1USPA

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
137
structure length
137
Chain Sequence
NVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPADSTITARVGLQKAGLAFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
total genus 31
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspA02
3HOZI 4B3SC 4LF4C 1J5EC 3CJEA 3T1HC 3ESWA 3I4MI 3GTQI 3AF6A 5LMUC 3H0GI 1I6HI 4LF5C 3M3YI 2DYJA 3S14I 3S17I 3HOYI 5C3EI 5IWAC 2UU9C 4NBHA 2CXCA 4JI1C 2E7GA 2UXBC 3R9XA 2E8EA 3K7AI 4NBCA 3VB9A 3CQZI 2E8CA 3S1NI 5CM2M 2ONFA 1YUAA 5FLMI 1TWFI 3S2HI 4YHHC 4DV5C 5IP7I 3GKUA 4LFAC 1Y1VI 4K0KC 4A3LI 2DE6A 4A3FI 2E2JI 2OPLA 2HHHC 2JMPA 2JA5I 2PN2A 2UXDC 1RO4A 4LF8C 2UXCC 5FLXD 3JAMD 1IBLC 3J81D 4DR3C 4X6AI 3GTMS 1NYEA 4DCUA 4KHPC 1N2FA 4GKJC 4QTUA 1TWCI 4LFBC 4Y7NI 2UUAC 1LQLA 3GTOI 4DV7C 1SFOI 2YU9I 1ZB8A 1WF3A 3VMHA 3PO3S 2CY1A 1DL6A 4A3KI 2R92I 3S15I 4X66C 2DE7A 2JA6I 4LFCC 3I4NI 3VMGA 4X64C 3H3VJ 1X3ZA 5BR8C 3U50C 4NBDA 4LF9C 2VQEC 2JNYA 2F4VC 2JS4A 1RLYA 1N32C 2NVTI 4JI0C 1HNZC 4NB9A 4JI5C 3GTPI 4X62C 1I50I 4BY1I 4A3BI 1WH9A 4DCTA 4DV2C 3FKII 1PFTA 2NVYI 3S1RI 2JR6A 3D6WA 1I3QI 4AQYC 4YY3C 3Q87A 3VMIA 1IBMC 4DR1C 1XNRC 2E2HI 4JI3C 2NVQI 1WCMI 4A3EI 4B3MC 1UKKA 5A2QD 1TWHI 2R93I 1TFIA 4X65C 2JA8I 3HOWI 4DR6C 1XMOC 1Y1VS 1XNQC 5C4XI 1JOSA 1Y1WI 1FJGC 2XR1A 1QWIA 4NBEA 4DR5C 1K0RA 3AF5A 1N33C 4DV0C 1ML8A 1MKYA 1WW9A 4GKKC 4DCSA 1HNXC 2PT7G 1ZB9A 1R9TI 4DUZC 1L1OC 3OTOC 2RBLA 3M4OI 4Y52I 2VQFC 4JV5C 3HOVI 4DR7C 3HOUI 2F4MA 1HNWC 3S16I 4A3CI 3IEVA 5C4JI 2J6AA 4NBBA 2E2II 2E5LC 2P3YA 4JI2C 1N36C 2D7VA 3T1YC 4QTTA 1K83I 4LF6C 4B3TC 1KKGA 1USPA 2AKLA 1N34C 3GCFA 4NXNC 2DE5A 4MH4A 2F4OA 2UUCC 2ASBA 1I94C 1X3WA 5IT9D 4BY7I 4BBSI 1HR0C 4BSZA 1TWAI 4A3II 2R7ZI 3PO2I 4NBAA 1L2FA 3S1QI 4DV3C 4JI4C 2K5RA 4DCVA 2EGTA 3GTKI 2NVXI 1VLAA 4DV4C 3IEUA 4NOZA 4DUYC 1EGAA 5IP9I 2JA7I 4BBRI 2OPLB 3S2DI 2KZFA 3J80D 1XMQC 3HOXI 2E8FA 2ZM6C 3EERA 2YCBA 4NBGA 4A3GI 2QL8A 4A3DI 1HH2P 4JI7C 4A3JI 3RZDI 4NBFA 4JYAC 2UUBC 3GTMI 1TWGI 1PA4A 4XX2A 2BJOA 1NUIA 3LUSA 4A3MI 4B3RC 2B63I 4BXXI 4DR2C 2ATWA 4DR4C 4A93I 3GKQA 4JI6C 5LMNC 3S1MI 2PK7A 4LF7C 2HF1A 2KPIA 4MTNA 3RZOI 3PO3I 4NXMC 2VUMI 3GTJI 1USPB 1QYPA 3R9WA 3GTLI 3GTGI 2HJGA 4NB8A 3I07A 4DV6C 5C44I 1IBKC 4DV1C 4JI8C 4OX9C
chains in the Genus database with same CATH superfamily
3HOZI 3CCVZ 3A26A 4B3SC 3NYQA 2P2JA 4LF4C 1J5EC 4PUHA 3J80f 2IZ3A 3CJEA 2Q4ZA 3CCR1 4S1TA 3T1HC 3ESWA 2M6NA 2Y0SA 3I4MI 2P2QA 1V60A 3I551 3GTQI 2PROA 3AF6A 5LMUC 3H0GI 4U5YD 1I6HI 4LF5C 3TR3A 4HH4A 3M3YI 4ISBA 2DYJA 3S14I 1Q7Y1 4LE5A 3S17I 4HGZA 4DQYB 2NAPA 1K9M2 3HOYI 5C3EI 1TH5A 2P2MA 5IWAC 4ODJA 2UU9C 4NBHA 3EQ6A 2CXCA 1K731 3CCEZ 4JI1C 3IFUA 3NH5A 2NCLA 3NH4A 4RVFA 2E7GA 2UXBC 3R9XA 2QEX1 2WP0C 2YWCA 3CCRZ 2E8EA 2V7BA 3K7AI 4NBCA 3VB9A 3CQZI 4GS5A 2E8CA 3S1NI 5BSWA 2W04A 5CM2M 3LAXA 5A2Qb 1MXAA 2ONFA 3LGXA 1YUAA 3MONA 5FLMI 1JJ2Y 1YIJ1 1TWFI 3CXCZ 3S2HI 3MZKB 3TQIA 3D2LA 4D4GA 1GPMA 4YHHC 4MXUA 3CCL1 2GTHA 4DV5C 3CQ3A 3CD6Z 5IP7I 5BUSA 1T5HX 4RVHA 2DPLA 3DAYA 2GU2A 3GKUA 5BSTA 3VNRA 1P4EA 3J80b 1VQ9Z 4RVGA 4WV3A 2D1QA 1RY2A 1T5DX 4LFAC 3KXWA 4MD7A 1Y1VI 2IZ4A 4MONA 4K0KC 1Q862 4A3LI 3TDHB 4PROC 3OW2Z 4FUQA 3E7XA 2YWBA 1M1K2 4CL1A 3CCQ1 2Z51A 3O2EA 1YJ9Z 1N8R1 2Y4OA 2DE6A 3OW2Y 1VQOZ 4A3FI 2M5HA 2E2JI 2OPLA 4BC9A 2VPZA 3CC41 1Y8CA 3R44A 3GR1A 3G7SA 2LIYA 4L2ZA 2JMPA 2HHHC 2QA41 2JA5I 2PN2A 2UXDC 1RO4A 2M5OA 1VQL1 5T67A 4LF8C 5FLXD 2JIMA 3JAMD 1IBLC 2UXCC 1KC82 1KD12 2RT9A 1WCJA 3J81D 3N2QA 4DR3C 1VQM1 4X6AI 3GTMS 4DG9A 4I9FA 5D1OB 1MD9A 3IR7A 4HGYA 1NYEA 4DCUA 4KHPC 1N2FA 3CCQZ 4GKJC 4QTUA 1TWCI 3TDEA 4LFBC 1M902 2OZKA 4Y7NI 2UUAC 2ZZNA 1XRCA 4FTFA 4MD9A 3E7WA 3CCV1 3CC4Z 4RV9A 1LQLA 3GTOI 1ULTA 1O9TA 3CMAZ 4DV7C 1SFOI 5DV9A 2P20A 1XRAA 3SO4A 3L8CA 2CU6A 2YU9I 1S72Z 1ZB8A 3A9VA 3NI2A 1WF3A 4I9GA 4KTVA 5LCIA 2P28A 3VMHA 1VQMZ 2JNVA 3PO3S 5GTDA 5AE2A 5K8FA 1XRBA 2CY1A 2OOXB 1Z01A 1DL6A 5AE1A 2V3VA 3NPDA 1YITZ 1M6XA 1QM4A 4WS9A 4A3KI 2R92I 3CCE1 5KYTA 3CMEZ 3S15I 4X66C 2DE7A 2JA6I 4EATA 2I3CA 4LFCC 1VQ51 3I4NI 1WIIA 5BUQA 3HKZA 3VMGA 1NJI1 5IT9b 4E32A 5CZVA 4X64C 3H3VJ 1RG9A 4E30A 1X3ZA 5BR8C 2P2FA 2QLVB 1VQ61 3U50C 2LFUA 4OYCA 4NBDA 2R6MA 2VF1A 4LF9C 2VQEC 3NDJA 2VUGA 1ZH1A 2JNYA 2OOYB 1Q7Y2 2QW0X 5IFIA 2JS4A 2W03A 1RLYA 1RQFA 3TUFA 2F4VC 3MZLB 3CD61 4RVOA 1N32C 4E2YA 2NVTI 1LCIA 4JI0C 1HNZC 1VQ91 1YUKA 4NB9A 1K732 4JI5C 1VQ5Z 3GTPI 5T8TA 4X62C 3NH8A 1I50I 4BY1I 4A3BI 1WH9A 4DCTA 3JAMf 5FLXf 4DV2C 3G4SZ 3FKII 1P9NA 2VPXA 2D1RA 1PFTA 1JJ2Z 4IZ6A 3VNSA 2NVYI 3QWUA 3I56Z 1YJ91 1VQO1 3S1RI 1YJNZ 2JR6A 3VNQA 2OBVA 2WD9A 2VSQA 1VQ6Z 1MXCA 1MDBA 3D6WA 3RG2A 1I3QI 1PG4A 4AQYC 1V26A 5A1IA 4YY3C 3Q87A 3VMIA 1W2BY 1IBMC 4R0MA 4DR1C 1XNRC 1QVGY 4E2XA 3LNOA 5D1PA 2E2HI 2JIPA 1AA6A 4JI3C 2H85A 3KIFA 4GXQA 2NVQI 1WCMI 4A3EI 4B3MC 1VQNZ 2P02A 1UKKA 2Q51A 2V8KA 2HU9A 5CZXA 5A2QD 1YHQZ 4RLQA 2QREB 3LNVA 1TWHI 5BSMA 2R93I 2KZ0A 1TFIA 4E33A 5AN9F 3CC21 2G2KA 2D27A 3IPLA 1N8R2 5BURA 4X65C 1QF8A 2JA8I 3HOWI 4DR6C 1Y1VS 1XMOC 3F3FC 1XNQC 1VQK1 2RIQA 5C4XI 3CMA1 1JOSA 1Y1WI 1FJGC 2XR1A 3I08A 5BSUA 5JRHA 3CW9A 3CCJ1 1Q861 5BSRA 1S721 3JAMb 1O93A 4PZPA 1Q821 2D1SA 1PU1A 1QWIA 4JM1A 4NBEA 3CCMZ 2OTJZ 1VQPZ 2KDNA 4BBYA 4DR5C 1K0RA 2YX1A 3AF5A 4R1LA 3CC2Z 1N33C 4DV0C 2V8JA 1ML8A 4K0BA 1YIT1 5K85A 4KTTA 2WAQA 1MKYA 1Q812 1FUGA 1WW9A 5LL6f 3CC71 3CME1 2DHMA 4GKKC 4NDNA 4DCSA 1HNXC 1VQKZ 2QVYX 2PT7G 1KD11 1ZB9A 4RVDA 1R9TI 4G1IA 4IR7A 1L1OC 4DUZC 3OTOC 3CCJZ 2RBLA 3M4OI 4Y52I 2VQFC 2QVXX 5AE3A 4JV5C 3HOVI 4DR7C 2Y27A 2QR1B 3HOUI 2F4MA 1WJ2A 3N54B 1QVFY 1HNWC 1PG3A 3S16I 2D1TA 3UEBA 4RM2A 2MCQA 3BG0B 4A3CI 5D1OA 3AY0A 3ETCA 3IEVA 5T6BA 2QKDA 5C4JI 2J6AA 4NBBA 2E2II 2E5LC 2P3YA 1YJ7A 5A19A 1Z02A 2QRDB 2D7VA 3L95X 3UX2A 3T1YC 1N36C 4JI2C 1KQSY 4QTTA 3FQMA 1X0TA 3PROC 3CC7Z 1K83I 3A9UA 4LF6C 2RHBA 4PHTA 3FQQA 5BSVA 1IB8A 3CW8X 4B3TC 4ZLPA 3B7WA 3G4S1 1KKGA 1USPA 1Q16A 1V25A 4PUGA 3C5EA 1NJI2 3I561 2AKLA 1YI2Z 5A2Qf 1YJN1 1N34C 3GCFA 1RNIA 1K8A1 4TPSB 4NXNC 2DE5A 4MH4A 4OXIA 1WZNA 2F4OA 3RV2A 2UUCC 2ASBA 1YJWZ 2AYAA 3F3PC 1I94C 1MXBA 3NYRA 1QXFA 1P4EC 1VQ7Z 1X3WA 3G6EZ 2MMAB 3UX3A 5IT9D 4D56A 2OTLZ 3CCUZ 4BY7I 4BBSI 1MDFA 1VQN1 1HR0C 4BSZA 4RM3A 1TWAI 1YHQ1 4A3II 5KYVA 2JIQA 4MD8A 1AMUA 3J81f 2R7ZI 4RMNA 3PO2I 4NBAA 1L2FA 3H2TA 3S1QI 4DV3C 1K9M1 4GXRA 4JI4C 3UZ0A 3A4IA 3FCEA 1W2BZ 4BCAA 1NP6A 2O4HA 1BA3A 3D9XA 2K5RA 1QVGZ 1VQ4Z 2JIOA 4DCVA 2EGTA 1FLOA 3GTKI 4AYBA 2NVXI 2RPRA 2E9HA 1NY8A 1VLAA 4FUTA 4RLFA 4DV4C 4E2WA 2VPYA 3IEUA 4L4QA 4NOZA 3T4NB 3I55Z 4DUYC 4MRIA 1EGAA 5IP9I 3CCM1 2JA7I 4DGLA 2OTJ1 1VQP1 1FDOA 4BBRI 4G37A 3KIHA 2WB1A 3PBKA 2OPLB 2JMOA 2VPWA 3IF8A 2LEXA 3S2DI 4EWCA 2KZFA 5T8SA 3CXCY 1Z03A 3J80D 1XMQC 2K3RA 1S7MA 3NFZA 2QRCB 4TNUA 3HOXI 2E8FA 2ZM6C 3A25A 1XHJA 2PM9A 3EERA 2YCBA 2ZAEB 4NBGA 4A3GI 2QL8A 2QEXZ 4A3DI 1HH2P 4JI7C 3K6RA 4A3JI 5ADZA 3NDIA 5FLXb 2JIRA 1M1K1 3TE5B 1XS3A 2M48A 4HPVA 3RZDI 3J81b 1Q822 4E2ZA 4NBFA 3PESA 5H9UA 1VQ81 4RVNA 2QVZX 2YADA 4JYAC 4RS4A 4E31A 2BH1X 1YIJZ 2UUBC 1VEHA 3GR0A 3GTMI 5A1GA 1TWGI 1M6XC 3CCLZ 1PA4A 3FCCA 4NFRA 1O90A 4XX2A 2BJOA 1KC81 3ETOA 4R1MA 3VTNA 3UOWA 1NUIA 3LUSA 2ZZMA 2P2BA 3CPWZ 4A3MI 4NH1C 1P7LA 4B3RC 1QVFZ 5IT9f 3DLPX 2B63I 4BXXI 2V8IA 4DR2C 1JWHC 2AYDA 3CPWY 1YI21 3G711 2ATWA 4A93I 4DR4C 3GKQA 4JI6C 5LMNC 3S1MI 5T64A 2PK7A 4PUIA 3J7A4 5E7QA 2D28C 1M901 3IMLA 4LF7C 3BG1B 1VQ8Z 2HF1A 2E0GA 1Q811 3EEDA 2KPIA 2MM9A 3CCS1 1KQSZ 1FDIA 3RZOI 4MTNA 4ZJZA 1YJW1 3IX0A 5KEIA 2VZEA 2Y4NA 3PO3I 3CQ2A 4NXMC 1RO0A 2E7ZA 2VUMI 3GTJI 1VQ71 3G6E1 2QA4Z 1USPB 4G36A 1QYPA 2OTL1 3CCU1 1VQLZ 3GTLI 4L7IA 3R9WA 2OO4A 3S82A 1KRLA 2V45A 4DK1A 3GTGI 1O92A 2HJGA 3CQ1A 2JUBA 4D57A 4D4IA 4NB8A 1UWDA 1SIWA 3I07A 4DV6C 5C44I 3GPCA 3G71Z 1IBKC 2O53A 2PMZA 4DG8A 2GTIA 3P5JB 2KI7B 4BC7A 4DV1C 4JI8C 3DHVA 1K8A2 2IV2X 1VQ41 3CCSZ 1RO2A 4OX9C
chains in the Genus database with same CATH topology
3HOZI 3CCVZ 4B3SC 3NYQA 2P2JA 4LF4C 1J5EC 3J80f 2IZ3A 3CJEA 2Q4ZA 3CCR1 4S1TA 3T1HC 3ESWA 2M6NA 2Y0SA 3I4MI 2P2QA 3I551 3GTQI 2PROA 3AF6A 5LMUC 3H0GI 4U5YD 1I6HI 4LF5C 4HH4A 3M3YI 4ISBA 2DYJA 3S14I 1Q7Y1 4LE5A 3S17I 4HGZA 4DQYB 1K9M2 3HOYI 5C3EI 2P2MA 5IWAC 4ODJA 2UU9C 4NBHA 3EQ6A 2CXCA 1K731 3CCEZ 4JI1C 3IFUA 3NH5A 3NH4A 4RVFA 2E7GA 2UXBC 3R9XA 2QEX1 2WP0C 2YWCA 3CCRZ 2E8EA 2V7BA 3K7AI 4NBCA 3VB9A 3CQZI 4GS5A 2E8CA 3S1NI 5BSWA 2W04A 5CM2M 3LAXA 5A2Qb 1MXAA 2ONFA 3LGXA 1YUAA 3MONA 5FLMI 1JJ2Y 1YIJ1 1TWFI 3CXCZ 3S2HI 3MZKB 3TQIA 4D4GA 1GPMA 4YHHC 4MXUA 3CCL1 2GTHA 4DV5C 3CD6Z 5IP7I 5BUSA 1T5HX 4RVHA 2DPLA 3DAYA 2GU2A 3GKUA 5BSTA 3VNRA 3J80b 1VQ9Z 4RVGA 4WV3A 2D1QA 1RY2A 1T5DX 4LFAC 3KXWA 4MD7A 1Y1VI 2IZ4A 4MONA 4K0KC 1Q862 4A3LI 3TDHB 4PROC 3OW2Z 4FUQA 3E7XA 2YWBA 1M1K2 4CL1A 3CCQ1 1YJ9Z 1N8R1 2Y4OA 2DE6A 3OW2Y 1VQOZ 4A3FI 2E2JI 2OPLA 4BC9A 3CC41 3R44A 3GR1A 3G7SA 2LIYA 4L2ZA 2JMPA 2HHHC 2QA41 2JA5I 2PN2A 2UXDC 1RO4A 1VQL1 5T67A 4LF8C 5FLXD 3JAMD 2UXCC 1IBLC 1KC82 1KD12 2RT9A 3J81D 3N2QA 4DR3C 1VQM1 4X6AI 3GTMS 4DG9A 4I9FA 5D1OB 1MD9A 4HGYA 1NYEA 4DCUA 4KHPC 1N2FA 3CCQZ 4GKJC 4QTUA 1TWCI 3TDEA 4LFBC 1M902 2OZKA 4Y7NI 2UUAC 1XRCA 4FTFA 4MD9A 3E7WA 3CCV1 3CC4Z 4RV9A 1LQLA 3GTOI 1ULTA 1O9TA 3CMAZ 4DV7C 1SFOI 5DV9A 2P20A 1XRAA 3SO4A 3L8CA 2YU9I 1S72Z 1ZB8A 3A9VA 3NI2A 1WF3A 4I9GA 4KTVA 2P28A 3VMHA 1VQMZ 5K8FA 3PO3S 5GTDA 5AE2A 1XRBA 2CY1A 2OOXB 1Z01A 1DL6A 5AE1A 3NPDA 1YITZ 1QM4A 4WS9A 4A3KI 2R92I 3CCE1 5KYTA 3CMEZ 3S15I 4X66C 2DE7A 2JA6I 4EATA 2I3CA 4LFCC 1VQ51 3I4NI 1WIIA 5BUQA 3HKZA 3VMGA 1NJI1 5IT9b 4E32A 5CZVA 4X64C 3H3VJ 1RG9A 4E30A 1X3ZA 5BR8C 2P2FA 2QLVB 1VQ61 3U50C 2LFUA 4OYCA 4NBDA 2R6MA 2VF1A 4LF9C 2VQEC 3NDJA 2VUGA 1ZH1A 2JNYA 2OOYB 1Q7Y2 2QW0X 5IFIA 2JS4A 2W03A 1RLYA 1RQFA 3TUFA 2F4VC 3MZLB 3CD61 4RVOA 1N32C 4E2YA 2NVTI 1LCIA 4JI0C 1HNZC 1VQ91 1YUKA 4NB9A 1K732 4JI5C 1VQ5Z 3GTPI 5T8TA 4X62C 3NH8A 1I50I 4BY1I 4A3BI 1WH9A 4DCTA 3JAMf 5FLXf 4DV2C 3G4SZ 3FKII 1P9NA 2D1RA 1PFTA 1JJ2Z 4IZ6A 3VNSA 2NVYI 3QWUA 3I56Z 1YJ91 1VQO1 3S1RI 1YJNZ 2JR6A 3VNQA 2OBVA 2WD9A 2VSQA 1VQ6Z 1MXCA 1MDBA 3D6WA 3RG2A 1I3QI 1PG4A 4AQYC 1V26A 5A1IA 4YY3C 3Q87A 3VMIA 1W2BY 1IBMC 4R0MA 4DR1C 1XNRC 1QVGY 4E2XA 5D1PA 2E2HI 4JI3C 2H85A 3KIFA 4GXQA 2NVQI 1WCMI 4A3EI 4B3MC 1VQNZ 2P02A 1UKKA 2Q51A 2V8KA 2HU9A 5CZXA 5A2QD 1YHQZ 4RLQA 2QREB 3LNVA 1TWHI 5BSMA 2R93I 1TFIA 4E33A 5AN9F 3CC21 2G2KA 2D27A 3IPLA 1N8R2 5BURA 4X65C 1QF8A 2JA8I 3HOWI 4DR6C 1Y1VS 1XMOC 3F3FC 1XNQC 1VQK1 2RIQA 5C4XI 3CMA1 1JOSA 1Y1WI 1FJGC 2XR1A 3I08A 5BSUA 5JRHA 3CW9A 3CCJ1 1Q861 5BSRA 1S721 3JAMb 1O93A 4PZPA 1Q821 2D1SA 1QWIA 4JM1A 4NBEA 3CCMZ 2OTJZ 1VQPZ 4BBYA 4DR5C 1K0RA 3AF5A 4R1LA 3CC2Z 1N33C 4DV0C 2V8JA 1ML8A 4K0BA 1YIT1 5K85A 4KTTA 2WAQA 1MKYA 1Q812 1FUGA 1WW9A 5LL6f 3CC71 3CME1 4GKKC 4NDNA 4DCSA 1HNXC 1VQKZ 2QVYX 2PT7G 1KD11 1ZB9A 4RVDA 1R9TI 4G1IA 4IR7A 1L1OC 4DUZC 3OTOC 3CCJZ 2RBLA 3M4OI 4Y52I 2VQFC 2QVXX 5AE3A 4JV5C 3HOVI 4DR7C 2Y27A 2QR1B 3HOUI 2F4MA 3N54B 1QVFY 1HNWC 1PG3A 3S16I 2D1TA 4RM2A 3BG0B 4A3CI 5D1OA 3ETCA 3IEVA 5T6BA 2QKDA 5C4JI 2J6AA 4NBBA 2E2II 2E5LC 2P3YA 1YJ7A 5A19A 1Z02A 2QRDB 2D7VA 3L95X 1N36C 3T1YC 4JI2C 1KQSY 4QTTA 3FQMA 1X0TA 3PROC 3CC7Z 1K83I 3A9UA 4LF6C 2RHBA 4PHTA 3FQQA 5BSVA 3CW8X 4B3TC 4ZLPA 3B7WA 3G4S1 1KKGA 1USPA 1V25A 3C5EA 1NJI2 3I561 2AKLA 1YI2Z 5A2Qf 1YJN1 1N34C 3GCFA 1RNIA 1K8A1 4TPSB 4NXNC 2DE5A 4MH4A 4OXIA 2F4OA 3RV2A 2UUCC 2ASBA 1YJWZ 2AYAA 3F3PC 1I94C 1MXBA 3NYRA 1VQ7Z 1X3WA 3G6EZ 5IT9D 4D56A 2OTLZ 3CCUZ 4BY7I 4BBSI 1MDFA 1VQN1 1HR0C 4BSZA 4RM3A 1TWAI 1YHQ1 4A3II 5KYVA 4MD8A 1AMUA 3J81f 2R7ZI 4RMNA 3PO2I 4NBAA 1L2FA 3H2TA 3S1QI 4DV3C 1K9M1 4GXRA 4JI4C 3UZ0A 3A4IA 3FCEA 1W2BZ 4BCAA 1NP6A 2O4HA 1BA3A 3D9XA 2K5RA 1QVGZ 1VQ4Z 4DCVA 2EGTA 3GTKI 4AYBA 2NVXI 2RPRA 2E9HA 1VLAA 4FUTA 4RLFA 4DV4C 4E2WA 3IEUA 4L4QA 4NOZA 3T4NB 3I55Z 4DUYC 4MRIA 1EGAA 5IP9I 3CCM1 2JA7I 4DGLA 2OTJ1 1VQP1 4BBRI 4G37A 3KIHA 2WB1A 3PBKA 2OPLB 2JMOA 3IF8A 3S2DI 4EWCA 2KZFA 5T8SA 3CXCY 1Z03A 3J80D 1XMQC 2K3RA 1S7MA 3NFZA 2QRCB 4TNUA 3HOXI 2E8FA 2ZM6C 2PM9A 3EERA 2YCBA 2ZAEB 4NBGA 4A3GI 2QL8A 2QEXZ 4A3DI 1HH2P 4JI7C 4A3JI 5ADZA 3NDIA 5FLXb 1M1K1 3TE5B 4HPVA 2M48A 3RZDI 3J81b 1Q822 4E2ZA 4NBFA 3PESA 5H9UA 1VQ81 4RVNA 2QVZX 2YADA 4JYAC 4RS4A 4E31A 2BH1X 1YIJZ 2UUBC 3GR0A 3GTMI 5A1GA 1TWGI 3CCLZ 1PA4A 3FCCA 4NFRA 1O90A 4XX2A 2BJOA 1KC81 3ETOA 4R1MA 3VTNA 3UOWA 1NUIA 3LUSA 2P2BA 3CPWZ 4A3MI 4NH1C 1P7LA 4B3RC 1QVFZ 5IT9f 3DLPX 2B63I 4BXXI 2V8IA 4DR2C 1JWHC 3CPWY 1YI21 3G711 2ATWA 4A93I 4DR4C 3GKQA 4JI6C 5LMNC 3S1MI 5T64A 2PK7A 5E7QA 3J7A4 2D28C 1M901 3IMLA 4LF7C 3BG1B 1VQ8Z 2HF1A 2E0GA 1Q811 3EEDA 2KPIA 4MTNA 3CCS1 1KQSZ 3RZOI 4ZJZA 1YJW1 3IX0A 5KEIA 2VZEA 2Y4NA 3PO3I 4NXMC 1RO0A 2VUMI 3GTJI 1VQ71 3G6E1 2QA4Z 1USPB 4G36A 1QYPA 2OTL1 3CCU1 1VQLZ 3GTLI 4L7IA 3R9WA 2OO4A 3S82A 1KRLA 4DK1A 3GTGI 1O92A 2HJGA 2JUBA 4D57A 4D4IA 4NB8A 3I07A 4DV6C 5C44I 3GPCA 3G71Z 1IBKC 2O53A 2PMZA 4DG8A 2GTIA 3P5JB 2KI7B 4BC7A 4DV1C 4JI8C 3DHVA 1K8A2 1VQ41 3CCSZ 1RO2A 4OX9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ I;  4B3S C;  4LF4 C;  1J5E C;  3CJE A;  3T1H C;  3ESW A;  3I4M I;  3GTQ I;  3AF6 A;  5LMU C;  3H0G I;  1I6H I;  4LF5 C;  3M3Y I;  2DYJ A;  3S14 I;  3S17 I;  3HOY I;  5C3E I;  5IWA C;  2UU9 C;  4NBH A;  2CXC A;  4JI1 C;  2E7G A;  2UXB C;  3R9X A;  2E8E A;  3K7A I;  4NBC A;  3VB9 A;  3CQZ I;  2E8C A;  3S1N I;  5CM2 M;  2ONF A;  1YUA A;  5FLM I;  1TWF I;  3S2H I;  4YHH C;  4DV5 C;  5IP7 I;  3GKU A;  4LFA C;  1Y1V I;  4K0K C;  4A3L I;  2DE6 A;  4A3F I;  2E2J I;  2OPL A;  2HHH C;  2JMP A;  2JA5 I;  2PN2 A;  2UXD C;  1RO4 A;  4LF8 C;  2UXC C;  5FLX D;  3JAM D;  1IBL C;  3J81 D;  4DR3 C;  4X6A I;  3GTM S;  1NYE A;  4DCU A;  4KHP C;  1N2F A;  4GKJ C;  4QTU A;  1TWC I;  4LFB C;  4Y7N I;  2UUA C;  1LQL A;  3GTO I;  4DV7 C;  1SFO I;  2YU9 I;  1ZB8 A;  1WF3 A;  3VMH A;  3PO3 S;  2CY1 A;  1DL6 A;  4A3K I;  2R92 I;  3S15 I;  4X66 C;  2DE7 A;  2JA6 I;  4LFC C;  3I4N I;  3VMG A;  4X64 C;  3H3V J;  1X3Z A;  5BR8 C;  3U50 C;  4NBD A;  4LF9 C;  2VQE C;  2JNY A;  2F4V C;  2JS4 A;  1RLY A;  1N32 C;  2NVT I;  4JI0 C;  1HNZ C;  4NB9 A;  4JI5 C;  3GTP I;  4X62 C;  1I50 I;  4BY1 I;  4A3B I;  1WH9 A;  4DCT A;  4DV2 C;  3FKI I;  1PFT A;  2NVY I;  3S1R I;  2JR6 A;  3D6W A;  1I3Q I;  4AQY C;  4YY3 C;  3Q87 A;  3VMI A;  1IBM C;  4DR1 C;  1XNR C;  2E2H I;  4JI3 C;  2NVQ I;  1WCM I;  4A3E I;  4B3M C;  1UKK A;  5A2Q D;  1TWH I;  2R93 I;  1TFI A;  4X65 C;  2JA8 I;  3HOW I;  4DR6 C;  1XMO C;  1Y1V S;  1XNQ C;  5C4X I;  1JOS A;  1Y1W I;  1FJG C;  2XR1 A;  1QWI A;  4NBE A;  4DR5 C;  1K0R A;  3AF5 A;  1N33 C;  4DV0 C;  1ML8 A;  1MKY A;  1WW9 A;  4GKK C;  4DCS A;  1HNX C;  2PT7 G;  1ZB9 A;  1R9T I;  4DUZ C;  1L1O C;  3OTO C;  2RBL A;  3M4O I;  4Y52 I;  2VQF C;  4JV5 C;  3HOV I;  4DR7 C;  3HOU I;  2F4M A;  1HNW C;  3S16 I;  4A3C I;  3IEV A;  5C4J I;  2J6A A;  4NBB A;  2E2I I;  2E5L C;  2P3Y A;  4JI2 C;  1N36 C;  2D7V A;  3T1Y C;  4QTT A;  1K83 I;  4LF6 C;  4B3T C;  1KKG A;  1USP A;  2AKL A;  1N34 C;  3GCF A;  4NXN C;  2DE5 A;  4MH4 A;  2F4O A;  2UUC C;  2ASB A;  1I94 C;  1X3W A;  5IT9 D;  4BY7 I;  4BBS I;  1HR0 C;  4BSZ A;  1TWA I;  4A3I I;  2R7Z I;  3PO2 I;  4NBA A;  1L2F A;  3S1Q I;  4DV3 C;  4JI4 C;  2K5R A;  4DCV A;  2EGT A;  3GTK I;  2NVX I;  1VLA A;  4DV4 C;  3IEU A;  4NOZ A;  4DUY C;  1EGA A;  5IP9 I;  2JA7 I;  4BBR I;  2OPL B;  3S2D I;  2KZF A;  3J80 D;  1XMQ C;  3HOX I;  2E8F A;  2ZM6 C;  3EER A;  2YCB A;  4NBG A;  4A3G I;  2QL8 A;  4A3D I;  1HH2 P;  4JI7 C;  4A3J I;  3RZD I;  4NBF A;  4JYA C;  2UUB C;  3GTM I;  1TWG I;  1PA4 A;  4XX2 A;  2BJO A;  1NUI A;  3LUS A;  4A3M I;  4B3R C;  2B63 I;  4BXX I;  4DR2 C;  2ATW A;  4DR4 C;  4A93 I;  3GKQ A;  4JI6 C;  5LMN C;  3S1M I;  2PK7 A;  4LF7 C;  2HF1 A;  2KPI A;  4MTN A;  3RZO I;  3PO3 I;  4NXM C;  2VUM I;  3GTJ I;  1USP B;  1QYP A;  3R9W A;  3GTL I;  3GTG I;  2HJG A;  4NB8 A;  3I07 A;  4DV6 C;  5C44 I;  1IBK C;  4DV1 C;  4JI8 C;  4OX9 C; 
#chains in the Genus database with same CATH topology
 3HOZ I;  3CCV Z;  3A26 A;  4B3S C;  3NYQ A;  2P2J A;  4LF4 C;  1J5E C;  4PUH A;  3J80 f;  2IZ3 A;  3CJE A;  2Q4Z A;  3CCR 1;  4S1T A;  3T1H C;  3ESW A;  2M6N A;  2Y0S A;  3I4M I;  2P2Q A;  1V60 A;  3I55 1;  3GTQ I;  2PRO A;  3AF6 A;  5LMU C;  3H0G I;  4U5Y D;  1I6H I;  4LF5 C;  3TR3 A;  4HH4 A;  3M3Y I;  4ISB A;  2DYJ A;  3S14 I;  1Q7Y 1;  4LE5 A;  3S17 I;  4HGZ A;  4DQY B;  2NAP A;  1K9M 2;  3HOY I;  5C3E I;  1TH5 A;  2P2M A;  5IWA C;  4ODJ A;  2UU9 C;  4NBH A;  3EQ6 A;  2CXC A;  1K73 1;  3CCE Z;  4JI1 C;  3IFU A;  3NH5 A;  2NCL A;  3NH4 A;  4RVF A;  2E7G A;  2UXB C;  3R9X A;  2QEX 1;  2WP0 C;  2YWC A;  3CCR Z;  2E8E A;  2V7B A;  3K7A I;  4NBC A;  3VB9 A;  3CQZ I;  4GS5 A;  2E8C A;  3S1N I;  5BSW A;  2W04 A;  5CM2 M;  3LAX A;  5A2Q b;  1MXA A;  2ONF A;  3LGX A;  1YUA A;  3MON A;  5FLM I;  1JJ2 Y;  1YIJ 1;  1TWF I;  3CXC Z;  3S2H I;  3MZK B;  3TQI A;  3D2L A;  4D4G A;  1GPM A;  4YHH C;  4MXU A;  3CCL 1;  2GTH A;  4DV5 C;  3CQ3 A;  3CD6 Z;  5IP7 I;  5BUS A;  1T5H X;  4RVH A;  2DPL A;  3DAY A;  2GU2 A;  3GKU A;  5BST A;  3VNR A;  1P4E A;  3J80 b;  1VQ9 Z;  4RVG A;  4WV3 A;  2D1Q A;  1RY2 A;  1T5D X;  4LFA C;  3KXW A;  4MD7 A;  1Y1V I;  2IZ4 A;  4MON A;  4K0K C;  1Q86 2;  4A3L I;  3TDH B;  4PRO C;  3OW2 Z;  4FUQ A;  3E7X A;  2YWB A;  1M1K 2;  4CL1 A;  3CCQ 1;  2Z51 A;  3O2E A;  1YJ9 Z;  1N8R 1;  2Y4O A;  2DE6 A;  3OW2 Y;  1VQO Z;  4A3F I;  2M5H A;  2E2J I;  2OPL A;  4BC9 A;  2VPZ A;  3CC4 1;  1Y8C A;  3R44 A;  3GR1 A;  3G7S A;  2LIY A;  4L2Z A;  2JMP A;  2HHH C;  2QA4 1;  2JA5 I;  2PN2 A;  2UXD C;  1RO4 A;  2M5O A;  1VQL 1;  5T67 A;  4LF8 C;  5FLX D;  2JIM A;  3JAM D;  1IBL C;  2UXC C;  1KC8 2;  1KD1 2;  2RT9 A;  1WCJ A;  3J81 D;  3N2Q A;  4DR3 C;  1VQM 1;  4X6A I;  3GTM S;  4DG9 A;  4I9F A;  5D1O B;  1MD9 A;  3IR7 A;  4HGY A;  1NYE A;  4DCU A;  4KHP C;  1N2F A;  3CCQ Z;  4GKJ C;  4QTU A;  1TWC I;  3TDE A;  4LFB C;  1M90 2;  2OZK A;  4Y7N I;  2UUA C;  2ZZN A;  1XRC A;  4FTF A;  4MD9 A;  3E7W A;  3CCV 1;  3CC4 Z;  4RV9 A;  1LQL A;  3GTO I;  1ULT A;  1O9T A;  3CMA Z;  4DV7 C;  1SFO I;  5DV9 A;  2P20 A;  1XRA A;  3SO4 A;  3L8C A;  2CU6 A;  2YU9 I;  1S72 Z;  1ZB8 A;  3A9V A;  3NI2 A;  1WF3 A;  4I9G A;  4KTV A;  5LCI A;  2P28 A;  3VMH A;  1VQM Z;  2JNV A;  3PO3 S;  5GTD A;  5AE2 A;  5K8F A;  1XRB A;  2CY1 A;  2OOX B;  1Z01 A;  1DL6 A;  5AE1 A;  2V3V A;  3NPD A;  1YIT Z;  1M6X A;  1QM4 A;  4WS9 A;  4A3K I;  2R92 I;  3CCE 1;  5KYT A;  3CME Z;  3S15 I;  4X66 C;  2DE7 A;  2JA6 I;  4EAT A;  2I3C A;  4LFC C;  1VQ5 1;  3I4N I;  1WII A;  5BUQ A;  3HKZ A;  3VMG A;  1NJI 1;  5IT9 b;  4E32 A;  5CZV A;  4X64 C;  3H3V J;  1RG9 A;  4E30 A;  1X3Z A;  5BR8 C;  2P2F A;  2QLV B;  1VQ6 1;  3U50 C;  2LFU A;  4OYC A;  4NBD A;  2R6M A;  2VF1 A;  4LF9 C;  2VQE C;  3NDJ A;  2VUG A;  1ZH1 A;  2JNY A;  2OOY B;  1Q7Y 2;  2QW0 X;  5IFI A;  2JS4 A;  2W03 A;  1RLY A;  1RQF A;  3TUF A;  2F4V C;  3MZL B;  3CD6 1;  4RVO A;  1N32 C;  4E2Y A;  2NVT I;  1LCI A;  4JI0 C;  1HNZ C;  1VQ9 1;  1YUK A;  4NB9 A;  1K73 2;  4JI5 C;  1VQ5 Z;  3GTP I;  5T8T A;  4X62 C;  3NH8 A;  1I50 I;  4BY1 I;  4A3B I;  1WH9 A;  4DCT A;  3JAM f;  5FLX f;  4DV2 C;  3G4S Z;  3FKI I;  1P9N A;  2VPX A;  2D1R A;  1PFT A;  1JJ2 Z;  4IZ6 A;  3VNS A;  2NVY I;  3QWU A;  3I56 Z;  1YJ9 1;  1VQO 1;  3S1R I;  1YJN Z;  2JR6 A;  3VNQ A;  2OBV A;  2WD9 A;  2VSQ A;  1VQ6 Z;  1MXC A;  1MDB A;  3D6W A;  3RG2 A;  1I3Q I;  1PG4 A;  4AQY C;  1V26 A;  5A1I A;  4YY3 C;  3Q87 A;  3VMI A;  1W2B Y;  1IBM C;  4R0M A;  4DR1 C;  1XNR C;  1QVG Y;  4E2X A;  3LNO A;  5D1P A;  2E2H I;  2JIP A;  1AA6 A;  4JI3 C;  2H85 A;  3KIF A;  4GXQ A;  2NVQ I;  1WCM I;  4A3E I;  4B3M C;  1VQN Z;  2P02 A;  1UKK A;  2Q51 A;  2V8K A;  2HU9 A;  5CZX A;  5A2Q D;  1YHQ Z;  4RLQ A;  2QRE B;  3LNV A;  1TWH I;  5BSM A;  2R93 I;  2KZ0 A;  1TFI A;  4E33 A;  5AN9 F;  3CC2 1;  2G2K A;  2D27 A;  3IPL A;  1N8R 2;  5BUR A;  4X65 C;  1QF8 A;  2JA8 I;  3HOW I;  4DR6 C;  1Y1V S;  1XMO C;  3F3F C;  1XNQ C;  1VQK 1;  2RIQ A;  5C4X I;  3CMA 1;  1JOS A;  1Y1W I;  1FJG C;  2XR1 A;  3I08 A;  5BSU A;  5JRH A;  3CW9 A;  3CCJ 1;  1Q86 1;  5BSR A;  1S72 1;  3JAM b;  1O93 A;  4PZP A;  1Q82 1;  2D1S A;  1PU1 A;  1QWI A;  4JM1 A;  4NBE A;  3CCM Z;  2OTJ Z;  1VQP Z;  2KDN A;  4BBY A;  4DR5 C;  1K0R A;  2YX1 A;  3AF5 A;  4R1L A;  3CC2 Z;  1N33 C;  4DV0 C;  2V8J A;  1ML8 A;  4K0B A;  1YIT 1;  5K85 A;  4KTT A;  2WAQ A;  1MKY A;  1Q81 2;  1FUG A;  1WW9 A;  5LL6 f;  3CC7 1;  3CME 1;  2DHM A;  4GKK C;  4NDN A;  4DCS A;  1HNX C;  1VQK Z;  2QVY X;  2PT7 G;  1KD1 1;  1ZB9 A;  4RVD A;  1R9T I;  4G1I A;  4IR7 A;  1L1O C;  4DUZ C;  3OTO C;  3CCJ Z;  2RBL A;  3M4O I;  4Y52 I;  2VQF C;  2QVX X;  5AE3 A;  4JV5 C;  3HOV I;  4DR7 C;  2Y27 A;  2QR1 B;  3HOU I;  2F4M A;  1WJ2 A;  3N54 B;  1QVF Y;  1HNW C;  1PG3 A;  3S16 I;  2D1T A;  3UEB A;  4RM2 A;  2MCQ A;  3BG0 B;  4A3C I;  5D1O A;  3AY0 A;  3ETC A;  3IEV A;  5T6B A;  2QKD A;  5C4J I;  2J6A A;  4NBB A;  2E2I I;  2E5L C;  2P3Y A;  1YJ7 A;  5A19 A;  1Z02 A;  2QRD B;  2D7V A;  3L95 X;  3UX2 A;  3T1Y C;  1N36 C;  4JI2 C;  1KQS Y;  4QTT A;  3FQM A;  1X0T A;  3PRO C;  3CC7 Z;  1K83 I;  3A9U A;  4LF6 C;  2RHB A;  4PHT A;  3FQQ A;  5BSV A;  1IB8 A;  3CW8 X;  4B3T C;  4ZLP A;  3B7W A;  3G4S 1;  1KKG A;  1USP A;  1Q16 A;  1V25 A;  4PUG A;  3C5E A;  1NJI 2;  3I56 1;  2AKL A;  1YI2 Z;  5A2Q f;  1YJN 1;  1N34 C;  3GCF A;  1RNI A;  1K8A 1;  4TPS B;  4NXN C;  2DE5 A;  4MH4 A;  4OXI A;  1WZN A;  2F4O A;  3RV2 A;  2UUC C;  2ASB A;  1YJW Z;  2AYA A;  3F3P C;  1I94 C;  1MXB A;  3NYR A;  1QXF A;  1P4E C;  1VQ7 Z;  1X3W A;  3G6E Z;  2MMA B;  3UX3 A;  5IT9 D;  4D56 A;  2OTL Z;  3CCU Z;  4BY7 I;  4BBS I;  1MDF A;  1VQN 1;  1HR0 C;  4BSZ A;  4RM3 A;  1TWA I;  1YHQ 1;  4A3I I;  5KYV A;  2JIQ A;  4MD8 A;  1AMU A;  3J81 f;  2R7Z I;  4RMN A;  3PO2 I;  4NBA A;  1L2F A;  3H2T A;  3S1Q I;  4DV3 C;  1K9M 1;  4GXR A;  4JI4 C;  3UZ0 A;  3A4I A;  3FCE A;  1W2B Z;  4BCA A;  1NP6 A;  2O4H A;  1BA3 A;  3D9X A;  2K5R A;  1QVG Z;  1VQ4 Z;  2JIO A;  4DCV A;  2EGT A;  1FLO A;  3GTK I;  4AYB A;  2NVX I;  2RPR A;  2E9H A;  1NY8 A;  1VLA A;  4FUT A;  4RLF A;  4DV4 C;  4E2W A;  2VPY A;  3IEU A;  4L4Q A;  4NOZ A;  3T4N B;  3I55 Z;  4DUY C;  4MRI A;  1EGA A;  5IP9 I;  3CCM 1;  2JA7 I;  4DGL A;  2OTJ 1;  1VQP 1;  1FDO A;  4BBR I;  4G37 A;  3KIH A;  2WB1 A;  3PBK A;  2OPL B;  2JMO A;  2VPW A;  3IF8 A;  2LEX A;  3S2D I;  4EWC A;  2KZF A;  5T8S A;  3CXC Y;  1Z03 A;  3J80 D;  1XMQ C;  2K3R A;  1S7M A;  3NFZ A;  2QRC B;  4TNU A;  3HOX I;  2E8F A;  2ZM6 C;  3A25 A;  1XHJ A;  2PM9 A;  3EER A;  2YCB A;  2ZAE B;  4NBG A;  4A3G I;  2QL8 A;  2QEX Z;  4A3D I;  1HH2 P;  4JI7 C;  3K6R A;  4A3J I;  5ADZ A;  3NDI A;  5FLX b;  2JIR A;  1M1K 1;  3TE5 B;  1XS3 A;  2M48 A;  4HPV A;  3RZD I;  3J81 b;  1Q82 2;  4E2Z A;  4NBF A;  3PES A;  5H9U A;  1VQ8 1;  4RVN A;  2QVZ X;  2YAD A;  4JYA C;  4RS4 A;  4E31 A;  2BH1 X;  1YIJ Z;  2UUB C;  1VEH A;  3GR0 A;  3GTM I;  5A1G A;  1TWG I;  1M6X C;  3CCL Z;  1PA4 A;  3FCC A;  4NFR A;  1O90 A;  4XX2 A;  2BJO A;  1KC8 1;  3ETO A;  4R1M A;  3VTN A;  3UOW A;  1NUI A;  3LUS A;  2ZZM A;  2P2B A;  3CPW Z;  4A3M I;  4NH1 C;  1P7L A;  4B3R C;  1QVF Z;  5IT9 f;  3DLP X;  2B63 I;  4BXX I;  2V8I A;  4DR2 C;  1JWH C;  2AYD A;  3CPW Y;  1YI2 1;  3G71 1;  2ATW A;  4A93 I;  4DR4 C;  3GKQ A;  4JI6 C;  5LMN C;  3S1M I;  5T64 A;  2PK7 A;  4PUI A;  3J7A 4;  5E7Q A;  2D28 C;  1M90 1;  3IML A;  4LF7 C;  3BG1 B;  1VQ8 Z;  2HF1 A;  2E0G A;  1Q81 1;  3EED A;  2KPI A;  2MM9 A;  3CCS 1;  1KQS Z;  1FDI A;  3RZO I;  4MTN A;  4ZJZ A;  1YJW 1;  3IX0 A;  5KEI A;  2VZE A;  2Y4N A;  3PO3 I;  3CQ2 A;  4NXM C;  1RO0 A;  2E7Z A;  2VUM I;  3GTJ I;  1VQ7 1;  3G6E 1;  2QA4 Z;  1USP B;  4G36 A;  1QYP A;  2OTL 1;  3CCU 1;  1VQL Z;  3GTL I;  4L7I A;  3R9W A;  2OO4 A;  3S82 A;  1KRL A;  2V45 A;  4DK1 A;  3GTG I;  1O92 A;  2HJG A;  3CQ1 A;  2JUB A;  4D57 A;  4D4I A;  4NB8 A;  1UWD A;  1SIW A;  3I07 A;  4DV6 C;  5C44 I;  3GPC A;  3G71 Z;  1IBK C;  2O53 A;  2PMZ A;  4DG8 A;  2GTI A;  3P5J B;  2KI7 B;  4BC7 A;  4DV1 C;  4JI8 C;  3DHV A;  1K8A 2;  2IV2 X;  1VQ4 1;  3CCS Z;  1RO2 A;  4OX9 C; 
#chains in the Genus database with same CATH homology
 3HOZ I;  3CCV Z;  4B3S C;  3NYQ A;  2P2J A;  4LF4 C;  1J5E C;  3J80 f;  2IZ3 A;  3CJE A;  2Q4Z A;  3CCR 1;  4S1T A;  3T1H C;  3ESW A;  2M6N A;  2Y0S A;  3I4M I;  2P2Q A;  3I55 1;  3GTQ I;  2PRO A;  3AF6 A;  5LMU C;  3H0G I;  4U5Y D;  1I6H I;  4LF5 C;  4HH4 A;  3M3Y I;  4ISB A;  2DYJ A;  3S14 I;  1Q7Y 1;  4LE5 A;  3S17 I;  4HGZ A;  4DQY B;  1K9M 2;  3HOY I;  5C3E I;  2P2M A;  5IWA C;  4ODJ A;  2UU9 C;  4NBH A;  3EQ6 A;  2CXC A;  1K73 1;  3CCE Z;  4JI1 C;  3IFU A;  3NH5 A;  3NH4 A;  4RVF A;  2E7G A;  2UXB C;  3R9X A;  2QEX 1;  2WP0 C;  2YWC A;  3CCR Z;  2E8E A;  2V7B A;  3K7A I;  4NBC A;  3VB9 A;  3CQZ I;  4GS5 A;  2E8C A;  3S1N I;  5BSW A;  2W04 A;  5CM2 M;  3LAX A;  5A2Q b;  1MXA A;  2ONF A;  3LGX A;  1YUA A;  3MON A;  5FLM I;  1JJ2 Y;  1YIJ 1;  1TWF I;  3CXC Z;  3S2H I;  3MZK B;  3TQI A;  4D4G A;  1GPM A;  4YHH C;  4MXU A;  3CCL 1;  2GTH A;  4DV5 C;  3CD6 Z;  5IP7 I;  5BUS A;  1T5H X;  4RVH A;  2DPL A;  3DAY A;  2GU2 A;  3GKU A;  5BST A;  3VNR A;  3J80 b;  1VQ9 Z;  4RVG A;  4WV3 A;  2D1Q A;  1RY2 A;  1T5D X;  4LFA C;  3KXW A;  4MD7 A;  1Y1V I;  2IZ4 A;  4MON A;  4K0K C;  1Q86 2;  4A3L I;  3TDH B;  4PRO C;  3OW2 Z;  4FUQ A;  3E7X A;  2YWB A;  1M1K 2;  4CL1 A;  3CCQ 1;  1YJ9 Z;  1N8R 1;  2Y4O A;  2DE6 A;  3OW2 Y;  1VQO Z;  4A3F I;  2E2J I;  2OPL A;  4BC9 A;  3CC4 1;  3R44 A;  3GR1 A;  3G7S A;  2LIY A;  4L2Z A;  2JMP A;  2HHH C;  2QA4 1;  2JA5 I;  2PN2 A;  2UXD C;  1RO4 A;  1VQL 1;  5T67 A;  4LF8 C;  5FLX D;  3JAM D;  2UXC C;  1IBL C;  1KC8 2;  1KD1 2;  2RT9 A;  3J81 D;  3N2Q A;  4DR3 C;  1VQM 1;  4X6A I;  3GTM S;  4DG9 A;  4I9F A;  5D1O B;  1MD9 A;  4HGY A;  1NYE A;  4DCU A;  4KHP C;  1N2F A;  3CCQ Z;  4GKJ C;  4QTU A;  1TWC I;  3TDE A;  4LFB C;  1M90 2;  2OZK A;  4Y7N I;  2UUA C;  1XRC A;  4FTF A;  4MD9 A;  3E7W A;  3CCV 1;  3CC4 Z;  4RV9 A;  1LQL A;  3GTO I;  1ULT A;  1O9T A;  3CMA Z;  4DV7 C;  1SFO I;  5DV9 A;  2P20 A;  1XRA A;  3SO4 A;  3L8C A;  2YU9 I;  1S72 Z;  1ZB8 A;  3A9V A;  3NI2 A;  1WF3 A;  4I9G A;  4KTV A;  2P28 A;  3VMH A;  1VQM Z;  5K8F A;  3PO3 S;  5GTD A;  5AE2 A;  1XRB A;  2CY1 A;  2OOX B;  1Z01 A;  1DL6 A;  5AE1 A;  3NPD A;  1YIT Z;  1QM4 A;  4WS9 A;  4A3K I;  2R92 I;  3CCE 1;  5KYT A;  3CME Z;  3S15 I;  4X66 C;  2DE7 A;  2JA6 I;  4EAT A;  2I3C A;  4LFC C;  1VQ5 1;  3I4N I;  1WII A;  5BUQ A;  3HKZ A;  3VMG A;  1NJI 1;  5IT9 b;  4E32 A;  5CZV A;  4X64 C;  3H3V J;  1RG9 A;  4E30 A;  1X3Z A;  5BR8 C;  2P2F A;  2QLV B;  1VQ6 1;  3U50 C;  2LFU A;  4OYC A;  4NBD A;  2R6M A;  2VF1 A;  4LF9 C;  2VQE C;  3NDJ A;  2VUG A;  1ZH1 A;  2JNY A;  2OOY B;  1Q7Y 2;  2QW0 X;  5IFI A;  2JS4 A;  2W03 A;  1RLY A;  1RQF A;  3TUF A;  2F4V C;  3MZL B;  3CD6 1;  4RVO A;  1N32 C;  4E2Y A;  2NVT I;  1LCI A;  4JI0 C;  1HNZ C;  1VQ9 1;  1YUK A;  4NB9 A;  1K73 2;  4JI5 C;  1VQ5 Z;  3GTP I;  5T8T A;  4X62 C;  3NH8 A;  1I50 I;  4BY1 I;  4A3B I;  1WH9 A;  4DCT A;  3JAM f;  5FLX f;  4DV2 C;  3G4S Z;  3FKI I;  1P9N A;  2D1R A;  1PFT A;  1JJ2 Z;  4IZ6 A;  3VNS A;  2NVY I;  3QWU A;  3I56 Z;  1YJ9 1;  1VQO 1;  3S1R I;  1YJN Z;  2JR6 A;  3VNQ A;  2OBV A;  2WD9 A;  2VSQ A;  1VQ6 Z;  1MXC A;  1MDB A;  3D6W A;  3RG2 A;  1I3Q I;  1PG4 A;  4AQY C;  1V26 A;  5A1I A;  4YY3 C;  3Q87 A;  3VMI A;  1W2B Y;  1IBM C;  4R0M A;  4DR1 C;  1XNR C;  1QVG Y;  4E2X A;  5D1P A;  2E2H I;  4JI3 C;  2H85 A;  3KIF A;  4GXQ A;  2NVQ I;  1WCM I;  4A3E I;  4B3M C;  1VQN Z;  2P02 A;  1UKK A;  2Q51 A;  2V8K A;  2HU9 A;  5CZX A;  5A2Q D;  1YHQ Z;  4RLQ A;  2QRE B;  3LNV A;  1TWH I;  5BSM A;  2R93 I;  1TFI A;  4E33 A;  5AN9 F;  3CC2 1;  2G2K A;  2D27 A;  3IPL A;  1N8R 2;  5BUR A;  4X65 C;  1QF8 A;  2JA8 I;  3HOW I;  4DR6 C;  1Y1V S;  1XMO C;  3F3F C;  1XNQ C;  1VQK 1;  2RIQ A;  5C4X I;  3CMA 1;  1JOS A;  1Y1W I;  1FJG C;  2XR1 A;  3I08 A;  5BSU A;  5JRH A;  3CW9 A;  3CCJ 1;  1Q86 1;  5BSR A;  1S72 1;  3JAM b;  1O93 A;  4PZP A;  1Q82 1;  2D1S A;  1QWI A;  4JM1 A;  4NBE A;  3CCM Z;  2OTJ Z;  1VQP Z;  4BBY A;  4DR5 C;  1K0R A;  3AF5 A;  4R1L A;  3CC2 Z;  1N33 C;  4DV0 C;  2V8J A;  1ML8 A;  4K0B A;  1YIT 1;  5K85 A;  4KTT A;  2WAQ A;  1MKY A;  1Q81 2;  1FUG A;  1WW9 A;  5LL6 f;  3CC7 1;  3CME 1;  4GKK C;  4NDN A;  4DCS A;  1HNX C;  1VQK Z;  2QVY X;  2PT7 G;  1KD1 1;  1ZB9 A;  4RVD A;  1R9T I;  4G1I A;  4IR7 A;  1L1O C;  4DUZ C;  3OTO C;  3CCJ Z;  2RBL A;  3M4O I;  4Y52 I;  2VQF C;  2QVX X;  5AE3 A;  4JV5 C;  3HOV I;  4DR7 C;  2Y27 A;  2QR1 B;  3HOU I;  2F4M A;  3N54 B;  1QVF Y;  1HNW C;  1PG3 A;  3S16 I;  2D1T A;  4RM2 A;  3BG0 B;  4A3C I;  5D1O A;  3ETC A;  3IEV A;  5T6B A;  2QKD A;  5C4J I;  2J6A A;  4NBB A;  2E2I I;  2E5L C;  2P3Y A;  1YJ7 A;  5A19 A;  1Z02 A;  2QRD B;  2D7V A;  3L95 X;  1N36 C;  3T1Y C;  4JI2 C;  1KQS Y;  4QTT A;  3FQM A;  1X0T A;  3PRO C;  3CC7 Z;  1K83 I;  3A9U A;  4LF6 C;  2RHB A;  4PHT A;  3FQQ A;  5BSV A;  3CW8 X;  4B3T C;  4ZLP A;  3B7W A;  3G4S 1;  1KKG A;  1USP A;  1V25 A;  3C5E A;  1NJI 2;  3I56 1;  2AKL A;  1YI2 Z;  5A2Q f;  1YJN 1;  1N34 C;  3GCF A;  1RNI A;  1K8A 1;  4TPS B;  4NXN C;  2DE5 A;  4MH4 A;  4OXI A;  2F4O A;  3RV2 A;  2UUC C;  2ASB A;  1YJW Z;  2AYA A;  3F3P C;  1I94 C;  1MXB A;  3NYR A;  1VQ7 Z;  1X3W A;  3G6E Z;  5IT9 D;  4D56 A;  2OTL Z;  3CCU Z;  4BY7 I;  4BBS I;  1MDF A;  1VQN 1;  1HR0 C;  4BSZ A;  4RM3 A;  1TWA I;  1YHQ 1;  4A3I I;  5KYV A;  4MD8 A;  1AMU A;  3J81 f;  2R7Z I;  4RMN A;  3PO2 I;  4NBA A;  1L2F A;  3H2T A;  3S1Q I;  4DV3 C;  1K9M 1;  4GXR A;  4JI4 C;  3UZ0 A;  3A4I A;  3FCE A;  1W2B Z;  4BCA A;  1NP6 A;  2O4H A;  1BA3 A;  3D9X A;  2K5R A;  1QVG Z;  1VQ4 Z;  4DCV A;  2EGT A;  3GTK I;  4AYB A;  2NVX I;  2RPR A;  2E9H A;  1VLA A;  4FUT A;  4RLF A;  4DV4 C;  4E2W A;  3IEU A;  4L4Q A;  4NOZ A;  3T4N B;  3I55 Z;  4DUY C;  4MRI A;  1EGA A;  5IP9 I;  3CCM 1;  2JA7 I;  4DGL A;  2OTJ 1;  1VQP 1;  4BBR I;  4G37 A;  3KIH A;  2WB1 A;  3PBK A;  2OPL B;  2JMO A;  3IF8 A;  3S2D I;  4EWC A;  2KZF A;  5T8S A;  3CXC Y;  1Z03 A;  3J80 D;  1XMQ C;  2K3R A;  1S7M A;  3NFZ A;  2QRC B;  4TNU A;  3HOX I;  2E8F A;  2ZM6 C;  2PM9 A;  3EER A;  2YCB A;  2ZAE B;  4NBG A;  4A3G I;  2QL8 A;  2QEX Z;  4A3D I;  1HH2 P;  4JI7 C;  4A3J I;  5ADZ A;  3NDI A;  5FLX b;  1M1K 1;  3TE5 B;  4HPV A;  2M48 A;  3RZD I;  3J81 b;  1Q82 2;  4E2Z A;  4NBF A;  3PES A;  5H9U A;  1VQ8 1;  4RVN A;  2QVZ X;  2YAD A;  4JYA C;  4RS4 A;  4E31 A;  2BH1 X;  1YIJ Z;  2UUB C;  3GR0 A;  3GTM I;  5A1G A;  1TWG I;  3CCL Z;  1PA4 A;  3FCC A;  4NFR A;  1O90 A;  4XX2 A;  2BJO A;  1KC8 1;  3ETO A;  4R1M A;  3VTN A;  3UOW A;  1NUI A;  3LUS A;  2P2B A;  3CPW Z;  4A3M I;  4NH1 C;  1P7L A;  4B3R C;  1QVF Z;  5IT9 f;  3DLP X;  2B63 I;  4BXX I;  2V8I A;  4DR2 C;  1JWH C;  3CPW Y;  1YI2 1;  3G71 1;  2ATW A;  4A93 I;  4DR4 C;  3GKQ A;  4JI6 C;  5LMN C;  3S1M I;  5T64 A;  2PK7 A;  5E7Q A;  3J7A 4;  2D28 C;  1M90 1;  3IML A;  4LF7 C;  3BG1 B;  1VQ8 Z;  2HF1 A;  2E0G A;  1Q81 1;  3EED A;  2KPI A;  4MTN A;  3CCS 1;  1KQS Z;  3RZO I;  4ZJZ A;  1YJW 1;  3IX0 A;  5KEI A;  2VZE A;  2Y4N A;  3PO3 I;  4NXM C;  1RO0 A;  2VUM I;  3GTJ I;  1VQ7 1;  3G6E 1;  2QA4 Z;  1USP B;  4G36 A;  1QYP A;  2OTL 1;  3CCU 1;  1VQL Z;  3GTL I;  4L7I A;  3R9W A;  2OO4 A;  3S82 A;  1KRL A;  4DK1 A;  3GTG I;  1O92 A;  2HJG A;  2JUB A;  4D57 A;  4D4I A;  4NB8 A;  3I07 A;  4DV6 C;  5C44 I;  3GPC A;  3G71 Z;  1IBK C;  2O53 A;  2PMZ A;  4DG8 A;  2GTI A;  3P5J B;  2KI7 B;  4BC7 A;  4DV1 C;  4JI8 C;  3DHV A;  1K8A 2;  1VQ4 1;  3CCS Z;  1RO2 A;  4OX9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...