4IZ6A

Structure of ente and entb, an nrps adenylation-pcp fusion protein with pseudo translational symmetry
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
614
structure length
609
Chain Sequence
SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSREVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure determination of the functional domain interaction of a chimeric nonribosomal peptide synthetase from a challenging crystal with noncrystallographic translational symmetry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Enterobactin synthase component E, Isochorismatase
total genus 198
structure length 609
sequence length 614
chains with identical sequence B
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4iz6A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4iz6A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iz6A01
2JU2A 2FAEA 2JQ4A 2N5IA 2X2BA 3GZLA 4R0MA 1YJ7A 2P2BA 2P20A 2AF8A 4GS5A 5BUSA 2GDXA 3QYAA 1T5HX 2D1SA 4M46A 4LGCA 2QVYX 4H2WC 2P2QA 5BSUA 3WV4A 2FHSC 1T5DX 3EJEA 3KXWA 2FQ2A 5BSRA 3G7SA 4ISBA 4G37A 3RIXA 2KR5A 2LKIA 3B7WA 2K0XA 2M5RA 2FACA 3EQ6A 3U17A 2FVEA 2N5HA 1KLPA 2Y4OA 2KOSA 3DAYA 5HV8A 4BPFA 3C5EA 5KP7B 2VZEA 2MR7A 4GXQA 1DV5A 2LMLA 1LCIA 4FUTA 3LGXA 2KOOA 2K93A 5BUQA 2KOQA 3WV5A 2GDWA 2QVZX 2L4BA 2QW0X 3NY7B 4PXHB 2K92A 3DLPX 4H2YC 2VSQA 1MDFA 3T5CA 4RLFA 2KG8A 2Y4NA 2MR8A 4RVNA 5BSWA 5KEIA 2JGPA 2LPKA 5K8FA 3O83A 5JRHA 4GR4A 4PWVB 5K85A 1RY2A 3IERA 2LL8A 4GR5A 3LAXA 3IESA 4OXIA 5BSMA 5HVCA 2LTEA 2KW2A 3EJDA 2XZ0D 2QVXX 1OR5A 4OYCA 1MD9A 1PG4A 5BSVA 3O82A 3CE7A 3E7XA 3ETCA 4R1MA 2FADA 5KYVA 3U16A 1L0IA 2K0YA 4MRTC 3L8CA 1X3OA 2N6YA 3FCCA 2KGEA 2L9FA 2N6ZA 5EJDA 1ACPA 1MDBA 3VNQA 2KGCA 4RM2A 4E5DA 4D56A 2MVUA 1NQ4A 2KGAA 3GZMA 2MD9A 4HKGA 3PBKA 4GXRA 2D1TA 4U5YD 3A9UA 1ULTA 2P2MA 2EHSA 2MVVA 2D1RA 1AMUA 3E7WA 3EJBA 4RVOA 5KP6B 3LNVA 2P2JA 3TSYA 4G36A 2FVFA 2PNGA 3WVNA 2KWLA 4EATA 4FUQA 2QNWA 3A9VA 5GTDA 2WD9A 2AFEA 2KG9A 4BPGA 1T8KA 1BA3A 2D1QA 3R44A 3NYRA 2N98A 4RM3A 5IFIA 4R1LA 2Y27A 4IZ6A 4NEOA 2L22A 2FVAA 2MF4A 1DNYA 2JU1A 1AF8A 2V7BA 2MY5A 2LIWA 5CZDB 3LMOA 4D57A 2KG6A 4D4IA 1V26A 2AVAA 3GPCA 4W8OA 4WV3A 5DWVA 3E53A 3T5AA 4IR7A 1PG3A 3VNSA 3RG2A 2AFDA 5E7QA 1V25A 3ITEA 2XZ1C 5DV9A 5KYTA 4CA3A 4DG9A 4BPHA 4RLQA 2KORA 2LIUA 3NI2A 4DG8A 3IEPA 5KP8B 3O84A 2CNRA 2DNWA 2FQ0A 4PZPA 3FCEA 1HY8A 4D4HA 5BSTA 2EHTA 2FQ1A 2CGQA 2K2QA 2K94A 3VNRA 4ZJZA 3IPLA 4D4GA 3DHVA 2KGDA 2ROQA 2L0QA 1HQBA 2CQ8A 3NYQA 2LOLA 3CW8X 1VKUA 4RMNA 1L0HA 2KOPA 2CG5B 3IVRA 5D6NA 3T5BA 2GDYA 3CW9A 2N50A 4H2XC 5BURA 2P2FA 1F80D
chains in the Genus database with same CATH superfamily
2NU7A 4WBSA 3E9ZA 4XVHA 4LXHA 3AVXA 1HE3A 1ML8A 1I1NA 4YK7A 4QJ3A 1IB6A 3K31A 2YS6A 1WNTA 1KOFA 1SIBE 3VTFA 3FUTA 4K28A 3ZDEA 2IC5A 4ZI7F 3EGWA 1SK9A 2PKXA 2PXAA 4JH0A 4L07A 4BS9A 2EEZA 4ZU6X 4BNYA 2IYRA 4EABA 2ADFA 1RCUA 3P97A 4G1CA 1BO6A 1QF9A 1B76A 4R1UA 4X9XA 3D0QA 1EXDA 2OBLA 4LDAA 1GSAA 5EY5B 2BJOA 2O3SA 3WRXA 4MJ3A 1KPHA 4KR7A 4HWTA 2X0NA 1JMYA 2GXSA 3F6SA 3IODA 2PUVA 4R0NA 3FPSA 4UHDA 4X1KA 4R7GA 5HE9A 2HCBA 1P7VA 3PKJA 1HZZA 4J7XA 4MR9B 3OTHA 2ACEA 1C0PA 1U4SA 5F3WB 1N9KA 4BMNA 3M1MA 2LCIA 5FI0B 5EJ6A 5ALOA 1F8FA 4OAPA 2A6PA 2EFJA 2YL2A 2XUGA 4W7HA 5JNRA 2P91A 1EGQA 2QP4A 2V5UA 2XWSA 4ZV9A 1US8B 3DNFA 1Q92A 2WC1A 1SUEA 5DHTA 4XYGA 1XL1A 2ZIAA 4BJ1A 2UYCA 4LDJA 4TRJA 1DZIA 1V71A 2BY4A 2J7PA 3QXSA 2IEAA 1UZAA 1VIAA 3X2EA 1ID1A 1E8MA 2C7GA 2XMSA 4U2DA 3KQKA 1SZDA 3D2CA 3DPIA 4IJVA 4WOCA 4AULA 1IRIA 3S3TA 2CDCA 5A1TA 5A3RA 1EP1B 4GPZA 1PUIA 3IUYA 3JZMA 5DXFA 4PSAA 1PR5A 3B1FA 3H1EA 3LW7A 1G0OA 2HCFA 2BMFA 4Z3DA 1GSOA 3RFCA 2QRUA 4XIJA 3ROZA 4B75A 4RF3A 1U4OA 1UKVY 3LTEA 5AE2A 5TVKA 1VKHA 4D3SA 1LBQA 4YRIA 1ZOSA 4Q4CA 1RVDA 2GN1A 5L3SA 2O59A 2QRQA 3D6HA 3Q3JB 4TTIA 4B9EA 5A02A 1T3TA 4DCMA 2IXTA 2OB2A 3G6EP 4HDMB 3ORQA 1Z9BA 2Q0XA 3D0KA 2G7MC 1K4MA 3TNLA 1SUWA 1VKOA 1DVRA 2IHTA 3F4BA 4V0MA 2PR7A 2OR3A 4PC3A 3BWEA 2QHXA 2QQEA 4QL3A 5TLSA 2IHZA 1N5LA 4S1NA 1Q0LA 4TWBA 1FFXA 1S2LA 2CK3A 3KLOA 4GX0A 1L5RA 4KQHA 1YDMA 4UXJA 3VDNB 4CTKA 4FNGA 4D4JA 1RWBA 1T36A 2A0FA 3MTGA 2VHVA 4ZEXA 1ZIOA 5FLXA 5FOSA 1WEKA 4QYXA 2PX8A 2HRZA 4O2AA 1RC0A 2Z9DA 1YOBA 2X3YA 3FMVA 4LE1A 1TAUA 4KQJA 2FN3A 2PIDA 1SQFA 2QVBA 2UZIR 3BB1A 3V4VB 1QR6A 3WRYA 2ROQA 3DBLA 3M4YA 4C08A 2VBGA 5U4QA 1KNXA 1Z22A 3TGWA 1ZIPA 1C3XA 5CCXA 2OGTA 3HHPA 5F77A 1WD5A 621PA 1G98A 3DT6A 1MB9A 1I2BA 1QB7A 3SQOA 1JSRA 3UWPA 3VYTB 3SGLA 3QYAA 2Y93A 4KODA 1R8SA 4ZT4A 1PZHA 1T34A 1Y3FE 4TLDA 2BFDB 1ISHA 3ZDFA 1RHMA 1WOMA 3ESRA 5IYZA 4N82A 2RH5A 1XC7A 3F1KA 1A5SB 3PK0A 1TPYA 3EUWA 4NU0A 1GPDG 4GUDA 5EERA 4LYFA 3JVUA 2CGEA 3ZD7A 1YO6A 3QMMA 1XCJA 1H1LB 2GM3A 1IEVA 4GLLA 4RTSA 2MU1A 3D6NB 3AL2A 3GDHA 4R0VA 2AV6A 1FQWA 2A1UB 4UASA 4LBWA 2FN4A 3UQZA 2VAPA 5EMMA 2VNKA 4INAA 4JB8A 3FVVA 5AKJA 1PDOA 1VKRA 4X1YA 1XVIA 3ESXA 2K93A 4G5OA 4M0EA 3N8DA 3MWLA 2Z09A 1UL1X 1NY6A 2Y1GA 3I8XA 3VOBA 1F7VA 1RQLA 3OT1B 2CV0A 5IF9A 1I94B 4LZOA 4K8RB 3DBLB 3DTNA 1PWXA 3RUAA 4B6FA 1RJ9B 1GRQA 4RVNA 2YZ7A 1DEOA 4EI7A 3P7MA 3HDGA 5LCXA 1FTQA 3HY3A 4QA9A 5K85A 3RVQA 2ZAOA 4L57A 4BUJA 5JYBA 2E49A 3ZVMA 2UZ1A 3IHTA 4R2HA 1QANA 5LDDC 1EFVB 1V8PA 2PX4A 4NZ9A 1N32C 2V5VA 4PFKA 4UHEA 3UPUA 2BMJA 2BJHA 4OXRA 4G8CA 3L1JA 2ZPTX 2FW6A 2P90A 4K9NA 4Q4HA 2ZXFA 5K8LA 3PD7A 4HGPA 3T1OA 5LJLA 1P1JA 1EZ4A 5ITSA 3KQNA 3QVWA 1XL0A 3DEAA 2F4VB 1N1MA 2E1PA 4YRZA 3B1YA 1ECGA 4YRMA 3ZXYA 4YMGA 3VNAA 1AK2A 1VIVA 4WINA 3DV0A 4F84A 3FWYA 4FJ2A 1S7GA 4F21A 1P17A 4GBED 4IMRA 4O2AF 5AVKA 5H83A 5AESA 1Q7EA 4DWWA 1YJ5A 3IRUA 1KYIA 1KJYA 2DUWA 1SBCA 3CLRC 4NS4A 5J4LA 3P5BA 3L7BA 3MRSA 1YK1A 1XQ1A 4MZDA 4ZC8A 4OLHA 4XE5A 4C30A 3UKOA 3V5NA 4AY3A 4D9EA 4C3VA 1UDBA 4E1VA 2G0NA 4RH3A 1RCFA 5T8TA 3R77A 5AKXA 2XB9A 4NDNE 2FVAA 3DOJA 1Y6JA 2HK6A 2B6HA 2WJGA 4BO2A 3IYLW 1AGNA 2QROA 3LMOA 2UZ0A 4HB2A 4DWOA 2O7QA 1TKAA 1GCAA 1P62B 2W6NA 4JSTA 4W1PA 4C0SA 1DJPA 2FX5A 1KY4A 4RGBA 1V4BA 3RSOA 3TEMA 5CXQA 4Q47A 1M2HA 1J2RA 3HDQA 3RIEA 4RPIA 4Y1EA 4EBFA 5DV9A 1D9XA 1JSLA 1KBQA 4A8JA 5LD2C 1JEYB 1NY5A 3QKRB 5CDSA 1OAOC 3FNHA 3OZAA 4P4GA 2P1RA 4XFZA 4MYSA 3U3KA 3IIKA 3BGIA 2G28A 4RFVA 5JVDB 1HM5A 5B7GA 3RVNA 1VJ5A 1Z7YA 1SHUX 1FNSA 3F6RA 1W36D 2VPZA 3BQ9A 3R7BA 3AOGA 1GNPA 3VSDA 2X4LA 4EKNB 1YQQA 3IBGA 3FYHA 2DBZA 3JQBA 1XQ9A 4C4RA 4E14A 1F2DA 3ASYA 3L04A 1NKTA 1SVKA 3D2BA 3L01A 2GHTA 4MR9A 2KODA 1DC3A 1YU6A 3GUVA 1M0EA 3DWEX 1E5DA 2AS0A 2VC2B 2JFZA 3HYSA 4TL6A 3FNFA 3DBRB 4F8YA 4XYEA 3PEWA 1SOMA 2MCQA 1HDZA 3S68A 5KHOC 3W3AD 3JRNA 3ZNPA 3GA0A 4KDEA 4Z4IA 4YV2A 4WIAA 2FHSC 1J8DA 1JHOA 2J07A 2J6IA 1YC5A 4LV5B 4A15A 4H08A 3IKJA 3KKOA 2WU0A 1JBQA 4PLWA 3SP1A 4V0LA 4HLUC 1JOSA 5I51A 1EESA 2H1CA 3EG5A 1K06A 3F1LA 3H9JA 5A7HA 4K1XA 3IPRA 1NMSA 4YRAA 3PCXA 1T3ZA 3FPCA 1G1MA 3EVEA 5D51S 1W4AA 4LKOA 4ECEA 1EJ6A 2ZYRA 2Q5HA 1L4MA 4UEJA 2DHRA 2BISA 3F74A 2X9LA 1A71A 1CRLA 3OE7D 1BS9A 1C9JA 3IXQA 4N5HX 4Q1DA 3HJCA 1S3FA 2OGSA 3C74A 3GPIA 3QYFA 1L5NA 4P32A 2X5OA 3D3EA 3U31A 3W2IA 1SRQA 3L4KA 4DLUA 3W4IA 2VXCA 4BO5A 4G85A 3IH5A 3SF8B 4TMWA 4URYR 5J1SB 5DI3A 1T1EA 2GCNA 2I80A 3RI3A 3PKZA 4N5LA 2VZ8A 5I9NA 5U9CA 5CA0F 3BH6A 5C7LO 3TEJA 1W1UA 4LSGA 1HH2P 1QPGA 3WA6A 2BGJA 4B7AA 1RC8A 3GFFA 2A67A 5JJCA 4YJ3A 4C0XA 4D8UA 3K1YA 4PGFA 5K0GA 1N6PA 3TI9A 4DR3C 4PNPA 2XZ0D 4UVDA 4IGEA 1E63A 3CCEP 3GFGA 4P1ZA 4NNJA 1Q7GA 1K0RA 1J7KA 1GTVA 4GEKA 1U80A 5EKSA 1L5KA 4DUGA 1EAYA 1UCFA 4FD2A 4M0UA 4JVLA 5K3CA 1ANKA 2C4HA 4BWVA 3WO1A 1ZJWA 4QBFA 2QLJA 4EF4A 3VYRB 1E4VA 5KNDD 3B1ZA 1G4UR 2MTBA 3ORFA 1U1GA 2C1EA 4LOJA 5BW8A 4E09A 2EFDB 1KTIA 4J4BA 2CJWB 2IPOA 3EH2A 3LNVA 3I73A 4OPMA 3QVVA 1XTRA 4QLOA 3C4QA 3PGKA 3O8QA 2WA1A 5AJUA 2YDYA 3ER9A 1JHXA 2XE4A 4QIHA 4D74A 2XOKA 2X0EA 5LZ7A 2X19A 1PTJC 4OBWA 1CZHA 1QPBA 1LBIA 1R4MA 5DX0A 2Z51A 2ZBFA 4EW2A 2PEJA 3JVVA 1DOAA 1JE1A 1I0ZA 4FOLA 2A0UA 1WSWA 2ZUCA 3KHSA 4JC4A 1VE5A 4NAUA 4IIXA 4Q6BA 1CNFA 2IP1A 2PQ6A 2HHAA 4MW2A 1TK3A 2GN9A 3ANYB 3WMRA 3M2PA 4LQLA 3C4VA 3QPAA 1XDGA 2JARA 3QNWA 1AKUA 1Z4PX 1MT3A 1TA9A 4O02B 3QVJA 4LOLA 1ESCA 2AFIA 3QLVA 1E18A 1YB4A 2WLSA 3N5KA 5C46F 1AA6A 2VYVA 4ZMRA 5DLYA 5IJ0B 3WRYC 4AMBA 4D8TA 3HLTA 2P9XA 2GBGA 4L3WA 2HL6A 4L72A 5FFMA 2DWQA 3RYTC 1ETUA 2AH5A 3TLBA 1IY9A 1T0PA 1M67A 4AP5A 2BGIA 2LP4Y 5IK2A 4LG1A 2PJDA 5EHIA 4CHGA 1MJFA 2PWZA 1M6NA 4BP9A 1DXQA 1VZ2A 2WAAA 5E6UA 5D5QA 1OVGA 5JWRA 2W2VA 2ZRKA 4X1YB 3ZS9A 5B30A 1G5HA 3DVRX 5DTMA 4PCAA 2C9ZA 4ZVKA 4LWPA 1PWZA 1HDIA 3WGTA 4YP9A 1OWOA 2X15A 1M1YB 4FYVA 3GG9A 3KJEA 4I36A 1V9CA 3O73A 1ZVKA 4K6OA 4NCNA 3PHIA 4JI6C 1XNRB 2XUOA 3O8LA 1NLMA 1YRBA 2B1IA 3PX3A 1CRWG 2DY0A 1NVGA 1G8HA 1GPYA 2Q3MA 3CUKA 4IKEA 2SKCA 2TS1A 2VP5A 3G82C 3KPJA 1BX1A 3R9WA 2PL1A 3P1JA 1PG2A 4HTFB 3AR7A 4RVCA 2CVZA 4JC5A 1U7HA 3ROEA 3IAS1 3L93A 1OTXA 3QMPA 3S2SA 4LF8C 3NBUA 1GRNA 1WY7A 2VJYA 4QJ5A 4DA6A 1Y98A 5LMNC 4BGIA 1I7PA 1HDOA 3RO7A 3C5CA 1NURA 2WHXA 4JX8A 4MJ7A 5IVPA 1PEKE 4FGSA 4KN6A 3BRCA 1E20A 5ALFA 4DV2B 4AI6A 1Y8CA 4LOIA 4MCHA 3DOEA 3SE0A 2KOSA 1NOIA 1O0CA 1GN9A 4L08A 2O23A 3V2HA 4B73A 1KY2A 3H6HA 3A37A 1NF8A 3IQGX 3DW3X 4N0QA 4N1AA 4OB8A 5JMTA 2EF0A 2PXCA 4EL5A 3PF9A 1ITZA 2O1WA 3BORA 4WPGA 3PR1A 3MJSA 3ORSA 4CM9A 5C8YA 2ZPUA 5EJ5A 1GV0A 2IZ5A 4OF4A 4PSVA 3MELA 1GNQA 2QW0X 4RTNA 5KU7A 3Q87B 3JD4A 1TYDE 4UUBA 4TYYA 4R01A 3OM9A 4X64C 4Q1BA 5KNCA 4ZU1X 1QE5A 3THSA 4CM4B 4C7OB 1L5MA 5JJKA 1MO4A 1KA9H 4FTFA 2RHDA 2OCPA 4WNCA 2VJDA 3R5HA 1HT2E 4JOBA 1HBJA 2GRUA 4UNIA 3P9SA 3UX2A 1Z5GA 2FN9A 3FAZA 4UUOA 1P3DA 4W1QA 4XWTA 4K0KB 5LZ8A 1QQTA 3UMFA 4Z1MD 3O82A 4Z1OA 3JRXA 4A0GA 1PL8A 3JPWA 4IQGA 1N2OA 1YJ8A 4M22A 4M9ZA 4BLRA 1KIMA 2BI7A 1QIHA 5BMVA 3IPXA 1OD6A 2X0JA 4BTVA 4B3TC 1DX4A 4LGMA 3L7AA 4KZPA 5K51A 5I7FA 1X74A 3GNTA 4ZXFA 2W37A 5FPQA 3LDGA 3C6ZA 4FFMA 3COYA 4UDNA 3PHGA 4ZAGA 2W6JA 4WESB 3WB1A 2QR5A 3CE9A 4REOA 3NBXX 1DOZA 3MFYA 1J0XO 3CRQA 3NEAA 4RD3A 1F8XA 4ICIA 5HDBB 1EHYA 1X1EA 1CUCA 1SVOA 4MHOA 1ACMA 1MC8A 2ZRMA 3DT8A 1NRXA 3LBYA 4EY3A 3IAM1 5DNCA 2IYXA 2BEUA 3KVOA 1ESDA 2V8BA 3NOVA 1EB9A 2GEUA 4RF4A 4Q7QA 1NW5A 3MEQA 2HBZA 1GGEA 3I6QA 4B3RC 1L7OA 2I4TA 4Z0HO 3D59A 4NXNB 2ZJ0A 1LK0A 3N2GA 4TXNA 3UPTA 2VTBB 3H4VA 5EHGA 3FLAA 3VPHA 1F1BA 4P2GA 2H4HA 2R6AA 3HUUA 3K70B 3CQ9A 3EZLA 1X1CA 4YHHC 3MC1A 3TAHA 4G6ZA 1C3VA 3KYJB 1F14A 2W4IA 3TTTA 4B2IA 4A2WA 4BVGA 4BX0A 1ZRNA 4YJHA 3ETGA 2JIOA 4I66A 1D0SA 2CNWA 4TV9F 2IIPA 2V7XA 4C06A 3DDCA 1K7XB 4ZIRB 1I94C 1TU0A 1A4XA 1I4DD 3D81A 4F4FA 1M34E 2PWBA 2WSSA 4LJ8A 4IUDS 2GKOA 3L92A 3UK1A 3T7IA 5FF9A 3PR2B 4QUAA 1ISIA 1QHHA 1ZC4A 3ETJA 2AFHA 5GV8A 4TWRA 2P6OA 3NOXA 1ZH4A 3H4EA 4OHVA 4DXAA 3WLSA 4DLVA 5GAJA 4CKBB 4HX9A 5CXXA 3F8SA 1JIUA 1EUCA 2GJAA 4KXYA 2M6LA 3R9IA 5C8ZA 1HOTA 5FWDA 3H05A 1LS1A 3LV8A 2WIAA 3OHMA 5DNEA 3AFMA 1HEYA 1S0UA 4EB3A 2OYCA 1T5DX 1J39A 4A92A 3RGWS 1GKLA 4ZZ3A 4HR7A 2QZSA 2PT5A 3V4ZA 4D9BA 4X7MA 3AW9A 4R5MA 1DXOA 3SS8A 3ZNNA 1KRXA 2G76A 4KZKA 3NC0C 4QREA 4B3DA 2NACA 3BHIA 2BD0A 3OOYA 5FWYA 2C3MA 1NATA 4J03A 3WYFA 4NI5A 5L3VA 3R5FA 1T1RA 2QL7A 1JI3A 3W8EA 5B3JC 2O19A 4EA8A 2QD5A 4ASUD 4EG5A 4KGXA 4JI4B 4EYSA 1G3MA 4RU1A 1BOOA 3B6KA 3T5PA 2ZVJA 2VO1A 1OWMA 1CY8A 1TUBA 2DFVA 3FNIA 3GGJA 4Q21A 4RZ3A 3VVLA 4IHAA 1D2AA 2BKXA 2JYLA 1MF7A 3O2SB 2WKRA 3B2NA 1WU8A 4F9FA 1WF3A 4KQ9A 5AVZA 1GNRA 4FOOA 2ZYWX 3L02A 3M6WA 4I5EA 4I4TA 4NONA 4ETWA 4WLFA 4DIDA 5LA6B 2XZOA 3KNZA 3ZCTA 1JUDA 5JS1A 3FR8A 5JRZA 4MWSA 2EHDA 1E5VA 1XCPA 3L05A 1A96A 4MDYA 1MRSA 2LDXA 4M1OA 3DBIA 3OFJA 4D3YA 1CUBA 2C9DA 4QNRA 4JYZA 1IM8A 1OKKD 1MDBA 3LDAA 1FYFA 1W0KD 1P1RA 4C5BA 2A3RA 2ZIZA 4BFVA 1ZK0A 5EE1A 4E70A 4BZXA 5KTMA 5JROA 4PAQA 4E5SA 3I2KA 3OEEA 4IIYA 2VRWA 2AKEA 3K2QA 1PNQA 2R8XA 4CE6A 3CSDA 4F56A 4O1IA 2P2NA 1KYXA 2DH5A 5EYPA 1C1YA 4J3NA 1Y4AE 1N9ZA 3QU2A 3P2JA 4FYWA 5JE8A 2C7BA 3QTTA 2DRIA 3ICVA 3S70A 2HDNB 4EGJA 2O2XA 4HYTA 4FHGA 2C8KA 1XTJA 1ENOA 2VQSA 1ILEA 3LF1A 2FUCA 2VDRB 3HPQA 4K26A 5CVEA 4CFZA 2B8WA 2RB4A 1CQZA 5TF0A 1N3LA 3NG1A 1I2DA 5AYVA 1XTKA 3L0DA 3O8OB 3L4BC 4K9KA 2ZJFA 1B26A 3U09A 2CHVA 3PUHA 2EZ8A 2Z8YM 1WQ1R 2J3DA 3T7RA 4P92A 2QBYB 5EE5B 3ABQB 2FSFA 3CR3C 1NSYA 1T6NA 4UU0A 4MNTA 3NI2A 2OGWA 1UJMA 1B00A 2QUKA 3A9RA 3MWGA 4XCXA 2ZE7A 1EX7A 1KAQA 2QPOA 4I4TB 1I3KA 1S1MA 2VJQA 5HQTA 1T10A 4HADA 3VZCA 5JS8A 2VHZA 3OT5A 4FMCB 1N0IA 5SY9A 1FYXA 3KQMA 3KAQA 2BBOA 4DE5A 3BE8A 1X7HA 3HXOA 3EA4A 2P4HX 1XEXA 2HK8A 2QAGB 2YY6A 2ZBDA 3QFCA 4RHUA 2AQHA 1T2EA 1PFYA 2M6SA 3L6CA 2HMVA 3LC2O 1MG0A 5DHQA 5IN5A 5FV7A 5CFPA 3A9CA 2XSZD 3NJ8A 4CEJA 3PPYA 4I1UA 1A5TA 2P2FA 1QVAA 1O95D 3LUFA 4LEIA 4ROSA 4Q9DA 1PQWA 4DCNA 4B6OA 2P2BA 2ACWA 1WZNA 3FNGA 5EN4A 3UAOA 2C3UA 2JGLA 5BMVB 1UBCA 5IJ9B 4ZEVA 3D4PA 3QP9A 4I4TF 1G4AE 1CUJA 1SGWA 1Y6RA 2H1LA 4PAWA 5DGHA 4CLHA 4F45A 1M7GA 4JFAA 4TMFA 2XJ9A 3G6WA 2VYQA 1PT8A 5K09A 2W6ZA 1HNZC 4GYJA 2Y8EA 4I6GA 1QV6A 4W7IA 1EDBA 1SD5A 3KK0A 3OX2A 1ZD8A 2MYPA 4L50A 4QPPA 4UAJA 4BMDA 1ID8A 2P3OA 4JNCA 2PSDA 1JDBC 5DOZA 3H1PA 3CT6A 4LTMA 1XZBA 4MW7A 1BU5A 2H1OA 2V3WA 3VPCA 1DJLA 1K6JA 2I4LA 1TLTA 3MVEA 4NK5A 4HI0E 5FR2A 1E8NA 1T4CB 4OJMX 3W6NA 3ZTYA 2IPNA 4LYHA 5C5CA 1Z2OX 1E2NA 2ZETA 2QJWA 4YJGA 1UKYA 2YINC 5ALDA 5PNTA 1A8IA 2ZYTX 3KHUA 4YCNA 3VR0A 1CLUA 1QDLB 2RJOA 4CBVA 4E7OA 1GZ3A 3NGXA 4YJ2F 1AKTA 2FZVA 3STUA 2IKQA 2MR8A 2MMAB 1UPUA 4KSYA 1LLQA 3UJ8A 1UBHS 3M5DA 3P9PA 4QVGA 2H57A 3FUUA 1CJTC 4RKQA 1VRVA 1EVIA 4KYVA 4E5PA 1WKBA 1KZYC 1ODJA 1E1CB 1MENA 2R4TA 1ULHA 2W98A 3CF6R 3FUWA 4I5DA 1OU4A 5EIOA 3KCNA 1XZGA 2ADOA 1UF9A 2QF7A 2QD3A 3KVYA 3MXTA 4BJHB 1XMXA 2PBZA 4DC1A 1KWKA 3W1VA 1WL8A 1X80A 1L7PA 1XTSA 2LD4A 4MVYA 5DGTA 5AHWA 1FSZA 3H99A 1LSSA 2FFQA 2X8JA 3QVGA 1HNNA 2UAGA 3DWGA 3H9UA 3D0OA 3MB5A 1KP9A 1XA4A 4HVTA 4UHFA 1XDUA 4HRXA 4JHXA 1EJ2A 1Y80A 5I9TA 2Q4EA 3GJ8A 3WRXC 4D0SA 3OD1A 3O8RA 2VWPA 1H8HA 1YHNA 2CK3D 2ZATA 1E4EA 1P8AA 1SB9A 1MJNA 4QNBA 1T8KA 2SKEA 4KO2S 3K9WA 4M0CA 2BCJQ 5LBIA 5T4EA 4QDOA 4J94A 2HRDA 5F78A 2DLNA 5C37A 2A9JA 3LGSA 4PNZA 1T9GR 2CJXA 2XNKA 2ATCA 3BRWD 4L15A 3IVAA 1OWNA 1WTCA 4WV3A 2PRZA 3FF1A 1EXWA 1MX3A 1DG3A 1V6CA 2PGAA 1CERA 1XTZA 1GT6A 3ID6C 1BW9B 4TL7A 5H16A 4X66B 5DBHX 1AF4A 1E4YA 2B6NA 2WNIA 2KM1A 1XJ5A 1GARA 2QD2A 5KYTA 1PR6A 4KLNA 4L8LA 3B3AA 1A3CA 2UU9C 1R8YA 4EHJA 1QRUA 4KJZA 2XXJA 4G89A 1DG9A 1UR5A 4QX6A 1FMTA 1JIQA 2W22A 2D00A 1Y7LA 2AKAB 3B3QA 4GZ6A 2QE7D 2VNIA 1R9MA 1L6IA 2ZE6A 3TL6A 2PD6A 3OJWA 2EWMA 1OLSB 3L7DA 4PG7A 3LH5A 3UK7A 1CIVA 5DT9A 3BHJA 3R7LA 2K7ZA 2LRHA 2ZKLA 3O3MB 4YLGA 1Z6QA 1TDJA 4HLQB 4TRMA 5ER9A 5KHAA 3U62A 5ITVA 4G0VA 1LI7A 1A9QA 1RM3A 5D7BA 3DUFA 1W75A 1F80D 3ET4A 4MRMA 2QUBA 4DQXA 4HNGA 4JUAA 1R6AA 1WMFA 1K7FB 1VBNA 4TKVB 3UW1A 1WUYA 4LOKA 2WNHA 2ZUVA 1E64A 5AJVB 5DYTA 3ZWWA 4ZO4A 2P2QA 1H2HA 3IELA 4KFSA 5KYNA 4QARA 4WX2B 3NEYA 3WGYA 1UC4B 5EWLA 4DA0A 1XZCA 2DE0X 2KW5A 4G84A 5LBTA 3DDOA 4OHUA 4F9EA 1ADYA 4AJ9A 4JP8A 4EO7A 4NMLA 4YCAA 5AKLA 3TE6A 4B3JA 4UNQA 2RGWA 3AL3A 3ADBA 4MRSA 5H3HA 1GITA 4RK1A 3S81A 2I4RA 2GZGA 1ONBA 2G4CA 4DIBA 5EIEA 1GQQA 2XDWA 3JAMA 4DKJA 4KIUA 2QVCA 1N2JA 1A7JA 1G8GA 1Y1PA 1I3CA 4WW0A 2COEA 3SQLA 4EVSA 1TZBA 3TVTA 2NTEA 5EP1A 2GDJA 3THRA 3OFKA 3REGA 5DISB 4P54A 4H2YC 2FP4A 3IB6A 4KQIA 3KEMA 2NXNA 2WVJA 3TBKA 1SZCA 4G0QA 1M34A 2BEKA 2OB1A 1K66A 1L4BA 1V3QE 4Y2PA 1TW2A 4BCDA 3CEPB 1BAPA 3CTPA 1GU7A 1MVOA 5JCJA 3W5HA 1IBMC 4TV8A 3S40A 3L8YA 4K46A 4LWOA 4NCHA 2RE8A 3VVMA 1L4LA 3HCCA 3GEHA 1V6AA 2R7KA 6YASA 3DTTA 4DJTA 4CM9D 2BHVA 2W6JD 4MRNA 5EJDA 1TZ2A 3GRYA 2JVJA 4D96A 1SUPA 7REQA 2J5KA 3RV4A 1WY5A 5BWLA 3UJHA 3ZDBA 3NZEA 4P98A 3PPXA 1O0BA 2ECOA 2QEXP 1W59A 1A5ZA 4F86A 2C7PA 3R6GA 4PN7A 1MBZA 4F6CA 3CU5A 4ZVNA 4YRSA 3NVMB 4R9NA 4D0GA 3AGQA 1J2UA 1GNVA 5I7HA 3DMDA 1K30A 4Y1FA 1X1BA 3HY6A 3NDBB 4P6VF 4KNYA 1YFKA 1PL7A 2VHYA 1ZXXA 1KETA 3EOZA 4IG9A 5NLLA 3JPYA 4R1LA 1RWKA 3A0UA 1W36B 4EFLA 3ZCRA 1Y6GA 4X85A 3ZIAD 2HWXA 3G8CA 1N2FA 1N2CA 2H4YA 1NLYA 3B9RA 3CN9A 4Z8XA 4BGUA 4DJJA 1AF8A 4KFRA 4R2LA 5CU7A 2BELA 3FDXA 2AVNA 5A3QA 2VNHA 3E53A 4GYKA 2JJMA 1R66A 2PT7A 4XR4A 2VHCA 3N8IA 3NFYA 3RR2A 2ZYIA 1QRSA 3D4NA 4UBOA 1I9GA 2P41A 2V45A 2GYVA 4IMPA 3INRA 4DBVO 3T3DA 4HNUA 3TZBA 1GDDA 4GOKA 4EZIA 1Y1TA 3SQNA 1R0WA 5JV5A 3EF0A 2AC4A 1SD2A 4C0HA 4G1IA 2ZS7A 3I04M 4JJIA 3PQ4A 3AY6A 4EKEA 1QU2A 4F8EA 4ZRDA 3A9SA 1LXCA 4V0QA 4URFA 2H2WA 1IOLA 3TIFA 4IVQA 1YQ9A 4C9BA 5CCBA 1JAIA 2V97A 3VR5H 4D42A 4C4SA 4Q34A 3SYMA 4OQNA 4BX3A 5LD2B 2IYZA 2WYVA 4IQ0A 2RHOA 1U0LA 2VL7A 4F7DA 1PLLA 4L5IA 2GO7A 4BEWA 4R71A 2XBLA 2Y1FA 3RH0A 5C1DA 3ANMA 1ZGAA 4Q4DA 3SHOA 1P2BA 2C0PA 3OE7A 2GERA 4BQPA 5J2TB 3ND6A 3FHLA 3SM3A 4EGSA 4RWEA 4TGLA 1K9SA 1PFUA 3I1FA 3E1KA 4M87A 4F5EA 3G7UA 2DETA 4XB2A 2AEEA 3CZRA 3UA3A 2BR3A 3RVJA 1U8CB 1ZDMA 2OBBA 5EJAA 3VZDA 2AW3A 3OZFA 1LV7A 5FJIA 4TLBA 2VJLA 3OZ7A 4TRRA 5CHEA 4ZYWA 1MO3A 2HK9A 3HWSA 3IIEA 4XROA 5AMXA 3GEMA 1ZL0A 1JSZA 3BWBA 1KPIA 2GARA 4Y3UA 5CDUA 5ICSA 1UJ5A 1DRVA 1C4OA 1XZLA 3I6YA 3WSWA 2ZS8A 2BEWB 1L5SA 1M0TA 3DGFC 4MTCA 4D9MA 2P9TA 3TTSA 1RPAA 1MC5A 4RV4A 3ZY5A 5C18A 3H87A 3R9XA 3RIGA 2XYGA 3LHSA 1M6WA 4Q6WA 5DM0A 5EGSA 4BX2A 4EWLA 4HNRA 3TZ6A 3IJ5A 2IDJA 3D1LA 3L41A 1P0IA 3NDIA 4Z0PA 1H69A 2GZSA 3LOPA 3RT9A 4ZODA 2OZVA 2Q27A 1E2GA 1KI9A 2XT9A 5JRHA 2VR1A 1FDWA 3RREA 4PRYA 1KZ9A 4LY3A 5E3JA 2JYGA 1EFPB 3U1VA 3HMQA 3F9CA 3K0BA 3UF0A 1IE3A 1M1ZA 3LSTA 3IB3A 1CXZA 3OLCX 4PR3A 3WDLA 4E32A 1MJGA 2GN4A 4INZA 3TRIA 5FOVA 2XNSA 3GO4A 1TVMA 5HKAA 3A1NA 4E5DA 2C20A 1E66A 3JALA 3AVTA 1MHTA 4EFNA 1USIA 3GRCA 2O5CA 5LYJF 4RHEA 4ZGWA 4Q66C 3O2EA 2QL5A 1GRRA 1L5WA 5CA1A 1P33A 3D64A 1L7BA 1AD2A 1NW6A 2OHFA 3H2KA 4FZ3A 5HK8A 4CMAA 3L4BA 4OQYA 2UUCC 2FW0A 4GU5A 1IMJA 1LK7A 4YQZA 2PKCA 4NCAA 4L4YA 1WMSA 1JTVA 2JEZA 3CN7A 5TARA 1Z6GA 2CHEA 1KAEA 2QORA 4ZRMA 1YTUA 2YWRA 4OM8A 4RCYA 5F2NA 1I1QB 3NRBA 4P5DA 4UMFA 4H2DA 3B5JA 5FOXA 1G59A 5COQA 5JDIC 2FDCA 1UPBA 2QAGA 1DAIA 3T6KA 1NF9A 1QGDA 5DHAA 3NKLA 4ITUA 4CQMD 1VLHA 3EGXB 4D98A 4IPYA 1EVYA 4RS3A 1N5DA 3I2IA 2IYLD 1XKQA 5FA8A 4KR9A 4ZI7B 1F4VA 4QU0A 4M21A 4EITA 4Z53A 1CRQA 4QECA 1JPNA 2C59A 4RJIA 4XJXA 4TXLA 3KPUA 3UCEA 4X64B 3ZWPA 3CISA 2EIAA 2NCLA 4MI3A 1LTKA 1PS9A 2XMZA 1GP2A 3E3NA 1TCVA 4LE0A 3HJGA 3RTCA 1U3DA 3X1DA 3GJ0A 4HQOA 1I36A 2W7TA 5JR3A 1GIAA 1ZD3A 3K72B 3EWAA 3PDCA 4YJHB 3S28A 4DT1B 1C1HA 4Q39A 4QUHA 2JB9A 1T9DA 3H5AA 3F0TA 2YX1A 3F46A 5FLEX 5PGMA 1GXHA 3T5DA 3KLNA 5J4KA 4WLVA 4C88A 1OH7A 3MT8A 4HEQA 4G5XA 1XK7A 2Y77A 3C7AA 3EDRA 1HL3A 4FYJA 4MRRA 2JA1A 2CG5B 3QEJA 2QLFA 3E3OA 4EB6A 1P0CA 1PU2A 1EBBA 2Q21A 1JDBB 5BRJA 1N7HA 2JGDB 2OZLA 3T9FA 1KH3A 2AYAA 1JQDA 3LF2A 1PGNA 1UPFA 1U3VA 3ST7A 5TS3A 1HL7A 3LOQA 4R8SA 3F98A 4GKAA 3RYHA 5F1OA 2WP0C 1P1KA 5A4IS 3EQ6A 3EVGA 1CUSA 4QUJA 1W49A 3FYCA 3FKSA 4JI7C 3EMBA 3MS7A 2VTVA 4HDSB 4PCVA 3RJMA 5HNKA 1B15A 2NZ2A 1XZHA 4IDQA 4LFBC 1YDFA 1O1YA 3RHTA 4RUKA 7ADHA 1H2AS 1RR6A 2QU8A 2EX1A 4I99A 1ZBDA 4CG1A 3FMFA 3CLVA 3NTEA 1YDHA 1O96B 1T4DA 4XKJA 4I8XA 4RLHA 5TGTA 1Q0TA 3MW8A 3WIDA 1X94A 2PJZA 2A0WA 1JPUA 2QIPA 4TM8A 4AN4A 5C35A 13PKA 3TF5A 4Y7DA 1MX5A 2BFFB 3RJZA 3DONA 4BQQA 1I7SB 1VSQA 3N86A 3CKYA 1CQJB 1SM4A 2FSHA 1U8FO 4RSRA 4RKRA 1N6RA 4ZCQA 1UNKA 1K7CA 1SCAA 1XZEA 2QS9A 5K03A 3MYYA 1JVSA 2J85A 3LT4A 4QQFA 2J46A 3C48A 4NLLA 1G8SA 3KOOA 1SUAA 4BV3A 3L07A 5JZ9A 3EDCA 3MGCA 1Q0PA 1A88A 2GPYA 2WV7A 3ITDA 5H4GA 5KYWB 1DGQA 4IIGA 2FGJA 1YQTA 2Q49A 4MVJM 5ENDA 4BDSA 4P2BA 4D3ZA 2D8AA 3R7WB 1HQKA 3EARA 1ONNA 5A5GA 1AB6A 3ECSA 3K9LA 3SEZA 4BVEA 4GMFA 4DRXA 3K9FC 1X8KA 4GGPA 4HAZA 2F67A 4YCBA 1BXRB 2CLEB 5U4XA 3INTA 2MD9A 1CQPA 1I32A 1XQYA 4LHZA 3OZGA 2OTLP 5HQ3B 2QG6A 5BN4A 1R0CA 3CS3A 4DTCA 2YHAA 1OC2A 1KC1A 4TV9B 5K8UA 1X7ZA 5E1BA 3WYCA 1Z26A 2HPZA 6PFKA 1KTVA 1PT5A 1Y8RB 4BFXA 1EUCB 2B9EA 3QX9A 2AD1A 4LAFA 5H4HA 3UFBA 3F7NA 3K9GA 2DHQA 1Q0SA 3ILSA 3PFFA 4M9XA 4WD3A 2GILA 2ECKA 2BYTA 1G8KA 2ZQYA 4ZYVA 3A2NA 5K2OA 1X77A 4YB8A 1DBPA 2XD4A 4EGQA 2FG5A 4RSHA 3DS5A 4PANA 5CLGA 4ESHA 1JLHA 3EUFA 2KG6A 2ONYA 5SICE 1YV9A 2NU7B 5T6MA 4EJSC 4HLDA 1NFRA 2GM5A 2XE8A 3VSCA 1T0BA 4K8OA 4HRYA 2IOQA 2QE7A 2R4QA 4Z86A 4PYIA 2XADA 2AT1A 3H1BA 4K05A 1GQOA 4QASA 5DLEA 1ZD9A 2VHXA 4L9AA 3WK6A 1N2ZA 3IAM6 5COAA 3STVA 2RFLA 4AO8A 5BRNA 4D41A 1A9OA 1OH5A 4CEIB 2W6IA 3AUTA 2R8YA 3PRHA 1B2LA 3M7IA 1APBA 3VR6D 4MS3A 4YROA 4JI0C 1WXFA 3E4CA 2MM9A 3MUNA 2QM0A 1FB5A 3U1TA 2GXAA 1G8JA 3GGCA 4PBSA 2VQFC 2X2FA 2J09A 4DANA 2WI8A 3BMQA 3CCJP 4D3XA 1L4YA 1W5SA 2OO5A 3DZIA 5A3JA 1ZL2A 4F4CA 4U9UA 4TWAA 3R3VA 4MLDA 1H8EA 3S1SA 5C52B 3FWHA 4NESA 2NUAB 2WSYB 4HATA 1ODCA 5AD1A 1JAYA 3TFQA 3R8XA 2RI6A 3F49S 2APJA 1FYVA 2VT2A 3SYLA 3FRJA 5DIFA 4CVNA 1EM6A 3QY0A 3PROC 1JV2B 7MHTA 4CM8B 3WAJA 1ULZA 1LPBB 4I08A 4F38A 2QRZA 1EFUA 1T6YA 5MGNA 4V1CI 2O1EA 3RHZA 2E5LB 1E2KA 1ZOPA 1ZHHA 1QZZA 2I1VB 2QMYA 2QTAA 3NBZC 3JWJA 3L6BA 3VOTA 1J8QA 1E2IA 1LF0A 3MQ2A 2DTDA 4LMBA 4RTRA 3PYMA 2HMYB 1Z39A 5CB8A 1S9HA 2VF4X 4OU5A 5HXAA 1UBOS 1ZN9A 3EZ9A 3COZA 4MA5A 3GLGE 1YR6A 4DM3A 3EMVA 2WTUA 1UDXA 4AN1A 2Q41A 1USPB 2HM7A 2ZTSA 3ENWA 3X1MA 2A0KA 3IJEB 1E2QA 3QNUA 4AJ1A 1GAEO 2PX2A 1RM0A 1N6KA 5F5NA 2HBRA 3AESB 1XAIA 4YWHA 3IEKA 5SZKB 3ONFA 4IUCS 4V0NA 3WGHA 1O6FA 5CT9A 4UOZA 3SZMA 1IB0A 3F2VA 5B57C 4I1PA 3IPYA 1DAHA 1NZJA 2HV8A 3GI1A 3UJBA 4C6TA 1BS2A 5TMEA 3NYWA 3QUQA 4LOHA 3EAGA 4ZDWA 1AK1A 3F5DA 3TS1A 1Y9JA 1KDRA 1IN6A 3WJ7A 4KO3S 4DILA 1FP4A 2GBPA 1IOVA 3SQWA 1ES9A 2B1RA 2B35A 4DAEA 1K98A 1ORVA 3RVRA 5KINB 3QUBA 1QRTA 5DNYB 1ZJ6A 3EZXA 1FDRA 1ORHA 4AQYC 1GPBA 4BQFA 3COSA 3B3JA 1RAAA 2IEGA 3WYBA 3OMXA 5EW5E 3CVJA 2I2XB 1W35A 3A9UA 1L7RA 1M1NA 4M0MA 2BMDA 1ISFA 1OFIA 4CU5A 1ZWLA 3I0ZA 3ICEA 2GF2A 2ZRFA 3VR3D 4QU9A 3PU6A 2VH1A 2RHCA 2E0IA 4LRQA 4ZVPA 3SOZA 3TZEA 4EOGA 4BX9A 1T8WA 3G9TA 2OO5C 4GDMA 1Q82Q 3RAJA 3KEGA 3MWFA 4BKRA 2XIJA 2L82A 3Q88A 5DNAA 4B3RB 2R1VB 4OO3A 3D8BA 1GL7A 4EKDA 4ZYXA 3EDMA 3AP1A 4PX9A 2O05A 3IEVA 3N87A 1DWQA 1JG2A 4CJXA 5CZDB 4DCVA 1ZUHA 4GC5A 5ALGA 3BBLA 3G23A 4RCVA 5FLYA 4IX1A 3UW3A 3EA0A 2OV3A 5TSDA 4KXQA 1QFSA 2Q50A 4J1TA 1QGAA 4XDGA 5BR1A 4O4HA 5K0NA 4FONA 3G9ZA 4MIEA 2Y9PB 1W5EA 3KP1A 3MG9A 4E22A 4Z0NA 1RZ3A 4N5DA 5ADZA 1NUAA 2PSFA 3EQ9A 5ALEA 1SUCA 4BQSA 5CVTA 2C3OA 2OFXA 2LIUA 4E12A 1ZVMA 4TLLB 3U7FB 1VLVA 4B43A 2AYXA 1XRLA 4YAUA 3ZEIA 3Q5DA 4JLNA 3U7QA 3AJAA 3ZIAA 1PBTA 2WJWA 3TM5A 5DBFA 3V7NA 3CLTC 2P7IA 3K5WA 1PA4A 1XPUA 5HSGA 3TL2A 3GJQA 4EG3A 2YHUA 3MJTA 3K05A 4YQYA 2JZOA 3E3AA 3EIXA 2VQEB 3GDOA 2M8NA 4WADA 1OVMA 3EWIA 3LP8A 2QB5A 5B2FA 2XCUA 4KGZA 3TVYA 8GPBA 2PLWA 3O90A 2O7NA 1IQ0A 3M4XA 3SIPA 3GROA 2FMXA 3RUPA 1PUJA 3GMIA 4B8WA 2QUHA 2D1SA 4LF7B 2KI5A 4MKFA 1FR2A 4QSHA 5EUCA 4ER3A 3RYCB 3K35A 5DB4A 1QGED 1E5TA 5HHTA 3NHFA 3H9QA 4PEVA 2C98A 2UVPB 1NLUA 1T4MA 2DPMA 1WH9A 3QVLA 1GXGA 4X71A 2A7XA 2EJWA 2DR3A 2CEAA 3L6EA 1T8YA 3A6KA 1K6MA 3NHSA 4YAFA 5TE9A 1GGMA 3VAZA 4J0QA 1HK7A 3LLMA 4K1LA 4JI4C 1UBSB 3RYIA 1SO8A 4PTLA 4Z7JA 5KP7B 5I45A 5AIBA 4B5KA 3R3YA 2D27A 1OBOA 2X86A 1QS0B 2G9RA 1YDEA 1D2MA 4ZK2A 2EZ4A 5A03A 4RNCA 2OT3B 3W2FA 2CJYA 2OV6A 4PCLA 4RF2A 4NFLA 2ZAYA 1XUOA 1DFIA 2ZYDA 3TD6A 5KAPA 4WZBA 1ZKDA 1UFQA 3RIMA 5CXUA 1IUPA 1QHGA 2K92A 1FRVA 3D7NA 2W2KA 5IAEA 1BYUA 3L1VA 2XUHA 3RBXA 1A69A 1TCUA 2DGYA 2J1LA 4RACA 3WIOA 3DO6A 1U5BB 2C3PA 2X8BA 2UXCC 2XUIA 2O9JA 4FOPA 3KB8A 4JJZA 1Q50A 3LAXA 3D7SA 3FD8A 1FSGA 3U3ZA 3OQOA 2PLRA 2XV6A 4TXHA 3FGPA 2A1IA 1RI1A 1QB8A 3BF8A 1PRYA 1GPAA 1OOEA 2AX3A 2XBUA 5KYVA 4JJ8A 1X14A 1N8NA 2KGEA 1SEPA 1P81A 4LQDA 3ZCVA 1BH2A 1PHRA 4W5TA 4ISCA 4A27A 5ABPA 1E2MA 3AF0A 4KV9A 1DQPA 3ZKWB 2Q2NA 1ZOIA 2P2MA 4L78A 1I0IA 5B58T 1GKYA 1NRIA 3PQ5A 5EKUA 3TX2A 3ED5A 2WT9A 3N6XA 5JLAA 1DC5A 3IVGA 2WJ4A 1KHTA 5ECWA 3ROMA 3GFVA 3HBLA 1ULUA 1PVDA 1NYRA 4FUQA 1EIZA 1U94A 2BZGA 2X5JO 2PUWA 3ISTA 3GA7A 2JIRA 3GEGA 2LPMA 4BX8A 3EEQA 4ERNA 3K6RA 1T2DA 3GAMA 4MR7B 3DZDA 4HAXA 2IYUA 4C20A 5FPTA 4MP6A 2ORVA 4WEOA 1II0A 1HSZA 2QZJA 3FMPB 4KVZA 1Z15A 3KKZA 1TJNA 4W5QA 3LT1A 2Q7DA 4S12A 3NWJA 3M8KA 4PZ0A 1N2BA 1Z13A 4RIEA 1C7ZA 2FZWA 3FFBA 3G8YA 4YCMA 5KYXB 2FV8A 4RAOA 4CG2A 1E3WB 1Z5NA 1KI6A 1N2GA 4G67A 4NF2A 5E9QA 5A05A 3QKWA 2BW0A 3TWOA 5HIAA 2Q3JA 1X42A 3FM9A 2VBCA 3PC6A 2M6RA 2XW6A 1MXAA 2O6HA 3ENZA 3HWX1 1DRUA 3MGBA 3O84A 2CNRA 1HE5A 2ZBVA 3F7OA 3NB0A 1Z0DA 2FQXA 3Q6IA 3K9QO 4QU5A 4C05A 5IUJC 1Z75A 2XT0A 1UBGA 3H1FA 3PNKA 1UBFA 1ISPA 2HDWA 3MUOA 1MPXA 2FPMA 3L6RA 3NV7A 4WXEA 4BEBA 4DLAA 4G3XA 4F11A 2RC6A 2E18A 4AWBA 1DEKA 4V1CB 4BFWA 5JT1A 2WJZB 5LC1A 4QHTA 3HUFA 1VSBA 1CZLA 2V8OA 3HYTA 2Q5JA 1JIKA 5DN9A 4RE6A 5DTIA 1FUYB 3GJYA 1U2RA 4OBXA 1J8MF 3K1JA 3VKGA 2VAXA 3BK7A 1R0XA 5JMOA 1C30B 2DPHA 1PE0A 4KVAA 3UZUA 3VKVA 1EVQA 1BEZA 1OYVA 1KJJA 3G1TA 1LX7A 1M2GA 3BXGA 4ZT3A 1MB3A 2EP5A 4FFNA 1SVMA 2X0IA 3HV2A 3BSFA 4IWNA 2Y92A 4RKYA 4HDRA 5LP6A 3IEIA 2WZBA 3OF2A 1KFKB 3STWA 1QUFA 2BGTA 2YKGA 3GBVA 1V48A 1GZ7A 2HC9A 3AB8A 2C5LA 3JR7A 3K20A 1G3RA 3WB2A 1E1MA 2O0KA 2DERA 1GA6A 4DLKA 3O0TA 4UQLA 3ZE1B 1H8ED 1Z5OA 3TZLA 3HXMA 1DV5A 3KU1A 1MT0A 2X3UA 3DC2A 4N0PA 5AKKA 5JDCC 4PG8A 4NG4A 4Q3BA 3BUSA 1QM5A 1E4OA 2FG7C 2IBMA 4BBZA 1DIAA 2IUFA 1V35A 3VV2A 1E3LA 4RVFA 5KOIA 1ECBA 1WDTA 3T7AA 1Z68A 4FILA 3H1AA 5FRDA 4N7BA 4DIKA 5HIKA 2ZVQX 4QT0A 4G65A 4WK0B 3T5CA 5IABA 1JHUA 2WFLB 2JGPA 3KVNA 3ZLVA 5A1IA 2QW8A 5KO2A 1P75A 4KQ2A 2WTBA 1NP3A 2IYPA 2VHUA 3AZOA 2H0QA 1KDZA 2FTKE 2JIDA 3UJDA 4OLFA 1DV2A 3KQHA 1N3YA 3F5SA 4FHEA 3WYGA 3HJNA 1E69A 4CZ2A 5LQJA 5CGZA 3S27A 3AZPA 1Y5RA 2OLEA 4TS1A 5B6JA 2IOFK 2UUAC 1G9SA 5KVCA 1H2FA 2QTWB 1WB9A 1PQYA 4Z4GA 3SYNA 2AG0A 2OBVA 3DV2A 1J33A 1GZSA 1POXA 3OPNA 4CFYA 2NYRA 4KTVA 4PSCA 1IQRA 2OE2A 4ML3A 1H2WA 3CUEF 1QIGA 2JAUA 3KOZA 2BDUA 5AE3A 2VATA 3F67A 3G5LA 3LJKA 1BE1A 1UM9B 3F7TA 2Z6QA 4GRIA 4GXNA 3BMOB 1Z35A 4GGMX 4RS4A 5CJ2A 3S2YA 4KMOA 3IP7A 1AG9A 2OHJA 2AFEA 2VQDA 4Q1AA 4KGVA 4DMUB 5CFMA 3B1KA 2HIGA 1N8SA 3TAUA 1NI4B 1Z8FA 4PLZA 1R50A 2ZBGA 4IUBS 3BFXA 4MUXA 4BKUA 1YJAA 2JH9A 2C96A 4O0MA 1P3Y1 2WWTA 4MUNA 5CFNA 3LDHA 4KH1A 1SBNE 2YV2A 3P20A 2AZDA 1Z18A 5FLXD 3D31A 2QN9A 3HYNA 1HLFA 2A9VA 2C2MA 1Y89A 1WB4A 4BMZA 1NJ2A 2PL5A 4KBGA 5GY7A 4UTPA 3KQUA 4CTNA 4CA3A 1XCLA 4CF4A 4U7GA 4HUTA 1ZI6A 2JCBA 3IEPA 4XTCS 2E8CA 3DEFA 2W2QA 1IATA 3BFJA 1IBSA 4PVCA 3TXYA 3UMBA 3J81D 4L22A 4EUSA 4ZK6A 5B1EA 2QQ5A 2FY8A 2OQ2A 5J5VA 1NF2A 1QIJA 4TYNA 3C7CB 2YUIA 3KSDO 3BDVA 5B6PA 4OQFA 3M6UA 4N6OA 3VNBA 4F93B 3IPLA 2ORED 3HJRA 3UV7A 2YFYA 3HGQA 2MYTA 2D0PB 1I2AA 3AUXA 1O95A 3AGPA 3OZUA 3SF8A 4POOA 1XMOB 4X45A 4DR7B 2AXQA 3PNYA 1UP7A 4IF6A 4K6HA 5EGNA 1M72A 2VKQA 3TINA 4NV3A 3UAVA 3FTFA 3EGDA 4B7XA 5IVHA 1E58A 1XJQA 5IH3A 9LDBA 5T41A 3I2FA 4FWIB 4H7KA 4JR0A 4D44A 1VQ9P 3I05A 1IVSA 2GLUA 3WR5A 2ZFUA 1PSDA 2OZKA 5I9BA 1NVKA 2R6CA 3FA2A 1YL6A 4UNPA 3S6JA 1DAMA 1V8OA 3ZGYA 4P7GA 1HNXC 1VHQA 1DBQA 2ZQ5A 4MTNA 5TGZA 1F17A 1XT6A 3GNSA 2WAOA 4NENA 2PAFA 3KT0A 4HNSA 4N9QA 2PROA 1GGHA 3KUDA 2OM6A 5HJ2A 4CLRA 2N0SA 2BEVA 3NANA 4HYYA 4PLFA 1GRVA 3ENNA 1VCHA 1AKEA 1QF7A 4FHCA 5TX7A 3FJ1A 2XXBA 3BTSA 4W6ZA 1Y6QA 2JCVA 1L8OA 1ZR2A 3GMTA 1X2EA 4I1OA 3ZCXA 4XOUA 1L4GA 1NTOA 3AUFA 3DW1X 3K0HA 3QIAA 4AY2A 4TYMA 2XMPA 3SDSA 1G42A 1WV0A 3UEOA 1N6OA 2GDWA 4EEZA 4C6SA 1G21E 3K09C 3SWWA 2BFPA 4DXDA 3AETB 4BECA 2BRUC 4CMIB 5A9RA 5JNWA 1AB5A 3SSNA 1E2PA 1B0UA 1XQWA 2H85A 3ZWYA 5DCKA 1SJ9A 2PLAA 5HVCA 4X62B 1JXMA 3AIIA 1ZMRA 5TB5A 1P19A 2O5VA 1SHJA 4AAYA 1EFCA 1SZPA 3QA9A 4B8YA 5LZ2A 4C0LA 2FUEA 3WLKX 3HO8A 1OB2A 1RLUA 2Q9CA 3CA8A 2D1FA 4OFWA 1J5XA 2A7QA 3SMQA 2C5GA 2VI5A 4MYCA 4M9QA 3WQHA 3A3NA 3N2EA 1ZNZA 2AR0A 4KOAA 4P3OA 3RSSA 1PJ8A 4ABTA 3AF2A 2Z0MA 3S5JA 3H0CA 3HCPA 4IJ6A 2GZRA 1JZQA 2FHSA 2QJTA 4OL9A 3D8HA 1YI2P 2ZGVA 1U2PA 5IUKC 3DS3A 1YJWP 3RJTA 4YJ2A 3DB2A 3DD1A 2WMNB 4JJ7A 3BHNA 5C4IA 3NRJA 3L0ZA 2HXGA 3DM5A 3EDYA 4AZ0A 1OIXA 3ASVA 4GZLA 1U2SA 4Q1VA 1HYGA 3W2GA 4O4LB 4IDPA 3DV0B 3OLYA 3C24A 2MR5A 4KP7A 3D02A 4HQRA 3M5WA 4TLEA 4JN6B 4CIXA 4CMKA 1CUGA 1O97D 3HP1A 4IINA 2BH9A 5KDLA 1G8FA 1P31A 1MA3A 3AHJA 4D9GA 2R8EA 2VHWA 3AP3A 2G63A 3KAKA 1RPTA 4YFVA 2HIMA 4EG6A 3U60B 2HHHC 1E3QA 1T8PA 2FN7A 4P7BA 5HILA 3WBKA 3WLLA 3ZLTA 1U5CA 1BHJA 4JSYA 3PNQA 1Z07A 2IY7A 2JRLA 2POQX 3HV0A 3L0OA 3Q15C 3TUZC 5C8YB 1CY7A 3G71P 1Z45A 1IJKA 2C5BA 2OUKA 2Q9AA 2NZWA 3AV3A 2EBFX 3LD9A 3RTBA 1R0ZA 5JEDA 4DB4A 4NWIA 5T3UA 4Z8YA 3ZQUA 1LRKA 4QO7A 1QH1A 1E59A 2Z45A 2VSNA 3SR4A 2P2CA 1QHEA 3EUEA 4KXFB 4BUCA 1TM1E 1FUGA 2R66A 5HMLA 3RK4A 1Z4MA 3EIFA 3PUIA 1GN8A 4MCIA 4Q4LA 4X63A 4XVRA 1JSCA 5GOZA 4ZOEA 3RS0A 3UAGA 4L4SA 3DZJA 1K6IA 2BMWA 2AQKA 2FSUA 2OORC 1L5FA 1N6NA 1GL6A 3P9NA 3PFKA 3RHFA 1XIVA 2BM9A 1H05A 4L95C 1QZTA 5BNWA 4HPJB 3MTQA 3O0DA 3UMMA 4CF6A 2HT1A 3AY0A 4NZOA 3X2FA 3P0IA 1DC7A 1ZUD1 2LWIA 2C92A 2YZ2A 3KUXA 4NYIR 3CCQP 1OASA 4GBJA 1HURA 5F12A 1CULC 1N2HA 3UANA 1HGXA 1LQUA 5IYZB 1W7AA 3T7SA 4B83A 1J99A 3CNBA 3M33A 4CQNA 3QOFA 1TVKB 5CVJA 3RAGA 2YBDA 2Z9CA 2C9BA 4RYDA 4BBYA 1SHLA 3D6MA 4MX8A 2JK1A 1NDUA 3WLRA 3O2NA 4L02A 5LQCA 1O08A 2R84A 3Q2KA 1W6RA 3KFVA 4LZLA 1AS2A 3LYUA 1DB3A 1N2IA 4QTTB 3U4QA 1VQOP 4RE5A 4P4SB 3IT3A 3RS7A 2CJPA 1U1CA 3U9SA 5JCJD 3P9KA 2G9ZA 1GFZA 2HBYA 3HXPA 4WQMA 3U9LA 2VNSA 2AC2A 2HMWA 3MIIA 4YC7A 4CM4A 4IFTA 1HG0A 3IULA 3P45A 1P3JA 2D3TA 3LPLA 2PYDA 1Z83A 1B3RA 1V5IA 3H5NA 3BN3A 5A4FS 1KQPA 2ZJZA 4I2VA 4R1MA 2RGRA 3KD2A 1GWNA 1JKIA 3FZEA 5A6SA 2C4WA 1H4SA 2QT9A 3NS7A 2XOKD 4A0FA 4ND5A 4HWOA 3UUGA 4HBZA 4P80A 3WI7A 3Q2OA 3HP7A 1VPVA 3LRYA 1JLLA 5DM4A 5IEBA 3WLTA 5JZSA 3SHQA 1ULTA 1M2JA 1ZW6A 4C7VA 4EA7A 1ZK3A 3WB9A 3AMVA 4HPVA 3JWGA 4ATNA 1DADA 3MLEA 5KNBD 1JQAA 1A9XA 4KTTA 4LJSA 1XLVA 2HJHA 3HCDA 1GQSA 1DPFA 3OA2A 4PLHA 5D86A 4PICA 2AI2A 1BXGB 2A9QA 2H4ZA 2R25B 1C4WA 3NTLA 3L8EA 1NWCA 5BV2P 4HXEB 4XD7D 4AYWA 2A57A 4OHFA 1VPDA 1SG6A 1O5TA 3C8ZA 3HA7A 2HQSA 2ZR8A 4HK4A 3F71A 3AEXA 4E13A 1JQBA 3MOSA 2JGEA 1RS0A 1ZAKA 5CW1A 2JHPA 5IK2D 1NG9A 2WEKA 3THXA 4RK4A 5F1KA 4KQXA 2PCJA 4PZ9A 1CU1A 1RZUA 4LXGA 3K4QA 4JKYA 5BW5A 5LWHA 3PRKE 2QMEA 3M82A 1Y48E 3CUSA 4BWYA 3AFIA 4QO8A 4TTAA 1MZPA 2AYZA 2K0DX 1QX4A 1TJ4A 2IHVA 2K94A 1U0HC 2DCUA 4GECA 4QG7A 2C97A 1WTAA 3TLCA 3ZKAA 3AVPA 2DEUA 4YR9A 2WVAA 4WTOA 1M8JA 3NTXA 1TF5A 2WG1A 3HZHA 4I4IA 4S1OA 3IVRA 3TTYA 1N6LA 4M1EA 1EGMB 4LYEA 3BE4A 3HB0A 1TQ2A 4GZ5A 4R9UC 3T1QA 1QWOA 2QX9A 3VH3A 3U7GA 3H2IA 4X60A 2PUCA 2PXXA 3PITA 3PVSA 4OP1A 2YZGA 4YMIA 4G0YA 3VHXB 4JUCA 2XYPA 3ZHOA 1SBTA 4H27A 2DKNA 1YQEA 1G6Q1 3KR9A 1NXSA 4TLCA 1X8XA 5DT2A 1E5LA 1RNIA 3IOYA 4TTQA 2PN1A 3T5GA 4AX4A 1ABBA 1S6YA 2OHOA 3S99A 4ZCRA 5KQPA 4TTTS 4D9IA 2QM7A 4NABA 1G5TA 5JMWA 1K1EA 2NQTA 3FOBA 3OQPA 3VPFA 3VPDA 4CR6A 1L5OA 2R6DA 3EWSA 4OV6B 5G3YA 3X1XA 5LR6A 3CH4B 2UUCB 4F2PA 3KOMA 1OUMA 3EXHB 4KFUA 4RBNA 3K3PA 3CH5A 2FR1A 4COPA 4UCFA 3H3XA 2QLTA 5T8KA 4EG0A 5CEFA 3ZS8A 1A4IA 5FTLA 4IOLA 5JCXA 4AS1A 4BZQA 5KKNB 1SC1A 1J1UA 3WGJA 3OMWA 2W2KB 1QBGA 3DP9A 4M1ZA 4B3FX 4LC9A 3NR2A 1HOXA 1Q1QA 1SHTX 3PFNA 4XX1A 1Y5IA 5AJZA 4D92A 3T4XA 4MUYA 1FZQA 2W6CX 2V9ZA 1Y1RA 2JI4A 2BPOA 3GK3A 3DL4A 1R5BA 4P08A 4ZQEA 1YONA 1XQVA 1W2BO 1KIAA 1E6WA 3KPWA 1CDZA 1W4ZA 4MGEA 5K3AA 1BG6A 4KPUA 2Q3DA 3SFVA 5IAOA 1BCSB 1CJUC 3KOXA 4G0ZA 2RKOA 1VP3A 1PW5A 2PH3A 1KI8A 3RS4A 1NVDA 4EX6A 2C84A 1UFOA 2R79A 4R2IA 1C8VB 3E3MA 4R41A 3CPWO 3ZI4A 2Z46A 3ZGLA 4B71A 1IN8A 2EHSA 2RCYA 3BXZA 4EMTA 1NP7A 2X13A 1JE0A 3ONDA 5DYYA 3UH0A 5NULA 5KTPA 2W6ID 1NZDA 5IUNC 1H2EA 1E2DA 1WOYA 3DAFA 4X6YA 1M1XB 4L8VA 2C3YA 3LUPA 4AL4A 5FQOA 3NWOA 4K3VA 2ATVA 3T1HB 3TQFA 3V4RA 1T24A 4ND3A 1UZUA 3UUEA 5DBGA 4GPTA 4DJ5X 1D3AA 2PY8A 2J4CA 4M76B 4R83A 2HCJB 3DLAA 5KYUA 1TL7C 3EY9A 5KX5A 4IVPA 2C5AA 1K8YB 1JYEA 2C4TA 5ELXA 1PR0A 3PG5A 4N01A 1SPXA 1UMBA 3CCMP 1KORA 3AUJB 3OM0A 2CY1A 4PZLA 4YUXA 4ZGGA 3UJAA 1NYLA 2Q62A 3DTVA 5LP6F 1O94A 1MXBA 2GEFA 4KX5A 4BFUA 2QN3A 3L49A 2VAVA 2FCAA 5L3ZA 1KK2A 1JJBA 3L4EA 4KXWA 4E0BA 3EC2A 1LSJA 1A82A 1O4WA 3MBKA 2JFPA 1KKLA 5FBRB 3TIIA 4E21A 2W0MA 2WQZA 1YB5A 2Z8XA 1N7IA 3A6DA 3BIJA 3CZAA 1NUUA 2H1VA 2QMUA 2J3QA 3O9MA 3RTAA 3LO5A 1ZQ1A 3KSBC 3JQDA 3NHAA 4RWZA 4J0DA 1NYEA 1KK0A 1VIDA 2J67A 3AU9A 2ZM5A 4D26A 4YIKA 3N9IA 4OB6A 2Y1DA 4QQKA 2HBQA 4ZVLA 3WGOA 5GIPE 1FJGB 3PS9A 2JC3A 2X2PA 2OHXA 1IC6A 2PEMA 1ODSA 3LQRA 2ZAGA 4MR8B 3W90A 3KQVA 5IU6A 4JBLA 2DCMA 3FDZA 1XGKA 4C04A 1WULS 1A8QA 1UADA 4Y2XA 3QOWA 1P5HA 4IH1A 2BGRA 2VUHB 1ADGA 1FPQA 2RI1A 1NVEA 5MGBA 4O4IA 5DU2A 4G4SO 1KC8Q 5CZVA 3ZDRA 3IV6A 1FU4A 1FMCA 1LY1A 3PGLA 4LYDA 4RENA 5F7JA 1D1TA 5AKZA 3VPGA 3I4LA 4A2PA 1S01A 5IPFA 2RAFA 4HD8A 2BP7A 2P75A 2CYCA 2XTAA 4E3WA 1KP2A 4JT9A 3MRVA 4KAAA 2FQYA 4CFSA 1AXEA 1PTKA 2XB6A 2J08A 3O75A 2Q9UA 1JZSA 4YLEA 3LWBA 3ZDYB 3ZXUB 4DDHA 1XMSA 4PZEA 2GRJA 5HYVA 3IIMA 4FMDF 4H9GA 2ODTX 2R8OA 3UXHA 4ARUA 3FDIA 2CHQA 1LQ2A 1Z74A 1R6TA 1RFGE 4GKJB 4XYMA 3JX9A 1WBDA 1U99A 3R6DA 5CGQB 5KQLA 1A72A 4DPKA 1U6KA 3ANXA 1WUTA 2ZI4A 2PBRA 2Y1WA 1U90A 4IJMA 2CJFA 1QTRA 4AMVA 1C2TA 3RS9A 2BHRA 3TXXA 1QRJA 2E37A 3IIIA 1DL5A 2EDAA 1TVCA 2EL9A 1AUPA 1M2EA 1BVRA 1J8VA 4XQ9A 5AOAA 4LF6C 2HSWA 4AW9A 3TOXA 2LV8A 4QNMA 3K2EA 4HBGA 1KWGA 1MD9A 2JFQA 3H2HA 4XWYA 4UD2A 3C15C 1OI7A 4QPDA 2ZJ1A 5F5LA 1NRJB 3ZD9A 5HKKA 3TQSA 3ZUPA 1TM7E 2E89A 3WBBA 4ZCTA 1CEEA 3IMKA 3QFTA 2PEOA 2EG9A 4EMUA 1JHMA 1O7JA 4BNHA 1CV2A 1AMUA 3E7WA 1CLEA 2CUKA 2ZRDA 4NZPA 5ICCA 4WMLA 2O8NA 3H8VA 5JQGB 3RDPA 4X8OA 3DT9A 2GCPA 1L1RA 3MILA 4QTZA 3O4JA 3W1EA 4XVCA 5IKPA 1XK6A 4J43A 5A3VA 3VR5D 5LMUB 1G63A 2B94A 4COKA 3ZJVA 1A95A 3VDMA 3KTFA 2JFNA 3AG5A 1IZ0A 4RY9A 4BO3A 1C7RA 1SNYA 3GIWA 1N5KA 1YOVB 2OV1A 2XA2A 3WAGA 5TEVA 5JC1A 1JWLA 4Q16A 1F5NA 5ESWA 4DCPA 1QAMA 3C6MA 4D97A 1WXIA 3UMJA 1ZK4A 1CIJA 3CKLA 4H7EA 2XNDD 4BQIA 1OTHA 3EVAA 2B7BA 3SXPA 4I3FA 5B1HA 1WB5A 2B99A 2EATA 5KQRA 4O4IF 2CXRA 3INYA 2CXUA 1N34B 5EEGA 4Z4HA 4M86A 5HCIA 5FO1A 4AS3A 3BILA 2Y1EA 3NHPA 5EHQA 4CEIA 4MKGA 1K8RA 4UBMA 5TPWA 2HQBA 3QLVC 3ER6A 2VEOA 3L9WA 1WCYA 5F4BA 4BBPA 3K70D 1HDYA 3H2YA 4HUQA 1UEJA 2J3KA 3RU7A 4C01A 2D6FA 4DIEA 1KVQA 3ABSB 3BGDA 4GF5A 4U7WA 4B4DA 3WLIA 3ND7A 4QPNA 4LV6A 4F4IA 3IL2A 1L8QA 2KE5A 3EZYA 4J16C 4JLMA 3EG9B 4ZQCB 4EUEA 1K75A 1Q3KA 4AROA 3MS2A 3QKSB 5FBHA 3ZIDA 3R0VA 3E15A 5IG2A 2H16A 4GNKA 4HDKA 3I2GA 4X62C 4PZUA 2I8AA 5AHXA 3QE0A 5K4HA 2ECFA 2Q5IA 4M9UA 1PGQA 3WO0A 3OTOC 3HBAA 4BVKA 1J2JA 5ALVA 3A4TA 4MARA 2YVKA 2I03A 3RRFA 1KQGA 1B1AA 2OCDA 1HLDA 1JJVA 2PCLA 5EPUA 3TQHA 1Q84A 3TLGA 5JSQA 1FFDA 3CC8A 4X3OA 3UG6A 5KJFA 4I7EA 1X39A 3K1AA 4MQ4A 3TFOA 1G9XA 3KAPA 5TDHA 3B7GA 1BTOA 4IXDA 4Q19A 3FWZA 4ER6A 3KXIA 4YRNA 2FLWA 3NHUA 4UARA 4ANFA 3IKTA 1U0EA 1DHRA 2O2YA 5HA5A 2ZS9A 4EJ6A 4EM6A 1X38A 3HG7A 3BH0A 4CEHA 4NY1A 2BZ1A 2EFCB 2VT3A 2ZI3A 1H93A 3BGOS 4LJ9A 1SQ0A 4LF8B 1OBFO 4NBKA 1Y8ZA 1QYCA 4U9HS 2P6PA 3COWA 4G9EA 4H7JA 1HT3A 1XKXA 4PQGA 4EO9A 4FK8A 3PPIA 4M6WA 5JJIA 1N1EA 2UV8A 4YN3A 2HNKA 1QIDA 1YUNA 3ETNA 5EZ6B 3U61B 5D6OA 2ETVA 4PH0A 2QN7A 4JZYA 4Q3DA 4RF5A 5SY4A 3L8DA 2R1ZA 1NUHA 1OILA 1DBWA 3IERA 1GAJA 2HNAA 3MJDA 3JZIA 3PICA 4NR0A 2ZUWA 3TW4A 3OWXA 3SZ3A 2JVIA 2XOXA 3BERA 4UU7A 4OYCA 3TNDA 2O6LA 1W85B 3EVBA 1OIWA 4UHCA 1EINA 1YB1A 2GCEA 2I6SA 2VFAA 3G5TA 4KAFA 1XEFA 2AB0A 3W2EA 2ADMA 3KT3A 3JWIA 2NUPA 1U3FA 2V7UA 4FS3A 4MYRA 1LTHR 1YZTA 4JQZA 5HF6A 5F1YA 5M2QA 4HB4A 4RJKA 2HEIA 3FSRA 4R9VA 1H2ZA 4GH5A 2G72A 3V33A 3WIBA 5KYYB 2XV1A 3VDXA 1FNDA 1G5PA 4DM4A 1K4KA 1ML3A 3QFHA 4Z9FA 1I7DA 3ANSA 3ZXXA 4YXFA 2F48A 4MV4A 5EZYB 1TH5A 3ZDQA 3QFRA 4LNHA 2LBPA 3ZD6A 1FMLA 1SQGA 4P53A 3G4SP 1FFBA 3WP0A 4AX8A 4DDKA 3SZOA 1EDOA 1PR9A 3PT5A 2R8ZA 3NU1A 1HNZB 1H0SA 4TUYF 5CZXA 3ELYA 4MI9A 1ECJA 4UDYX 4EG1A 1V3VA 5IJZA 4K6MA 1PGJA 4GI2A 4UBLA 4QXMA 5DNDA 1D6MA 1FSSA 4Y9DA 2C2GA 4R69A 4Z51A 2JZCA 4UCXA 4RMJA 1T8SA 1PJRA 1HRDA 2W2LA 1GFIA 1RFLA 2FRDC 4KMRA 3CB2A 3I6BA 5CVUA 4DKXA 2DWUA 1AU9A 3MGEA 3A1VA 3WICA 4YAKA 2Y2UA 1IHPA 2P9YA 3C8UA 4WUVA 1NVBA 3UMCA 2MDTA 4EJMA 3MRXA 4ZT6A 2GN2A 3WIVA 4PLPA 4ZVRA 4B3CA 4C1NA 2CV2A 5ALNA 4F85A 4PAGA 5EZYF 3KE9A 5FX2A 1FFHA 1UK9A 1VKUA 2G5GX 2L19A 3RSLA 3K71B 2TECE 3OJCA 2JIZD 1XD2B 2M2IA 2VUUA 4G9GA 4W99A 3SLKA 3ZCSA 5AVUA 2XUJA 3CLKA 2H4FA 4FX5A 5BURA 5KYUB 3FGNA 1ZXBA 2WNSA 2PZBA 3OOHA 1C9YA 2FAEA 1P5FA 3DZHA 3Q8WA 2DR0A 1GTMA 3LQYA 1AVTA 5THXA 4LJKA 2YHIA 2A59A 2WE7A 4MVWA 3SQMA 1MR3F 1ZA1A 1D5CA 1LNQA 1Y3IA 2FLVA 3HUDA 2J6CA 4TPKA 5BQPA 1EUZA 3BWCA 2AJCA 3LP5A 1NVTA 3RABA 4EHIA 1MXCA 1SBYA 1GQRA 1YULA 3BJMA 4L2IB 2PFKA 1YMUA 3RS8A 1QJ4A 3GLSA 5CURA 4EY5A 1OFVA 2ZK7A 4PO3X 4ZREA 1VLAA 4MVCA 2RGYA 1ZLYA 2JFXA 3AIOA 3T35A 3X1ZA 4I3HA 3CCUP 3PTZA 1CS4C 3IVMA 4FT4A 5G0VA 2O8DB 2W8BA 3AWDA 3D6UA 1E60A 1IOWA 1YR9A 2GBCA 1HFWA 2RG1A 3MIZA 3K0EA 3H42B 4KE6A 5TT0A 3VR6H 1ZISA 3ZY3A 4MI1A 4NARA 2ZUUA 4CLOA 1BX0A 1SU6A 2HA2A 4BC9A 1TTHA 2JGKA 3HFJA 1V11B 3HA3A 3QSGA 5EUQB 1QXSA 4Z4EA 4MS4A 4KPUB 5AOCA 2PENA 2PZJA 4EGFA 5E0OA 3H75A 4IJKA 4Y98A 4FHFA 3C7KA 3MS4A 1MHPA 4FLMA 2ZIEA 4OL0A 3HYCA 1P18A 4KXNA 5AK6A 1S96A 1SU4A 3KJXA 4B4VA 4FE7A 2V7VA 2CCJA 3PENA 4WT7A 4FYMA 4S35A 2V6GA 5BV7A 2FLKA 1Q14A 3RVSA 2JIPA 4DF3A 1Y5MA 4F4UA 1WCIB 1TIKA 5K6AC 1WABA 3KC2A 3WKAA 1QQAA 4KQKA 4MDHA 1BWQA 1GNLA 1NJSA 1NNUA 2QN6A 3VXKA 4JXKA 5BYJA 4WN3A 2ZSIA 3MHPA 5F3DA 2HSEA 3DMTA 5EQDA 2H4WA 3H1GA 3HKDB 2N6ZA 4WNAB 1UC8A 4HP8A 2EF1A 4N3GA 3I2JA 1TJYA 4GZ3A 2R97A 1Q74A 3CINA 4UBKA 4ND1A 3TSCA 4YMVA 3GLIB 4N76A 4LHSA 2XTMA 3SXUB 4ZCMA 3B9BA 3LCMA 4O2BA 3KEOA 1EPUA 1Q86Q 1JPVA 1R10A 1HQCA 2UYOA 1K0UA 1UXIA 2EKZA 2WWRA 3C7DB 4M8LA 1Y8RA 4MAMA 1IPEA 3WWDA 5JANA 1E99A 1QR2A 1DTEA 2VHEA 3NORA 4HDKB 3MCZA 3QX8A 4IIBA 1ORRA 4BBJA 5CD1A 4DUYB 1OGJA 1BNCA 3PT9A 4ZKEA 3HKEA 1O57A 1ZB9A 5DK6A 1EQ2A 1PJ3A 5GV7A 5HKKD 2UYQA 5A5VA 1P77A 1GDTA 3NVKI 4D4IA 1CZUA 2C88A 4E15A 1TRHA 5L9AA 5JWOA 4GM4A 4P58A 1GYQA 5CJJA 4NMHA 4F2DA 1VJ1A 4JJEA 4RTJA 2XCIA 1WD7A 2PLFA 2WSLA 5DJ5A 4IXMA 2JFOA 3B1WA 2ID8A 5WRFA 1GG2A 4IFBA 1DQNA 2C2HA 2H2AA 3G2JA 4L0QA 2V96A 4BKOA 3L7IA 5ELLA 1Y8QA 1N34C 2CL7X 2NPOA 3I62A 1YFLA 5FNZA 4QGFA 5E7MA 2V1UA 1IONA 1NQ5A 2CVFA 1T4GA 5LUBA 1W8IA 4MSUA 1A7KA 4PG5A 3R41A 5ALZA 1IAVA 2YIMA 4FWBA 3QWHA 4PZDA 1Z7WA 5KUTA 4Q4AA 1P1FA 2QE6A 4MLZA 5KOHA 4LIPD 1M9NA 5L40A 4DPMA 1UPAA 3FZQA 4LRYA 4MP8A 4Y9SA 1II9A 5AWFC 2Y71A 1ZM9A 5KYXA 2NWQA 1BEUB 4QXPA 1CY0A 3WADA 5KNLA 4V0OA 4XWAA 2PT6A 3H9CA 4PUIA 3P5SA 2HD4A 4UUPA 1ZD1A 3G26A 3L5KA 1AA9A 1RI2A 5AOBA 2X8LA 1NASA 1PLJA 1ECLA 2M5RA 1DQRA 1T15A 2W6PA 3AHIA 2EFEB 4LJLA 3U17A 3QF4A 4DV1B 1N8KA 4FX2A 1G20E 1D8TA 4EUHA 1L5ZA 1ECFA 3COJA 3WGVA 3L7OA 4D43A 1H4TA 1DUVG 1ZGBA 3OUUA 4UATA 1QTQA 4L4QA 1ILWA 2FE1A 4YV1A 2IHUA 2X9QA 2D2IA 1B42A 1NMEA 2OZLB 2WFZA 1F8UA 4MUIA 4OSPA 5ALKA 5DOVA 4BCCA 4CKYA 2H8KA 3G5AA 4LV8B 2VQFB 4EPRA 1MV5A 2VLIA 3QKUA 5ER6A 2RHGB 5AVOA 5C80A 4QGSA 1ZJ5A 2I4MA 3R5JA 5LQRA 5FO0A 2A58A 1XJ0A 2VCEA 5HUJA 5F9HA 2A5YB 4XEUA 1UK6A 2C1ZA 2PX0A 4JLUA 5ALSA 3ZIUA 1PNTA 4P3YA 4EX7A 2SCUA 3A1SA 4RXMA 4EA6A 2Z8ZA 4AKGA 2Z6AA 1TQ6A 4EYEA 2XZDA 2E87A 4HS4A 5E4JA 3VU9A 1N5IA 5C3UA 1QKJA 1IPFA 2YV5A 1YZHA 1GKIA 1M10A 1N6IA 1SXHA 3PQ2A 3H6KA 4NJEB 2OPBA 2R00C 1NOKA 4HUJA 3CYFA 2HZ7A 4PYOA 4R6XA 3ZE7A 2KQUA 1W8DA 2V5AA 1KHHA 1RYEA 1V37A 3VR5A 4KE7A 3ZOKA 4NZNA 4KBYA 3IEXA 4CT0A 2GESA 2H4JA 1TIPA 4TSFD 1SXJB 1HSOA 3EHEA 4UMDA 4P93A 1GPMA 1ZMBA 1Q7YQ 1C8BA 5LCIA 1TC1A 2FWIA 1M74A 2Z44A 1X9IA 1CVLA 2O7SA 3FVQA 3NHZA 3WVNA 2C29D 2SNIE 4FCWA 3MMSA 4HGZA 4W5HA 2XMBA 2WDZA 1CBUA 1I6WA 1PT7A 4WN9B 1Y4DE 1WCJA 2TRSB 1RI5A 4BP1A 4AJHA 3OFVA 2PMEA 3IQHX 1CUHA 4E2YA 3ASUA 4YV0A 2ID4A 1NDQA 4JC8A 4OM7A 2SKDA 1FRZA 1PFGA 3IFSA 5ADUS 1XDDA 3ONWA 4J90A 3T4PA 2NPIA 2MF4A 2HSJA 2JLWA 3G79A 3KFXA 4B3SB 2A9OA 1KVTA 1XFDA 2F8MA 2PZEA 1BIFA 3E5RA 4KQMA 4K7JA 4YDRA 1NIPA 1RJFA 2VPWA 3D1JA 4P35A 3LKDA 1IZ7A 4U0BA 4RD4A 1I9CA 1U11A 3PQ8A 4L8YA 5FFFA 3WLNA 1EXMA 2JBAA 1GY8A 2O2JA 4C3UA 3OJOA 3UC9A 3ZHCA 4EUNA 3NONA 1MOPA 2W42A 2FWAA 3JQ9A 4JLSA 5I4IA 1QTNA 3W5AA 3DBHB 1M2FA 5BNZA 4MEBA 1PIWA 4Q9HA 1CFZA 3TAXA 2EGUA 1EFPA 1FYWA 1JLRA 2F7SA 3OEYA 3GCWA 3O47A 4ZN6A 2PNFA 4JBGA 2CHFA 1ZN2A 2WMDA 3RRNA 4Y6PA 1Q95A 2C4KA 2HRCA 3PQ3A 3R3WA 3PESA 4XWKA 4MUBA 2YJGA 3RG6C 5I4BA 2YXLA 4H1UA 1IMOA 3PIDA 4IV0A 1X7XB 1J8YF 4DLXA 1H9BA 3CF0A 4F92B 2ES4A 3H5LA 4FB5A 1ZZEA 1KJ9A 2X5XA 4MPRA 4P7JA 1M5UA 3T34A 4BB5A 4EHFA 5HGNA 4AQ7A 3UT5B 4KN9S 2A35A 3GJ5A 1HH4A 2C83A 2OHGA 5DYWA 1U0RA 2E5LC 5KDOA 2PU5A 2PQ0A 3BJEA 3WRWA 2YJ5A 4Z9XA 5C31A 1CUVA 2YQ5A 4GPBA 2IHNA 2CXTA 2Q7XA 2NSLA 3I5AA 3WLHA 2PUAA 2WM3A 4BNDB 4YJ2B 2BFNA 1NJIQ 3BSSA 4IYRA 4OUDA 3UTCA 2YWFA 3KM0A 3LZDA 3EFOA 1S2IA 3U6BA 3KQSA 1PHPA 4RFSA 5ILGA 2B34A 2XEDA 3L43A 2QENA 5L45A 2IYNA 1G3IA 4YMHA 4XFJA 4XW2A 4NH4A 1RXCA 5FBZA 1ZNYA 4OI0A 5GVRA 2NO8A 3CLUD 2OP0A 2F2TA 5ILOA 1N7JA 4PS0A 1J8FA 4HDCA 3KTOA 1FFCA 5C7IO 3KBOA 5E9JA 5E7IA 2FOIA 4H35A 1H65A 1AZSC 4D4LA 1AMOA 3SQXA 3X2SA 1SBIA 1Q0HA 3NLLA 4LJAA 2ATWA 2J6HA 1LBHA 1YS7A 2UZ1B 1LPNA 3AFNA 1Q3HA 1YVDA 4LF7C 4XRGA 1XVLA 1C1DB 2I6QA 4OXIA 1IN7A 1GV1A 1F3OA 1K27A 3F78A 3UUFA 1ZNXA 3GU3A 2HXYA 3RT7A 3SPXA 4AZVA 2NQ8A 2WKWA 2XQVA 2Q45A 1BGVA 3O8NA 3QVKA 3SS7X 4E1AA 5FWNA 1TAGA 2AJDA 1T5BA 2EJVA 1KDOA 3R4VA 3NDJA 3ZBPA 4IH4A 4LFAB 3HUEA 4GE3A 4C2BA 1TYCA 1GKKA 2WHYA 1M6XA 4LC1A 5JRJA 4GP6A 1Q0QA 4J