1USPA

Organic hydroperoxide resistance protein from deinococcus radiodurans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
137
structure length
137
Chain Sequence
NVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPADSTITARVGLQKAGLAFALDVELEGHFPGLSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Organic Hydroperoxide Resistance Protein from Deinococcus Radiodurans: Do Conformational Changes Facilitate Recycling of the Redox Disulfide?
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
total genus 31
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1uspA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1uspA02
1HR0C 4NBCA 4A3DI 4A3BI 2KPIA 4JI0C 3PO2I 4A3CI 3HOUI 3GTJI 4A3II 4QTUA 4DCVA 2UUAC 2E2JI 2F4OA 4A3JI 4NB8A 4YY3C 4DCTA 2ZM6C 2D7VA 1TWAI 1X3WA 4B3TC 2NVTI 4X65C 5IP7I 4NOZA 3GTPI 4DUYC 1HNWC 3GTQI 1TWHI 1JOSA 1K0RA 4LFCC 4A3EI 5IP9I 4DR7C 3ESWA 1WH9A 3GTMS 4NBEA 4NXNC 2F4VC 3D6WA 3U50C 3PO3I 1K83I 2UXCC 5CM2M 3S1RI 1QYPA 4DV3C 2DE6A 4MTNA 3AF5A 5C4JI 3EERA 4NBBA 3PO3S 1EGAA 1USPB 2QL8A 3RZDI 4GKKC 1VLAA 1X3ZA 4DR4C 3GTOI 2HJGA 1TWGI 2UU9C 2E7GA 4NBGA 1N34C 1USPA 2DE5A 2RBLA 3HOVI 3HOWI 2VUMI 4A93I 1IBKC 3H3VJ 4A3GI 3GKQA 1PA4A 1I50I 2XR1A 2E5LC 5A2QD 3GTLI 1Y1VS 4JI5C 2ASBA 2PT7G 4B3MC 4JI3C 1XMOC 4LF6C 4JI1C 3GTGI 5BR8C 5FLXD 3HOXI 1N33C 2CXCA 1WCMI 2PN2A 3S15I 4LF4C 4B3SC 3IEUA 4JI2C 2P3YA 2JS4A 3J80D 4DV2C 2JMPA 2AKLA 5FLMI 2DYJA 3LUSA 4DUZC 3M3YI 2R93I 3GKUA 4LFAC 2HHHC 4B3RC 1KKGA 1XNQC 4NBAA 1N36C 2ATWA 1XMQC 1FJGC 3S2HI 3S16I 2R7ZI 4DV5C 1I3QI 2DE7A 5C44I 2CY1A 4KHPC 2E8CA 4DR6C 1TWCI 4Y7NI 4DCUA 3S1MI 4Y52I 4JI7C 5LMUC 3S1QI 3S2DI 2NVYI 4LF8C 1TWFI 2UXDC 4DV4C 2E8FA 3T1YC 1L2FA 2JNYA 4JYAC 3HOZI 1WF3A 4DV6C 1Y1VI 3M4OI 1MKYA 2JA8I 4YHHC 3HOYI 5LMNC 3CQZI 1L1OC 1HH2P 1IBMC 3S14I 3AF6A 1NUIA 1IBLC 2UUCC 1UKKA 2F4MA 4DR1C 2KZFA 4LF9C 5IT9D 1N32C 4X64C 1ML8A 3VMHA 1PFTA 4DR2C 3S17I 4NXMC 3Q87A 1WW9A 2JA5I 4DV7C 2E2HI 2ONFA 3R9WA 2VQEC 1ZB8A 3I07A 4X6AI 2E2II 1YUAA 3FKII 3GTMI 2VQFC 4BY7I 1TFIA 3GCFA 4DR3C 4NBFA 4BY1I 3S1NI 1ZB9A 3VB9A 1SFOI 2E8EA 2YU9I 2HF1A 4LFBC 4A3LI 5C4XI 4DV1C 4AQYC 4NBHA 2NVXI 3I4MI 2OPLB 2YCBA 4X66C 3VMGA 4JV5C 4JI4C 2K5RA 4X62C 2JA6I 1J5EC 1RO4A 4QTTA 4OX9C 4K0KC 3T1HC 1QWIA 4GKJC 3RZOI 4JI8C 3J81D 1RLYA 2PK7A 1Y1WI 1LQLA 3H0GI 4NBDA 4BBSI 2J6AA 3OTOC 4A3MI 3JAMD 2BJOA 4BBRI 2EGTA 4XX2A 5C3EI 2NVQI 2OPLA 3CJEA 4BXXI 4LF7C 1XNRC 3IEVA 3R9XA 4A3FI 4MH4A 1I6HI 4DR5C 1R9TI 3VMIA 1HNZC 3I4NI 1N2FA 2B63I 1NYEA 1I94C 2UUBC 5IWAC 4DV0C 2R92I 1HNXC 2JA7I 3K7AI 2JR6A 4A3KI 2UXBC 4NB9A 1DL6A 3GTKI 4BSZA 4DCSA 4LF5C 4JI6C
chains in the Genus database with same CATH superfamily
3CCM1 4A3DI 5KYTA 2JIQA 4TNUA 3CC21 5IT9b 3PO2I 1XS3A 3GTJI 4QTUA 2M5OA 1K8A1 2F4OA 4DCTA 1TWAI 2RT9A 1AMUA 1QVFY 4E30A 5IP7I 5CZVA 4I9GA 2W04A 4DR7C 1KRLA 2IZ4A 4NXNC 2UXCC 2HU9A 3D6WA 3PO3I 4GXRA 5T8SA 5A1IA 3MZLB 5A1GA 3PROC 1VQO1 2H85A 3PO3S 3EERA 3CW8X 4L7IA 3CCV1 4GKKC 3JAMb 1VLAA 3G4S1 2QVZX 2HJGA 1TWGI 3CC2Z 1YJNZ 3GR0A 2UU9C 4RM3A 4NBGA 2Y0SA 2VUMI 1Q861 4A3GI 2ASBA 1I50I 1FLOA 1LCIA 4GS5A 2JIPA 3N54B 2M6NA 2V8JA 2QLVB 1XMOC 4JI1C 1O9TA 3TDEA 3HOXI 3G711 1YJ7A 2CXCA 1WCMI 2P2FA 3R44A 2VPWA 2Q51A 2K3RA 2QRCB 3IEUA 4TPSB 5FLMI 4DUZC 4LFCC 4FTFA 1N8R2 3CCL1 1O93A 2R7ZI 1M6XC 4DV5C 2JNVA 3CC41 3NFZA 4E2XA 3CCS1 3S2DI 4R0MA 3G71Z 4DV4C 4PUIA 3T1YC 5FLXf 3CPWY 2JMOA 3IPLA 3FQQA 3M4OI 1S72Z 2JA8I 3HOYI 3NYRA 5LMNC 3CQZI 2JUBA 1IBMC 1T5HX 3S14I 3AF6A 2QEX1 3CME1 3PBKA 1NUIA 5AN9F 4DR1C 4PROC 4LF9C 5IT9D 1Q811 1Q821 4X64C 1VQ81 1PFTA 3UZ0A 4FUTA 2WB1A 1WW9A 1T5DX 3F3FC 1P4EA 2ONFA 3BG0B 1VQK1 2MM9A 2VQEC 1AA6A 3E7WA 4E31A 1VQ6Z 2Q4ZA 3TUFA 2VQFC 4BY7I 1TFIA 1P9NA 2WAQA 5BUQA 4HH4A 3CC4Z 1ZB9A 2E8EA 1VQ41 4LFBC 1VQM1 4NFRA 5FLXb 4AQYC 1MDBA 2NVXI 2OPLB 4X66C 4JV5C 2V3VA 4X62C 1J5EC 1RO4A 2QA4Z 1M901 4OX9C 1YITZ 1Q7Y2 1GPMA 1PG4A 3CCUZ 1QWIA 4HGZA 1RLYA 2PK7A 2V8KA 4BBSI 2J6AA 2PM9A 1VQ7Z 5A19A 4XX2A 2NVQI 2G2KA 1P4EC 3VNSA 3UX3A 3OW2Z 3I4NI 2KDNA 1I94C 3KIFA 3T4NB 1HNXC 2OOXB 3K7AI 4G36A 4JI6C 4CL1A 3JAMf 1NJI1 2QA41 4JI0C 2AYAA 5ADZA 3CCU1 1VEHA 2M5HA 4DCVA 2UUAC 4MRIA 3TE5B 3GR1A 5AE2A 4YY3C 1RG9A 2D7VA 4B3TC 4E32A 3MZKB 2W03A 2KZ0A 1YJ9Z 1YJN1 1HNWC 4DUYC 3GTQI 3KIHA 4A3EI 2OTL1 2YADA 2QR1B 3GTMS 4L2ZA 2F4VC 1QVGZ 3U50C 3LGXA 1K83I 5CM2M 3CCJZ 1QYPA 1VQNZ 3UOWA 4NBBA 3VTNA 3G6EZ 1EGAA 1USPB 2ZZNA 5T6BA 4NDNA 3J7A4 3RV2A 2P2MA 1Q16A 2E7GA 2HHHC 2DE5A 3HOWI 3DHVA 2OZKA 3RG2A 4A93I 2OBVA 3H3VJ 1PA4A 3GKQA 5D1OA 5K85A 4JM1A 3L8CA 2V8IA 3J80b 2D28C 3OW2Y 2QREB 2VPXA 2PN2A 3G6E1 4JI2C 2P3YA 1VQP1 3GKUA 4B3RC 5BSVA 2ATWA 3S16I 2CU6A 2DE7A 5LL6f 2CY1A 4KHPC 2O4HA 1TWCI 3G4SZ 4Y52I 4JI7C 5LMUC 1TWFI 1Z03A 2E8FA 3BG1B 4MXUA 1L2FA 4JYAC 1M1K2 3HOZI 2GTIA 1WF3A 3N2QA 4ZJZA 1P7LA 1MKYA 4AYBA 1QM4A 2P2QA 5A2Qf 1ZH1A 3CCR1 2Y4OA 4PZPA 1YUKA 2VUGA 1VQ4Z 4EWCA 1IBLC 1UKKA 2NCLA 1VQMZ 2OO4A 2JIOA 3ETOA 1ML8A 3VMHA 4DR2C 3S17I 1RO2A 1VQPZ 4DV7C 2VPYA 3R9WA 1NP6A 2WP0C 1ZB8A 3I07A 4X6AI 3LNOA 2E2II 5BSTA 3GTMI 1QXFA 5DV9A 3GCFA 4DR3C 1WJ2A 5A2Qb 4BY1I 1RQFA 1PU1A 3VB9A 1VQ5Z 2YU9I 1QVGY 1VQ71 3A4IA 2WD9A 2M48A 3I56Z 4IR7A 4DV1C 4NBHA 1KC81 4RVNA 2YCBA 4JI4C 1S721 2K5RA 3CCMZ 1K9M2 4D56A 3VNRA 3TDHB 1N8R1 1VQ9Z 3A26A 4I9FA 4GKJC 5BSUA 3RZOI 4RVFA 3O2EA 3J81D 1W2BY 3H0GI 3QWUA 4MD8A 1UWDA 3HKZA 3PESA 4D4IA 3FCEA 1ULTA 3LNVA 4R1LA 2KI7B 2BJOA 4BBRI 3CXCZ 3I561 2VSQA 2OPLA 2JIMA 2RIQA 3CJEA 3R9XA 2QRDB 1I6HI 4DR5C 2NAPA 3VMIA 1R9TI 3E7XA 4DG8A 4RLQA 2QKDA 3TQIA 2D27A 3D9XA 1YJ91 2JR6A 4A3KI 5IFIA 4PHTA 3MONA 1HR0C 3I08A 2ZAEB 3A25A 4BC7A 1JWHC 3CCE1 3HOUI 4A3II 2E2JI 4A3JI 1VQOZ 4NB8A 3NH8A 3IMLA 1FUGA 2ZM6C 1X3WA 1XRBA 3J80f 4WV3A 4BCAA 5KYVA 3CCQZ 1K732 3L95X 3CMAZ 4NOZA 4G37A 3NDIA 5T64A 1TWHI 1JOSA 5IP9I 3ESWA 1M1K1 1WH9A 4NBEA 3DLPX 5BURA 3CCLZ 2GU2A 2DE6A 2YX1A 2D1QA 5C4JI 2QL8A 1IB8A 3RZDI 3GTOI 3CCSZ 2P20A 1WIIA 3J81b 1N34C 2BH1X 2LEXA 1XRAA 3P5JB 2XR1A 1MDFA 1QF8A 1Z01A 3UEBA 4B3MC 4JI3C 1Q7Y1 5D1OB 5BSWA 2GTHA 2OTJZ 4OYCA 1QVFZ 4WS9A 1W2BZ 4LF4C 2D1TA 1YI2Z 3NH5A 4B3SC 2JS4A 2JMPA 2AKLA 2YWCA 2LIYA 4LFAC 2R93I 4RVGA 4LE5A 1KKGA 4RVOA 1VQN1 1XNQC 5H9UA 4NBAA 1FJGC 1MXAA 4RM2A 4HGYA 5C44I 4U5YD 4DR6C 4DCUA 4LF8C 1VQL1 2NVYI 2P2BA 4PUHA 2JNYA 1JJ2Y 4KTTA 4DV6C 5K8FA 3EQ6A 3IR7A 2OTJ1 3LAXA 5D1PA 3CD6Z 2F4MA 2KZFA 1N32C 1YJWZ 1VQLZ 2RPRA 4NXMC 3Q87A 4E33A 2JA5I 4ODJA 2E2HI 1V60A 2OOYB 3FKII 2O53A 1NY8A 3A9UA 2LFUA 3CQ3A 3CQ2A 4NBFA 3SO4A 2QVXX 1K8A2 3S1NI 3F3PC 1PG3A 4L4QA 5AE1A 2HF1A 4A3LI 4ZLPA 5CZXA 1YJW1 4MD9A 2P28A 4E2WA 1O90A 2E7ZA 4K0KC 4DGLA 3T1HC 5E7QA 4DG9A 1VQ61 4MD7A 1WCJA 3FQMA 4JI8C 2JIRA 3DAYA 1MD9A 2IZ3A 4A3MI 2VF1A 2D1RA 4RVHA 1Y8CA 3I55Z 2EGTA 2IV2X 3KXWA 3TR3A 4LF7C 1MXCA 4EATA 3IF8A 2MCQA 3B7WA 1HNZC 4HPVA 1N2FA 1NYEA 1VQ91 3UX2A 3S82A 4D57A 4DV0C 1KQSZ 2VZEA 5BSMA 2UXBC 4DV2C 3GTKI 1IBKC 4S1TA 4LF5C 1FDIA 4NBCA 2E0GA 4A3BI 2KPIA 4K0BA 4A3CI 1YIT1 3J81f 1KD12 1MXBA 5BSRA 3IX0A 5T8TA 3D2LA 2NVTI 3NDJA 5LCIA 3CC7Z 2V45A 4RV9A 3CQ1A 4X65C 1NJI2 3GTPI 4RVDA 1SIWA 3C5EA 4PUGA 1K0RA 1X0TA 3CCEZ 4GXQA 1RNIA 3S1RI 3NH4A 1JJ2Z 4NH1C 4DV3C 4MTNA 3FCCA 3AF5A 1V26A 5JRHA 1X3ZA 5BUSA 4RS4A 4DR4C 2AYDA 3CMA1 5IT9f 4MONA 3CPWZ 3ETCA 1USPA 3HOVI 2RBLA 2YWBA 2E5LC 5A2QD 3GTLI 1Y1VS 5T67A 3CXCY 1RY2A 3CCJ1 2VPZA 2PT7G 2QW0X 4JI5C 4LF6C 1M6XA 3GTGI 5BR8C 5FLXD 1N33C 3NPDA 2R6MA 3S15I 2V7BA 1Q862 4G1IA 3J80D 4IZ6A 2DYJA 2D1SA 3LUSA 3M3YI 2RHBA 4BC9A 4DK1A 1N36C 1XMQC 1Z02A 3S2HI 4E2ZA 3G7SA 1KC82 1I3QI 1YHQZ 1BA3A 3AY0A 3CCVZ 2E8CA 4Y7NI 1K731 5GTDA 1VQ8Z 3S1MI 2UXDC 3S1QI 4RLFA 2DHMA 1M902 1VQKZ 3H2TA 4ISBA 1Q812 1Q822 4E2YA 4FUQA 4KTVA 1Y1VI 4YHHC 2P2JA 3NYQA 3VNQA 1L1OC 1HH2P 1FDOA 1XHJA 2UUCC 2QVYX 1YHQ1 1YI21 3GPCA 3IFUA 3EEDA 1WZNA 1O92A 1YUAA 1KD11 2ZZMA 2MMAB 1XRCA 2QEXZ 3CMEZ 4BBYA 1YIJZ 1SFOI 1KQSY 2DPLA 3K6RA 3I551 3NI2A 5C4XI 2Y4NA 4D4GA 3I4MI 1S7MA 3VMGA 4DQYB 2Y27A 4R1MA 5KEIA 2JA6I 4QTTA 5AE3A 3CCRZ 3A9VA 3CD61 1Y1WI 1LQLA 4NBDA 2PROA 3OTOC 3JAMD 2I3CA 3CCQ1 5C3EI 3CW9A 1TH5A 1V25A 1XNRC 2E9HA 4BXXI 3IEVA 2PMZA 4A3FI 4MH4A 1K9M1 2OTLZ 4OXIA 4RMNA 2UUBC 2P02A 2B63I 2Z51A 5IWAC 1YIJ1 1VQ51 2R92I 2JA7I 3CC71 1RO0A 4NB9A 1DL6A 4BSZA 4DCSA
chains in the Genus database with same CATH topology
3CCM1 4A3DI 5KYTA 4TNUA 3CC21 5IT9b 3PO2I 3GTJI 4QTUA 1K8A1 2F4OA 4DCTA 1TWAI 2RT9A 1AMUA 1QVFY 4E30A 5IP7I 5CZVA 4I9GA 2W04A 4DR7C 1KRLA 2IZ4A 4NXNC 2UXCC 2HU9A 3D6WA 3PO3I 4GXRA 5T8SA 5A1IA 3MZLB 5A1GA 3PROC 1VQO1 2H85A 3PO3S 3EERA 3CW8X 4L7IA 3CCV1 4GKKC 3JAMb 1VLAA 3G4S1 2QVZX 2HJGA 1TWGI 3CC2Z 1YJNZ 3GR0A 2UU9C 4RM3A 4NBGA 2Y0SA 2VUMI 1Q861 4A3GI 2ASBA 1I50I 1LCIA 4GS5A 3N54B 2M6NA 2V8JA 2QLVB 1XMOC 4JI1C 1O9TA 3TDEA 3HOXI 3G711 1YJ7A 2CXCA 1WCMI 2P2FA 3R44A 2Q51A 2K3RA 2QRCB 3IEUA 4TPSB 5FLMI 4DUZC 4LFCC 4FTFA 1N8R2 3CCL1 1O93A 2R7ZI 4DV5C 3CC41 3NFZA 4E2XA 3CCS1 3S2DI 4R0MA 3G71Z 4DV4C 3T1YC 5FLXf 3CPWY 2JMOA 3IPLA 3FQQA 3M4OI 1S72Z 2JA8I 3HOYI 3NYRA 5LMNC 3CQZI 2JUBA 1IBMC 1T5HX 3S14I 3AF6A 2QEX1 3CME1 3PBKA 1NUIA 5AN9F 4DR1C 4PROC 4LF9C 5IT9D 1Q811 1Q821 4X64C 1VQ81 1PFTA 3UZ0A 4FUTA 2WB1A 1WW9A 1T5DX 3F3FC 2ONFA 3BG0B 1VQK1 2VQEC 3E7WA 4E31A 1VQ6Z 2Q4ZA 3TUFA 2VQFC 4BY7I 1TFIA 1P9NA 2WAQA 5BUQA 4HH4A 3CC4Z 1ZB9A 2E8EA 1VQ41 4LFBC 1VQM1 4NFRA 5FLXb 4AQYC 1MDBA 2NVXI 2OPLB 4X66C 4JV5C 4X62C 1J5EC 1RO4A 2QA4Z 1M901 4OX9C 1YITZ 1Q7Y2 1GPMA 1PG4A 3CCUZ 1QWIA 4HGZA 1RLYA 2PK7A 2V8KA 4BBSI 2J6AA 2PM9A 1VQ7Z 5A19A 4XX2A 2NVQI 2G2KA 3VNSA 3OW2Z 3I4NI 1I94C 3KIFA 3T4NB 1HNXC 2OOXB 3K7AI 4G36A 4JI6C 4CL1A 3JAMf 1NJI1 2QA41 4JI0C 2AYAA 5ADZA 3CCU1 4DCVA 2UUAC 4MRIA 3TE5B 3GR1A 5AE2A 4YY3C 1RG9A 2D7VA 4B3TC 4E32A 3MZKB 2W03A 1YJ9Z 1YJN1 1HNWC 4DUYC 3GTQI 3KIHA 4A3EI 2OTL1 2YADA 2QR1B 3GTMS 4L2ZA 2F4VC 1QVGZ 3U50C 3LGXA 1K83I 5CM2M 3CCJZ 1QYPA 1VQNZ 3UOWA 4NBBA 3VTNA 3G6EZ 1EGAA 1USPB 5T6BA 4NDNA 3J7A4 3RV2A 2P2MA 2E7GA 2HHHC 2DE5A 3HOWI 3DHVA 2OZKA 3RG2A 4A93I 2OBVA 3H3VJ 1PA4A 3GKQA 5D1OA 5K85A 4JM1A 3L8CA 2V8IA 3J80b 2D28C 3OW2Y 2QREB 2PN2A 3G6E1 4JI2C 2P3YA 1VQP1 3GKUA 4B3RC 5BSVA 2ATWA 3S16I 2DE7A 5LL6f 2CY1A 4KHPC 2O4HA 1TWCI 3G4SZ 4Y52I 4JI7C 5LMUC 1TWFI 1Z03A 2E8FA 3BG1B 4MXUA 1L2FA 4JYAC 1M1K2 3HOZI 2GTIA 1WF3A 3N2QA 4ZJZA 1P7LA 1MKYA 4AYBA 1QM4A 2P2QA 5A2Qf 1ZH1A 3CCR1 2Y4OA 4PZPA 1YUKA 2VUGA 1VQ4Z 4EWCA 1IBLC 1UKKA 1VQMZ 2OO4A 3ETOA 1ML8A 3VMHA 4DR2C 3S17I 1RO2A 1VQPZ 4DV7C 3R9WA 1NP6A 2WP0C 1ZB8A 3I07A 4X6AI 5BSTA 2E2II 3GTMI 5DV9A 3GCFA 4DR3C 5A2Qb 4BY1I 1RQFA 3VB9A 1VQ5Z 2YU9I 1QVGY 1VQ71 3A4IA 2WD9A 2M48A 3I56Z 4IR7A 4DV1C 4NBHA 1KC81 4RVNA 2YCBA 4JI4C 1S721 2K5RA 3CCMZ 1K9M2 4D56A 3VNRA 3TDHB 1N8R1 1VQ9Z 4I9FA 4GKJC 5BSUA 3RZOI 4RVFA 3J81D 1W2BY 3H0GI 3QWUA 4MD8A 4D4IA 3HKZA 3PESA 3FCEA 1ULTA 3LNVA 4R1LA 2KI7B 2BJOA 4BBRI 3CXCZ 3I561 2VSQA 2OPLA 3CJEA 2RIQA 3R9XA 2QRDB 1I6HI 4DR5C 1R9TI 3VMIA 3E7XA 4DG8A 4RLQA 2QKDA 3TQIA 2D27A 3D9XA 1YJ91 2JR6A 4A3KI 5IFIA 4PHTA 3MONA 1HR0C 3I08A 2ZAEB 4BC7A 1JWHC 3CCE1 3HOUI 4A3II 2E2JI 4A3JI 1VQOZ 4NB8A 3NH8A 3IMLA 1FUGA 2ZM6C 1X3WA 1XRBA 3J80f 4WV3A 4BCAA 5KYVA 3CCQZ 1K732 3L95X 3CMAZ 4NOZA 4G37A 3NDIA 5T64A 1TWHI 1JOSA 5IP9I 3ESWA 1M1K1 1WH9A 4NBEA 3DLPX 5BURA 3CCLZ 2GU2A 2DE6A 2D1QA 5C4JI 2QL8A 3RZDI 3GTOI 3CCSZ 2P20A 1WIIA 3J81b 1N34C 2BH1X 1XRAA 3P5JB 2XR1A 1MDFA 1QF8A 1Z01A 4B3MC 4JI3C 1Q7Y1 5D1OB 5BSWA 2GTHA 2OTJZ 4OYCA 1QVFZ 4WS9A 1W2BZ 4LF4C 2D1TA 1YI2Z 3NH5A 4B3SC 2JS4A 2JMPA 2AKLA 2YWCA 2LIYA 4LFAC 2R93I 4RVGA 4LE5A 1KKGA 4RVOA 1VQN1 1XNQC 5H9UA 4NBAA 1FJGC 1MXAA 4RM2A 4HGYA 5C44I 4U5YD 4DR6C 4DCUA 4LF8C 1VQL1 2NVYI 2P2BA 2JNYA 1JJ2Y 4KTTA 4DV6C 5K8FA 3EQ6A 2OTJ1 3LAXA 5D1PA 3CD6Z 2F4MA 2KZFA 1N32C 1YJWZ 1VQLZ 2RPRA 4NXMC 3Q87A 4E33A 2JA5I 4ODJA 2E2HI 2OOYB 3FKII 2O53A 3SO4A 3A9UA 2LFUA 4NBFA 2QVXX 1K8A2 3S1NI 3F3PC 1PG3A 4L4QA 5AE1A 2HF1A 4A3LI 4ZLPA 5CZXA 1YJW1 4MD9A 2P28A 4E2WA 1O90A 4K0KC 4DGLA 3T1HC 5E7QA 4DG9A 1VQ61 4MD7A 3FQMA 4JI8C 3DAYA 1MD9A 2IZ3A 4A3MI 2VF1A 2D1RA 4RVHA 3I55Z 2EGTA 3KXWA 4LF7C 1MXCA 4EATA 3IF8A 3B7WA 1HNZC 4HPVA 1N2FA 1NYEA 1VQ91 4D57A 3S82A 4DV0C 1KQSZ 2VZEA 5BSMA 2UXBC 4DV2C 3GTKI 1IBKC 4S1TA 4LF5C 4NBCA 2E0GA 4A3BI 2KPIA 4K0BA 4A3CI 1YIT1 3J81f 1KD12 1MXBA 5BSRA 3IX0A 5T8TA 2NVTI 3NDJA 3CC7Z 4RV9A 4X65C 1NJI2 3GTPI 4RVDA 3C5EA 1K0RA 1X0TA 3CCEZ 4GXQA 1RNIA 3S1RI 3NH4A 1JJ2Z 4NH1C 4DV3C 4MTNA 3FCCA 3AF5A 1V26A 5JRHA 1X3ZA 5BUSA 4RS4A 4DR4C 3CMA1 5IT9f 4MONA 3CPWZ 3ETCA 1USPA 3HOVI 2RBLA 2YWBA 2E5LC 5A2QD 3GTLI 1Y1VS 5T67A 3CXCY 1RY2A 3CCJ1 2PT7G 2QW0X 4JI5C 4LF6C 3GTGI 5BR8C 5FLXD 1N33C 3NPDA 2R6MA 3S15I 2V7BA 1Q862 4G1IA 3J80D 4IZ6A 2DYJA 2D1SA 3LUSA 3M3YI 2RHBA 4BC9A 4DK1A 1N36C 1XMQC 1Z02A 3S2HI 4E2ZA 3G7SA 1KC82 1I3QI 1YHQZ 1BA3A 3CCVZ 2E8CA 4Y7NI 1K731 5GTDA 1VQ8Z 3S1MI 2UXDC 3S1QI 4RLFA 1M902 1VQKZ 3H2TA 4ISBA 1Q812 1Q822 4E2YA 4FUQA 4KTVA 1Y1VI 4YHHC 2P2JA 3NYQA 3VNQA 1L1OC 1HH2P 2UUCC 2QVYX 1YHQ1 1YI21 3GPCA 3IFUA 3EEDA 1O92A 1YUAA 1KD11 1XRCA 2QEXZ 3CMEZ 4BBYA 1YIJZ 1SFOI 1KQSY 2DPLA 3I551 3NI2A 5C4XI 2Y4NA 4D4GA 3I4MI 1S7MA 3VMGA 4DQYB 2Y27A 4R1MA 5KEIA 2JA6I 4QTTA 5AE3A 3CCRZ 3A9VA 3CD61 1Y1WI 1LQLA 4NBDA 2PROA 3OTOC 3JAMD 2I3CA 3CCQ1 5C3EI 3CW9A 1V25A 1XNRC 2E9HA 4BXXI 3IEVA 2PMZA 4A3FI 4MH4A 1K9M1 2OTLZ 4OXIA 4RMNA 2UUBC 2P02A 2B63I 5IWAC 1YIJ1 1VQ51 2R92I 2JA7I 3CC71 1RO0A 4NB9A 1DL6A 4BSZA 4DCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 C;  4NBC A;  4A3D I;  4A3B I;  2KPI A;  4JI0 C;  3PO2 I;  4A3C I;  3HOU I;  3GTJ I;  4A3I I;  4QTU A;  4DCV A;  2UUA C;  2E2J I;  2F4O A;  4A3J I;  4NB8 A;  4YY3 C;  4DCT A;  2ZM6 C;  2D7V A;  1TWA I;  1X3W A;  4B3T C;  2NVT I;  4X65 C;  5IP7 I;  4NOZ A;  3GTP I;  4DUY C;  1HNW C;  3GTQ I;  1TWH I;  1JOS A;  1K0R A;  4LFC C;  4A3E I;  5IP9 I;  4DR7 C;  3ESW A;  1WH9 A;  3GTM S;  4NBE A;  4NXN C;  2F4V C;  3D6W A;  3U50 C;  3PO3 I;  1K83 I;  2UXC C;  5CM2 M;  3S1R I;  1QYP A;  4DV3 C;  2DE6 A;  4MTN A;  3AF5 A;  5C4J I;  3EER A;  4NBB A;  3PO3 S;  1EGA A;  1USP B;  2QL8 A;  3RZD I;  4GKK C;  1VLA A;  1X3Z A;  4DR4 C;  3GTO I;  2HJG A;  1TWG I;  2UU9 C;  2E7G A;  4NBG A;  1N34 C;  1USP A;  2DE5 A;  2RBL A;  3HOV I;  3HOW I;  2VUM I;  4A93 I;  1IBK C;  3H3V J;  4A3G I;  3GKQ A;  1PA4 A;  1I50 I;  2XR1 A;  2E5L C;  5A2Q D;  3GTL I;  1Y1V S;  4JI5 C;  2ASB A;  2PT7 G;  4B3M C;  4JI3 C;  1XMO C;  4LF6 C;  4JI1 C;  3GTG I;  5BR8 C;  5FLX D;  3HOX I;  1N33 C;  2CXC A;  1WCM I;  2PN2 A;  3S15 I;  4LF4 C;  4B3S C;  3IEU A;  4JI2 C;  2P3Y A;  2JS4 A;  3J80 D;  4DV2 C;  2JMP A;  2AKL A;  5FLM I;  2DYJ A;  3LUS A;  4DUZ C;  3M3Y I;  2R93 I;  3GKU A;  4LFA C;  2HHH C;  4B3R C;  1KKG A;  1XNQ C;  4NBA A;  1N36 C;  2ATW A;  1XMQ C;  1FJG C;  3S2H I;  3S16 I;  2R7Z I;  4DV5 C;  1I3Q I;  2DE7 A;  5C44 I;  2CY1 A;  4KHP C;  2E8C A;  4DR6 C;  1TWC I;  4Y7N I;  4DCU A;  3S1M I;  4Y52 I;  4JI7 C;  5LMU C;  3S1Q I;  3S2D I;  2NVY I;  4LF8 C;  1TWF I;  2UXD C;  4DV4 C;  2E8F A;  3T1Y C;  1L2F A;  2JNY A;  4JYA C;  3HOZ I;  1WF3 A;  4DV6 C;  1Y1V I;  3M4O I;  1MKY A;  2JA8 I;  4YHH C;  3HOY I;  5LMN C;  3CQZ I;  1L1O C;  1HH2 P;  1IBM C;  3S14 I;  3AF6 A;  1NUI A;  1IBL C;  2UUC C;  1UKK A;  2F4M A;  4DR1 C;  2KZF A;  4LF9 C;  5IT9 D;  1N32 C;  4X64 C;  1ML8 A;  3VMH A;  1PFT A;  4DR2 C;  3S17 I;  4NXM C;  3Q87 A;  1WW9 A;  2JA5 I;  4DV7 C;  2E2H I;  2ONF A;  3R9W A;  2VQE C;  1ZB8 A;  3I07 A;  4X6A I;  2E2I I;  1YUA A;  3FKI I;  3GTM I;  2VQF C;  4BY7 I;  1TFI A;  3GCF A;  4DR3 C;  4NBF A;  4BY1 I;  3S1N I;  1ZB9 A;  3VB9 A;  1SFO I;  2E8E A;  2YU9 I;  2HF1 A;  4LFB C;  4A3L I;  5C4X I;  4DV1 C;  4AQY C;  4NBH A;  2NVX I;  3I4M I;  2OPL B;  2YCB A;  4X66 C;  3VMG A;  4JV5 C;  4JI4 C;  2K5R A;  4X62 C;  2JA6 I;  1J5E C;  1RO4 A;  4QTT A;  4OX9 C;  4K0K C;  3T1H C;  1QWI A;  4GKJ C;  3RZO I;  4JI8 C;  3J81 D;  1RLY A;  2PK7 A;  1Y1W I;  1LQL A;  3H0G I;  4NBD A;  4BBS I;  2J6A A;  3OTO C;  4A3M I;  3JAM D;  2BJO A;  4BBR I;  2EGT A;  4XX2 A;  5C3E I;  2NVQ I;  2OPL A;  3CJE A;  4BXX I;  4LF7 C;  1XNR C;  3IEV A;  3R9X A;  4A3F I;  4MH4 A;  1I6H I;  4DR5 C;  1R9T I;  3VMI A;  1HNZ C;  3I4N I;  1N2F A;  2B63 I;  1NYE A;  1I94 C;  2UUB C;  5IWA C;  4DV0 C;  2R92 I;  1HNX C;  2JA7 I;  3K7A I;  2JR6 A;  4A3K I;  2UXB C;  4NB9 A;  1DL6 A;  3GTK I;  4BSZ A;  4DCS A;  4LF5 C;  4JI6 C; 
#chains in the Genus database with same CATH topology
 3CCM 1;  4A3D I;  5KYT A;  2JIQ A;  4TNU A;  3CC2 1;  5IT9 b;  3PO2 I;  1XS3 A;  3GTJ I;  4QTU A;  2M5O A;  1K8A 1;  2F4O A;  4DCT A;  1TWA I;  2RT9 A;  1AMU A;  1QVF Y;  4E30 A;  5IP7 I;  5CZV A;  4I9G A;  2W04 A;  4DR7 C;  1KRL A;  2IZ4 A;  4NXN C;  2UXC C;  2HU9 A;  3D6W A;  3PO3 I;  4GXR A;  5T8S A;  5A1I A;  3MZL B;  5A1G A;  3PRO C;  1VQO 1;  2H85 A;  3PO3 S;  3EER A;  3CW8 X;  4L7I A;  3CCV 1;  4GKK C;  3JAM b;  1VLA A;  3G4S 1;  2QVZ X;  2HJG A;  1TWG I;  3CC2 Z;  1YJN Z;  3GR0 A;  2UU9 C;  4RM3 A;  4NBG A;  2Y0S A;  2VUM I;  1Q86 1;  4A3G I;  2ASB A;  1I50 I;  1FLO A;  1LCI A;  4GS5 A;  2JIP A;  3N54 B;  2M6N A;  2V8J A;  2QLV B;  1XMO C;  4JI1 C;  1O9T A;  3TDE A;  3HOX I;  3G71 1;  1YJ7 A;  2CXC A;  1WCM I;  2P2F A;  3R44 A;  2VPW A;  2Q51 A;  2K3R A;  2QRC B;  3IEU A;  4TPS B;  5FLM I;  4DUZ C;  4LFC C;  4FTF A;  1N8R 2;  3CCL 1;  1O93 A;  2R7Z I;  1M6X C;  4DV5 C;  2JNV A;  3CC4 1;  3NFZ A;  4E2X A;  3CCS 1;  3S2D I;  4R0M A;  3G71 Z;  4DV4 C;  4PUI A;  3T1Y C;  5FLX f;  3CPW Y;  2JMO A;  3IPL A;  3FQQ A;  3M4O I;  1S72 Z;  2JA8 I;  3HOY I;  3NYR A;  5LMN C;  3CQZ I;  2JUB A;  1IBM C;  1T5H X;  3S14 I;  3AF6 A;  2QEX 1;  3CME 1;  3PBK A;  1NUI A;  5AN9 F;  4DR1 C;  4PRO C;  4LF9 C;  5IT9 D;  1Q81 1;  1Q82 1;  4X64 C;  1VQ8 1;  1PFT A;  3UZ0 A;  4FUT A;  2WB1 A;  1WW9 A;  1T5D X;  3F3F C;  1P4E A;  2ONF A;  3BG0 B;  1VQK 1;  2MM9 A;  2VQE C;  1AA6 A;  3E7W A;  4E31 A;  1VQ6 Z;  2Q4Z A;  3TUF A;  2VQF C;  4BY7 I;  1TFI A;  1P9N A;  2WAQ A;  5BUQ A;  4HH4 A;  3CC4 Z;  1ZB9 A;  2E8E A;  1VQ4 1;  4LFB C;  1VQM 1;  4NFR A;  5FLX b;  4AQY C;  1MDB A;  2NVX I;  2OPL B;  4X66 C;  4JV5 C;  2V3V A;  4X62 C;  1J5E C;  1RO4 A;  2QA4 Z;  1M90 1;  4OX9 C;  1YIT Z;  1Q7Y 2;  1GPM A;  1PG4 A;  3CCU Z;  1QWI A;  4HGZ A;  1RLY A;  2PK7 A;  2V8K A;  4BBS I;  2J6A A;  2PM9 A;  1VQ7 Z;  5A19 A;  4XX2 A;  2NVQ I;  2G2K A;  1P4E C;  3VNS A;  3UX3 A;  3OW2 Z;  3I4N I;  2KDN A;  1I94 C;  3KIF A;  3T4N B;  1HNX C;  2OOX B;  3K7A I;  4G36 A;  4JI6 C;  4CL1 A;  3JAM f;  1NJI 1;  2QA4 1;  4JI0 C;  2AYA A;  5ADZ A;  3CCU 1;  1VEH A;  2M5H A;  4DCV A;  2UUA C;  4MRI A;  3TE5 B;  3GR1 A;  5AE2 A;  4YY3 C;  1RG9 A;  2D7V A;  4B3T C;  4E32 A;  3MZK B;  2W03 A;  2KZ0 A;  1YJ9 Z;  1YJN 1;  1HNW C;  4DUY C;  3GTQ I;  3KIH A;  4A3E I;  2OTL 1;  2YAD A;  2QR1 B;  3GTM S;  4L2Z A;  2F4V C;  1QVG Z;  3U50 C;  3LGX A;  1K83 I;  5CM2 M;  3CCJ Z;  1QYP A;  1VQN Z;  3UOW A;  4NBB A;  3VTN A;  3G6E Z;  1EGA A;  1USP B;  2ZZN A;  5T6B A;  4NDN A;  3J7A 4;  3RV2 A;  2P2M A;  1Q16 A;  2E7G A;  2HHH C;  2DE5 A;  3HOW I;  3DHV A;  2OZK A;  3RG2 A;  4A93 I;  2OBV A;  3H3V J;  1PA4 A;  3GKQ A;  5D1O A;  5K85 A;  4JM1 A;  3L8C A;  2V8I A;  3J80 b;  2D28 C;  3OW2 Y;  2QRE B;  2VPX A;  2PN2 A;  3G6E 1;  4JI2 C;  2P3Y A;  1VQP 1;  3GKU A;  4B3R C;  5BSV A;  2ATW A;  3S16 I;  2CU6 A;  2DE7 A;  5LL6 f;  2CY1 A;  4KHP C;  2O4H A;  1TWC I;  3G4S Z;  4Y52 I;  4JI7 C;  5LMU C;  1TWF I;  1Z03 A;  2E8F A;  3BG1 B;  4MXU A;  1L2F A;  4JYA C;  1M1K 2;  3HOZ I;  2GTI A;  1WF3 A;  3N2Q A;  4ZJZ A;  1P7L A;  1MKY A;  4AYB A;  1QM4 A;  2P2Q A;  5A2Q f;  1ZH1 A;  3CCR 1;  2Y4O A;  4PZP A;  1YUK A;  2VUG A;  1VQ4 Z;  4EWC A;  1IBL C;  1UKK A;  2NCL A;  1VQM Z;  2OO4 A;  2JIO A;  3ETO A;  1ML8 A;  3VMH A;  4DR2 C;  3S17 I;  1RO2 A;  1VQP Z;  4DV7 C;  2VPY A;  3R9W A;  1NP6 A;  2WP0 C;  1ZB8 A;  3I07 A;  4X6A I;  3LNO A;  2E2I I;  5BST A;  3GTM I;  1QXF A;  5DV9 A;  3GCF A;  4DR3 C;  1WJ2 A;  5A2Q b;  4BY1 I;  1RQF A;  1PU1 A;  3VB9 A;  1VQ5 Z;  2YU9 I;  1QVG Y;  1VQ7 1;  3A4I A;  2WD9 A;  2M48 A;  3I56 Z;  4IR7 A;  4DV1 C;  4NBH A;  1KC8 1;  4RVN A;  2YCB A;  4JI4 C;  1S72 1;  2K5R A;  3CCM Z;  1K9M 2;  4D56 A;  3VNR A;  3TDH B;  1N8R 1;  1VQ9 Z;  3A26 A;  4I9F A;  4GKJ C;  5BSU A;  3RZO I;  4RVF A;  3O2E A;  3J81 D;  1W2B Y;  3H0G I;  3QWU A;  4MD8 A;  1UWD A;  3HKZ A;  3PES A;  4D4I A;  3FCE A;  1ULT A;  3LNV A;  4R1L A;  2KI7 B;  2BJO A;  4BBR I;  3CXC Z;  3I56 1;  2VSQ A;  2OPL A;  2JIM A;  2RIQ A;  3CJE A;  3R9X A;  2QRD B;  1I6H I;  4DR5 C;  2NAP A;  3VMI A;  1R9T I;  3E7X A;  4DG8 A;  4RLQ A;  2QKD A;  3TQI A;  2D27 A;  3D9X A;  1YJ9 1;  2JR6 A;  4A3K I;  5IFI A;  4PHT A;  3MON A;  1HR0 C;  3I08 A;  2ZAE B;  3A25 A;  4BC7 A;  1JWH C;  3CCE 1;  3HOU I;  4A3I I;  2E2J I;  4A3J I;  1VQO Z;  4NB8 A;  3NH8 A;  3IML A;  1FUG A;  2ZM6 C;  1X3W A;  1XRB A;  3J80 f;  4WV3 A;  4BCA A;  5KYV A;  3CCQ Z;  1K73 2;  3L95 X;  3CMA Z;  4NOZ A;  4G37 A;  3NDI A;  5T64 A;  1TWH I;  1JOS A;  5IP9 I;  3ESW A;  1M1K 1;  1WH9 A;  4NBE A;  3DLP X;  5BUR A;  3CCL Z;  2GU2 A;  2DE6 A;  2YX1 A;  2D1Q A;  5C4J I;  2QL8 A;  1IB8 A;  3RZD I;  3GTO I;  3CCS Z;  2P20 A;  1WII A;  3J81 b;  1N34 C;  2BH1 X;  2LEX A;  1XRA A;  3P5J B;  2XR1 A;  1MDF A;  1QF8 A;  1Z01 A;  3UEB A;  4B3M C;  4JI3 C;  1Q7Y 1;  5D1O B;  5BSW A;  2GTH A;  2OTJ Z;  4OYC A;  1QVF Z;  4WS9 A;  1W2B Z;  4LF4 C;  2D1T A;  1YI2 Z;  3NH5 A;  4B3S C;  2JS4 A;  2JMP A;  2AKL A;  2YWC A;  2LIY A;  4LFA C;  2R93 I;  4RVG A;  4LE5 A;  1KKG A;  4RVO A;  1VQN 1;  1XNQ C;  5H9U A;  4NBA A;  1FJG C;  1MXA A;  4RM2 A;  4HGY A;  5C44 I;  4U5Y D;  4DR6 C;  4DCU A;  4LF8 C;  1VQL 1;  2NVY I;  2P2B A;  4PUH A;  2JNY A;  1JJ2 Y;  4KTT A;  4DV6 C;  5K8F A;  3EQ6 A;  3IR7 A;  2OTJ 1;  3LAX A;  5D1P A;  3CD6 Z;  2F4M A;  2KZF A;  1N32 C;  1YJW Z;  1VQL Z;  2RPR A;  4NXM C;  3Q87 A;  4E33 A;  2JA5 I;  4ODJ A;  2E2H I;  1V60 A;  2OOY B;  3FKI I;  2O53 A;  1NY8 A;  3A9U A;  2LFU A;  3CQ3 A;  3CQ2 A;  4NBF A;  3SO4 A;  2QVX X;  1K8A 2;  3S1N I;  3F3P C;  1PG3 A;  4L4Q A;  5AE1 A;  2HF1 A;  4A3L I;  4ZLP A;  5CZX A;  1YJW 1;  4MD9 A;  2P28 A;  4E2W A;  1O90 A;  2E7Z A;  4K0K C;  4DGL A;  3T1H C;  5E7Q A;  4DG9 A;  1VQ6 1;  4MD7 A;  1WCJ A;  3FQM A;  4JI8 C;  2JIR A;  3DAY A;  1MD9 A;  2IZ3 A;  4A3M I;  2VF1 A;  2D1R A;  4RVH A;  1Y8C A;  3I55 Z;  2EGT A;  2IV2 X;  3KXW A;  3TR3 A;  4LF7 C;  1MXC A;  4EAT A;  3IF8 A;  2MCQ A;  3B7W A;  1HNZ C;  4HPV A;  1N2F A;  1NYE A;  1VQ9 1;  3UX2 A;  3S82 A;  4D57 A;  4DV0 C;  1KQS Z;  2VZE A;  5BSM A;  2UXB C;  4DV2 C;  3GTK I;  1IBK C;  4S1T A;  4LF5 C;  1FDI A;  4NBC A;  2E0G A;  4A3B I;  2KPI A;  4K0B A;  4A3C I;  1YIT 1;  3J81 f;  1KD1 2;  1MXB A;  5BSR A;  3IX0 A;  5T8T A;  3D2L A;  2NVT I;  3NDJ A;  5LCI A;  3CC7 Z;  2V45 A;  4RV9 A;  3CQ1 A;  4X65 C;  1NJI 2;  3GTP I;  4RVD A;  1SIW A;  3C5E A;  4PUG A;  1K0R A;  1X0T A;  3CCE Z;  4GXQ A;  1RNI A;  3S1R I;  3NH4 A;  1JJ2 Z;  4NH1 C;  4DV3 C;  4MTN A;  3FCC A;  3AF5 A;  1V26 A;  5JRH A;  1X3Z A;  5BUS A;  4RS4 A;  4DR4 C;  2AYD A;  3CMA 1;  5IT9 f;  4MON A;  3CPW Z;  3ETC A;  1USP A;  3HOV I;  2RBL A;  2YWB A;  2E5L C;  5A2Q D;  3GTL I;  1Y1V S;  5T67 A;  3CXC Y;  1RY2 A;  3CCJ 1;  2VPZ A;  2PT7 G;  2QW0 X;  4JI5 C;  4LF6 C;  1M6X A;  3GTG I;  5BR8 C;  5FLX D;  1N33 C;  3NPD A;  2R6M A;  3S15 I;  2V7B A;  1Q86 2;  4G1I A;  3J80 D;  4IZ6 A;  2DYJ A;  2D1S A;  3LUS A;  3M3Y I;  2RHB A;  4BC9 A;  4DK1 A;  1N36 C;  1XMQ C;  1Z02 A;  3S2H I;  4E2Z A;  3G7S A;  1KC8 2;  1I3Q I;  1YHQ Z;  1BA3 A;  3AY0 A;  3CCV Z;  2E8C A;  4Y7N I;  1K73 1;  5GTD A;  1VQ8 Z;  3S1M I;  2UXD C;  3S1Q I;  4RLF A;  2DHM A;  1M90 2;  1VQK Z;  3H2T A;  4ISB A;  1Q81 2;  1Q82 2;  4E2Y A;  4FUQ A;  4KTV A;  1Y1V I;  4YHH C;  2P2J A;  3NYQ A;  3VNQ A;  1L1O C;  1HH2 P;  1FDO A;  1XHJ A;  2UUC C;  2QVY X;  1YHQ 1;  1YI2 1;  3GPC A;  3IFU A;  3EED A;  1WZN A;  1O92 A;  1YUA A;  1KD1 1;  2ZZM A;  2MMA B;  1XRC A;  2QEX Z;  3CME Z;  4BBY A;  1YIJ Z;  1SFO I;  1KQS Y;  2DPL A;  3K6R A;  3I55 1;  3NI2 A;  5C4X I;  2Y4N A;  4D4G A;  3I4M I;  1S7M A;  3VMG A;  4DQY B;  2Y27 A;  4R1M A;  5KEI A;  2JA6 I;  4QTT A;  5AE3 A;  3CCR Z;  3A9V A;  3CD6 1;  1Y1W I;  1LQL A;  4NBD A;  2PRO A;  3OTO C;  3JAM D;  2I3C A;  3CCQ 1;  5C3E I;  3CW9 A;  1TH5 A;  1V25 A;  1XNR C;  2E9H A;  4BXX I;  3IEV A;  2PMZ A;  4A3F I;  4MH4 A;  1K9M 1;  2OTL Z;  4OXI A;  4RMN A;  2UUB C;  2P02 A;  2B63 I;  2Z51 A;  5IWA C;  1YIJ 1;  1VQ5 1;  2R92 I;  2JA7 I;  3CC7 1;  1RO0 A;  4NB9 A;  1DL6 A;  4BSZ A;  4DCS A; 
#chains in the Genus database with same CATH homology
 3CCM 1;  4A3D I;  5KYT A;  4TNU A;  3CC2 1;  5IT9 b;  3PO2 I;  3GTJ I;  4QTU A;  1K8A 1;  2F4O A;  4DCT A;  1TWA I;  2RT9 A;  1AMU A;  1QVF Y;  4E30 A;  5IP7 I;  5CZV A;  4I9G A;  2W04 A;  4DR7 C;  1KRL A;  2IZ4 A;  4NXN C;  2UXC C;  2HU9 A;  3D6W A;  3PO3 I;  4GXR A;  5T8S A;  5A1I A;  3MZL B;  5A1G A;  3PRO C;  1VQO 1;  2H85 A;  3PO3 S;  3EER A;  3CW8 X;  4L7I A;  3CCV 1;  4GKK C;  3JAM b;  1VLA A;  3G4S 1;  2QVZ X;  2HJG A;  1TWG I;  3CC2 Z;  1YJN Z;  3GR0 A;  2UU9 C;  4RM3 A;  4NBG A;  2Y0S A;  2VUM I;  1Q86 1;  4A3G I;  2ASB A;  1I50 I;  1LCI A;  4GS5 A;  3N54 B;  2M6N A;  2V8J A;  2QLV B;  1XMO C;  4JI1 C;  1O9T A;  3TDE A;  3HOX I;  3G71 1;  1YJ7 A;  2CXC A;  1WCM I;  2P2F A;  3R44 A;  2Q51 A;  2K3R A;  2QRC B;  3IEU A;  4TPS B;  5FLM I;  4DUZ C;  4LFC C;  4FTF A;  1N8R 2;  3CCL 1;  1O93 A;  2R7Z I;  4DV5 C;  3CC4 1;  3NFZ A;  4E2X A;  3CCS 1;  3S2D I;  4R0M A;  3G71 Z;  4DV4 C;  3T1Y C;  5FLX f;  3CPW Y;  2JMO A;  3IPL A;  3FQQ A;  3M4O I;  1S72 Z;  2JA8 I;  3HOY I;  3NYR A;  5LMN C;  3CQZ I;  2JUB A;  1IBM C;  1T5H X;  3S14 I;  3AF6 A;  2QEX 1;  3CME 1;  3PBK A;  1NUI A;  5AN9 F;  4DR1 C;  4PRO C;  4LF9 C;  5IT9 D;  1Q81 1;  1Q82 1;  4X64 C;  1VQ8 1;  1PFT A;  3UZ0 A;  4FUT A;  2WB1 A;  1WW9 A;  1T5D X;  3F3F C;  2ONF A;  3BG0 B;  1VQK 1;  2VQE C;  3E7W A;  4E31 A;  1VQ6 Z;  2Q4Z A;  3TUF A;  2VQF C;  4BY7 I;  1TFI A;  1P9N A;  2WAQ A;  5BUQ A;  4HH4 A;  3CC4 Z;  1ZB9 A;  2E8E A;  1VQ4 1;  4LFB C;  1VQM 1;  4NFR A;  5FLX b;  4AQY C;  1MDB A;  2NVX I;  2OPL B;  4X66 C;  4JV5 C;  4X62 C;  1J5E C;  1RO4 A;  2QA4 Z;  1M90 1;  4OX9 C;  1YIT Z;  1Q7Y 2;  1GPM A;  1PG4 A;  3CCU Z;  1QWI A;  4HGZ A;  1RLY A;  2PK7 A;  2V8K A;  4BBS I;  2J6A A;  2PM9 A;  1VQ7 Z;  5A19 A;  4XX2 A;  2NVQ I;  2G2K A;  3VNS A;  3OW2 Z;  3I4N I;  1I94 C;  3KIF A;  3T4N B;  1HNX C;  2OOX B;  3K7A I;  4G36 A;  4JI6 C;  4CL1 A;  3JAM f;  1NJI 1;  2QA4 1;  4JI0 C;  2AYA A;  5ADZ A;  3CCU 1;  4DCV A;  2UUA C;  4MRI A;  3TE5 B;  3GR1 A;  5AE2 A;  4YY3 C;  1RG9 A;  2D7V A;  4B3T C;  4E32 A;  3MZK B;  2W03 A;  1YJ9 Z;  1YJN 1;  1HNW C;  4DUY C;  3GTQ I;  3KIH A;  4A3E I;  2OTL 1;  2YAD A;  2QR1 B;  3GTM S;  4L2Z A;  2F4V C;  1QVG Z;  3U50 C;  3LGX A;  1K83 I;  5CM2 M;  3CCJ Z;  1QYP A;  1VQN Z;  3UOW A;  4NBB A;  3VTN A;  3G6E Z;  1EGA A;  1USP B;  5T6B A;  4NDN A;  3J7A 4;  3RV2 A;  2P2M A;  2E7G A;  2HHH C;  2DE5 A;  3HOW I;  3DHV A;  2OZK A;  3RG2 A;  4A93 I;  2OBV A;  3H3V J;  1PA4 A;  3GKQ A;  5D1O A;  5K85 A;  4JM1 A;  3L8C A;  2V8I A;  3J80 b;  2D28 C;  3OW2 Y;  2QRE B;  2PN2 A;  3G6E 1;  4JI2 C;  2P3Y A;  1VQP 1;  3GKU A;  4B3R C;  5BSV A;  2ATW A;  3S16 I;  2DE7 A;  5LL6 f;  2CY1 A;  4KHP C;  2O4H A;  1TWC I;  3G4S Z;  4Y52 I;  4JI7 C;  5LMU C;  1TWF I;  1Z03 A;  2E8F A;  3BG1 B;  4MXU A;  1L2F A;  4JYA C;  1M1K 2;  3HOZ I;  2GTI A;  1WF3 A;  3N2Q A;  4ZJZ A;  1P7L A;  1MKY A;  4AYB A;  1QM4 A;  2P2Q A;  5A2Q f;  1ZH1 A;  3CCR 1;  2Y4O A;  4PZP A;  1YUK A;  2VUG A;  1VQ4 Z;  4EWC A;  1IBL C;  1UKK A;  1VQM Z;  2OO4 A;  3ETO A;  1ML8 A;  3VMH A;  4DR2 C;  3S17 I;  1RO2 A;  1VQP Z;  4DV7 C;  3R9W A;  1NP6 A;  2WP0 C;  1ZB8 A;  3I07 A;  4X6A I;  5BST A;  2E2I I;  3GTM I;  5DV9 A;  3GCF A;  4DR3 C;  5A2Q b;  4BY1 I;  1RQF A;  3VB9 A;  1VQ5 Z;  2YU9 I;  1QVG Y;  1VQ7 1;  3A4I A;  2WD9 A;  2M48 A;  3I56 Z;  4IR7 A;  4DV1 C;  4NBH A;  1KC8 1;  4RVN A;  2YCB A;  4JI4 C;  1S72 1;  2K5R A;  3CCM Z;  1K9M 2;  4D56 A;  3VNR A;  3TDH B;  1N8R 1;  1VQ9 Z;  4I9F A;  4GKJ C;  5BSU A;  3RZO I;  4RVF A;  3J81 D;  1W2B Y;  3H0G I;  3QWU A;  4MD8 A;  4D4I A;  3HKZ A;  3PES A;  3FCE A;  1ULT A;  3LNV A;  4R1L A;  2KI7 B;  2BJO A;  4BBR I;  3CXC Z;  3I56 1;  2VSQ A;  2OPL A;  3CJE A;  2RIQ A;  3R9X A;  2QRD B;  1I6H I;  4DR5 C;  1R9T I;  3VMI A;  3E7X A;  4DG8 A;  4RLQ A;  2QKD A;  3TQI A;  2D27 A;  3D9X A;  1YJ9 1;  2JR6 A;  4A3K I;  5IFI A;  4PHT A;  3MON A;  1HR0 C;  3I08 A;  2ZAE B;  4BC7 A;  1JWH C;  3CCE 1;  3HOU I;  4A3I I;  2E2J I;  4A3J I;  1VQO Z;  4NB8 A;  3NH8 A;  3IML A;  1FUG A;  2ZM6 C;  1X3W A;  1XRB A;  3J80 f;  4WV3 A;  4BCA A;  5KYV A;  3CCQ Z;  1K73 2;  3L95 X;  3CMA Z;  4NOZ A;  4G37 A;  3NDI A;  5T64 A;  1TWH I;  1JOS A;  5IP9 I;  3ESW A;  1M1K 1;  1WH9 A;  4NBE A;  3DLP X;  5BUR A;  3CCL Z;  2GU2 A;  2DE6 A;  2D1Q A;  5C4J I;  2QL8 A;  3RZD I;  3GTO I;  3CCS Z;  2P20 A;  1WII A;  3J81 b;  1N34 C;  2BH1 X;  1XRA A;  3P5J B;  2XR1 A;  1MDF A;  1QF8 A;  1Z01 A;  4B3M C;  4JI3 C;  1Q7Y 1;  5D1O B;  5BSW A;  2GTH A;  2OTJ Z;  4OYC A;  1QVF Z;  4WS9 A;  1W2B Z;  4LF4 C;  2D1T A;  1YI2 Z;  3NH5 A;  4B3S C;  2JS4 A;  2JMP A;  2AKL A;  2YWC A;  2LIY A;  4LFA C;  2R93 I;  4RVG A;  4LE5 A;  1KKG A;  4RVO A;  1VQN 1;  1XNQ C;  5H9U A;  4NBA A;  1FJG C;  1MXA A;  4RM2 A;  4HGY A;  5C44 I;  4U5Y D;  4DR6 C;  4DCU A;  4LF8 C;  1VQL 1;  2NVY I;  2P2B A;  2JNY A;  1JJ2 Y;  4KTT A;  4DV6 C;  5K8F A;  3EQ6 A;  2OTJ 1;  3LAX A;  5D1P A;  3CD6 Z;  2F4M A;  2KZF A;  1N32 C;  1YJW Z;  1VQL Z;  2RPR A;  4NXM C;  3Q87 A;  4E33 A;  2JA5 I;  4ODJ A;  2E2H I;  2OOY B;  3FKI I;  2O53 A;  3SO4 A;  3A9U A;  2LFU A;  4NBF A;  2QVX X;  1K8A 2;  3S1N I;  3F3P C;  1PG3 A;  4L4Q A;  5AE1 A;  2HF1 A;  4A3L I;  4ZLP A;  5CZX A;  1YJW 1;  4MD9 A;  2P28 A;  4E2W A;  1O90 A;  4K0K C;  4DGL A;  3T1H C;  5E7Q A;  4DG9 A;  1VQ6 1;  4MD7 A;  3FQM A;  4JI8 C;  3DAY A;  1MD9 A;  2IZ3 A;  4A3M I;  2VF1 A;  2D1R A;  4RVH A;  3I55 Z;  2EGT A;  3KXW A;  4LF7 C;  1MXC A;  4EAT A;  3IF8 A;  3B7W A;  1HNZ C;  4HPV A;  1N2F A;  1NYE A;  1VQ9 1;  4D57 A;  3S82 A;  4DV0 C;  1KQS Z;  2VZE A;  5BSM A;  2UXB C;  4DV2 C;  3GTK I;  1IBK C;  4S1T A;  4LF5 C;  4NBC A;  2E0G A;  4A3B I;  2KPI A;  4K0B A;  4A3C I;  1YIT 1;  3J81 f;  1KD1 2;  1MXB A;  5BSR A;  3IX0 A;  5T8T A;  2NVT I;  3NDJ A;  3CC7 Z;  4RV9 A;  4X65 C;  1NJI 2;  3GTP I;  4RVD A;  3C5E A;  1K0R A;  1X0T A;  3CCE Z;  4GXQ A;  1RNI A;  3S1R I;  3NH4 A;  1JJ2 Z;  4NH1 C;  4DV3 C;  4MTN A;  3FCC A;  3AF5 A;  1V26 A;  5JRH A;  1X3Z A;  5BUS A;  4RS4 A;  4DR4 C;  3CMA 1;  5IT9 f;  4MON A;  3CPW Z;  3ETC A;  1USP A;  3HOV I;  2RBL A;  2YWB A;  2E5L C;  5A2Q D;  3GTL I;  1Y1V S;  5T67 A;  3CXC Y;  1RY2 A;  3CCJ 1;  2PT7 G;  2QW0 X;  4JI5 C;  4LF6 C;  3GTG I;  5BR8 C;  5FLX D;  1N33 C;  3NPD A;  2R6M A;  3S15 I;  2V7B A;  1Q86 2;  4G1I A;  3J80 D;  4IZ6 A;  2DYJ A;  2D1S A;  3LUS A;  3M3Y I;  2RHB A;  4BC9 A;  4DK1 A;  1N36 C;  1XMQ C;  1Z02 A;  3S2H I;  4E2Z A;  3G7S A;  1KC8 2;  1I3Q I;  1YHQ Z;  1BA3 A;  3CCV Z;  2E8C A;  4Y7N I;  1K73 1;  5GTD A;  1VQ8 Z;  3S1M I;  2UXD C;  3S1Q I;  4RLF A;  1M90 2;  1VQK Z;  3H2T A;  4ISB A;  1Q81 2;  1Q82 2;  4E2Y A;  4FUQ A;  4KTV A;  1Y1V I;  4YHH C;  2P2J A;  3NYQ A;  3VNQ A;  1L1O C;  1HH2 P;  2UUC C;  2QVY X;  1YHQ 1;  1YI2 1;  3GPC A;  3IFU A;  3EED A;  1O92 A;  1YUA A;  1KD1 1;  1XRC A;  2QEX Z;  3CME Z;  4BBY A;  1YIJ Z;  1SFO I;  1KQS Y;  2DPL A;  3I55 1;  3NI2 A;  5C4X I;  2Y4N A;  4D4G A;  3I4M I;  1S7M A;  3VMG A;  4DQY B;  2Y27 A;  4R1M A;  5KEI A;  2JA6 I;  4QTT A;  5AE3 A;  3CCR Z;  3A9V A;  3CD6 1;  1Y1W I;  1LQL A;  4NBD A;  2PRO A;  3OTO C;  3JAM D;  2I3C A;  3CCQ 1;  5C3E I;  3CW9 A;  1V25 A;  1XNR C;  2E9H A;  4BXX I;  3IEV A;  2PMZ A;  4A3F I;  4MH4 A;  1K9M 1;  2OTL Z;  4OXI A;  4RMN A;  2UUB C;  2P02 A;  2B63 I;  5IWA C;  1YIJ 1;  1VQ5 1;  2R92 I;  2JA7 I;  3CC7 1;  1RO0 A;  4NB9 A;  1DL6 A;  4BSZ A;  4DCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...