4IZ6A

Structure of ente and entb, an nrps adenylation-pcp fusion protein with pseudo translational symmetry
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
614
structure length
609
Chain Sequence
b'SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSREVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enterobactin synthase component E, Isochorismatase
publication title Structure determination of the functional domain interaction of a chimeric nonribosomal peptide synthetase from a challenging crystal with noncrystallographic translational symmetry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 198
structure length 609
sequence length 614
chains with identical sequence B
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4iz6A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4iz6A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iz6A01
5BSTA 4CA3A 3O82A 2CGQA 4M46A 3WVNA 5BSRA 3L8CA 2LIUA 5BURA 4ZJZA 2FQ0A 2KR5A 2V7BA 4GR5A 3E7XA 2L0QA 3EJEA 1ACPA 5DV9A 3ITEA 2MR8A 2EHTA 2P2QA 3IPLA 2JQ4A 2JU2A 2FQ1A 2VSQA 1RY2A 5KP8B 3NYRA 2LMLA 1L0HA 2MF4A 4DG9A 2K94A 1DV5A 4ISBA 2WD9A 1T8KA 2N5IA 3LMOA 2KGAA 2P2JA 5IFIA 4E5DA 3IEPA 4D4IA 2QNWA 5K8FA 2KOPA 3VNRA 3VNQA 4FUQA 2LTEA 2D1SA 3LGXA 2N5HA 3RIXA 2FQ2A 3NY7B 2Y4NA 2FVFA 3DHVA 2KOSA 2KG6A 5E7QA 2KOQA 2CG5B 3C5EA 2LIWA 3EQ6A 1AF8A 4H2YC 4HKGA 3QYAA 4BPFA 1ULTA 3DLPX 2FHSC 2GDWA 1F80D 2KOOA 1AMUA 2VZEA 2MVVA 2KGCA 2AVAA 3B7WA 3NYQA 5BSVA 2KGEA 2GDXA 4MRTC 2N50A 5HV8A 4D56A 3IESA 1MDBA 3EJDA 4H2WC 4PWVB 4PXHB 1VKUA 2D1TA 4G36A 2AF8A 4NEOA 4LGCA 2EHSA 2AFDA 1NQ4A 2KORA 2N6ZA 2XZ0D 1PG3A 4RMNA 3KXWA 3O84A 5DWVA 2LPKA 2JU1A 3T5AA 2K92A 3CW8X 4RM3A 4PZPA 2JGPA 2P2BA 3GZMA 4WV3A 3WV4A 1MD9A 4RLQA 2LKIA 1PG4A 2ROQA 2CNRA 3GZLA 3DAYA 1LCIA 2XZ1C 3U17A 2L9FA 3T5BA 2QW0X 3E53A 2MY5A 4RVOA 3CE7A 2D1QA 4BPGA 3IERA 5KEIA 5HVCA 5D6NA 1L0IA 5KP6B 4OYCA 2L22A 3LNVA 4R0MA 1HQBA 2KG8A 2K2QA 2FVAA 2N6YA 4OXIA 5K85A 2LOLA 1V26A 3A9UA 5KYVA 3IVRA 3EJBA 5KP7B 4G37A 3RG2A 1T5DX 4IR7A 2PNGA 4U5YD 3A9VA 2Y4OA 5KYTA 2MR7A 4FUTA 3G7SA 4IZ6A 2FAEA 4D57A 2L4BA 3E7WA 5CZDB 4DG8A 4W8OA 4D4GA 1YJ7A 2P20A 4RVNA 3WV5A 4H2XC 2LL8A 3FCEA 2N98A 3ETCA 3VNSA 2P2FA 2X2BA 4RM2A 1HY8A 3GPCA 4GXRA 3T5CA 2AFEA 3FCCA 4GS5A 1MDFA 1BA3A 2KG9A 2QVXX 2P2MA 2K93A 5BSWA 2M5RA 2Y27A 4D4HA 3LAXA 5GTDA 2QVZX 2FACA 2MVUA 5EJDA 2D1RA 5BSUA 3O83A 4GR4A 2K0XA 1KLPA 3NI2A 4BPHA 1OR5A 3U16A 2KWLA 3TSYA 2CQ8A 1T5HX 3R44A 2QVYX 2FADA 2K0YA 2GDYA 4R1MA 2DNWA 5BUSA 5BUQA 3CW9A 2KGDA 2KW2A 1DNYA 4R1LA 4EATA 5BSMA 4GXQA 2FVEA 5JRHA 4RLFA 1X3OA 3PBKA 1V25A 2MD9A
chains in the Genus database with same CATH superfamily
1R0SA 1TZMA 3NGXA 3GAAA 2VQ6A 3DQPA 2ZCVA 5C8VA 4GUDA 4E4YA 1XGKA 4KWEA 3TGLA 3HXOA 2XHZA 3OMLA 4R2IA 4TMYA 4MR8A 3WLTA 2C84A 2RKBA 2MJLA 3IKJA 3BSWA 2CJFA 5JSUA 4NEOA 3KHSA 3ZQUA 3TCNA 5C53B 3TVTA 5LN1A 3IAEA 4MPJA 5KYGA 4NFYA 2H7CA 4ENSA 2B4KA 4IDGA 3IERA 3P9ZA 4U3JB 4IDPA 4OK6A 2G63A 4NZ9A 2GCEA 5L7TA 3ZLTA 3HKBB 1TTTA 4ND1A 2JJ2D 4TXHA 3ISVA 4JAVC 3OM1A 1I33A 4DJ5X 1MJGM 1EX7A 1FMFA 3BTUA 1NUTA 4Z5XA 3P2IA 4L07A 3RSSA 1M2EA 2BEVA 3EEBA 1KO7A 1EE9A 2EFHB 4QXQA 3TX2A 4RSMA 4HX2A 4M1OA 2X19A 1IM5A 1B6SA 5C7IO 1CETA 4FPXA 4NBVA 2XODA 1PTJC 3GCWA 1POWA 3OLXA 3QKSA 4XGQA 3QLJA 3TNJA 4ZK6A 1S4MA 2YWHA 3AK4A 3GUYA 3AY6A 3AY0A 3BWCA 1P2SA 2F67A 4FFWA 1NC1A 1QO0D 5LMNC 3KFXA 1LI4A 1JLHA 3NTLA 3D6NB 1AV7A 3BAZA 4UBIA 3RT7A 5A0VA 1NQ5A 2D00A 1N6OA 4AYWA 1E69A 4NEHB 1ECLA 3F96A 1T8WA 4B31A 2QN6A 3GLSA 2Q7XA 1X8LA 1RMTA 4UHDA 3H13A 4X1IA 1MIOA 4D0GA 4F6RA 3AFIA 5BY2A 3AUTA 3RJ9A 4RZQA 2ADMA 1GQOA 1ZMOA 3OQVA 3M3HA 1GJRA 4HWSA 3IBYA 3UOAB 2RGEA 2EARA 3E3AA 3ZE0B 2F3SA 2Q7OE 2N47A 2QW8A 3ADCA 1OZFA 1AMNA 1KFKB 3I6QA 1P72A 4UTPA 4OX9B 4F96A 1KFCB 1V3TA 3I6MA 3GEEA 3OKCA 1SQ6A 1WD7A 3KYDB 1DLJA 4Q4AA 2ZT7A 4JCOA 4TGLA 2HEGA 3I05A 1GO2A 5CA0F 3DPSA 5TQ2A 1XTZA 1EFLA 1IBMC 3NTXA 4YJ2A 4JU9A 4J7AA 1WQ3A 3VJMA 3ZE6A 3L07A 1A7KA 1RAFA 4KE6A 1T8UA 4O4JF 3DB2A 2A1UA 2K92A 4LY6A 4BQOA 3AEKB 4MPDA 4EKEA 2JMPA 4PV7A 2IS6A 1JDBB 4P22A 4BC0A 3SR3A 2DHMA 4P7JA 2PKYX 2GILA 3E8SA 4CLDA 4XWOA 3PC3A 1YQEA 4CM1A 4E22A 4JJ7A 1QVWA 1QG0A 2J5BA 1XMVA 2BN4A 3C3PA 1N4DA 1XDUA 3WWOA 4HLNA 4RH3A 3ORHA 2CD7A 2JKVA 1UT6A 2I6QA 3UKOA 5CIYA 3DYIA 4D9KA 1H2FA 3PBKA 4QRHA 3CY6A 4L85A 4I4IA 5LB4A 3AI1A 3KB1A 3EZFA 4Q6WA 1T5TA 4XXHA 4X93A 5DTMA 2PANA 5ESXA 3EDYA 2IEZA 1T2DA 1RIFA 4P3PA 3C43A 1ENZA 4JT2A 2UYGA 4GBED 2V7QA 2B5WA 2VT7A 4ENUA 1FNCA 3IV9A 4PXHB 1NRWA 2JLZA 1DKRA 2G9UA 3ZV7A 2NUPA 3G88A 4N6OA 1ENPA 1PD1A 5F2NA 2PWZA 1Z8FA 2WVGA 3OUZA 4PG6A 5IBRA 1SUSA 1EUCA 3JASB 4FR2A 5GGYA 1J8YF 3LPDA 5JJIA 3LDHA 1CYEA 4LJ5A 2BZ0A 2QN8A 2ZT5A 2FYTA 4D9HA 4UNIA 2QBYA 4UU7A 1CB0A 4K1XA 4G9BA 1YDMA 4LE1A 3QYFA 3N5CA 3HVUA 1H1DA 3TO5A 1NT4A 3UM9A 2WZDA 3G71P 1AO0A 2MYUA 3AR3A 5TC4A 2I3GA 4BTLA 1NJFA 1QRAA 1CIJA 2RIRA 1TK3A 1SU4A 3IDFA 1QTIA 1KO1A 3RFXA 1MORA 4Q03A 4RV5A 3GZNA 1F9AA 1JXMA 1XG5A 5A4AA 3HJUA 1A9QA 1KXJA 1L8QA 4A15A 2YZNA 3ZH9B 3R7WB 2DFPA 3CR3C 4R69A 1THGA 1MXBA 4MGHA 4MX8A 2J6BA 1FJ2A 3QUSA 3OCXA 4NK5A 4MVJF 4F86A 3S99A 3SHQA 1KYQA 2BEUA 2W43A 1L5HB 2VKQA 5ALXA 3LIIA 4IH1A 1ESNA 4DV7C 4X1KB 4ALNA 5U9CA 5LCIA 3JATA 3HUEA 3R9IA 4NF2A 3IXQA 5SZJA 4OV6B 3EXHC 5DNWA 5HJ2A 2DHQA 4YMUA 1P31A 3LA6A 4F3NA 1E7RA 3PUJA 3CH7A 3A6FA 1Q17A 1T2AA 3HYTA 4EVIA 2Y1FA 1Q91A 3AVYA 3SXPA 1KOLA 1YRBA 1LC3A 1W36C 5AKEA 3A0UA 1TA9A 4LXHA 4TT8A 4LF8B 4BPRA 5AVJA 1UKVY 1QFXA 4JVNA 4PGGA 1K73Q 3PGVA 5F3RA 2X0FA 2ZB7A 1H1TA 4ZI3A 4FZ5A 2PSSA 1RI4A 5HE9A 1R18A 1AQ6A 4UE3S 1AJEA 1MAHA 3DVLA 3O0DA 3G8AA 3PWZA 1JJ2O 1Z7GA 3C4QA 3BDAA 3G17A 4ND8B 2Y0BA 1IZ0A 5AI5A 1BVUA 2WE7A 4Q9AA 4OSOA 1IVNA 2QSUA 5AR1A 1QO9A 1MGOA 3DBRA 1JHYA 1BQ4A 1TMGE 3DOJA 1IJKA 5HGLA 4HDRB 3NONA 4P4GA 1WEKA 3L0DA 1V1MA 4UUQA 2QE6A 1KSHA 4PE5B 4G89A 5FFNA 1ECJA 2QQEA 5C4GB 1XEAA 4R8VA 4C7JA 2Q45A 4ZYVA 4D8TA 1I3CA 1ZM4A 2FUKA 2PU7A 1DX4A 3HB1A 1NRIA 5KYTA 1W73A 2VRNA 4M1TA 2ISSD 3SZOA 4QNNA 2ISCA 3I58A 1OXKB 4NKRA 1K27A 2O0KA 2OGZA 1PJRA 4XYMA 5MDHA 2RJNA 3EDRA 5FWXB 4TYPA 4EIWA 1OAKA 1QF9A 1G6OA 2BFMA 5B3KA 1XTTA 4CEJB 1Z25A 4EG3A 4HATA 2GEUA 1JR2A 1M7BA 3P5BA 1BN7A 1PR1A 4G1BA 2A5JA 4ASUA 2YZMA 1M2WA 4JCCA 2HMSA 2PMCA 4ER7A 4PAGA 4RSRA 3EDMA 3QXXA 5BOSA 2ZJ4A 1GDDA 4CUJA 2IYOA 1U2PA 3EXEB 4U1RA 1MO6A 2FK8A 5BQXA 3FYHA 2JGDA 5EIBD 2R25B 2NU8A 4P3YA 5LOVF 5ISMA 2JYGA 1D2GA 4TUYF 1SFRA 1WLSA 3K09C 3UZ0A 3QFHA 5A5GA 4CMAA 2P9EA 2FZ5A 1LSSA 3GWZA 4MW7A 2FPSA 3TZLA 4D9MA 1JG6A 4XVRA 3GUZA 4LWZA 4S0XA 1H4VB 2HB6A 4AZTA 2Y68A 1U4OA 4RF4A 1FFYA 3LW7A 3Q7PA 5HFAA 4L4SA 1UOPA 1G8FA 2DC1A 1EXWA 5KVQA 5EKSA 4LZLA 1AKVA 2WG0A 3T1HB 3W0LB 4IS2A 5H83A 2PS9A 4L0QA 2QL5A 1ZVQA 3IQWA 1L8XA 5H3CA 3I2JA 4RJIA 3KQUA 2HHHB 1XZDA 3EW7A 3A70A 4MQEB 5FTLA 1XZBA 4PLTA 2Z5GA 1M6VB 3VOAA 3TD2A 4II3A 3GKLC 1QMGA 5IAGA 1MO4A 5FOVA 4CDNA 4ZEMA 1I80A 1NDUA 3IODA 1SU8A 2MT9A 5C7LO 1IHOA 2HPHA 3H0CA 4MHTA 4INJA 3AXSA 4N3GA 2MIIA 1E9BA 1UBKS 3C8HA 3FVWA 4JVOA 3AFHA 3DZHA 3LDFA 1IN1A 4H9GA 2JKYA 4UTNA 4D4JA 1W0JD 3OOEA 1W0CA 3OQ6A 1NQVA 1O6GA 1OJLA 1TPYA 6PFKA 2OZKA 1AKYA 1IG3A 2GN0A 5T7BA 3S4YA 3ZHSA 2OM6A 4G56A 4BECA 5T41A 3PUHA 5TEWA 1APBA 2ZKIA 2NXEA 2QWXA 3T1QA 5DNAA 2B4RO 4TV8B 4NCIA 2IPMA 2YDXA 1IMJA 1XR3A 4YT2A 2Z3ZA 1WUHS 4HAZA 3U9LA 4W5JA 6REQB 3VC2A 1YT5A 4U2KA 1W4CA 1PUIA 5ULLA 2EBUA 4MVWA 3UC9A 1G291 3WMRA 2HBYA 3L7AA 4K88A 2Y92A 3L7CA 5AE2A 2XNKA 1IBSA 4F4HA 3ZXIA 1N3LA 4QTXA 3U5ZB 1A71A 4JUAA 1PL0A 1HE3A 1I13A 1OZHA 1DTEA 3IAFA 2J1LA 3LO8A 1GPBA 4BQPA 4R2JA 1TT7A 3TSYA 1KJYA 1JI0A 5DGIA 4AMVA 3ZDDA 1DUSA 1JALA 4TKMA 5M29A 4HDSA 1YTLA 2OO5C 3B9BA 4JDPA 2WG2A 1T3GA 4W7IA 3L4SO 3KV3O 3BWBA 3DZKA 3VTFA 5CDFA 3B6IA 1MF7A 1Z83A 2QG4A 3FYDA 4QOIA 3C7KA 2A78A 3WFIA 3O8RA 1K9VF 5IDYA 3TW8A 2ZUWA 1B00A 2Q8NA 3O8QB 4F9TA 4ALKA 2QN9A 3VA7A 1AN9A 2AB0A 4G0VA 2BM8A 2E8FA 3GLGA 1J1UA 3GUUA 4P4SA 3L41A 2CDRA 1VPDA 5IJ9A 5KNDA 4NIMA 4FTWA 5B2ZA 4NBRA 1DKMA 2WW8A 2ASEA 3T7TA 3P2MA 1M74A 1PS8A 1XC7A 2HM7A 3L92A 4NG4A 1RBZA 1JV2B 3UK1A 3DOIA 2W2MA 2HA5A 4ZOEA 1JSRA 2JAQA 5HRAA 5IAOA 3IE2A 1NAHA 4J2OA 2VAPA 4X95A 1E6CA 4EW6A 2RH9B 1E1NA 1HR0C 2E2WA 1KC8Q 1Y63A 1W48A 1DNYA 4COPA 3GELA 5AMXA 3FYUC 2JIMA 2BE9A 1PVDA 2VNSA 4CKYA 3RRZA 4YJGA 9GPBA 3PC8A 1A9PA 2PPLA 4FHFA 1XZ8A 3VI4B 4ZVLA 2QA5A 1NI5A 2PUVA 3EY9A 4GZLA 3GJ8A 3KXIA 4RD2A 3NHAA 2IWRA 2PBZA 4MJ3A 2Y1KA 2GD6A 3PICA 4DCVA 2Y6UA 4JJFA 2QLNA 5FWNA 4MCJA 4DUPA 4DEVA 3SZRA 1K3FA 3QKRB 4C7OB 2VS1A 3D6HA 1WV1A 1GG9A 1HDEA 2OP1A 3DQZA 2JH9A 2CBGA 3GEMA 3I9MA 1J1IA 3GP3A 1CY2A 2ZZMA 4ZAGA 2DLCX 1CRZA 5AW9A 1VZ2A 3L0CA 1NVTA 3AF4A 5KCMA 1MNAA 4UDOA 2FQ0A 1AHIA 3C5HA 4MQFB 3W77A 2E49A 3ZUPA 4CTOA 4L6CA 5DT2A 2Q9CA 4KPUA 1F5SA 4Y6GB 4BGIA 2QSYA 1JZQA 1DRVA 2G1AA 1Z6YA 3D81A 5F64A 3VR6A 3KXPA 1HURA 4UPEA 5KYKA 1PL7A 1XQ9A 3FOCA 3OO1A 3UATA 4UU8A 3KE8A 5EMNA 3ET5A 1ARZA 3EC2A 5LMUC 4PYKA 5ECGC 1I2DA 2ZBUA 4YCNA 1ADYA 3A1NA 4TWZA 2F43A 4LJKA 3T4PA 2Q4DA 1FSGA 4LXTA 4BB0A 4GLOA 4G5FA 4BCDA 2EGTA 4Q4HB 2HD4A 3AJAA 1VLAA 3V2UA 2M5RA 5KYUB 2EWVA 2YIDA 2H17A 5D84A 5CJPA 2BZSA 3FPJA 1V6AA 5B6IA 1M2VB 4P7BA 5BYKA 1EE1A 4Y2TA 4GMDA 4JHLA 3VNVA 4LMAA 3Q8MA 3ZLBA 1H2RS 4C14A 5JD3A 5HKOA 2Q5FA 2CKMA 3TAHA 2ZI5A 1TQ2A 4A03A 5KP8B 1YJAA 4MRVA 4RAQA 1Z56C 1FC0A 1KYWA 1HORA 2J87A 2N5HA 2W8BB 3QIAA 4O0LA 3A4LA 5EHXA 3VU9B 3KV1A 1T15A 4KQ9A 2JS7A 1YVEI 1MJ5A 1ZGBA 1YOVA 4DV4B 1RAEA 3ZVLA 2V7PA 4JR0A 4C22A 1F17A 1T13A 4KU4A 1R5OA 3SLRA 1B76A 4ME6A 5ICCA 3Q6IA 4FR0A 3WIUA 5DNCA 2G09A 4QQKA 3RRNA 3K2QA 1L4UA 4GHWA 1YR8A 4QGGA 2ATWA 3V5NA 1I01A 3MGBA 1SURA 3W5BA 1F60A 1B6GA 1UT5A 1YZKA 4WFKA 3G0IA 3IAAA 1R5NA 3V55A 1ZC3A 1N6HA 2IPOA 2JQ4A 2H1SA 1BOFA 3D3KA 1XMJA 1J5EB 3LXXA 4HUJA 1AZSC 4CIWA 4GSLA 2P3LA 5F77A 4NU8X 5L3VA 3THXA 3QJGA 2A9JA 3CN9A 4MDFA 1TQ6A 4RZ3A 3BULA 2AUMA 1OXUA 3G1WA 2V7EA 2NUAA 1LK5A 4H3SA 3GNLA 1LWOA 4MI9A 1YRLA 1U2TA 3TEFA 4FYYA 1WMAA 4O29A 2P6MA 4DB2A 2O2XA 4HVTA 3UT0A 1DQRA 2BP7B 4TVKA 2QJWA 5JSYA 1XOIA 1QHNA 2FRDA 4HAYA 2YQ5A 2Q1SA 5CXSA 1HLGA 4M99A 1Y89A 2PT7G 3P20A 3P45A 4EY5A 1OLOA 2PZBA 2CVFA 3O03A 3UZUA 3CVVA 3GEGA 3I2FA 4X8HA 1M6HA 2XQGA 2YJ6A 2HU2A 1BXIA 2O07A 5M04A 3I23A 4JUIA 2X0IA 4IVRA 4ZRNA 1E5DA 4DF3A 3SDZA 1X0VA 1DUIA 1ULHA 3FGNA 1ND5A 3PPIA 5KHAA 4CG1A 3NBUA 3IOCA 4JI0C 1JDTA 3SS7X 4TL9A 4MYUA 1WU8A 1BU8A 1PS0A 2DTXA 4LBYA 5FUBA 1J25A 1UIRA 5E7JA 5IEJA 2J4FA 3GD7A 2J33A 2PXAA 3B7PA 1X1DA 2XQIA 4TWIA 4QJ3A 5EWJA 1ZU5A 5FV4A 1HX7A 5LM3A 3CVYA 3UUEA 2E8CA 1NQAO 3U7QB 3VX4A 2VIIA 1MB0A 5FBHA 2BF4A 1MVOA 2W6CX 2LF4A 2H08A 2VG8A 2BVNA 3F3SA 1KOFA 4B7XA 2XA9A 2B82A 4KQXA 1ZD1A 1FFWA 1UDAA 2R6AA 3K9BA 1E77A 1Z38A 3T1OA 5JC1A 5ANRB 5A7GA 4H31A 4DDTA 1UBUS 3VV3A 2YRXA 3HFRA 3UWOA 5A5EA 4EYGA 4WKNA 4G09A 1M2KA 3SXUA 1VBMA 4YC7A 3N5KA 3FROA 1NJGA 3PC6A 4ANFA 4ENWA 3Q9NA 3OE1A 3LNVA 1P0FA 1Q5PA 3FWHA 2PQ2A 4FJ1A 3K4QA 5A4FS 3KTOA 3L0BA 4PCLA 3WBHA 1FNNA 1TZBA 1XRJA 3DD5A 1GN9A 3K9QO 1LDMA 5BNFA 5A1GA 1VLZA 2HU8A 3GT3A 1K5GA 3ZU3A 2QDXA 3I6YA 3Q8XB 1FVHA 3RREA 3TFWA 5H9VA 2ARKA 3OCWA 1RBQA 3VJLA 2L0QA 5LYJA 2IHJA 5JXGA 3LO5A 1O4WA 2V54A 3R74A 4CW7A 4M86A 3SQLA 3GARA 3CZCA 4ENQA 3GR0A 1P5RA 3DV0A 1AS3A 4ZALA 1UJNA 2E18A 2GPAA 2RKOA 3OJXA 2CY1A 4PLZA 1NNLA 2PDAA 1Q95A 5DZSA 5BQ5A 3L05A 3FFAA 5H59A 2PA0A 2LD4A 4Q34A 2IDMA 2VFAA 1QQTA 3FB4A 5LP6B 1S3IA 3KZCA 4CF7A 2VP9A 4DEYA 3HXLA 5DB4A 1YCHA 1PZNA 1E0HA 3T3DA 5A7FA 1YZYA 4MQUA 1NSFA 4FONA 5KPDA 4YQEA 4D9NA 1ITZA 5D3ZA 5I7FA 3G5MA 4X62B 4QE3A 4DKJA 4B71A 5TJ9A 3ZTTA 3MCWA 2O9JA 1HGXA 2IYTA 4WNIA 3L1VA 2NM0A 2X9VA 2GN6A 3WGNA 1VL1A 4J0EA 3UBTA 3I61A 2ZWMA 2PIDA 3X1XA 1SC6A 2R65A 2OVFA 1KC1A 3HYCA 4OGKA 3OY7A 3FNRA 3QI2A 3NTOA 3T3EA 2ZSHA 1C8VB 2EC5A 1VIMA 4OXYA 2FQQA 5JU6A 1KDOA 4PHFA 5EW5E 3TQOA 4HLUA 2AOUB 4D81A 2D3TA 2Y2VA 4U9IS 2PS3A 4URVR 3DW1X 2OC4A 3H1GA 1N5DA 3WLPA 2XD4A 2RI6A 2Z2KA 4QYTA 4YRBA 2J0SA 5THXA 2GLUA 5DYYA 1SXJE 1KVSA 1E7QA 4IFBA 5HGJA 1BEZA 2IUUA 1XNHA 2AMJA 3EEFA 5BUQA 5KYXB 1E1RA 4HGRA 2JJQA 1IB0A 3RYCA 1Y8QA 1QMPA 3GO4A 1V7CA 2V3CC 2WJWA 2FE1A 2O1SA 4XGIA 3GRUA 1U8CB 4PC1A 4MMXB 4CLRA 4QREA 3QYAA 5LZ5A 1B2RA 4MWBA 3HKEB 3TF5A 1WUTA 1L5WA 1W88A 5CT4A 3DOHA 2ROQA 3FNIA 3IOMA 4JI8C 1ZN9A 3NATA 1B43A 4LJSA 2NO4A 4NENA 1F3OA 3O1JC 3X3HA 1D1PA 1W0KA 4CYMA 2OV2A 4CM9D 1QFZA 2PK3A 3L18A 1P39A 2C3MA 4YT4A 3EA0A 3B1VA 3U6BA 3HJFA 4YP6A 2O2HA 3PC4A 1C7QA 5LNK1 3RVKA 2G4LA 4FYVA 1NNEA 2HJRA 5ITWA 3O1LA 2GD2A 4NS1A 4FM9A 4UEKA 2NYUA 3ZDZB 5C34B 3C6ZA 1QBGA 1TTQB 3HM2A 3H2YA 2Q3LA 3V6LA 5DBHX 1OD6A 2Q7DA 4ZTZB 1SWWA 4XYEA 1PKEA 4XAQA 3ZI0A 1F8XA 3KQTA 1ZPDA 1O0CA 4R0VA 4AG3A 1L7QA 4WPGA 2VAMA 4A2PA 4FHCA 5CRIA 2WJ6A 2QTLA 2G76A 1CR6A 5B4TA 3H9QA 2X0EA 1RXSA 3C5VA 4OMCA 1VQLP 4NCNA 5EE3A 1NN1A 2H9YA 1DCTA 5H81A 2ZIAA 1NI4A 5KTPA 1FRQA 2AXEA 4JU8A 3CLHA 2VYND 2CV0A 2N3ZA 2VUIB 1C8LA 1KJQA 3E1KA 1YK0A 2XADA 4LGVA 4HPWA 5C8DA 4RDIA 3ZWQA 3VBEA 2GF9A 2GF2A 3EWAA 2ZULA 5KVAA 2C2MA 4H7IA 3RTDA 1NF8A 2YNMA 4K46A 2N5IA 3Q8WA 4B3GA 2DYKA 1FRFS 2IHKA 3SE7A 2BRUC 3FPGA 1NW5A 5KOIA 1LSUA 4GL2A 1N8SA 1M90Q 2IHUA 3M6MD 1EAYA 3EXHB 3T95A 1JRLA 1XCOA 4PBTA 2AG6A 4G8BA 5E4YA 2EQBA 5DWVA 5CEFA 4OTZA 4WV3A 3EZ2A 4F6LA 1E9EA 4N3BA 2MHCA 2QL7A 5J4VA 2PTHA 3IR5A 4D3SA 5AHRA 3B60A 2GAAA 4QARA 3IBGA 1Z08A 5SICE 5AOCA 1IWPB 1W36B 1SO8A 3VGJA 3WL5A 1U0BB 3GA7A 4KRXA 2OBBA 2ATIA 5JR3A 1WW2A 5GQSA 3ZY4A 3NEJA 3QX3A 3OOHA 4C0KA 1R0WA 1IPHA 3MPOA 2NO0A 4P6VF 3VBCA 5K0SA 2WVAA 2C5FA 5BN5B 1DB3A 1BNCA 2E0GA 2IYYA 4DXAA 1R74A 1N6KA 2X3FA 3EMKA 1JW9B 2A0WA 1EUZA 4UASA 4EGFA 3K5HA 5CNIA 5K99A 1SKQA 1C4OA 3JZDA 4BFWA 3HZQA 4NDZA 1PJ3A 2HT1A 1KEZA 2OA0A 1CUBA 1QWSA 2C4HA 3CNEA 3BL8A 2B78A 4HMQA 4Q9NA 4B87A 3TTSA 3GLFB 2EYUA 1KAQA 1R64A 4UNPA 3I3SR 1E59A 3UPTA 2GN9A 3T7JA 2IF0A 3UK7A 1VQ1A 2P4EA 3TM4A 4XWWA 2I99A 5AK4A 5MN4A 1ACMA 4NMWA 1P7ZA 4Y2YA 1X7WA 1VLJA 1DIBA 3QLTA 2F1OA 1AF7A 3MWEB 2H63A 2WM2A 1K89A 4QICA 3I34X 5AVWA 3J81D 4R2KA 2A4KA 4BE4A 3SJBA 4DCUA 3ENVA 4TQUS 1ISMA 3R6LA 3C39A 1VIDA 1UBSB 2I55A 1ZP6A 4C6SA 3OQIB 1DPGA 2C5LA 3L8HA 1UBRS 1E4OA 3LBNA 1OV4A 3FZNA 1RNLA 5D01A 1YS7A 2ZR7A 2GOYA 5EJ6A 3RNOA 3EN0A 1L5QA 4JV5B 2WHRA 3HBFA 1SQFA 3DAYA 2OD2A 3QP9A 4U0FA 3GLIB 1BW9A 1NVAA 1UOOA 4RK5A 5G1OA 3ZW9A 1UCFA 3I9OA 1TX4B 1SHUX 3OC0A 3FOEC 3AB3A 1KSFX 3ZBQA 5GP1A 4JASB 3UK0A 3THRA 5EY5B 1WPGA 1PYDA 3I6ZA 2YZ7A 4S1NA 4JLAA 3ISJA 3E9QA 3P71T 2C78A 1XLTA 3BL5A 2KB0A 2ERCA 3QYPA 5L3RA 4TQ9A 3UMRA 4FMDB 5C9ZA 2VRBA 3G0BA 4F3YA 4QUJA 1YS1X 3UMMA 1TCBA 1W581 1VLLA 1AQYA 1B4DA 4HUQA 3CT4A 4IW3B 5FUXA 1XJWA 1M2HA 2ZYIA 1FYVA 4BRUA 3TLXA 1V11A 2V6MA 3DE3X 1JYFA 4GOND 4H7FA 1UM8A 3GLUA 4ETMA 3UXMA 4EWLA 1QYWA 4IEEA 2EHSA 1E6JP 2IT1A 3D9QX 3OX3A 4LF4B 1NAIA 1RJEA 2O0JA 1JHQA 2X8JA 4NBUA 2QSJA 3VXKA 3V8QA 4IPYA 2FJPA 4PLHA 1XTRA 1YWGO 2D1YA 1XVLA 5KCZA 3K16A 1FMLA 2W2XA 2GR9A 2G4VA 2CFRA 4PONA 4COOA 5AVVA 3SHWA 3QNWA 4OU5A 3OQMA 4L73A 3CSDA 5IXYA 5GVSA 1NF9A 1VJDA 1P9NA 1N5MA 3N6VA 4JIGA 1OFUA 4RORA 2R8YA 5F9HA 1RO0A 4BO5A 2CL7X 1CDZA 2VZLA 3ETHA 3SOZA 3U4HA 5JEDA 4O0MA 1P5ZB 3TRKA 1UXKA 4Z4FA 5BR4A 5C1DA 5B37A 2ZIGA 1RACA 4WUVA 1BD4A 3IQXA 3R0QA 4M0KA 2ZANA 3CG0A 4KLZA 3Q7SA 3O7MA 1JJBA 2CXSA 5ALSA 4WGFA 2OSBA 1ENOA 2GZAA 1IB8A 5JVDB 3AKZA 1SU7A 1IE3A 4DR5C 5DM0A 3ZV5A 3C87A 4YAKA 3ORYA 3Q5DA 2HYIC 1R6AA 3HCNA 3VC7A 2YQZA 1TM5E 1CRQA 1HV8A 1UODA 5CXXA 4FW8A 2XSZD 2VNJA 4JI5C 3F7TA 4GP6A 2MSLA 3L79A 3DDUA 3R7NA 4XQEA 2VHUA 4DT1A 2FHSA 1L1RA 1CLEA 2W58A 2W5UA 2A4MA 1W59A 1ID1A 1NA5A 3LP5A 5LL6P 4EDFA 4TTIA 3TUFA 3AESA 1XPOA 5AJHA 1XT6A 2JGNA 4LY3A 4NLLA 4WZBB 2O2DA 3I9V6 2J3MA 2AMVA 5ALMA 4PTLA 5GJCA 2H7XA 2V8BA 3R6GA 5BRNA 3O94A 4NNJA 1WB6A 3FCOA 2TMGA 4OAPA 3NDRA 1HLDA 1P0QA 2VTDA 4FFBB 3A6ZA 3RGWS 3U44A 5KU1A 4LOLA 3K9FC 2W2NA 4OA5A 1K8QA 4IDBA 5EZYF 3FYCA 2E5WA 2UDPA 2P5SA 3HSKA 4WFJA 1X70A 2D27A 2EZ9A 3MUNA 5DISB 2DERA 3V8MA 3V9AA 1ZX1A 3WO1A 2FN9A 5AFSA 2EKDA 3R7BA 4JYMA 4QFCA 1W94A 3SYTA 2A2ZA 3OU2A 2OVBA 3HCEA 4BX3A 4GVPA 3SG0A 3OCVA 4V0RA 4Q6BA 5ITVA 1ABBA 3TRJA 5IXJA 1YZLA 4ZCIA 5DCKA 2WP0C 2P9XA 3PR3A 2OV3A 3WRXA 2QM8A 4Y98A 3HCWA 3UA3A 3CC7P 2B34A 2RBGA 4BTVA 3V1LA 1RJDA 2QAJA 5TF4A 1MV8A 1P81A 2ZTSA 2PL5A 2AJLI 3FR7A 2FUG6 3ZHBA 3V7FA 3SPXA 4OO3A 3IUYA 1JHUA 2BKVA 3BREA 4GDFA 2A67A 2XUOA 2WF7A 3G8BA 4MW4A 3F71A 4MRPA 5KMGB 2V6IA 3GUCA 2DAPA 3WK5A 3BQ9A 4AWXA 2VJCA 3ZLVA 4CQMA 5JNVA 3ZDBA 3W6ZA 4RDCA 1Q2XA 4EO7A 5I7AA 1RPNA 3FKQA 1UJBA 1WVMA 3C5WP 2Y1OA 5JQGA 4HWOA 3EXG1 3CCVP 1OFTA 3P97A 1QAQA 5CDGA 5HNKA 3E7FA 4JQSA 4MH0R 2G7MC 4GP7A 3DH0A 3LHKA 4ARSA 3QVSA 2F55A 2IU3A 3U1VA 5BT9A 5ERGB 4I50B 3VH2A 4PFQA 2WSBA 5L40A 2O52A 4AP6A 2FSVA 3WYFA 3CZ9A 3OBIA 4JBIA 1GZSA 3QKWA 4W9NA 5GOTA 2ZE5A 4E5KA 2GUWA 3P2YA 4CG3A 3M70A 1P1BA 1AV6A 1F8GA 2P2SA 4ZT2A 2JFOA 4F5ZA 4X41A 1AA6A 4YYEA 4CI0B 3ICPA 4AMUA 4DV2C 1TW3A 1ZICA 4BMYA 2KE5A 3LUSA 1DQYA 4JJ4A 5AW7A 3NCHA 4ER6A 4ZTUB 4ZN6A 4RTRA 3QE3A 1JPUA 3FGZA 2JFFA 1GUZA 2RHLA 4FFMA 4AVYA 3H4TA 2FPPB 2AJ8A 3MTDA 1S3FA 4J3FA 3S2UA 4B47A 3GRKA 1X0XA 4J91A 1YDEA 5GONA 4QDKA 2VAXA 1IBLB 3ADKA 2YN4A 2NN3C 3OZRA 3HV2A 4IV8A 2HPVA 3U7HB 5SZKB 1WCIB 3HSYA 4B4VA 1GKLA 1FUGA 4MV5A 3H8VA 3M0EA 1MUUA 3F9CA 2A5DA 2ZYWX 4BP3A 3I6IA 3B3GA 1N8RQ 1FFAA 3CQ3A 2IELA 4Q9LA 5CP8A 2NSLA 4EW3A 1YJXA 1JA1A 1IBRA 4QELA 3T3MB 3Q2KA 1M2OB 4ZHQF 3UAZA 1YI2P 2PD3A 5AKJA 1ORTA 2MMAB 1JL3A 1HQYE 1T10A 2KS6A 3LX5A 2OCAA 3I9KA 1ZH6A 4DCTA 1ZVMA 3VTAA 3SFTA 3TG2A 4C5AA 3EPJA 4EYKA 4KOAA 5AUPB 2J3QA 2CJPA 3D54D 2GDYA 2PT7A 3O4IA 4YR7A 2PGXA 2GSWA 3CEMA 1OUMA 5DV9A 4HYQA 1B0ZA 3MWDB 4CDRA 5B2EA 4DR4B 4XFZA 3T34A 5IVPA 3FLAA 1KR2A 2GDJA 4KJXA 1YFLA 4JITA 2YW2A 1YHYA 5EWLB 4BRWA 1LJLA 2WZQA 2PX2A 3GK3A 4K6KA 3FGOA 2F90A 1N2FA 2ZYTX 4U2DA 3UWPA 3W5AA 1QRRA 2IW1A 3HR4A 1JAHA 2CJWB 1ZNVA 4L3WA 5TS3A 1BQEA 1I6KA 2VHQA 3THYB 1H8HA 2B35A 5ABPA 4OHRA 1PL6A 3D6MA 4CG0A 1NN5A 3GJNA 1NY8A 4BC7A 4HS4A 2HT6A 2R6ZA 5EPUA 2WC1A 2GN1A 2E4ZA 3JV7A 2YWEA 1SZPA 1WY7A 1KP3A 3MRVA 1AOXA 3L1KA 4P92A 1FRVA 2BBWA 5EJMA 3OD1A 1ZI8A 4K40A 1DIGA 3TKYA 1V5FA 2PKXA 3IDQA 1B0PA 4C2UA 2QTFA 1OLXA 1YI0A 5CZXA 4M4SA 2D28C 1P0IA 3M1YA 2REXB 1DWPA 1GGHA 4RA9A 2G71A 3DZBA 5H82A 3KQPA 2XMZA 2V6FA 3X1MA 1S8FA 3PC7A 1R2QA 2LCIA 1QOZA 3G82C 4MQ4A 4PR3A 1YZUA 3QW2A 5KYYA 4PVCA 4G67A 5EHNA 2GEBA 1H4QA 1FSZA 2V7TA 5L4SA 3KEFA 4HKTA 5BSMA 5AHXA 3U09A 2O2SA 5TJHA 1EG7A 3VPGA 1ECFA 1MABA 5LXTB 5G40A 3BK1A 3H0EA 1O0SA 3TLGA 3H0KA 2JGIA 4E5DA 4MEBA 3VNRA 4C03A 4WXMA 4J7XA 2XDYA 3BH6A 3F6BX 2B1QA 3Q9UA 4N7BA 1QWIA 4LGCA 1K8RA 4HXEB 3ZWAA 3PLRA 3K1AB 2HCTA 5KOJB 1CX9B 2AWOA 4B76A 1J2RA 3J7AC 1E1QA 2A0KA 4NAUA 1JYEA 3K9CA 3P4YA 3JQ6A 3WFJA 3I0ZA 4K1LA 4EL0A 3ZJ4A 3D8TA 3DBHB 2I2FA 4FGZA 3WWEA 1TKRA 3MAJA 2B5OA 1E2GA 4KODA 3EGOA 3AM5A 5FEUA 4OSPA 1Z62A 1FVOA 3GDGA 4S2EA 2LBPA 1WV0A 2N42A 5BUCA 5K8JB 3B51X 1J70A 3W4IA 3M49A 3MQ4A 4WAUA 2OC9A 4AD8A 1MO5A 4YCLA 5C1BA 2G1KA 2ZI3A 3P9QA 1ACPA 5JJBA 3BBPA 3WNDA 3NG1A 3GB9A 3RRYA 1K1EA 3RIEA 3MMZA 3R7FA 5C0OE 4OHFA 3GFPA 4MUYA 4BNNA 1F2TA 1K6IA 1RWNA 1ZUNA 3MCUA 1E2FA 1H2ZA 1DOHA 1FJGB 1UFOA 1G38A 1W30A 4QQNA 3EULA 2UXBC 3EH1A 4FU0A 1J42A 4XD7A 4IHJF 4JMPA 2OBFA 5FO0A 3M4JA 3O92A 1UOEA 2PEMA 4DWWA 3HTXA 4AI6A 1MLDA 3K71B 1F38A 3A32A 5C8XA 5DM4A 1E9VA 2BL4A 5JS6A 1Q1AA 3AM4A 3LCCA 1W9MA 5IC5A 3ZU2A 3CKMA 1KEWA 5H16A 4G2TA 2DNWA 3A4IA 4UDXX 2FR0A 4NFLA 4J29A 5BVHA 3IEUA 1DOAA 3CMAP 1ZNZA 3D31A 4QUDA 3QE0A 3VU8A 5EMJA 4GP9A 1XYYA 3ML1A 3I4CA 4J9VA 5EUBA 2H1WA 1N6PA 4D5EA 1PJLA 4M3NA 4GPAA 1R27A 3IP9A 4WX2B 2YHIB 1BZYA 4U0JA 2WFZA 3WMGA 3R3SA 4MP8A 3A2KA 2G5TA 3L7MA 3LNTA 1XP8A 5E4FA 3TOXA 5DLQC 5C18A 2UZ4A 2QTNA 3W4KA 3E9CA 1UANA 1VGRA 2P69A 1UBTS 4YT8A 1KQOA 4A16A 3R3WA 4R1QA 3JWIA 4Q3LA 4I1UA 4BQQA 4B3MC 3OU7A 1RLTA 4FOTA 3LPCA 4Q9KA 4Q4LA 4B32A 2O50A 3G2PA 4IV5A 3R1IA 2XV1A 3A1DA 4CLOA 2JAXA 3QPUA 1K8YB 3NI2A 4UUMA 1UQRA 3BDIA 4L7IA 1TM1E 2EAUA 1XNGA 3GJ3A 1HNZC 3NHYA 4LCJA 3WL8A 5JPCA 2R6JA 1Z16A 3VPDA 2OB1A 2D1FA 4QRDA 5MN6A 3OF5A 1M5TA 3C97A 2KJQA 1EVIA 4D0NA 4LQ4A 1Y6QA 1GVHA 1JDSA 5K0TA 2Q41A 4TS4A 4PZDA 4TYWA 1G2PA 4ZQIA 1Z37A 4OXQA 4LOHA 5TDHA 2R1TA 2OHVA 1JFFB 1VG9B 4PUIA 2JAHA 3KEMA 3A2LA 1WMEA 4GU5A 3RHZA 2H06A 1N6NA 5KI6A 3ZHTA 2MSEB 3USCS 3KHTA 3DVAB 4EFDA 4PXYA 4JI8B 1Y3BE 2H00A 1K3UB 4N9WA 3WLOA 2OKGA 5K6RA 5ES3A 5HUQA 1J23A 1H66A 5DULA 2IXFA 2GZGA 2YJ4A 1QHSA 4CDGA 3MCZA 2Q3EA 2FG5A 1V25A 3UJ8A 2BUOA 4GR5A 1EVKA 2CBXA 1WF3A 4ZCRA 4ILEA 4G4GA 5CB8A 3SZLA 1RYDA 3SX2A 4JS0A 1U65A 4WCVA 4BNLA 2W98A 2PSFA 5EIFA 2CLHB 2IF2A 1ONOA 4RSGA 4M53A 4ABYA 4I6GA 3KXWA 4Q3NA 4PLCA 3NFYA 5D3MA 1PG4A 4BFTA 4Y1GA 2H9AA 4E1VA 4KSBA 3RROA 1V48A 1KI3A 3TSAA 3L02A 3PEVA 3AX6A 3T0FA 3RIYA 5KJFA 4HNGA 3HRIA 2WQ7A 5F4BA 3CRW1 5AJVB 4F85A 5F52A 4ZARA 2K87A 2WAAA 1R4NA 4M37A 3CUKA 1OH7A 4I55A 2GO1A 1SY7A 3EG9B 3LKZA 3QX9A 3KXDA 1QRDA 4OCZA 1TCVA 1V7QA 5LYYA 2YMPA 2GEFA 3B2QA 5IC4A 4O8CA 3JW8A 2VSQA 3Q1LA 3L3BA 2XUIA 3C8UA 4IRXA 1FY2A 1JHXA 1O8BA 3ZS8A 2OOSA 4RE6A 2HA0A 3LL7A 3P0JA 4L50A 4BJHB 2QYSA 3BMCB 4RCYA 3TLYA 4GI2A 1FF9A 5TIIA 4REMA 2D2IA 2XMBA 3GCZA 3TEMA 4RVGA 4EDHA 4BZPA 1JFRA 1JLLB 4CL3A 4Z4IA 1G4HA 2OK8A 1ZWKA 1W85B 1UPBA 2IYVA 1V5IA 2Q2QA 1II9A 4NBLA 4S05A 3RE1A 4L51A 3AP2A 5GZ1A 2FX5A 1VPLA 4P4UA 4KRGA 4YQZA 1RYNA 3KCNA 1NVKA 2DYJA 3N05A 1LLQA 1XSEA 1GTG1 1Z73A 2YWCA 3T5PA 3QGMA 1U3FA 4Q12A 3N7UA 3PE3A 4O4IB 2PG3A 3MJRA 2Q6IA 3CURA 2UUCC 4FC6A 2VQ3A 2FCRA 3A2MA 1V3UA 1TCUA 1UAYA 5JYEA 3DTNA 4Y2XA 2EKPA 1CZUA 1JWLA 2JHCA 3IQZA 1DXOA 3OFND 1O6BA 2PQ6A 3W6OA 5DDIP 5IC6A 1XD2A 4GPD1 4CLHA 4JBGA 5CAEA 3W2TA 3DKIA 1K8AQ 2H5IA 3IELA 4FWTA 4FEAA 3BUSA 5LQMA 4OJNA 3K9WA 1N9ZA 3K7EA 3AI2A 4ZIRA 4DNOA 4YAJA 2WSSA 5AW6A 1WX1A 3UW1A 1KQGA 2NU7B 3KJZA 3G9TA 1WPQA 1XCJA 1I9GA 3GVHA 3HYSA 4ZU6X 4FYJA 4LFBC 4UHCA 3T12A 4LX8A 1Q44A 2IV2X 3G5UA 2MMCA 1IH8A 5DGHA 2L42A 1OXBB 2RH4A 3CCFA 1M6YA 3ITEA 1G8YA 1U9YA 5CT6A 1LBIA 1UBCA 3K0KA 1P2UA 4B79A 9ABPA 3D0RA 1V8BA 1BN6A 4J75A 3H1TA 4PZUA 1V6CA 4B3RC 4XIJA 3BG5A 4X60A 1Y3HA 3NOOA 1AS0A 3AUKA 4YV2A 2UV8A 4Y9UA 2CDCA 4BMNA 2YWRA 3PUZA 3IESA 1B8NA 4EGAA 4V1CI 1UF9A 1JPJA 4NE2A 4GE0A 1Y8RA 5KTSA 1KP2A 1NBMD 4V0NA 4QHYA 3U3RA 1JT9A 3S6JA 2WT9A 2NNWB 4WJLA 1GDTA 1NVMB 3AG6A 1ZK3A 1P75A 1C2YA 1K6MA 3DS3A 1C4WA 3QLEA 4A8PA 4C3OB 5AHOA 5JECA 5HX7A 4WCFB 1GFIA 4I9UA 4R1OA 2HO5A 4C7KA 5HIKA 1KIMA 2REQB 4R1NA 1GQQA 5A9SB 4OF4A 1Q7YQ 2BY4A 3FOFC 1MG5A 5LQRA 5K8IA 4LN1A 2OGWA 2VJAA 3SHVA 3WL6A 4L7QA 1CY4A 2NLOA 3K9GA 1NF3A 2MDTA 3MELA 2AQ8A 4W99A 2TYSB 2IW3A 4OXKA 1J8DA 1Y6FA 4DIKA 3DXFA 1M1YB 3BC1A 1ZRMA 4RUKA 3QU9A 1G8GA 1YFKA 5CA1B 2ZVQX 1UINA 4EO9A 1P61B 2AV6A 4AJ2A 3PNLA 3EZXA 3MUFA 3GQBB 2EFGA 3AUSA 2WB4A 4Z1OA 1EMDA 2W00A 2JAZA 3GR6A 4D8UA 2I8AA 4GGPA 7REQB 1QIFA 2X3UA 2VRCA 1G2QA 1A9SA 3WMEA 3IQEA 2HQBA 3A4VA 3PNKA 4ZEXA 2H52A 1R0XA 3K5WA 3Q9LA 1X7YA 1NR1A 3KSDO 4ZCTA 4EJ6A 2IYZA 2HLPA 3MVEA 3UT5A 1TIKA 4UVEA 4F7DA 3F98A 2MINA 3QWBA 5HBGA 4TVOA 4F92B 1SVKA 1AGXA 3BN3A 3QJ5A 1PO7A 3RHSA 1MO3A 2CXXA 4OHBA 3KJIA 4LPKA 3FTFA 1LX6A 1XCLA 2X7XA 4UEOA 1WIWA 4QU9A 2DWQA 1DFGA 3RIGA 1WKBA 1AQIA 2O2ZA 3JALA 2K2WA 2L0XA 5AJWA 3WK7A 1CUCA 3TDNA 4BMZA 3WE7A 4EHJA 3LLMA 1ZDMA 3AIMA 4M7RA 4JXXA 1NRXA 3KZVA 3EUEA 4Q24A 5FOTA 3OJOA 3H6HA 4YCDA 3E48A 2FEXA 2KW2A 4AY4A 4LRXA 2ZM6B 4TS1A 2C83A 4HTFB 4L78A 4HN2A 2VSNA 2PFGA 2QTTA 5L6MB 1R4MA 4DV1B 3OKPA 2FQ1A 3T3HA 2GJKA 3OQHA 4ZVMA 4UAVA 5HJEA 1TUIA 3ITDA 4QO7A 2OP0A 3HPRA 3IUPA 4B82A 1GNRA 5DYGA 2BUBA 3DMNA 4B3FX 2YXBA 2GETA 4RHTA 5CBPB 3G9QA 4LF7B 5CVEA 2Q9UA 3LVBA 3E5MA 3BFJA 4KJZA 3TPCA 5HVCA 1G7TA 4MMZB 3GC6A 3S28A 2I4RA 4X3PA 1STOA 4YIKA 4HDAA 2YVKA 4IHAA 5KREA 5EG5A 2YHAA 3PC8C 3RBVA 3S40A 2XMQA 2QYTA 5EIXA 2HJGA 4NVRA 3STWA 3SX0A 4HDKA 2R751 2Q1UA 2YZ2A 4LRQA 2DBRA 3B38A 2IBMA 4C3UA 4E1AA 1PHRA 5C2JB 3V4FA 3UGJA 3IURA 3FOAA 5AK3A 4Y2UA 4PLPA 1SBQA 3IP6A 4E11A 3OZBA 5BMVF 4I5FA 2VHTA 2WWVD 1SA0B 2F62A 3C6XA 1NMXA 1CG6A 1VHQA 2WDPA 1GPNA 3PENA 3GGGA 5HGXA 5IVIA 4CTJA 5HZGA 1B0UA 1YBHA 2ZE6A 4RKFA 4WCDA 1B23P 4BB9A 1T9HA 1XQYA 2QX8A 4GI1A 2NV2B 5DGCA 3GRRA 1LKZA 3D8SA 2F3RA 4MVJD 2DCUA 3MJFA 1QLJA 4IF6A 1RFLA 2RGBA 3PI6A 3R20A 5BPFA 1KL7A 3RYIA 1D0VA 1AH2A 3PB3A 4HB4A 2H2GA 3UGQA 3B1KA 2DWUA 4EEKA 3QMMA 1ZUD1 4Z0TA 5F2OA 4C2BA 2IFTA 1ST2A 5LA6F 3C24A 2IBSA 3WL4A 5LMNB 3QNMA 1JEQA 4Y6LA 5IK2D 3UJDA 2ZTHA 3K0FA 4UJ5A 3L6EA 1EB9A 3IDSA 5EKXA 2C9MA 5BWBA 1EFRD 5LQDA 2ZW9A 3MGCA 4X45A 4LS3A 1AZTA 3UK6A 1UK6A 1RYYA 4OUKX 2OFPA 3B78A 2DH5A 3QLUA 1G9TA 1CQZA 3ACBA 1RE0A 4LDZA 4LKOA 2LPMA 1BA2A 2D4HA 1V4BA 3HZZA 4G0OA 2OM2A 2QF7A 1QS0A 1WOMA 3B85A 2DWOA 1RYZA 5GMOA 1DIRA 4B1FA 1N6IA 3KOYA 1Y80A 1VFPA 2ASBA 4BPHA 4DV2B 2HF2A 2CLSA 2E1PA 5CCDA 3MUEA 4GPIB 3PEUA 1P7WA 5JIBA 3NALA 1ZR2A 1XZJA 3ZVMA 5BP7A 2TSYB 4IBOA 3T3PB 4MDYA 2CDBA 1IBMB 1NQTA 1SUDA 4P1ZA 2PRIA 1XI2A 2OZVA 2QT9A 1NLZA 1J24A 3I5UA 4F2GA 3HCFA 4B6RA 4GSYA 1ZOOA 3VPSA 4KLRA 5C32A 3PEEA 2LGJA 3ZYCA 3G2HA 4O59O 4K6FA 1SEVA 3ZHUA 1N5OX 3FTDA 1KK2A 5A5VA 4XSVA 2TMDA 1KY2A 1QXSA 4CMGA 1ZOSA 1YU9A 2XT1A 5EPEA 3LP6A 2OFFA 1BKYA 8AT1A 1SUCA 4V0ME 5JFOA 3H4EA 1ZH4A 1PGJA 4UNQA 1MBZA 2BSAA 4NNPA 3FDXA 4IIVA 4MWGA 1Q74A 2F1JA 3NETA 1A72A 2ZJYA 4ARUA 1DAMA 2YY5A 1JQDA 3DF7A 5FHQA 3ZCUA 4ZRDA 4YP9A 3QY0A 3KVNA 3EVAA 1OW3B 2FB9A 4Q9JA 3PFBA 4K9QA 4HZUA 4QODA 4WASA 3UAYA 1H85A 1U8ZA 3RTBA 2WD7B 2OUKA 5I4TG 1GZ5A 2B1IA 3DFKA 5CB4F 5C4IA 1QDLB 3R5KA 3MB8A 3WZLA 4ER0A 3KPVA 1TVKB 3TW4A 9MHTA 2QUKA 3WYAA 3ASYA 5REQB 2FRDC 1G5PA 1OH5A 3TQCA 2I7TA 3HB7A 2FUEA 2LCFA 5HIAA 1A4RA 5AKIA 3PRHA 3MIIA 5EIEA 3BERA 5EXSA 2WUGA 3CEPB 3RVDA 3KJXA 1HH2P 3RV3A 2EW2A 4CA3A 4CMBA 1QANA 4W7HA 4NPCA 2RGXA 1C2TA 2PE5A 2ON6A 4R2LA 2I4TA 4YJHB 1GPWB 2DECA 2B20A 2IQIA 5FTMA 2RDMA 2RHJA 1NPYA 2COKA 3NXKA 4GI5A 2F1RA 4URFA 3RAGA 1QK4A 5ERYA 3FCYA 2H1HA 4V02A 4RAOA 5CFOA 2ORWA 2P3QA 2V7GA 2CB9A 1JDUA 4U2GA 5KZMB 1KKGA 2O1WA 3HN2A 4JJKA 3RAPR 2RHWA 4OLBA 3SKVA 3E1SA 4H1HA 4LKRA 3PKIA 4QFMA 2P2DA 2VNHA 1OIWA 3OZDA 3X1ZA 2BEWB 4AG5A 3CX3A 2DKNA 2E8EA 3ELDA 1XZPA 1NNI1 1QKIA 1FYDA 4YHHC 3VSCA 1H5UA 1GUAA 3FCXA 4DV7B 4MQLA 3R41A 3K9LA 2E4VA 3L0SA 1SVNA 3TW6A 1F0KA 3WICA 2C4NA 3A1WA 2FWRA 1P0PA 3KU4A 3MSCA 1JJIA 1OH8A 1XXHB 2E55A 3FOZA 1Z6MA 4LZWA 3RSCA 3GA5A 3WGQA 5ESRA 1V8OA 2P2YA 3K0AB 1YJCA 5JNUA 5DYNA 2IEAA 1VBNA 4GT1A 1SRRA 4F9FA 3GLHB 2RHTA 4D8VA 1DJNA 2H0RA 3G2KA 1RDFA 2ZREA 3D6JA 4ZQHA 2BEVB 1R9NA 3LVFO 3WV5A 2XGOA 2ZT6A 3E05A 3L8DA 3DQQA 1EEHA 1Q20A 4Q1EA 2C58A 3QKSB 1PDOA 6CHYA 1SOVA 4R1MA 3SZUA 4CL0A 2QZSA 1XZNA 4LXUA 4X66C 1KYIA 3I04A 2Y93A 1G66A 3QMVA 3O4VA 5LZ8A 5A4KA 2ZDQA 2B1JA 4ZXFA 1N9GB 3PXAA 4GR9A 5BS1A 1UKKA 3RAEC 2O8EA 5KU7A 3C3CA 3ILXA 5CLFA 3WC4A 1EX6A 1ZJZA 3BGIA 5JJCA 3E6AA 1KY4A 2KQUA 2X41A 3B6MA 1UBGA 2OHJA 1WUJS 4PZEA 2Q5JA 3KOOA 4X1IB 2JVKA 4F6RB 2B0CA 1DPFA 1YULA 5AKYA 2J6CA 3O1IC 2L22A 4JP3A 1U31A 1SHJA 3ZBPA 1UJ6A 2AUTA 3E15A 3KJFA 2WM8A 5FI0B 2G7ZA 1ZZEA 1PFQA 1E2QA 1EX1A 3EBLA 3MQ2A 1A04A 2WKQA 1J8MF 3SF8A 1SXJA 3P1JA 4Z3KA 4I66A 4AO7A 2OBYA 5AVOA 3C74A 2YJ5A 5D1NA 3RTEA 5BR7A 4HLUC 1KOGA 5J2TB 3UNXA 4ML3A 1AQUA 1JKIA 2I1QA 2KSQA 1L5KA 2A1UB 2G5PA 3LU1A 2OE2A 3ZOKA 2UUAC 1U9ZA 3HY4A 3BWXA 1AMUA 1P7PA 2JJ1A 1BCSA 4OJQA 2CZQA 3NVAA 5JW6A 1U8EA 4KKXB 4M0FA 3AOGA 2XNJA 1YUBA 2Z9CA 3RVBA 4PIPA 2QEQA 3H1EA 4EA9A 2Z45A 4ACAA 3CCUP 3BZWA 3S55A 5TR9A 2XRYA 4D5GA 2I9KA 3MGGA 5LVAA 4DIEA 2DGYA 1HYEA 3FB1A 5DN6A 1VPTA 5FH9A 3ZU6A 2NSDA 2GPSA 2RAVA 4LSWA 1W5AA 1J9GA 4G1CA 4G07A 1Y4UA 1RAAA 2WWTA 3GJSA 6YASA 1FFCA 4NRDA 3M5DA 4BPBA 3QJYA 4BP9A 3NEAA 4II7A 1XVTA 3OTOC 5JZ9A 3RD5A 4W6QA 2ZUCA 4FFSA 1T2CA 4Z9BA 1AGYA 2GZJA 1LDYA 2E0IA 4XGNA 2EX4A 5BNWA 1NZFA 1JH9A 1LFAA 3F90A 4EHDA 4DOMA 1F51E 1TUBB 1GNTA 4RY9A 4I9FA 1YXMA 4BYGA 4KBFA 4YGYA 2R8RA 3VNAA 1X6VA 2C8LA 4C3ZA 1KERA 1DCMA 4MDEA 3II6X 4AP5A 4EYEA 3UPUA 5CT8A 1SC4A 1NOKA 1XTQA 2O3JA 3OU6A 2UZ0A 5HF5A 5GVRA 1A82A 3ZC3A 5JTTA 1QC5A 2DT8A 1HT0A 3B20A 4ROSA 4E5SA 3FPBA 1S01A 3E9NA 4M0DA 1V9SA 2XRFA 5KWSA 2PRYA 4WXHA 5A03A 4GUAA 3D4NA 2J5RA 1GITA 2PEOA 3KC2A 2Z2YA 3A04A 4ZOLF 1RC1A 3NAMA 4GR6A 1UFQA 1G2OA 3VTKA 4PICA 4JBNA 3VH4A 3E3OA 4CJXA 4CUKA 3JQ9A 2D1SA 4YREA 3NYIA 1UPCA 3EEOA 1IRIA 2BFDB 3DL7A 1W8DA 1R4AA 1V7ZA 1TU3A 5C8YB 1T1RA 3GZNB 1W96A 4BASA 2PKQP 1K7FB 4FD2A 4B46A 5TVKA 3ESDA 1XRQA 1EBFA 4WBNB 2Q4BA 3DMPA 4HGOA 1JA0A 4MRAA 2GJ4A 1E4YA 3GJ7A 4B3JA 2YN0A 2O8FA 4ILKA 1R50A 5EZQA 3V32A 4LRUA 4BATA 1T2VA 3IAM6 2YNMC 2FFAA 5AYVA 3DTVA 4F91B 1N9KA 4LF6C 1IVSA 4MWCA 1S9HA 4YEDA 3AGPA 4ENVA 1Z9BA 2CL6X 16PKA 2W4QA 3RAJA 1J9ZA 4HFRA 3F6RA 2FR1A 4MUBA 4K9MA 1LI5A 3AR7A 5IANA 2O8DA 3UJ7A 1A9XB 4MS1A 1RXUA 3DP7A 1V47A 2NPIA 4HKGA 1C1XA 4RMGA 1T8PA 1U2EA 1JE0A 4O2AF 4BNDB 5I51A 2JCYA 4KQMA 4QJBA 2BKUA 4UHPB 2JG3A 4CKBA 1HYQA 3EIWA 1VBKA 3IIEA 2W37A 3E2PA 4HPVA 2JH3A 4RFSB 1KWKA 5DP2A 5JBNA 5F2KA 1OBHA 2F1IA 4UCFA 3G1GA 2B9EA 3S7TA 2XDQA 1EHYA 4L4RA 3Q0EA 1SKMA 1DAPA 5CG2A 1PLLA 2HHJA 1WZUA 5B6JA 1JHPA 2Q28A 2Z5LA 2ZBVA 3ADPA 1OAAA 4TT3A 1KWGA 1HR0B 2V7VA 4DRXA 3FYUB 4X8MA 1VQPP 3MT9A 3EQ8A 4MB6A 3VR0A 4XH9B 3P9XA 1JQKA 3EQ7A 1KRXA 3VOSA 3BHJA 1XQWA 2CFCA 4ZPXA 2C4MA 3L7IA 3P52A 1NX9A 5CVVA 2VCHA 1H6BA 4MPRA 4RKEA 3X1KA 2UUCB 4BP1A 4ED9A 5MGBA 4UBOA 5A04A 5HCIA 3KKKA 5IT0A 1YO6A 2VPQA 4UD2A 4QBKA 3DCIA 4MW9A 3WAGA 5KYVA 5AM4A 4LZOA 4KW7A 3JYLA 1O94D 1ISFA 1UFRA 3JX9A 3B3FA 4PH1A 4F2WA 4HX5A 1VKRA 2PLFA 1UJCA 4J0GA 4L2IA 1G3QA 2FV8A 2B7CA 3V3KA 1PNOA 4LGMA 4H1UA 2I1LA 2WIKA 3QHPA 1I5RA 4IDFA 3CC8A 2FDRA 4FEEA 3RUEA 1VHNA 521PA 4CKWA 2QYOA 2ZRFA 1JQAA 3RF7A 1FNSA 4HEA6 2GXQA 2PD4A 3GNTA 2UZIR 3CRMA 4EW2A 1TO2E 3QU7A 3I9FA 3UC5A 1VHDA 3JQRA 2JGDB 2NU8B 1CRLA 5LMUB 4UMFA 4DGQA 3A58B 1L7RA 2ZRMA 4WNYA 5IKXA 1VE6A 5AH0A 1XLTC 4LAFA 1P2VA 2JVIA 3AVPA 2NO7A 4FHZA 1AM4D 1M7HA 3ZDFA 4KFRA 4N03A 4GEGA 2VHVA 1YDFA 2G67A 5IM4F 1YUMA 4CEHB 2XQVA 4R3UC 4GYWA 3KVRA 2A9FA 3U4DA 3H8WA 4D3XA 3ZNPA 2XF2A 1QHIA 4TMZA 2ABWA 1NXQA 3E1GA 2MSKA 4IZIA 5AXAA 5FRDA 2PT6A 1XFDA 4QYMA 2IEDA 1QCZA 2ONCA 3RFUA 2PL9A 2DETA 5J4HA 5B4UA 4LVOA 4DLYA 3TVYA 1M8GA 4BO1A 3VH3A 4E2YA 1Y34E 5AI8A 4M9QA 4TYYA 1NN0A 2ZBPA 2N6ZA 3I07A 3NHZA 3O90A 3L6UA 2VHZA 3V1KA 3GGDA 1CDDA 1RWBA 2ZXFA 3SBDA 1FFXA 4LXYA 1CJCA 4BPGA 4F4IA 3KDPA 1E1KA 3TPFA 2H1FA 1ZVKA 3A6HA 4RENA 3DBOB 4GNKA 1H0HA 1F3LA 2WNIA 4MPPA 2LTAA 3DZCA 4PLFA 3TKLA 1L3CA 5AVZA 4QTZA 4LVCA 3OJLA 3R0IA 4RU1A 4O4LA 1JVSA 2OT3B 1W4RA 3HRHA 1VHTA 4DW8A 5E38A 1ADGA 2FN8A 3KUUA 1OE0A 2PTGA 3U4QA 4K8OA 2H85A 3OX1A 4CV3A 1BYIA 1TOAA 2QAIA 1TAGA 4G63A 5FTNA 2C2HA 1WEHA 4BPFA 4G0XA 4C43A 2ZUSA 1LK0A 5I7VA 3EXAA 2FHSC 1EVZA 4IV0A 4Z7QB 4ALLA 1SKYE 1WB9A 4F9EA 4EB3A 2QP3A 4PPFA 1TQ8A 2BEJA 4WERA 3G1IA 3I62A 4Z1MA 5C3MA 3HBMA 3EVFA 5KTNA 2QK4A 2CGEA 4INAA 3ID6C 2O8VA 3ZWDA 2VZ8A 1IBKC 1OI4A 2O8CA 4BVLA 4YALA 4MLPA 2HU5A 4R41A 2NUTA 1YCFA 3LDAA 1KDYA 5C7OO 4M9RA 3KUCA 1PGQA 1KMHA 3ADOA 1PK9A 1PNTA 3GXOA 3OZUA 5HBRA 4E4TA 1I4WA 2ONTA 2VN8A 4TXNA 4LJRA 4I3GA 1XEWY 3WYGA 4BKUA 4COKA 1K7XB 2F9MA 1L0HA 1E61A 4RETA 3RRMA 2IYLD 3TTWA 1PUXA 3TNDA 3CR7A 1U0LA 2BHRA 1KZHA 1M2FA 1T9KA 2NW6A 3VDNB 4YRSA 1XWIA 4ZQGA 1SULA 3HU3A 1JJVA 2OILA 2QY6A 3GLGB 4JI0B 2FPUA 1Z06A 4XUDA 1E3LA 1D03A 1WWKA 5IJ9B 4J1SA 3BH0A 3I52A 1YK1A 3U17A 4ND2A 2BBTA 1G3UA 2MSDB 3OA2A 4GRDA 2Z1NA 3RAFC 3KBOA 4KVAA 4YB8A 3WRXC 1S2OA 2OXCA 1QONA 3OKAA 2AGVA 1XB2A 1YMUA 2JFXA 3EIEA 3JS5A 5EKUA 3TLKA 2ZJ8A 1P2TA 2G5CA 4W63A 2VR1A 3PCXA 3WJ7A 1KFEB 2X2EA 4IKOA 2BMVA 2H18A 1E2EA 3B8EA 1XEXA 1AHHA 1II8B 1Q0RA 3MRSA 5AXCA 1VSVA 1QIHA 4GRAA 4GKJC 3TMYA 5LQUA 4C4RA 3VMFA 3GHYA 1TM4E 4PAMA 3Q2OA 5DYTA 4RE5A 4QA9A 1PQUA 3CNOA 1M1XB 5HZKA 2DPXA 3E3MA 2CE7A 1FQKA 2XEXA 4NPAA 1U3TA 2BH2A 3O74A 3G8YA 1QO0A 2ZJ7A 3V33A 2JI6A 4ZI7B 4OLAA 1CSEE 3LKVA 5WRFA 5UKDA 1LLCA 1U7UA 4PHTA 3RH0A 1FFSA 3UBMA 2INGX 4Q7EA 2PJUA 4E5UA 1TL7C 3CR8A 1RXYA 2AT1A 3PJFA 4TTQA 2HWKA 2QYHA 3ZD7A 4DIUA 1IWBB 4BMVA 1LPNA 2ZSIA 5F3DA 5AM0A 1A88A 5HUJA 1ZD8A 1GCGA 5I8PA 4QUHA 5T8TA 2E6KA 4P53A 2FSVC 2A84A 2XTZA 5EQDA 4CV1A 4PIVA 4YBZA 4D82A 1J39A 2QP9X 4W9NC 1W1IA 5CW1A 1ONBA 3AR4A 3P19A 4BFCA 4ZCSA 2W6MA 2XGMA 3UK2A 4YAOA 4TV9F 1Z3IX 4KR3A 1N8KA 1DJMA 2LIVA 1Q6ZA 4JYBA 1HE8B 1VEHA 1C1DA 4EQ6B 3CN7A 4O08A 3TSZA 2VDOB 1XA0A 1CZKA 2OBXA 3ZJTA 4HDNB 2QDKA 2ZJ5A 2F43B 1X3SA 4L9AA 4D46A 1XRRA 1YACA 2QUZA 1ZHHA 2IYPA 3PHCA 4Z9FA 4QOJA 5AE3A 1JKMA 4NV0A 4PW0A 5ARBA 3D4IA 3EB9A 3H47A 3RYFA 2HJHA 2X1MA 4PH0A 1O97C 3MRTA 1QB8A 3DAPA 4BVBA 2PXXA 2N0SA 5MF6A 5K0NA 3ZW7A 5JDIA 1H69A 2ZUUA 4K0RA 4R1SA 3JVVA 5FOSA 5KAMA 2FPKA 1GLGA 1GQFA 3FLEA 1U4SA 2JIZD 3HB5X 4KR2A 4ZI2A 1KNXA 4HWPA 4DQUA 4E88A 3LBYA 1YOVB 1IN6A 2YWFA 1E6KA 4C4SA 1QGDA 1PJ8A 4RD4A 1WUKS 2ID8A 3U40A 1F7UA 2NVOA 1QX4A 4BEVA 2EEPA 3SBEA 1EQ2A 1TK9A 4GF5A 4KO2S 1A1SA 5BRAA 2BGMA 2CCKA 2O1XA 4DCOA 5DBGA 4ZAVA 1Z5UA 3H17A 2JLVA 1WTCA 3WK6A 4ZVOA 2PEZA 4TXJA 4TWBA 3EF3A 4PNEA 4U9UA 1B1AA 4JNKA 1Y9AA 4WL0A 4G0NA 2JBAB 2AJCA 1ULAA 4FGJA 3GIDA 2GTHA 2X9QA 4M9CA 1XU7A 3HV0A 1JSZA 1KMIY 4EARA 1DP4A 4JOQA 2H1CA 5DOVA 4IGIA 2LRHA 2P79A 2VF2A 2XCQA 2Q29A 3RS0A 3DZGA 3GT0A 4BV2A 2JFVA 5FJJA 3AERA 2P27A 1AKEA 4WBSA 1TMOA 3CUWA 1Z5VA 1ETHA 2Y76A 4TMKA 3UKJA 4A0GA 1OFHA 4KMMA 3VZSA 2BHVA 4QTUB 2ODBA 3T5MA 2G1PA 4W5OA 1HG0A 1WCYA 3VPHA 1WXQA 4DLRA 2DFNA 4Q3AA 2PWBA 3QLVA 4YCSA 1K8ZB 2BF7A 2HCBA 2AN4A 4RD6A 2FPIB 2RHHA 3UAGA 4O25A 1C9NA 2FPWA 4A6PA 1YB5A 2GCOA 2OHOA 2L2QA 3NANA 4HB0A 5K0GA 1JHVA 1MC4A 3SHFA 3FVVA 3ANYB 3D5QA 4G4IA 2SHKA 1MN6A 3EZLA 2IHNA 1YAHA 3U3ZA 4WKPA 3QVJA 3ZDXB 3GUHA 1VMIA 4ITUA 1DEHA 3TB6A 2GNPA 2QXTA 4XX2A 5AWFC 3AFNA 4OYLA 2RBEA 1UAAA 2UYOA 4D4IA 6Q21A 1D2NA 3FN4A 3GFRA 7YASA 4ZAWA 2VTKA 5DMHA 4EJ2A 2BONA 4Z0PA 4TLMB 1FYFA 4S04A 3GYGA 3MHTA 3ER6A 3UAOA 4DR2C 5EWJB 1E3IA 3PNBA 4MVJP 5DTQA 4B5KA 2ECFA 4KQCA 3OJ0A 3G8DA 2NVWA 4E7OA 1PG2A 3PQ7A 4GPBA 1YB2A 4GXRA 1F48A 1OWOA 3UHOA 1U0NA 1J33A 3SR4A 4JP8A 4LVUA 2ICAA 2WM3A 2JHFA 1BTOA 2WF6A 3OIWA 2E7GA 3UAXA 3RYHA 3HVRA 1I7SB 1J56A 4JUCA 5BV2P 1XQVA 3LDUA 3K4HA 1MJNA 3CVOA 5I5GA 5KQPA 1IQPA 2I8LA 1SOAA 3I5YA 1K7YA 4MR7A 4FDMA 3GLQA 2JFQA 2Z58A 4YJFA 1XLWA 4ICIA 3D02A 5IBQA 1P9LA 3OT1A 3ZK9A 3RC8A 5CIWA 3SXUB 4UC0A 3Q5EA 4CM8B 3TXAA 5H9UA 4P80A 3PGA1 3SGLA 4G0MA 5LLDA 2QAGA 1O58A 2CEKA 3AIOA 1T36B 3CO0S 2I1WA 1L7VC 4F5WA 5ILOA 4YRLA 4GI7A 4G1EB 2OWDA 2PJDA 3ODGA 2VDQB 1Q1BA 3OIYA 2AI1A 4CN8A 3R77A 1PL8A 2IH5A 2OD7A 4XSGA 1BEEA 3BXPA 2C1ZA 4IH4A 4W5QA 5A4IS 5EJFA 1QH8A 1MB9A 5LYJB 4B85A 1UMCA 3MCAA 3GEHA 4KXNA 3U13A 4JENA 3AVVA 1HDOA 3SJUA 1HMPA 3K0CA 3TQTA 2GVNA 4QDXA 4XVQA 5CVDA 4EG5A 2V1XA 1WB4A 3LXMA 2NQ2C 1YR2A 3LPNA 1YB1A 4MH4A 2LVBA 4X66B 3SE0A 2O7VA 2VDMB 1XWFA 5E2BA 4LGYA 3R8XA 13PKA 3FTPA 3ZD6A 1V1RA 5IM5A 3SBXA 2F8TA 4H6VA 3MWLA 2KBFA 4HDQB 5LBIA 5DLPA 4TQAA 2P4SA 2L17A 1WXFA 3TSCA 1Z2DA 1OVMA 2J4DA 4MUKA 6NULA 1S6YA 4BHTA 1XKLA 2QGNA 4NECA 4CCYA 1XS3A 4DY6A 1R8QA 3NBMA 1QM4A 3WWDA 1GARA 2JLSA 4EF6A 3DEJA 3KG2A 4BFSA 2SCUA 2B98A 3SQMA 3BWMA 2HCRA 4LJ6A 2M2IA 1FPMA 5ENVA 3S2FA 5JNTA 1Z34A 1Q7EA 5TS2A 4M98A 4Q1CA 2P6NA 2O8BA 4J0JA 4A8JA 3FPEA 3HYLA 2ESRA 2V1UA 3GWGA 1PT7A 4C0LA 3L2OB 2IX3A 2D5BA 1EXNA 1M10A 1T4DA 5CVUA 2PUDA 1B14A 4AZ3A 2QIOA 1GSAA 1DG9A 3GGJA 3P0FA 4PBRA 1ODJA 1XTSA 3KAJA 1FDIA 3RUIA 5JPAA 3BMNA 3G21A 2BGUA 3PF9A 2WSMA 1IVYA 5CCEA 2Q4EA 2UUAB 5KSOA 1U7PA 1QGED 1D4ZA 2ZQZA 4IO1A 1XRBA 2C1XA 1WBDA 1QOQB 4OQQA 3OQJA 4X3CA 2GPYA 1RAIA 2CBZA 3OF3A 4GOLD 4MCHA 4FJ0A 3R6WA 4LA4A 3QUTA 4TSKA 3C3KA 3DEZA 3CC4P 1EFUA 1Y8QB 3HA3A 2IHVA 4YFVA 5DHSA 1Q14A 1HDZA 2J30A 4M1EA 3O8OA 1W0JA 2HTFA 1FUIA 5K20A 5JXWA 4CLRB 4URXR 2C82A 3DKPA 2VYCA 3V7WA 1UZNA 2W93A 4J49A 1DV2A 2HZBA 1KNQA 1PE0A 1ZOLA 2CHQA 2YVQA 4D1YA 1CNMA 1NMSA 1WABA 3H5TA 3I09A 4EUFA 3G1UA 1EFKA 1U3CA 4XCXA 4EABA 2Q9BA 3E2DA 5TE9A 3PXBA 2ZAYA 5LZ7A 4N48A 4QO8A 5HKLA 1WUIS 1X1EA 4WY2A 4EUHA 2GEVA 1A76A 1QHXA 4FYKA 3QWHA 1LS6A 4ARZA 4I6EA 1RI1A 3NDJA 4ZU1X 2V0NA 3AO0B 3BWVA 3RT1A 1PTKA 4IFTA 4KEAA 3D2AA 3TL6A 3VR4H 1YIDA 4EG1A 4KZKA 4IGFA 2I6FA 3OZVA 3T35A 2EBFX 4ZWNA 3PZRA 5B3LA 4HQ6A 4X63A 5HGNA 5IWAC 1YIOA 1BQ3A 3L6BA 4KXLA 3ZKWA 1TEVA 3GBSA 2XB4A 2BM0A 1BVYF 1P1HA 4UHKA 2VWGA 5F7JA 5CTAA 2Q62A 5FLXD 1F0PA 2CYBA 1R0BA 3N3AC 2OB2A 1A7AA 2JA2A 5BV0A 3FUWA 5HUHA 1R8JA 3Q15C 5F4ZA 2V45A 1GXSA 4DR5B 2GX6A 3JXEA 3T99A 1LQ2A 1T0PA 4JT8A 4KQWA 3D3EA 4JI5B 1BGXT 3DC2A 1UJZA 3ZR4B 1U8FO 3W3ZB 2I80A 1G8SA 1YQ9A 2H4ZA 3N8GA 3PGJA 5LDGA 4LOIA 4FS3A 1E9FA 1B3RA 2JAOA 2WWFA 2Z4RA 2XOKD 5IJAA 4Z3DA 5L95A 3S1AA 3I08A 3P2OA 4TKUA 1AB5A 1RTKA 3B8HA 4WI1A 5E3JA 3JQAB 4ZVSA 1XAHA 1GCOA 3UWSA 2PT9A 2JIPA 3WTBA 3L40A 2FLWA 3WGLA 4DKXA 2EG9A 4TTSA 5AP9A 5BRJA 4G0WA 2I78A 3M4XA 4O3MA 4JI4C 2DTDA 4I0WB 4B6OA 3ONWA 2ZJZA 3GZLA 4HB3A 3ZVRA 2HCFA 2OV8A 4FOOA 3CB2A 1UZLA 5FKJA 3N9IA 4FDLA 5JMOA 4HVAA 1UWKA 3EWNA 3FNQA 5CW2A 1AVTA 3R9XB 3WS7A 4KH1A 2BR4A 5AXDA 4BO3A 3SQOA 4H1WA 2WIDA 4DR6C 4LDQA 4MYHA 1F6WA 4R71A 2QTHA 1I2MA 4GI3A 4FZRA 4NONA 1QYCA 1ZK2A 3GJRA 3YASA 5CHYA 4D42A 4AY2A 3UX2A 3FUVA 2RHDA 4FVTA 3CX4A 1IRXA 3WB0A 4RTNA 4JT9A 3PG5A 3VI3B 2WRZA 4EO4A 1OJ7A 5BN4A 3M6IA 1CZNA 3H7AA 4FC7A 5GZ3A 2TMYA 1JAIA 3ND6A 3RCBA 3ROKA 3ICQB 3DLAA 3DEYX 1OBCA 1C30A 2C54A 5ICFA 1JAYA 3KCQA 4HH4A 2CMHA 2H16A 1G5TA 4B84A 2ZI7A 3W9YA 2KPOA 2YCBA 1DJOA 4R8SA 4F12A 5TY0A 4UM7A 5EINA 4JC8A 1X9GA 1AUQA 3E03A 3EERA 1WD5A 2ZIXA 2E1MA 4AY3A 4MVJE 4OIFA 2XXMA 4HDMA 1TTHA 5E6SA 1UBEA 1ZLYA 3S8MA 2XZPA 1CE8B 4WOPA 4R2HA 1T9GR 2VK8A 1A2KC 4LYEA 3SC2B 1LK7A 1BDJA 1ISRA 4M0CA 3OUTA 4RVFA 4OP3A 5B7GA 2LIWA 1ZHFA 2HWYA 4HRYA 4GICA 3OQBA 2X76A 1BW9B 4LYFA 5KDLA 3MWJA 5LPNA 1N2IA 2HF7A 1LLFA 1E5VA 2H2IA 1WJGA 10MHA 4BU0A 1NPTO 4RTMA 3HP4A 1T1IA 1GPMA 1PLJA 2JCSA 3MLAA 4CXMA 1OMOA 2CLDX 4Z2AA 4ZV4A 1OASA 3HGMA 2F3QA 2PWPA 5GV7A 2W6JD 3OJFA 3NKLA 3IP5A 1ENYA 1QQBA 3VISA 1UK7A 3HJHA 3ZVNA 4D8YA 1YI1A 2GLTA 1G6Q1 1KFJB 3D0OA 2HWWA 3QPWA 4KHPC 1XTPA 4DLUA 5DKFA 1RQRA 4TS3A 5LDHA 1XVAA 2ONJA 3HLTA 3NLLA 2WT8A 2WVJA 3A37A 1SQ5A 4WDRA 4Z7NB 4GVLA 1KK3A 3AW9A 4HUQB 5CFQA 4OQEA 2Q4OA 1ODTC 1D09A 3MBOA 3PGLA 2BJHA 1E5TA 3GMDA 3NIGB 1ODIA 1I32A 2BFPA 2GFQA 2MR8A 4LF5C 5FDFA 3JR7A 4QM6A 4HWTA 3ZCPA 2QQFA 1DV1A 3ZIAD 5CITA 4G0PA 2YASA 2D2EA 1PZEA 2CXQA 1XTUA 5LFAA 2HUNA 1SB9A 1GTSA 3U3OA 4I4TA 4D96A 5LKRA 3I2HA 5HDQA 1JUDA 2QPLA 4YMSA 4DREA 2HLHA 5DXJA 2W8ZA 3BDVA 4P8RA 5DT9A 5MN5A 3DVQX 2YZGA 4Q3DA 5J43A 1KI1A 4MKXA 4WNAA 5SV2A 4L8GA 3LV8A 2FRXA 4E14A 1S2GA 4K6MA 3LRXA 4MI1A 3VGPA 4HNVA 3T5CA 2VCYA 3B36A 3W78A 4R2MA 3AY3A 3NZEA 2HLNA 3O83A 3NV7A 1OR5A 3MXOA 1RT9A 4RPLA 1FTWA 1G18A 3FGPA 4HNTA 2F2TA 2OCKA 1O6FA 4OH1A 4EY7A 3I5MA 2VDKB 5IJXA 3FYTA 3GMTA 4LECA 1M34E 2HNAA 1L1EA 1JLSA 4B8WA 3WSWA 1RHJA 2P7IA 3AF5A 3WWYA 1PWHA 4YUAA 4HNRA 4LDNA 3CISA 3LUFA 3RVNA 2MTBA 1ECBA 1YMQA 3IXMA 1I5OA 1EKXA 3HG7A 1RM0A 2EGHA 3M6VA 4DT1B 5F1KA 2XJ4A 4C4OA 1WPRA 4ZT5A 2AOWA 1QIMA 2BKEA 2BMFA 3HUTA 2C2XA 4A8TA 5E8RA 3Q12A 2PRKA 1RHRA 4BNVA 1V3VA 2MSCB 3CLKA 2IX9A 3V4OA 2KX7A 1SIBE 1QG2A 4V0KA 1EZZA 3VYTB 4NZMA 3UANA 1Z68A 3AOEA 2H7VA 3EUFA 3S27A 1TD1A 3UWDA 3RPEA 2IP1A 4HGPA 1GL6A 2OY0A 4GEKA 5BW6B 2VHEA 4IZOA 3ELUA 4U0CA 1KS9A 4XFKA 1M72A 1YS9A 5M2QA 4IGEA 4MQ5A 1PVOA 1MHTA 4KOEC 1C3OB 1LTHR 5HQTA 3FWNA 1LV7A 5LD2C 3NV9A 5JOQA 4IXMA 1A97A 1KQNA 3CLUC 4MGZR 3AEXA 2ZDGA 1A9YA 5FNVF 4JL5A 1GT91 1GKYA 2P41A 4KZPA 2VNKA 3A26A 4HYTA 3KTAA 3FCEA 4S1OA 1OIVA 1QPGA 5FWAA 4MR8B 4MP6A 1YFZA 4LBZA 4HXGA 4I8XA 2XHEA 1N7JA 3JYOA 3MIZA 1N33C 1HK7A 3DTTA 1ND6A 2R9VA 2QVBA 5B53A 1KEEA 1CY8A 4WJKB 4OEHA 2FDCA 2VAWA 2H1VA 3I9LA 2NQ8A 2AZXA 3QIVA 2CK3D 4QDTA 1GILA 4KNYA 2J0QA 1R5BA 4OJKA 4LTDA 2QHXA 3DE4X 4A5OA 5FFFA 5SYNA 5AVQA 2BFCA 1CUEA 4BGUA 5ESDA 4PTYA 3PHBE 1BS1A 4KQ2A 1FFDA 2FXVA 4UW9A 1JWAB 1KJ8A 2QJOA 1VGVA 2XB2A 1UFKA 2QUJA 3EPKA 1USVA 3KYJB 1PQWA 1TJYA 1UBFA 3BFKA 5ECYA 3TLAA 1YS4A 3V4ZA 4RVUA 4OXIA 4X91A 3RUAA 2O5RA 4C3VA 1K9MQ 4HQOA 3VKGA 4Z8XA 1PSZA 3ES9A 1DVRA 1W2GA 5BMOA 3AP1A 4ZLPA 1JR6A 4DPLA 4FI3C 3F6EX 2FFJA 2PWYA 5BW4A 3I8OA 4PGFA 2XE6A 1N4AA 4KK3A 1X15A 2JVJA 4HPXB 3K70C 2QVYX 4CMIA 2H4JA 3UXEA 3M6WA 3KSUA 4X9XA 4D6PA 3DS1A 4L5IA 3SAJA 3QLUC 3SSMA 1KMCA 4FFVA 4IVQA 1MJGA 1MIOB 4ONEA 5E0OA 3HNRA 4RZ2A 4PU0A 1W93A 1NURA 3PUXA 2OO4A 4CM4A 2MYPA 2ONZA 4OHPA 3R40A 2UXBB 3FX2A 3ZBTA 1UJ5A 3GDHA 4WXRA 3JARA 1DADA 3ELWA 2O23A 1CEQA 3IE0A 3ZHYA 4ROTA 3I1FA 2CUTA 3BE8A 1F7VA 1A5TA 2JH8A 3VZBA 4AUEA 3NJRA 5FUQA 2PJRA 4YMWA 2W2PA 5KQSA 1VMDA 4Q4AB 3VNSA 3F46A 2CL5A 3PE4A 2MSNA 1GQYA 3D4LA 1TE2A 1WQ1R 2M98A 5AVXA 5TQ2B 4ZYWA 5LUAA 4YJ2B 2QVGA 4V0MA 4HCJA 3CBQA 3KOXA 4KR0A 1AD2A 1I4LD 1XZFA 3NGLA 1N3YA 3FPFA 3RU9A 1G1MA 4PIMA 4G01B 3TGWA 1VE1A 1RVV1 2I87A 3MMXA 4BBAA 2WICA 4GW3A 3SK0A 4TM8A 1OWPA 4BVEA 2R84A 2WILA 4IIHA 1GRNA 4UPVA 4OG2A 5T57A 1OXXK 4A7PA 1EDEA 1A5ZA 4K9LA 3IUBA 2A35A 3OCJA 4MVXA 2ST1A 5HF9A 4BC1A 2QTRA 4YO8A 1M34A 3E2IA 3VO8A 5A9RA 2DT5A 3DE2X 1LF0A 2D1QA 2AMLA 1PKXA 1OLSA 3QK7A 2Q3BA 4B3MB 4B6FA 2V03A 4EMTA 3DONA 3S7ZA 4NCBA 2PZFA 1Q7RA 5H80A 3WGZA 2HHLA 3GGSA 4AT1A 1YB7A 1I3OA 3FE2A 4CM9A 3K0BA 3O9MA 3M1LA 3ECCA