GTPI 2P28A 2YCBA 3N2QA 5KEIA 1PU1A 1USPA 3UZ0A 1VQKZ 2NCLA 1S721 1YI21 4MXUA 3CCRZ 4DUZC 4NOZA 3S2HI 5A2QD 4DV5C 4X64C 4DR6C 5D1OB 4GS5A 3HOYI 4FUTA 4LF5C 5CZVA 3EQ6A 3IEVA 3GTMS 2QR1B 2JA6I 4RM3A 1K9M1 1RQFA 1VQN1 2O4HA 3LAXA 1WCJA 2UXCC 1YIJ1 3A26A 3PO3S 5AE1A 2VUMI 2D1SA 3EEDA 3F3FC 2OTJZ 2OOYB 3H2TA 4LF4C 4NH1C 4L4QA 3T1YC 3UX2A 4NB9A 3GKQA 3CCUZ 1VQM1 2KZFA 3CME1 1USPB 1VQ4Z 1PA4A 1M1K1 1IBKC 1YI2Z 3S1NI 3I07A 3D6WA 1WH9A 5C4JI 2YWBA 1V60A 2QRCB 3G4SZ 3CCSZ 1XRCA 3CW8X 4HGYA 3DAYA 5KYVA 5FLXb 1X3WA 1Q861 4NBGA 2P2MA 4RVHA 2PROA 4ZLPA 1VLAA 2HHHC 2JA8I 2QREB 4MD8A 2OPLA 2D1RA 2P2QA 1K9M2 2K5RA 3P5JB 2VPXA 1YUAA 3GTOI 3HOZI 2OPLB 1J5EC 1RNIA 4LF6C 3S15I 4YY3C 1VQOZ 2VPYA 4DV1C 4LFBC 2D1QA 5AE3A 2AKLA 1NJI1 4NBHA 3GKUA 2LIYA 4JM1A 2QLVB 5BSMA 4NBEA 3T4NB 4HGZA 1VQ51 1XNRC 3CCE1 3CC2Z 1VQLZ 2PM9A 2V7BA 3I561 4DK1A 1VQ8Z 3IEUA 3A9UA 2VQFC 4DR5C 1JOSA 1Y8CA 2KDNA 4KHPC 2KZ0A 3ESWA 2W03A 2Y4NA 2GU2A 2DE7A 3GTJI 1QF8A 5IT9D 4LF9C 2DYJA 4G1IA 2VPWA 1TFIA 1TWFI 4ISBA 2E0GA 3JAMD 3CCV1 4WS9A 1KQSZ 3CCQZ 4MH4A 4L2ZA 3ETOA 3CC7Z 2JIRA 4HH4A 1MDBA 2RT9A 2JA7I 3UOWA 1ML8A 1SIWA 4HPVA 2BH1X 4NXMC 3CXCY 1QYPA 2E2HI 1X0TA 3CC71 4IZ6A 2XR1A 2VF1A 4NBCA 2PN2A 2ONFA 4AYBA 5LMUC 1YHQZ 4LFCC 5BURA 3G6E1 4DV7C 3R9XA 3U50C 2CY1A 1K83I 1TWAI 2Q4ZA 2E2II 2AYAA 2E8FA 2Z51A 3ETCA 3J80f 1HH2P 1RO4A 1K732 3FQQA 3CD61 1XMQC 2M5OA 5IFIA 1M1K2 4BBYA 2P2BA 2PMZA 5LMNC 4DV2C 2JS4A 4OX9C 3I56Z 1IB8A 1MDFA 5E7QA 4JI6C 3HOXI 4DR4C 2VZEA 4GKKC 4Y52I 1Z03A 3KIHA 4R1LA 5CZXA 3J81b 5A1GA 2E7ZA 4JI5C 1VQ5Z 2W04A 4A3FI 2E8EA 3HOWI 4DV4C 1MXAA 2D1TA 2OO4A 4FUQA 2NVYI 1KQSY 2R6MA 1VQP1 3CQ2A 3VNRA 4DCUA 4DCSA 5GTDA 5BSRA 3AF6A 3GR1A 1N36C 1XMOC 1ULTA 2J6AA 4B3MC 2E9HA 4IR7A 5A2Qf 1JJ2Y 4JI4C 2K3RA 1KC82 1XRAA 3S1QI 1YJ91 5BSTA 2V8IA 3CCM1 3CCQ1 4A3GI 3SO4A 3FQMA 4B3RC 2JIQA 4RVNA 2Y0SA 3KXWA 3VNSA 3NFZA 3JAMf 3CCEZ 4QTUA 1VQ61 2DPLA 3AY0A 2VPZA 3GR0A 3CCL1 3LNOA 1WJ2A 1YIJZ 3AF5A 4JI2C 1S7MA 5D1OA 4WV3A 4DCTA 1RY2A 2UUBC 3I4NI 3S1MI 5BSVA 3TQIA 1N34C 4XX2A 2MMAB 2OZKA 2VQEC 3MONA 1Z02A 4JI7C 1Q812 2UUCC 4OYCA 1N8R2 3CC21 1VQL1 2DE6A 3IFUA 5C4XI 3GTLI 3I551 1T5HX 4PROC 1S72Z 2JIMA 4RV9A 3M4OI 3JAMb 1DL6A 1K8A1 3CW9A 2KI7B 4GXQA 4EATA 3R9WA 3G71Z 3CCJ1 3TE5B 1QVGY 2V3VA 3A25A 1MXBA 1RLYA 2H85A 4A3KI 1N32C 3G4S1 3CCS1 2R92I 4G36A 4L7IA 3K6RA 1RO0A 2E5LC 1NJI2 3GTMI 3CQ3A 1WZNA 2G2KA 3CPWY 4RMNA 3VNQA 5IWAC 1AMUA 4LF7C 3IMLA 1KRLA 2PT7G 2YX1A 3MZLB 2JIPA 3HKZA 3MZKB 3S82A 4DUYC 1IBLC 3D9XA 3PBKA 2R93I 5DV9A 3OW2Y 3OW2Z 1MXCA 2UUAC 1QVGZ 2OTJ1 2WAQA 3G7SA 4BSZA 1Y1VI 3BG1B 1XNQC 2NVXI 3NDJA 1N8R1 2PK7A 1YJWZ 2OBVA 5FLXD 4E2XA 3FKII 4A3LI 4DR1C 4BBRI 3UX3A 1NYEA 4A3BI 2ATWA 1P4EA 1EGAA 4RVDA 4E2ZA 3A9VA 2EGTA 2D27A 3BG0B 1XS3A 2M5HA 3VMHA 1O90A 2IZ4A 3J81D 4RVGA 2HF1A 1VQMZ 3CCU1 5FLXf 4A3DI 2AYDA 3I08A 5T8TA 1P9NA 3GTKI 2LEXA 4NB8A 1VQ91 3VMGA 4FTFA 3H3VJ 1UWDA 4MONA 2OTLZ 3N54B
chains in the Genus database with same CATH topology
3IX0A 4JI3C 3CCLZ 1VQNZ 5BSUA 5IP9I 3VB9A 2F4OA 2ZM6C 5K85A 1R9TI 4DG9A 4MTNA 1YUKA 2JR6A 1YJ9Z 4BY1I 4U5YD 2JMOA 3GPCA 2HJGA 2JMPA 2RPRA 4TNUA 3DLPX 3CCR1 2Q51A 3CMA1 4RLQA 1VQK1 2LFUA 3E7WA 3QWUA 1L2FA 3Q87A 4A3CI 1LCIA 1GPMA 1SFOI 3L95X 1O93A 3S14I 1MKYA 1VQPZ 3HOUI 1X3ZA 1HNWC 1I94C 1N33C 3CCJZ 3G711 4D56A 2QEXZ 2V8JA 3S16I 4D4IA 4QTTA 5CM2M 5AN9F 4BY7I 3I55Z 4E33A 2IZ3A 3NH4A 2M6NA 1MD9A 1TWGI 4D4GA 3LGXA 3TUFA 1QM4A 1ZH1A 1I3QI 4PZPA 1YJN1 2UU9C 3VTNA 2P20A 2QRDB 4BXXI 1WCMI 2F4VC 1M902 2VSQA 3PROC 1WIIA 4E2YA 3M3YI 1Y1VS 2P02A 4D57A 4X65C 3CJEA 3TDEA 4NBBA 5T64A 1YJ7A 4X6AI 4JI1C 2UXDC 3NI2A 1KKGA 1YHQ1 2WD9A 3NDIA 1HNZC 3S1RI 1RG9A 3FCCA 4A3II 1WF3A 5AE2A 2QL8A 4NBDA 1ZB8A 1T5DX 5BR8C 1Q822 3CD6Z 2KPIA 4S1TA 5C3EI 4BC7A 4DR2C 1P7LA 1HNXC 2O53A 3PO3I 2QA41 4LF8C 1VQ6Z 2DE5A 1FJGC 3G6EZ 1M901 2ZAEB 4JI8C 2D28C 1WW9A 5IT9f 2B63I 3RZOI 3LUSA 1TWCI 4MRIA 5D1PA 3CCMZ 4ZJZA 3J81f 1BA3A 3DHVA 4E32A 1K8A2 3T1HC 4E31A 1YIT1 4PHTA 2HU9A 4NFRA 3GTQI 1L1OC 4DCVA 4RLFA 3CPWZ 4CL1A 4GXRA 2E2JI 4K0BA 3PESA 2CXCA 2GTIA 2QVXX 4X66C 5KYTA 3OTOC 3CC41 2OOXB 2QA4Z 4GKJC 3HOVI 5A2Qb 2JUBA 1W2BZ 4E30A 3GTGI 2M48A 3J7A4 2P2FA 1XRBA 4I9FA 3CC4Z 2P3YA 4DR7C 2UXBC 1V26A 1PG4A 3C5EA 3F3PC 4JI0C 4NXNC 1Q862 1KC81 1QVFY 3FCEA 1KD12 1KD11 3I4MI 4MD7A 4B3SC 4I9GA 1YITZ 1W2BY 1NP6A 2JNYA 2RIQA 3LNVA 1K0RA 1V25A 4RM2A 2QEX1 3CXCZ 5T8SA 4ODJA 2ASBA 3CCVZ 5BSWA 2JA5I 5A1IA 3L8CA 2I3CA 1IBMC 2Y27A 3PO2I 1YJNZ 2QVZX 4MD9A 4B3TC 3CMAZ 3CQZI 2YWCA 3VMIA 1JJ2Z 2RBLA 1LQLA 1VQ81 2D7VA 2NVQI 2GTHA 5K8FA 4JV5C 2QVYX 1O92A 5A19A 1JWHC 2RHBA 4RS4A 2WP0C 1O9TA 4AQYC 1K731 1QVFZ 3S17I 2Y4OA 4R1MA 3B7WA 4DGLA 3RV2A 3RZDI 3NYQA 1VQ9Z 1I50I 4BBSI 4BCAA 4NBAA 1RO2A 1VQ41 4JYAC 1QWIA 1I6HI 5H9UA 4TPSB 4KTTA 1NUIA 1VQO1 5T6BA 4EWCA 4A3JI 4OXIA 4R0MA 3H0GI 1Q821 2QW0X 5T67A 2E7GA 4NBFA 4DR3C 1HR0C 5LL6f 2F4MA 2R7ZI 4RVFA 5FLMI 4K0KC 3KIFA 4DV0C 2V8KA 1YJW1 5BUSA 1Z01A 5IP7I 2NVTI 1Q7Y2 2OTL1 1TWHI 3S2DI 1UKKA 3NH8A 3IPLA 1ZB9A 2WB1A 2P2JA 4DG8A 3J80b 4G37A 4A3EI 3RG2A 2YADA 4E2WA 1FUGA 4X62C 2E8CA 3E7XA 3IF8A 3TDHB 3EERA 1Q811 4Y7NI 3NPDA 1VQ71 4RVOA 1Y1WI 5JRHA 4KTVA 4LFAC 4LE5A 3NYRA 1PFTA 1PG3A 4A93I 5ADZA 4DV3C 3GCFA 3CMEZ 2BJOA 1VQ7Z 1Q7Y1 2YU9I 4DQYB 2VUGA 4BC9A 2QKDA 3NH5A 1N2FA 4DV6C 3K7AI 3A4IA 4NDNA 4A3MI 5BUQA 5C44I 3R44A 4YHHC 5IT9b 3J80D 3GTPI 2P28A 2YCBA 3N2QA 5KEIA 1USPA 3UZ0A 1VQKZ 1S721 1YI21 4MXUA 3CCRZ 4DUZC 4NOZA 3S2HI 5A2QD 4DV5C 4X64C 4DR6C 5D1OB 4GS5A 3HOYI 4FUTA 4LF5C 5CZVA 3EQ6A 3IEVA 3GTMS 2QR1B 2JA6I 4RM3A 1K9M1 1RQFA 1VQN1 2O4HA 3LAXA 2UXCC 1YIJ1 3PO3S 5AE1A 2VUMI 2D1SA 3EEDA 3F3FC 2OTJZ 2OOYB 3H2TA 4LF4C 4NH1C 4L4QA 3T1YC 4NB9A 3GKQA 3CCUZ 1VQM1 2KZFA 3CME1 1USPB 1VQ4Z 1PA4A 1M1K1 1IBKC 1YI2Z 3S1NI 3I07A 3D6WA 1WH9A 5C4JI 2YWBA 2QRCB 3G4SZ 3CCSZ 1XRCA 3CW8X 4HGYA 3DAYA 5KYVA 5FLXb 1X3WA 1Q861 4NBGA 2P2MA 4RVHA 2PROA 4ZLPA 1VLAA 2HHHC 2JA8I 2QREB 4MD8A 2OPLA 2D1RA 2P2QA 1K9M2 2K5RA 3P5JB 1J5EC 1YUAA 3GTOI 3HOZI 2OPLB 4LF6C 1RNIA 3S15I 4YY3C 1VQOZ 4DV1C 4LFBC 2D1QA 5AE3A 2AKLA 1NJI1 4NBHA 3GKUA 2LIYA 4JM1A 2QLVB 5BSMA 4NBEA 3T4NB 4HGZA 1VQ51 1XNRC 3CCE1 3CC2Z 1VQLZ 2PM9A 2V7BA 3I561 4DK1A 1VQ8Z 3IEUA 3A9UA 2VQFC 4DR5C 1JOSA 4KHPC 3ESWA 2W03A 2Y4NA 2GU2A 2DE7A 3GTJI 1QF8A 5IT9D 4LF9C 2DYJA 4G1IA 1TFIA 1TWFI 4ISBA 2E0GA 3JAMD 3CCV1 4WS9A 1KQSZ 3CCQZ 4MH4A 4L2ZA 3ETOA 3CC7Z 4HH4A 1MDBA 2RT9A 2JA7I 3UOWA 1ML8A 4HPVA 2BH1X 4NXMC 3CXCY 1QYPA 2E2HI 1X0TA 3CC71 4IZ6A 2XR1A 2VF1A 4NBCA 2PN2A 2ONFA 4AYBA 5LMUC 1YHQZ 4LFCC 5BURA 3G6E1 4DV7C 3R9XA 3U50C 2CY1A 1K83I 1TWAI 2Q4ZA 2E2II 2AYAA 2E8FA 3ETCA 3J80f 1HH2P 1RO4A 1K732 3FQQA 3CD61 1XMQC 5IFIA 1M1K2 4BBYA 2P2BA 2PMZA 5LMNC 4DV2C 2JS4A 4OX9C 3I56Z 5E7QA 1MDFA 4JI6C 3HOXI 4DR4C 2VZEA 4GKKC 4Y52I 1Z03A 3KIHA 4R1LA 5CZXA 3J81b 5A1GA 4JI5C 1VQ5Z 2W04A 4A3FI 2E8EA 3HOWI 4DV4C 1MXAA 2D1TA 2OO4A 4FUQA 2NVYI 1KQSY 2R6MA 1VQP1 3VNRA 4DCSA 4DCUA 5GTDA 5BSRA 3AF6A 3GR1A 1N36C 1XMOC 1ULTA 2J6AA 4B3MC 2E9HA 4IR7A 5A2Qf 1JJ2Y 4JI4C 2K3RA 1KC82 1XRAA 3S1QI 1YJ91 5BSTA 2V8IA 3CCM1 3CCQ1 4A3GI 3SO4A 3FQMA 4B3RC 4RVNA 2Y0SA 3KXWA 3VNSA 3NFZA 3JAMf 3CCEZ 4QTUA 1VQ61 2DPLA 3GR0A 3CCL1 1YIJZ 3AF5A 4JI2C 1S7MA 5D1OA 4WV3A 4DCTA 1RY2A 2UUBC 3I4NI 3S1MI 5BSVA 3TQIA 1N34C 4XX2A 2OZKA 2VQEC 3MONA 1Z02A 4JI7C 1Q812 2UUCC 4OYCA 1N8R2 3CC21 1VQL1 2DE6A 3IFUA 5C4XI 3GTLI 3I551 1T5HX 4PROC 1S72Z 4RV9A 3M4OI 3JAMb 1DL6A 1K8A1 3CW9A 2KI7B 4GXQA 4EATA 3R9WA 3G71Z 3CCJ1 3TE5B 1QVGY 1MXBA 1RLYA 2H85A 4A3KI 1N32C 3G4S1 3CCS1 2R92I 4G36A 4L7IA 1RO0A 2E5LC 1NJI2 3GTMI 2G2KA 3CPWY 3VNQA 4RMNA 5IWAC 1AMUA 4LF7C 3IMLA 1KRLA 2PT7G 3MZLB 3HKZA 3MZKB 3S82A 4DUYC 1IBLC 3D9XA 3PBKA 2R93I 5DV9A 3OW2Y 3OW2Z 1MXCA 2UUAC 1QVGZ 2OTJ1 2WAQA 3G7SA 4BSZA 1Y1VI 3BG1B 1XNQC 2NVXI 3NDJA 1N8R1 2PK7A 1YJWZ 2OBVA 5FLXD 4E2XA 3FKII 4A3LI 4DR1C 4BBRI 1NYEA 4A3BI 2ATWA 1EGAA 4RVDA 4E2ZA 3A9VA 2EGTA 2D27A 3BG0B 3VMHA 1O90A 2IZ4A 3J81D 4RVGA 2HF1A 1VQMZ 3CCU1 5FLXf 4A3DI 5T8TA 3I08A 1P9NA 3GTKI 4NB8A 1VQ91 3VMGA 4FTFA 3H3VJ 4MONA 2OTLZ 3N54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 C;  2UXC C;  3HOX I;  4NXN C;  4JI0 C;  3PO3 S;  4JI3 C;  4DR4 C;  4GKK C;  5IP9 I;  4Y52 I;  2VUM I;  3VB9 A;  3I4M I;  2F4O A;  2ZM6 C;  4B3S C;  1R9T I;  4MTN A;  4JI5 C;  4LF4 C;  2JNY A;  2JR6 A;  1K0R A;  4A3F I;  3T1Y C;  2E8E A;  3HOW I;  4NB9 A;  4BY1 I;  4DV4 C;  3GKQ A;  2KZF A;  2ASB A;  1USP B;  1PA4 A;  2HJG A;  2JMP A;  2NVY I;  1IBK C;  2JA5 I;  3S1N I;  4DCU A;  4DCS A;  3AF6 A;  3I07 A;  3D6W A;  1WH9 A;  1L2F A;  3Q87 A;  5C4J I;  4A3C I;  1XMO C;  1N36 C;  1IBM C;  2J6A A;  1SFO I;  3PO2 I;  4B3M C;  4B3T C;  3S14 I;  3CQZ I;  1MKY A;  3HOU I;  1X3Z A;  3VMI A;  1X3W A;  4JI4 C;  1I94 C;  1HNW C;  2RBL A;  1N33 C;  4NBG A;  1LQL A;  3S1Q I;  2D7V A;  2NVQ I;  1VLA A;  3S16 I;  4A3G I;  2HHH C;  2JA8 I;  4B3R C;  4JV5 C;  4QTT A;  5CM2 M;  2OPL A;  4BY7 I;  2K5R A;  1J5E C;  1YUA A;  1TWG I;  4QTU A;  3GTO I;  3HOZ I;  2OPL B;  4LF6 C;  4AQY C;  3S15 I;  4YY3 C;  1I3Q I;  4GKJ C;  3S17 I;  3AF5 A;  4JI2 C;  4DCT A;  2UU9 C;  4DV1 C;  3I4N I;  2UUB C;  4BXX I;  3RZD I;  3S1M I;  1WCM I;  4LFB C;  2F4V C;  1I50 I;  4BBS I;  1N34 C;  4XX2 A;  4NBA A;  2AKL A;  3M3Y I;  2VQE C;  4JYA C;  4NBH A;  1Y1V S;  1QWI A;  1I6H I;  3GKU A;  4JI7 C;  2UUC C;  1NUI A;  4X65 C;  4A3J I;  3CJE A;  3H0G I;  4NBE A;  2E7G A;  4NBB A;  4NBF A;  1XNR C;  5C4X I;  2DE6 A;  1HR0 C;  3GTL I;  4X6A I;  4JI1 C;  2UXD C;  2F4M A;  2R7Z I;  5FLM I;  4K0K C;  1KKG A;  3M4O I;  4DV0 C;  1DL6 A;  1HNZ C;  3S1R I;  5IP7 I;  2NVT I;  3IEU A;  2VQF C;  1TWH I;  3S2D I;  1JOS A;  1UKK A;  4DR5 C;  3R9W A;  1ZB9 A;  4A3I I;  1WF3 A;  4KHP C;  2QL8 A;  4A3E I;  4NBD A;  1RLY A;  1ZB8 A;  4A3K I;  5BR8 C;  3ESW A;  4X62 C;  1N32 C;  2KPI A;  2E8C A;  5C3E I;  3EER A;  2R92 I;  4Y7N I;  2DE7 A;  3GTJ I;  4DR2 C;  5IT9 D;  1HNX C;  1Y1W I;  2E5L C;  4LF9 C;  3PO3 I;  2DYJ A;  4LFA C;  4LF8 C;  2DE5 A;  3GTM I;  1TFI A;  1TWF I;  5IWA C;  1FJG C;  1PFT A;  4JI8 C;  4A93 I;  3JAM D;  4DV3 C;  1WW9 A;  3GCF A;  4LF7 C;  2BJO A;  2B63 I;  3LUS A;  3RZO I;  1TWC I;  4MH4 A;  2YU9 I;  2PT7 G;  4DUY C;  1IBL C;  3T1H C;  1N2F A;  2R93 I;  4DV6 C;  3K7A I;  3GTQ I;  4A3M I;  1L1O C;  2UUA C;  5C44 I;  4DCV A;  2JA7 I;  1ML8 A;  4BSZ A;  1Y1V I;  1XNQ C;  2NVX I;  4NXM C;  1QYP A;  2E2H I;  4YHH C;  2E2J I;  2XR1 A;  2PK7 A;  3GTP I;  2YCB A;  2CXC A;  4NBC A;  2PN2 A;  2ONF A;  5FLX D;  4A3L I;  3FKI I;  4X66 C;  5LMU C;  1USP A;  4DR1 C;  4BBR I;  1NYE A;  4A3B I;  3OTO C;  4LFC C;  2ATW A;  3J80 D;  1EGA A;  4NOZ A;  4DUZ C;  3S2H I;  4DV7 C;  3R9X A;  5A2Q D;  2EGT A;  4DV5 C;  3U50 C;  3VMH A;  4X64 C;  4DR6 C;  3HOV I;  3J81 D;  2CY1 A;  1K83 I;  1TWA I;  2HF1 A;  2E2I I;  3HOY I;  4A3D I;  2E8F A;  3GTK I;  1HH2 P;  1RO4 A;  4LF5 C;  3GTG I;  3IEV A;  4NB8 A;  3GTM S;  1XMQ C;  4DR7 C;  2UXB C;  2P3Y A;  2JA6 I;  5LMN C;  3VMG A;  3H3V J;  4DV2 C;  2JS4 A;  4OX9 C;  4DR3 C; 
#chains in the Genus database with same CATH topology
 3IX0 A;  4JI3 C;  3CCL Z;  1VQN Z;  5BSU A;  5IP9 I;  3D2L A;  3VB9 A;  2F4O A;  2ZM6 C;  5K85 A;  1R9T I;  4DG9 A;  4MTN A;  1YUK A;  2JR6 A;  1YJ9 Z;  4BY1 I;  4U5Y D;  2JMO A;  3GPC A;  1M6X A;  2HJG A;  2JMP A;  2RPR A;  4TNU A;  3DLP X;  3CCR 1;  2Q51 A;  3CMA 1;  4RLQ A;  1VQK 1;  2LFU A;  3E7W A;  3QWU A;  1L2F A;  3Q87 A;  4A3C I;  1LCI A;  1GPM A;  4PUI A;  1SFO I;  3L95 X;  1O93 A;  3S14 I;  1MKY A;  1VQP Z;  3HOU I;  1X3Z A;  1HNW C;  1I94 C;  1N33 C;  3CCJ Z;  3G71 1;  4D56 A;  2QEX Z;  2V8J A;  3S16 I;  4D4I A;  4QTT A;  5CM2 M;  5AN9 F;  4BY7 I;  3I55 Z;  4E33 A;  2IZ3 A;  3NH4 A;  2M6N A;  1MD9 A;  1TWG I;  4D4G A;  3LGX A;  3TUF A;  1QM4 A;  1ZH1 A;  1I3Q I;  4PZP A;  1YJN 1;  3CQ1 A;  2UU9 C;  3VTN A;  2P20 A;  2QRD B;  4BXX I;  1WCM I;  2F4V C;  1M90 2;  2VSQ A;  3PRO C;  1WII A;  4E2Y A;  3M3Y I;  2MCQ A;  1Y1V S;  2P02 A;  4D57 A;  4X65 C;  3TR3 A;  3CJE A;  3TDE A;  4NBB A;  1TH5 A;  5T64 A;  1YJ7 A;  4X6A I;  2MM9 A;  4JI1 C;  2UXD C;  3NI2 A;  1XHJ A;  1KKG A;  1YHQ 1;  2WD9 A;  2ZZM A;  3NDI A;  1HNZ C;  3S1R I;  1FDI A;  2V45 A;  2JIO A;  1RG9 A;  3FCC A;  4A3I I;  1WF3 A;  5AE2 A;  2QL8 A;  4NBD A;  1M6X C;  1ZB8 A;  1T5D X;  5BR8 C;  1Q82 2;  3CD6 Z;  2KPI A;  4S1T A;  5C3E I;  4BC7 A;  4DR2 C;  1P7L A;  1HNX C;  2O53 A;  2IV2 X;  3PO3 I;  2QA4 1;  4LF8 C;  1VQ6 Z;  2DE5 A;  1FJG C;  3G6E Z;  1M90 1;  2ZAE B;  4JI8 C;  2D28 C;  1WW9 A;  5IT9 f;  2B63 I;  3RZO I;  3LUS A;  1TWC I;  5D1P A;  4MRI A;  3CCM Z;  4ZJZ A;  3J81 f;  1BA3 A;  3DHV A;  4E32 A;  1K8A 2;  3T1H C;  4E31 A;  1YIT 1;  4PHT A;  2HU9 A;  4NFR A;  3GTQ I;  1L1O C;  4DCV A;  4RLF A;  3CPW Z;  4CL1 A;  4GXR A;  2E2J I;  4K0B A;  3PES A;  2CXC A;  2GTI A;  2QVX X;  4X66 C;  5KYT A;  3OTO C;  3CC4 1;  2OOX B;  2QA4 Z;  3O2E A;  4GKJ C;  3HOV I;  5A2Q b;  2JUB A;  1W2B Z;  4E30 A;  3GTG I;  2M48 A;  3J7A 4;  2P2F A;  1XRB A;  4I9F A;  3CC4 Z;  2P3Y A;  4PUH A;  4DR7 C;  1Q16 A;  2UXB C;  1V26 A;  1QXF A;  1PG4 A;  3C5E A;  3F3P C;  4JI0 C;  4NXN C;  1Q86 2;  1KC8 1;  1QVF Y;  3FCE A;  1KD1 2;  1KD1 1;  3I4M I;  4MD7 A;  4B3S C;  4I9G A;  1YIT Z;  1W2B Y;  1NP6 A;  2JNY A;  2RIQ A;  3LNV A;  1K0R A;  1V25 A;  4RM2 A;  2DHM A;  5LCI A;  2QEX 1;  3CXC Z;  5T8S A;  1P4E C;  4ODJ A;  2ASB A;  3CCV Z;  5BSW A;  2JA5 I;  5A1I A;  3L8C A;  2I3C A;  1IBM C;  2Y27 A;  3PO2 I;  1YJN Z;  2QVZ X;  4MD9 A;  4B3T C;  3CMA Z;  3CQZ I;  2YWC A;  3VMI A;  1JJ2 Z;  2RBL A;  1VEH A;  2CU6 A;  1LQL A;  1VQ8 1;  2D7V A;  2NVQ I;  2GTH A;  5K8F A;  4JV5 C;  2QVY X;  1O92 A;  5A19 A;  1JWH C;  2RHB A;  4RS4 A;  2WP0 C;  1O9T A;  4AQY C;  1K73 1;  1QVF Z;  3S17 I;  2Y4O A;  3IR7 A;  3B7W A;  4R1M A;  4DGL A;  1AA6 A;  3RV2 A;  3RZD I;  3NYQ A;  1VQ9 Z;  4PUG A;  1I50 I;  4BBS I;  4BCA A;  4NBA A;  1RO2 A;  1VQ4 1;  4JYA C;  1QWI A;  1I6H I;  5H9U A;  4TPS B;  4KTT A;  1NUI A;  1VQO 1;  5T6B A;  4EWC A;  4A3J I;  4OXI A;  4R0M A;  3H0G I;  1Q82 1;  2QW0 X;  2ZZN A;  5T67 A;  2E7G A;  4NBF A;  4DR3 C;  1HR0 C;  2JNV A;  5LL6 f;  2F4M A;  2R7Z I;  4RVF A;  5FLM I;  4K0K C;  3KIF A;  4DV0 C;  2V8K A;  1YJW 1;  5BUS A;  1Z01 A;  5IP7 I;  3UEB A;  2NVT I;  1Q7Y 2;  2OTL 1;  1TWH I;  3S2D I;  1UKK A;  3NH8 A;  3IPL A;  1ZB9 A;  2WB1 A;  2P2J A;  4DG8 A;  3J80 b;  4G37 A;  4A3E I;  3RG2 A;  2YAD A;  4E2W A;  1FUG A;  4X62 C;  2E8C A;  3E7X A;  3IF8 A;  3TDH B;  3EER A;  1Q81 1;  4Y7N I;  3NPD A;  1VQ7 1;  4RVO A;  1Y1W I;  1NY8 A;  5JRH A;  4KTV A;  4LFA C;  1FDO A;  4LE5 A;  3NYR A;  1PFT A;  1PG3 A;  4A93 I;  5ADZ A;  4DV3 C;  3GCF A;  3CME Z;  2BJO A;  1VQ7 Z;  1Q7Y 1;  2YU9 I;  4DQY B;  2VUG A;  4BC9 A;  2QKD A;  3NH5 A;  1FLO A;  1N2F A;  4DV6 C;  3K7A I;  3A4I A;  4NDN A;  4A3M I;  5BUQ A;  5C44 I;  2NAP A;  3R44 A;  4YHH C;  5IT9 b;  3J80 D;  3GTP I;  2P28 A;  2YCB A;  3N2Q A;  5KEI A;  1PU1 A;  1USP A;  3UZ0 A;  1VQK Z;  2NCL A;  1S72 1;  1YI2 1;  4MXU A;  3CCR Z;  4DUZ C;  4NOZ A;  3S2H I;  5A2Q D;  4DV5 C;  4X64 C;  4DR6 C;  5D1O B;  4GS5 A;  3HOY I;  4FUT A;  4LF5 C;  5CZV A;  3EQ6 A;  3IEV A;  3GTM S;  2QR1 B;  2JA6 I;  4RM3 A;  1K9M 1;  1RQF A;  1VQN 1;  2O4H A;  3LAX A;  1WCJ A;  2UXC C;  1YIJ 1;  3A26 A;  3PO3 S;  5AE1 A;  2VUM I;  2D1S A;  3EED A;  3F3F C;  2OTJ Z;  2OOY B;  3H2T A;  4LF4 C;  4NH1 C;  4L4Q A;  3T1Y C;  3UX2 A;  4NB9 A;  3GKQ A;  3CCU Z;  1VQM 1;  2KZF A;  3CME 1;  1USP B;  1VQ4 Z;  1PA4 A;  1M1K 1;  1IBK C;  1YI2 Z;  3S1N I;  3I07 A;  3D6W A;  1WH9 A;  5C4J I;  2YWB A;  1V60 A;  2QRC B;  3G4S Z;  3CCS Z;  1XRC A;  3CW8 X;  4HGY A;  3DAY A;  5KYV A;  5FLX b;  1X3W A;  1Q86 1;  4NBG A;  2P2M A;  4RVH A;  2PRO A;  4ZLP A;  1VLA A;  2HHH C;  2JA8 I;  2QRE B;  4MD8 A;  2OPL A;  2D1R A;  2P2Q A;  1K9M 2;  2K5R A;  3P5J B;  2VPX A;  1YUA A;  3GTO I;  3HOZ I;  2OPL B;  1J5E C;  1RNI A;  4LF6 C;  3S15 I;  4YY3 C;  1VQO Z;  2VPY A;  4DV1 C;  4LFB C;  2D1Q A;  5AE3 A;  2AKL A;  1NJI 1;  4NBH A;  3GKU A;  2LIY A;  4JM1 A;  2QLV B;  5BSM A;  4NBE A;  3T4N B;  4HGZ A;  1VQ5 1;  1XNR C;  3CCE 1;  3CC2 Z;  1VQL Z;  2PM9 A;  2V7B A;  3I56 1;  4DK1 A;  1VQ8 Z;  3IEU A;  3A9U A;  2VQF C;  4DR5 C;  1JOS A;  1Y8C A;  2KDN A;  4KHP C;  2KZ0 A;  3ESW A;  2W03 A;  2Y4N A;  2GU2 A;  2DE7 A;  3GTJ I;  1QF8 A;  5IT9 D;  4LF9 C;  2DYJ A;  4G1I A;  2VPW A;  1TFI A;  1TWF I;  4ISB A;  2E0G A;  3JAM D;  3CCV 1;  4WS9 A;  1KQS Z;  3CCQ Z;  4MH4 A;  4L2Z A;  3ETO A;  3CC7 Z;  2JIR A;  4HH4 A;  1MDB A;  2RT9 A;  2JA7 I;  3UOW A;  1ML8 A;  1SIW A;  4HPV A;  2BH1 X;  4NXM C;  3CXC Y;  1QYP A;  2E2H I;  1X0T A;  3CC7 1;  4IZ6 A;  2XR1 A;  2VF1 A;  4NBC A;  2PN2 A;  2ONF A;  4AYB A;  5LMU C;  1YHQ Z;  4LFC C;  5BUR A;  3G6E 1;  4DV7 C;  3R9X A;  3U50 C;  2CY1 A;  1K83 I;  1TWA I;  2Q4Z A;  2E2I I;  2AYA A;  2E8F A;  2Z51 A;  3ETC A;  3J80 f;  1HH2 P;  1RO4 A;  1K73 2;  3FQQ A;  3CD6 1;  1XMQ C;  2M5O A;  5IFI A;  1M1K 2;  4BBY A;  2P2B A;  2PMZ A;  5LMN C;  4DV2 C;  2JS4 A;  4OX9 C;  3I56 Z;  1IB8 A;  1MDF A;  5E7Q A;  4JI6 C;  3HOX I;  4DR4 C;  2VZE A;  4GKK C;  4Y52 I;  1Z03 A;  3KIH A;  4R1L A;  5CZX A;  3J81 b;  5A1G A;  2E7Z A;  4JI5 C;  1VQ5 Z;  2W04 A;  4A3F I;  2E8E A;  3HOW I;  4DV4 C;  1MXA A;  2D1T A;  2OO4 A;  4FUQ A;  2NVY I;  1KQS Y;  2R6M A;  1VQP 1;  3CQ2 A;  3VNR A;  4DCU A;  4DCS A;  5GTD A;  5BSR A;  3AF6 A;  3GR1 A;  1N36 C;  1XMO C;  1ULT A;  2J6A A;  4B3M C;  2E9H A;  4IR7 A;  5A2Q f;  1JJ2 Y;  4JI4 C;  2K3R A;  1KC8 2;  1XRA A;  3S1Q I;  1YJ9 1;  5BST A;  2V8I A;  3CCM 1;  3CCQ 1;  4A3G I;  3SO4 A;  3FQM A;  4B3R C;  2JIQ A;  4RVN A;  2Y0S A;  3KXW A;  3VNS A;  3NFZ A;  3JAM f;  3CCE Z;  4QTU A;  1VQ6 1;  2DPL A;  3AY0 A;  2VPZ A;  3GR0 A;  3CCL 1;  3LNO A;  1WJ2 A;  1YIJ Z;  3AF5 A;  4JI2 C;  1S7M A;  5D1O A;  4WV3 A;  4DCT A;  1RY2 A;  2UUB C;  3I4N I;  3S1M I;  5BSV A;  3TQI A;  1N34 C;  4XX2 A;  2MMA B;  2OZK A;  2VQE C;  3MON A;  1Z02 A;  4JI7 C;  1Q81 2;  2UUC C;  4OYC A;  1N8R 2;  3CC2 1;  1VQL 1;  2DE6 A;  3IFU A;  5C4X I;  3GTL I;  3I55 1;  1T5H X;  4PRO C;  1S72 Z;  2JIM A;  4RV9 A;  3M4O I;  3JAM b;  1DL6 A;  1K8A 1;  3CW9 A;  2KI7 B;  4GXQ A;  4EAT A;  3R9W A;  3G71 Z;  3CCJ 1;  3TE5 B;  1QVG Y;  2V3V A;  3A25 A;  1MXB A;  1RLY A;  2H85 A;  4A3K I;  1N32 C;  3G4S 1;  3CCS 1;  2R92 I;  4G36 A;  4L7I A;  3K6R A;  1RO0 A;  2E5L C;  1NJI 2;  3GTM I;  3CQ3 A;  1WZN A;  2G2K A;  3CPW Y;  4RMN A;  3VNQ A;  5IWA C;  1AMU A;  4LF7 C;  3IML A;  1KRL A;  2PT7 G;  2YX1 A;  3MZL B;  2JIP A;  3HKZ A;  3MZK B;  3S82 A;  4DUY C;  1IBL C;  3D9X A;  3PBK A;  2R93 I;  5DV9 A;  3OW2 Y;  3OW2 Z;  1MXC A;  2UUA C;  1QVG Z;  2OTJ 1;  2WAQ A;  3G7S A;  4BSZ A;  1Y1V I;  3BG1 B;  1XNQ C;  2NVX I;  3NDJ A;  1N8R 1;  2PK7 A;  1YJW Z;  2OBV A;  5FLX D;  4E2X A;  3FKI I;  4A3L I;  4DR1 C;  4BBR I;  3UX3 A;  1NYE A;  4A3B I;  2ATW A;  1P4E A;  1EGA A;  4RVD A;  4E2Z A;  3A9V A;  2EGT A;  2D27 A;  3BG0 B;  1XS3 A;  2M5H A;  3VMH A;  1O90 A;  2IZ4 A;  3J81 D;  4RVG A;  2HF1 A;  1VQM Z;  3CCU 1;  5FLX f;  4A3D I;  2AYD A;  3I08 A;  5T8T A;  1P9N A;  3GTK I;  2LEX A;  4NB8 A;  1VQ9 1;  3VMG A;  4FTF A;  3H3V J;  1UWD A;  4MON A;  2OTL Z;  3N54 B; 
#chains in the Genus database with same CATH homology
 3IX0 A;  4JI3 C;  3CCL Z;  1VQN Z;  5BSU A;  5IP9 I;  3VB9 A;  2F4O A;  2ZM6 C;  5K85 A;  1R9T I;  4DG9 A;  4MTN A;  1YUK A;  2JR6 A;  1YJ9 Z;  4BY1 I;  4U5Y D;  2JMO A;  3GPC A;  2HJG A;  2JMP A;  2RPR A;  4TNU A;  3DLP X;  3CCR 1;  2Q51 A;  3CMA 1;  4RLQ A;  1VQK 1;  2LFU A;  3E7W A;  3QWU A;  1L2F A;  3Q87 A;  4A3C I;  1LCI A;  1GPM A;  1SFO I;  3L95 X;  1O93 A;  3S14 I;  1MKY A;  1VQP Z;  3HOU I;  1X3Z A;  1HNW C;  1I94 C;  1N33 C;  3CCJ Z;  3G71 1;  4D56 A;  2QEX Z;  2V8J A;  3S16 I;  4D4I A;  4QTT A;  5CM2 M;  5AN9 F;  4BY7 I;  3I55 Z;  4E33 A;  2IZ3 A;  3NH4 A;  2M6N A;  1MD9 A;  1TWG I;  4D4G A;  3LGX A;  3TUF A;  1QM4 A;  1ZH1 A;  1I3Q I;  4PZP A;  1YJN 1;  2UU9 C;  3VTN A;  2P20 A;  2QRD B;  4BXX I;  1WCM I;  2F4V C;  1M90 2;  2VSQ A;  3PRO C;  1WII A;  4E2Y A;  3M3Y I;  1Y1V S;  2P02 A;  4D57 A;  4X65 C;  3CJE A;  3TDE A;  4NBB A;  5T64 A;  1YJ7 A;  4X6A I;  4JI1 C;  2UXD C;  3NI2 A;  1KKG A;  1YHQ 1;  2WD9 A;  3NDI A;  1HNZ C;  3S1R I;  1RG9 A;  3FCC A;  4A3I I;  1WF3 A;  5AE2 A;  2QL8 A;  4NBD A;  1ZB8 A;  1T5D X;  5BR8 C;  1Q82 2;  3CD6 Z;  2KPI A;  4S1T A;  5C3E I;  4BC7 A;  4DR2 C;  1P7L A;  1HNX C;  2O53 A;  3PO3 I;  2QA4 1;  4LF8 C;  1VQ6 Z;  2DE5 A;  1FJG C;  3G6E Z;  1M90 1;  2ZAE B;  4JI8 C;  2D28 C;  1WW9 A;  5IT9 f;  2B63 I;  3RZO I;  3LUS A;  1TWC I;  4MRI A;  5D1P A;  3CCM Z;  4ZJZ A;  3J81 f;  1BA3 A;  3DHV A;  4E32 A;  1K8A 2;  3T1H C;  4E31 A;  1YIT 1;  4PHT A;  2HU9 A;  4NFR A;  3GTQ I;  1L1O C;  4DCV A;  4RLF A;  3CPW Z;  4CL1 A;  4GXR A;  2E2J I;  4K0B A;  3PES A;  2CXC A;  2GTI A;  2QVX X;  4X66 C;  5KYT A;  3OTO C;  3CC4 1;  2OOX B;  2QA4 Z;  4GKJ C;  3HOV I;  5A2Q b;  2JUB A;  1W2B Z;  4E30 A;  3GTG I;  2M48 A;  3J7A 4;  2P2F A;  1XRB A;  4I9F A;  3CC4 Z;  2P3Y A;  4DR7 C;  2UXB C;  1V26 A;  1PG4 A;  3C5E A;  3F3P C;  4JI0 C;  4NXN C;  1Q86 2;  1KC8 1;  1QVF Y;  3FCE A;  1KD1 2;  1KD1 1;  3I4M I;  4MD7 A;  4B3S C;  4I9G A;  1YIT Z;  1W2B Y;  1NP6 A;  2JNY A;  2RIQ A;  3LNV A;  1K0R A;  1V25 A;  4RM2 A;  2QEX 1;  3CXC Z;  5T8S A;  4ODJ A;  2ASB A;  3CCV Z;  5BSW A;  2JA5 I;  5A1I A;  3L8C A;  2I3C A;  1IBM C;  2Y27 A;  3PO2 I;  1YJN Z;  2QVZ X;  4MD9 A;  4B3T C;  3CMA Z;  3CQZ I;  2YWC A;  3VMI A;  1JJ2 Z;  2RBL A;  1LQL A;  1VQ8 1;  2D7V A;  2NVQ I;  2GTH A;  5K8F A;  4JV5 C;  2QVY X;  1O92 A;  5A19 A;  1JWH C;  2RHB A;  4RS4 A;  2WP0 C;  1O9T A;  4AQY C;  1K73 1;  1QVF Z;  3S17 I;  2Y4O A;  4R1M A;  3B7W A;  4DGL A;  3RV2 A;  3RZD I;  3NYQ A;  1VQ9 Z;  1I50 I;  4BBS I;  4BCA A;  4NBA A;  1RO2 A;  1VQ4 1;  4JYA C;  1QWI A;  1I6H I;  5H9U A;  4TPS B;  4KTT A;  1NUI A;  1VQO 1;  5T6B A;  4EWC A;  4A3J I;  4OXI A;  4R0M A;  3H0G I;  1Q82 1;  2QW0 X;  5T67 A;  2E7G A;  4NBF A;  4DR3 C;  1HR0 C;  5LL6 f;  2F4M A;  2R7Z I;  4RVF A;  5FLM I;  4K0K C;  3KIF A;  4DV0 C;  2V8K A;  1YJW 1;  5BUS A;  1Z01 A;  5IP7 I;  2NVT I;  1Q7Y 2;  2OTL 1;  1TWH I;  3S2D I;  1UKK A;  3NH8 A;  3IPL A;  1ZB9 A;  2WB1 A;  2P2J A;  4DG8 A;  3J80 b;  4G37 A;  4A3E I;  3RG2 A;  2YAD A;  4E2W A;  1FUG A;  4X62 C;  2E8C A;  3E7X A;  3IF8 A;  3TDH B;  3EER A;  1Q81 1;  4Y7N I;  3NPD A;  1VQ7 1;  4RVO A;  1Y1W I;  5JRH A;  4KTV A;  4LFA C;  4LE5 A;  3NYR A;  1PFT A;  1PG3 A;  4A93 I;  5ADZ A;  4DV3 C;  3GCF A;  3CME Z;  2BJO A;  1VQ7 Z;  1Q7Y 1;  2YU9 I;  4DQY B;  2VUG A;  4BC9 A;  2QKD A;  3NH5 A;  1N2F A;  4DV6 C;  3K7A I;  3A4I A;  4NDN A;  4A3M I;  5BUQ A;  5C44 I;  3R44 A;  4YHH C;  5IT9 b;  3J80 D;  3GTP I;  2P28 A;  2YCB A;  3N2Q A;  5KEI A;  1USP A;  3UZ0 A;  1VQK Z;  1S72 1;  1YI2 1;  4MXU A;  3CCR Z;  4DUZ C;  4NOZ A;  3S2H I;  5A2Q D;  4DV5 C;  4X64 C;  4DR6 C;  5D1O B;  4GS5 A;  3HOY I;  4FUT A;  4LF5 C;  5CZV A;  3EQ6 A;  3IEV A;  3GTM S;  2QR1 B;  2JA6 I;  4RM3 A;  1K9M 1;  1RQF A;  1VQN 1;  2O4H A;  3LAX A;  2UXC C;  1YIJ 1;  3PO3 S;  5AE1 A;  2VUM I;  2D1S A;  3EED A;  3F3F C;  2OTJ Z;  2OOY B;  3H2T A;  4LF4 C;  4NH1 C;  4L4Q A;  3T1Y C;  4NB9 A;  3GKQ A;  3CCU Z;  1VQM 1;  2KZF A;  3CME 1;  1USP B;  1VQ4 Z;  1PA4 A;  1M1K 1;  1IBK C;  1YI2 Z;  3S1N I;  3I07 A;  3D6W A;  1WH9 A;  5C4J I;  2YWB A;  2QRC B;  3G4S Z;  3CCS Z;  1XRC A;  3CW8 X;  4HGY A;  3DAY A;  5KYV A;  5FLX b;  1X3W A;  1Q86 1;  4NBG A;  2P2M A;  4RVH A;  2PRO A;  4ZLP A;  1VLA A;  2HHH C;  2JA8 I;  2QRE B;  4MD8 A;  2OPL A;  2D1R A;  2P2Q A;  1K9M 2;  2K5R A;  3P5J B;  1J5E C;  1YUA A;  3GTO I;  3HOZ I;  2OPL B;  4LF6 C;  1RNI A;  3S15 I;  4YY3 C;  1VQO Z;  4DV1 C;  4LFB C;  2D1Q A;  5AE3 A;  2AKL A;  1NJI 1;  4NBH A;  3GKU A;  2LIY A;  4JM1 A;  2QLV B;  5BSM A;  4NBE A;  3T4N B;  4HGZ A;  1VQ5 1;  1XNR C;  3CCE 1;  3CC2 Z;  1VQL Z;  2PM9 A;  2V7B A;  3I56 1;  4DK1 A;  1VQ8 Z;  3IEU A;  3A9U A;  2VQF C;  4DR5 C;  1JOS A;  4KHP C;  3ESW A;  2W03 A;  2Y4N A;  2GU2 A;  2DE7 A;  3GTJ I;  1QF8 A;  5IT9 D;  4LF9 C;  2DYJ A;  4G1I A;  1TFI A;  1TWF I;  4ISB A;  2E0G A;  3JAM D;  3CCV 1;  4WS9 A;  1KQS Z;  3CCQ Z;  4MH4 A;  4L2Z A;  3ETO A;  3CC7 Z;  4HH4 A;  1MDB A;  2RT9 A;  2JA7 I;  3UOW A;  1ML8 A;  4HPV A;  2BH1 X;  4NXM C;  3CXC Y;  1QYP A;  2E2H I;  1X0T A;  3CC7 1;  4IZ6 A;  2XR1 A;  2VF1 A;  4NBC A;  2PN2 A;  2ONF A;  4AYB A;  5LMU C;  1YHQ Z;  4LFC C;  5BUR A;  3G6E 1;  4DV7 C;  3R9X A;  3U50 C;  2CY1 A;  1K83 I;  1TWA I;  2Q4Z A;  2E2I I;  2AYA A;  2E8F A;  3ETC A;  3J80 f;  1HH2 P;  1RO4 A;  1K73 2;  3FQQ A;  3CD6 1;  1XMQ C;  5IFI A;  1M1K 2;  4BBY A;  2P2B A;  2PMZ A;  5LMN C;  4DV2 C;  2JS4 A;  4OX9 C;  3I56 Z;  5E7Q A;  1MDF A;  4JI6 C;  3HOX I;  4DR4 C;  2VZE A;  4GKK C;  4Y52 I;  1Z03 A;  3KIH A;  4R1L A;  5CZX A;  3J81 b;  5A1G A;  4JI5 C;  1VQ5 Z;  2W04 A;  4A3F I;  2E8E A;  3HOW I;  4DV4 C;  1MXA A;  2D1T A;  2OO4 A;  4FUQ A;  2NVY I;  1KQS Y;  2R6M A;  1VQP 1;  3VNR A;  4DCS A;  4DCU A;  5GTD A;  5BSR A;  3AF6 A;  3GR1 A;  1N36 C;  1XMO C;  1ULT A;  2J6A A;  4B3M C;  2E9H A;  4IR7 A;  5A2Q f;  1JJ2 Y;  4JI4 C;  2K3R A;  1KC8 2;  1XRA A;  3S1Q I;  1YJ9 1;  5BST A;  2V8I A;  3CCM 1;  3CCQ 1;  4A3G I;  3SO4 A;  3FQM A;  4B3R C;  4RVN A;  2Y0S A;  3KXW A;  3VNS A;  3NFZ A;  3JAM f;  3CCE Z;  4QTU A;  1VQ6 1;  2DPL A;  3GR0 A;  3CCL 1;  1YIJ Z;  3AF5 A;  4JI2 C;  1S7M A;  5D1O A;  4WV3 A;  4DCT A;  1RY2 A;  2UUB C;  3I4N I;  3S1M I;  5BSV A;  3TQI A;  1N34 C;  4XX2 A;  2OZK A;  2VQE C;  3MON A;  1Z02 A;  4JI7 C;  1Q81 2;  2UUC C;  4OYC A;  1N8R 2;  3CC2 1;  1VQL 1;  2DE6 A;  3IFU A;  5C4X I;  3GTL I;  3I55 1;  1T5H X;  4PRO C;  1S72 Z;  4RV9 A;  3M4O I;  3JAM b;  1DL6 A;  1K8A 1;  3CW9 A;  2KI7 B;  4GXQ A;  4EAT A;  3R9W A;  3G71 Z;  3CCJ 1;  3TE5 B;  1QVG Y;  1MXB A;  1RLY A;  2H85 A;  4A3K I;  1N32 C;  3G4S 1;  3CCS 1;  2R92 I;  4G36 A;  4L7I A;  1RO0 A;  2E5L C;  1NJI 2;  3GTM I;  2G2K A;  3CPW Y;  3VNQ A;  4RMN A;  5IWA C;  1AMU A;  4LF7 C;  3IML A;  1KRL A;  2PT7 G;  3MZL B;  3HKZ A;  3MZK B;  3S82 A;  4DUY C;  1IBL C;  3D9X A;  3PBK A;  2R93 I;  5DV9 A;  3OW2 Y;  3OW2 Z;  1MXC A;  2UUA C;  1QVG Z;  2OTJ 1;  2WAQ A;  3G7S A;  4BSZ A;  1Y1V I;  3BG1 B;  1XNQ C;  2NVX I;  3NDJ A;  1N8R 1;  2PK7 A;  1YJW Z;  2OBV A;  5FLX D;  4E2X A;  3FKI I;  4A3L I;  4DR1 C;  4BBR I;  1NYE A;  4A3B I;  2ATW A;  1EGA A;  4RVD A;  4E2Z A;  3A9V A;  2EGT A;  2D27 A;  3BG0 B;  3VMH A;  1O90 A;  2IZ4 A;  3J81 D;  4RVG A;  2HF1 A;  1VQM Z;  3CCU 1;  5FLX f;  4A3D I;  5T8T A;  3I08 A;  1P9N A;  3GTK I;  4NB8 A;  1VQ9 1;  3VMG A;  4FTF A;  3H3V J;  4MON A;  2OTL Z;  3N54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...