4IZ6A

Structure of ente and entb, an nrps adenylation-pcp fusion protein with pseudo translational symmetry
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
614
structure length
609
Chain Sequence
SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSREVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Enterobactin synthase component E, Isochorismatase
publication title Structure determination of the functional domain interaction of a chimeric nonribosomal peptide synthetase from a challenging crystal with noncrystallographic translational symmetry.
pubmed doi rcsb
source organism Escherichia coli
total genus 198
structure length 609
sequence length 614
chains with identical sequence B
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4iz6A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4iz6A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iz6A01
1VKUA 2V7BA 2FADA 1ACPA 3KXWA 1HQBA 3PBKA 2GDXA 3R44A 4RVNA 4GS5A 5BSRA 2FQ0A 2JU1A 3NI2A 2WD9A 2CNRA 2D1QA 4U5YD 3VNRA 2K93A 2FACA 2EHTA 2LIWA 2D1TA 1NQ4A 2KOQA 4RLFA 2CQ8A 3L8CA 3CW8X 2FVEA 2MR7A 2KGEA 3E7WA 2VZEA 4R1MA 4RM2A 3IESA 4BPHA 4D4GA 3EQ6A 4GR4A 2ROQA 4E5DA 5BSVA 2LPKA 4DG8A 2L22A 4MRTC 2P2QA 1PG4A 3LNVA 2QVZX 2L9FA 2MD9A 2L4BA 3GPCA 5K85A 2K2QA 2KGDA 3NYRA 2N50A 2X2BA 5IFIA 3O83A 1RY2A 2P20A 3A9VA 1ULTA 3GZLA 2CGQA 1HY8A 2LOLA 4G37A 2VSQA 2LIUA 4PZPA 1L0HA 2LKIA 2XZ1C 4PWVB 4BPFA 4G36A 2MVUA 4R0MA 4GXRA 2EHSA 3CW9A 2KOPA 2KW2A 4HKGA 2GDYA 2KR5A 4DG9A 1PG3A 3G7SA 2P2JA 3U16A 5DWVA 4FUTA 2QVXX 3ITEA 3RIXA 5BSWA 1L0IA 3FCEA 5BSMA 2FQ1A 2Y4OA 2KGAA 2L0QA 2Y27A 3C5EA 1X3OA 4W8OA 3GZMA 3CE7A 4LGCA 4OXIA 1DNYA 3VNQA 4PXHB 5E7QA 1AMUA 2QNWA 1LCIA 2N98A 2DNWA 5KP6B 3LGXA 5HV8A 5D6NA 3VNSA 2CG5B 3EJBA 1OR5A 3U17A 2KOSA 3DHVA 5JRHA 3FCCA 2JU2A 3E7XA 3E53A 1T8KA 4IZ6A 2GDWA 2N5HA 2KG9A 2M5RA 2FHSC 3B7WA 1MDFA 4GR5A 2D1RA 1DV5A 3O84A 2FVAA 3WVNA 5DV9A 3IEPA 4RVOA 3QYAA 5KP7B 5CZDB 2P2MA 4R1LA 4RM3A 3IERA 4H2WC 1BA3A 1AF8A 2KWLA 4ISBA 4D57A 2K0YA 4BPGA 4IR7A 2MVVA 5KYTA 2LTEA 4H2YC 3LMOA 2QW0X 2KORA 2FAEA 2N5IA 5BURA 3IPLA 3IVRA 4H2XC 3T5AA 2AF8A 1F80D 2K94A 3EJEA 3TSYA 4FUQA 2FVFA 2MF4A 1T5HX 2AFEA 2KG6A 3NY7B 2JGPA 2MR8A 2KOOA 2MY5A 4WV3A 3WV4A 2LL8A 3DAYA 2N6ZA 1KLPA 1MDBA 4D56A 2K92A 2LMLA 2KG8A 4GXQA 5GTDA 5KEIA 4D4HA 4NEOA 4D4IA 2D1SA 3O82A 4M46A 3T5BA 1V25A 3DLPX 2KGCA 1MD9A 2P2BA 3EJDA 2Y4NA 4ZJZA 5KYVA 4RMNA 4OYCA 2K0XA 5EJDA 5BUSA 4CA3A 1T5DX 5BSUA 5BUQA 5HVCA 1YJ7A 1V26A 2QVYX 2JQ4A 4EATA 2FQ2A 3A9UA 3ETCA 2N6YA 3WV5A 2AVAA 2AFDA 5K8FA 5BSTA 2P2FA 3T5CA 5KP8B 2PNGA 3RG2A 3LAXA 3NYQA 2XZ0D 4RLQA
chains in the Genus database with same CATH superfamily
4HGPA 2I2BA 2QMZA 4F92B 4M7RA 3ZKWA 1LBIA 4ALLA 3DO8A 3BBPA 3TXXA 2KE5A 2Q5HA 2H7CA 3L9WA 1G19A 1FFXB 3V7UA 4MRTC 1N6PA 5DYYA 5F1PA 2VT6A 1OXSC 3BRSA 4GZ5A 2EBFX 3GNTA 2P6RA 4Z51A 4D97A 1H5NA 3VV3A 3PITA 4JYBA 1IZ8A 3V2UA 4JB3A 2BH1X 4JROA 5AKGA 3R0VA 5FUBA 2B5VA 3H13A 1AS3A 3IRUA 3R9WA 2PMBA 1QG4A 3CLSC 1G6HA 2C5SA 4EQ6B 5A3SA 3LW8A 2X86A 2AWOA 2ZULA 4K05A 3OA0A 4Q3EA 3AR3A 1YGYA 1X1QA 3QELB 2VLOA 4XJSA 2ZS9A 1PS0A 1OH7A 2PLWA 4B44A 5A0TA 5KYGA 2H17A 3UK7A 3N8NA 3L95X 4D9IA 2I76A 1QFJA 2HBZA 1UPCA 1E7YA 5HGXA 3FPKA 2PZBA 3BD6A 4O4IF 4F4UA 1Q82Q 2JI4A 2QM0A 2C8JA 4DIDA 2QVLA 4IUDS 1NXTA 4I6GA 1D4FA 1GPBA 1YTUA 3MELA 5CM8B 1G21E 3RW9A 4DYVA 3NV9A 3QV1A 2OA0A 3PLRA 5SY6A 3H4TA 5EL0A 1D2GA 3PGJA 5KYNA 4B3BA 1C1XB 1PTKA 5CCEA 4M86A 3BSFA 3FM9A 4QPNA 5ARDA 3OHMA 1W8DA 4U7DA 2YWBA 4LYGA 2PX6A 2AG0A 2OHHA 5T6MA 1SXJC 4R1PA 1U0TA 1JT2A 2A9KA 1KYIA 1ADJA 1M7HA 3ZWAA 4HDCA 2OV1A 3IDOA 3RKUA 1LW7A 1QO9A 3BICA 4WLFA 4X1KB 1UOOA 1TRKA 2Q62A 3S5JA 2X2OA 1CUXA 5FJIA 4XWOA 5CT4A 2PWYA 1EIZA 5G3YA 4HEHA 1Y9JA 1XDGA 3IALA 1VLVA 3KWFA 4LYHA 2XT1A 1COWD 2IW1A 4ZYWA 3PJGA 4MKHA 1FW8A 3SY8A 2FPGB 4CM8B 1UAYA 4K0KB 3EVTA 1LCIA 2ZBFA 5LYJF 1SIOA 5JCXA 4OQFA 3SLGA 5BT9A 5AW5A 1WSAA 2CYCA 4RMGA 4Q16A 3T41A 2OEPA 3TOXA 3BZUA 3ZOZA 4MW6A 4FR2A 3ICVA 3IPLA 3BMQB 4PBRA 1B74A 1H6CA 3I4LA 1VL5A 5K0FA 4C9BA 1UBHS 3DHEA 3G0OA 2SICE 4LFCB 1SIUA 2YZNA 4K9LA 1ABEA 2OP1A 1LTQA 1Z9BA 4H3KB 5A4KA 2PNGA 1F0KA 2AFHE 3NXSA 2XF2A 1CNFA 1QU3A 1OR8A 2PEMA 1E0KA 4MYRA 3STTA 5HJEA 1JEDA 4D5GA 1R7RA 1SCKA 1EZ4A 4RDXA 3RT9A 2H9YA 4UQLA 4MNTA 2J3QA 5AT1A 3O83A 1EFDN 4B3MC 2P90A 4OTZA 1WD7A 3EGXB 1DAOA 3AM1A 4J43A 1T6YA 4LZWA 2QNWA 2QPLA 3ROTA 3NHJA 3H19A 4J90A 1WPXA 4AY6A 4HQ0A 2WU1A 5HNKA 5TS3A 2VT2A 4P0TA 3VR0A 4MUAA 5IYZF 1P6XA 1OLSB 1HG1A 1QFYA 4ILKA 3COYA 2GEUA 3TZEA 1GSOA 1G2QA 2OM6A 4HDNA 3PE6A 2W8ZA 1Z62A 3VTFA 4ERXA 1S89A 3EEFA 1NFFA 3A9TA 5D2CA 1WUJS 3WK7A 2Y05A 3KSUA 3MJRA 3CZMA 5ELXA 1T1SA 3UGQA 5FEUA 2Z08A 4O4HA 3UOGA 3O4IA 1J42A 2WTBA 3QK7A 4H15A 1PUIA 2RB5A 2QN6A 3NOOA 4DCCA 2PRZA 3K2IA 1Z68A 4YMTA 2IZ0A 4BBZA 3J7AC 1YQTA 1UK6A 4LY3A 4EZEA 3JTMA 2H1OA 2W6MA 2H3HA 4GBMA 5FL7D 2Z2XA 3UMGA 4AG5A 3F3YA 4G0MA 2HM7A 3D59A 4FI3F 3LQ1A 3IP7A 4LJ9A 4S1NA 3I55P 4A6PA 4LY9A 2FK8A 2MHCA 2NCLA 4FEAA 3C7KA 2V0CA 1P8AA 3GT0A 1ZA2A 2QRLA 3TOCA 2Z45A 1FDWA 4GU5A 2ZVJA 2DEUA 1OREA 3COVA 4CZ2A 3DKKA 3A9CA 3M6MD 4C6SA 4RSHA 1QIJA 3N0WA 4CG1A 2OYRA 2OFWA 1MFPA 1MAAA 1E3IA 3GROA 4F5EA 1TDJA 2XGGA 5TPZA 1JKIA 2X6TA 3CPJB 3TG8A 1F1BA 3TCNA 6NULA 3FDZA 3KB1A 4RWEA 5GINE 4XM0A 3CS3A 2AQKA 1NDQA 4JVNA 4ZVRA 3OM1A 3PGMA 3IAAA 4TVBA 1FZTA 3QE2A 5LZ9A 1MAHA 5JISA 1HY8A 2BI7A 1L0HA 2QGFA 4WKCA 3QPAA 1NQWA 1NIJA 1YQUA 4RZUA 3U4GA 2A5GA 1DIRA 3VR5A 3U0BA 2GDWA 3AV3A 3G2NA 4MMYB 1W0CA 4PRYA 3TEFA 3IAS1 3KDPA 3QXCA 1N2HA 1GPKA 2FMTA 2WUVA 2VH5R 1WAMA 4NQRA 2WHPB 5AXAA 4PPQA 1PS9A 2HQ1A 1SRRA 4TTTS 2DP4E 1V11A 4X60A 5BPHA 3UIEA 3OU7A 4F3TA 3V55A 5EJMA 4KODA 3W3AD 4LMRA 3I5UA 1DE0A 2UKDA 3L6DA 4MW0A 2ZTSA 2XUOA 2JIOA 3ZUGA 1RC8A 3FYUB 2WWVD 3BWBA 2FZWA 4YCMA 5CA0F 2N50A 3ROEA 3TLCA 3U7RA 3C5WP 2D1YA 3W3ZB 2HA0A 1XLVA 2VP9A 3QUBA 1GEEA 2ZYSA 3M6FA 5CB4B 5A06A 1RHUA 4Y9TA 1IH8A 5CPBA 3ODGA 3RSGA 2REBA 4WLVA 3M1MA 1XTTA 2Z0MA 1WXFA 1K9VF 3UH0A 2P30A 3HWWA 1G5QA 4TSFA 1PJZA 5IJAA 3EAGA 4NS4A 3WKEA 1DXYA 4PO8A 4L51A 2R86A 3WWCA 4R51A 4RVCA 1MMFB 1Q1BA 2GEKA 3I1YA 4URUR 4IHQA 1Y3FE 2P9JA 3DMTC 4ZAZA 2GBLC 1U0HC 1XOIA 4MVWA 3Q5DA 1WMSA 3TXYA 3E82A 3RS5A 3B9RA 5B6IA 3OIVA 1B93A 1AKRA 4X85A 1K5DA 1XK6A 1UQRA 1GPNA 3GXOA 1QWSA 1K7SN 2F9FA 3ZLTA 2CB0A 4YI3A 1I3MA 3O1IC 4AZ0A 5KTMA 1TZMA 1ZJ6A 4YRZA 4BN4A 4ENVA 3VNUA 3AF2A 4LC0A 4YA6A 3B78A 2GKOA 3NC0C 3CU5A 1ZBDA 3DOCA 2YOGA 1Y3DE 2R00A 3SSOA 5F7ZA 1KARA 5JCOA 2H1FA 4G41A 3H9QA 1QS0A 1E9SA 3VO1A 2Y1FA 3CF0A 3HHPA 2NOAA 1CFZA 3F5FA 1WEHA 1T15A 1VFPA 3TM5A 2OM2A 2Y1GA 2ECOA 5T3UA 1FXUA 4P7BA 2I6FA 5IXSA 3K1YA 1G3IA 3WLMA 3CCEP 1H1TA 5B3KA 1C3XA 2FYTA 4EF5A 4J91A 2F64A 2PQ2A 3DQQA 1KEKA 3TTUA 5CFOA 1KYZA 3H2KA 1JDUA 4XOUA 5SZHB 5KINB 2WM3A 1KFJB 1S2NA 5JIBA 3HKCB 1SK8A 1T2FA 1JFFB 5F9FA 1LVGA 4OQQA 1FP4A 3SZUA 4ON9A 4S12A 2CXRA 3THSA 1LPBB 4CLOB 2P4EA 2RAFA 2DYJA 2D5AA 3HQ4O 2PE5A 3FYHA 1TVMA 3R6TA 1KY2A 1MZPA 4IHAA 3O7WA 4G0ZA 2X1VA 2Q3MA 4URZR 4LBYA 3MJEA 3SO4A 3HJRA 1PR5A 4LJ6A 3RT1A 1VCOA 2IELA 4ARZB 2GR9A 3KWMA 3FYDA 1K63A 2LIWA 5DK6A 3CURA 4LZOA 2RFLA 4LRYA 1NC3A 4MICA 2FW8A 1XXHA 5G02A 1H05A 4JSRA 4LHSA 2RHBA 4E5MA 4NMLA 4RTNA 3M8KA 4FMDB 4OK3A 5A9RA 2B4YA 5CFZA 1RIIA 3QOWA 2Z46A 3U40A 1IY2A 4AJPA 1J9EA 4KQEA 1XALA 5ELLA 3JQ8B 1R64A 4J9UE 4YAGA 2MJLA 2ZPAA 2ZUWA 3K6RA 3SVTA 2H57A 3HMKA 3SOZA 4E5VA 1XCLA 2VP0A 1I2BA 4YJ3A 1XRMA 3G2KA 2NYUA 3DB1A 4O1HA 3HACA 3KDSE 4YAIA 3PHHA 3AZQA 4E5PA 4LF5B 4XE5A 2IHJA 7MHTA 1ZITA 3PTLA 1R74A 3IAUA 4KR6A 5E9WA 5CX1A 1DHTA 2P9YA 4HJXA 3MCTA 3KQMA 5H83A 1I14A 1DO8A 2F3QA 1B26A 3C74A 2EF1A 7ADHA 3SI7A 1Z35A 4BTVA 4CTKA 3T35A 1N5DA 2FPSA 3OHSX 3F6BX 4IXMA 3DS8A 3K0CA 5E7QA 2VHWA 3E18A 3NRBA 3VH4A 4LNUA 3ZVKA 4KZPA 5MDHA 3L1KA 5TPZD 1SCUB 4OUDA 1IAVA 3F8WA 3EMVA 5JSQA 1QKKA 4X3OA 1GZ7A 3WE7A 2GCOA 4BNYA 1UMDA 2Y99A 1SXJB 2V58A 3AETB 3D0KA 1BFDA 2NNWB 4B4UA 1R6DA 4BL5A 1ZNXA 3A6ZA 3ZGOA 3ZVMA 2JD1A 3MUNA 4UEOA 2C5BA 2GFQA 5IDYA 4YB8A 3VR5D 3TNDA 3JATA 3PFGA 2R2AA 2Z44A 4KE7A 2ZWPA 4FVTA 3NQ41 2EWVA 2XSZA 4OXKA 1INLA 4GVPA 1IB6A 5DWQA 1BSVA 1XTQA 2XZOA 4MYDA 1I1NA 2WSSD 2I2XB 2XD4A 1E7RA 1KSFX 4IRUB 2WF9A 4NC9A 3W8NA 2O8EA 3L7IA 1TA0A 3U3DA 1VDMA 2VK8A 4DIBA 3SEZA 2FPOA 4I5DA 1K86A 3T5DA 3UC5A 3MQ4A 1CUEA 2ZIFA 1HF3A 2IKQA 4A16A 4HY3A 1MH9A 1OFUA 4MR7B 3UW1A 1X2BA 3LBNA 1NXSA 1SVKA 1QHSA 4PN3A 1A8QA 2AEJA 1IQ0A 4TLMB 3RWBA 5JFTA 1VLJA 3R6LA 3PI6A 1RLJA 2XUJA 3FOZA 3ZS9A 4KFTA 2XNHA 3T7IA 4QDUA 3BQ9A 5KOJA 5T7BA 4PO3X 3KEQA 3AVUA 1WLSA 2OFXA 3GDOA 2VTEA 4Z53A 4I1YA 5FI5A 2KR5A 1GVNB 3S7ZA 1XP5A 4GM1A 2DULA 1N3BA 3ZD8A 5BR4A 4C4AA 4X7RA 2CZGA 3R0JA 1HYQA 1N2XA 5K4GA 4BN0A 4PG8A 1C7JA 4Q12A 1Y6FA 4PRZA 3RC9A 2FN4A 1RHMA 2GTIA 1J6UA 4HAVA 4U7JA 1KTVA 2X58A 3L8YA 1G8SA 4E3WA 3UV6A 1I51A 1Q92A 2A67A 1L5QA 4J4HA 2FA9A 1B6GA 2J3EA 4U7PB 1XNRC 2WVJA 4IFIA 1ZVQA 3ASZA 4C3UA 2ZTVA 1MABA 3T38A 1C7IA 4PGHA 1C1DB 3D8HA 1U04A 4MUGA 1NQ4A 1V6CA 1E2FA 2IKSA 1C2YA 1SBZA 4BP3A 4JL5A 3H83A 1K73Q 4G37A 2PD6A 4AUEA 2ZJYA 1ID1A 2UZAA 3T5PA 3ITDA 1GITA 2PKRA 2ZITA 4PLYA 1IRIA 2AI1A 4JFRA 1BOFA 2PBZA 4M9QA 5JROA 1PT7A 4Q5IA 2QB5A 1E2UA 2BTQB 3LYLA 3INNA 1QBGA 5DNCA 4TYNA 3PESA 3AM3A 4OY3A 1XLTC 2J3IA 3THYA 1MB2A 3FUCA 5DHRA 1T43A 1VG1A 6ADHA 2OECA 2X41A 3GFGA 1JG4A 2AR0A 3GDFA 3QJ5A 4EFKA 5KUTA 4K0RA 3BWVA 4AXXA 4AX8A 4IDBA 4E32A 2Y9MB 3V2GA 2EP5A 3V1TC 5EE0A 4PHCA 1YA8A 4CUZA 3I1FA 3FBTA 5FBQB 1SU6A 2V7WA 4XYGA 4QGSA 3ETNA 1C3OA 3MBOA 2W7TA 4HZIA 4IIXA 4DJJA 5K85A 3FGNA 1Z4KA 4KYIB 3FAZA 3PQDA 2OCGA 1E9FA 1R12A 3A4IA 4S0XA 5K0EA 1KO5A 5CAEA 3ZS8A 4GR9A 4JQOA 4X90A 1W2WB 4HX5A 4W8GA 2FG6C 1VL8A 5IP5A 4COKA 1ZIXA 2VWGA 2YN2A 2RHTA 1C9EA 3HR8A 1UH5A 3CKMA 1IZ0A 2C8LA 1FZQA 2A1UA 2PKWA 1RAIA 4NJEB 3FNHA 3ZD7A 4CU5A 2JJ1A 6ABPA 4PZCA 3HKBA 1SHZA 1KR5A 4QBIA 4HYEA 1Z06A 4N8SA 1A8IA 1TGVA 2O6HA 2WTEA 3RU3A 4MV8A 2AVNA 5MFZA 1ADCA 1KP2A 2OO5A 3RTGA 4F91B 3DE4X 1VQ7P 4PTLA 3NI2A 3MBIA 1BZYA 3D6UA 4GLLA 5DM60 1KPGA 1YKGA 3W34A 3CEMA 3CVJA 1AG9A 4G0WA 3MS7A 2AOWA 3RRFA 5GV7A 4U9UA 1D6MA 1N2SA 1OIXA 1XEAA 2B30A 4R98A 2QL9A 4EG8A 3DCNA 3LT0A 1XAIA 2SKEA 4YROA 5TQVA 5FUVA 3O92A 3ASVA 3TTTA 2FW1A 3LDAA 3H4VA 2XCTB 1J4AA 3UVEA 5AM1A 5B4UA 1TK3A 5DBHX 4KR7A 3VR2A 3QWHA 2CLIB 4RU1A 3WJ2A 4PGAA 3ZV3A 1EGQA 4YJ2F 1K6JA 4YJHA 2EVWX 3OTIA 2YJNA 2HF7A 1ML3A 3U3RA 2P2BA 1QNLA 1XR3A 2ZUCA 1CDEA 4BZZA 4DA4A 4EY7A 3Q7TA 4NHEA 4W4TA 1OFHA 1N6OA 4DOMA 4LZPA 1I13A 4E33A 3L1JA 3RB8A 2XI4A 3MTGA 4RZIA 4L0QA 4QYWA 4CKWA 4KAAA 1N0HA 2V7QA 4R9UC 4YWHA 3L46A 3GZTB 4KO4S 3CWQA 3HM9A 4NAHA 2ZJ5A 4Y6RA 1P75A 2VHZA 1CF9A 4F4IA 1H1LA 2PUAA 4W9RA 4BPFA 2VS1A 4RVHA 4I9FA 4AZ3A 1MQAA 2D0OB 2DMRA 2V7UA 2QK4A 3M1YA 1DHRA 2WZDA 1OQAA 3GLFA 4AMGA 3N0RA 4ACBA 4M0KA 2XSZD 1P7PA 3LG2A 3R3HA 3NTQA 4DV4C 3N58A 5EIAA 4ACAA 4L9RA 1R00A 1OROA 2IYOA 4Q19A 3DAHA 2NUTB 1G0OA 3AO0B 5JJCA 2I4IA 2O3JA 4CQNA 3TB4A 3M4NA 3B8HA 4ER3A 2CBZA 5KJ1A 3O82A 4JELA 3R9KA 3WGJA 1V1RA 4H6VA 1H2RS 1AUXA 2W2TA 5U9CA 1ZMOA 4Y2HA 3WI7A 1BCSA 4KH0A 1ODIA 2A1TS 3U3MA 5E38A 1VE9A 4R1OA 1Z6QA 3HJGA 3ZXYA 1IIRA 2JGRA 1SKAA 3I9LA 2GEBA 4DVJA 2NADA 3N2LA 1LSUA 3KELA 2IDKA 4ZU6X 4ZZ2A 1NG1A 3WNBA 2F8MA 2YQ4A 5JY1A 3DKIA 3C3PA 1VGRA 4D46A 4OXYA 2AN5A 3OZBA 2RGRA 5LOVB 4DDWA 1ELOA 2O0JA 3DLAA 1WIWA 3HLYA 4LYEA 2AE1A 1PG2A 4RYDA 1GRVA 5B64A 3AGPA 1V9SA 4BYMA 1I6MA 2PKCA 3AKYA 5BVHA 5DBGA 2VC2B 4IQ4A 3Q98A 1H2HA 1NW8A 1NBOA 4HLDA 4MGEA 1A8PA 1BEZA 3T7CA 5EI5A 1DJMA 3WP1B 2C5FA 3PNBA 1XTZA 1EDEA 4LXXA 3UBMA 1N1MA 4CU2A 1YIOA 2Z8YM 4QXRA 3I92A 3RQIA 4FSXA 1E0DA 1ENOA 2G6BA 2IPXA 1C4WA 4X1YB 4HPVA 2PLNA 3U44B 3GWZA 2VI5A 3TR3A 4YXWD 1MB4A 3CLTC 1U1CA 3H7IA 2ZAYA 1QC5A 3EJWA 4ZI7F 1I1QB 3NBXX 1BGXT 3DTVA 1R0RE 4Q01A 5TEWA 3GAAA 3WYAA 2DUMA 1SPBS 4GVLA 2VJCA 4WOPA 4NX2A 4AW9A 1IEXA 1ONBA 2O8NA 1Q84A 4YDHB 3EOBI 1GA6A 3MFYA 3TUIC 2ZJ0A 3LWZA 2XOKA 4IEFB 3ZHZA 4HR7A 2HMYB 2NVUB 1FFAA 1DKPA 4TTVA 1ZWLA 4GRDA 1ZOOA 3L7JA 1XVTA 4G56A 3UJPA 1NKTA 2G76A 2Q6OA 1JLSA 3GD5A 1QO7A 4LCEA 2BR4A 3ZUPA 4WXYB 1YZHA 1HUQA 4HAWA 2EOAA 1KOLA 2N3ZA 3GT7A 4AAYA 2XNSA 3Q9SA 2CJFA 4UVIA 1Q7GA 5DMXA 3AF4A 1GNQA 1IUPA 3FTPA 4IHKA 1MPXA 4OHUA 3LC7O 4HX9A 5FTWA 1G9TA 1HE8B 3N8HA 4NDNA 1YUMA 4JCOA 3IQHX 3WKAA 1OE0A 4H2DA 3HB4X 1YCHA 2IIQA 1N7IA 1F2UA 2GN1A 4ZEVA 2PYZA 5EXXA 4C4PA 1P2DA 4KXFB 3P20A 4MYCA 5TXGA 2YZKA 1XB2A 2B1IA 3R5JA 5JAIA 1Z7YA 2OMEA 1RRKA 3AT1A 3TVTA 3PNQA 4Q48A 4K6KA 1O9GA 1EK2A 1QLWA 1EBUA 5TEVA 1HKUA 3MMPA 3E9DA 1B4DA 1ISPA 3N05A 1UT8A 2BGTA 5AW7A 1IM5A 5KYUB 3H2IA 5AI8A 4ZRMA 2QTWB 2JJ1D 4J0DA 2K0DX 4DBLC 4MP6A 2DHMA 3WBHA 3EWNA 1YJ5A 3OPYA 4P33A 4BO9A 3EGCA 1X80B 2C94A 5CPFA 5EZSA 1UOEA 4PR3A 2IX3A 1IY1A 2XIJA 3WGMA 3O84A 5HK8A 2G17A 3LVQE 2C5GA 3ET4A 3NETA 2R60A 2ZAMA 3OT4A 4OUKX 1VLMA 1CQXA 3RWOA 2WVGA 2IQIA 1NG9A 4YQFA 1CF2O 3AOGA 1I36A 4K8RB 1YB1A 2R79A 2UUCB 5AHOA 3QKSB 4P80A 1X8LA 3K0AB 2GEFA 4KWHA 4NFHA 4TXJA 4KXQA 1MQ9A 1HDIA 1Y4ZA 5ER6A 2LIVA 4GZMA 2QSJA 3VR2D 2OQ2A 3MMXA 4M38A 3LRXA 4ZI3A 3CPEA 1JQBA 4N7RA 3U7JA 3BSWA 1A9XA 1AUMA 1ZQ1A 3QFCA 3K1JA 2VJNA 1SNYA 3KJHA 2PX5A 4AURA 4ARCA 1T9GR 5IHXA 3Q7PA 3ZVNA 4N5IX 2V7QD 5IULC 1CT9A 2ZU6A 4CN9A 5L40A 5LDGA 4U7TB 4G1MB 3CQ2A 4RSMA 1ULBA 4UJ3A 3WDMA 3LT1A 3GEDA 1G7TA 1HTWA 3G2LA 3O94A 1GG5A 1R5JA 1ZGCA 1RKXA 3KHUA 1FTWA 1K68A 4CIVA 4AZWA 3V2IA 1WOYA 5CTAA 4QTXA 4JP2A 4KBGA 3KBOA 1L5RA 4NBTA 2QT1A 3FUVA 1MVLA 2RGUA 3VC1A 3SXPA 4N8DA 4RH3A 5C51B 3HO6A 4EJ6A 1VPWA 1JAXA 3DS2A 2QMEA 3PC8A 2P79A 1GILA 4QM7A 5BP7A 1OLUB 4ARUA 3Q8WA 1HZJA 3KOWA 1T1JA 2O52A 2HAEA 4LDPA 1BWSA 4RY8A 4AP5A 1Z36A 2ZUFA 3OFKA 4F71A 5D6NA 1MOZA 4S1TA 3KYCA 4KKXB 4TWRA 3THOA 1FLVA 2I03A 2RH8A 2FSVA 4UEQA 3I28A 1OMOA 3EIUA 5J58A 4DR4C 3A4MA 1J1UA 3Q0IA 5EN4A 5KMGB 5C5IA 1HDCA 5BVGB 4Z4IA 3U43A 5C1DA 2MINA 1UJCA 1JHRA 4LE1A 4UU0A 3COWA 3FGOA 2BKLA 4HS9A 1YL7A 2NV2B 2VA9A 4BMYA 2QEQA 1DRKA 2ZRIA 3NHYA 3IUJA 5B7PA 3DDNA 3ENVA 4MQFA 4YO7A 2V7EA 3KOOA 5BOVA 1GG9A 1OWLA 2L42A 1Y4DE 1U3VA 3RFXA 1L4GA 3THWB 3HEBA 1C9DB 1CE8A 3UMJA 3ZE9A 3Q6MA 3W1WA 2DSNA 4IJWA 1ORWA 2E2WA 4MV7A 3CFYA 4WIAA 4TS9A 1NE7A 3IR6A 4ZYYA 4KB5A 2P69A 1IM2A 3O8RA 2M9MA 1CNMA 1LH0A 3BXZA 2HHAA 3NTVA 2N98A 5FYQA 3LCVB 5JC1A 4V0ME 1T3GA 3X3HA 2NXNA 2B7CA 1N5MA 3OIWA 4X44A 1CRZA 4RNDB 4YRIA 4D57A 4FFSA 3E2IA 3PTZA 1NYLA 3PWSA 1BS9A 5FAXA 3PC4A 1W94A 1VB5A 4X24A 4OQEA 3LIIA 1G5IA 3FVWA 4F3CA 4YAKA 3DTVD 2O05A 3MWEA 1SM4A 3D8RA 4PW0A 4JWTA 4DV1C 2PKQP 2RGWA 1MX1A 2AFVA 5K0ZA 1YULA 2AKYA 4KJZA 2IBMA 1K8ZB 4DFDA 3BKWA 4TT8A 3KTAB 3NKLA 3QFTA 3CUVA 4NBRA 3SF8A 2NLOA 1U3UA 1ZH6A 3L82B 3IMFA 2BGMA 1QCZA 3FKSD 3LUFA 2WJ6A 4E51A 1O4VA 4H1TA 1STOA 4KXWA 4OX9B 2DRIA 1S8AA 1P9RA 3NYWA 3ST7A 3W90A 3OLQA 1Y8QB 2K7ZA 4MTCA 3ZJTA 3CNBA 3EGWA 1M1YA 3GMIA 4G5XA 1M73E 3OX3A 3BTSA 4QSHA 2LNDA 2QRPA 4ARIA 2AMYA 3I01A 1XNHA 1ZM7A 1DKRA 2LUOA 4MULA 3OQJA 4G5QA 4Q4CA 1Z75A 1WJGA 4ZYZA 1QFXA 4XDZA 4L3WA 2I7XA 1KZHA 3BD7A 5AXDA 4E2XA 4GHWA 4TLAA 2ZDGA 3IBFA 4C7OB 4HI0E 4KUHA 1L5GB 4MMZB 2C2WA 2OYCA 3LLUA 3JWJA 1Y9DA 2YOFA 1OFTA 3FJ1A 4XJXA 2HU5A 3VZQA 1KJYA 1WMAA 3QY0A 3RUPA 4EK9A 3DZBA 1WKBA 2PRYA 1WXGA 5JD4A 2QSUA 2KPOA 4N7BA 3ZY5A 3C6BA 3BMCB 1V2GA 3I08A 4F60A 1OZAA 1NY6A 1NUUA 1Z39A 2C2YA 3IX7A 3RU9A 2N42A 1CC1S 5M34A 4HTFA 2JGPA 4CLEA 4YACA 3U7HB 4XX2A 2G4VA 3NPMA 3A27A 3DFFA 2FZVA 3ENWA 4KDEA 4EEZA 4R8RA 3G49A 1V60A 3G0CA 3AB8A 1E7MA 5FA6A 1GZ4A 5JYDA 4Z0PA 3S2EA 4ZQGA 4HZUB 4UQPA 3VPCA 3C15C 4L0CA 3JZMA 1W30A 4E0BA 4BGVA 3QEOA 2OVFA 4JIMA 3RNLA 3O1HB 4OQ4A 4GWGA 1P7ZA 4G8JA 3WHKA 1UM9A 1G1MA 2QT0A 1V5GA 5JAPA 2R85A 4ZD6A 5ARBA 2P67A 3CQ9A 1TW2A 4OLFA 1EJ0A 2NQ2C 5EIXA 4M8IA 4UHHA 3P32A 2XB8A 2JI7A 3P2IA 3AWIA 1QF7A 2JDIA 3AUYA 2RBKA 4ARBA 4BVKA 1I0ZA 3TLYA 1A98A 2H4XA 1KIFA 3WKCA 4WNAA 2WG2A 4LYYA 2A3NA 5I45A 3P9RA 3DEKA 3UHAA 3A0UA 4J6EA 4PLGA 3VRLC 2ZI9A 3W06A 1Z4LA 4P7GA 1F2VA 4US1R 1VECA 4TV9F 4O2LA 4JJ4A 3O3CA 5GV8A 3TEMA 3OZAA 2QAIA 2IVFA 3EEYA 3W6NA 4MEBA 3W3AA 4R4JA 3ECCA 5JW6A 4U2BA 2WFLA 1Z5PA 5AE3A 3S7TA 3CV3A 2J87A 1IM8A 2NUAB 1G1AA 3IDAA 3I56P 5F2OA 4BNDA 4Q9HA 4AK9A 2FXIA 5IKEA 1YBVA 4DV2C 4MAFA 5AVXA 5I4IA 4HFJA 2BT4A 1ZHOA 1L1QA 1UIRA 3ESQA 4I9GA 4KN5A 1SXJE 4EFLA 5K3OA 5DFAA 5IXJA 1ZUD1 3OMXA 4Q6WA 3WNQA 4CA3A 3JQDA 4I1PA 3LHKA 2WQ7A 5IJ0B 3FOAA 3F74A 2PNFA 1YUBA 1KZ6A 5DBIA 1JPJA 5JFGA 4D6PA 1CUUA 3EVEA 7REQA 4TZ0A 4R7ZA 2ZJOA 4JBXA 1ZH8A 3MOGA 4J7AA 4YGYA 1WO8A 3V3TA 2OXFA 1J8VA 2YJZA 5H4HA 4LF6C 1ODCA 2Y0DA 4EPWA 2VPIA 5JMWA 1SOAA 1J0XO 1S3GA 1I0IA 1W4BA 5SYMA 2REXB 4GFDA 4N3BA 3LPCA 3RG6C 3HBMA 3TKAA 4KMRA 2OY0A 3U62A 4FD3A 1MW8X 4BUJA 3EGDA 1FL9A 1T5BA 3HUEA 3VNQA 2QTTA 3RPEA 1RXYA 1ZRSA 4BNGA 1ZN7A 2O1EA 1W1IA 1OR5A 4U39A 1JMYA 1C3VA 2ISQA 1NW9B 3M82A 4X20A 2BGJA 5JS2A 3ZTWA 3U3OA 1OBOA 1UMBB 5LWHA 4QBGB 5AVJA 1U0FA 5LPNA 4RS3A 1IPHA 1VEHA 3H97A 2HJSA 1EWKA 1HE4A 1VTKA 2PFGA 3ZWCA 3TIFA 4OFBA 2CUTA 2VNSA 3M6IA 1Q57A 1K08A 4CTMA 2JGMA 2O48X 1E9BA 4ZT5A 3WMFA 1M0WA 3LUAA 1TKBA 3FPGA 3IAFA 3ILXA 3SN6A 4Y2XA 5JCJA 3A6PC 1IBSA 2OHGA 4HAYA 3AEUB 3K9NA 3LWNA 4G5RA 4QUBA 1SOMA 1YS1X 3ACBA 4V0QA 2O3SA 3MYRA 4HS4A 3OFVA 2RGDA 4Z7QB 5M5BA 4IIFA 3IP8A 4RGVA 5E1OA 3CVUA 1B43A 3BRCA 4E88A 2WF5A 3DPSA 3IULA 1POXA 3PEWA 3OD5A 3O0DA 4EY4A 3K4QA 4QUJA 1WR8A 4GAEA 5CH8A 4CG3A 5C80A 3DNPA 4FNAA 1A95A 2FPKA 2CLMB 2GPWA 4RCVA 5JAMA 2ZSDA 3DFZA 3HDVA 3I37X 5F3RA 2WG1A 1ZIPA 3A04A 3AEYA 2P9FA 2UZ0A 3QUTA 1DDIA 1Q7EA 3SSNA 5TLSA 3EC7A 1VP3A 4XD7D 3LKDA 3UAOA 2GQ0A 1DO2A 5THQA 2D5BA 4UBMA 3H4EA 4D4GA 3T3EA 2JVJA 1XL1A 5B3AA 4FGKA 3EZFA 4H0NA 3DE6X 4IIHA 3ZEIA 3GNQA 4RCYA 3PA8A 1PFVA 3GZMA 2JIQA 1DC5A 3ZI4A 1Q20A 1SD1A 2ATVA 5EXPA 1COZA 3K96A 3B12A 1L5ZA 1K8AQ 2VBIA 1WVGA 2I65A 3G2PA 3EBLA 4EM6A 1ZD8A 1A9RA 2P2SA 2CNOA 2HA4A 1OU4A 1L4KA 3ODPA 1XJ5A 2GEDA 3A3YA 1SPXA 1JHAA 4CF4A 2ZJ7A 3OECA 2XRFA 3IVAA 1RAEA 3ANSA 2VPWA 1I4DD 1P2TA 1JKFA 3RS8A 1EB8A 4XTRA 3ZQKA 3AOEC 1K8YB 3KOUA 4RJLA 3CCSP 4ZCSA 1Y1RA 2FHPA 1C3EA 2CLHB 4YRTA 3G1IA 2PK3A 3TNJA 3ORQA 4NOKA 4OV6B 5FV4A 3S3TA 4OJNA 4ZOBA 2V8BA 2DBVO 3H65A 1GNPA 1OXVA 4UM5A 1LWNA 3OUZA 2FVFA 1NJ2A 2YQ5A 4JT9A 3MJ4A 1JAZA 4Y6SA 1WBBA 1VFNA 4M53A 3W6OA 4BNUA 1QOQB 1OLOA 2FQ2A 2JDID 1R6UA 1CRPA 4GWKA 4OL9A 2D7JA 5FPTA 3G5LA 4FN4A 4R1QA 1PGJA 1LPNA 2Q49A 2Q4OA 4X1IB 3D6AA 3GBPA 2A94A 1HA3A 5MN6A 3PL1A 2OO5C 4URHA 1NMXA 5IBRA 2UYQA 3KFLA 4GYKA 2VNAA 1II9A 4QU0A 1KEEA 3P0RA 1FS5A 2HRDA 4IDQA 1H2BA 4A1OA 2WSSA 1DV1A 1KI4A 3OIYA 2SECE 5LJLA 4ZREA 1HE5A 2UZ1A 4RHCA 3GUCA 1W29A 3PIDA 1X7YA 1OX4B 2KBEA 3PUHA 4DR6B 1EWYA 3VAAA 4JJEA 4PVCA 3EQ2A 2PX2A 2OBXA 4DV1B 3NT5A 1ZEMA 3GCXA 5AM5A 2YFYA 1XVIA 3BF7A 3BZBA 4J9VA 3GELA 3VKVA 1KVTA 3ELUA 2C9YA 1B1AA 4JLUA 2DPLA 3AZOA 4ZYUA 3SFVA 5IM4A 4KXNA 4OCZA 5C37A 3A3KA 2XITA 3UWMA 3P52A 1R8JA 2X40A 3OESA 1RFGE 2NXWA 3HRIA 3UT6A 1I3NA 1WXDA 4C5AA 1OXXK 1MVOA 3VGPA 4OXNA 2BHNA 4DDKA 3KEFA 4N3NA 3V00A 1TD9A 1ZXXA 1IWPB 3D6HA 3CWCA 4UHCA 5IT4A 1SUPA 1JIIA 3IJRA 4HLUC 5KQGA 2HPVA 3D1LA 4DY4A 2IZ7A 2Q28A 1ANKA 1OGYA 2WAXA 1XKXA 3KNZA 1A27A 3EIFA 1OILA 3U4QB 1QHYA 1KP9A 1KFKB 3O8LA 4W7HA 4FGLA 2GHRA 1LBQA 3OOEA 5AVVA 2WWFA 3IIIA 4NYIR 3I5MA 5M7EA 3AFGA 5LA6F 2G1AA 5FLYA 1XD2B 1E2LA 5PNTA 5GONF 4B3GA 1VHJA 1VZ2A 3NIGB 1TT5A 4YY3C 2FMIA 1DCTA 3FTCA 2FWRA 4C6RA 1L7DA 1RYBA 4R3UC 1WF3A 2NU8A 1T9CA 3PX3A 1M2OB 4PSCA 3RYIA 4OA5A 1J07A 4BFVA 3CUEF 5J4HA 2WYVA 2QDXA 1N6NA 5JCJD 4FFNA 5KNCA 5JYCA 4E2FA 4DWJA 1S2IA 3KEGA 3V2HA 2FW7A 1L8QA 4NSNA 3L7AA 1Q7TA 1UJZA 5EGNA 1I6KA 2FWAA 1QG2A 2CWOA 3EH2A 3HCPA 5F73A 5A9TA 3SEQA 4JI3C 3DS1A 1GZSA 2Z1MA 1MQSA 3AI2A 5BSUA 2RHCA 3GH3A 3BDIA 3VZCA 1B14A 3C3DA 4NNPA 4MITA 2C83A 1U5BA 2ACWA 3S29A 4HBZA 1UDRA 3AP2A 5G41A 2FW9A 2W6QA 1HQBA 2OWEA 4K26A 3IIEA 4JD5A 4UULA 2XUKA 2JHCA 2CE2X 5B1EA 3GP8A 5CH5A 1Q95A 2N1MA 1NUQA 2OSVA 1OXUA 1EUCA 2NU7B 4F8EA 2N46A 1VPLA 2FV8A 2YFQA 2XUPA 4DMKA 5JH7A 4BTEA 2ZB4A 5L3SB 5T8TA 4P9NA 4EUFA 2PGJA 1QM5A 3VUFA 4QARA 3U5TA 3DFMA 4LGVA 4JVLA 5HMMA 2GPBA 2XDYA 4MIOA 2X8LA 3UM9A 4IW3B 2GK4A 1JIJA 1XC7A 1LKZA 2BHLA 3SZMA 2L17A 2HDNB 3ECSA 1TQ8A 1I94C 1ZCFA 3Q10A 4DEYA 3W05A 2QN8A 3CE9A 4MGIR 5ESRA 5JANA 2RGBA 5ALRA 3OIDA 1XLUA 2PGAA 4DRYA 5DIZA 3RTBA 4GC5A 2YFHA 1BX3A 3HCRA 4UNNA 1SQ5A 3AEZA 3ETCA 3TQTA 3VOBA 2H4FA 3RRZA 3BIWA 2C29D 1E0AA 4JUDX 1SHJA 2XNCA 2VAMA 4J0QA 5JDCC 1FNCA 1ABBA 1RYZA 4J7CA 3A7DA 1PWXA 2ZUDA 1WF6A 2VT3A 3MIZA 4FB5A 4EL0A 4WBNA 1HETA 3V7FA 3R6GA 3E8XA 3MXTA 2QD4A 3IUYA 5BRJA 2O3RA 4R2IA 4D8VA 1QYCA 2EZ9A 1UT5A 3H75A 3CW2A 3GLGA 3SHTA 1O6ZA 2J9ZB 3F98A 1XJQA 5BQPA 4QTUB 1CP3A 4QG3A 4K3VA 4DT1B 2QGNA 5IVDA 1SWVA 3OI7A 1FTYA 4WZ6A 3RRNA 2ZYRA 1X8KA 1SBYA 2C42A 4HATA 5IAOA 1IQRA 2IYFA 2Q6VA 2FWBA 3I5XA 2VHTA 3OPNA 3E5NA 4XX0B 2XMCA 2X8BA 3D4LA 2I7CA 4FFVA 4WA8A 3WL8A 3ZBUA 3K0FB 1V8BA 2YYZA 3D64A 3SK0A 3K1TA 4JM1A 4MH4A 1YZLA 1BWPA 3R5TA 1O97D 2BKUA 2OCBA 3W0LB 4IIEA 1SN7A 3Q88A 4Q4HA 4YLGA 3JAWB 1Z8DA 1NNUA 1QGDA 3LZCA 3F67A 2VDMB 2Z9CA 3N2KB 3AB3A 4M9UA 3O7MA 1VE7A 1Z38A 4PG7A 5FPQA 2BGGA 1V7PC 4G9BA 3EJEA 4MEJA 1J8MF 3HZHA 3RO7A 2IPAB 4S2UA 1YNOA 3MCZA 3U4CA 2RGNA 1RXCA 2XOEA 5FCDA 2HN9A 3S40A 4E5YA 4D41A 3T1TA 1IXRC 1NLUA 4XJVA 8LDHA 3LVRE 1CY4A 5HJ2A 1KYQA 1PNVA 3KSMA 1OBVA 5IAJA 4YEDA 4ER6A 2ZIEA 1W4ZA 4FBMA 2C88A 4P5DA 2WU0A 4AYXA 4WVLA 4OSPA 3G2MA 1YA4A 4LSMA 4D8YA 2YRFA 2NZVG 4BV9A 1E3TA 1MIOA 3CPSA 1QGOA 3VPBA 5FADA 2BBOA 4HH3C 3HZQA 3ZD9A 4C3ZA 4XGQA 4FE7A 4Z8YA 2FLKA 4CIWA 2MVVA 1GT91 3KB2A 2MYPA 1LQLA 1QP4A 4RL4A 1NF8A 3FH0A 3L40A 1EP2B 4PE5B 2CBGA 2BMEA 5ADHA 4ZJZA 4RA9A 5EXSA 4QD3A 1EPUA 1W8IA 3PP8A 4OHPA 4A0GA 3EXHA 3HFGA 4B3MB 3QRWA 4BNJA 4KGXA 5DNWA 2BFPA 2YMLA 3WGZA 5FULA 3A25A 1AN0A 2XWJI 3GJ6A 4FDMA 4I9UA 4O4IA 2UVPA 5G0TA 1LX7A 2I6TA 2A59A 2K2QB 1XKLA 1MB9A 5KQLA 1EUQA 2H4JA 2GNAA 4PGFA 3IMEA 3CA8A 3BUSA 2W6CX 1Q86Q 3DLCA 2NSLA 4FEGA 1HG0A 1VQKP 3B6MA 4YXWA 4FD2A 1M74A 1UPUA 3EVZA 4ZOCA 1JSZA 3PC8C 1B3RA 1PJTA 1BS1A 2LCFA 3W4JA 3IV9A 2F8SA 1QYWA 1HL3A 1O96A 2VSFA 2X2FA 3A7EA 3NO4A 1C30A 3B53X 4Q6BA 4Q37A 2FFQA 5D7NA 1UP6A 4E08A 3ICQB 5FHQA 3VHQA 3ZC3A 3CZQA 4P34A 1EFLA 4MA5A 3RU7A 5AHXA 1NBIA 1ZUNA 4DE5A 1PK9A 2WLSA 5KNCD 3THYB 4E4TA 2R7NA 5G0UA 2ZUUA 2GH1A 5LQJA 4CL3A 2PD3A 4MUIA 1OZHA 3QX9A 3QIAA 4IDDA 4QOIA 2JJ8A 4C06A 3RV2A 5AM2A 2VJAA 1XQVA 4M55A 4LE2A 2WSIA 3FPLA 2B83A 1CYEA 1E64A 1U0JA 2F9MA 3HY6A 4RSGA 1R8YA 1VG0B 3JR7A 3LRYA 4B73A 5HZMA 4C5BA 1Z6AA 2DR3A 4HADA 4RC9A 4BMVA 4YMHA 4FQ5A 3TMYA 3OX2A 5L7WA 3NYIA 3J81A 4B1FA 2F1RA 1F4LA 3P45A 2OBLA 3TAHA 2QLMA 1V5FA 4L2IB 2XRMA 4RJKA 2I1WA 1T2EA 2J32A 5JSUA 5MN5A 3MWDA 3EARA 2WD9A 3INGA 4C4RA 3PICA 4OHVA 3V4VB 1XZCA 1JQEA 5L3VA 2GPSA 4IH4A 5KYWA 4AY2A 3HCDA 3SHOA 1NQUA 2WPTA 1MFZA 1EDZA 4JNCA 5K4AA 1HT3A 4BPRA 2ET6A 1HE3A 4GKJC 1XKTA 4BB6A 3BB1A 2B37A 5KIAA 3R3YA 4KN9S 1E2JA 2D5CA 1IN6A 3A32A 1BC5A 5IYZA 1OYWA 2IEBA 2WYHA 4A5OA 4YRAA 2EIXA 2L19A 4PBSA 3ZW7A 3QLTA 4ZU3A 5KX5B 3LSTA 2JLXA 3TBHA 2Z1DA 1W581 3SC4A 1F38A 4UOQA 2NZ2A 1GYRA 4ZYXA 4MS4A 1SR8A 2RJ3A 1EDBA 2FQYA 1DSSG 3QBEA 4RXTA 5JWRA 2B1QA 1ODTC 1XZKA 1UK9A 4V39A 4MQLA 4YJHB 3PDIB 1GADO 2O8VA 2YW2A 3UPDA 4DZTA 1E4OA 1H0HA 5FBZA 2R44A 4YRKA 3DEIA 4JSTA 1OTHA 4DLKA 5CHYA 1Y8CA 2WHEA 3T9FA 4MGKR 3V8VA 2HLNA 1C4KA 3BWDD 4RVDA 3NMUF 5JRHA 4FZ3A 3MILA 2PMEA 3SE0A 2TSYB 4GBGA 1G42A 1VQNP 2OBYA 2XCLA 3I04M 2ZT5A 1FF9A 2XJ9A 5BN1A 3TE6A 4K9DA 5JJBA 4NOJA 3DTYA 5AJTA 1LNZA 1UBSB 1PJ3A 4GYJA 1MO5A 4N01A 3GC6A 1YVDA 5EFOA 1DRVA 3UMSA 4V1CB 4MGHA 1J90A 2GJ9A 2AFDA 2VHEA 4IOKA 2AQ8A 4PWZA 5F4BA 1LV8A 2YV3A 4JC4A 3A9RA 1V9CA 5B7QA 4XIFA 3JVEA 3NVKI 2R47A 4YY3B 2HPZA 3S81A 3ELWA 1QFSA 1ZPDA 2XMZA 3CNHA 3UXYA 2BFBB 4ENTA 1PLJA 3W1EA 1EWVA 2FETA 1BKSB 3MRTA 2I22A 1E0JA 3FLAA 4HAZA 2P9CA 3LGXA 3DM9B 4F4JA 4NPHA 5DE3A 3GLVA 4EB0A 4UHKA 5LSAA 2H2HA 4MS3B 1QO0D 3V1UA 4ZA2A 5JTTA 1J0AA 1W85B 3BM5A 4RKQA 2A35A 2VSOA 1RCTE 4Z0HO 5LLSA 1SG6A 3EUFA 1S3SA 1LPMA 3IQFA 2P8SA 4MWTA 4DQLA 2VAVA 2QQ0A 2HRZA 1AX9A 1DIAA 1JP7A 2XGJA 1Z6YA 5JO9A 1S0UA 2R7KA 1FU4A 2DCMA 2HF8A 1DT3A 2P8JA 4RXUA 1L4MA 2A5FA 5AMXA 4PTYA 5IM5A 2O14A 1LBEA 1PLLA 3WP0A 4HWKA 3TLMA 1RZ3A 5TMPA 2F2TA 2Q9BA 4R0MA 5BW6B 4KR3A 4C7BA 3UWOA 3EVCA 2J0EA 4IPYA 1FRFS 5EIWA 5U4XA 2OILA 1N7JA 3ZE2B 1W76A 3T3PB 3MMZA 2KX7A 5BMOA 2YVLA 1SAYA 3JAKA 1I2AA 1I94B 4RHTA 3MMNA 2B1JA 2EQ5A 4H18A 3MGBA 5LR6A 1ZOSA 4K81B 3RWMB 3WICA 3QY9A 3U1TA 4F7WA 1QE3A 4OYHA 4KPUB 2PMDA 2PUTA 4V0KA 1GM5A 4GT1A 3VYSB 5CZVA 1EUZA 4XGRA 1ZNYA 1USPB 2WQZA 1S3FA 4ZU1X 5C8YA 3KJFA 5LZ2A 1KMIY 2PBRA 2BH9A 4TS4A 5H0IA 2YXBA 2ZYGA 2XNDA 3U7QB 4ZANA 3Q20A 4PXYA 1FMTA 2Z8XA 3N9IA 3F0TA 2QN3A 1SA0A 1UPFA 3ZIDA 3HG7A 2GCGA 3NDPA 3P19A 4WRRA 5HE9A 3B1VA 4M1QA 4H4CA 2FE1A 1JHZA 1YJAA 1JZTA 1CZKA 2YTZA 3OCZA 3IA7A 4MR9B 2HFKA 2OBBA 2QI9C 4KSCA 2PX4A 1Q7RA 4RF4A 1HDGO 5FYDA 1RJ9B 3Q9NA 4JMPA 5L45A 2WZCA 3FKSA 4HQNA 4CV0A 3WIVA 3R9XA 3BL5A 3ZDAA 4G0QA 5C7OO 1NLFA 4O2AB 4ND6A 4ZC1A 1D9XA 4Q1CA 5E6SB 3J81D 3HY3A 2VNIA 1MJHA 3CRVA 1M34A 3E7WA 4GQAA 4JVMA 1QVVA 4ZOLF 5ALYA 3N28A 4RAOA 4XROA 2BKAA 4DBLE 1P1JA 2AOVA 3MC1A 3CE7A 2AE2A 3A1CA 4WLUA 3P9CA 5E2IA 3QVLA 3EJBA 1N2OA 4DRXB 3C3CA 1TVKA 2YVQA 4IDFA 4CT5A 3RADC 3C1AA 1EWRA 3HEMA 3E2MA 2PX8A 2PFSA 4Z0NA 1YB2A 5KTRA 4B6JA 3AHIA 2PEQA 1BQEA 5ADUS 1DG3A 1S6YA 4QDJA 4LECA 3R3WA 4F3KA 5G4LA 1DQZA 4BRZA 1F3LA 2GWRA 1IJEA 3TRFA 1WPRA 1X9IA 1PQPA 4OBWA 4S24A 1YI0A 3DZGA 2Q2QA 1T36B 4R6WA 2A5JA 1T3HA 4AJEA 3DL7A 4FR0A 2BMVA 1IZ7A 4MKXA 2VCHA 4PO9A 4G5YA 4R9NA 2GD0A 4W6QA 2TMKA 1ULAA 3ROZA 4DTCA 3C4JA 4W9NA 3B1XA 4Z3KA 4TS1A 3F5DA 2FN3A 3RVMA 4MIEA 5JSYA 4EUKA 1B76A 5EIFA 3QI7A 2J07A 4FYVA 1KZ9A 1Z3CA 2K6GA 4HDRB 3OUUA 2O1XA 3D7KA 3BD8A 4L7VA 4F45A 1X38A 5GOZA 3VM6A 1HDYA 4EHHA 3ZJ4A 4E1AA 4DHEA 1IBLC 2AYAA 2BC9A 2Q0SA 1WXIA 1FBTA 2WNIA 1U2GA 5I9BA 1TVCA 1TTHA 3GZNA 1CQJA 4B2IA 5FBLB 1JHMA 1W4AA 5LU8A 4OJKA 1JU9A 5EAIA 3ZI7A 1WDWB 4F5ZA 5IZ4A 2RG1A 2G63A 2CWWA 1G8YA 2PT9A 1X7HA 1GZ5A 3K9WA 1JQDA 2Q4EA 4GPEA 1Y42X 4B8YA 1LLQA 1VSBA 3WGVA 2V4UA 4NE2A 1C0LA 2GCNA 3FSGA 1Z18A 2L18A 2ZBPA 4KQ2A 1Y34E 3LY9A 2GM4A 4M6WA 4DWOA 3CVWA 2CG5B 1BJRE 1QM4A 2OD9A 4GUDA 1ZK0A 2QTAA 1PEKE 2JH3A 3FDXA 4QBKA 2O2ZA 3FTFA 2ON6A 5FI1B 2ZLBA 1YZNA 4IIJF 1JWLA 1XNRB 2GA9A 4MUHA 4TQGA 1X87A 3KU1A 1BTOA 1JALA 1QHHA 3DHWC 1I2MA 1P9NA 2OARA 1HLDA 3KTDA 2ODQA 4G23A 2HQBA 3DFKA 5HKKA 4LE0A 2FQXA 4NIMA 3ETEA 2AKAB 2O8CA 1CEQA 2SCUA 1DINA 2B98A 1V1MB 2FDXA 3W9SA 5I9LA 4W5HA 1K92A 3TZBA 1FYDA 4D0RA 1BD4A 3C2QA 3OPMA 2C5LA 2RGYA 1U8TA 3ZY6A 5ICSA 2EJWA 3ISTA 4A36A 3BCRA 4DC9A 2V7XA 3E8MA 4D9NA 4OIMA 2RAVA 2C04A 4DNXA 2QJTA 1RWPA 5AK3A 2BEUA 2QT9A 1TLLA 2CVQA 3PUKA 2IEYA 4D0NA 1LK0A 4M0LA 4Z0TA 4O59O 4R16A 4BXOB 2BONA 4FFRA 4OQMA 1Z73A 2RCYA 5EXTA 3DLPX 5H16A 1CU1A 4RMNA 3PJEA 4DB4A 2YXNA 2N47A 1DRUA 1SUEA 3O9VA 3UJ8A 4TXMA 2P4QA 1MOQA 4FINA 3T34A 3C45A 1P81A 5ILQA 1YZTA 3GWGA 3H86A 3REFA 2A30A 3JCZA 3VDRA 3L6EA 3PKJA 1U9CA 4JBLA 3ZWYA 1VMEA 2QX8A 5IW8A 4I1RA 3JYPA 2I99A 5E7JA 4J0JA 3ROFA 2B3TA 3EXEA 5HGLA 3AY0A 1PN3A 4ZFNA 3E7PA 3EULA 1TI7A 3AVOA 1GTSA 4C3VA 5I01A 2QG9A 4N4AA 1J21A 4G1IA 4M8LA 4DR1C 2PA0A 4QYMA 4LV6A 2VTBB 3MERA 3EZ2A 4MLDA 3ZE7A 4GKJB 3LQRA 2XNDD 3BK1A 1XHLA 2XDWA 4MUXA 2EKPA 3UJ9A 4DIKA 3SJAA 3L0CA 2JGJA 1FFBA 1QRAA 2KDNA 2FJPA 3FPEA 4B45A 3UFXB 1OXBB 2AS0A 2NZ8A 3VU3A 3STHA 2EWWA 1P19A 1UMCB 3E48A 1NI4A 4AJJA 1ZLXA 3TOVA 4RJ2A 3TN7A 1GPDG 1E89A 2J0UA 3CO5A 3OSUA 3D3WB 4X62C 3TNYA 1Z33A 4CQMA 3WL7A 1XBTA 3P1JA 2GETA 4CLXA 1UQTA 3O03A 3OEYA 1H69A 3M9XA 4L4SA 4BB9A 4UUOA 3KDAA 4AWAA 4P7FA 2CVOA 1SQ6A 1N5KA 3I0NA 4MCJA 4XD7A 2GAAA 3AF3A 2BFEA 1HURA 1LLUA 4BMZA 3K9HA 2CLDX 3BGWA 2DWUA 4EA6A 3PD0A 2FFJA 5ERGB 1AE1A 3EASA 3V7YA 4GH5A 1DAFA 4WOCA 5DTQA 1IK6A 3LCMA 1GZVA 4E4YA 4KOAA 1YL6A 2H0AA 2Z5GA 3G6EP 1YIDA 2AF8A 4UTOA 3OZGA 2OTCA 3IXQA 1K0RA 1RI3A 2YKGA 2EBHX 2R00C 2Y4NA 2VP3A 1EXDA 5JCOC 4RPJA 1ZCZA 2PL1A 2PIAA 4HVAA 1KA9H 2NPOA 3PHLA 3RS2A 1MC8A 2FW0A 3PNKA 4F1WA 4MRPA 1HOXA 1W0JA 4KQKA 4CF7A 4FX5A 4HNRA 2WUFA 1UWVA 5KWSA 1JDNA 2QV0A 4G1CA 2EHTA 1I5EA 3N2GB 1SKBA 1ISIA 2BMFA 4OHMA 3HSKA 1RQRA 4EW6A 4HGYA 4QGAA 4DV4B 5EWLA 4WZBB 2JBHA 2P4UA 5I48A 2ID4A 3BF8A 2GDZA 3QYJA 4TX1A 1ISHA 3DV0A 1WCIA 1LUAA 1E2KA 3B1FA 5HOEA 4MX8A 5FLXA 2PZ8A 1YTLA 2FGKA 4QPPA 4M0DA 3CJEA 5DCUA 4UMEA 5F1YA 4DDHA 2FAEA 4LF9C 2EW2A 3GAZA 2HK8A 4HWSA 3T06B 2H07A 1QZXA 1C7RA 3WQSB 4CFZA 3OLVA 4L2ZA 2FCRA 2HHLA 4EOGA 2VDLB 1WMBA 4NABA 2PROA 2QS9A 4HD8A 2ZCJA 3ZE1B 1NPYA 4MPPA 2JLBA 1VI2A 5FWNA 3ESDA 6Q21A 3CINA 4Q9NA 1L7AA 2PS0A 1JBEA 3RRJA 3ZKWB 1Q1ZA 1DWUA 3K2BA 4V3CA 5G4KA 5KNDH 3DE3X 2Q27A 2IRWA 4QQRA 3BEOA 1Z17A 2I9KA 3TQOA 4QHYA 5G1PA 4KTTE 3ZIUA 4DGSA 1ZU5A 3A1VA 5E7MA 1BE0A 3JZIA 1GSIA 1C0KA 1FFGA 4QDZA 1GQRA 2Q8PA 3LOPA 5C1PA 1QHNA 3WL4A 4GKVA 4PPYA 4PH0A 1F06A 2O3QA 5HCUA 3DZCA 1XRBA 3JWEA 5FTMA 4YJ2A 3QSGA 3UJAA 2Q41A 4D56A 3FSGD 3JQCA 4JITA 1HNZC 1OYVA 2AVDA 4Y1RA 1SBNE 3F3KA 3I53A 3ILVA 3IEMA 4GLOA 3MQFA 2JZNA 1QHIA 3OZFA 4IZIA 4JEHA 2FMUA 5TMDA 1V16A 1K6IA 3BK7A 5BYAA 1F9AA 4URWR 3GJ8A 3TPZA 4HYQA 3WBKA 5JRJA 4FGJA 2I33A 1P17A 3RYCA 2XZ1C 3CW9A 2O54A 4DSZA 5F23A 4MB6A 5HKKD 1XRLA 4IEEA 2IYRA 3IDFA 2A9PA 1RABA 3MJVA 4Z4QA 1MLDA 3N7AA 5TS2A 1RM4A 3K0CC 1R0BA 3RHSA 4DIUA 3PDHA 2M8LA 4BUZA 1KH2A 4KDFA 5DW3A 1IBCA 3CD6P 2B0CA 2JGDA 4K6HA 3D8UA 5CG2A 2VO1A 1KQSO 2IS2A 5JNTA 3IQEA 2ZS7A 5JXWA 4R7TA 4PICA 1T9AA 1TMOA 3U26A 5ANRB 4CV3A 5CUQA 1EVZA 1KO4A 5ER9A 3UJHA 2EJCA 1DEKA 2BMJA 3EXIA 2H00A 4LGMA 2VR1A 3RVNA 3DMDA 5CCBA 1JIKA 1SVSA 3ICOA 3CZRA 1JA1A 2CNWA 1QDUA 4NL4H 2IHUA 5CCXA 4JODA 4KH1A 3K9FC 3WWYA 1WZIA 1WW2A 1ML8A 1MGOA 3FPCA 3IUPA 4H7JA 2QUJA 2PZMA 2EEPA 1AKUA 3TM4A 2C2BA 1K9SA 4GR5A 1UBRS 1GDHA 3FX2A 2PUFA 4AJOA 2JBAA 2B20A 2J41A 4WDQA 4B4WA 2QX4A 5B2EA 3SP1A 3MWYW 5DYWA 4HAIA 2JQ4A 4Y6PA 3OFJA 5IWCA 1K6XA 3PBKA 4X71A 4EG5A 4I55F 5LKRA 4KMOA 3M6AA 4J7UA 3RSCA 1ZFNA 3KVVA 2GM3A 5LZ5A 4IRXA 1VL1A 1SK9A 4IQGA 5KJFA 3RM3A 4GICA 4WLNA 1C5KA 3AP1A 5AVYA 5KYXA 4GOXA 4WAUA 4RMIA 4HLNA 4X8LA 1HFEL 3DUFA 5C5CA 4FMCF 3FHOA 4A8HA 3W6PA 1EVLA 1AF7A 4ZEWA 2UYCA 4FMPA 4CQMD 5GY7A 4GMXA 1EFTA 2ZXFA 1F7UA 3R0ZA 1NQOA 3TIGA 4LDRA 1QQAA 1UJBA 2YJ3A 4LWPA 1FPQA 1YK1A 1IBLB 4ND5A 2QLBA 2ZUBA 1UXJA 1SCAA 1GQ2A 2A84A 4BAZA 4DL9A 1L1RA 4NEOA 2OCLA 2XLBA 4KQ1A 4L75A 3EOAI 1CBUA 1G9SA 3ENQA 4IGAA 5FBRB 5FOVA 1IB0A 4F4HA 1QIFA 1SUWA 1GGVA 4HDNB 5FDFA 2DVMA 4JT4A 2D2FA 3FGZA 1OKKA 2ZVQX 2E5FA 3AGQA 1L7PA 1YBAA 3VHXA 5CTJA 1X77A 4E94A 3BTOA 2GZRA 4O4HB 1XTKA 1NBMA 4Y9SA 3IHLA 1HTBA 4HQRA 4IMIB 2IHTA 4BO6A 4F37A 2DWCA 3GO4A 1GKKA 2HQOA 3DEJA 3ITEA 4YIHA 2PENA 4AP9A 1NNSA 4XIYA 4G5HA 3VU1A 1W0JD 4JXJA 2OD7A 1U5AA 2NPIA 3DBHA 3DBVO 3MRSA 4QG7A 4BQIA 4G0VA 1WDMA 4KLCA 4PQYA 1E6KA 1EE9A 2H11A 1WQ3A 3HBNA 3UHOA 3K6KA 3ZHCA 3PYXA 4GI7A 2AV6A 1YRAA 4N0EA 2CHUA 1L4YA 5IN5A 4KPGA 4GWLA 1W96A 2A9VA 2XE4A 1RG9A 4YP7A 4CL0A 2EEZA 1C14A 4B9AA 1V8FA 3ZDBA 1JTVA 2PUGA 5FLXD 2GVDC 4AWBA 4B6OA 5AFSA 4YWJA 1B6TA 4FYJA 5GPBA 2FMKA 4ZDJA 3FPJA 4H6PA 3FDZB 4YFVA 3T5TA 4CQLA 4EKIA 3CMEP 4O4LF 2H9IA 2BHSA 2JHFA 3ZWQA 1Q81Q 4BLWA 1D2MA 4IWNA 4DR4B 3RARA 2CF5A 2GS9A 3DW1X 2POCA 1OYOA 5FNVF 1YHQP 3RBVA 4E46A 5HGNA 4MJ3A 1SXIA 4BWFB 1AM4D 4HN9A 4Q4JA 1KGSA 2XYQA 3IT1A 4DCPA 4DLAA 1I9CA 3B3FA 3OZDA 4UHPB 3NIDB 3KFVA 4L6CA 4HUJA 1FYFA 3DR3A 3DHNA 1L7OA 1F51E 5FOUA 2Q6TA 4JLOA 2YBDA 1C7FA 1V11B 1RP7A 4AB1A 4Q34A 1VGQA 4B81A 4H7HA 2AG5A 1XAHA 5AJVB 2ZAIA 2ATIA 3A3PA 4HWRA 2QSZA 3LKZA 1OI7A 4OU5A 2F4NA 3ORFA 4P4NA 4DA9A 4QNBA 1IHDA 3KB6A 1QJ4A 3TWOA 1GRQA 4D8WA 1QQ7A 5NLLA 4DS3A 1LDGA 4JUAA 2B2NA 3W5BA 4YJDA 4L28A 2AXNA 3ESRA 4DR1B 1H3NA 1AURA 1LB1B 4Y2SA 3OJEA 3DV9A 4I50F 3IHKA 3FZEA 2RGEA 2OD2A 2ZYIA 1GXHA 3STVA 3U9TA 2UXDC 4DUYC 5JFOA 4Q9LA 3CM0A 1FB5A 1IPFA 3NEYA 3SGLA 3GHHA 1TW3A 4RV9A 3PEFA 2ZP1A 5B1DA 4AMBA 1N2BA 1G2IA 3IEVA 4Q1EA 2ZIZA 1GQFA 2EQAA 4PGMA 2AN9A 4XEHA 4X62B 4GR6A 1P0QA 5E0KB 1PYDA 1L4NA 3HDTA 3DVLA 3JY6A 1P4SA 4XWAA 4D9HA 4B8ZA 3L84A 2J0QA 3GVIA 4O3FA 3HYBA 5KC9A 3T54A 4WOKA 1KOJA 2HY7A 4BN5A 3OZVA 2GYYA 1W36D 1E1NA 2BMWA 3KM0A 4DC1A 4HPJB 3CX8A 4ZC8A 2DKOA 4PX2A 4NBVA 3FCEA 2HXGA 3U3XA 2ZRMA 5EWJA 1H4SA 4U7WA 1EP9A 1LI4A 4TKUA 3RODA 4Q1FA 3MJFA 3WSWA 3V1KA 4B7AA 2HFJA 1RHQA 2CNWD 4AZ0B 1N77A 3E23A 5LC1A 3CUKA 3VPXA 5I5GA 3P27A 3C1UA 2J3MA 2YWEA 2Y1DA 3UC9A 5DYTA 5AK4A 2IUTA 1H2FA 4YHHC 4ZOEA 1YV9A 2IBTA 2VJMA 2UYGA 3B2QA 1QS0B 1KDOA 5A5VA 1XD8A 2WHYA 1LI5A 2JFNA 2I1VB 3AUFA 4KTVA 4HN2A 1AKTA 3R41A 4KI0A 2Z43A 3IAEA 4XDYA 1LJLA 4TLEA 2JFYA 3LPDA 1QAMA 3SBDA 1JQKA 2I7TA 3QNWA 4LCBA 3NT2A 3DWIA 1C41A 4E5SA 3E3LA 5CLHA 3AR2A 3CC8A 7GPBA 1L5LA 1I3CA 2QVCA 2OSBA 2Q3JA 1KDPA 4M0CA 3B7GA 2VH2A 4TKZA 4BLOA 3VNSA 5DGIA 3A6DA 4ZMBA 2N5HA 3WKDA 1PKXA 4YPOA 4M0PA 4MKZA 3T3GA 1WZCA 3RHFA 1FP4B 1YRYE 4LF9B 4LMAA 3SQDA 1JJBA 3B38A 1E9RA 1NATA 1Q0PA 1JEJA 1LNSA 5I4TG 2RI0A 1Y6QA 5DP1A 4IQ0A 2F48A 2NIPA 2GPJA 1GPJA 1UWDA 1T8TA 2ZRHA 3JYHA 4FYWA 1Z47A 2HRCA 2UUBC 2CQ8A 4O2BF 1OB2A 2XMRA 5DNDA 1BMDA 1NY8A 3JRXA 1TYAE 4V0NA 5AKHA 4Q02A 1BW9A 1I3OA 5FPSA 5C31A 4IV5A 1XXHB 4RDIA 3HL0A 1DKLA 3PE4A 5DCLA 4TV8F 3GCZA 1W5SA 2Y93A 1JJFA 1PZEA 2QLLA 1MG0A 2EAUA 1GG8A 1QK3A 5AO9A 3BQNB 1OKKD 1Y8ZA 5DTIA 2QW8A 2IH4A 5ALTA 4D42A 3LO8A 4OQXA 4CKZA 2JGLA 2YXEA 2I78A 1NBMD 3EIXA 4EKYA 4EKDA 3ONNA 4WDRA 3VNVA 1YR1A 4YJ3B 2GBIA 4M9ZA 5DM2A 5D5QA 5A71A 3KOXA 1YU9A 1MHPA 3PYLA 5DBFA 5H3LA 4PONA 4UPEA 2P9EA 1WQ1R 3BXEA 2PYDA 1TTPB 4ARSA 3GLTA 4IGFA 5CX1B 2XYRA 4WSOA 1X14A 3KUUA 1FW6A 1N0WA 3HA2A 4HDSA 5J2UA 4FYHA 2AIRA 3HJCA 3I09A 4DV2B 4UHJA 3RVBA 4GO1A 4IS2A 1XO1A 3L41A 1YS6A 3ZWXA 3NWEA 4BO8A 3H11A 3W5VA 2QMQA 2CK3D 3TIIA 4LNUB 1ZL2A 1NRIA 3BXHA 1WEKA 3BC1A 4OUDB 1K3TA 3CLUD 3QVMA 1BXRA 1P7CA 3E3NA 3KQWA 2FEXA 1ESZA 2GCOB 1UMDB 5BS1A 3QWFA 4B40A 8GPBA 1RNLA 2WWWA 5H5JA 2Z6UA 3RF6A 1T34A 2DUNA 1Y7TA 2IK8A 3MWFA 3IMGA 4LF6B 2REQA 2QRGA 4BVGA 4ZK6A 1I33A 1JJAA 3DGEC 2C54A 4E30A 4JBHA 2FSUA 3JATB 4GPZA 4XAQA 1CUYA 4X7BA 3STXA 2CNRA 3UV7A 1LRJA 1AC5A 4O25A 3NTLA 1MB0A 3L6BA 5F33A 2L9FA 1AXGA 2GYKA 1Z0SA 3EGEA 1M2KA 4LJYA 2PV0A 1M6XA 4R2LA 2A9JA 4D9CA 3PHIA 2O8EB 1IOZA 3LLMA 4B6RA 1OHHD 4II3A 3PPVA 1U7ZA 2JF0A 1WSBA 1P1KA 5BR8C 2WHRA 3GMSA 4W9NC 3UMVA 1FUIA 4N3AA 3N74A 4MUBA 4ZAGA 2Z8ZA 1P1CA 4LYDA 2G9ZA 3AONB 3VUEA 4ZT2A 1KMCA 3HYTA 1YJ9P 2PKXA 1HV8A 1ORDA 4ZTUB 5CHEA 3KPJA 3VSDA 3BH0A 2OPLA 2OPBA 4YASA 2YZ2A 4W1PA 2VRWA 1QO0A 4QIHA 3WQQA 1M2WA 1KC1A 2YJTD 3O8NA 4EW1A 1ECPA 1D6NA 3ZWWA 2PQ6A 3UHFA 5EJEA 3L0PA 1Q19A 1BDJA 5A4IS 2XPCA 1H4TA 2Y66A 4ME6A 4U3JA 4IY1A 1U2GC 4Q0MA 1YS9A 5KOJB 2TMGA 1AKEA 4Y6QA 1QH8A 1W35A 2AEFA 3HVJA 3NHLA 3M1LA 3AY6A 4P92A 3CSSA 1GQYA 2A9RA 5FR1A 3V1LA 3ZW8A 4GX0A 3NW9A 4HB2A 2QPAA 3WKBA 5D7BA 5KWJA 1IVSA 4JXXA 6CHYA 1QF6A 5LFAA 4TMZA 5C35A 3H1EA 4YXFA 4UU8A 3B7PA 3VU0A 3PGKA 2NO5A 4REQA 2BW0A 1FQOA 3P5SA 5ALKA 4TYMA 1N5JA 3CEJA 2IITA 3W04A 4ZV4A 1JIVA 1G3MA 3DWEX 4N7MA 2XWPA 2AFIA 4R2XA 4A03A 5J3JA 2J85A 3CISA 1MABB 3OOWA 1E8NA 1RXSA 3KZ1E 1DJNA 3HWX1 4DLWA 3P0FA 2EGUA 3EZGA 3VDQA 4ILEA 3WMWA 4W82A 1JDSA 1ENZA 3R0QA 3FI9A 5F4ZA 1K4KA 2H51A 1XU9A 3AEQA 1PK7A 3MB8A 3N70A 1ONNA 1US8A 3NBYC 4DBVO 3DOHA 4QQKA 2KJQA 4WK6A 4I8IA 1Q74A 4UHDA 2FSVC 4F6RA 3IDQA 4HVTA 4YT8A 3QG5A 4P38A 4D92A 4LHXA 3G9TA 4OOFA 1FS4A 3VC2A 4ZP1A 3SOPA 1E3EA 1ZGBA 3UHJA 4EYEA 5ARCA 2ERCA 1FK8A 1NVTA 2B4TO 3G2IA 5LMUC 2D28C 3R40A 3S68A 4EABA 3LDUA 1V3VA 4C5CA 1O92A 5IKMA 4DYHA 2FF5A 5A3RA 2E4XA 2V9PA 3HBAA 2FN7A 5JALA 4ECEA 5LYJA 2WWRA 2JB0A 1CEEA 1C3OB 3UT5A 3T52A 1KQOA 3EWIA 3PQ4A 4RY2A 1UODA 1CUGA 4IUCS 4KR2A 1J9GA 2W0MA 1QK5A 4JYAC 3MRVA 3LYUA 3UMRA 5FFMA 5IAEA 1GGEA 5CAEB 2FLWA 3RBAA 5EWMA 1I0LA 4KREA 5JBIA 1U3TA 5J2TF 5HRAA 3P7MA 3OZSA 1T3LA 4MRNA 3D7RA 2A1UB 1NKSA 3D4OA 4DM4A 2BEVA 5FFFA 5EMHA 4EF4A 4IIGA 4D0GA 5MFPA 5FTKA 5AKIA 4RK5A 2A6PA 2RE8A 4D4HA 2X5OA 4LX8A 1NVVR 3HKBB 5CD9A 3WNCA 4FWIB 2ZSBA 4CEIA 1MO4A 2B1GA 1V43A 1SD2A 2M32A 2PBFA 1KETA 4JC5A 2DKFA 1FLOA 3CO0S 1GWNA 1DGQA 5KJEA 1B15A 2O2SA 5I7FA 3O2JA 3ZWPA 1QJCA 4DDTA 4G97A 1XEWY 3RLIA 4R1NA 3N5KA 1JEOA 3T9BA 5ES4B 4MROA 4Y2PA 4ZOAA 4M1EA 5DYIA 4QDKA 4QUEA 3QLVA 5B58C 3KPUA 3VU8A 2W4MA 4EG7A 1NJ1A 4MVJI 2UXDB 1TGYA 4DUYB 4W5JA 1XK7A 4IVQA 5JLAA 2JFXA 1XZPA 1B42A 3IO5A 1VQPP 5KYYA 1EHCA 1AXRA 5EE5B 1RYMA 1Y5IA 2PGIA 4I66A 1PJBA 1I3KA 3WB0A 4C0JA 5ICMA 3Q3VA 3QBVA 5J5CA 4RZHA 3I8SA 4QXPA 4LFAC 2MM9A 1NT2A 3DE7X 4S3MA 3GY0A 3HXQA 3B6IA 4ZZ3A 3OMWA 4CKWB 2Q5LA 4D2IA 5REQA 4RELA 3ETJA 3BRWA 3LV8A 2OESA 1GAEO 4R3WA 3V9AA 3Q3IA 3A4VA 4NF2A 3U6BA 1H1LB 4AZ3B 2QBYA 2RAUA 1AVTA 3PHGA 1NXOA 4WZBE 3IMLA 2M5RA 1HZZA 3GLFB 1XZDA 5D01A 4PYNA 4ER0A 2RKWA 3U19A 4XIIA 3FOEC 3HO1A 4ZVUA 1BU5A 4YIKA 3QEMA 4JLJA 4WECA 1K3FA 4YHHB 4H0CA 3K0HA 3QWAA 5IC4A 4YR7A 1V1RB 3L0BA 4L5CA 2PXHA 4FFDA 3QXJA 1BCSB 4LJ4A 5DHSA 4YV2A 1AJEA 2HBQA 1GCGA 2FUG6 5IPFA 5TQ2A 1P6UA 3F47A 5I9NA 3EQ6A 3WXBA 4MPJA 5JJKA 3LNVA 2VLPA 4BFYA 2E87A 4RNCA 3VH1A 3RJ5A 4Q00A 3GUYA 4Y2TA 1EFUA 2X76A 4ZCTA 1MGPA 1G98A 1L8XA 2JW5A 3VMFA 3GBVA 2MOKA 1JQ5A 4JI3B 1S01A 3NWJA 1YZQA 1KYTA 4U00A 2CCGA 2LD4A 2XQVA 3SR0A 2H18A 3IPAA 2IGBA 3AF1A 5KYKA 5BVHB 3G6WA 3DOIA 1W49A 4EPXA 5LBTA 3JASA 3CCMP 2AB0A 3HV0A 1CY8A 4LX0A 1OPXA 3V4PB 3PA6A 3SD7A 4J3NA 3AYXB 3O1LA 4ZQIA 4S1PA 1G6OA 2VP4A 4FGUA 5CA0A 2DHEA 4L50A 3VO2A 1N2EA 1NJ8A 3LDGA 2UUBB 4AJNA 2WTMA 2E18A 1A5AB 1C80A 1SCNE 1LJUA 2YDXA 4YRQA 5AYVA 1DG1G 2QZ4A 1NTOA 1QFZA 4UDXX 5IVKA 2VSQA 3D6JA 1G291 4B32A 4XTCS 3I12A 5BO5A 3UWKA 1QC5B 4JKIA 1P2BA 3DTVB 3UJ6A 4DABA 3N54B 4IQFA 5JAHA 4G07A 3CUWA 4JBIA 4DXHA 3WRVA 1GYQA 2ESRA 3DMPA 2R7MA 4NTZA 2X8WA 3V4OA 3FRJA 2YHBA 3EW9A 3AG5A 5NULA 5C52B 3OM9A 4DTIA 3FF1A 3MAJA 3S55A 3T5BA 1AMOA 4G9GA 1I4EB 1ZS9A 3GJ0A 3L4KA 2IP1A 3H9GA 2NUPA 2QTGA 5DDIP 2YCLA 1NXPA 4D44A 1O6FA 1KSJA 2QY9A 4MAAA 4MDYA 3UUWA 2W2KA 3R9XB 1O8BA 1X1DA 2E4AA 2XRZA 1U8YA 4DW8A 3TPCA 2E9SA 1IONA 1FMFA 4AP6A 2PUCA 2IUEA 4JI4C 3JQPA 1ETHA 3UKOA 4OQNA 3Q7SA 5SY4A 2G1PA 2ODAA 3NNDA 4PLHA 1SEVA 5D87A 4AZTA 3IDZA 3LXXA 3AF0A 1Z37A 1W1WA 4A73A 1E6LA 2VYVA 5KCZA 1HM5A 5JPDA 1F2UB 5JCZA 1J2TA 1NJGA 4WXPA 2IOFA 5EHIA 2PEYA 1QZUA 4EG1A 2EZUA 1NQ5A 5T57A 5DSZA 3CR3C 1ZKDA 5K20A 1EFHA 1J20A 1U0BB 5CJ2A 2C7RA 2XXMA 2D3WA 2F43A 4KYUA 1QOZA 5IRCD 4JJFA 2VN8A 3P97A 2WR8A 3ACCA 4DMUB 5HRCA 4HEJA 3HP4A 3AKEA 2HA5A 1RTTA 2HCRA 4DG8A 3H04A 4TYYA 1G2OA 1KXZA 4BFSA 1J8YF 1ULTA 2Y8EA 5L3RA 2LOLA 5AI0A 4UE6A 5CDUA 4Q82A 3LHDA 3OZRA 4NXMC 3OPYB 1KI8A 1MKYA 4ZCQA 4NCAA 3ERCA 3SHQA 2KMLA 4B80A 1JXMA 1U5CA 4UAUA 5AJWA 1ZN8A 1RBMA 4NAUA 1KAMA 1KDVA 3Q2OA 1W59A 3OFND 2B35A 5BR8B 2PEOA 4BLSA 1M2VA 1O6CA 2ZROA 1RR6A 1QPZA 2CHGA 4HRAA 1E1DA 5HZHA 2Z1NA 3KL2A 2K0XA 1Y6RA 3IIJA 5BORA 1QP8A 5CIYA 4DWVA 1ZMBA 3ICWA 1T3SA 3Q41A 3PDUA 2CXHA 1ES9A 5AQ1A 5KKNB 5SYNA 1SB9A 3E3AA 3AUKA 3LFHA 2NPFA 2JATA 2CGQA 2LWIA 3A1EA 3AJAA 3H9UA 4MCHA 4YGXB 1C4OA 5C53B 4YMIA 1A9XB 1NR5A 3FSEA 4LOHA 5TPWA 4Z4GA 1IY0A 2XKAA 3G1UA 1QE5A 2IHYA 1U7TA 5G0VA 1XA4A 1M0EA 4JIGA 1R4ZA 3BRWD 1RZVA 2QRUA 3B89A 1NZJA 4BNLA 3EZ9A 3CRW1 3DF7A 3EC2A 3IHTA 4MV5A 2B82A 4ZQEA 5A6VA 1R8SA 3WAKA 2FRDA 3OG9A 2HBRA 2O2GA 2O23A 3WWZA 1IHPA 2H54A 5HOQA 3DKRA 3OF5A 1YBHA 1QTRA 5CJPA 4K6GA 4EJSA 1VQLP 2YWHA 1AGNA 1YJCA 3T94A 2VUTA 1UOQA 4N3CA 3N59A 3U16A 2D62A 1XVLA 5ALDA 1A9PA 4UATA 2ZQYA 5H68A 1ZK2A 1M6YA 3OLWA 1GUBA 3R7BA 2QIOA 1I32A 2VHJA 2P7HA 3KYCB 4HGZA 2AF4C 1GCUA 3QW2A 2X13A 3KT6A 2CY1A 4CYMA 2Z5LA 3C70A 1QX3A 1A4XA 5IH7A 4CG2A 3VO9A 2CDNA 1FRVA 4WJKB 1TQ2A 3I30X 3G8DA 1KEUA 1Z7GA 1O97C 3DPIA 2MINB 2P3OA 3NTOA 3B52X 5LMUB 3L7KA 5GIOE 2OTJP 4MQFB 2H1SA 4MDEA 3L92A 4GOOD 3JQBA 4FOLA 3HE3A 4KRXA 3C4VA 1CE8B 1U31A 1PJQA 2WPNA 3F73A 1RU3A 4JYAB 4IYJA 4OK5A 3WYNA 4KYVA 4FW9A 5EMNA 4GOLD 1VIDA 4YCNA 3GDWA 2DTEA 4TTSA 4BV8A 4PC1A 2YIDA 3ZCPA 4MYHA 1MC4A 1CZUA 2LCQA 1JVBA 3IVMA 4ZODA 2XCOA 1L5WA 1BX0A 2XCQA 1WM1A 2A7QA 3GJ7A 3WGQA 2GTPA 4DCSA 3NEJA 5AJXA 3AX6A 1REQA 3G0GA 1DAEA 1ND6A 2XTJA 1I2DA 5TSDA 3RIMA 3MWEB 3QTTA 1QCDA 4RH0A 2ZIXA 3ANNA 4XR9A 1VP9A 2X7JA 2DPGA 3I2JA 4BVAA 4C0AC 4U6NA 1Z5OA 2K93A 2W2OA 3WTBA 1L7RA 2V6MA 2CKDA 4BX2A 4QPJC 2QVZX 4JLKA 1IEQA 2K87A 2BL4A 2ZQ5A 3DQPA 4PYKA 4OX9Y 5ALIA 3SF8B 2IY9A 3K0SA 4CN8A 4JOCA 4QEDA 1ZD2P 4AYWA 5JE8A 3T3IA 1G8AA 3BAFA 4LHZA 4BE9A 3OJFA 3GP3A 1XVAA 2EFHB 2EP8A 3NBMA 5HEKA 1M1YB 4CDMA 1B8UA 4RA6A 4RY0A 3KKPA 4Y7CA 2DYKA 5D6OA 2ZE5A 2JJQA 3WZ2A 3L1IA 3OP1A 3PVSA 2RHDA 3NUZA 4LFAB 4PSUA 1GRRA 4LOIA 1VYVA 1YH3A 4Q9IA 1YFJA 2VYVD 1E1MA 4BZWA 1PD0A 3BWCA 4YFYA 3KSZO 1N1GA 3NUGA 4FNMA 1I7NA 3NFYA 4YC7A 2R6ZA 3OO1A 5HIJA 1BWQA 4UTZA 4A5SA 1V6SA 1ADFA 1CJKC 2XMGA 2B94A 5E3HA 3ER8A 3TTVA 3EUEA 1EXWA 4LHYA 3ANYB 1W52X 4YCAA 3QG1A 4XSVA 3WHPA 2OAEA 3AHFA 3QZUA 4OHOA 3PCTA 1F9EA 1CDDA 4MQ5A 4RM3A 4KC0A 4EZBA 1QVRA 3FG9A 1KI7A 1X92A 3X2EA 1LY1A 1FFYA 2N6ZA 1WP9A 1EK6A 1CY7A 3I9MA 4HTFB 4PIMA 3X1KA 5TY0A 4E4RA 3PSHA 3QH4A 2Q3EA 3DBOB 4KNWA 2CXOA 4GW3A 3T8YA 4CTJA 2C3OA 2I87A 2R8XA 1CY1A 3D1VA 3PT5A 4KVZA 5H9VA 3W7BA 3EXG1 3FDFA 3TR6A 1C9KA 3JQFA 3H9EO 4L8WB 1SVIA 5K2MA 3R5SA 3TB6A 2I54A 1OXTA 1UM9B 3GYGA 5EUQB 4MTLA 3QV2A 3WMRA 5DHQA