1USPA

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
137
structure length
137
Chain Sequence
NVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPADSTITARVGLQKAGLAFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
total genus 31
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspA02
1L2FA 3HOZI 3GTOI 4DR6C 3HOUI 4NBHA 4X65C 4GKJC 3VMIA 3RZDI 4Y52I 4NXNC 3R9XA 2JS4A 2K5RA 3HOXI 2NVQI 3Q87A 4A3BI 4DCSA 1WW9A 1DL6A 4DUZC 1L1OC 1IBKC 4BSZA 5C4XI 4NBAA 3IEVA 2OPLB 3S16I 2ZM6C 3D6WA 4X66C 4JI8C 2XR1A 1Y1WI 2VUMI 1N2FA 1XNRC 2UU9C 1N36C 2R7ZI 4JI2C 3GTJI 3FKII 1XNQC 1NYEA 1LQLA 4DR4C 3JAMD 4BY7I 3S17I 4JV5C 2R92I 2E8FA 3EERA 3VMHA 2QL8A 2YCBA 2JA5I 4BBRI 1IBLC 1K83I 3J81D 4NXMC 2ATWA 5CM2M 4YY3C 1RLYA 4DR7C 1ML8A 4Y7NI 4YHHC 2VQEC 2PT7G 2NVYI 3PO3S 3M3YI 2JNYA 4DR1C 3GTQI 1KKGA 2EGTA 2DE5A 1K0RA 4DR5C 4DV3C 1FJGC 2JMPA 4NBFA 4A3MI 5LMUC 1USPA 4BBSI 1TFIA 4LFBC 4DV6C 4DV4C 4JI7C 4A3GI 4DV1C 4A3DI 3T1HC 3S2DI 2HF1A 1N33C 3S14I 3S15I 1MKYA 5IWAC 1X3ZA 4NBEA 1Y1VS 3IEUA 1I94C 4A3CI 1SFOI 2B63I 1QYPA 3GCFA 5FLMI 3GKQA 3AF6A 1TWCI 3I4MI 4XX2A 4MTNA 1NUIA 3U50C 1IBMC 3VB9A 4JI6C 3CQZI 1X3WA 2E2JI 2J6AA 3GTGI 2E5LC 3PO3I 3RZOI 3GTPI 5LMNC 2R93I 1QWIA 4AQYC 4A3II 1WF3A 4DV2C 2OPLA 1TWFI 2RBLA 1HNZC 3CJEA 2DE6A 3I07A 3VMGA 1VLAA 4LF4C 4MH4A 2E2II 5BR8C 1YUAA 4NBCA 2UUBC 3H3VJ 3J80D 2E2HI 2UUCC 1HNXC 1TWGI 4LFAC 4JYAC 1Y1VI 2UXDC 4NBBA 1JOSA 4NOZA 5FLXD 2HHHC 5C3EI 4DCUA 1R9TI 4JI0C 4GKKC 2JR6A 4LF6C 3R9WA 3OTOC 2PK7A 2JA6I 3S1QI 4BXXI 1ZB9A 1N34C 3GTKI 2NVXI 4LF8C 4NB8A 4A3FI 2P3YA 2KZFA 2DYJA 1XMOC 4A3EI 3HOYI 2JA8I 2UXCC 3I4NI 1EGAA 4LF9C 2KPIA 4BY1I 4DCTA 2PN2A 4JI3C 1HR0C 3T1YC 4A3JI 5C4JI 4NBGA 1I50I 4NB9A 4DR3C 4B3TC 5A2QD 1TWAI 2CY1A 1RO4A 4JI1C 1PFTA 2F4VC 2ASBA 4K0KC 3M4OI 4QTUA 2E8EA 2F4MA 1UKKA 2UXBC 4JI5C 1ZB8A 3PO2I 3GTLI 3S2HI 1I6HI 4A3LI 3S1MI 4X6AI 4DCVA 2BJOA 3HOVI 1XMQC 4OX9C 5IP7I 3ESWA 3LUSA 5C44I 2UUAC 1TWHI 4B3MC 3HOWI 1HNWC 4DV0C 4DV7C 4NBDA 3GTMI 2NVTI 2ONFA 3H0GI 4A3KI 4QTTA 2DE7A 2E8CA 4X64C 1USPB 4DV5C 1I3QI 3S1NI 4LFCC 2E7GA 4JI4C 5IP9I 4B3RC 4X62C 3S1RI 2D7VA 1WCMI 4A93I 1HH2P 5IT9D 4DUYC 2VQFC 3AF5A 2HJGA 2F4OA 3GTMS 3K7AI 2JA7I 2AKLA 1PA4A 1J5EC 3GKUA 4B3SC 2YU9I 4LF7C 2CXCA 4KHPC 1WH9A 1N32C 4LF5C 4DR2C
chains in the Genus database with same CATH superfamily
2M6NA 5IFIA 1L2FA 3HOZI 3GTOI 4DR6C 2VPWA 5A19A 3CQ3A 4E33A 4NBHA 3HOUI 4X65C 4GKJC 3VMIA 3RZDI 2PM9A 4Y52I 4NXNC 1Q16A 3R9XA 1KQSZ 2OTLZ 1VQ91 2JS4A 2OOYB 2K5RA 3HOXI 1O92A 2QVXX 3GPCA 1M6XA 3CC71 2NVQI 3Q87A 4A3BI 3IF8A 3SO4A 3UEBA 4DCSA 4MD9A 1WW9A 1DL6A 4RM2A 4DUZC 1L1OC 1IBKC 2YX1A 3MZLB 2Y27A 4BSZA 2W03A 5C4XI 4OYCA 4NBAA 3CCSZ 1YHQZ 3L95X 3IEVA 2OPLB 1V26A 4RV9A 3S16I 4HH4A 5T64A 2ZM6C 1P4EA 3D6WA 3CCL1 5T8SA 4X66C 4JI8C 4NFRA 1Y1WI 2XR1A 3VNRA 2VUMI 1N2FA 1XNRC 5AN9F 2UU9C 4WS9A 1N36C 2R7ZI 3LAXA 3J80b 1MDBA 1VQK1 1N8R2 1VQ51 1YIT1 4L4QA 2GU2A 3NH4A 1BA3A 4BC9A 1FUGA 4JI2C 1M1K1 3GTJI 1LCIA 2W04A 3FKII 1VQN1 1XNQC 2Q4ZA 3CCEZ 3CMEZ 1YIJZ 4ZLPA 1AA6A 2R6MA 3P5JB 3F3FC 3OW2Y 2P2JA 1K9M1 1NYEA 2M5HA 3CCR1 1LQLA 4DR4C 1Q7Y1 3JAMD 4I9FA 5A2Qf 3L8CA 4BY7I 3NYRA 2KZ0A 2M48A 4KTTA 3S17I 1Q811 4JV5C 2DHMA 3PBKA 2R92I 2CU6A 4E2XA 2E8FA 3NPDA 2V3VA 3EERA 3VMHA 5LCIA 3A26A 3CCQ1 2QL8A 2JUBA 2NCLA 3NFZA 3CMAZ 5BSVA 2YCBA 3TDHB 3E7WA 2JA5I 3CPWY 2QVYX 3A25A 4BBRI 1IBLC 3O2EA 1GPMA 1K83I 1YJN1 1VQ9Z 1VQ61 1MXAA 3A4IA 5CZVA 3IR7A 4OXIA 4RVFA 3J81D 4NXMC 3BG1B 1JJ2Y 2ATWA 1YI2Z 5CM2M 3IX0A 2OTL1 4YY3C 4BCAA 1KD12 1RLYA 2RHBA 5BSTA 5KEIA 2OOXB 4DQYB 5IT9b 4IR7A 1T5HX 1K732 4DR7C 1ML8A 4FUTA 4Y7NI 2YWBA 3CCLZ 3FCEA 1Q822 4YHHC 2VQEC 2PT7G 2NVYI 3CCV1 3PO3S 3M3YI 4DG9A 3UX3A 2JNYA 2V45A 2DPLA 1RY2A 4DR1C 3GTQI 1KKGA 4S1TA 1PU1A 2EGTA 2DE5A 2HU9A 2QREB 1K0RA 1VQKZ 1VQ5Z 1YITZ 4DV3C 4DR5C 1FJGC 2QRCB 1PG4A 2JMPA 4NBFA 5T67A 3JAMf 3J7A4 4A3MI 2GTHA 2K3RA 5LMUC 1QVGY 3S82A 4E32A 1VQM1 3D9XA 1USPA 3CCRZ 3RV2A 4BBSI 4ISBA 1K8A1 2JNVA 1YIJ1 1QVFY 1TFIA 5D1OA 4PROC 4LFBC 4DV6C 3CW8X 1PG3A 4DV4C 5D1PA 1YJ9Z 4JI7C 4A3GI 4ZJZA 4A3DI 4DV1C 3FQMA 1MXBA 3BG0B 3T1HC 3S2DI 1AMUA 2HF1A 1N33C 3IFUA 3S14I 3S15I 1MKYA 5IWAC 1X3ZA 1YJNZ 4NBEA 1VQ6Z 3IPLA 5BURA 1Y1VS 3DHVA 1Q861 2JIRA 3CMA1 3IEUA 3C5EA 4DGLA 1X0TA 3LNOA 1VEHA 4RVNA 1VQOZ 2E7ZA 1I94C 1YI21 1QXFA 2QW0X 1O90A 4A3CI 3LGXA 1SFOI 2B63I 1QYPA 3GCFA 1NY8A 5FLMI 3GKQA 3AF6A 3FQQA 1YJ7A 4MONA 1TWCI 3CCVZ 3VNQA 1M1K2 3I4MI 2MM9A 3TE5B 5IT9f 2VPXA 4XX2A 3CXCZ 1VQL1 2OTJZ 5AE1A 4MTNA 2JIQA 2KI7B 1KQSY 1NJI1 1NUIA 3E7XA 1K9M2 3JAMb 1XRBA 1O93A 1Q7Y2 2JIPA 3DLPX 3U50C 4NH1C 3FCCA 2LEXA 5H9UA 1IBMC 3VB9A 1Q812 1YJW1 3A9UA 4JI6C 3CQZI 1X3WA 1VQMZ 5BSWA 4R1MA 3TQIA 2E2JI 3TUFA 2J6AA 3GTGI 2E5LC 3PO3I 3RZOI 3TR3A 2LFUA 1TH5A 3GTPI 5LMNC 3CXCY 4CL1A 2R93I 4TPSB 2ZZNA 1QWIA 4AQYC 3NYQA 4A3II 2P2MA 1WF3A 4DV2C 3G4S1 4G36A 2OPLA 2BH1X 2O53A 4DK1A 1S7MA 2WP0C 3PROC 4HPVA 1TWFI 2RBLA 1HNZC 4AYBA 3CJEA 2JIOA 4NDNA 1M901 1NP6A 3NH5A 2AYAA 1M6XC 1WZNA 1YUKA 2DE6A 4L7IA 1YJ91 2VF1A 1RO0A 3I07A 3VMGA 5A1GA 1VLAA 2RPRA 2WAQA 4LF4C 4MH4A 4L2ZA 3TDEA 4BC7A 5AE3A 2E2II 5BR8C 3K6RA 1YUAA 2D1TA 4NBCA 3I551 1KC81 1XRAA 2MCQA 4I9GA 4TNUA 3MZKB 1W2BZ 2E9HA 4PUGA 1Z03A 3KIHA 3G7SA 5T8TA 1MXCA 2PROA 4K0BA 2UUBC 4ODJA 4LE5A 3H3VJ 2RIQA 2E2HI 4G37A 5KYTA 3J80D 1HNXC 2UUCC 3G6EZ 1VQO1 3EEDA 1TWGI 4D4GA 4LFAC 4E2YA 3N54B 5BUSA 4RVOA 1VQ71 4JYAC 3KXWA 1Y1VI 3I561 2UXDC 4NBBA 2D1SA 1WJ2A 1VQLZ 2O4HA 3QWUA 4RLFA 1JOSA 4NOZA 5FLXD 2HHHC 5C3EI 1QM4A 4DCUA 3CQ2A 1R9TI 2V8JA 4RMNA 4PUIA 3I08A 1K8A2 4JI0C 2OTJ1 4GKKC 2JR6A 4LF6C 1RG9A 3R9WA 3NH8A 3OTOC 4RM3A 1YJWZ 2PK7A 2JA6I 4GXRA 2V7BA 2PMZA 1ULTA 3S1QI 4EWCA 4BXXI 1ZB9A 4DR2C 1N34C 2P2QA 3GTKI 2NVXI 3CCMZ 3CD61 2V8KA 2P20A 1FDOA 3G4SZ 1XS3A 4NB8A 4LF8C 1Q862 3CQ1A 4EATA 2ZZMA 4MD7A 4A3FI 2OBVA 2P3YA 2QR1B 2KZFA 3PESA 2DYJA 3ETCA 2QRDB 2I3CA 2D28C 1XMOC 4A3EI 3HOYI 1QF8A 2OZKA 2VPYA 3D2LA 2JA8I 1IB8A 1XRCA 3J81f 4G1IA 5AE2A 2UXCC 3I4NI 4GXQA 4JM1A 3NDJA 5K85A 1EGAA 1T5DX 4KTVA 4PUHA 5BSMA 2KPIA 3RG2A 2GTIA 2IZ3A 4BY1I 4LF9C 2Y0SA 4E30A 3I55Z 4DCTA 2V8IA 2QKDA 1V60A 1ZH1A 3CCU1 2PN2A 1Z02A 4JI3C 1MDFA 2QA4Z 2M5OA 1HR0C 2NAPA 3T1YC 4A3JI 5C4JI 1VQP1 4NBGA 2JMOA 1NJI2 1O9TA 3NI2A 2QLVB 3F3PC 1I50I 4RVDA 2Y4OA 1VQ7Z 5K8FA 4NB9A 3I56Z 4IZ6A 4RS4A 4U5YD 3G6E1 5T6BA 2P02A 4DR3C 4B3TC 5A2QD 1TWAI 5A1IA 2P2FA 2CY1A 4E2ZA 3A9VA 3MONA 1RO4A 3EQ6A 4JI1C 1PFTA 5GTDA 1VQ8Z 2F4VC 2ASBA 1UWDA 4R1LA 2OO4A 3UZ0A 4K0KC 2P28A 1VQ4Z 3M4OI 3DAYA 4QTUA 1Y8CA 2E8EA 4MXUA 5LL6f 4E31A 1M902 2P2BA 2F4MA 4R0MA 1UKKA 3CD6Z 4JI5C 2UXBC 2QEX1 4D57A 4RVGA 3OW2Z 3G711 4BBYA 1JWHC 1ZB8A 4RVHA 2JIMA 3PO2I 3CCM1 1RQFA 2MMAB 3R44A 3GTLI 3KIFA 2VPZA 1KC82 1I6HI 3CC21 3T4NB 3J81b 3S2HI 4A3LI 3AY0A 3S1MI 4X6AI 4DCVA 3CC41 2BJOA 1WIIA 3HOVI 2LIYA 1XMQC 3UOWA 4OX9C 3HKZA 2D1QA 5IP7I 5DV9A 1Z01A 2YWCA 1WCJA 3ESWA 3ETOA 3CPWZ 3LUSA 3CCUZ 2IV2X 4HGZA 5BSUA 2WB1A 2E0GA 3LNVA 3CW9A 5C44I 5FLXb 1VQPZ 2UUAC 1JJ2Z 2G2KA 3H2TA 1P4EC 1TWHI 4B3MC 3CCJ1 1FDIA 3HOWI 5CZXA 5JRHA 1V25A 1HNWC 4E2WA 2QA41 2AYDA 2Z51A 1N8R1 1RO2A 2YADA 1S721 2VZEA 1P9NA 3IMLA 5KYVA 4DV0C 4DV7C 5E7QA 4NBDA 2D1RA 4HGYA 3GTMI 3B7WA 4MD8A 5BSRA 2NVTI 4PHTA 3VTNA 3VNSA 2ONFA 3CC7Z 1W2BY 3H0GI 4GS5A 4A3KI 4QTTA 1RNIA 2DE7A 1XHJA 2E8CA 3GR1A 1VQ81 4X64C 1FLOA 1USPB 1VQ41 2QEXZ 4DV5C 4FTFA 2D27A 1I3QI 3G71Z 5D1OB 1QVGZ 3S1NI 4DG8A 4LFCC 3CCS1 1YHQ1 2E7GA 4PZPA 2ZAEB 3CC2Z 1QVFZ 2H85A 4JI4C 5IP9I 3CC4Z 2Q51A 4B3RC 4FUQA 2QVZX 1KD11 4X62C 4D56A 3S1RI 1P7LA 3NDIA 2VUGA 2D7VA 2WD9A 1WCMI 4MRIA 4A93I 1K731 1HH2P 4WV3A 4DUYC 2VQFC 1VQNZ 3AF5A 5IT9D 2HJGA 1Q821 2VSQA 2F4OA 3GTMS 1KRLA 3J80f 3K7AI 2JA7I 2AKLA 1PA4A 1J5EC 5A2Qb 3GKUA 4B3SC 1MD9A 3CCJZ 3CCE1 3CME1 2YU9I 3GR0A 1SIWA 4RLQA 4LF7C 3N2QA 3UX2A 2IZ4A 2CXCA 4D4IA 1S72Z 4KHPC 5ADZA 2KDNA 2RT9A 5FLXf 1WH9A 2Y4NA 1N32C 5BUQA 4LF5C 3CCQZ
chains in the Genus database with same CATH topology
2M6NA 5IFIA 1L2FA 3HOZI 3GTOI 4DR6C 5A19A 4E33A 4NBHA 3HOUI 4X65C 4GKJC 3VMIA 3RZDI 2PM9A 4Y52I 4NXNC 3R9XA 1KQSZ 2OTLZ 1VQ91 2JS4A 2OOYB 2K5RA 3HOXI 1O92A 2QVXX 3GPCA 3CC71 2NVQI 3Q87A 4A3BI 3IF8A 3SO4A 4DCSA 4MD9A 1WW9A 1DL6A 4RM2A 4DUZC 1L1OC 1IBKC 3MZLB 2Y27A 4BSZA 2W03A 5C4XI 4OYCA 4NBAA 3CCSZ 1YHQZ 3L95X 3IEVA 2OPLB 1V26A 4RV9A 3S16I 4HH4A 5T64A 2ZM6C 3D6WA 3CCL1 5T8SA 4X66C 4JI8C 4NFRA 1Y1WI 2XR1A 3VNRA 2VUMI 1N2FA 1XNRC 5AN9F 2UU9C 4WS9A 1N36C 2R7ZI 3LAXA 3J80b 1MDBA 1VQK1 1N8R2 1VQ51 1YIT1 4L4QA 2GU2A 3NH4A 1BA3A 4BC9A 1FUGA 4JI2C 1M1K1 3GTJI 1LCIA 2W04A 3FKII 1VQN1 1XNQC 2Q4ZA 3CCEZ 3CMEZ 1YIJZ 4ZLPA 2R6MA 3P5JB 3F3FC 3OW2Y 2P2JA 1K9M1 1NYEA 3CCR1 1LQLA 4DR4C 1Q7Y1 3JAMD 4I9FA 5A2Qf 3L8CA 4BY7I 3NYRA 2M48A 4KTTA 3S17I 1Q811 4JV5C 3PBKA 2R92I 4E2XA 2E8FA 3NPDA 3EERA 3VMHA 3CCQ1 2QL8A 2JUBA 5BSVA 3NFZA 3CMAZ 2YCBA 3TDHB 3E7WA 2JA5I 3CPWY 2QVYX 4BBRI 1IBLC 1GPMA 1K83I 1YJN1 1VQ9Z 1VQ61 1MXAA 3A4IA 5CZVA 4OXIA 4RVFA 3J81D 4NXMC 3BG1B 1JJ2Y 2ATWA 1YI2Z 5CM2M 3IX0A 2OTL1 4YY3C 4BCAA 1KD12 1RLYA 2RHBA 5BSTA 5KEIA 2OOXB 4DQYB 5IT9b 4IR7A 1T5HX 1K732 4DR7C 1ML8A 4FUTA 4Y7NI 2YWBA 3CCLZ 3FCEA 1Q822 4YHHC 2VQEC 2PT7G 2NVYI 3CCV1 3PO3S 3M3YI 4DG9A 2JNYA 2DPLA 1RY2A 4DR1C 3GTQI 1KKGA 4S1TA 2EGTA 2DE5A 2HU9A 2QREB 1K0RA 1VQKZ 1VQ5Z 1YITZ 4DV3C 4DR5C 1FJGC 2QRCB 1PG4A 2JMPA 4NBFA 5T67A 3JAMf 3J7A4 4A3MI 2GTHA 2K3RA 5LMUC 1QVGY 3S82A 4E32A 1VQM1 3D9XA 1USPA 3CCRZ 3RV2A 4BBSI 4ISBA 1K8A1 1YIJ1 1QVFY 1TFIA 5D1OA 4PROC 4LFBC 4DV6C 3CW8X 1PG3A 4DV4C 5D1PA 1YJ9Z 4JI7C 4A3GI 4ZJZA 4A3DI 4DV1C 3FQMA 1MXBA 3BG0B 3T1HC 3S2DI 1AMUA 2HF1A 1N33C 3IFUA 3S14I 3S15I 1MKYA 5IWAC 1X3ZA 1YJNZ 4NBEA 1VQ6Z 3IPLA 5BURA 1Y1VS 3DHVA 1Q861 3CMA1 3IEUA 3C5EA 4DGLA 1X0TA 4RVNA 1VQOZ 1I94C 1YI21 2QW0X 1O90A 4A3CI 3LGXA 1SFOI 2B63I 1QYPA 3GCFA 5FLMI 3GKQA 3AF6A 3FQQA 1YJ7A 4MONA 1TWCI 3CCVZ 3VNQA 1M1K2 3I4MI 3TE5B 5IT9f 4XX2A 3CXCZ 1VQL1 2OTJZ 5AE1A 4MTNA 2KI7B 1KQSY 1NJI1 1NUIA 3E7XA 1K9M2 3JAMb 1XRBA 1O93A 1Q7Y2 3DLPX 3U50C 4NH1C 3FCCA 1IBMC 5H9UA 3VB9A 1Q812 1YJW1 3A9UA 4JI6C 3CQZI 1X3WA 1VQMZ 5BSWA 4R1MA 3TQIA 2E2JI 3TUFA 2J6AA 3GTGI 2E5LC 3PO3I 3RZOI 2LFUA 3GTPI 5LMNC 3CXCY 4CL1A 2R93I 4TPSB 1QWIA 4AQYC 3NYQA 4A3II 2P2MA 1WF3A 4DV2C 3G4S1 4G36A 2OPLA 2BH1X 2O53A 4DK1A 1S7MA 2WP0C 3PROC 4HPVA 1TWFI 2RBLA 1HNZC 4AYBA 3CJEA 4NDNA 1M901 1NP6A 3NH5A 2AYAA 1YUKA 2DE6A 4L7IA 1YJ91 2VF1A 1RO0A 3I07A 3VMGA 5A1GA 1VLAA 2RPRA 2WAQA 4LF4C 4MH4A 4L2ZA 3TDEA 4BC7A 5AE3A 2E2II 5BR8C 1YUAA 2D1TA 4NBCA 3I551 1KC81 1XRAA 4I9GA 4TNUA 3MZKB 1W2BZ 2E9HA 1Z03A 3KIHA 3G7SA 5T8TA 1MXCA 2PROA 4K0BA 2UUBC 4ODJA 4LE5A 3H3VJ 2RIQA 2E2HI 4G37A 5KYTA 3J80D 1HNXC 2UUCC 3G6EZ 1VQO1 3EEDA 1TWGI 4D4GA 4LFAC 4E2YA 3N54B 5BUSA 4RVOA 1VQ71 4JYAC 3KXWA 1Y1VI 3I561 2UXDC 4NBBA 2D1SA 1VQLZ 2O4HA 3QWUA 4RLFA 1JOSA 4NOZA 5FLXD 2HHHC 5C3EI 1QM4A 4DCUA 1R9TI 2V8JA 4RMNA 3I08A 1K8A2 4JI0C 2OTJ1 4GKKC 2JR6A 4LF6C 1RG9A 3R9WA 3NH8A 3OTOC 4RM3A 1YJWZ 2PK7A 2JA6I 4GXRA 2V7BA 2PMZA 1ULTA 3S1QI 4EWCA 4BXXI 1ZB9A 4DR2C 1N34C 2P2QA 3GTKI 2NVXI 3CCMZ 3CD61 2V8KA 2P20A 3G4SZ 4LF8C 4NB8A 1Q862 4EATA 4MD7A 4A3FI 2OBVA 2P3YA 2QR1B 2KZFA 3PESA 2DYJA 3ETCA 2QRDB 2I3CA 2D28C 1XMOC 4A3EI 3HOYI 1QF8A 2OZKA 2JA8I 1XRCA 3J81f 4G1IA 5AE2A 2UXCC 3I4NI 4GXQA 4JM1A 3NDJA 5K85A 1EGAA 1T5DX 4KTVA 5BSMA 4LF9C 2KPIA 3RG2A 2GTIA 2IZ3A 4BY1I 2Y0SA 4E30A 3I55Z 4DCTA 2V8IA 2QKDA 1ZH1A 3CCU1 2PN2A 1Z02A 4JI3C 1MDFA 2QA4Z 1HR0C 3T1YC 4A3JI 5C4JI 1VQP1 4NBGA 2JMOA 1NJI2 1O9TA 3NI2A 2QLVB 3F3PC 1I50I 4RVDA 2Y4OA 1VQ7Z 5K8FA 4NB9A 3I56Z 4IZ6A 4RS4A 4U5YD 3G6E1 5T6BA 2P02A 4DR3C 4B3TC 5A2QD 1TWAI 5A1IA 2P2FA 2CY1A 4E2ZA 3A9VA 3MONA 1RO4A 3EQ6A 4JI1C 1PFTA 5GTDA 1VQ8Z 2F4VC 2ASBA 4R1LA 2OO4A 3UZ0A 4K0KC 2P28A 1VQ4Z 3M4OI 3DAYA 4QTUA 2E8EA 4MXUA 5LL6f 4E31A 1M902 2P2BA 2F4MA 4R0MA 1UKKA 3CD6Z 4JI5C 2UXBC 2QEX1 4D57A 4RVGA 3OW2Z 3G711 4BBYA 1JWHC 1ZB8A 4RVHA 3PO2I 3CCM1 1RQFA 3R44A 3GTLI 3KIFA 1KC82 3S2HI 1I6HI 3CC21 3T4NB 3J81b 4A3LI 3S1MI 4X6AI 4DCVA 3CC41 2BJOA 1WIIA 3HOVI 2LIYA 1XMQC 3UOWA 4OX9C 3HKZA 2D1QA 5IP7I 5DV9A 1Z01A 2YWCA 3ESWA 3ETOA 3CPWZ 3LUSA 3CCUZ 4HGZA 5BSUA 2WB1A 2E0GA 3LNVA 3CW9A 5C44I 5FLXb 1VQPZ 2UUAC 1JJ2Z 2G2KA 3H2TA 1TWHI 4B3MC 3CCJ1 3HOWI 5CZXA 5JRHA 1HNWC 1V25A 4E2WA 2QA41 1N8R1 1RO2A 2YADA 1S721 2VZEA 1P9NA 3IMLA 5KYVA 4DV0C 4DV7C 5E7QA 4NBDA 2D1RA 4HGYA 3GTMI 3B7WA 4MD8A 5BSRA 2NVTI 4PHTA 3VTNA 3VNSA 2ONFA 3CC7Z 1W2BY 3H0GI 4GS5A 4A3KI 4QTTA 1RNIA 2DE7A 2E8CA 3GR1A 1VQ81 4X64C 1USPB 1VQ41 2QEXZ 4DV5C 4FTFA 2D27A 1I3QI 3G71Z 5D1OB 1QVGZ 3S1NI 4DG8A 4LFCC 3CCS1 1YHQ1 2E7GA 4PZPA 2ZAEB 3CC2Z 1QVFZ 2H85A 4JI4C 5IP9I 3CC4Z 2Q51A 4B3RC 4FUQA 2QVZX 1KD11 4X62C 4D56A 3S1RI 1P7LA 3NDIA 2VUGA 2D7VA 2WD9A 1WCMI 4MRIA 4A93I 1K731 1HH2P 4WV3A 4DUYC 2VQFC 1VQNZ 3AF5A 5IT9D 2HJGA 1Q821 2VSQA 2F4OA 3GTMS 1KRLA 3J80f 3K7AI 2JA7I 2AKLA 1PA4A 1J5EC 5A2Qb 3GKUA 4B3SC 1MD9A 3CCJZ 3CCE1 3CME1 2YU9I 3GR0A 4RLQA 4LF7C 3N2QA 2IZ4A 2CXCA 4D4IA 1S72Z 4KHPC 5ADZA 2RT9A 5FLXf 1WH9A 2Y4NA 1N32C 5BUQA 4LF5C 3CCQZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2F A;  3HOZ I;  3GTO I;  4DR6 C;  3HOU I;  4NBH A;  4X65 C;  4GKJ C;  3VMI A;  3RZD I;  4Y52 I;  4NXN C;  3R9X A;  2JS4 A;  2K5R A;  3HOX I;  2NVQ I;  3Q87 A;  4A3B I;  4DCS A;  1WW9 A;  1DL6 A;  4DUZ C;  1L1O C;  1IBK C;  4BSZ A;  5C4X I;  4NBA A;  3IEV A;  2OPL B;  3S16 I;  2ZM6 C;  3D6W A;  4X66 C;  4JI8 C;  2XR1 A;  1Y1W I;  2VUM I;  1N2F A;  1XNR C;  2UU9 C;  1N36 C;  2R7Z I;  4JI2 C;  3GTJ I;  3FKI I;  1XNQ C;  1NYE A;  1LQL A;  4DR4 C;  3JAM D;  4BY7 I;  3S17 I;  4JV5 C;  2R92 I;  2E8F A;  3EER A;  3VMH A;  2QL8 A;  2YCB A;  2JA5 I;  4BBR I;  1IBL C;  1K83 I;  3J81 D;  4NXM C;  2ATW A;  5CM2 M;  4YY3 C;  1RLY A;  4DR7 C;  1ML8 A;  4Y7N I;  4YHH C;  2VQE C;  2PT7 G;  2NVY I;  3PO3 S;  3M3Y I;  2JNY A;  4DR1 C;  3GTQ I;  1KKG A;  2EGT A;  2DE5 A;  1K0R A;  4DR5 C;  4DV3 C;  1FJG C;  2JMP A;  4NBF A;  4A3M I;  5LMU C;  1USP A;  4BBS I;  1TFI A;  4LFB C;  4DV6 C;  4DV4 C;  4JI7 C;  4A3G I;  4DV1 C;  4A3D I;  3T1H C;  3S2D I;  2HF1 A;  1N33 C;  3S14 I;  3S15 I;  1MKY A;  5IWA C;  1X3Z A;  4NBE A;  1Y1V S;  3IEU A;  1I94 C;  4A3C I;  1SFO I;  2B63 I;  1QYP A;  3GCF A;  5FLM I;  3GKQ A;  3AF6 A;  1TWC I;  3I4M I;  4XX2 A;  4MTN A;  1NUI A;  3U50 C;  1IBM C;  3VB9 A;  4JI6 C;  3CQZ I;  1X3W A;  2E2J I;  2J6A A;  3GTG I;  2E5L C;  3PO3 I;  3RZO I;  3GTP I;  5LMN C;  2R93 I;  1QWI A;  4AQY C;  4A3I I;  1WF3 A;  4DV2 C;  2OPL A;  1TWF I;  2RBL A;  1HNZ C;  3CJE A;  2DE6 A;  3I07 A;  3VMG A;  1VLA A;  4LF4 C;  4MH4 A;  2E2I I;  5BR8 C;  1YUA A;  4NBC A;  2UUB C;  3H3V J;  3J80 D;  2E2H I;  2UUC C;  1HNX C;  1TWG I;  4LFA C;  4JYA C;  1Y1V I;  2UXD C;  4NBB A;  1JOS A;  4NOZ A;  5FLX D;  2HHH C;  5C3E I;  4DCU A;  1R9T I;  4JI0 C;  4GKK C;  2JR6 A;  4LF6 C;  3R9W A;  3OTO C;  2PK7 A;  2JA6 I;  3S1Q I;  4BXX I;  1ZB9 A;  1N34 C;  3GTK I;  2NVX I;  4LF8 C;  4NB8 A;  4A3F I;  2P3Y A;  2KZF A;  2DYJ A;  1XMO C;  4A3E I;  3HOY I;  2JA8 I;  2UXC C;  3I4N I;  1EGA A;  4LF9 C;  2KPI A;  4BY1 I;  4DCT A;  2PN2 A;  4JI3 C;  1HR0 C;  3T1Y C;  4A3J I;  5C4J I;  4NBG A;  1I50 I;  4NB9 A;  4DR3 C;  4B3T C;  5A2Q D;  1TWA I;  2CY1 A;  1RO4 A;  4JI1 C;  1PFT A;  2F4V C;  2ASB A;  4K0K C;  3M4O I;  4QTU A;  2E8E A;  2F4M A;  1UKK A;  2UXB C;  4JI5 C;  1ZB8 A;  3PO2 I;  3GTL I;  3S2H I;  1I6H I;  4A3L I;  3S1M I;  4X6A I;  4DCV A;  2BJO A;  3HOV I;  1XMQ C;  4OX9 C;  5IP7 I;  3ESW A;  3LUS A;  5C44 I;  2UUA C;  1TWH I;  4B3M C;  3HOW I;  1HNW C;  4DV0 C;  4DV7 C;  4NBD A;  3GTM I;  2NVT I;  2ONF A;  3H0G I;  4A3K I;  4QTT A;  2DE7 A;  2E8C A;  4X64 C;  1USP B;  4DV5 C;  1I3Q I;  3S1N I;  4LFC C;  2E7G A;  4JI4 C;  5IP9 I;  4B3R C;  4X62 C;  3S1R I;  2D7V A;  1WCM I;  4A93 I;  1HH2 P;  5IT9 D;  4DUY C;  2VQF C;  3AF5 A;  2HJG A;  2F4O A;  3GTM S;  3K7A I;  2JA7 I;  2AKL A;  1PA4 A;  1J5E C;  3GKU A;  4B3S C;  2YU9 I;  4LF7 C;  2CXC A;  4KHP C;  1WH9 A;  1N32 C;  4LF5 C;  4DR2 C; 
#chains in the Genus database with same CATH topology
 2M6N A;  5IFI A;  1L2F A;  3HOZ I;  3GTO I;  4DR6 C;  2VPW A;  5A19 A;  3CQ3 A;  4E33 A;  4NBH A;  3HOU I;  4X65 C;  4GKJ C;  3VMI A;  3RZD I;  2PM9 A;  4Y52 I;  4NXN C;  1Q16 A;  3R9X A;  1KQS Z;  2OTL Z;  1VQ9 1;  2JS4 A;  2OOY B;  2K5R A;  3HOX I;  1O92 A;  2QVX X;  3GPC A;  1M6X A;  3CC7 1;  2NVQ I;  3Q87 A;  4A3B I;  3IF8 A;  3SO4 A;  3UEB A;  4DCS A;  4MD9 A;  1WW9 A;  1DL6 A;  4RM2 A;  4DUZ C;  1L1O C;  1IBK C;  2YX1 A;  3MZL B;  2Y27 A;  4BSZ A;  2W03 A;  5C4X I;  4OYC A;  4NBA A;  3CCS Z;  1YHQ Z;  3L95 X;  3IEV A;  2OPL B;  1V26 A;  4RV9 A;  3S16 I;  4HH4 A;  5T64 A;  2ZM6 C;  1P4E A;  3D6W A;  3CCL 1;  5T8S A;  4X66 C;  4JI8 C;  4NFR A;  1Y1W I;  2XR1 A;  3VNR A;  2VUM I;  1N2F A;  1XNR C;  5AN9 F;  2UU9 C;  4WS9 A;  1N36 C;  2R7Z I;  3LAX A;  3J80 b;  1MDB A;  1VQK 1;  1N8R 2;  1VQ5 1;  1YIT 1;  4L4Q A;  2GU2 A;  3NH4 A;  1BA3 A;  4BC9 A;  1FUG A;  4JI2 C;  1M1K 1;  3GTJ I;  1LCI A;  2W04 A;  3FKI I;  1VQN 1;  1XNQ C;  2Q4Z A;  3CCE Z;  3CME Z;  1YIJ Z;  4ZLP A;  1AA6 A;  2R6M A;  3P5J B;  3F3F C;  3OW2 Y;  2P2J A;  1K9M 1;  1NYE A;  2M5H A;  3CCR 1;  1LQL A;  4DR4 C;  1Q7Y 1;  3JAM D;  4I9F A;  5A2Q f;  3L8C A;  4BY7 I;  3NYR A;  2KZ0 A;  2M48 A;  4KTT A;  3S17 I;  1Q81 1;  4JV5 C;  2DHM A;  3PBK A;  2R92 I;  2CU6 A;  4E2X A;  2E8F A;  3NPD A;  2V3V A;  3EER A;  3VMH A;  5LCI A;  3A26 A;  3CCQ 1;  2QL8 A;  2JUB A;  2NCL A;  3NFZ A;  3CMA Z;  5BSV A;  2YCB A;  3TDH B;  3E7W A;  2JA5 I;  3CPW Y;  2QVY X;  3A25 A;  4BBR I;  1IBL C;  3O2E A;  1GPM A;  1K83 I;  1YJN 1;  1VQ9 Z;  1VQ6 1;  1MXA A;  3A4I A;  5CZV A;  3IR7 A;  4OXI A;  4RVF A;  3J81 D;  4NXM C;  3BG1 B;  1JJ2 Y;  2ATW A;  1YI2 Z;  5CM2 M;  3IX0 A;  2OTL 1;  4YY3 C;  4BCA A;  1KD1 2;  1RLY A;  2RHB A;  5BST A;  5KEI A;  2OOX B;  4DQY B;  5IT9 b;  4IR7 A;  1T5H X;  1K73 2;  4DR7 C;  1ML8 A;  4FUT A;  4Y7N I;  2YWB A;  3CCL Z;  3FCE A;  1Q82 2;  4YHH C;  2VQE C;  2PT7 G;  2NVY I;  3CCV 1;  3PO3 S;  3M3Y I;  4DG9 A;  3UX3 A;  2JNY A;  2V45 A;  2DPL A;  1RY2 A;  4DR1 C;  3GTQ I;  1KKG A;  4S1T A;  1PU1 A;  2EGT A;  2DE5 A;  2HU9 A;  2QRE B;  1K0R A;  1VQK Z;  1VQ5 Z;  1YIT Z;  4DV3 C;  4DR5 C;  1FJG C;  2QRC B;  1PG4 A;  2JMP A;  4NBF A;  5T67 A;  3JAM f;  3J7A 4;  4A3M I;  2GTH A;  2K3R A;  5LMU C;  1QVG Y;  3S82 A;  4E32 A;  1VQM 1;  3D9X A;  1USP A;  3CCR Z;  3RV2 A;  4BBS I;  4ISB A;  1K8A 1;  2JNV A;  1YIJ 1;  1QVF Y;  1TFI A;  5D1O A;  4PRO C;  4LFB C;  4DV6 C;  3CW8 X;  1PG3 A;  4DV4 C;  5D1P A;  1YJ9 Z;  4JI7 C;  4A3G I;  4ZJZ A;  4A3D I;  4DV1 C;  3FQM A;  1MXB A;  3BG0 B;  3T1H C;  3S2D I;  1AMU A;  2HF1 A;  1N33 C;  3IFU A;  3S14 I;  3S15 I;  1MKY A;  5IWA C;  1X3Z A;  1YJN Z;  4NBE A;  1VQ6 Z;  3IPL A;  5BUR A;  1Y1V S;  3DHV A;  1Q86 1;  2JIR A;  3CMA 1;  3IEU A;  3C5E A;  4DGL A;  1X0T A;  3LNO A;  1VEH A;  4RVN A;  1VQO Z;  2E7Z A;  1I94 C;  1YI2 1;  1QXF A;  2QW0 X;  1O90 A;  4A3C I;  3LGX A;  1SFO I;  2B63 I;  1QYP A;  3GCF A;  1NY8 A;  5FLM I;  3GKQ A;  3AF6 A;  3FQQ A;  1YJ7 A;  4MON A;  1TWC I;  3CCV Z;  3VNQ A;  1M1K 2;  3I4M I;  2MM9 A;  3TE5 B;  5IT9 f;  2VPX A;  4XX2 A;  3CXC Z;  1VQL 1;  2OTJ Z;  5AE1 A;  4MTN A;  2JIQ A;  2KI7 B;  1KQS Y;  1NJI 1;  1NUI A;  3E7X A;  1K9M 2;  3JAM b;  1XRB A;  1O93 A;  1Q7Y 2;  2JIP A;  3DLP X;  3U50 C;  4NH1 C;  3FCC A;  2LEX A;  5H9U A;  1IBM C;  3VB9 A;  1Q81 2;  1YJW 1;  3A9U A;  4JI6 C;  3CQZ I;  1X3W A;  1VQM Z;  5BSW A;  4R1M A;  3TQI A;  2E2J I;  3TUF A;  2J6A A;  3GTG I;  2E5L C;  3PO3 I;  3RZO I;  3TR3 A;  2LFU A;  1TH5 A;  3GTP I;  5LMN C;  3CXC Y;  4CL1 A;  2R93 I;  4TPS B;  2ZZN A;  1QWI A;  4AQY C;  3NYQ A;  4A3I I;  2P2M A;  1WF3 A;  4DV2 C;  3G4S 1;  4G36 A;  2OPL A;  2BH1 X;  2O53 A;  4DK1 A;  1S7M A;  2WP0 C;  3PRO C;  4HPV A;  1TWF I;  2RBL A;  1HNZ C;  4AYB A;  3CJE A;  2JIO A;  4NDN A;  1M90 1;  1NP6 A;  3NH5 A;  2AYA A;  1M6X C;  1WZN A;  1YUK A;  2DE6 A;  4L7I A;  1YJ9 1;  2VF1 A;  1RO0 A;  3I07 A;  3VMG A;  5A1G A;  1VLA A;  2RPR A;  2WAQ A;  4LF4 C;  4MH4 A;  4L2Z A;  3TDE A;  4BC7 A;  5AE3 A;  2E2I I;  5BR8 C;  3K6R A;  1YUA A;  2D1T A;  4NBC A;  3I55 1;  1KC8 1;  1XRA A;  2MCQ A;  4I9G A;  4TNU A;  3MZK B;  1W2B Z;  2E9H A;  4PUG A;  1Z03 A;  3KIH A;  3G7S A;  5T8T A;  1MXC A;  2PRO A;  4K0B A;  2UUB C;  4ODJ A;  4LE5 A;  3H3V J;  2RIQ A;  2E2H I;  4G37 A;  5KYT A;  3J80 D;  1HNX C;  2UUC C;  3G6E Z;  1VQO 1;  3EED A;  1TWG I;  4D4G A;  4LFA C;  4E2Y A;  3N54 B;  5BUS A;  4RVO A;  1VQ7 1;  4JYA C;  3KXW A;  1Y1V I;  3I56 1;  2UXD C;  4NBB A;  2D1S A;  1WJ2 A;  1VQL Z;  2O4H A;  3QWU A;  4RLF A;  1JOS A;  4NOZ A;  5FLX D;  2HHH C;  5C3E I;  1QM4 A;  4DCU A;  3CQ2 A;  1R9T I;  2V8J A;  4RMN A;  4PUI A;  3I08 A;  1K8A 2;  4JI0 C;  2OTJ 1;  4GKK C;  2JR6 A;  4LF6 C;  1RG9 A;  3R9W A;  3NH8 A;  3OTO C;  4RM3 A;  1YJW Z;  2PK7 A;  2JA6 I;  4GXR A;  2V7B A;  2PMZ A;  1ULT A;  3S1Q I;  4EWC A;  4BXX I;  1ZB9 A;  4DR2 C;  1N34 C;  2P2Q A;  3GTK I;  2NVX I;  3CCM Z;  3CD6 1;  2V8K A;  2P20 A;  1FDO A;  3G4S Z;  1XS3 A;  4NB8 A;  4LF8 C;  1Q86 2;  3CQ1 A;  4EAT A;  2ZZM A;  4MD7 A;  4A3F I;  2OBV A;  2P3Y A;  2QR1 B;  2KZF A;  3PES A;  2DYJ A;  3ETC A;  2QRD B;  2I3C A;  2D28 C;  1XMO C;  4A3E I;  3HOY I;  1QF8 A;  2OZK A;  2VPY A;  3D2L A;  2JA8 I;  1IB8 A;  1XRC A;  3J81 f;  4G1I A;  5AE2 A;  2UXC C;  3I4N I;  4GXQ A;  4JM1 A;  3NDJ A;  5K85 A;  1EGA A;  1T5D X;  4KTV A;  4PUH A;  5BSM A;  2KPI A;  3RG2 A;  2GTI A;  2IZ3 A;  4BY1 I;  4LF9 C;  2Y0S A;  4E30 A;  3I55 Z;  4DCT A;  2V8I A;  2QKD A;  1V60 A;  1ZH1 A;  3CCU 1;  2PN2 A;  1Z02 A;  4JI3 C;  1MDF A;  2QA4 Z;  2M5O A;  1HR0 C;  2NAP A;  3T1Y C;  4A3J I;  5C4J I;  1VQP 1;  4NBG A;  2JMO A;  1NJI 2;  1O9T A;  3NI2 A;  2QLV B;  3F3P C;  1I50 I;  4RVD A;  2Y4O A;  1VQ7 Z;  5K8F A;  4NB9 A;  3I56 Z;  4IZ6 A;  4RS4 A;  4U5Y D;  3G6E 1;  5T6B A;  2P02 A;  4DR3 C;  4B3T C;  5A2Q D;  1TWA I;  5A1I A;  2P2F A;  2CY1 A;  4E2Z A;  3A9V A;  3MON A;  1RO4 A;  3EQ6 A;  4JI1 C;  1PFT A;  5GTD A;  1VQ8 Z;  2F4V C;  2ASB A;  1UWD A;  4R1L A;  2OO4 A;  3UZ0 A;  4K0K C;  2P28 A;  1VQ4 Z;  3M4O I;  3DAY A;  4QTU A;  1Y8C A;  2E8E A;  4MXU A;  5LL6 f;  4E31 A;  1M90 2;  2P2B A;  2F4M A;  4R0M A;  1UKK A;  3CD6 Z;  4JI5 C;  2UXB C;  2QEX 1;  4D57 A;  4RVG A;  3OW2 Z;  3G71 1;  4BBY A;  1JWH C;  1ZB8 A;  4RVH A;  2JIM A;  3PO2 I;  3CCM 1;  1RQF A;  2MMA B;  3R44 A;  3GTL I;  3KIF A;  2VPZ A;  1KC8 2;  1I6H I;  3CC2 1;  3T4N B;  3J81 b;  3S2H I;  4A3L I;  3AY0 A;  3S1M I;  4X6A I;  4DCV A;  3CC4 1;  2BJO A;  1WII A;  3HOV I;  2LIY A;  1XMQ C;  3UOW A;  4OX9 C;  3HKZ A;  2D1Q A;  5IP7 I;  5DV9 A;  1Z01 A;  2YWC A;  1WCJ A;  3ESW A;  3ETO A;  3CPW Z;  3LUS A;  3CCU Z;  2IV2 X;  4HGZ A;  5BSU A;  2WB1 A;  2E0G A;  3LNV A;  3CW9 A;  5C44 I;  5FLX b;  1VQP Z;  2UUA C;  1JJ2 Z;  2G2K A;  3H2T A;  1P4E C;  1TWH I;  4B3M C;  3CCJ 1;  1FDI A;  3HOW I;  5CZX A;  5JRH A;  1V25 A;  1HNW C;  4E2W A;  2QA4 1;  2AYD A;  2Z51 A;  1N8R 1;  1RO2 A;  2YAD A;  1S72 1;  2VZE A;  1P9N A;  3IML A;  5KYV A;  4DV0 C;  4DV7 C;  5E7Q A;  4NBD A;  2D1R A;  4HGY A;  3GTM I;  3B7W A;  4MD8 A;  5BSR A;  2NVT I;  4PHT A;  3VTN A;  3VNS A;  2ONF A;  3CC7 Z;  1W2B Y;  3H0G I;  4GS5 A;  4A3K I;  4QTT A;  1RNI A;  2DE7 A;  1XHJ A;  2E8C A;  3GR1 A;  1VQ8 1;  4X64 C;  1FLO A;  1USP B;  1VQ4 1;  2QEX Z;  4DV5 C;  4FTF A;  2D27 A;  1I3Q I;  3G71 Z;  5D1O B;  1QVG Z;  3S1N I;  4DG8 A;  4LFC C;  3CCS 1;  1YHQ 1;  2E7G A;  4PZP A;  2ZAE B;  3CC2 Z;  1QVF Z;  2H85 A;  4JI4 C;  5IP9 I;  3CC4 Z;  2Q51 A;  4B3R C;  4FUQ A;  2QVZ X;  1KD1 1;  4X62 C;  4D56 A;  3S1R I;  1P7L A;  3NDI A;  2VUG A;  2D7V A;  2WD9 A;  1WCM I;  4MRI A;  4A93 I;  1K73 1;  1HH2 P;  4WV3 A;  4DUY C;  2VQF C;  1VQN Z;  3AF5 A;  5IT9 D;  2HJG A;  1Q82 1;  2VSQ A;  2F4O A;  3GTM S;  1KRL A;  3J80 f;  3K7A I;  2JA7 I;  2AKL A;  1PA4 A;  1J5E C;  5A2Q b;  3GKU A;  4B3S C;  1MD9 A;  3CCJ Z;  3CCE 1;  3CME 1;  2YU9 I;  3GR0 A;  1SIW A;  4RLQ A;  4LF7 C;  3N2Q A;  3UX2 A;  2IZ4 A;  2CXC A;  4D4I A;  1S72 Z;  4KHP C;  5ADZ A;  2KDN A;  2RT9 A;  5FLX f;  1WH9 A;  2Y4N A;  1N32 C;  5BUQ A;  4LF5 C;  3CCQ Z; 
#chains in the Genus database with same CATH homology
 2M6N A;  5IFI A;  1L2F A;  3HOZ I;  3GTO I;  4DR6 C;  5A19 A;  4E33 A;  4NBH A;  3HOU I;  4X65 C;  4GKJ C;  3VMI A;  3RZD I;  2PM9 A;  4Y52 I;  4NXN C;  3R9X A;  1KQS Z;  2OTL Z;  1VQ9 1;  2JS4 A;  2OOY B;  2K5R A;  3HOX I;  1O92 A;  2QVX X;  3GPC A;  3CC7 1;  2NVQ I;  3Q87 A;  4A3B I;  3IF8 A;  3SO4 A;  4DCS A;  4MD9 A;  1WW9 A;  1DL6 A;  4RM2 A;  4DUZ C;  1L1O C;  1IBK C;  3MZL B;  2Y27 A;  4BSZ A;  2W03 A;  5C4X I;  4OYC A;  4NBA A;  3CCS Z;  1YHQ Z;  3L95 X;  3IEV A;  2OPL B;  1V26 A;  4RV9 A;  3S16 I;  4HH4 A;  5T64 A;  2ZM6 C;  3D6W A;  3CCL 1;  5T8S A;  4X66 C;  4JI8 C;  4NFR A;  1Y1W I;  2XR1 A;  3VNR A;  2VUM I;  1N2F A;  1XNR C;  5AN9 F;  2UU9 C;  4WS9 A;  1N36 C;  2R7Z I;  3LAX A;  3J80 b;  1MDB A;  1VQK 1;  1N8R 2;  1VQ5 1;  1YIT 1;  4L4Q A;  2GU2 A;  3NH4 A;  1BA3 A;  4BC9 A;  1FUG A;  4JI2 C;  1M1K 1;  3GTJ I;  1LCI A;  2W04 A;  3FKI I;  1VQN 1;  1XNQ C;  2Q4Z A;  3CCE Z;  3CME Z;  1YIJ Z;  4ZLP A;  2R6M A;  3P5J B;  3F3F C;  3OW2 Y;  2P2J A;  1K9M 1;  1NYE A;  3CCR 1;  1LQL A;  4DR4 C;  1Q7Y 1;  3JAM D;  4I9F A;  5A2Q f;  3L8C A;  4BY7 I;  3NYR A;  2M48 A;  4KTT A;  3S17 I;  1Q81 1;  4JV5 C;  3PBK A;  2R92 I;  4E2X A;  2E8F A;  3NPD A;  3EER A;  3VMH A;  3CCQ 1;  2QL8 A;  2JUB A;  5BSV A;  3NFZ A;  3CMA Z;  2YCB A;  3TDH B;  3E7W A;  2JA5 I;  3CPW Y;  2QVY X;  4BBR I;  1IBL C;  1GPM A;  1K83 I;  1YJN 1;  1VQ9 Z;  1VQ6 1;  1MXA A;  3A4I A;  5CZV A;  4OXI A;  4RVF A;  3J81 D;  4NXM C;  3BG1 B;  1JJ2 Y;  2ATW A;  1YI2 Z;  5CM2 M;  3IX0 A;  2OTL 1;  4YY3 C;  4BCA A;  1KD1 2;  1RLY A;  2RHB A;  5BST A;  5KEI A;  2OOX B;  4DQY B;  5IT9 b;  4IR7 A;  1T5H X;  1K73 2;  4DR7 C;  1ML8 A;  4FUT A;  4Y7N I;  2YWB A;  3CCL Z;  3FCE A;  1Q82 2;  4YHH C;  2VQE C;  2PT7 G;  2NVY I;  3CCV 1;  3PO3 S;  3M3Y I;  4DG9 A;  2JNY A;  2DPL A;  1RY2 A;  4DR1 C;  3GTQ I;  1KKG A;  4S1T A;  2EGT A;  2DE5 A;  2HU9 A;  2QRE B;  1K0R A;  1VQK Z;  1VQ5 Z;  1YIT Z;  4DV3 C;  4DR5 C;  1FJG C;  2QRC B;  1PG4 A;  2JMP A;  4NBF A;  5T67 A;  3JAM f;  3J7A 4;  4A3M I;  2GTH A;  2K3R A;  5LMU C;  1QVG Y;  3S82 A;  4E32 A;  1VQM 1;  3D9X A;  1USP A;  3CCR Z;  3RV2 A;  4BBS I;  4ISB A;  1K8A 1;  1YIJ 1;  1QVF Y;  1TFI A;  5D1O A;  4PRO C;  4LFB C;  4DV6 C;  3CW8 X;  1PG3 A;  4DV4 C;  5D1P A;  1YJ9 Z;  4JI7 C;  4A3G I;  4ZJZ A;  4A3D I;  4DV1 C;  3FQM A;  1MXB A;  3BG0 B;  3T1H C;  3S2D I;  1AMU A;  2HF1 A;  1N33 C;  3IFU A;  3S14 I;  3S15 I;  1MKY A;  5IWA C;  1X3Z A;  1YJN Z;  4NBE A;  1VQ6 Z;  3IPL A;  5BUR A;  1Y1V S;  3DHV A;  1Q86 1;  3CMA 1;  3IEU A;  3C5E A;  4DGL A;  1X0T A;  4RVN A;  1VQO Z;  1I94 C;  1YI2 1;  2QW0 X;  1O90 A;  4A3C I;  3LGX A;  1SFO I;  2B63 I;  1QYP A;  3GCF A;  5FLM I;  3GKQ A;  3AF6 A;  3FQQ A;  1YJ7 A;  4MON A;  1TWC I;  3CCV Z;  3VNQ A;  1M1K 2;  3I4M I;  3TE5 B;  5IT9 f;  4XX2 A;  3CXC Z;  1VQL 1;  2OTJ Z;  5AE1 A;  4MTN A;  2KI7 B;  1KQS Y;  1NJI 1;  1NUI A;  3E7X A;  1K9M 2;  3JAM b;  1XRB A;  1O93 A;  1Q7Y 2;  3DLP X;  3U50 C;  4NH1 C;  3FCC A;  1IBM C;  5H9U A;  3VB9 A;  1Q81 2;  1YJW 1;  3A9U A;  4JI6 C;  3CQZ I;  1X3W A;  1VQM Z;  5BSW A;  4R1M A;  3TQI A;  2E2J I;  3TUF A;  2J6A A;  3GTG I;  2E5L C;  3PO3 I;  3RZO I;  2LFU A;  3GTP I;  5LMN C;  3CXC Y;  4CL1 A;  2R93 I;  4TPS B;  1QWI A;  4AQY C;  3NYQ A;  4A3I I;  2P2M A;  1WF3 A;  4DV2 C;  3G4S 1;  4G36 A;  2OPL A;  2BH1 X;  2O53 A;  4DK1 A;  1S7M A;  2WP0 C;  3PRO C;  4HPV A;  1TWF I;  2RBL A;  1HNZ C;  4AYB A;  3CJE A;  4NDN A;  1M90 1;  1NP6 A;  3NH5 A;  2AYA A;  1YUK A;  2DE6 A;  4L7I A;  1YJ9 1;  2VF1 A;  1RO0 A;  3I07 A;  3VMG A;  5A1G A;  1VLA A;  2RPR A;  2WAQ A;  4LF4 C;  4MH4 A;  4L2Z A;  3TDE A;  4BC7 A;  5AE3 A;  2E2I I;  5BR8 C;  1YUA A;  2D1T A;  4NBC A;  3I55 1;  1KC8 1;  1XRA A;  4I9G A;  4TNU A;  3MZK B;  1W2B Z;  2E9H A;  1Z03 A;  3KIH A;  3G7S A;  5T8T A;  1MXC A;  2PRO A;  4K0B A;  2UUB C;  4ODJ A;  4LE5 A;  3H3V J;  2RIQ A;  2E2H I;  4G37 A;  5KYT A;  3J80 D;  1HNX C;  2UUC C;  3G6E Z;  1VQO 1;  3EED A;  1TWG I;  4D4G A;  4LFA C;  4E2Y A;  3N54 B;  5BUS A;  4RVO A;  1VQ7 1;  4JYA C;  3KXW A;  1Y1V I;  3I56 1;  2UXD C;  4NBB A;  2D1S A;  1VQL Z;  2O4H A;  3QWU A;  4RLF A;  1JOS A;  4NOZ A;  5FLX D;  2HHH C;  5C3E I;  1QM4 A;  4DCU A;  1R9T I;  2V8J A;  4RMN A;  3I08 A;  1K8A 2;  4JI0 C;  2OTJ 1;  4GKK C;  2JR6 A;  4LF6 C;  1RG9 A;  3R9W A;  3NH8 A;  3OTO C;  4RM3 A;  1YJW Z;  2PK7 A;  2JA6 I;  4GXR A;  2V7B A;  2PMZ A;  1ULT A;  3S1Q I;  4EWC A;  4BXX I;  1ZB9 A;  4DR2 C;  1N34 C;  2P2Q A;  3GTK I;  2NVX I;  3CCM Z;  3CD6 1;  2V8K A;  2P20 A;  3G4S Z;  4LF8 C;  4NB8 A;  1Q86 2;  4EAT A;  4MD7 A;  4A3F I;  2OBV A;  2P3Y A;  2QR1 B;  2KZF A;  3PES A;  2DYJ A;  3ETC A;  2QRD B;  2I3C A;  2D28 C;  1XMO C;  4A3E I;  3HOY I;  1QF8 A;  2OZK A;  2JA8 I;  1XRC A;  3J81 f;  4G1I A;  5AE2 A;  2UXC C;  3I4N I;  4GXQ A;  4JM1 A;  3NDJ A;  5K85 A;  1EGA A;  1T5D X;  4KTV A;  5BSM A;  4LF9 C;  2KPI A;  3RG2 A;  2GTI A;  2IZ3 A;  4BY1 I;  2Y0S A;  4E30 A;  3I55 Z;  4DCT A;  2V8I A;  2QKD A;  1ZH1 A;  3CCU 1;  2PN2 A;  1Z02 A;  4JI3 C;  1MDF A;  2QA4 Z;  1HR0 C;  3T1Y C;  4A3J I;  5C4J I;  1VQP 1;  4NBG A;  2JMO A;  1NJI 2;  1O9T A;  3NI2 A;  2QLV B;  3F3P C;  1I50 I;  4RVD A;  2Y4O A;  1VQ7 Z;  5K8F A;  4NB9 A;  3I56 Z;  4IZ6 A;  4RS4 A;  4U5Y D;  3G6E 1;  5T6B A;  2P02 A;  4DR3 C;  4B3T C;  5A2Q D;  1TWA I;  5A1I A;  2P2F A;  2CY1 A;  4E2Z A;  3A9V A;  3MON A;  1RO4 A;  3EQ6 A;  4JI1 C;  1PFT A;  5GTD A;  1VQ8 Z;  2F4V C;  2ASB A;  4R1L A;  2OO4 A;  3UZ0 A;  4K0K C;  2P28 A;  1VQ4 Z;  3M4O I;  3DAY A;  4QTU A;  2E8E A;  4MXU A;  5LL6 f;  4E31 A;  1M90 2;  2P2B A;  2F4M A;  4R0M A;  1UKK A;  3CD6 Z;  4JI5 C;  2UXB C;  2QEX 1;  4D57 A;  4RVG A;  3OW2 Z;  3G71 1;  4BBY A;  1JWH C;  1ZB8 A;  4RVH A;  3PO2 I;  3CCM 1;  1RQF A;  3R44 A;  3GTL I;  3KIF A;  1KC8 2;  3S2H I;  1I6H I;  3CC2 1;  3T4N B;  3J81 b;  4A3L I;  3S1M I;  4X6A I;  4DCV A;  3CC4 1;  2BJO A;  1WII A;  3HOV I;  2LIY A;  1XMQ C;  3UOW A;  4OX9 C;  3HKZ A;  2D1Q A;  5IP7 I;  5DV9 A;  1Z01 A;  2YWC A;  3ESW A;  3ETO A;  3CPW Z;  3LUS A;  3CCU Z;  4HGZ A;  5BSU A;  2WB1 A;  2E0G A;  3LNV A;  3CW9 A;  5C44 I;  5FLX b;  1VQP Z;  2UUA C;  1JJ2 Z;  2G2K A;  3H2T A;  1TWH I;  4B3M C;  3CCJ 1;  3HOW I;  5CZX A;  5JRH A;  1HNW C;  1V25 A;  4E2W A;  2QA4 1;  1N8R 1;  1RO2 A;  2YAD A;  1S72 1;  2VZE A;  1P9N A;  3IML A;  5KYV A;  4DV0 C;  4DV7 C;  5E7Q A;  4NBD A;  2D1R A;  4HGY A;  3GTM I;  3B7W A;  4MD8 A;  5BSR A;  2NVT I;  4PHT A;  3VTN A;  3VNS A;  2ONF A;  3CC7 Z;  1W2B Y;  3H0G I;  4GS5 A;  4A3K I;  4QTT A;  1RNI A;  2DE7 A;  2E8C A;  3GR1 A;  1VQ8 1;  4X64 C;  1USP B;  1VQ4 1;  2QEX Z;  4DV5 C;  4FTF A;  2D27 A;  1I3Q I;  3G71 Z;  5D1O B;  1QVG Z;  3S1N I;  4DG8 A;  4LFC C;  3CCS 1;  1YHQ 1;  2E7G A;  4PZP A;  2ZAE B;  3CC2 Z;  1QVF Z;  2H85 A;  4JI4 C;  5IP9 I;  3CC4 Z;  2Q51 A;  4B3R C;  4FUQ A;  2QVZ X;  1KD1 1;  4X62 C;  4D56 A;  3S1R I;  1P7L A;  3NDI A;  2VUG A;  2D7V A;  2WD9 A;  1WCM I;  4MRI A;  4A93 I;  1K73 1;  1HH2 P;  4WV3 A;  4DUY C;  2VQF C;  1VQN Z;  3AF5 A;  5IT9 D;  2HJG A;  1Q82 1;  2VSQ A;  2F4O A;  3GTM S;  1KRL A;  3J80 f;  3K7A I;  2JA7 I;  2AKL A;  1PA4 A;  1J5E C;  5A2Q b;  3GKU A;  4B3S C;  1MD9 A;  3CCJ Z;  3CCE 1;  3CME 1;  2YU9 I;  3GR0 A;  4RLQ A;  4LF7 C;  3N2Q A;  2IZ4 A;  2CXC A;  4D4I A;  1S72 Z;  4KHP C;  5ADZ A;  2RT9 A;  5FLX f;  1WH9 A;  2Y4N A;  1N32 C;  5BUQ A;  4LF5 C;  3CCQ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...