1USPA

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
137
structure length
137
Chain Sequence
b'NVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPADSTITARVGLQKAGLAFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
molecule tags Oxidoreductase
source organism Deinococcus radiodurans
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
total genus 31
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspA02
1TWAI 2YU9I 3I4MI 4BBRI 4A3BI 3I07A 5IP9I 4BBSI 2PT7G 4DV4C 2DE5A 3VB9A 1IBKC 4B3TC 2ATWA 1SFOI 4A3LI 1MKYA 2CY1A 4A3JI 1K0RA 2ONFA 2RBLA 3HOVI 4LF8C 2EGTA 1RLYA 3S17I 2OPLB 3GTPI 3GTMS 4JV5C 2BJOA 4Y7NI 2VQEC 4DR7C 2KZFA 4DCTA 3AF6A 2NVXI 2HHHC 4MTNA 2JA5I 2R92I 1R9TI 3S2DI 4QTUA 5C44I 2UXBC 2ZM6C 3HOZI 3GTKI 2P3YA 1NUIA 2JA6I 3GTGI 3GTLI 2J6AA 4NBCA 4NBHA 3VMHA 3S16I 3S1MI 3S15I 3S2HI 1NYEA 4AQYC 1TWGI 2E8CA 1TFIA 1N2FA 2F4OA 5IT9D 3RZOI 1LQLA 2YCBA 4LF4C 4DV6C 1XMQC 4B3MC 3HOUI 4JI5C 2JMPA 3H3VJ 1IBMC 3RZDI 5IP7I 4JI0C 5LMUC 2DE7A 4A3CI 4JI3C 4NBDA 3HOWI 4BY1I 4A3GI 3GTOI 4Y52I 4DUZC 1WCMI 4NBEA 4DCSA 1YUAA 3M3YI 4X62C 3VMGA 2DE6A 4DV1C 4A3II 4JI6C 4A3KI 2ASBA 2HF1A 2F4VC 3Q87A 4JYAC 1USPB 4X64C 4NBFA 2R7ZI 2VQFC 3FKII 1QWIA 2CXCA 2R93I 4BSZA 3HOYI 1I94C 2OPLA 4NXNC 5CM2M 2QL8A 5LMNC 4DCVA 4LFAC 1FJGC 1J5EC 1ML8A 4LFBC 1N33C 2UXCC 4A3EI 1HNZC 1WH9A 4DR2C 4LF9C 4DR6C 4A3FI 2B63I 3M4OI 4X66C 4JI2C 4LFCC 2PN2A 1RO4A 4XX2A 4A3DI 4MH4A 1N34C 4JI8C 4LF7C 4NOZA 1TWHI 3I4NI 2KPIA 4JI4C 1WW9A 2NVYI 4X6AI 5FLMI 3H0GI 2AKLA 3GKQA 1HH2P 1PA4A 5IWAC 1EGAA 5C3EI 1I6HI 4KHPC 1PFTA 3S1QI 2E8FA 5C4JI 4X65C 4GKJC 2E7GA 1WF3A 3PO2I 3VMIA 3GKUA 1I3QI 3EERA 3K7AI 3HOXI 3ESWA 1N32C 3S1RI 1TWFI 4YHHC 4DR4C 2VUMI 4JI1C 3LUSA 4DCUA 4DV5C 1X3ZA 4A3MI 3S14I 2D7VA 2HJGA 3J81D 4LF5C 3GCFA 3S1NI 2JA7I 4YY3C 1TWCI 1XMOC 4DR3C 4DR1C 4A93I 2E2JI 3PO3I 1USPA 4NB8A 4NBAA 5BR8C 4DV3C 3T1YC 1HR0C 1UKKA 4NBGA 4DV0C 1HNWC 3T1HC 4K0KC 3AF5A 3R9WA 2DYJA 1QYPA 2UXDC 4DV2C 1X3WA 3CQZI 3CJEA 1IBLC 4BXXI 1L2FA 2UUBC 2NVTI 3GTMI 4JI7C 4B3SC 2JNYA 1ZB8A 4NXMC 1ZB9A 2K5RA 3PO3S 3D6WA 3R9XA 1XNQC 1JOSA 2E5LC 3U50C 4GKKC 5C4XI 4DR5C 1K83I 1DL6A 2JA8I 3IEVA 4DV7C 2XR1A 2UUCC 1KKGA 2E2II 5A2QD 4NB9A 5FLXD 4DUYC 1XNRC 1I50I 2UU9C 1Y1VS 2JS4A 1L1OC 1VLAA 4BY7I 4OX9C 1Y1VI 4LF6C 4NBBA 4QTTA 2JR6A 3GTJI 2E2HI 1Y1WI 3GTQI 2PK7A 2E8EA 2F4MA 3IEUA 3J80D 2NVQI 3JAMD 1N36C 1HNXC 2UUAC 4B3RC 3OTOC
chains in the Genus database with same CATH superfamily
1RO2A 2P2MA 4D56A 3JAMb 3NYRA 4BBRI 4BBSI 5IP9I 1VQL1 2RHBA 5T6BA 2D1QA 3A9UA 3CCR1 1MKYA 3CC71 2AYAA 2CY1A 4RVOA 3CCEZ 3VNSA 2VF1A 4HGYA 2OPLB 3GTPI 2GU2A 4JV5C 2QW0X 4ZJZA 4DQYB 4MTNA 2JA5I 1VQ81 1R9TI 4TPSB 3TR3A 2KZ0A 2LFUA 5D1PA 2JA6I 4KHPC 4NBCA 4LF6C 4AQYC 3S15I 1MDBA 4B3RC 1TWGI 2OTL1 2E8CA 4LF4C 2JNVA 2PM9A 2Y27A 5KEIA 1YUKA 3J80f 2JMPA 4E31A 3RZDI 2KDNA 2QRDB 3CQ3A 3HOWI 3GTOI 4NBEA 4JI6C 5AE1A 4A3KI 2HF1A 1YJ91 3PESA 3I55Z 1USPB 3H2TA 3PROC 3L8CA 2VQFC 4I9FA 1T5DX 3I561 2BH1X 2YADA 3BG1B 4RV9A 4PZPA 4NXNC 5LMNC 1M901 4DCVA 1J5EC 1Q7Y2 3CCRZ 2UXCC 1HNZC 4LF9C 3TE5B 2DHMA 1MXBA 3UX3A 4JI2C 1YHQ1 2R6MA 1VQ71 1N34C 4NOZA 4JI4C 2KPIA 1VQ4Z 1V60A 4DG8A 3VNRA 1Q16A 1HH2P 1T5HX 3NFZA 1Y8CA 3KIHA 3DAYA 5BURA 3N2QA 2E8FA 3BG0B 1WF3A 3PO2I 3R44A 3J81f 4RLFA 5A1GA 3QWUA 1KC82 1KRLA 3NDJA 2VPZA 4I9GA 3CXCZ 3S1RI 4YHHC 1V26A 2VPXA 3LUSA 4DCUA 1X3ZA 5T8SA 3J80b 4YY3C 1TWCI 1VQNZ 1WIIA 1LCIA 3CCLZ 2E2JI 3G4SZ 3CD61 5KYTA 1UKKA 1HR0C 4DV0C 5BSWA 5ADZA 5DV9A 4K0KC 2IZ3A 3R9WA 2O4HA 1X0TA 3CQZI 2UUBC 1FDIA 4BXXI 3IMLA 2NVTI 2JIMA 3KIFA 2YX1A 3CW9A 2CU6A 4B3SC 3T4NB 4DG9A 3CCQZ 2QRCB 3G6E1 3U50C 1K83I 3G71Z 2O53A 1JJ2Y 2JA8I 5LCIA 2Y4OA 3UOWA 4RVHA 2UUCC 2E2II 1YJNZ 3MZLB 2GTHA 3CCE1 2QVZX 3CCSZ 2JS4A 1VLAA 3CCMZ 2P02A 5AE3A 1WJ2A 4BBYA 4QTTA 3GTJI 2E8EA 5IT9D 3CC41 3J80D 1N36C 3JAMD 3CMEZ 3FQQA 1KD11 5CZXA 3GR1A 5A19A 3UX2A 2YU9I 3I4MI 4A3BI 4PHTA 4B3TC 2ATWA 2IZ4A 2Y0SA 1SFOI 5BSRA 4A3LI 1M6XA 2ONFA 3ETCA 2RBLA 3B7WA 4GXQA 2QREB 2VPWA 4MD8A 1VQOZ 4NH1C 2QA4Z 4Y7NI 4R1LA 4DR7C 1QXFA 3IX0A 2JIQA 1YI2Z 1YIJZ 2M6NA 5AN9F 1KD12 2VZEA 3GTKI 4DK1A 3S16I 4E2XA 3GTLI 1VEHA 4LE5A 3I56Z 3AY0A 5BSMA 1N2FA 2F4OA 2YCBA 1XRCA 4JI5C 4EWCA 3LGXA 4G36A 3CCV1 4RS4A 4RM2A 1Q821 2DE7A 4A3CI 1O92A 4MRIA 4PUIA 1VQLZ 2IV2X 4A3GI 4Y52I 2JIOA 2M48A 4DCSA 1FLOA 1VQ8Z 4X62C 2F4VC 4JYAC 4A3II 2ASBA 1Q812 2QLVB 2WD9A 4RVGA 4X64C 1YJ9Z 4NBFA 2R7ZI 1XS3A 3FKII 2CXCA 3P5JB 1QVGY 1V25A 3G711 2M5OA 2VSQA 1P7LA 2OPLA 3CXCY 2OTJ1 2QL8A 3E7XA 4U5YD 3OW2Z 1SIWA 1NJI1 3RG2A 4LFAC 4LFBC 2P28A 2MM9A 1FJGC 3E7WA 5E7QA 4GXRA 1S721 4DR6C 4A3FI 2D1TA 2RIQA 2V7BA 2P2QA 5K8FA 4LF7C 3N54B 1YHQZ 3D9XA 1WZNA 1TWHI 3I4NI 4X6AI 2NVYI 5FLMI 2E9HA 3GKQA 1PA4A 1QM4A 2PROA 5IWAC 4TNUA 3CC7Z 3CCJ1 1I6HI 5FLXb 5C4JI 3S82A 4E33A 1FUGA 2E7GA 3GPCA 4OYCA 3SO4A 2E0GA 3HOXI 2V8JA 3ESWA 4DR4C 2VUMI 3JAMf 4PROC 2HU9A 4DV5C 3S14I 2D7VA 1VQPZ 2HJGA 4PUGA 3S1NI 2JA7I 1MXAA 1XMOC 3G4S1 3LNVA 1QVFY 4A93I 1VQN1 3PO3I 4NB8A 2LIYA 2Y4NA 3UEBA 3AF5A 1Q862 2DYJA 2MMAB 5IFIA 4RVDA 2RPRA 2VUGA 1IBLC 3GTMI 1VQ7Z 1VQKZ 1N8R1 1MDFA 4L7IA 2JNYA 4NXMC 2P2BA 5JRHA 3CCU1 2D27A 3CCQ1 3D6WA 1XNQC 1M6XC 3CCVZ 1Z03A 4RLQA 1XHJA 1VQ51 4WS9A 1YIT1 5A2Qb 4GKKC 2QKDA 3CPWY 1RG9A 1VQK1 4FUTA 2XR1A 3NH5A 5FLXD 3CW8X 4R0MA 1XNRC 2Q4ZA 1Y1VS 4L4QA 1M1K2 4BY7I 1PG4A 4OX9C 1Y1VI 2OOYB 4NBBA 2E2HI 3GTQI 1Y1WI 2PK7A 1NY8A 2F4MA 3IEUA 3VNQA 3J7A4 1HNXC 2UUAC 3I551 1NP6A 1Q822 2ZAEB 4HGZA 1BA3A 4MD9A 3F3FC 1IBKC 3VB9A 4JM1A 1VQ6Z 1AMUA 3CCJZ 3HOVI 1PU1A 2EGTA 3CCS1 1RLYA 3IF8A 3S17I 3GTMS 3CMAZ 2V45A 3LNOA 2OTLZ 1NJI2 1WCJA 3AF6A 2I3CA 1QVGZ 2NVXI 1XRBA 5IT9f 2HHHC 2R92I 1VQ61 2PMZA 4QTUA 1S72Z 3OW2Y 3MONA 3GTGI 2J6AA 4NBHA 3NYQA 1N32C 5A2Qf 1TFIA 2K3RA 2WP0C 2OOXB 3RZOI 1LQLA 4DV6C 1XMQC 4B3MC 3HOUI 1MD9A 1PG3A 1TH5A 2OZKA 4HPVA 3KXWA 3H3VJ 1IBMC 2V8IA 2QVXX 4JI0C 2WB1A 4JI3C 3CC21 4IR7A 1RY2A 4DUZC 1WCMI 1YUAA 2KI7B 3M3YI 3PBKA 2DE6A 3Q87A 3A25A 2R93I 4CL1A 4BSZA 1I94C 5CM2M 3D2LA 4A3EI 1WH9A 4DR2C 4ODJA 1K8A2 2B63I 3M4OI 5K85A 3NPDA 4LFCC 1RO4A 1W2BY 3GR0A 4MH4A 3A26A 4JI8C 5T64A 5D1OA 3C5EA 1Q861 1VQO1 1EGAA 5IT9b 2JIRA 1QVFZ 2Q51A 4E2WA 1PFTA 3NH8A 4GKJC 4RVNA 2JUBA 3CCL1 1N8R2 5H9UA 3VMIA 2OTJZ 4L2ZA 2YWBA 1XRAA 3K7AI 4ZLPA 2V8KA 1VQM1 1Z01A 1P4EA 4IZ6A 1YJ7A 3EEDA 1N33C 3EQ6A 1VQ5Z 3J81D 3VTNA 1YITZ 2D28C 3MZKB 5BUSA 1USPA 4NBAA 3T1YC 2RT9A 4FTFA 1M1K1 5FLXf 1QYPA 1ULTA 2GTIA 4ISBA 1AA6A 1X3WA 1JJ2Z 4E30A 4EATA 1ZB8A 5A1IA 1ZB9A 2MCQA 5GTDA 1VQ91 2P2FA 2M5HA 1JOSA 1VQP1 1RNIA 4BC7A 2E5LC 1K9M1 2NAPA 1P4EC 4D4IA 5C4XI 2JIPA 5T67A 1UWDA 3RV2A 3TQIA 3IEVA 3CQ2A 5A2QD 4DUYC 4NB9A 2AYDA 1I50I 1KC81 3K6RA 3DLPX 4PUHA 3G6EZ 3TDHB 1VQ9Z 2LEXA 3L95X 1ZH1A 4KTTA 2W03A 3IR7A 5BSUA 2JR6A 1KQSZ 3NI2A 4BCAA 2P20A 3J81b 3CPWZ 1S7MA 1IB8A 3OTOC 4HH4A 3ETOA 2QEXZ 4DGLA 1TWAI 3I07A 2PT7G 1K9M2 4DV4C 2DE5A 1Q811 2W04A 1MXCA 4A3JI 1K0RA 1K732 3CCUZ 4LF8C 4MXUA 4E2YA 1QF8A 4G1IA 3UZ0A 2BJOA 4D4GA 2VQEC 2KZFA 4MONA 2G2KA 4DCTA 1K8A1 3S2DI 2E7ZA 4RMNA 5C44I 4OXIA 2UXBC 3HOZI 2P3YA 1NUIA 2VPYA 3S2HI 4FUQA 3VMHA 4E2ZA 3S1MI 1O9TA 4G37A 1NYEA 1W2BZ 4R1MA 2Z51A 3A9VA 1K731 2QVYX 1GPMA 3HKZA 5IP7I 1O90A 5LMUC 4D57A 4NBDA 1YJW1 4BY1I 2QR1B 3DHVA 2YWCA 4DV1C 1FDOA 3VMGA 1VQMZ 2D1SA 2ZZNA 1QWIA 3CMA1 2ZZMA 2WAQA 3HOYI 2DPLA 3F3PC 2V3VA 1ML8A 1KQSY 3FCEA 2NCLA 3G7SA 2H85A 4GS5A 4K0BA 4X66C 2PN2A 4XX2A 4A3DI 3TUFA 1VQ41 3TDEA 3FQMA 1WW9A 3H0GI 2AKLA 3CC4Z 5AE2A 5C3EI 3NDIA 5BUQA 3I08A 3S1QI 4X65C 1Z02A 4MD7A 3GKUA 1O93A 1I3QI 3EERA 1M902 1TWFI 1Q7Y1 2D1RA 5CZVA 5KYVA 4JI1C 2QA41 4LF5C 1JWHC 4A3MI 5LL6f 5BSTA 5BSVA 3GCFA 3CCM1 5T8TA 4DR3C 4DR1C 1YJWZ 3LAXA 4KTVA 2OO4A 3CD6Z 5BR8C 4DV3C 4RM3A 4NBGA 3CQ1A 1HNWC 3T1HC 1YJN1 4AYBA 3IFUA 2UXDC 4DV2C 3CJEA 4S1TA 1L2FA 4JI7C 1P9NA 3O2EA 3A4IA 2K5RA 4WV3A 3PO3S 5D1OB 4BC9A 4RVFA 4E32A 3R9XA 2OBVA 4DR5C 1DL6A 4DV7C 1KKGA 2UU9C 1L1OC 3NH4A 3FCCA 3CC2Z 1RQFA 4NDNA 1RO0A 2JMOA 2ZM6C 4NFRA 1YIJ1 1YI21 2NVQI 3IPLA 2P2JA 2QEX1 3CME1
chains in the Genus database with same CATH topology
1RO2A 2P2MA 4D56A 3JAMb 3NYRA 4BBRI 4BBSI 5IP9I 1VQL1 2RHBA 5T6BA 2D1QA 3A9UA 3CCR1 1MKYA 3CC71 2AYAA 2CY1A 4RVOA 3CCEZ 3VNSA 2VF1A 4HGYA 2OPLB 3GTPI 2GU2A 4JV5C 2QW0X 4ZJZA 4DQYB 4MTNA 2JA5I 1VQ81 1R9TI 4TPSB 2LFUA 5D1PA 2JA6I 4KHPC 4NBCA 4LF6C 4AQYC 3S15I 1MDBA 4B3RC 1TWGI 2OTL1 2E8CA 4LF4C 2Y27A 2PM9A 5KEIA 1YUKA 3J80f 2JMPA 4E31A 3RZDI 2QRDB 3HOWI 3GTOI 4NBEA 4JI6C 5AE1A 4A3KI 2HF1A 1YJ91 3PESA 3I55Z 1USPB 3H2TA 3PROC 3L8CA 2VQFC 4I9FA 1T5DX 3I561 2BH1X 2YADA 3BG1B 4RV9A 4PZPA 4NXNC 5LMNC 1M901 4DCVA 1J5EC 1Q7Y2 3CCRZ 2UXCC 1HNZC 4LF9C 3TE5B 1MXBA 4JI2C 1YHQ1 2R6MA 1VQ71 1N34C 4NOZA 4JI4C 2KPIA 1VQ4Z 4DG8A 3VNRA 1HH2P 1T5HX 3NFZA 3KIHA 3DAYA 5BURA 3N2QA 2E8FA 3BG0B 1WF3A 3PO2I 3R44A 3J81f 4RLFA 5A1GA 3QWUA 1KC82 1KRLA 3NDJA 4I9GA 3CXCZ 3S1RI 4YHHC 1V26A 3LUSA 4DCUA 1X3ZA 5T8SA 3J80b 4YY3C 1TWCI 1VQNZ 1WIIA 1LCIA 3CCLZ 2E2JI 3G4SZ 3CD61 5KYTA 1UKKA 1HR0C 4DV0C 5BSWA 5ADZA 5DV9A 4K0KC 2IZ3A 3R9WA 2O4HA 1X0TA 3CQZI 2UUBC 4BXXI 3IMLA 2NVTI 3CW9A 3KIFA 4B3SC 3T4NB 4DG9A 3CCQZ 2QRCB 3G6E1 3U50C 1K83I 3G71Z 2O53A 1JJ2Y 2JA8I 2Y4OA 3UOWA 4RVHA 2UUCC 2E2II 1YJNZ 3MZLB 2GTHA 3CCE1 2QVZX 3CCSZ 2JS4A 1VLAA 3CCMZ 2P02A 5AE3A 4BBYA 4QTTA 3GTJI 2E8EA 5IT9D 3CC41 3J80D 1N36C 3JAMD 3CMEZ 3FQQA 1KD11 5CZXA 3GR1A 5A19A 2YU9I 3I4MI 4A3BI 4PHTA 4B3TC 2ATWA 2IZ4A 2Y0SA 1SFOI 5BSRA 4A3LI 2ONFA 3ETCA 2RBLA 3B7WA 4GXQA 2QREB 4MD8A 1VQOZ 4NH1C 2QA4Z 4Y7NI 4R1LA 4DR7C 3IX0A 1YI2Z 1YIJZ 2M6NA 5AN9F 1KD12 2VZEA 3GTKI 4DK1A 3S16I 4E2XA 3GTLI 4LE5A 3I56Z 5BSMA 1N2FA 2F4OA 2YCBA 1XRCA 4JI5C 4EWCA 3LGXA 4G36A 3CCV1 4RS4A 4RM2A 1Q821 2DE7A 4A3CI 1O92A 4MRIA 1VQLZ 4A3GI 4Y52I 2M48A 4DCSA 1VQ8Z 4X62C 2F4VC 4JYAC 4A3II 1Q812 2QLVB 2WD9A 4RVGA 4X64C 1YJ9Z 4NBFA 2R7ZI 3FKII 2CXCA 3P5JB 1QVGY 1V25A 3G711 2VSQA 1P7LA 2OPLA 3CXCY 2OTJ1 2QL8A 3E7XA 4U5YD 3OW2Z 3RG2A 1NJI1 4LFAC 1FJGC 4LFBC 2P28A 3E7WA 5E7QA 4GXRA 1S721 4DR6C 4A3FI 2D1TA 2RIQA 2V7BA 2P2QA 5K8FA 4LF7C 3N54B 1YHQZ 3D9XA 1TWHI 3I4NI 4X6AI 2NVYI 5FLMI 2E9HA 3GKQA 1PA4A 1QM4A 2PROA 5IWAC 4TNUA 3CC7Z 3CCJ1 1I6HI 5FLXb 5C4JI 3S82A 4E33A 1FUGA 2E7GA 3GPCA 4OYCA 3SO4A 2E0GA 3HOXI 2V8JA 3ESWA 4DR4C 2VUMI 3JAMf 4PROC 2HU9A 4DV5C 3S14I 2D7VA 1VQPZ 2HJGA 3S1NI 2JA7I 1MXAA 1XMOC 3G4S1 3LNVA 1QVFY 4A93I 1VQN1 3PO3I 4NB8A 2LIYA 2Y4NA 3AF5A 1Q862 2DYJA 5IFIA 4RVDA 2RPRA 2VUGA 1IBLC 3GTMI 1VQ7Z 1VQKZ 1N8R1 1MDFA 4L7IA 2JNYA 4NXMC 2P2BA 5JRHA 3CCU1 2D27A 3CCQ1 3D6WA 1XNQC 3CCVZ 1Z03A 4RLQA 1VQ51 4WS9A 1YIT1 5A2Qb 4GKKC 2QKDA 3CPWY 1RG9A 1VQK1 4FUTA 2XR1A 3NH5A 5FLXD 3CW8X 4R0MA 1XNRC 2Q4ZA 1Y1VS 4L4QA 1M1K2 4BY7I 1PG4A 4OX9C 1Y1VI 2OOYB 4NBBA 2E2HI 3GTQI 1Y1WI 2PK7A 3IEUA 2F4MA 3VNQA 3J7A4 1HNXC 2UUAC 3I551 1NP6A 1Q822 2ZAEB 4HGZA 1BA3A 4MD9A 3F3FC 1IBKC 3VB9A 4JM1A 1VQ6Z 1AMUA 3CCJZ 3HOVI 2EGTA 3CCS1 1RLYA 3IF8A 3S17I 3GTMS 3CMAZ 2OTLZ 1NJI2 3AF6A 2I3CA 1QVGZ 2NVXI 1XRBA 5IT9f 2HHHC 2R92I 1VQ61 2PMZA 4QTUA 1S72Z 3OW2Y 3MONA 3GTGI 2J6AA 4NBHA 3NYQA 1N32C 5A2Qf 1TFIA 2K3RA 2WP0C 2OOXB 3RZOI 1LQLA 4DV6C 1XMQC 4B3MC 3HOUI 1MD9A 1PG3A 2OZKA 4HPVA 3KXWA 3H3VJ 1IBMC 2V8IA 2QVXX 4JI0C 2WB1A 4JI3C 3CC21 4IR7A 1RY2A 4DUZC 1WCMI 1YUAA 2KI7B 3M3YI 3PBKA 2DE6A 3Q87A 2R93I 4CL1A 4BSZA 1I94C 5CM2M 4A3EI 1WH9A 4DR2C 4ODJA 1K8A2 2B63I 3M4OI 5K85A 3NPDA 4LFCC 1RO4A 1W2BY 3GR0A 4MH4A 4JI8C 5T64A 5D1OA 3C5EA 1Q861 1VQO1 1EGAA 5IT9b 1QVFZ 2Q51A 4E2WA 1PFTA 3NH8A 4GKJC 4RVNA 2JUBA 3CCL1 1N8R2 5H9UA 3VMIA 2OTJZ 4L2ZA 2YWBA 1XRAA 3K7AI 4ZLPA 2V8KA 1VQM1 1Z01A 4IZ6A 1YJ7A 3EEDA 1N33C 3EQ6A 1VQ5Z 3J81D 3VTNA 1YITZ 2D28C 3MZKB 5BUSA 1USPA 4NBAA 3T1YC 2RT9A 4FTFA 1M1K1 5FLXf 1QYPA 1ULTA 2GTIA 4ISBA 1X3WA 1JJ2Z 4E30A 4EATA 1ZB8A 5A1IA 1ZB9A 5GTDA 1VQ91 2P2FA 1JOSA 1VQP1 1RNIA 4BC7A 2E5LC 1K9M1 4D4IA 5C4XI 5T67A 3RV2A 3TQIA 3IEVA 5A2QD 4DUYC 4NB9A 1I50I 1KC81 3DLPX 3G6EZ 3TDHB 1VQ9Z 3L95X 1ZH1A 4KTTA 2W03A 5BSUA 2JR6A 1KQSZ 3NI2A 4BCAA 2P20A 3J81b 3CPWZ 1S7MA 3OTOC 4HH4A 3ETOA 2QEXZ 4DGLA 1TWAI 3I07A 2PT7G 1K9M2 4DV4C 2DE5A 1Q811 2W04A 1MXCA 4A3JI 1K0RA 1K732 3CCUZ 4LF8C 4MXUA 4E2YA 1QF8A 4G1IA 3UZ0A 2BJOA 4D4GA 2VQEC 2KZFA 4MONA 2G2KA 4DCTA 1K8A1 3S2DI 4RMNA 5C44I 4OXIA 2UXBC 3HOZI 2P3YA 1NUIA 4FUQA 3S2HI 2ASBA 3VMHA 4E2ZA 3S1MI 1O9TA 4G37A 1NYEA 1W2BZ 4R1MA 3A9VA 1K731 2QVYX 1GPMA 3HKZA 5IP7I 1O90A 5LMUC 4D57A 4NBDA 1YJW1 4BY1I 2QR1B 3DHVA 2YWCA 4DV1C 3VMGA 1VQMZ 2D1SA 1QWIA 3CMA1 2WAQA 3HOYI 2DPLA 3F3PC 1ML8A 1KQSY 3FCEA 3G7SA 4K0BA 2H85A 4GS5A 4X66C 2PN2A 4XX2A 4A3DI 3TUFA 1VQ41 3TDEA 3FQMA 1WW9A 3H0GI 2AKLA 3CC4Z 5AE2A 5C3EI 3NDIA 5BUQA 3I08A 3S1QI 4X65C 1Z02A 4MD7A 3GKUA 1O93A 1I3QI 3EERA 1M902 1TWFI 1Q7Y1 2D1RA 5CZVA 5KYVA 4JI1C 2QA41 4LF5C 1JWHC 4A3MI 5LL6f 5BSTA 5BSVA 3GCFA 3CCM1 5T8TA 4DR3C 4DR1C 1YJWZ 3LAXA 4KTVA 2OO4A 3CD6Z 5BR8C 4DV3C 4RM3A 4NBGA 1HNWC 3T1HC 1YJN1 4AYBA 3IFUA 2UXDC 4DV2C 3CJEA 4S1TA 1L2FA 4JI7C 1P9NA 3A4IA 2K5RA 4WV3A 3PO3S 5D1OB 4BC9A 4RVFA 4E32A 3R9XA 2OBVA 4DR5C 1DL6A 4DV7C 1KKGA 2UU9C 1L1OC 3NH4A 3FCCA 3CC2Z 1RQFA 4NDNA 1RO0A 2JMOA 2ZM6C 4NFRA 1YIJ1 1YI21 2NVQI 3IPLA 2P2JA 2QEX1 3CME1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWA I;  2YU9 I;  3I4M I;  4BBR I;  4A3B I;  3I07 A;  5IP9 I;  4BBS I;  2PT7 G;  4DV4 C;  2DE5 A;  3VB9 A;  1IBK C;  4B3T C;  2ATW A;  1SFO I;  4A3L I;  1MKY A;  2CY1 A;  4A3J I;  1K0R A;  2ONF A;  2RBL A;  3HOV I;  4LF8 C;  2EGT A;  1RLY A;  3S17 I;  2OPL B;  3GTP I;  3GTM S;  4JV5 C;  2BJO A;  4Y7N I;  2VQE C;  4DR7 C;  2KZF A;  4DCT A;  3AF6 A;  2NVX I;  2HHH C;  4MTN A;  2JA5 I;  2R92 I;  1R9T I;  3S2D I;  4QTU A;  5C44 I;  2UXB C;  2ZM6 C;  3HOZ I;  3GTK I;  2P3Y A;  1NUI A;  2JA6 I;  3GTG I;  3GTL I;  2J6A A;  4NBC A;  4NBH A;  3VMH A;  3S16 I;  3S1M I;  3S15 I;  3S2H I;  1NYE A;  4AQY C;  1TWG I;  2E8C A;  1TFI A;  1N2F A;  2F4O A;  5IT9 D;  3RZO I;  1LQL A;  2YCB A;  4LF4 C;  4DV6 C;  1XMQ C;  4B3M C;  3HOU I;  4JI5 C;  2JMP A;  3H3V J;  1IBM C;  3RZD I;  5IP7 I;  4JI0 C;  5LMU C;  2DE7 A;  4A3C I;  4JI3 C;  4NBD A;  3HOW I;  4BY1 I;  4A3G I;  3GTO I;  4Y52 I;  4DUZ C;  1WCM I;  4NBE A;  4DCS A;  1YUA A;  3M3Y I;  4X62 C;  3VMG A;  2DE6 A;  4DV1 C;  4A3I I;  4JI6 C;  4A3K I;  2ASB A;  2HF1 A;  2F4V C;  3Q87 A;  4JYA C;  1USP B;  4X64 C;  4NBF A;  2R7Z I;  2VQF C;  3FKI I;  1QWI A;  2CXC A;  2R93 I;  4BSZ A;  3HOY I;  1I94 C;  2OPL A;  4NXN C;  5CM2 M;  2QL8 A;  5LMN C;  4DCV A;  4LFA C;  1FJG C;  1J5E C;  1ML8 A;  4LFB C;  1N33 C;  2UXC C;  4A3E I;  1HNZ C;  1WH9 A;  4DR2 C;  4LF9 C;  4DR6 C;  4A3F I;  2B63 I;  3M4O I;  4X66 C;  4JI2 C;  4LFC C;  2PN2 A;  1RO4 A;  4XX2 A;  4A3D I;  4MH4 A;  1N34 C;  4JI8 C;  4LF7 C;  4NOZ A;  1TWH I;  3I4N I;  2KPI A;  4JI4 C;  1WW9 A;  2NVY I;  4X6A I;  5FLM I;  3H0G I;  2AKL A;  3GKQ A;  1HH2 P;  1PA4 A;  5IWA C;  1EGA A;  5C3E I;  1I6H I;  4KHP C;  1PFT A;  3S1Q I;  2E8F A;  5C4J I;  4X65 C;  4GKJ C;  2E7G A;  1WF3 A;  3PO2 I;  3VMI A;  3GKU A;  1I3Q I;  3EER A;  3K7A I;  3HOX I;  3ESW A;  1N32 C;  3S1R I;  1TWF I;  4YHH C;  4DR4 C;  2VUM I;  4JI1 C;  3LUS A;  4DCU A;  4DV5 C;  1X3Z A;  4A3M I;  3S14 I;  2D7V A;  2HJG A;  3J81 D;  4LF5 C;  3GCF A;  3S1N I;  2JA7 I;  4YY3 C;  1TWC I;  1XMO C;  4DR3 C;  4DR1 C;  4A93 I;  2E2J I;  3PO3 I;  1USP A;  4NB8 A;  4NBA A;  5BR8 C;  4DV3 C;  3T1Y C;  1HR0 C;  1UKK A;  4NBG A;  4DV0 C;  1HNW C;  3T1H C;  4K0K C;  3AF5 A;  3R9W A;  2DYJ A;  1QYP A;  2UXD C;  4DV2 C;  1X3W A;  3CQZ I;  3CJE A;  1IBL C;  4BXX I;  1L2F A;  2UUB C;  2NVT I;  3GTM I;  4JI7 C;  4B3S C;  2JNY A;  1ZB8 A;  4NXM C;  1ZB9 A;  2K5R A;  3PO3 S;  3D6W A;  3R9X A;  1XNQ C;  1JOS A;  2E5L C;  3U50 C;  4GKK C;  5C4X I;  4DR5 C;  1K83 I;  1DL6 A;  2JA8 I;  3IEV A;  4DV7 C;  2XR1 A;  2UUC C;  1KKG A;  2E2I I;  5A2Q D;  4NB9 A;  5FLX D;  4DUY C;  1XNR C;  1I50 I;  2UU9 C;  1Y1V S;  2JS4 A;  1L1O C;  1VLA A;  4BY7 I;  4OX9 C;  1Y1V I;  4LF6 C;  4NBB A;  4QTT A;  2JR6 A;  3GTJ I;  2E2H I;  1Y1W I;  3GTQ I;  2PK7 A;  2E8E A;  2F4M A;  3IEU A;  3J80 D;  2NVQ I;  3JAM D;  1N36 C;  1HNX C;  2UUA C;  4B3R C;  3OTO C; 
#chains in the Genus database with same CATH topology
 1RO2 A;  2P2M A;  4D56 A;  3JAM b;  3NYR A;  4BBR I;  4BBS I;  5IP9 I;  1VQL 1;  2RHB A;  5T6B A;  2D1Q A;  3A9U A;  3CCR 1;  1MKY A;  3CC7 1;  2AYA A;  2CY1 A;  4RVO A;  3CCE Z;  3VNS A;  2VF1 A;  4HGY A;  2OPL B;  3GTP I;  2GU2 A;  4JV5 C;  2QW0 X;  4ZJZ A;  4DQY B;  4MTN A;  2JA5 I;  1VQ8 1;  1R9T I;  4TPS B;  3TR3 A;  2KZ0 A;  2LFU A;  5D1P A;  2JA6 I;  4KHP C;  4NBC A;  4LF6 C;  4AQY C;  3S15 I;  1MDB A;  4B3R C;  1TWG I;  2OTL 1;  2E8C A;  4LF4 C;  2JNV A;  2PM9 A;  2Y27 A;  5KEI A;  1YUK A;  3J80 f;  2JMP A;  4E31 A;  3RZD I;  2KDN A;  2QRD B;  3CQ3 A;  3HOW I;  3GTO I;  4NBE A;  4JI6 C;  5AE1 A;  4A3K I;  2HF1 A;  1YJ9 1;  3PES A;  3I55 Z;  1USP B;  3H2T A;  3PRO C;  3L8C A;  2VQF C;  4I9F A;  1T5D X;  3I56 1;  2BH1 X;  2YAD A;  3BG1 B;  4RV9 A;  4PZP A;  4NXN C;  5LMN C;  1M90 1;  4DCV A;  1J5E C;  1Q7Y 2;  3CCR Z;  2UXC C;  1HNZ C;  4LF9 C;  3TE5 B;  2DHM A;  1MXB A;  3UX3 A;  4JI2 C;  1YHQ 1;  2R6M A;  1VQ7 1;  1N34 C;  4NOZ A;  4JI4 C;  2KPI A;  1VQ4 Z;  1V60 A;  4DG8 A;  3VNR A;  1Q16 A;  1HH2 P;  1T5H X;  3NFZ A;  1Y8C A;  3KIH A;  3DAY A;  5BUR A;  3N2Q A;  2E8F A;  3BG0 B;  1WF3 A;  3PO2 I;  3R44 A;  3J81 f;  4RLF A;  5A1G A;  3QWU A;  1KC8 2;  1KRL A;  3NDJ A;  2VPZ A;  4I9G A;  3CXC Z;  3S1R I;  4YHH C;  1V26 A;  2VPX A;  3LUS A;  4DCU A;  1X3Z A;  5T8S A;  3J80 b;  4YY3 C;  1TWC I;  1VQN Z;  1WII A;  1LCI A;  3CCL Z;  2E2J I;  3G4S Z;  3CD6 1;  5KYT A;  1UKK A;  1HR0 C;  4DV0 C;  5BSW A;  5ADZ A;  5DV9 A;  4K0K C;  2IZ3 A;  3R9W A;  2O4H A;  1X0T A;  3CQZ I;  2UUB C;  1FDI A;  4BXX I;  3IML A;  2NVT I;  2JIM A;  3KIF A;  2YX1 A;  3CW9 A;  2CU6 A;  4B3S C;  3T4N B;  4DG9 A;  3CCQ Z;  2QRC B;  3G6E 1;  3U50 C;  1K83 I;  3G71 Z;  2O53 A;  1JJ2 Y;  2JA8 I;  5LCI A;  2Y4O A;  3UOW A;  4RVH A;  2UUC C;  2E2I I;  1YJN Z;  3MZL B;  2GTH A;  3CCE 1;  2QVZ X;  3CCS Z;  2JS4 A;  1VLA A;  3CCM Z;  2P02 A;  5AE3 A;  1WJ2 A;  4BBY A;  4QTT A;  3GTJ I;  2E8E A;  5IT9 D;  3CC4 1;  3J80 D;  1N36 C;  3JAM D;  3CME Z;  3FQQ A;  1KD1 1;  5CZX A;  3GR1 A;  5A19 A;  3UX2 A;  2YU9 I;  3I4M I;  4A3B I;  4PHT A;  4B3T C;  2ATW A;  2IZ4 A;  2Y0S A;  1SFO I;  5BSR A;  4A3L I;  1M6X A;  2ONF A;  3ETC A;  2RBL A;  3B7W A;  4GXQ A;  2QRE B;  2VPW A;  4MD8 A;  1VQO Z;  4NH1 C;  2QA4 Z;  4Y7N I;  4R1L A;  4DR7 C;  1QXF A;  3IX0 A;  2JIQ A;  1YI2 Z;  1YIJ Z;  2M6N A;  5AN9 F;  1KD1 2;  2VZE A;  3GTK I;  4DK1 A;  3S16 I;  4E2X A;  3GTL I;  1VEH A;  4LE5 A;  3I56 Z;  3AY0 A;  5BSM A;  1N2F A;  2F4O A;  2YCB A;  1XRC A;  4JI5 C;  4EWC A;  3LGX A;  4G36 A;  3CCV 1;  4RS4 A;  4RM2 A;  1Q82 1;  2DE7 A;  4A3C I;  1O92 A;  4MRI A;  4PUI A;  1VQL Z;  2IV2 X;  4A3G I;  4Y52 I;  2JIO A;  2M48 A;  4DCS A;  1FLO A;  1VQ8 Z;  4X62 C;  2F4V C;  4JYA C;  4A3I I;  2ASB A;  1Q81 2;  2QLV B;  2WD9 A;  4RVG A;  4X64 C;  1YJ9 Z;  4NBF A;  2R7Z I;  1XS3 A;  3FKI I;  2CXC A;  3P5J B;  1QVG Y;  1V25 A;  3G71 1;  2M5O A;  2VSQ A;  1P7L A;  2OPL A;  3CXC Y;  2OTJ 1;  2QL8 A;  3E7X A;  4U5Y D;  3OW2 Z;  1SIW A;  1NJI 1;  3RG2 A;  4LFA C;  4LFB C;  2P28 A;  2MM9 A;  1FJG C;  3E7W A;  5E7Q A;  4GXR A;  1S72 1;  4DR6 C;  4A3F I;  2D1T A;  2RIQ A;  2V7B A;  2P2Q A;  5K8F A;  4LF7 C;  3N54 B;  1YHQ Z;  3D9X A;  1WZN A;  1TWH I;  3I4N I;  4X6A I;  2NVY I;  5FLM I;  2E9H A;  3GKQ A;  1PA4 A;  1QM4 A;  2PRO A;  5IWA C;  4TNU A;  3CC7 Z;  3CCJ 1;  1I6H I;  5FLX b;  5C4J I;  3S82 A;  4E33 A;  1FUG A;  2E7G A;  3GPC A;  4OYC A;  3SO4 A;  2E0G A;  3HOX I;  2V8J A;  3ESW A;  4DR4 C;  2VUM I;  3JAM f;  4PRO C;  2HU9 A;  4DV5 C;  3S14 I;  2D7V A;  1VQP Z;  2HJG A;  4PUG A;  3S1N I;  2JA7 I;  1MXA A;  1XMO C;  3G4S 1;  3LNV A;  1QVF Y;  4A93 I;  1VQN 1;  3PO3 I;  4NB8 A;  2LIY A;  2Y4N A;  3UEB A;  3AF5 A;  1Q86 2;  2DYJ A;  2MMA B;  5IFI A;  4RVD A;  2RPR A;  2VUG A;  1IBL C;  3GTM I;  1VQ7 Z;  1VQK Z;  1N8R 1;  1MDF A;  4L7I A;  2JNY A;  4NXM C;  2P2B A;  5JRH A;  3CCU 1;  2D27 A;  3CCQ 1;  3D6W A;  1XNQ C;  1M6X C;  3CCV Z;  1Z03 A;  4RLQ A;  1XHJ A;  1VQ5 1;  4WS9 A;  1YIT 1;  5A2Q b;  4GKK C;  2QKD A;  3CPW Y;  1RG9 A;  1VQK 1;  4FUT A;  2XR1 A;  3NH5 A;  5FLX D;  3CW8 X;  4R0M A;  1XNR C;  2Q4Z A;  1Y1V S;  4L4Q A;  1M1K 2;  4BY7 I;  1PG4 A;  4OX9 C;  1Y1V I;  2OOY B;  4NBB A;  2E2H I;  3GTQ I;  1Y1W I;  2PK7 A;  1NY8 A;  2F4M A;  3IEU A;  3VNQ A;  3J7A 4;  1HNX C;  2UUA C;  3I55 1;  1NP6 A;  1Q82 2;  2ZAE B;  4HGZ A;  1BA3 A;  4MD9 A;  3F3F C;  1IBK C;  3VB9 A;  4JM1 A;  1VQ6 Z;  1AMU A;  3CCJ Z;  3HOV I;  1PU1 A;  2EGT A;  3CCS 1;  1RLY A;  3IF8 A;  3S17 I;  3GTM S;  3CMA Z;  2V45 A;  3LNO A;  2OTL Z;  1NJI 2;  1WCJ A;  3AF6 A;  2I3C A;  1QVG Z;  2NVX I;  1XRB A;  5IT9 f;  2HHH C;  2R92 I;  1VQ6 1;  2PMZ A;  4QTU A;  1S72 Z;  3OW2 Y;  3MON A;  3GTG I;  2J6A A;  4NBH A;  3NYQ A;  1N32 C;  5A2Q f;  1TFI A;  2K3R A;  2WP0 C;  2OOX B;  3RZO I;  1LQL A;  4DV6 C;  1XMQ C;  4B3M C;  3HOU I;  1MD9 A;  1PG3 A;  1TH5 A;  2OZK A;  4HPV A;  3KXW A;  3H3V J;  1IBM C;  2V8I A;  2QVX X;  4JI0 C;  2WB1 A;  4JI3 C;  3CC2 1;  4IR7 A;  1RY2 A;  4DUZ C;  1WCM I;  1YUA A;  2KI7 B;  3M3Y I;  3PBK A;  2DE6 A;  3Q87 A;  3A25 A;  2R93 I;  4CL1 A;  4BSZ A;  1I94 C;  5CM2 M;  3D2L A;  4A3E I;  1WH9 A;  4DR2 C;  4ODJ A;  1K8A 2;  2B63 I;  3M4O I;  5K85 A;  3NPD A;  4LFC C;  1RO4 A;  1W2B Y;  3GR0 A;  4MH4 A;  3A26 A;  4JI8 C;  5T64 A;  5D1O A;  3C5E A;  1Q86 1;  1VQO 1;  1EGA A;  5IT9 b;  2JIR A;  1QVF Z;  2Q51 A;  4E2W A;  1PFT A;  3NH8 A;  4GKJ C;  4RVN A;  2JUB A;  3CCL 1;  1N8R 2;  5H9U A;  3VMI A;  2OTJ Z;  4L2Z A;  2YWB A;  1XRA A;  3K7A I;  4ZLP A;  2V8K A;  1VQM 1;  1Z01 A;  1P4E A;  4IZ6 A;  1YJ7 A;  3EED A;  1N33 C;  3EQ6 A;  1VQ5 Z;  3J81 D;  3VTN A;  1YIT Z;  2D28 C;  3MZK B;  5BUS A;  1USP A;  4NBA A;  3T1Y C;  2RT9 A;  4FTF A;  1M1K 1;  5FLX f;  1QYP A;  1ULT A;  2GTI A;  4ISB A;  1AA6 A;  1X3W A;  1JJ2 Z;  4E30 A;  4EAT A;  1ZB8 A;  5A1I A;  1ZB9 A;  2MCQ A;  5GTD A;  1VQ9 1;  2P2F A;  2M5H A;  1JOS A;  1VQP 1;  1RNI A;  4BC7 A;  2E5L C;  1K9M 1;  2NAP A;  1P4E C;  4D4I A;  5C4X I;  2JIP A;  5T67 A;  1UWD A;  3RV2 A;  3TQI A;  3IEV A;  3CQ2 A;  5A2Q D;  4DUY C;  4NB9 A;  2AYD A;  1I50 I;  1KC8 1;  3K6R A;  3DLP X;  4PUH A;  3G6E Z;  3TDH B;  1VQ9 Z;  2LEX A;  3L95 X;  1ZH1 A;  4KTT A;  2W03 A;  3IR7 A;  5BSU A;  2JR6 A;  1KQS Z;  3NI2 A;  4BCA A;  2P20 A;  3J81 b;  3CPW Z;  1S7M A;  1IB8 A;  3OTO C;  4HH4 A;  3ETO A;  2QEX Z;  4DGL A;  1TWA I;  3I07 A;  2PT7 G;  1K9M 2;  4DV4 C;  2DE5 A;  1Q81 1;  2W04 A;  1MXC A;  4A3J I;  1K0R A;  1K73 2;  3CCU Z;  4LF8 C;  4MXU A;  4E2Y A;  1QF8 A;  4G1I A;  3UZ0 A;  2BJO A;  4D4G A;  2VQE C;  2KZF A;  4MON A;  2G2K A;  4DCT A;  1K8A 1;  3S2D I;  2E7Z A;  4RMN A;  5C44 I;  4OXI A;  2UXB C;  3HOZ I;  2P3Y A;  1NUI A;  2VPY A;  3S2H I;  4FUQ A;  3VMH A;  4E2Z A;  3S1M I;  1O9T A;  4G37 A;  1NYE A;  1W2B Z;  4R1M A;  2Z51 A;  3A9V A;  1K73 1;  2QVY X;  1GPM A;  3HKZ A;  5IP7 I;  1O90 A;  5LMU C;  4D57 A;  4NBD A;  1YJW 1;  4BY1 I;  2QR1 B;  3DHV A;  2YWC A;  4DV1 C;  1FDO A;  3VMG A;  1VQM Z;  2D1S A;  2ZZN A;  1QWI A;  3CMA 1;  2ZZM A;  2WAQ A;  3HOY I;  2DPL A;  3F3P C;  2V3V A;  1ML8 A;  1KQS Y;  3FCE A;  2NCL A;  3G7S A;  2H85 A;  4GS5 A;  4K0B A;  4X66 C;  2PN2 A;  4XX2 A;  4A3D I;  3TUF A;  1VQ4 1;  3TDE A;  3FQM A;  1WW9 A;  3H0G I;  2AKL A;  3CC4 Z;  5AE2 A;  5C3E I;  3NDI A;  5BUQ A;  3I08 A;  3S1Q I;  4X65 C;  1Z02 A;  4MD7 A;  3GKU A;  1O93 A;  1I3Q I;  3EER A;  1M90 2;  1TWF I;  1Q7Y 1;  2D1R A;  5CZV A;  5KYV A;  4JI1 C;  2QA4 1;  4LF5 C;  1JWH C;  4A3M I;  5LL6 f;  5BST A;  5BSV A;  3GCF A;  3CCM 1;  5T8T A;  4DR3 C;  4DR1 C;  1YJW Z;  3LAX A;  4KTV A;  2OO4 A;  3CD6 Z;  5BR8 C;  4DV3 C;  4RM3 A;  4NBG A;  3CQ1 A;  1HNW C;  3T1H C;  1YJN 1;  4AYB A;  3IFU A;  2UXD C;  4DV2 C;  3CJE A;  4S1T A;  1L2F A;  4JI7 C;  1P9N A;  3O2E A;  3A4I A;  2K5R A;  4WV3 A;  3PO3 S;  5D1O B;  4BC9 A;  4RVF A;  4E32 A;  3R9X A;  2OBV A;  4DR5 C;  1DL6 A;  4DV7 C;  1KKG A;  2UU9 C;  1L1O C;  3NH4 A;  3FCC A;  3CC2 Z;  1RQF A;  4NDN A;  1RO0 A;  2JMO A;  2ZM6 C;  4NFR A;  1YIJ 1;  1YI2 1;  2NVQ I;  3IPL A;  2P2J A;  2QEX 1;  3CME 1; 
#chains in the Genus database with same CATH homology
 1RO2 A;  2P2M A;  4D56 A;  3JAM b;  3NYR A;  4BBR I;  4BBS I;  5IP9 I;  1VQL 1;  2RHB A;  5T6B A;  2D1Q A;  3A9U A;  3CCR 1;  1MKY A;  3CC7 1;  2AYA A;  2CY1 A;  4RVO A;  3CCE Z;  3VNS A;  2VF1 A;  4HGY A;  2OPL B;  3GTP I;  2GU2 A;  4JV5 C;  2QW0 X;  4ZJZ A;  4DQY B;  4MTN A;  2JA5 I;  1VQ8 1;  1R9T I;  4TPS B;  2LFU A;  5D1P A;  2JA6 I;  4KHP C;  4NBC A;  4LF6 C;  4AQY C;  3S15 I;  1MDB A;  4B3R C;  1TWG I;  2OTL 1;  2E8C A;  4LF4 C;  2Y27 A;  2PM9 A;  5KEI A;  1YUK A;  3J80 f;  2JMP A;  4E31 A;  3RZD I;  2QRD B;  3HOW I;  3GTO I;  4NBE A;  4JI6 C;  5AE1 A;  4A3K I;  2HF1 A;  1YJ9 1;  3PES A;  3I55 Z;  1USP B;  3H2T A;  3PRO C;  3L8C A;  2VQF C;  4I9F A;  1T5D X;  3I56 1;  2BH1 X;  2YAD A;  3BG1 B;  4RV9 A;  4PZP A;  4NXN C;  5LMN C;  1M90 1;  4DCV A;  1J5E C;  1Q7Y 2;  3CCR Z;  2UXC C;  1HNZ C;  4LF9 C;  3TE5 B;  1MXB A;  4JI2 C;  1YHQ 1;  2R6M A;  1VQ7 1;  1N34 C;  4NOZ A;  4JI4 C;  2KPI A;  1VQ4 Z;  4DG8 A;  3VNR A;  1HH2 P;  1T5H X;  3NFZ A;  3KIH A;  3DAY A;  5BUR A;  3N2Q A;  2E8F A;  3BG0 B;  1WF3 A;  3PO2 I;  3R44 A;  3J81 f;  4RLF A;  5A1G A;  3QWU A;  1KC8 2;  1KRL A;  3NDJ A;  4I9G A;  3CXC Z;  3S1R I;  4YHH C;  1V26 A;  3LUS A;  4DCU A;  1X3Z A;  5T8S A;  3J80 b;  4YY3 C;  1TWC I;  1VQN Z;  1WII A;  1LCI A;  3CCL Z;  2E2J I;  3G4S Z;  3CD6 1;  5KYT A;  1UKK A;  1HR0 C;  4DV0 C;  5BSW A;  5ADZ A;  5DV9 A;  4K0K C;  2IZ3 A;  3R9W A;  2O4H A;  1X0T A;  3CQZ I;  2UUB C;  4BXX I;  3IML A;  2NVT I;  3CW9 A;  3KIF A;  4B3S C;  3T4N B;  4DG9 A;  3CCQ Z;  2QRC B;  3G6E 1;  3U50 C;  1K83 I;  3G71 Z;  2O53 A;  1JJ2 Y;  2JA8 I;  2Y4O A;  3UOW A;  4RVH A;  2UUC C;  2E2I I;  1YJN Z;  3MZL B;  2GTH A;  3CCE 1;  2QVZ X;  3CCS Z;  2JS4 A;  1VLA A;  3CCM Z;  2P02 A;  5AE3 A;  4BBY A;  4QTT A;  3GTJ I;  2E8E A;  5IT9 D;  3CC4 1;  3J80 D;  1N36 C;  3JAM D;  3CME Z;  3FQQ A;  1KD1 1;  5CZX A;  3GR1 A;  5A19 A;  2YU9 I;  3I4M I;  4A3B I;  4PHT A;  4B3T C;  2ATW A;  2IZ4 A;  2Y0S A;  1SFO I;  5BSR A;  4A3L I;  2ONF A;  3ETC A;  2RBL A;  3B7W A;  4GXQ A;  2QRE B;  4MD8 A;  1VQO Z;  4NH1 C;  2QA4 Z;  4Y7N I;  4R1L A;  4DR7 C;  3IX0 A;  1YI2 Z;  1YIJ Z;  2M6N A;  5AN9 F;  1KD1 2;  2VZE A;  3GTK I;  4DK1 A;  3S16 I;  4E2X A;  3GTL I;  4LE5 A;  3I56 Z;  5BSM A;  1N2F A;  2F4O A;  2YCB A;  1XRC A;  4JI5 C;  4EWC A;  3LGX A;  4G36 A;  3CCV 1;  4RS4 A;  4RM2 A;  1Q82 1;  2DE7 A;  4A3C I;  1O92 A;  4MRI A;  1VQL Z;  4A3G I;  4Y52 I;  2M48 A;  4DCS A;  1VQ8 Z;  4X62 C;  2F4V C;  4JYA C;  4A3I I;  1Q81 2;  2QLV B;  2WD9 A;  4RVG A;  4X64 C;  1YJ9 Z;  4NBF A;  2R7Z I;  3FKI I;  2CXC A;  3P5J B;  1QVG Y;  1V25 A;  3G71 1;  2VSQ A;  1P7L A;  2OPL A;  3CXC Y;  2OTJ 1;  2QL8 A;  3E7X A;  4U5Y D;  3OW2 Z;  3RG2 A;  1NJI 1;  4LFA C;  1FJG C;  4LFB C;  2P28 A;  3E7W A;  5E7Q A;  4GXR A;  1S72 1;  4DR6 C;  4A3F I;  2D1T A;  2RIQ A;  2V7B A;  2P2Q A;  5K8F A;  4LF7 C;  3N54 B;  1YHQ Z;  3D9X A;  1TWH I;  3I4N I;  4X6A I;  2NVY I;  5FLM I;  2E9H A;  3GKQ A;  1PA4 A;  1QM4 A;  2PRO A;  5IWA C;  4TNU A;  3CC7 Z;  3CCJ 1;  1I6H I;  5FLX b;  5C4J I;  3S82 A;  4E33 A;  1FUG A;  2E7G A;  3GPC A;  4OYC A;  3SO4 A;  2E0G A;  3HOX I;  2V8J A;  3ESW A;  4DR4 C;  2VUM I;  3JAM f;  4PRO C;  2HU9 A;  4DV5 C;  3S14 I;  2D7V A;  1VQP Z;  2HJG A;  3S1N I;  2JA7 I;  1MXA A;  1XMO C;  3G4S 1;  3LNV A;  1QVF Y;  4A93 I;  1VQN 1;  3PO3 I;  4NB8 A;  2LIY A;  2Y4N A;  3AF5 A;  1Q86 2;  2DYJ A;  5IFI A;  4RVD A;  2RPR A;  2VUG A;  1IBL C;  3GTM I;  1VQ7 Z;  1VQK Z;  1N8R 1;  1MDF A;  4L7I A;  2JNY A;  4NXM C;  2P2B A;  5JRH A;  3CCU 1;  2D27 A;  3CCQ 1;  3D6W A;  1XNQ C;  3CCV Z;  1Z03 A;  4RLQ A;  1VQ5 1;  4WS9 A;  1YIT 1;  5A2Q b;  4GKK C;  2QKD A;  3CPW Y;  1RG9 A;  1VQK 1;  4FUT A;  2XR1 A;  3NH5 A;  5FLX D;  3CW8 X;  4R0M A;  1XNR C;  2Q4Z A;  1Y1V S;  4L4Q A;  1M1K 2;  4BY7 I;  1PG4 A;  4OX9 C;  1Y1V I;  2OOY B;  4NBB A;  2E2H I;  3GTQ I;  1Y1W I;  2PK7 A;  3IEU A;  2F4M A;  3VNQ A;  3J7A 4;  1HNX C;  2UUA C;  3I55 1;  1NP6 A;  1Q82 2;  2ZAE B;  4HGZ A;  1BA3 A;  4MD9 A;  3F3F C;  1IBK C;  3VB9 A;  4JM1 A;  1VQ6 Z;  1AMU A;  3CCJ Z;  3HOV I;  2EGT A;  3CCS 1;  1RLY A;  3IF8 A;  3S17 I;  3GTM S;  3CMA Z;  2OTL Z;  1NJI 2;  3AF6 A;  2I3C A;  1QVG Z;  2NVX I;  1XRB A;  5IT9 f;  2HHH C;  2R92 I;  1VQ6 1;  2PMZ A;  4QTU A;  1S72 Z;  3OW2 Y;  3MON A;  3GTG I;  2J6A A;  4NBH A;  3NYQ A;  1N32 C;  5A2Q f;  1TFI A;  2K3R A;  2WP0 C;  2OOX B;  3RZO I;  1LQL A;  4DV6 C;  1XMQ C;  4B3M C;  3HOU I;  1MD9 A;  1PG3 A;  2OZK A;  4HPV A;  3KXW A;  3H3V J;  1IBM C;  2V8I A;  2QVX X;  4JI0 C;  2WB1 A;  4JI3 C;  3CC2 1;  4IR7 A;  1RY2 A;  4DUZ C;  1WCM I;  1YUA A;  2KI7 B;  3M3Y I;  3PBK A;  2DE6 A;  3Q87 A;  2R93 I;  4CL1 A;  4BSZ A;  1I94 C;  5CM2 M;  4A3E I;  1WH9 A;  4DR2 C;  4ODJ A;  1K8A 2;  2B63 I;  3M4O I;  5K85 A;  3NPD A;  4LFC C;  1RO4 A;  1W2B Y;  3GR0 A;  4MH4 A;  4JI8 C;  5T64 A;  5D1O A;  3C5E A;  1Q86 1;  1VQO 1;  1EGA A;  5IT9 b;  1QVF Z;  2Q51 A;  4E2W A;  1PFT A;  3NH8 A;  4GKJ C;  4RVN A;  2JUB A;  3CCL 1;  1N8R 2;  5H9U A;  3VMI A;  2OTJ Z;  4L2Z A;  2YWB A;  1XRA A;  3K7A I;  4ZLP A;  2V8K A;  1VQM 1;  1Z01 A;  4IZ6 A;  1YJ7 A;  3EED A;  1N33 C;  3EQ6 A;  1VQ5 Z;  3J81 D;  3VTN A;  1YIT Z;  2D28 C;  3MZK B;  5BUS A;  1USP A;  4NBA A;  3T1Y C;  2RT9 A;  4FTF A;  1M1K 1;  5FLX f;  1QYP A;  1ULT A;  2GTI A;  4ISB A;  1X3W A;  1JJ2 Z;  4E30 A;  4EAT A;  1ZB8 A;  5A1I A;  1ZB9 A;  5GTD A;  1VQ9 1;  2P2F A;  1JOS A;  1VQP 1;  1RNI A;  4BC7 A;  2E5L C;  1K9M 1;  4D4I A;  5C4X I;  5T67 A;  3RV2 A;  3TQI A;  3IEV A;  5A2Q D;  4DUY C;  4NB9 A;  1I50 I;  1KC8 1;  3DLP X;  3G6E Z;  3TDH B;  1VQ9 Z;  3L95 X;  1ZH1 A;  4KTT A;  2W03 A;  5BSU A;  2JR6 A;  1KQS Z;  3NI2 A;  4BCA A;  2P20 A;  3J81 b;  3CPW Z;  1S7M A;  3OTO C;  4HH4 A;  3ETO A;  2QEX Z;  4DGL A;  1TWA I;  3I07 A;  2PT7 G;  1K9M 2;  4DV4 C;  2DE5 A;  1Q81 1;  2W04 A;  1MXC A;  4A3J I;  1K0R A;  1K73 2;  3CCU Z;  4LF8 C;  4MXU A;  4E2Y A;  1QF8 A;  4G1I A;  3UZ0 A;  2BJO A;  4D4G A;  2VQE C;  2KZF A;  4MON A;  2G2K A;  4DCT A;  1K8A 1;  3S2D I;  4RMN A;  5C44 I;  4OXI A;  2UXB C;  3HOZ I;  2P3Y A;  1NUI A;  4FUQ A;  3S2H I;  2ASB A;  3VMH A;  4E2Z A;  3S1M I;  1O9T A;  4G37 A;  1NYE A;  1W2B Z;  4R1M A;  3A9V A;  1K73 1;  2QVY X;  1GPM A;  3HKZ A;  5IP7 I;  1O90 A;  5LMU C;  4D57 A;  4NBD A;  1YJW 1;  4BY1 I;  2QR1 B;  3DHV A;  2YWC A;  4DV1 C;  3VMG A;  1VQM Z;  2D1S A;  1QWI A;  3CMA 1;  2WAQ A;  3HOY I;  2DPL A;  3F3P C;  1ML8 A;  1KQS Y;  3FCE A;  3G7S A;  4K0B A;  2H85 A;  4GS5 A;  4X66 C;  2PN2 A;  4XX2 A;  4A3D I;  3TUF A;  1VQ4 1;  3TDE A;  3FQM A;  1WW9 A;  3H0G I;  2AKL A;  3CC4 Z;  5AE2 A;  5C3E I;  3NDI A;  5BUQ A;  3I08 A;  3S1Q I;  4X65 C;  1Z02 A;  4MD7 A;  3GKU A;  1O93 A;  1I3Q I;  3EER A;  1M90 2;  1TWF I;  1Q7Y 1;  2D1R A;  5CZV A;  5KYV A;  4JI1 C;  2QA4 1;  4LF5 C;  1JWH C;  4A3M I;  5LL6 f;  5BST A;  5BSV A;  3GCF A;  3CCM 1;  5T8T A;  4DR3 C;  4DR1 C;  1YJW Z;  3LAX A;  4KTV A;  2OO4 A;  3CD6 Z;  5BR8 C;  4DV3 C;  4RM3 A;  4NBG A;  1HNW C;  3T1H C;  1YJN 1;  4AYB A;  3IFU A;  2UXD C;  4DV2 C;  3CJE A;  4S1T A;  1L2F A;  4JI7 C;  1P9N A;  3A4I A;  2K5R A;  4WV3 A;  3PO3 S;  5D1O B;  4BC9 A;  4RVF A;  4E32 A;  3R9X A;  2OBV A;  4DR5 C;  1DL6 A;  4DV7 C;  1KKG A;  2UU9 C;  1L1O C;  3NH4 A;  3FCC A;  3CC2 Z;  1RQF A;  4NDN A;  1RO0 A;  2JMO A;  2ZM6 C;  4NFR A;  1YIJ 1;  1YI2 1;  2NVQ I;  3IPL A;  2P2J A;  2QEX 1;  3CME 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...