4IZ6A

Structure of ente and entb, an nrps adenylation-pcp fusion protein with pseudo translational symmetry
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
614
structure length
609
Chain Sequence
SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSREVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enterobactin synthase component E, Isochorismatase
publication title Structure determination of the functional domain interaction of a chimeric nonribosomal peptide synthetase from a challenging crystal with noncrystallographic translational symmetry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 198
structure length 609
sequence length 614
chains with identical sequence B
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4iz6A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4iz6A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iz6A01
2FVAA 2P2FA 4FUTA 3WV5A 4FUQA 4H2XC 2AF8A 3QYAA 1HY8A 1F80D 2GDXA 4ISBA 2DNWA 4D56A 3CE7A 2P2JA 2KG9A 2CGQA 2N6YA 3EJDA 4BPFA 3NYRA 1V25A 2EHSA 5HVCA 3G7SA 4U5YD 2JU1A 4RLFA 4RM3A 3ETCA 3PBKA 4PZPA 4DG8A 4ZJZA 3CW8X 2MVVA 3VNSA 2FVEA 5BURA 5K8FA 1DNYA 3T5AA 3EJBA 5BSWA 4GXQA 2KGDA 1X3OA 2FQ1A 2L9FA 2Y27A 4D4HA 2CQ8A 2AVAA 3ITEA 2MF4A 2FAEA 2LMLA 2N50A 2PNGA 2QW0X 3C5EA 3DAYA 4D4GA 4IR7A 2D1RA 5KYTA 3LNVA 2LIWA 5BSUA 4G36A 4LGCA 1OR5A 1PG3A 2LIUA 2KORA 3L8CA 3KXWA 4M46A 3RG2A 2LTEA 2QNWA 2KOOA 1BA3A 4IZ6A 2KGEA 1MDBA 3LGXA 3U17A 1ACPA 3LMOA 2P2QA 2QVXX 4RVOA 3RIXA 3NI2A 5KP7B 4EATA 4OXIA 2L4BA 2LPKA 2N98A 3O83A 2CNRA 3O82A 2LOLA 2MR7A 2ROQA 4HKGA 5DV9A 2KG8A 4H2WC 5E7QA 2L0QA 2V7BA 4MRTC 2QVYX 4D57A 2GDYA 3IVRA 2JU2A 3GPCA 1T8KA 2LKIA 4DG9A 1DV5A 5GTDA 4E5DA 1AF8A 3DLPX 5BSVA 1VKUA 3WVNA 4BPGA 2XZ0D 2KOQA 1ULTA 2EHTA 4RVNA 5KYVA 1YJ7A 5IFIA 3NYQA 2JGPA 2K0YA 4GXRA 3TSYA 4D4IA 2N5HA 3T5BA 2VSQA 4GR4A 1L0HA 1PG4A 2P2BA 4R0MA 4WV3A 2N5IA 2KOSA 5KP8B 2Y4OA 3E7XA 2KGCA 1V26A 2FACA 2WD9A 5EJDA 2KOPA 5CZDB 3E53A 1T5DX 5BSRA 2FQ0A 2GDWA 5K85A 3WV4A 5KP6B 2K93A 4W8OA 3T5CA 2XZ1C 1KLPA 2KW2A 5KEIA 1AMUA 2P2MA 1HQBA 4R1LA 4G37A 4R1MA 2AFDA 5JRHA 4BPHA 5DWVA 2K2QA 2FQ2A 5HV8A 5BSTA 4GR5A 3VNRA 2KWLA 1LCIA 3A9VA 2MY5A 3EQ6A 1T5HX 2D1QA 2P20A 2MR8A 2KG6A 3IPLA 4OYCA 3IEPA 1L0IA 3B7WA 3IERA 3U16A 4PWVB 4RLQA 2D1TA 3R44A 2JQ4A 4RM2A 2LL8A 4CA3A 4PXHB 2KR5A 3NY7B 3E7WA 3O84A 5D6NA 3GZMA 3FCCA 3IESA 2K0XA 3EJEA 2MD9A 3GZLA 2VZEA 1MDFA 1RY2A 2QVZX 3CW9A 3FCEA 4RMNA 2Y4NA 2AFEA 2FADA 2K94A 3A9UA 2FHSC 4NEOA 5BUQA 3LAXA 2FVFA 4GS5A 2N6ZA 2CG5B 3DHVA 2L22A 2MVUA 2X2BA 3VNQA 2KGAA 2K92A 5BSMA 1NQ4A 5BUSA 4H2YC 2M5RA 1MD9A 2D1SA
chains in the Genus database with same CATH superfamily
2P69A 1BEEA 1U2DC 2DZDA 1YDMA 3P0HA 2AN9A 1PX0A 3K72B 2ERYA 3FPCA 5K3CA 3CB2A 1QF9A 3QENA 5HGMA 2P79A 4CTMA 1EPUA 4NK4A 1ECGA 2XD9A 4MR9B 2JARA 2PXCA 4MHOA 3N2LA 1HE5A 3W8RA 3G9ZA 5JARA 4B5LA 3UJDA 1SOVA 3CJTA 1K27A 1HQDA 1AU9A 1M7BA 4N12A 1EK1A 5KSWB 5DM4A 3MQFA 5IKEA 2ZYGA 1BDJA 2C31A 4ND2A 4XIFA 3P9IA 4YCJA 4RKQA 1QDLB 4B7XA 4DV2B 1E79A 1C8LA 1Y7HA 4TLLB 1PFWA 3UXYA 5D6OA 2ZS7A 4J4HA 5E2AA 4B7UA 1KFBB 3UGJA 2QZ4A 4KPUB 4ACAA 3LX8A 3UA3A 3PG5A 2C7RA 4F8EA 5F4ZA 1SC1A 4MO2A 5G1OA 3J7TA 2KM1A 1CF4A 1XNRB 3WOVA 5JCOC 3R5FA 2CC2A 4G23A 3LF1A 5T57A 3ZVNA 3ZS8A 3RYTC 1O9TA 5AQEA 1OXKB 4XR9A 1S5PA 3LY9A 2A0FA 3EIWA 4IJ6A 4OHZA 4KKVA 2JPDA 3ZJVA 1ZH8A 4CZ2A 1M2HA 3WYNA 1BU5A 2QX7A 3BL6A 3GR0A 1VJTA 2IYOA 3IA7A 1RKXA 2FFBA 2I4NA 3MBOA 4NDNE 1KY5A 3CKKA 4ZPJA 4DSNA 2EFHB 3A4TA 2J0QA 2R7KA 4ZLPA 2HIGA 1Q0PA 3GPBA 3QH4A 2AEEA 1XXHE 1PWEA 4E46A 2ONCA 2GPAA 3LVRE 2QI9F 4KR3A 4M0IA 2CNBA 3EULA 2PRYA 4PPGA 2BFDB 2IEBA 4L4SA 2KG9A 1Q16A 3TOVA 4E7PA 1MC5A 1V2GA 3EVFA 3N8NA 3HUDA 3OCWA 1FZTA 3A3NA 4HTAA 1IZ9A 3EIOA 5CT8A 3AMVA 2BFFB 1P73A 4FGWA 2ZIGA 2ABWA 4EZIA 4K1LA 1PSWA 2IS2A 1AZSC 1U5AA 1HYEA 1B2RA 2ZJ6A 3IPRA 4OSEA 2Y1OA 4CMCA 5FLYA 4NDNA 2YJZA 3K2BA 4ZFNA 2FU5C 4C20A 3M2TA 3MC1A 2ECPA 5E6RA 3D6UA 3BE6A 5KHOC 3ZCXA 1XXHA 3Q3EA 3TFQA 4EY7A 2Z1DA 3HY4A 4KR2A 3IP8A 3TR0A 4MAMA 2C77A 4Z3OA 5JMTA 3AM4A 3E0XA 3UJ8A 3KQHA 4OQPA 1QJCA 4BMPB 4BGEA 2GBPA 3N0VA 1EP3B 1VJDA 1S72P 4IKPA 4K05A 2PT9A 3RROA 1LBEA 1WXEA 1N0HA 3A2MA 4KLZA 1P2TA 4XUGB 3MGBA 5LZ9A 1KH1A 1OILA 5CCBA 4GFDA 3NALA 5HZKA 1WTCA 1TQ4A 4KO1S 2A1UA 3N3AC 5AE1A 3LOPA 2VDQB 3HFRA 4WNAB 1USIA 5CRIA 4MR8A 1PG2A 5TPWB 3NNDA 4N1AA 2VAMA 3K05A 3SJCA 2JCSA 4PIVA 3TQHA 1H2YA 3FM9A 3QTTA 4XB2A 4E5VA 4LSZA 4NZMA 1C1XB 1JGTA 4B40A 2VQEC 3LUCA 5I9SA 5EZYA 3N58A 3W90A 5JAUA 1VBNA 2AKYA 3CR3C 3GJTA 4WK0B 1N2GA 1Y80A 4R3NA 4P3XA 3FNFA 1JG4A 3NKFA 2FOLA 1PJQA 3IRVA 2CFSA 2ZSIA 3VKGA 9MHTA 1P7VA 3EGOA 4WQMA 3IKTA 3RYIB 1VQNP 4R8MA 2G72A 3ZK7A 1R66A 3IP5A 2Q4TA 5KQLA 1H8HA 4G0PA 4BMOB 2AQ8A 3FOFC 4GKJC 4I9FA 2LKIA 3T5DA 1ORTA 3HM9A 4ZYZA 2XZDA 2XEXA 2B61A 4DSOA 1B15A 4B3SC 1FDWA 3RAJA 1TYAE 1ZN2A 1J49A 2NUPB 4WAUA 3AZPA 2ISCA 3RLFA 2ZTMA 4KQ6A 1MG5A 2C2GA 1QKKA 2ZIUB 2M6RA 2QBYB 5JXJA 1Y1LA 1H6DA 2I2DA 3LYUA 3KQUA 4V0OA 5ILGA 4IHQA 1F1JA 4FTFA 5EQTA 2DFLA 2PT5A 2DKNA 1EE9A 3TAHA 4JMPA 4QNRA 2ZJOA 5KVSA 4IIJB 5CIYA 1QOZA 1QU3A 2X19A 2ID8A 1LVUA 2ZXFA 2VNHA 1NXXA 2Q6KA 2QP3A 4AQ7A 1DWUA 1WPGA 3ENVA 4MGZR 3PXUA 3ADCA 4RTRA 2I76A 3A8TA 2W71A 3DCYA 4CLEA 1LI4A 2XZ0D 3KYCB 2PGNA 4TTSA 3EODA 2CZCA 5EIFA 1BXRB 3PLNA 1XJWA 1J2EA 4PYIA 2X22A 5C52B 3FPFA 3IAS1 4N5DA 2ZRAA 3AL2A 3U3RA 2IY8A 4GECA 2JFNA 1TL7C 4U8GA 3ANLA 3LQ4A 2A33A 3G28A 2DOKA 5L3SA 4KXWA 1WV1A 1G6KA 5DTQA 4DUGD 3TUFA 4J2TA 1GT91 4G0NA 2M6SA 2BFMA 4DDTA 4K6OA 1ZAKA 3TWOA 5C9ZA 1EM6A 5I8WA 2WY2D 2NUAA 2CXXA 5HGLA 1GCOA 4WDQA 1HETA 1ZIYA 3ZH2A 1YZLA 3TLBA 2PBLA 4XGNA 1H6AA 1PJZA 4ENVA 1OV6A 3LVQE 1YDEA 1IQUA 2WTAA 3DT8A 1E69A 1PF7E 1RLMA 3WSVA 4Q7QA 1A9TA 1Z39A 4YT8A 1SBYA 2B4RO 3Q6IA 3ES9A 4GSYA 3KELA 3BSYA 1F12A 1O89A 4EPRA 2ZYSA 1NUAA 1FFGA 2WSSD 1PQPA 2C8LA 3OAAA 1YITP 3L84A 3I09A 1W2HA 1QIIA 5G3YA 3TG2A 3JARB 3L0CA 5DHRA 1XZMA 2YYYA 4LJYA 3KOOA 3CMEP 2XWPA 3KQOA 2H17A 4DV3B 4XGIA 1FFWA 3TG8A 5JI3E 4GE3A 4D5EA 2PQ0A 2X6TA 3VBCA 4HFNA 1IK4A 1GZUA 3TD9A 3KQTA 4QU0A 4X7PA 1USKA 3TQSA 4R31A 2IC5A 1DIAA 3I6YA 2VLNA 4RH0A 2WTBA 2Q7OE 2IFTA 4LGYA 2C9OA 4D9NA 3F6PA 3TNJA 2NSJA 4TVOA 10MHA 3DF7A 2EF1A 2VK1A 5JS2A 5LZ5A 4NH0A 4KHPB 4BGVA 1IJKA 3JRXA 4GXRA 3GUHA 4O2LA 3O0DA 1J0CA 1O97D 4JLSA 2PG3A 1BAJA 3QUQA 3A70A 2ADFA 4EG0A 3CE6A 3TTXA 1D2HA 3KR0A 3BXOA 3P2YA 5KWSA 4XCQA 3MXOA 3QMPA 1EXDA 1DJOA 4M60A 4JB3A 3S3TA 4O8CA 5HJ2A 3U3DA 4QE3A 2P8SA 2EG9A 2ZK7A 1M6VA 1E3WA 5FF9A 1GU1A 2WFLA 1O0SA 2VO1A 1GRRA 3JAWB 5D85A 2BMEA 1M1NA 3AKCA 5I9NA 4PINA 3VR4H 4M22A 2E5WA 4NG5A 4B3JA 2H3EA 1TYDE 1NM5C 4JBNA 5DW3A 5TEWA 1TU4A 1X7ZA 5IMSA 1TCCA 2HO4A 4HKGA 1ZYUA 2SKCA 4HZGA 1Y3IA 1BCSB 3ZVMA 1O77A 2Y99A 4QM6A 2P2LA 4J91A 1RPTA 3GB9A 4F7WA 2LRHA 2X23A 1G5PA 4AD8A 4MRAA 1KQ3A 4XWYA 5H70A 1UKEA 3R9XA 1G8GA 2ZREA 4ABTA 1HFEL 4FFOA 1NYEA 3IE0A 3CQ1A 1XCPA 1YDWA 2WW8A 2EL9A 4CIYA 4DUYB 1O96A 3FVWA 4DNOA 1XKQA 4FNMA 2JS7A 3MJTA 1D4ZA 5K0FA 3H17A 3WLQA 3R9IA 4O2RA 2P4QA 2JBAA 4G67A 3TOXA 3GUYA 2DGDA 4HC4A 1XZBA 1R0WA 4IFIA 2R9VA 3ZCVA 3QE0A 3ZE7A 3F5MA 3FIUA 1H4SA 3V33A 2OV8A 3IP6A 5CJ2A 2HXGA 1OSNA 4F38A 1CEQA 5F98A 4ZVLA 4XWAA 3SKXA 3BSFA 2KWIA 3AF1A 4JLMA 1IBLB 3MAGA 1L3IA 5BSVA 1YK0A 5JZMA 1TMKA 1UNKA 1BX1A 4DEYA 4LHVA 4MKIA 3RVNA 4TM7A 3D8BA 4NNJA 4WYMA 4Y2UA 1NXVA 1MABA 1S2GA 5HFNA 3HB9A 3VJMA 3EGDA 5HKBA 3OEHD 4HADA 4W9NC 4ZP1A 4FSXA 3I4CA 3NBAA 1TUBB 3I2KA 1PTJC 4IEIA 5IDXA 4MUYA 3IMKA 4QDTA 1U0RA 5J3JA 1X9IA 2FZCA 2I87A 1DAIA 1S2NA 4X91A 1KVTA 2ZI6A 1PS0A 1BWPA 2Y1DA 2HT1A 5LQKA 5K4AA 3ZZTA 5I7RA 4KC0A 1O9GA 4JWKA 3E7PA 3UA4A 2BF7A 4CU2A 4JGBA 3ZEAA 3IILA 1V16B 1XELA 3ESQA 1XZDA 4QFBA 3WRXA 3NHFA 5E8JA 4Y0VA 1G5HA 4GE0A 1XVIA 1VHWA 1B3RA 3C3BA 1TEZA 1X3SA 3SSMA 3QLEA 4GG1A 1D7AA 2WJZB 1GGKA 1VPEA 4OXIA 3CG4A 2OECA 4DBZA 4XFYA 2FEAA 2SICE 3WIEA 1SQ6A 1TAQA 1CBUA 4WZAB 4DQVA 2BP7A 2MINA 5AI8A 4MWZA 4ARCA 2NSLA 3OCZA 3E2MA 1Z5PA 3REFA 3CS3A 1UPUA 3WQSB 2ACVA 2JYGA 4ZCMA 3L8DA 4G5YA 1IN1A 4QJIA 1EIZA 4NXNB 3W77A 4RH1A 3OQBA 1NLUA 5AMXA 2ZWMA 4UTPA 2VNKA 1COZA 4HXGA 4UTXA 4G8DA 2GNOA 1ND6A 2Q6VA 2ZRPA 3BGIA 2DQYA 3GUZA 5GAJA 2AKEA 1V9LA 1IRXA 1Z22A 3DB1A 3HABA 1LF0A 4Q16A 4ERNA 3M1IA 3KQMA 5TQ2A 4KFSA 3BG5A 2FX3A 2QRZA 4YCDA 1XD8A 4G0YA 2IGBA 4A5OA 1S3GA 5KJ1A 2IBMA 1Q0QA 5EZYF 3EIUA 3O8OB 3TEJA 3C41J 2HIHA 2O7QA 3B1JA 3UJHA 2IYZA 3UAOA 3L7OA 4PO8A 4O25A 3JAKB 4IFBA 2MSWA 2Q1XA 4NU6A 1XVUA 4LQCA 4CMAA 3ZTTA 3I42A 2IEDA 2HMVA 1A8SA 5T8KC 3UT5B 3LYHA 3IDSA 1C7QA 2P5YA 3KB6A 2JDID 1O94C 4EYGA 4BAZA 1YL5A 1KC8Q 3ONWA 4B2LA 2Y4NA 1U0GA 3FKJA 3WLAA 1BOOA 1Q7BA 2C7PA 1MB9A 4LVUA 2WSMA 4NBWA 5JSQA 3FZGA 2NZVG 3VR5H 2X2FA 3KB8A 1VMDA 2QMYA 5DT9A 3VYRB 1XAJA 1RC0A 5EGNA 1P44A 2OT3B 3P9SA 2MR6A 3MHPA 1R0CA 4FTWA 3B70A 3LQQA 3BL8A 2JANA 3LWNA 4G2TA 2V7PA 1KYYA 5BVGB 3HRHA 3VR6D 4MW1A 2G9UA 1RW4A 3OZTA 1ZA1A 4MQUA 3OFKA 3ROZA 4CKWA 4R83A 2IYYA 5K8JB 3PPWA 5JAQA 3ZYZA 1UFVA 1FP4A 2OHFA 1K7CA 1S3SA 4TX1A 1A9PA 4P53A 1TLFA 2AE1A 4C4AA 3ZGOA 1HF3A 4BFWA 2PKWA 1GDTA 4PGFA 5JC1A 2P9HA 4DV0B 4X93A 2NVWA 4FQ7A 4KH0A 1XOIA 1W581 4HWTA 5FA8A 1NJGA 1UKAA 3MLAA 2V0NA 2Z44A 4AUMA 1Y7PA 2HU2A 1JKXA 1UK8A 4QO7A 1E6LA 4U5YD 1I9GA 3AYZB 3NTLA 3CSSA 2PEYA 3N8GA 1W44A 1YD7A 1S2IA 5M3BA 4EW1A 5E7JA 2XCSB 3E1SA 1Y9DA 1YB4A 1I2CA 3QVXA 4L3OA 3DYIA 4EHLA 4QEKA 2VLBA 4IWYA 4OBXA 2JK0A 4KYTA 3MMPA 4OQNA 1EUDA 4AP5A 2B94A 3TRJA 2AEMA 4HB2A 2Z5LA 4JR1A 1ACMA 2XCIA 2D7VA 5FEUA 1KOFA 1DC7A 2HC9A 2AFVA 2OHHA 2I2FA 2CVOA 2FW9A 3ZWVA 4ZI2A 4ON9A 1R5BA 2NVUA 5EVJA 1XL1A 5HQ3B 4CETA 3OKPA 2X5NA 1QF6A 3CVUA 2R65A 3RWBA 1SOMA 3LCMA 3RDPA 4MWBA 1EWVA 1L8LA 2LIVA 3QMWA 1P1KA 3VAYA 4HGZA 1NW5A 4YXWD 3BS4A 4H2DA 2HJ9A 4N39A 2QP4A 1PT9A 2G80A 4ID9A 3U19A 3Q72A 1CY7A 2XLCA 2M6LA 3NYIA 3NTQA 3BREA 3L0ZA 2CL5A 1SC6A 4X00A 1A5BB 4F4CA 3ETLA 3AR5A 3ZQ6A 1QBKC 2AOUA 1XKLA 2SCUB 4FEEA 1QIKA 3C5CA 4RPHA 2REXB 3OPYB 4Q4JB 4J94A 2A9QA 4TT3D 4PE5B 2VR1A 1SHJA 1CE8A 4I5DA 2B99A 2F55A 3BHMA 3BXHA 3PVCA 3ACBA 2IELA 3W4JA 3CKLA 3MT0A 1R4NA 2WJJA 2P75A 4K3UA 2A0UA 2CUKA 2J5XA 2YJGA 2Y9MB 3GH3A 4MW7A 4RTPA 1VG1A 1U9CA 5FPTA 4FONA 1LPSA 1NN5A 2FZGA 2A4MA 2XTJA 3FKSD 1A7JA 5BV2P 1DC6A 1WPQA 2OK7A 3JQGB 5HR5A 3U4QA 3BB1A 4BO4A 4X66C 4MMXB 4DG8A 1SG6A 3WYFA 5AM4A 2PA3A 1HNWC 4YT2A 1AC5A 3AHIA 2J6BA 2RBEA 3A9CA 4OJYA 4LFAC 3PXDA 4JBYA 2VPIA 1YQUA 2F67A 3B6MA 3OEYA 1IC6A 1NXTA 4B3FX 1JIKA 2G25A 2QX6A 3BMXA 1GG2A 1Z2DA 1ECBA 4TUYF 3WP0A 5BN1A 4K81B 2JIOA 3EIEA 4OBEA 8ATCA 3R3WA 4QGGA 2F7SA 2XQIA 4HVAA 1CWUA 1FX0A 4G81A 2XHEA 1KQGA 3HNPA 3FROA 4MVJP 4ZI7F 5FWXB 1JLMA 3EC1A 3LLMA 3VYTB 2ZSKA 3R4CA 4GVXA 2H7CA 4HLQB 1Z16A 2NYRA 3C3EA 2NUBA 3UTDA 2FAXA 1O3YA 3M6AA 2JGFA 4IEEA 4H7FA 4CBVA 4BLQA 2GN2A 4DDWA 4TXJA 2VP0A 1CJCA 4LF6C 5AVYA 3AR2A 1M5UA 4RVFA 3MTGA 4N9WA 1ZK0A 3WKAA 1E7WA 4TS3A 4B3DA 1NULA 4AP6A 1RMYA 5B7GA 5CGZA 4G1IA 2JO0A 4DANA 4RPIA 3ER9A 2PHZA 2R4TA 3R5XA 1E2UA 5B37A 4DHWA 3MCTA 1VQ5P 3E22B 4HDMA 3LZCA 1FYXA 1GFIA 3AT1A 1R12A 3V8NA 4E2WA 3R0VA 3GFOA 3OMXA 2J9GA 3TQFA 5K8CA 1DRKA 1LA2A 3O93A 2F59A 3IPCA 2RK3A 2NQ2C 2H4JA 3WBKA 2ODWA 3RT1A 1NRIA 3HB4X 4IRUB 1R15A 1SXJD 4KXMA 1QGED 3AB7A 2F2TA 2P1DA 3A3PA 4CIBA 3CEMA 2PGIA 1N3IA 4EY5A 4K1XA 1NVUQ 2AEJA 2D8MA 4AJLA 1IVSA 4NZOA 3CUKA 4QUAA 4HDKA 4NE9A 2A59A 4KDRA 5HMLA 1CT9A 2D2IA 4ZVMA 2FSGA 3KXPA 5J4HA 1M66A 2ILTA 5C5EA 4XD2A 3OJOA 4LDRA 2B8NA 2FKNA 4AMGA 1CPYA 4ACBA 2PZKA 4FFMA 1JVBA 4HFMA 4UEKA 1P6UA 2D1QA 2G1UA 2V54A 4BXOB 2AXPA 1JKJB 2O8DB 4JZKA 4QM7A 4BVHA 3CKMA 4Q01A 2XJ4A 4F2WA 3JQFA 3L7KA 1E0KA 4BO9A 3AEKB 4H1HA 4MS3A 1R8SA 2PKQO 4TL9A 1BWRA 4PRZA 4G5QA 3AI1A 5KO2A 4WESB 1GPBA 4ZOAA 2ZETA 2W6OA 2X0EA 1BXZA 2ZDQA 3RO7A 2P2SA 4NCAA 4QODA 5FOSA 4OUKX 1P4EC 4XGKA 1ZJ5A 4CCSA 4MWDA 1LI7A 4PLYA 3F49S 1YIOA 1WH9A 2M9MA 3FZNA 1L4HA 3PNLA 4U0CA 1F1BA 4WV3A 1ODKA 2XYVA 4P8RA 2V4UA 4KPEC 1JA9A 4HB3A 1DMRA 3FPSA 2VFAA 4PZ0A 4K6FA 1V8PA 4TV8A 2WAOA 3NJ8A 1FS4A 5A4IS 3L8HA 3I08A 3RFUA 5IT4A 3BGOS 4IOMA 1HK7A 4KN8A 1WLSA 4BE9A 3KX2A 1QV6A 3BBLA 2HRRA 5ALTA 4G09A 2C00A 2VZ0A 1NW4A 2Z3WA 1MJFA 3JASB 2A92A 3NT2A 7AT1A 1BQEA 1G21E 3UPDA 4YRZA 5F5XA 1DG1G 2V7WA 3TTUA 1HL3A 2W6PA 2H08A 4LY0A 4J1TA 5FULA 1MQ9A 1TOAA 4O4JF 4R40A 3EEYA 3C7CB 1H5NA 1XN4A 3U61B 1S9HA 3MS7A 3KAKA 4N5LA 4DG9A 2BFBB 3WHLA 4II3A 3QE2A 1S4MA 3FCUB 1T6YA 4QSMA 1WSAA 4UBIA 3DZKA 1II0A 1G9XA 2IX3A 3KUKA 5TMDA 1U1IA 2PKXA 1MNQA 4PEVA 3R6TA 2R7NA 3HB5X 3KTDA 4ZOLB 4HNSA 2O2ZA 1FQWA 3JPWA 3NTXA 4GP9A 4DCGA 1CTQA 1G21A 3ZXIA 2HW8A 1U90A 4KXFB 3ODPA 3CCJP 4KWHA 4D6XA 1YULA 4B45A 4DR3C 5CH3A 2GTHA 1COWA 3HTXA 4JOQA 2VRCD 3OOEA 3G8CA 2M8NA 4GUDA 4U0DA 3IV7A 1J20A 1GPMA 4LNHA 4BLOA 5K6AC 3IB3A 4Y2JA 3JD1A 3TZHA 3JAMD 4GBGA 3P9YA 1DKQA 2Z30A 4M83A 5JSZB 2CLFB 3PPYA 1DJMA 2OARA 4O5OA 3GROA 4PG5A 1T3TA 3I83A 4MV8A 1HUQA 4AYWA 1J0XO 3UMYA 4PZCA 2GZGA 1ZIPA 3NBXX 4E4TA 3S68A 1KC1A 4I0WB 2XIJA 1RQPA 4LFCB 2Y6VA 2ZITA 3FCAA 2EKBA 4CF4A 2VWPA 5FFMA 3GG9A 1KQOA 3K8OE 1R1DA 2O7SA 5HFJA 1AUOA 2PZGA 1LLDA 3IT3A 1ZD5A 1SVIA 2PUHA 4YJ2A 1MTOA 3GDOA 2ZE7A 2PSDA 1FNDA 1T24A 2PDAA 4NZNA 5CNMA 4B3GA 1E60A 2FLKA 4BVGA 4ITUA 2HCTA 3A1TA 4JR2A 4RQAA 1TYBE 1AXGA 5IWAB 1KEWA 4JVNA 4KK4A 3BXZA 2PL5A 5IABA 1SQGA 3T3PB 4HAVA 3VR3D 2C97A 3AHDA 4YMIA 1KVSA 2ILVA 4YWHA 2OORA 4PHCA 4XB6B 5D86A 1E3QA 3TB6A 3MIZA 3ZGVA 3ETGA 3HR7A 5K3OA 3THWA 3K5PA 3N8KA 2CBGA 2AFIA 4PH1A 4FB5A 4TKVA 3WK5A 4NF2A 4D8UA 4QPZA 4PLTA 1SHKA 4R9NA 1DCMA 2Y0BA 3UAZA 4G63A 3A4MA 1NW9B 4JHLA 4NBUA 1PZXA 1VQKP 2BFOA 3GNTA 4AICA 4R1PA 4LXXA 1YR1A 4BQNA 4DLUA 5LYJB 1NVEA 1ZZEA 4YV7A 2CNWD 4AT1A 1CQXA 2FN7A 1K0UA 2Z0MA 1P61B 4X1KB 1RJDA 5F3RA 2QUBA 2OBYA 3CZRA 4NP6A 4XZ3A 2QN7A 4Q93A 1NF2A 4CDNA 2FPGB 2JFZA 2PXXA 2QPAA 3EASA 2NW6A 1G8SA 2EHDA 2BEJA 4OIMA 2CT8A 4K6HA 3DLTA 4FN5A 3O84A 2GN4A 4IOJA 1DKUA 3FPGA 1XVVA 4UAGA 4XSGA 2OO3A 4WHMA 4BC9A 1ICIA 3JPYA 4JBXA 3LCJA 1HSOA 1I7QB 3N39C 1R9GA 4IO0A 2CZGA 3WLEA 5B4UA 1YR7A 2E7GA 4BFXA 1N57A 5ULLA 5ESWA 4S05A 1T8SA 3W1WA 4JJFA 5D5QA 3LFHA 5SYMA 1RYEA 3EE6A 4KFTA 5FPPA 1N0IA 4HLNA 4LVNA 2FJPA 2YMQA 3TSYA 3ZWKA 5JSKA 1E2HA 1SA0B 1JSXA 5IH7A 1ZEMA 4O1HA 4BLTA 1YUBA 2O1WA 2PUCA 2WWYA 4U39A 5JEEA 2H16A 1Y5IA 1BNCA 2J46A 1NDHA 2ZVQX 3W8EA 1HLDA 3NG1A 4GVPA 3CZQA 5ILQA 5EJ2A 2V3VA 1VQPP 1BXGB 4ODJA 2JL1A 3E7FA 5AHRA 4UC0A 4KITB 4MV1A 2O54A 1LPOA 1SJ9A 4CPDA 1QWIA 3QEAZ 1W0KA 1G17A 3A7DA 1XHEA 5I5GA 4L78A 1W85B 4LJ5A 4G5FA 2CHFA 4X64B 2MM9A 3LGXA 4MPDA 3BMQB 1VSTA 4BVFA 4GYKA 5CXUA 4WOBA 1CUYA 4R1OA 3OD1A 3H5TA 3VR0A 1LK5A 3O5AA 3G49A 1A96A 2AN3A 2OM6A 3OZ7A 3KQKA 1V37A 4C4ZA 3W6PA 1USPA 2ZEJA 5GVRA 4FOTA 5T4HA 2FG5A 4EVIA 3L41A 3HKBB 9ATCA 1QLWA 1DHTA 5IC6A 4DAEA 1YACA 2D2EA 2F1OA 4XOIA 3OJLA 1TTPB 2PMFA 4QUGA 3H19A 4NJOA 3D7KA 3CW9A 3V6MA 5EZ5A 3VX4A 4XPIB 4EB6A 5B7QA 3DOFA 3MW8A 3R7SA 3GF4A 2L18A 4J6EA 1ETUA 3TLKA 4P7JA 3FKQA 4TZKA 2HDHA 4U2DA 4MVJI 4CMEC 4YUZA 2Z1NA 2O48X 2V1XA 1HURA 4TTTS 2REBA 4D5GA 2ZRBA 1XK7A 3I73A 4N0DA 5BORA 4ODIA 2Q1UA 4QYMA 3VSAA 4JYPA 1HDXA 3Q20A 1S2DA 1TW2A 3C3YA 1CZOA 2GWHA 3GIDA 1QKJA 1QIGA 1D07A 4BO7A 1J2YA 5DYTA 2QE7D 1KE2A 2QMUA 3OQHA 2R97A 3RU7A 2XUJA 3G89A 3EMKA 1NVXQ 4R1LA 5GOZA 2P2DA 4MCJA 1I1OA 1C4OA 2R6GA 2ZROA 3NORA 3DEIA 1CDOA 1E99A 2Y1KA 4R8KA 2XQFA 5AE3A 5CDTA 4L4ZA 8OHMA 3SR3A 1SIOA 3FE2A 3TS1A 1F2DA 1U7UA 4QD3A 4LHZA 4P34A 4FFNA 1WZNA 1DKPA 3H13A 4YXFA 4DPKA 3K5HA 3KZVA 2C7GA 1OUMA 3Q6NA 1GNSA 1C8KA 4WXRA 2IS4A 2B78A 1FSFA 1X87A 2BKXA 1Y6JA 3VGJA 2XUPA 4F71A 2QLBA 3IOBA 4Z3DA 3OD5A 3ONNA 3D2BA 4KX3A 1RRFA 4DIUA 5M2QA 2IK8A 3KALA 1WSDA 2P9BA 1VPTA 2VK8A 3EXIA 1P2UA 5AVOA 4BZQA 4C22A 2R8BA 1N4AA 5DTEA 2C92A 3TLZA 2AMLA 3RRYA 5JWOA 2ZJ0A 4AURA 1DX6A 4PX3A 1X7YA 1Y82A 2FVFA 4Q1BA 4A6EA 2HDWA 3FYDA 1A2BA 3N2ZB 1GEGA 5LJLA 1Z38A 3R41A 2IHNA 3E23A 1O8CA 4KQFA 4YX9A 1WZEA 3QPVA 4RK7A 3EBPA 3TPCA 3TPZA 1GZSA 1NQOA 3G9QA 5ABPA 5GV8A 3LCVB 2OCLA 3PX2A 2H8GA 1B0AA 4Z0HO 2MJLA 2XEDA 1G41A 1OFIA 2GETA 2JCXA 2HDOA 5LIPA 1UM8A 4LI0A 1SKYE 3D54D 2CJXA 4PX2A 2FW8A 3RGWS 4EQ6A 4RAQA 4PYMA 2FQQA 3CCQP 3EGVA 1PZHA 5DX1A 2WA1A 4HN9A 4ZDKA 3MILA 4I6JA 1EE2A 3RU9A 1SKBA 4OXRA 3IAFA 4Q48A 1Q1QA 4P33A 4XIGS 1WZ2A 2MD9A 1KOJA 1BWQA 3E6AA 1NXWA 2WG2A 3RIMA 1TX4B 5JD4A 3UJ7A 2ZSAA 4BCDA 3WKCA 4W82A 2VWHA 4Q9AA 2XBLA 5C1OA 2W6CX 5F5NA 1CUGA 1GQFA 1IXKA 2Y67A 1UK7A 3WGJA 4N3BA 3Q9UA 3MJDA 2XLBA 1N77A 3GHYA 4YI5A 2EW1A 1ZUD1 2HO5A 4CFSA 2ZIEA 5JLAA 2DULA 2AUTA 3OTOB 1FIUA 4J1QA 1DQZA 1KYIA 4YJ2F 5IUKC 3OETA 2OVBA 4IMRA 4X20A 4CFYA 1XZFA 1M6WA 3PDUA 2Q7XA 2Q2NA 3IO5A 4V3BA 4DF3A 4RJJA 4H16A 3KK0A 4M87A 4W6ZA 2WUVA 5L8VA 4F2GA 5F3WB 4RQBA 4INPA 3KDAA 2FHSC 2ZM6C 4P08A 5HMMA 4PNHA 3C98A 4J90A 3URMA 1M54A 1R4ZA 2GCOA 2OV2A 4X8MA 5JMOA 4UCFA 3H4MA 5BSHA 1YRAA 2ZR8A 2D0IA 3WBJA 3D4NA 3B36A 3HJFA 1F48A 1Q3HA 4DPLA 3K53A 3BJIC 2XV6A 2LF4A 1G8HA 2C5GA 2DHCA 4PX5A 4KQ1A 4EJSB 3A6FA 1DX4A 1N0UA 3MOSA 1OC4A 4NOMA 4L75A 3ZJYA 1UAGA 2XZPA 3BHIA 5LBIA 2J48A 3HZOA 1I30A 3NBYC 4Q9DA 3QG1A 2H6EA 4IX1A 1TUGA 1X80B 3TJMA 1WS6A 2ZAOA 5TF4A 3GT7A 3U4GA 4UZFA 4AX8A 1TLLA 4RDCA 1PW5A 4MYRA 4BEWA 4GMDA 1P5RA 2HU8A 2EW8A 1YJNP 5AJYA 1IEXA 2MDTA 3PI6A 1V43A 1JKFA 2PEZA 1WOMA 3PR1A 2IXGA 1CY2A 3ELWA 3UMSA 1BKDR 5H1YA 4U7TB 3EERA 2EX4A 5DN6D 3U0VA 3P2MA 2VQFC 3O3MB 5DM0A 4RFSA 5BNZA 1J21A 3TLAA 4ROTA 4ZARA 5EUQB 2YWDA 2JLWA 4M8SA 1GD1O 2WAMA 3V7FA 4IIBA 2G40A 5MFZA 5CDSA 4FSDA 2V7VA 4N3GA 5F78A 3EJ6A 3I6IA 5HUJA 1QFYA 3RVOA 2QG9A 1W34A 3VU0A 3THYB 4YH1A 3IUEA 1T9DA 2Z95A 1L5YA 4OQMA 4RK0A 3H8WA 2QORA 3SI7A 4ND5A 5KINB 2P90A 3RSSA 1M9NA 3X1KA 4BV9A 2Z98A 4HX5A 4UUMA 2GZ2A 1ISSA 4RNCA 3TQCA 3CF4G 1XPOA 1SBIA 5C53B 2K4MA 4JNKA 5TS2A 3EJWA 3C6KA 4FYWA 3BTVA 1BKSB 2YNMC 4R8RA 2ESRA 5LQUA 4DQXA 3T5MA 2CQ8A 1F6BA 1E3TA 4J03A 1Z2PX 4OX9Y 3BFXA 3DE0X 3AEXA 4YEDA 2AEFA 4HGRA 3WDKA 4U0JA 4QHTA 2VJAA 3IMFA 3RRZA 5LB4A 2F8MA 1FW8A 4O2BA 2FFAA 4S3MA 1UPFA 2X4LA 4ZVVA 3D7LA 1HRDA 4OXYA 4BV2A 4LJKA 3GQBA 2W8BA 2JIZA 1EBFA 4GVLA 2P3QA 4AF7A 2YN0A 3PHIA 1Z73A 4QTUB 1OWMA 3D1LA 3QY0A 4HJXA 5I7OA 3D43A 4WXMA 2NO8A 2IS6A 2JIDA 2KGAA 5FQOA 2YV3A 4CMIA 1Y6QA 3GRCA 2GEFA 1HDYA 3H2KA 1KSJA 3VRLC 2ZS8A 1KKMA 4J0IA 3M3DA 2QU8A 3LK7A 3HJCA 1WDTA 2NACA 3OOWA 1P0MA 2QHXA 5AUNB 3ROKA 5KYUB 1NONA 1GQOA 3IEIA 1CJTC 3EXHA 1MDBA 5EJ4A 2WMYA 2X9LA 5JXHA 1CV2A 3BB4A 2PEIA 2VQDA 5FJIA 1YMUA 3F6RA 3LL7A 2IS1A 3V34A 5EHZA 3LY5A 2MSEB 1P7ZA 3HKEB 1WQ1R 4PLWA 2DLCX 3M5WA 2XD4A 1JR4A 1KIAA 2E85A 1BU8A 1NQVA 3FLEA 2NU6B 2O1SA 2ZYIA 2JIBA 3SR4A 4YUVA 1A2OA 1PP4A 4LEIA 3TNDA 4BNVA 1QGDA 4D26A 5C34B 1TJNA 4QRHA 1O5IA 4EABA 5AW4A 2YMMA 3HUEA 1CUIA 1OHHD 1G0OA 2GCNA 2XA2A 2D1RA 2JW5A 1YZFA 2G76A 3VC1A 3KJZA 2FDXA 3AKYA 5G2OA 2QUKA 2X5OA 1DXHA 1PJ2A 4X7RA 2XAAA 1QV7A 3ZTYA 2RB4A 4UUAA 3T3IA 3LLSA 4MS1B 2ZYTX 2XE7A 3LC7O 1HDRA 2JI7A 2C59A 2DECA 2YRWA 5IBCA 1XVLA 5DCYA 1LDEA 2ZWIA 5A02A 4UU8A 3DAPA 5M5BA 4CGZA 4YCCA 3TTTA 2NSHA 1E3JA 4JB0A 5BR7A 4IOLA 1KJJA 5AKLA 3LP5A 3K7EA 4HRVA 1SQFA 3RRMA 5L40A 3B7PA 3H1TA 1HT1E 5BQXA 1TU3A 4J29A 3NPMA 3ZDYB 1OCEA 1VCHA 2E55A 3ETNA 1Y89A 2P7HA 1Q0SA 1U6IA 4N0QA 1I33A 1XFDA 4H7PA 2YOFA 6ABPA 2PUDA 1NRJB 1J6UA 4R81A 1M8KA 1WBJB 3IIMA 1Y5MA 1H2RS 4XLTA 2PLNA 5JQGA 3JZDA 1J0BA 1EHCA 4E4RA 4UD6A 5HF8A 4D0NA 4C0SA 1UJCA 3W1EA 5F2KA 4TUYA 4HH4A 3PHJA 4J2HA 4B3IA 1KR2A 4V0MA 1HLFA 2A78A 1Z8DA 4WFKA 3TKYA 3QKTA 1NQUA 1VFPA 3DV0B 3M33A 1Y1RA 4ZI7A 3RFXA 3F2IA 5K3DA 3MXTA 4KREA 4LY6A 4AO7A 1HEYA 1Q7CA 3HYTA 4X1IA 2VJMA 5BSUA 1K8XB 1UOQA 3KZMA 5C5CA 2MSCB 4RY0A 3TTYA 3AFNA 1KH3A 4NX2A 3ZC3A 3SX4A 4O4LA 4AMZA 4B3SB 3Q8MA 2CNRA 5A2QA 2JHGA 3T7EA 2BUAA 2VAPA 2C7OA 4LAFA 3WR5A 4CIAA 4OK5A 3ZZ1A 1DELA 2JK1A 5DTRA 4HPVA 3BK2A 2IIPA 3OCUA 4CU5A 3CRNA 2R8EA 5JAPA 3BFJA 1XVTA 3D4PA 4M1YA 2VWGA 2MY5A 4RFLA 4GPAA 5JJIA 1H3NA 5E7MA 3VOSA 3ZKWB 1G18A 3PIRA 1EU1A 3GUCA 1N8TA 4KQEA 1L5VA 3ZOKA 3X0DA 4U2EA 2WYVA 3NWPA 1DFHA 4DLXA 5IZCA 1SBHA 1JV2B 1M2JA 2QNIA 2IOYA 2N46A 2CUNA 1YE3A 1RFGE 5JSHA 4B4OA 5JNLA 4OLAA 4EW3A 1H0HA 4B6PA 5H3HA 3P2JA 1ZOOA 1C3LA 4RVSA 4GMHA 1B16A 4YROA 2UXDC 1OFUA 1GPJA 2CCJA 3T06B 4Q4DA 1M0EA 1OXTA 4B6OA 3LRTA 2IV3A 2VOJA 3QWHA 4JUDX 1UOPA 3OTGA 3CUUA 5JC8A 3CTPA 3KKPA 2WAXA 3ONFA 1P4RA 4KWEA 5TMPA 3VR6H 1QK4A 4DDVA 2NPOA 3DV9A 3V1MA 2C83A 4BO3A 1LGYA 2IVZA 3WIOA 3GFQA 3I1JA 2KYRA 4QUEA 1L7DA 4L5YA 3L02A 5JLJA 3J81k 4QYTA 2PGOA 4M1SA 1VJ0A 4QBTA 1IY0A 1U1FA 1B2LA 1QMPA 4GNKA 3VJLA 1Z5WA 1WEHA 4WMLA 4ESHA 1H6CA 3F67A 3ZGLA 1XRPA 2GZDA 2GA9A 1UOOA 1UBNA 1AQJA 2Q2WA 4LPSA 1U0FA 4YQEA 4EA7A 4BCAA 1GGJA 4I1RA 3OCVA 1GAXA 3I9V1 2C98A 4HVTA 3VDXA 1GUFA 3N7AA 2OD9A 3DBLA 1A4XA 3QFRA 2CJWB 4XW2A 1XC7A 2QKYA 3Q3CA 2R44A 3P2IA 1CIVA 4CM8A 2VN8A 3EZ2A 2AB0A 2QRMA 5F64A 3ZGYA 4M8LA 1DE0A 2Q7DA 2JI8A 2F1RA 1RQRA 5B1IA 4XWOA 4F06A 2A3NA 2YHIA 1TGVA 1BMFA 1TYCA 1F6WA 5BUCA 3UIEA 4GOOD 1RWQA 4HG2A 3WV5A 3TW6A 1Z4KA 4G86A 1NJIQ 1L7MA 1JHXA 4MV3A 4CTJA 3WJ1A 4OTZA 3W5VA 2OFXA 1CF2O 2IH2A 3FOBA 1VIAA 4LI3X 4E0BA 1XN1A 5T7BA 3AX6A 2P6RA 4AG3A 1U9ZA 3HJBA 4FQ5A 1OLSA 1VZ3A 1EFPA 2L82A 4U7FA 2GJSA 5HSGA 3KXLA 3I28A 1ZUIA 1ZCZA 3PX7A 4UFOA 4TTQA 1N34B 4EY6A 4O4JA 1EG7A 4GKKB 3O4VA 4R1NA 1BX0A 3I2IA 1WHTA 3A6ZA 1W88A 1QYXA 1NW7A 2VBIA 5DJ5A 5FLXA 1K86A 4OU5A 3EGXA 4D9GA 1NNSA 1JUDA 2PCJA 1R6BX 3VSDA 3EFOA 4W1QA 1ZIXA 1T3LA 4O2BF 4IJQA 3FOZA 7ABPA 3FFTA 1V11A 3PFKA 1XQ9A 5F33A 2Z2YA 5DHTA 2IPXA 3TLGB 1F38A 2FW0A 2ZRHA 3PQDA 2RHRA 1DS6A 3FAKA 1OWPA 4LDPA 4MQ5A 4LJAA 2YYSA 1A7KA 4LGCA 1NNEA 3C7TA 4GZ3A 1KJWA 1FCJA 4M8IA 3NC4A 3MPUA 5KMGB 3DL0A 4F37A 1D4AA 4KE9A 4V0LA 4A16A 1EA7A 1O93A 2FE4A 1IY2A 3L06A 1YHNA 1FDTA 1YA4A 1L5MA 2I1VB 4ZAFA 5KYYB 1K0FA 3EY4A 2CD7A 1V0JA 1J4AA 1JFLA 4BAUA 1DSSG 2WQZA 2PZLA 4AMBA 4YLYA 5EERA 4ZODA 4Q1DA 5AW9A 4AZ3B 4N48A 1FFDA 2AN5A 4LE1A 1HT2E 2WOJA 4TLEA 1W96A 1PA4A 4GEGA 2X77A 2KLHA 1PJAA 4YK7A 1V35A 3K9FC 3MTQA 2P2JA 1O6ZA 1K8YB 5AKGA 4PC2A 2WHRA 4AKGA 1R7RA 2BFCA 2PX6A 2O8VA 2OFFA 2E6UX 4I2NA 4IQ4A 3G6KA 1FTWA 3UEBA 1PR6A 1R0XA 4FMCF 2HMUA 3FA2A 3SC6A 4R2WA 1WUHS 4CQMA 1T2CA 3MMNA 5KNCD 2IQ5A 1I94B 1WZCA 2ACWA 4BB5A 1RYHA 2P02A 3AOEA 1ZK3A 3BMNB 5IVPA 4NFLA 1QB8A 3EYWA 5DZSA 2F9FA 1GFSA 3UHJA 2C20A 4PAGA 1WMFA 3OZUA 1R6AA 4EA8A 3M3HA 1K5PA 3QEMA 3JYHA 5F2EA 1I1QB 4OK3A 5CVTA 4IF4A 4U00A 1ZJ6A 4D9HA 3DB2A 3VZDA 5U4XA 2ZB2A 1DMSA 3LSYA 2XYQA 3VHXB 5KCZA 5THKA 1DAHA 2DPMA 3ZHCA 5FIUA 2WILA 1Y8QA 3KLOA 3CLTD 3V42A 3F3SA 4PYJA 1SVWA 4NBRA 5J5CA 3UPUA 1VL0A 4MQFB 3AESB 1UJNA 5C1PA 2J59A 1Y8AA 2D1YA 1NF8A 1ISGA 2VSNA 1PD0A 3FPJA 2F8LA 4LTMA 2ZRMA 3FETA 3WLMA 5EHNA 1DGQA 1E0DA 3TIFA 2WHPA 1ZBQA 2JHPA 2PFGA 4UM9D 4DR1C 4MP3A 2FEMA 5AK0A 3DEHA 8LDHA 2FLWA 5JH7B 3K1TA 3H6GA 2EU8A 3Q40A 4D46A 3UB3A 3VPAA 2QENA 1Q11A 5L45A 2YW2A 4TYQA 1NBHA 1VG8A 4U5QA 3OG9A 4MWGA 5DWQA 4BYGA 5JQGF 5J5AA 4KX5A 4QQKA 2GVNA 1AIPA 3PEEA 2HHLA 1PS8A 1R37A 3TLMA 2A9VA 4QHSA 4HAUA 1YFZA 3PQ2A 1O87A 1P7CA 3ZTWA 4XFDA 5AVJA 4TWZA 1PU1A 4EGQA 2XWBF 3IBSA 1SU8A 1ECLA 2HZ7A 4UCQA 4O63O 1CUFA 5IAKA 1N32C 3H3XA 2MTBA 3O1JC 2OGSA 3WYCA 4GC5A 1QZUA 2PZEA 3QHAA 2HYIC 2BM8A 3FBWA 3L93A 1GXSA 3G6WA 5JCJD 2GRAA 4O4LF 5KYXA 1EMVA 1LQTA 5LP6B 1JAZA 1N36C 4RD0A 2BHVA 4PPFA 3F5SA 4RTMA 1DBVO 3QHPA 3F3KA 3NWBA 3RYCB 3FW1A 3P97A 3ZHSA 1ATZA 1GA6A 3PDIA 4CM3A 2A9RA 3ETEA 4XI9A 3MGGA 3SKYA 1AMNA 2QM0A 4B31A 5AWFC 3R3VA 4GWGA 4CKZA 1Q0RA 4KH1A 4U2CA 4KO4S 4U02A 1EZ1A 4U6QA 4P3PA 1RQ2A 2ZSFA 4KGXA 4ZREA 4KMRA 4WKPA 4OCZA 3GPCA 5TGZA 4HB4A 5GJVC 3O91A 2Z2XA 2A0XA 2IZZA 3PQ8A 2FSVA 1C3OB 1ZG3A 2QVBA 2HU7A 1G6Q1 1PZFA 1LPMA 1QX3A 3K4HA 4B87A 3VVCA 4ZMRA 2OAEA 4KIJA 4YMTA 3OEEA 4JI0C 3G2LA 2D7CA 1EH5A 3SQLA 4YCSA 4Y2QA 4CM4B 1V1RB 4UEJA 3UJPA 3V1TC 3K8ZA 1N1MA 4XLZA 3DQZA 3I2JA 1KP3A 4LCBA 2XZTA 5A7HA 3SHWA 5LC1A 1J2TA 3C3JA 3BH7A 1XA4A 2FETA 4NU8X 2OZPA 3TSZA 1R2QA 3FVVA 1ZL0A 1VQOP 1S8AA 1XE3A 3PYLA 1IN7A 3DDCA 5GONA 3Q11A 4HAZA 5AJUA 4L7QA 1P6XA 3W05A 1GR0A 4Q3NA 2C2YA 3SMVA 2WM9B 3WRXC 3PJRA 4IP0A 4ZMSA 3MFYA 2ZB8A 1ZMXA 5BN3B 2H0QA 4XUEA 4CM1A 3RS9A 2NPFA 2G0AA 3BILA 3OMWA 2JFXA 5EHXA 1X77A 4PGMA 2HLDD 4HEA1 3RR2A 3LUBA 3K1AB 2GLXA 4RCZA 2V6JA 5IVHA 4BC7A 2REQB 5K0GA 2AUNA 3EJDA 1D1SA 2BGRA 1DT5A 5A4DA 3Q12A 4NABA 1I4TD 5SZHB 1J0EA 3NETA 4V3CA 3H7AA 2LMLA 3P9PA 4HXEB 2HA5A 4D41A 4MDYA 2HBYA 3GLIA 5KCMA 2AXEA 2GILA 2QYSA 3LSTA 3Q1LA 5D3KA 4O4HB 2CNKA 3UX2A 2ZUUA 1F20A 1XRCA 5TLSA 4WLOA 4NPAA 4JX8A 3TLYA 1SKUA 3QVWA 3D6AA 4OLJA 2D5BA 4AUNA 4G85A 3R6WA 1P19A 5FYQA 4IVRA 4CN8A 5G0SA 4EG6A 4M1MA 3OT5A 3P0IA 5CEEA 4B8WA 5TB5A 5AJTA 3SU8A 4RELA 1T5BA 2W2NA 1GFWA 2BDUA 5EQDA 5DN9A 3RQSA 4KBGA 1UR5A 4WZBB 3GFVA 4LRUA 2JI4A 1GSOA 2FOXA 2WT9A 2QLMA 1FFBA 4RY2A 2MMGA 3A06A 4QVKA 2E7ZA 5A0TA 2BSXA 5FD8A 3IALA 3TL2A 1AKNA 3L7YA 4IDHA 5K9ZA 2AZTA 2HRQA 4BVBA 4DCSA 2HHCA 3WMFA 2X6QA 5DLYA 4F4DA 3REQB 2HTFA 2Y0PA 1E2QA 2HZBA 3DTVA 3O3CA 4DHEA 3KYJB 1QHHB 4COCA 1N2HA 3NP7A 4LF6B 2GZ3A 3GDFA 4WS9A 4POAA 2B5WA 4KRXA 5KX5B 2C1XA 2WZQA 3TQRA 1T36B 2F1JA 1YI1A 1Q20A 3CEPB 4D4HA 2IOFA 1LVHA 4KFRA 3OQVA 3ZK9A 4NBLA 5EN4A 1A1SA 1TA9A 1XGKA 3DE1X 2AZMA 1YONA 1IM2A 2YMLA 2C29D 1CP2A 2QQ0A 3RLIA 1DAKA 1T1GA 2HQBA 3ZY2A 1P2GA 4QYIB 1KNXA 4MINA 2R84A 7YASA 1AMOA 2UVDA 3GLGA 1B14A 1SCUB 2VDVE 3PX3A 1KZ9A 1X94A 4NYIR 4BWYA 3AHEA 3I9JA 1GRCA 3AB3A 3Q8WA 2C9MA 4H60A 1SXPA 3FOEC 5U1PA 2GK3A 1JFFB 2I2XB 2RC6A 4YA6A 2H2AA 3TGWA 5JADA 2UUOA 2BZSA 1V60A 2AFIE 2EP7A 2ZI7A 3ZJTA 1VEHA 2D2VA 1D9ZA 4DTIA 4PVDA 2XYRA 3WYBA 3CUYA 2XNSA 1Z4JA 1NVVR 1FFXA 3O2NA 1U0EA 3EPKA 1XTRA 4PHFA 3OF5A 3JQAB 1E7RA 3E3OA 2PT7G 2GKSA 4MHTA 1RYNA 2QQEA 4K9RA 1S8NA 1LD3A 5EEHA 4L5AA 3E9ZA 4DWVA 1CIPA 1YC5A 1U3GA 1HTTA 1RZRD 5TXGA 1UZLA 1YU9A 1HM5A 2X41A 2P0YA 1RXUA 1K7YA 1RJFA 1YXMA 1HWYA 5J2UB 2FN9A 5EVCA 3EVAA 4I6GA 2VJBA 2GZMA 3O03A 5I01A 4GR9A 1V1MB 2K92A 3PTZA 1QCYA 3T1YC 3QYAA 2EBHX 3HVUA 3NHMA 4WZ6A 3HM2A 4I4TF 1XEXA 1AGPA 2WIJA 4HDNB 4X7MA 1K1EA 1MP0A 3HWSA 1ZGAA 5ECGC 2NTEA 1VRCA 4MKZA 3F98A 1SIBE 1ULZA 4Q6WA 4BMYA 3WO1A 3QVLA 1AZLA 2HPHA 4PS1A 3N2QA 2PH1A 3KFVA 4CGYA 3PFNA 4NZPA 4KG7A 4CLXA 5LUAA 3K0CC 2XGMA 4M21A 2VSFA 2ETVA 2EJTA 5ALGA 3W8FA 2W11A 3B53X 2G0TA 1OYOA 2OD2A 2YWGA 1IXSB 1T0JB 4M1WA 4U0KA 5FBKA 1Y6RA 4HYYA 3HRIA 4JP5A 3CCFA 4O1IA 1Z2CA 3E05A 1KEKA 2N9UA 1MB0A 5A7FA 2NUTB 3B20A 2A5DA 4L76A 5T8SA 1GZVA 421PA 4EITA 1EFCA 2CB0A 2HLPA 1CQZA 4P31A 3CUWA 2VDOB 3AIMA 4DARA 5CURA 5ALZA 2JRLA 1Z08A 1ZMTA 2NTYC 5DHUA 4M0PA 3N1UA 1L7QA 1IONA 3M5CA 3STVA 1W2WB 3BKWA 4Q12A 5CYOA 3AY7A 4ZYXA 4L6CA 1D2CA 3RREA 3BD8A 2DH6A 4DRZA 2XGJA 2E4WA 3FCOA 1XZIA 2ZANA 1RQNA 4BNIA 2H52A 1QYRA 1D1TA 1NX6A 4HGOA 2CLIB 5IT9A 1XK6A 4DR7C 2DUWA 4V0RA 2WV7A 3DVSX 3CSDA 5CZVA 4HAOA 1ATIA 4YR7A 4NAVA 1SEVA 5ECDA 3COYA 1J90A 3DHVA 4P5PA 2XTZA 5KSYA 1Z5NA 2RSLA 3D6HA 1RM4A 2W2VA 3LGAA 3MCUA 3P1JA 1E9VA 3RHFA 3LDGA 1Z0FA 2O14A 3IL2A 4RS4A 2IVFA 2P9XA 2YBEA 3EBLA 5EJ6A 1BXKA 3QX9A 5ALFA 3HVKA 3GEPA 1M2VA 3O8DA 2JAHA 4MKRA 3WA6A 5BOSB 4MVJD 3ONVA 3EZ7A 4F85A 2ODTX 2G1KA 3L01A 2PD6A 2AD1A 3TI7A 4S12A 1PFGA 3AFIA 2WLTA 3ON5A 1QSGA 4QPNA 1YZVA 2NT4A 2FHPA 3C6MA 1SBTA 5LLDA 3L1IA 4FCVA 2M8LA 2XQKA 4FHCA 4ZTUB 1XTVA 4D8WA 5CB4B 3FOCA 3NFYA 3HGQA 4D3FA 4XAQA 4FLFA 2YWEA 2GDJA 3ZZNA 1Q0ZA 3RBAA 5GONF 3BWBA 1ODIA 1HORA 1K2VN 4CKBB 2H57A 4R4JA 4WOKA 3KLNA 4V39A 1R4MB 2PO5A 1E4EB 1PLLA 5KTRA 2J6HA 1QAMA 1P6QA 4X3OA 1F4PA 1FMTA 2X8JB 5AM2A 3NKVA 4C0HA 4LZNA 2DYKA 4YMSA 1HOXA 3GDHA 3GAAA 3ZQJA 3VMMA 1IJBA 3ZNNA 3JQFC 4Z51A 1PI3A 1JHQA 2JEYA 4P4LA 1XQYA 3DA8A 4DMFA 1W0JA 5GPBA 5H4GA 3GARA 4CKCA 3CLRC 3N0WA 2PSFA 3R3YA 1JOSA 3J81A 1ZGZA 1JPNA 3EPJA 1M2WA 3DVAA 3R24A 1T2EA 4AJPA 2OPLB 5KI6A 3G71P 3HY3A 1SU7A 3PFFA 5KUTA 2B2NA 4UTNA 4FZRA 4Q6BA 2XKBA 4AS3A 2CK3A 5KIAA 1F2TB 1OQAA 2IHTA 4BKRA 2R8XA 1WBDA 4CL0A 1D6NA 3ZWQA 1E9SA 4DMUB 3Q9NA 3WWYA 1EGHA 1J0AA 3I45A 1MH1A 2OEPA 4V0QA 1RZ3A 5JJCA 1T4BA 2I1LA 4JI5B 4KCGA 3DGFC 4L3VA 3ZIAA 3V1LA 2XT6A 2X0DA 4IXDA 5A1IA 2PXHA 1EP1B 3RWOA 2FUG1 1U99A 1I5RA 5KKNB 4RV4A 2XQVA 2GKOA 3IVRA 3DNPA 1ZINA 1KDTA 5GTDA 5CDFA 3R3UA 1A8IA 1T6NA 3AV0B 2XYPA 5BWBA 4EVQA 3V7YA 2YHBA 1N9GA 3B6IA 2HWKA 4Y9SA 3GEDA 1JQEA 3GJQA 2C5HA 1E1CB 2PS3A 3CQ3A 3H75A 4HNAB 1FJHA 3DTJA 1PZGA 4XLLA 3FCCA 2AVNA 3MAJA 3PJGA 1FFSA 4LDAA 1IY1A 2O8FA 2WU4A 4DLAA 2W2OA 4X1OA 3GLFA 2QE6A 2FP3A 4I46A 3QJ5A 5KQPA 1QIMA 1RPZA 3KETA 3VQTA 2P2GA 2QM7A 4MDHA 5FTNA 5I9BA 2YDYA 5L7TA 3I0NA 4G26A 3N0RA 4Y6RA 1P29A 4B8YA 3Q5DA 1LH0A 2IY9A 2R751 2IYWA 2FFQA 2JH3A 1YAHA 3KAJA 4H6PA 2X40A 2XF2A 2DP4E 2WZDA 2HMAA 2BN4A 3URKA 4XRQA 4H4CA 1X9GA 1PWHA 3WG9A 2BAGA 2GJKA 2DR3A 3CPEA 3I05A 3TKLA 3B7WA 1SVLA 1XLUA 4JX9A 2FJUA 1N1EA 2GYWA 1W5FA 1C8VB 4NECA 3MFQA 1LDYA 5LWQA 5I6DA 4DQLA 1X7WA 4W1PA 1HDOA 4DJFC 1VB5A 1KZ4A 4JJ6A 5E1OA 2RDMA 3ABSB 3TR5A 3T1VA 4B4DA 1ZW1A 1N2SA 3H1EA 3M70A 4IQ0A 2FWAA 3BE5A 1TDJA 1E7QA 2WWFA 2B69A 4U9UA 1X9HA 1UM9A 3KPYA 1CHDA 3BF8A 4BNZA 5D01A 2HF8A 5JVDB 1Q6YA 5TSDA 4F45A 3AWDA 4DRXA 5DE3A 5IFIA 5NULA 1RCFA 2G17A 1M1XB 3LOUA 1I4WA 3PVSA 3UH0A 5GIPE 1LI5A 3C8DA 2QI9C 4X6YA 3TAXA 3OZFA 4GUAA 2OSBA 2K7ZA 3BA1A 4RZXA 3H99A 4BWVA 4RXMA 4JHXA 3FTFA 3VZCA 3RTGA 2PH7A 2ZDGA 3RUCA 4NMLA 5EJFA 1XF1A 3SAJA 2OHXA 2IA5A 2MVVA 2FVEA 1BH2A 2HQRA 4C6TA 1MXCA 121PA 2OORC 1LK7A 3CMCO 1D2NA 1HE4A 4DLRA 2IEAA 4LOAA 3WMGA 2HSEA 4XTRA 1KSFX 4H27A 3LIPA 2SECE 5JW6A 1DXOA 1WMAA 1AXEA 4Z4CA 5CHEA 2J9XB 5B64A 1CY1A 1V45E 3WMWA 4MVCA 1IM5A 2QMEA 1HE3A 2ZUEA 4AN4A 2X4GA 3GMIA 3VJKA 4OY3A 4KNVA 1K66A 3BFPA 1JECA 1EAMA 3HGMA 3NXKA 2OCYC 2IYVA 1SPXA 1PU2A 1N1DA 3VO2A 5DHFA 3KZOA 4QWWA 1NYQA 3JQPA 3OQOA 3ED5A 4L57A 3VAZA 3LO5A 4RU1A 4QZVA 1S1CA 4RSGA 1QH8B 3ITEA 3QLJA 5HKLA 2OGZA 5JEDA 5JPDA 4M0EA 1XROA 3KD2A 3MB5A 4U3JA 1YTLA 4R84A 3SK0A 5CLFA 2C1EA 4C0KA 4ZK2A 2XUAA 4K86A 1OFTA 5DSXA 4ZEXA 1TQHA 3EH2A 3L9WA 2CVZA 2XOKA 2A57A 1YE8A 2KG6A 1J2UA 4UXIA 5HDBB 1KDYA 4JOCA 3AEZA 3OLQA 3ZGXA 5AVSA 1BE8A 2H2GA 4ER5A 2LPMA 2FQYA 5TPZD 1NLYA 4YUAA 2B20A 1GZ7A 4KDFA 1K5DA 4HYQA 2O9JA 3AU8A 4IMJB 5DFAA 3GT4A 3EQ7A 3PEWA 4YP5A 4MPPA 2XMZA 2E5FA 3CB4A 4Z2AA 4X90A 4ZGWA 3WI7A 2OXFA 3FF1A 4N18A 4PC1A 2B7LA 1E61A 2A0KA 2GN6A 4AF8A 2GRJA 1HMPA 1JZSA 5DNWA 4H08A 3ZV4A 1H2XA 4JV5C 1MO5A 3PWZA 2MWMA 4MB6A 2XKJE 1PKXA 1M2FA 4B0PA 2ZTSA 4UHBA 2B8TA 3D7SA 3HSSA 3JQ7B 3DOIA 2V0GA 1KD1Q 4C0AC 5K6TA 3T38A 1EVLA 4LRTB 5K03A 1EFKA 2XWJI 3IOMA 1Z74A 2BZGA 1AM4D 2P20A 3HB1A 3LDFA 2I1QA 3CRMA 5CX1B 3R44A 4AZ0A 3PC8A 1B73A 3QX8A 1W36C 4BNYA 3NHJA 1LLFA 3K0AB 1BVYF 3KTAA 4AB1A 1T9GR 1NBMD 4WXHA 1WXIA 1Z13A 2UZAA 5IEBA 4X5OA 1OBFO 3I2YX 3U1VA 2Q0SA 3CLSD 4ZZIA 3K0SA 1RTTA 4RX1A 5HIAA 3C3CA 3RKUA 2ONYA 4Q39A 1Z6AA 5M34A 4BO6A 3HCRA 5L6LB 1M74A 3AB8A 3EDRA 5ALMA 2J08A 3AR8A 1WNTA 2JU2A 1E2IA 2VBCA 3L8YA 4J8PA 1JW9B 2OTLP 1T9CA 3WTCA 5DX8A 2QOEA 5FBRB 1P8AA 1DBQA 3FAZA 4ETWA 2RBGA 3HKDB 4Q9NA 2R6DA 3G9UA 1IVYA 3CZ4A 3LUSA 3V8BA 3FUWA 4KBFA 1EFAA 3BJEA 4Q05A 1TC2A 1OAAA 2JASA 4RA9B 2I33A 1YJ9P 4HNUA 1BFKA 2AG6A 2X0IA 4RGBA 4DC0A 3SF8B 2GS9A 1K6MA 1CC1S 1WCJA 1UDRA 4OB8A 4MDFA 1KYZA 3NHPA 3RYFB 1P1CA 3ORYA 1PQYA 1EINA 4TXMA 2FEPA 4BZPA 4V0SA 4E5NA 1DT3A 3VNSA 1M2OB 2A9FA 5IANA 4NV0A 1XCMA 4H18A 4QEDA 6Q21A 5FADA 1ZLXA 3CFYA 3BDVA 3WLJA 3E8XA 1ONNA 2DSTA 3A0RB 5DH9A 1QQAA 1GFZA 4CEHB 3N8HA 4PHTA 4ENUA 4UNSA 4FEAA 3I61A 3W7BA 5CEJA 5CZDB 4BKMA 4BRUA 3CVWA 1CJMA 2Q3BA 5LKAA 3DUFA 3R7WA 4QJ3A 2AJ8A 1TAHA 3EF1A 4MGHA 2ZUTA 3DBRB 4XX0B 3Q41A 1W8IA 4QKQA 4V0ME 3BIXA 1J9ZA 2R5WA 4B3MC 4YP1A 3LOQA 1TTHA 3HP4A 1WVIA 3UV3A 1U0SY 1R00A 4NZ9A 3VYSB 2A86A 2OUIA 5LZ4A 2AE2A 1F0KA 2IU6A 2OILA 5D3MA 5IG2A 4GLJA 3X1DA 5BN5A 1N2CB 4FC6A 4DT1A 4F91B 5HZMA 4P7BA 1BRMA 1M1UA 1A9XA 4XYEA 1G66A 1DO2A 4BNHA 4X8OA 4XSHA 2VQEB 3DS1A 2QA5A 5MDHA 3ITKA 3R6LA 2OZVA 1TM5E 3TR6A 4DLNA 4QXAA 1ZL2A 1QDUA 1P81A 2VNJA 3THXB 4C29A 4IDBA 3LBYA 2ZWPA 1GUBA 4TTVA 1D2MA 4Q9JA 2BOVA 4BNXA 1GQYA 1L7AA 4J6FA 5EINA 4KUGA 1CUAA 2VTBA 4D9MA 1VE6A 4OHUA 4XA8A 4PLZA 1Q84A 3GJNA 1KVQA 3TDMA 3U7FB 2UYCA 4AZVA 4JC0A 1RADA 4GKJB 5EZ6B 1ODJA 2CG5B 3P2KA 4D9CA 1JEJA 1EZ4A 1P72A 2Y0EA 1LQ2A 1P8JA 3DLAA 1PHPA 3B51X 1XBTA 2NZJA 2ZLBA 2Z4RA 5BWCA 2OCAA 5C8DA 2FZEA 1D6JA 1KU0A 5B1YA 3DHEA 1DBRA 1VQMP 1ONSA 3X43A 3HC7A 4EJ2A 1WCXA 4WCVA 2CLHB 4LJ8A 4QBGB 4AJ9A 4ND1A 4HUTA 4DY6A 2PWBA 4KPGA 4X1YB 1TVEA 3K16A 3WNDA 4BPRA 1ONBA 1ZJYA 3F97A 4LTDA 5KNLA 1WW3A 1VPLA 3QWFA 3CZ9A 2M1ZA 4XCVA 3IV9A 4O5AA 5BSTA 2O3SA 5DEOA 2ZTVA 3UAVA 3I56P 1JHZA 4L0DA 2OHJA 4BE7B 2OQRA 1BN6A 3GY0A 2RGWA 4FDLA 4ILEA 3QKSA 1GKLA 1G8AA 4FE4A 1GGFA 3Q3JB 2E18A 4B0OA 1RWMA 1RAEA 4N0PA 2G28A 3N3BC 3OZAA 5D2CA 3NV7A 1CB0A 2BM1A 1W1WA 4HHEA 1H94A 4KYUA 4D9IA 1HNZC 2BEWB 4YIKA 1IFXA 2WU1A 4H6WA 1K08A 3B60A 2JFBA 2RG1A 3RTCA 3O2QB 4TVSA 1JJFA 2OV4A 2BTEA 1IMJA 1L4MA 2IIQA 5IJ9A 1AGRA 2V7BA 5KTOA 4NFSA 4U4AA 2WHXA 4C7JA 5JWRA 3PU6A 4RKYA 4B6QA 1E8MA 2DM6A 3IPYA 2ZUFA 3GMTA 3H9BA 3R0IA 2Q6TA 1Q21A 2IZ1A 1V1JA 2KOPA 5A9RA 2XYHA 3QUCA 2AQKA 2B9VA 1UC4B 3CX6A 3IELA 5AM5A 4ESVA 2EGUA 1DAMA 2AZ4A 2B7BA 1A9OA 7REQB 1G2IA 3EC2A 4C3OB 2VHVA 4AS1A 2A14A 5I9LA 5KTNA 1TT5A 1P7LA 1D8AA 1MAVA 2FNAA 3TM4A 2HBZA 2Q07A 2Q3HA 5ENVA 5J1TB 5A3QA 1QGUA 4J7AA 3FG9A 5T3UA 4OX9C 2HEGA 4JYZA 4V03A 4URXR 5ICSA 4FGZA 4KR0A 4FFWA 3GJ5A 5AVTA 3PT9A 4P0TA 4RW0A 4XGRA 2FY8A 1QZZA 3O21A 4B6GA 3OFNA 2QD4A 3GFFA 1M5TA 3O9MA 2ANBA 1PR0A 2VJCA 1QKIA 4OUDB 4WTOA 1JRLA 5FHRA 5LB2A 3EWNA 3K0KA 3HJGA 3TX6A 1AKMA 5CLHA 4FHFA 1KBOA 5MN6A 4K9PA 1GYRA 3VTZA 5KNCH 2B1GA 1HQYE 3PQFA 4DIOA 1WA5A 2YHSA 4AJOA 2XDQA 1PFQA 1S8FA 4UTOA 3SC2A 2FVAA 1RLOA 4NXMC 1P3Y1 4BKPA 5AI9A 4QEZA 3SJAA 2CHVA 1CQIB 3F6EX 4WNCA 2J87A 2B4QA 4BNKA 3DVLA 1M73E 3PFHA 2C7QA 3RK0A 1EDDA 4CV2A 2GB4A 1IU9A 4D3YA 1VQ6P 3VR4A 3C3AA 4WN9B 4DWWA 2PX5A 4IDFA 4E1AA 3H2SA 4LMAA 2LOLA 4DV6C 1K5HA 5JASA 3KOWA 3RAPR 3UW3A 3F5QA 3FMPB 4J0QA 4ZT7A 2ATVA 3V2HA 4NBVA 1RC8A 2IUFA 3ERCA 3AF6A 2VF4X 1UFRA 2BHLA 2BI4A 2Q4OA 4KAJA 1SVKA 2EJUA 3Q87B 1VE1A 2AJCA 3PHCA 3DXZA 4QC2A 2EARA 4V2IA 3M9LA 3OE7D 4FT2A 4NAUA 5K7SA 3DS5A 1Q0HA 1QHFA 2YW9A 3K6SA 1Y48E 5FO1A 4A8JA 2ZT5A 2J6IA 2ZBGA 1VC2A 1EM8B 1Q7TA 1Y3DE 2NLOA 4I3FA 3TQQA 4AWXA 5DLQC 1CJKC 5IFLA 5TIIA 4K8RB 2CHQA 3IVCA 2JDIA 1PJBA 3P4UA 3IQWA 3SYNA 3KKZA 2JC3A 1H5QA 1NE7A 4JSRA 4REQA 1Y4AE 3MWGA 2OFWA 5DWVA 4TVKA 4KRYA 4G5SA 4BBPA 3PLRA 1XLVA 3C74A 5IJWA 5SY4A 2BEUA 2XZOA 5BQ3A 4I5FA 3D5QA 2GJ8A 2I7VA 2QL7A 3LNTA 3W6UA 1P77A 2ECKA 1Q1EA 2COKA 2TYSB 2W6ID 3PUZA 1EVZA 3LZDA 2A88A 4CLRB 2UXDB 3BFVA 4QGSA 2EC5A 3MS2A 1PL6A 4MA5A 1N6PA 1U8ZA 4LSMA 3KZ1E 4ZQBA 4MJLA 2D1FA 5HKKD 1FDIA 2VBFA 1GNPA 3OCYA 3O1HB 1K9MQ 2ETXA 3DM9B 2J5BA 2CSUA 3ND5A 4EEXA 3KQSA 5JDIA 1ZESA 2DQKA 4YBRA 1EP2B 4HGQA 3II6X 3D4LA 2VPQA 3AL3A 1PNVA 3X1YA 4Q0MA 1WW8A 3AM5A 3AGPA 1ZCFA 3ICQB 1MAWA 5L4LA 1CX9B 3MBKA 4QGBA 3TKAA 2MU1A 4MS4B 5C2JB 1E2GA 5CYPA 1ZM3A 4P5DA 2BIFA 1YT5A 3DDOA 4FYVA 5CIWA 1P2SA 1W73A 2J7PD 3QKIA 2Q4DA 4BAGA 1F60A 1BHQ1 4I4TA 4L50A 1NLFA 2XXAB 1VSVA 3ZHUA 3RTDA 3HB7A 3BIWA 3ZW9A 1SGWA 3T0IA 1NJ2A 5HJEA 1QVAA 3KR2A 1X1AA 2RGDA 2UYQA 1ULBA 1U0BB 3BD7A 3K4QA 1U4OA 2JBWA 4LC0A 1M1YB 3MUFA 1ORWA 4B3RC 1M67A 2UUBC 2FRVA 1G3UA 1I01A 2DUNA 5TGTA 2FPSA 3H97A 3NOOA 3BMCA 8ADHA 2DFVA 5IMBA 3NOXA 1A88A 3C85A 3NX4A 4LYJA 3HYBA 4OGLA 4M54A 1ZUNB 5EE5B 1YL6A 3PC4A 1MO3A 1JTFA 1B23P 5LIRA 3HDGA 2FCAA 4BFLA 3LZ6A 2V7TA 3VR5A 3GGCA 1RPAA 4KP7A 2Q2OA 5IHXA 3TM5A 2O0JA 2Y1CA 2C4TA 4P93A 1E2PA 1ZHFA 4Z99A 2IYLD 4YFYA 4D8XA 2EKLA 3H9QA 1EJBA 4J7UA 2XOXA 1ADJA 3GU3A 4PYNA 4GM1A 1RBQA 1RQXA 3KJEA 2ZRDA 2HMSA 2W6ZA 5FPKA 1OTHA 5DNEA 5I7FA 4N9QA 5JJLA 2BHTA 1KYXA 1NHGA 2PUEA 2B0CA 5F7XA 1T4CA 5KKCA 2C4MA 5KP6B 1YJ5A 2RGRA 4M9RA 5THQA 4PW0A 2WK1A 2MMAB 4PTLA 4IDOA 4NATA 2YVKA 1IEVA 4GZ5A 5C37A 5EHIA 3U16A 1W29A 2R60A 2VP5A 3IAM1 1FTNA 4RJTA 3QBVA 1GWNA 1VG0B 3VISA 4ENTA 2YWRA 3MZ0A 5I7HA 3SDBA 3G5MA 2AH5A 5G0WA 3I07A 4C78A 5B2EA 2RIPA 5KPDA 3REGA 1ZNXA 3CD6P 1FPQA 3MMSA 3AP3A 4EGJA 1VRVA 1PKEA 4PZAA 4GOND 4P4SA 2PH5A 4H59A 3DKPA 3GELA 5BR1A 4ICIA 5KZMB 1TCBA 3DO6A 5CFZA 3OJXA 1P91A 2ZAMA 3UN1A 4YJFA 4YVFA 3MS4A 4MMZB 4URYR 4MJXA 1SCKA 4R41A 2Z8ZA 4DA9A 3P45A 1HFKA 5GJBA 1Q2XA 1RABA 4AY5A 4CJXA 1NFRA 1RXVA 2YC4C 5TQJA 3CTMA 1USUA 2QQ5A 4HJRA 4CCYA 1QP7A 1RE1A 1JJBA 4QYSA 1L8AA 4YRJA 4RA6A 4JGIA 3RF7A 3HN6A 2ORED 4JBWA 2FSIA 2E2WA 3MN1A 1STOA 3HP1A 2GR9A 1OROA 1ABFA 3AJDA 3OLVA 2MCQA 3BK1A 2BEVA 2PJDA 4QXOA 1QZXA 4CI9A 3U4DA 5BSWA 1KSGA 4D43A 3BUSA 2IIBA 5DT2A 1UKCA 3PRKE 1GNTA 1A9SA 3GLIE 2Q5LA 2IP4A 2CFRA 5A04A 2LCIA 2OB1A 2P2QA 3C3PA 2W83A 4TRMA 5B1DA 3EF3A 3GHHA 3D7RA 4P83A 3D3WA 3ETHA 4I7EA 3R7FA 4RWEA 5M7EA 4MW9A 1GNRA 4RF2A 3M82A 1KP2A 1Z12A 4CV3A 4ZDIA 1MJNA 4M9XA 1JIJA 3KG2A 2LZ0A 1X1DA 4R9SA 2RGNA 5TNXA 4MRRA 4N3NA 5C81A 2R6JA 3CNLA 4NENA 1P2DA 5T4BA 1Z6GA 3B1YA 3U7EB 3S1LA 3SNKA 5F1KA 3VC2A 3GFPA 1YF3A 1VXRA 3ZOZA 2UZ1A 5A6VA 4XQCA 3U31A 4JKOA 1Y42X 2ZRLA 4B3XA 1M6XA 4RKEA 3KWJA 5ENDA 4C3UA 3AZQA 5CDHA 1BEUB 4TPSB 4D45A 5EKUA 4IR7A 3LL4A 2YQZA 4OGKA 4RV9A 2CDBA 4LQ4A 2GBIA 3VR1A 2B35A 1QGYA 5GADl 5EYPA 4YRCA 3PNMA 1VG9B 2BGGA 4CM6A 4YDRA 3A9WA 3W2HA 4BZWA 4CQNA 1ZICA 4X66B 1CNEA 1OB2A 4KR9A 4OXXA 3LT0A 5E6SA 4RIHA 1HNWB 1ZISA 3VR2D 4MK4A 3LQYA 1XLTA 4LFAB 4QPPA 3BQMB 2M98A 1U7PA 1ZRMA 2P4SA 1TIPA 3IEXA 3K6RA 3SJZA 5E3IA 3X1WA 1MN6A 2I65A 3QQPA 1LSUA 3G1UA 2SHKA 1VI5A 3DXFA 1H2WA 2HMWA 3AUYA 1XVAA 4UCXA 4Z7NB 8ABPA 1E64A 4K0BA 2IPOA 3LG2A 3D4BA 1K68A 1UMBB 3OTQA 3AP1A 2WG1A 1XTBA 3OIUA 2OXRA 3F4KA 3GRAA 2XIQA 3E2DA 4LDZA 1OFUX 3ZLVA 5ALRA 4L1KA 3H8SA 1PR9A 5HCNA 3NIDB 1L7NA 1GYQA 4PZEA 3I64A 4LCJA 3GAZA 1RSZA 1EP9A 4OEHA 1MQAA 4GKVA 5I4BA 1XR3A 1K6EA 1CY0A 1V3UA 4BUCA 3A32A 3EARA 1YI2P 1K06A 3T94A 5T6MA 2L69A 2YZNA 4PANA 3S27A 3AKEA 1DDGA 3M4XA 3QVVA 1P9WA 4CUKA 3MEQA 3GLGE 3KUXA 1KJ8A 3JQRA 4BBYA 1TAGA 3G9XA 2HK6A 2WP0A 7ADHA 3ZJ5A 2JCVA 2ZVJA 4MI9A 1XDUA 3N76A 2TMGA 1RP7A 1JR6A 3IQDB 3KZNA 4G9GA 2P9TA 4A0SA 3MPOA 1RHQA 5DP2A 4COPA 5JHHB 3F8SA 1FTYA 1T0HB 3MA0A 1J1ZA 3FMOB 1WIWA 3UHAA 4G97A 1UADA 1E3MA 2FRDA 5A5EA 3LPNA 2B3DA 1I6WA 4AAYA 2IYQA 3OM8A 4IW3B 2EP8A 1GG8A 3QJYA 3A28A 3ZBQA 5CUQA 3UK6A 5ARDA 5AUQA 2OZKA 1VGRA 1GAQA 4IOKA 1SCDA 1P4SA 2VJOA 2I91A 4QDOA 2R1UA 3HXKA 3OY2A 2Q8NA 2B30A 4NE2A 4X24A 1O92A 4C7OB 1M1ZA 4PAWA 5AXCA 2QIOA 4UW9A 1E9EA 2P3SA 1DADA 3DMTA 2JD2A 3OM0A 4OQYA 1IVNA 1WSWA 4AQDA 3W4KA 1GTG1 2Q2VA 3TCKA 3NY7B 3TQTA 1Z6XA 2O2HA 1ZEJA 3AOEC 2QW1A 1EFDN 4Z5XA 5J9FA 4DLKA 2LTAA 1EJ6A 1DC5A 5FBWB 1IB8A 4CF6A 4MIYA 1QANA 3R5JA 4RM3A 1NUUA 1X15A 3E0QA 3PSAA 4PC7A 4BUZA 1WNFA 2FVYA 2I6FA 4CCAA 1QQ7A 1HFWA 3SFVA 5G4KB 4CMBA 3C7DB 4DXAA 2OFOA 3F6CA 1ZQ1A 3AW8A 3T9CA 3D8SA 1X7GA 2I3BA 2YJ4A 1VP9A 3GOQA 3CH5A 1H65A 5IAAA 3M1LA 1ZR2A 2IUSA 3BWEA 4K6GA 3TVTA 3GJ0A 2BR4A 3I92A 4BTLA 4KJXA 5DBFA 5BVHB 2BGWA 4G0UA 4LXIA 3VTAA 2VYNA 5FWYB 4A8HA 3TOZA 2X15A 4TS9A 4N82A 4BN0A 1ENZA 2ZM5A 1H3FA 2VTEA 4J3NA 2P6UA 2VH2A 3T3MB 1XCJA 3VSCA 4MVJH 4FZJA 4E3WA 2W43A 3E7WA 1JQLB 4DN6A 1XQWA 3QZUA 2FDRA 1THGA 2E5LC 3B2EA 2XCTB 4NMHA 3BWMA 2V6GA 1H4VB 1PDOA 2H1HA 4IVQA 1CG6A 1JR3D 2C8JA 4DSTA 4XUCA 1U9IA 4DV1C 4J0DA 1MR3F 3ULKA 2XZLA 5JIBA 1PT7A 3UWSA 5SZKB 1JIQA 1VJRA 3ZLTA 2M5OA 1S01A 3VR3A 4Y98A 4BEBA 3K71B 3RVDA 2VP2A 2GN0A 3DE2X 4QFMA 2L6EA 2QYHA 3BH6A 2EHTA 3MGEA 2V98A 4I55F 1CS0B 1EB9A 3S2UA 5DU2A 2EFJA 3GFTA 2NXNA 3BXXA 5FTWA 4XCXA 1PJ3A 4FFLA 5A4MS 2AXNA 2DUJA 4I8XA 2VHQA 3OICA 3MWLA 3ND7A 2O5EA 4O2AA 4NAHA 4ER3A 3IKJA 1Z8NA 4QOHA 1IUPA 2W2PA 3RS0A 3DDZX 4EBFA 1QTNA 1NKTA 3OI7A 1X7DA 1NYRA 4ZJZA 5E4TA 1X3OA 2AGVA 5TARA 5I7SA 2VKQA 4CR8A 1KQSO 5FXMA 1YZUA 2R7MA 3T0GA 4NLLA 4BX9A 1QCDA 2ZB4A 4UHHA 2YRFA 5E8RA 4JC5A 4TQGA 4MI6A 1OLUB 2FYTA 4E5DA 3K9BA 3JSAA 1KPGA 2QUAA 1AGXA 2XYGA 2QA4P 4DR3B 3DDUA 1LBHA 3DS3A 1NVFA 3A0UA 4AKIA 1IOWA 3L6RA 2H4XA 3ZWXA 3UMFA 2YH2A 3RANA 5HV8A 5FBVB 1SULA 5A4AA 3TRFA 1TQ8A 4MIEA 6REQB 1Q0UA 2G6BA 3PDCA 3A6LA 2ZRNA 2R79A 2QY6A 1L7BA 1E9DA 2FG6C 3BQ9A 4V1CB 1YQEA 3LM8A 3A6DA 1PG0A 1XJQA 5K05A 3NYRA 2VLOA 4W5QA 2Z08A 3D81A 3QU7A 4NYIQ 1OZHA 3ZNOA 2DHQA 2CMGA 5T8TA 3C5VA 3U4AA 2PNGA 4AJJA 5HS6A 2Z6UA 4JYMA 4MITA 4FFDA 2MCFA 5JO0A 2QPOA 3G0CA 5CM9C 5L7YA 4EFNA 3K9HA 3HDQA 3VTKA 3K1YA 1JEYA 3PP8A 4LJ6A 2OGWA 4ZT2A 1QPBA 2DPYA 2VT6A 4C2AA 5L3VA 5CGQB 1Q1ZA 4ILKA 2C5EA 1GVHA 3D8NA 4UVIA 5AR1A 5DI9A 3BYZA 1NVVQ 2LW7A 1RIFA 1C14A 2GEKA 5CAEA 2VAWA 4ASUD 3HBLA 1X3LA 3EIXA 2H4HA 1NNLA 3F4LA 1VMAA 4N3CA 2O7NA 4OJQA 2UUAC 1E1QA 3OJEA 4E94A 1UINA 3H1BA 4UU0A 1EESA 5CA0B 1EHYA 1ECFA 5F21A 3DBIA 2PMBA 4ZO7A 5DEIA 2PUFA 2IH5A 3CPJB 3UHFA 1H93A 2YVAA 4GGOA 2BFWA 3ZYCA 5LJIA 1OPRA 4KIFA 2Z2IA 5A6SB 1CRZA 3D6FA 5CDFE 1U6KA 3VC3A 1YA6A 3ZDQA 2WF6A 2Z3ZA 4BCCA 3P9KA 3SQDA 1I32A 2FXVA 1V6SA 2RHJA 3T3DA 2IBSA 2AXQA 1M8JA 4ZU1X 2LR0A 3G5UA 1ZOIA 1KGDA 1JG6A 4PH0A 3QVUA 1U8EA 2WNIA 2ORIA 4QASA 5F1PA 2PTHA 3TW0A 5AW7A 2QD1A 3LO8A 4HX9A 1BJKA 5FL7D 2QX9A 4GO1A 5EP3A 3QYJA 2JAUA 3TQOA 5HA5A 2QGFA 4W7HA 3MWDA 3GLFE 1N4DA 4RK6A 5KTPA 1WX1A 4FE3A 2AW3A 3DBHA 5TJHA 4L2ZA 2FMXA 3FLMA 1XL0A 3ZE8A 1ZAYA 4PNEA 1E9FA 1DO0A 2A5YB 3MLEA 4J1TC 1R16A 2ROQA 5E7QA 1FE8A 4EUNA 1V96A 2RHWA 3TI9A 1X1BA 3LBNA 2ZI5A 5CVDA 3Q7IA 1G1MA