4MH4A

Crystal structure of osmc-like protein from burkholderia cenocepacia j2315
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
b'SKIEKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAVDAEVDLGTAGNAYFLQARLNVSVPGLERDVAQRIVDAAHQTCPYSKATRGNIDVDIRIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OsmC-like protein
molecule tags Protein binding
source organism Burkholderia cenocepacia
publication title Crystal Structure of OsmC-like protein from Burkholderia cenocepacia J2315
rcsb
total genus 31
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mh4A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4mh4A02
1Y1WI 3RZDI 2E8CA 4JV5C 4YY3C 3VMIA 1WF3A 4DR7C 3IEUA 4MTNA 2YU9I 3GTGI 1N34C 4LF7C 1WCMI 4NOZA 4XX2A 4QTUA 3U50C 4A3EI 2NVTI 4DV0C 4LFBC 2UXDC 1TFIA 3HOYI 3PO3I 1USPB 2UXCC 2R93I 2E7GA 2PN2A 2HF1A 4LF8C 2E2JI 3I4MI 1RO4A 2NVXI 2JA7I 4DV4C 3M3YI 4BBRI 4Y52I 4BY1I 4DV5C 4B3SC 2UXBC 1N2FA 3S1NI 1L1OC 1MKYA 1JOSA 4DV7C 2AKLA 2DE5A 1NUIA 4DCUA 3AF6A 4NBDA 3VMGA 4X64C 4B3TC 4K0KC 2VUMI 5IP7I 3LUSA 4NB9A 3H3VJ 3VB9A 1TWHI 3M4OI 1IBMC 1I3QI 2JA6I 4DCSA 2VQEC 3GTMI 2EGTA 3GTQI 1HH2P 1UKKA 2PT7G 2JA8I 2UUCC 4OX9C 4LF6C 2E8EA 1K83I 4DV6C 2HHHC 4NBBA 2KZFA 4GKJC 2KPIA 2DYJA 2JMPA 4DR1C 4JI8C 3OTOC 2ASBA 2OPLA 1X3ZA 4DUZC 4DR3C 3PO3S 1XMOC 1N33C 4BSZA 2E2HI 4JI1C 3K7AI 4X66C 4X6AI 3R9WA 5IT9D 2B63I 1XNRC 1QYPA 4DV3C 3VMHA 4A3JI 5LMNC 3GCFA 4DR2C 3T1YC 1HNWC 3H0GI 1I50I 4NBEA 3R9XA 1FJGC 3Q87A 2PK7A 3S17I 4LFAC 2JA5I 4DR6C 3S1RI 1TWAI 1TWCI 1SFOI 1DL6A 4NXNC 2F4MA 3HOVI 2HJGA 4JI6C 1LQLA 3GTJI 2ATWA 3HOUI 4GKKC 4NBGA 2UUBC 3GTOI 2P3YA 3S2HI 1HNXC 4JI2C 5FLMI 1IBKC 4MH4A 1WH9A 4DCTA 2RBLA 4Y7NI 2R92I 2ZM6C 4A3LI 2QL8A 4DR5C 1XMQC 1TWGI 4BY7I 2BJOA 1XNQC 1ZB9A 4A3KI 4YHHC 1ZB8A 3S1MI 1Y1VI 4DV1C 4A3MI 2F4VC 3J81D 4JI5C 4AQYC 3S14I 1EGAA 4NB8A 3GTMS 3IEVA 1KKGA 2R7ZI 2DE7A 3JAMD 3I07A 1WW9A 4BBSI 2OPLB 5C44I 5FLXD 4NXMC 4NBFA 5C4JI 4NBHA 4JYAC 2J6AA 1I94C 1YUAA 2JR6A 3GTPI 3HOZI 1TWFI 3GKQA 4A3II 4A3BI 1L2FA 4DCVA 3EERA 5IP9I 3S1QI 1I6HI 4DV2C 3I4NI 1PA4A 1N32C 2JNYA 3GTLI 5BR8C 2NVQI 3ESWA 3FKII 1X3WA 3D6WA 3CJEA 1HR0C 2D7VA 1N36C 2K5RA 3T1HC 1IBLC 2CY1A 3CQZI 3HOXI 3S15I 4B3MC 4X65C 1HNZC 3S16I 3AF5A 4JI7C 2YCBA 3S2DI 1ML8A 4NBCA 4A3GI 4X62C 2UUAC 2DE6A 4A3CI 4LF4C 1VLAA 1Y1VS 3RZOI 4LF9C 4A3DI 2UU9C 4B3RC 4KHPC 4DUYC 4QTTA 4LF5C 2E2II 2F4OA 5CM2M 5C3EI 1R9TI 3GTKI 4A93I 5IWAC 2E5LC 1USPA 2NVYI 5LMUC 4NBAA 4DR4C 4BXXI 1QWIA 4JI4C 5C4XI 3HOWI 2E8FA 4A3FI 2CXCA 3PO2I 1NYEA 1PFTA 2ONFA 4JI3C 4LFCC 2JS4A 1K0RA 1J5EC 4JI0C 5A2QD 3J80D 3GKUA 2XR1A 2VQFC 1RLYA
chains in the Genus database with same CATH superfamily
3ETCA 2OOXB 3VMIA 1WF3A 1K9M2 3DLPX 2VUGA 4AYBA 1K731 2YU9I 1K732 4LF7C 3J7A4 5D1PA 1QVGZ 2VPWA 4LFBC 3VNSA 3NH8A 4L4QA 3KIFA 2E2JI 4DV4C 1Z03A 2OO4A 3IX0A 2D1SA 2P20A 4B3TC 1VQL1 1VQMZ 3LUSA 4NB9A 2QLVB 3A26A 4DCSA 5A1IA 1VQLZ 3GTMI 1VQK1 3N54B 3J80f 1KD11 2JA8I 2E8EA 2HHHC 1MD9A 2KPIA 2DYJA 3G4SZ 1X3ZA 4DR3C 2IV2X 4LE5A 1MDFA 3NPDA 1XMOC 1N33C 3CME1 1K8A2 4X66C 1FDOA 1XNRC 1XRAA 4A3JI 5LMNC 1AA6A 3CCR1 2MMAB 1I50I 1W2BZ 3Q87A 2PK7A 3C5EA 2JA5I 4RV9A 1FLOA 1Q7Y1 1DL6A 2ATWA 1LQLA 3GTJI 2BH1X 4E32A 4GXRA 3HOUI 1YUKA 1S721 4TPSB 1QVGY 2QVZX 2P3YA 1M1K2 2LFUA 3CC41 3S2HI 4E33A 3CCS1 5FLMI 1YJW1 1WH9A 5GTDA 2MCQA 3MONA 4DR5C 4BY7I 1V26A 4FUQA 4A3KI 1ZB8A 3S1MI 1Y1VI 1Q862 4G36A 3J81D 4GS5A 3CPWZ 3F3FC 5A1GA 3JAMD 2DPLA 2P28A 5D1OA 3L8CA 5C44I 3UZ0A 4DQYB 4E30A 3MZKB 5IT9b 3UOWA 4RVGA 3GTPI 4DR2C 5D1OB 3S1QI 1UWDA 4HGYA 3F3PC 1PA4A 3FKII 2V8JA 1Z01A 4RM2A 1VQPZ 1N8R1 3QWUA 4X65C 1KRLA 3CCE1 3FCEA 4JI7C 4CL1A 1T5DX 2JIPA 3IFUA 1YITZ 4A3CI 2Y4OA 3CC4Z 4PHTA 4QTTA 1W2BY 3I55Z 5CM2M 5IWAC 5C3EI 5CZVA 4RVDA 3TDHB 2E5LC 1USPA 3CCLZ 4DR4C 2E8FA 3LNOA 3E7XA 1VQN1 2E7ZA 2ONFA 1K9M1 4G37A 5BSMA 1K8A1 2JNVA 1MXBA 1WCJA 2ZZMA 4JM1A 1VQM1 2E8CA 2H85A 2DHMA 2GU2A 1RQFA 3GTGI 3LAXA 1AMUA 1Y8CA 1SIWA 2IZ4A 1MXCA 4QTUA 1YHQZ 4RS4A 3TQIA 4RVFA 3CCL1 1TFIA 4PUGA 3HOYI 2V3VA 3PO3I 5KYVA 4R0MA 1M1K1 4LF8C 1LCIA 2NVXI 2JA7I 2WB1A 3CCJZ 3GR1A 2RHBA 4BBRI 3IF8A 4BY1I 4OYCA 2QRDB 1N2FA 2JIOA 3B7WA 1YI2Z 5AE2A 1L1OC 1MKYA 4DCUA 4BCAA 3AF6A 1YIJZ 5A2Qb 3KXWA 4K0KC 1FUGA 3ETOA 1I3QI 2JA6I 3RV2A 3NH5A 4OX9C 1HH2P 2QVYX 2UUCC 4WS9A 3OW2Y 2Y27A 3I08A 3IPLA 4NBBA 3H2TA 2M6NA 2Q4ZA 2V7BA 2QEXZ 4JI8C 4FTFA 2OPLA 4WV3A 4MD7A 4BBYA 4BSZA 4JI1C 1VQO1 5IT9D 2O53A 3CCUZ 4IR7A 4ISBA 5FLXb 2WD9A 1VQ41 3CPWY 2AYAA 2E9HA 1FJGC 3IMLA 4PUIA 4LFAC 4D56A 3LGXA 1TWCI 1PG4A 3J81b 1Q812 1P7LA 3L95X 1O90A 1VQ8Z 3CCM1 4DG9A 3TE5B 1Q861 3CD61 1HNXC 1IBKC 3JAMf 4DCTA 1V60A 2RBLA 4Y7NI 2ZM6C 2QL8A 4NH1C 3CCSZ 1XNQC 1ZB9A 3CCJ1 4RVHA 3CC2Z 4A3MI 2F4VC 4AQYC 2QRCB 1VQ71 1EGAA 3I561 3R44A 2DE7A 3G4S1 2I3CA 1WW9A 2G2KA 4HGZA 4EWCA 4NBFA 4RVOA 5C4JI 2QA41 1QVFY 3S82A 3TUFA 3CMAZ 1ZH1A 2JR6A 5T67A 1VQNZ 1N8R2 3CCQ1 1VQKZ 1L2FA 4OXIA 5IP9I 4DCVA 2OTJZ 1I6HI 2KI7B 4MD9A 3E7WA 1X3WA 3I551 4ODJA 3T1HC 2GTIA 4B3MC 2QREB 3S2DI 2OTJ1 4A3GI 4PUHA 4LF4C 1VQ9Z 2DE6A 5AN9F 4DR6C 2LIYA 2JIRA 4A3DI 4LF5C 2E2II 3GTKI 5T8SA 1QXFA 3CCMZ 3JAMb 2OOYB 3CCEZ 1KC82 1QWIA 4L2ZA 3MZLB 4A3FI 2CXCA 4ZJZA 4TNUA 1MXAA 2D1RA 1YJ7A 3NI2A 4JI0C 2XR1A 2VQFC 1WJ2A 3A25A 1Y1WI 3RZDI 3IEUA 4MTNA 2YADA 3OW2Z 2RT9A 2VPZA 3D2LA 1N34C 1WCMI 2QVXX 1QF8A 4NOZA 3U50C 1YJ9Z 4DV0C 2VPYA 3CC71 3CQ2A 3A4IA 2R93I 2UXCC 5BSRA 2YX1A 2JIMA 1VQ4Z 2RIQA 3M3YI 5IFIA 1IB8A 3SO4A 2UXBC 1WZNA 3PBKA 1FDIA 2CU6A 3S1NI 3TDEA 3VNQA 3AY0A 4MXUA 3CXCZ 4DV7C 2AKLA 2DE5A 1KQSZ 4X64C 2VUMI 3H3VJ 3VB9A 3EEDA 3CCRZ 3CW8X 1YJ91 5LCIA 1IBMC 3GTQI 2PT7G 1UKKA 4BC7A 3TR3A 4LF6C 3UEBA 1PG3A 2PMZA 4U5YD 1P9NA 3NYQA 3OTOC 1JJ2Y 3CQ1A 1XHJA 2M48A 4HH4A 1Q822 3PO3S 3CXCY 2E2HI 1T5HX 3BG0B 3K7AI 3CW9A 4X6AI 5A19A 3R9WA 1VQ5Z 3HKZA 2OBVA 1QYPA 4DV3C 3VMHA 2K3RA 2V8KA 2D27A 3H0GI 3R9XA 2M5HA 4R1MA 3S17I 3G6EZ 2JUBA 2KDNA 4E31A 3HOVI 1YJNZ 3A9UA 2OTLZ 1ULTA 3VNRA 1JJ2Z 3T4NB 3GTOI 3G711 1WIIA 4G1IA 4JI2C 4MH4A 4BC9A 2R92I 1YIT1 2P2FA 1TWGI 4E2WA 1BA3A 3K6RA 2BJOA 4YHHC 4DV1C 1VQP1 2Y0SA 4NB8A 3GTMS 3FQMA 3IEVA 1KKGA 3I07A 2OZKA 4BBSI 5IT9f 1M901 1O93A 1VQ81 2OPLB 2LEXA 4DK1A 1M902 5BUQA 4NBHA 3CCV1 5FLXD 4D4IA 1KD12 3G71Z 1I94C 1YUAA 3CC21 2WP0C 5A2QD 1TWFI 3GKQA 1QM4A 4A3BI 4DV5C 2P2MA 4RLFA 1N32C 2GTHA 1QVFZ 3GTLI 5JRHA 5BR8C 2NVQI 1NY8A 2YWCA 3ESWA 4D57A 5BSWA 4KTVA 3CJEA 1NJI2 2D7VA 1Z02A 1IBLC 3CQZI 1X0TA 4L7IA 4E2XA 3S16I 3AF5A 1HNZC 4S1TA 2M5OA 1ML8A 2D28C 4LF9C 1VQ7Z 1Y1VS 3RZOI 4B3RC 2UU9C 4KHPC 2PM9A 1YJWZ 1NJI1 4EATA 1RO0A 4RM3A 1R9TI 5CZXA 2OTL1 4A93I 1M6XA 2Q51A 3P5JB 2NVYI 1S72Z 5LMUC 4BXXI 3HOWI 2Z51A 4RVNA 1Q821 1NYEA 5T8TA 1PFTA 2JMOA 4JI3C 4LFCC 3CD6Z 5AE1A 1J5EC 1VQ51 1RO2A 2E0GA 3GKUA 1YI21 5A2Qf 1RLYA 2RPRA 4RLQA 4JV5C 1S7MA 5T6BA 4YY3C 4DR7C 3CMEZ 5BUSA 4K0BA 1NP6A 1Q811 3NFZA 2NVTI 4XX2A 4A3EI 2UXDC 5BSVA 2ZAEB 5K8FA 5BSTA 1USPB 5KYTA 2VZEA 2E7GA 2PN2A 2HF1A 4RMNA 3I4MI 3EQ6A 2AYDA 1RO4A 4Y52I 4B3SC 4NFRA 2V8IA 3PROC 3J80b 4E2ZA 1JOSA 3UX2A 1NUIA 4ZLPA 4NBDA 3VMGA 1PU1A 4R1LA 5IP7I 3BG1B 3IR7A 1TWHI 2QA4Z 4PROC 1VQ91 4FUTA 3M4OI 2NCLA 2VQEC 1KQSY 1M6XC 1Q7Y2 3NYRA 2EGTA 5T64A 3PESA 1P4EA 1VQ61 4MONA 1XRBA 1K83I 4DV6C 3A9VA 3UX3A 2R6MA 2KZFA 4GKJC 2JMPA 4DR1C 1RY2A 2ASBA 2Y4NA 4DUZC 1XRCA 4DG8A 1VQ6Z 3G6E1 2B63I 5KEIA 3GCFA 2P02A 3T1YC 3NDIA 4NBEA 3S1RI 1TWAI 1SFOI 4NXNC 2F4MA 3FQQA 2HJGA 4JI6C 1RNIA 4GKKC 4NBGA 3CCQZ 4I9GA 3GR0A 2UUBC 5DV9A 2NAPA 3CMA1 2HU9A 2MM9A 5BSUA 1VQOZ 1O92A 4A3LI 1XMQC 4MRIA 2JIQA 1TH5A 3I56Z 3N2QA 5LL6f 2IZ3A 2QEX1 4E2YA 1MDBA 4JI5C 2W03A 3S14I 4D4GA 5BURA 2D1QA 2YWBA 2O4HA 2R7ZI 1YJN1 5AE3A 3VTNA 4NDNA 4PZPA 1VEHA 4NXMC 4JYAC 2J6AA 5E7QA 2P2BA 3J81f 3HOZI 5K85A 4A3II 1HNWC 1KC81 2QR1B 3EERA 2VPXA 2VSQA 3GPCA 3I4NI 4DV2C 4MD8A 2JNYA 2PROA 1GPMA 1XS3A 2W04A 2QKDA 4HPVA 3D6WA 2VF1A 5FLXf 1HR0C 3D9XA 3NH4A 1N36C 2D1TA 2K5RA 3LNVA 2CY1A 3HOXI 3S15I 4IZ6A 2YCBA 4X62C 4NBCA 3CCU1 2V45A 2UUAC 3FCCA 1VLAA 1YHQ1 4GXQA 1O9TA 5H9UA 4DUYC 3RG2A 2F4OA 1YIJ1 3O2EA 3G7SA 3CQ3A 3DAYA 3CC7Z 4NBAA 4KTTA 2WAQA 1V25A 2ZZNA 4JI4C 5C4XI 1Q16A 4DGLA 3DHVA 3PO2I 2QW0X 4I9FA 1JWHC 1RG9A 2P2JA 2JS4A 3KIHA 3CCVZ 1K0RA 3NDJA 2P2QA 1P4EC 5ADZA 2KZ0A 3J80D
chains in the Genus database with same CATH topology
3ETCA 2OOXB 3VMIA 1WF3A 1K9M2 3DLPX 2VUGA 4AYBA 1K731 2YU9I 1K732 4LF7C 3J7A4 5D1PA 1QVGZ 4LFBC 3VNSA 3NH8A 4L4QA 3KIFA 2E2JI 4DV4C 1Z03A 2OO4A 3IX0A 2D1SA 2P20A 4B3TC 1VQL1 1VQMZ 3LUSA 4NB9A 2QLVB 4DCSA 5A1IA 1VQLZ 3GTMI 1VQK1 3N54B 3J80f 1KD11 2JA8I 2E8EA 2HHHC 1MD9A 2KPIA 2DYJA 3G4SZ 1X3ZA 4DR3C 4LE5A 1MDFA 3NPDA 1XMOC 1N33C 3CME1 1K8A2 4X66C 1XNRC 1XRAA 4A3JI 5LMNC 3CCR1 1I50I 1W2BZ 3Q87A 2PK7A 3C5EA 2JA5I 4RV9A 1Q7Y1 1DL6A 2ATWA 1LQLA 3GTJI 2BH1X 4E32A 4GXRA 3HOUI 1YUKA 1S721 4TPSB 1QVGY 2QVZX 2P3YA 1M1K2 2LFUA 3CC41 3S2HI 4E33A 3CCS1 5FLMI 1YJW1 1WH9A 5GTDA 3MONA 4DR5C 4BY7I 1V26A 4FUQA 4A3KI 1ZB8A 3S1MI 1Y1VI 1Q862 4G36A 3J81D 4GS5A 3CPWZ 3F3FC 5A1GA 3JAMD 2DPLA 2P28A 5D1OA 3L8CA 5C44I 3UZ0A 4DQYB 4E30A 3MZKB 5IT9b 3UOWA 4RVGA 3GTPI 4DR2C 5D1OB 3S1QI 4HGYA 3F3PC 1PA4A 3FKII 2V8JA 1Z01A 4RM2A 1VQPZ 1N8R1 3QWUA 4X65C 1KRLA 3CCE1 3FCEA 4JI7C 4CL1A 1T5DX 3IFUA 1YITZ 4A3CI 2Y4OA 3CC4Z 4PHTA 4QTTA 1W2BY 3I55Z 5CM2M 5IWAC 5C3EI 5CZVA 4RVDA 3TDHB 2E5LC 1USPA 3CCLZ 4DR4C 2E8FA 3E7XA 1VQN1 2ONFA 1K9M1 4G37A 5BSMA 1K8A1 1MXBA 4JM1A 1VQM1 2E8CA 2H85A 2GU2A 1RQFA 3GTGI 3LAXA 1AMUA 2IZ4A 1MXCA 4QTUA 1YHQZ 4RS4A 3TQIA 4RVFA 3CCL1 1TFIA 3HOYI 3PO3I 5KYVA 4R0MA 1M1K1 4LF8C 1LCIA 2NVXI 2JA7I 2WB1A 3CCJZ 3GR1A 2RHBA 4BBRI 3IF8A 4BY1I 4OYCA 2QRDB 1N2FA 3B7WA 1YI2Z 5AE2A 1L1OC 1MKYA 4DCUA 4BCAA 3AF6A 1YIJZ 5A2Qb 3KXWA 4K0KC 1FUGA 3ETOA 1I3QI 2JA6I 3RV2A 3NH5A 4OX9C 1HH2P 2QVYX 2UUCC 4WS9A 3OW2Y 2Y27A 3I08A 3IPLA 4NBBA 3H2TA 2M6NA 2Q4ZA 2V7BA 2QEXZ 4JI8C 4FTFA 2OPLA 4WV3A 4MD7A 4BBYA 4BSZA 4JI1C 1VQO1 5IT9D 2O53A 3CCUZ 4IR7A 4ISBA 5FLXb 2WD9A 1VQ41 3CPWY 2AYAA 2E9HA 1FJGC 3IMLA 4LFAC 4D56A 3LGXA 1TWCI 1PG4A 3J81b 1Q812 1P7LA 3L95X 1O90A 1VQ8Z 3CCM1 4DG9A 3TE5B 1Q861 3CD61 1HNXC 1IBKC 3JAMf 4DCTA 2RBLA 4Y7NI 2ZM6C 2QL8A 4NH1C 3CCSZ 1XNQC 1ZB9A 3CCJ1 4RVHA 3CC2Z 4A3MI 2F4VC 4AQYC 2QRCB 1VQ71 1EGAA 3I561 3R44A 2DE7A 3G4S1 2I3CA 1WW9A 2G2KA 4HGZA 4EWCA 4NBFA 4RVOA 5C4JI 2QA41 1QVFY 3S82A 3TUFA 3CMAZ 1ZH1A 2JR6A 5T67A 1VQNZ 1N8R2 3CCQ1 1VQKZ 1L2FA 4OXIA 5IP9I 4DCVA 2OTJZ 1I6HI 2KI7B 4MD9A 3E7WA 1X3WA 3I551 4ODJA 3T1HC 2GTIA 4B3MC 2QREB 3S2DI 2OTJ1 4A3GI 4LF4C 4DR6C 1VQ9Z 2DE6A 5AN9F 2LIYA 4A3DI 4LF5C 2E2II 3GTKI 5T8SA 3CCMZ 3JAMb 2OOYB 3CCEZ 1KC82 1QWIA 4L2ZA 3MZLB 4A3FI 2CXCA 4ZJZA 4TNUA 1MXAA 2D1RA 1YJ7A 3NI2A 4JI0C 2XR1A 2VQFC 1Y1WI 3RZDI 3IEUA 4MTNA 2YADA 3OW2Z 2RT9A 1N34C 1WCMI 2QVXX 1QF8A 4NOZA 3U50C 1YJ9Z 4DV0C 3CC71 2UXCC 3A4IA 2R93I 5BSRA 1VQ4Z 2RIQA 3M3YI 5IFIA 3SO4A 2UXBC 3PBKA 3TDEA 3S1NI 3VNQA 4MXUA 3CXCZ 4DV7C 2AKLA 2DE5A 1KQSZ 4X64C 2VUMI 3H3VJ 3VB9A 3EEDA 3CCRZ 3CW8X 1YJ91 1IBMC 3GTQI 2PT7G 1UKKA 4BC7A 4LF6C 1PG3A 2PMZA 4U5YD 1P9NA 3NYQA 3OTOC 1JJ2Y 2M48A 4HH4A 1Q822 3PO3S 3CXCY 2E2HI 1T5HX 3BG0B 3K7AI 3CW9A 4X6AI 5A19A 3R9WA 1VQ5Z 3HKZA 2OBVA 1QYPA 4DV3C 3VMHA 2K3RA 2V8KA 2D27A 3H0GI 3R9XA 4R1MA 3S17I 3G6EZ 2JUBA 4E31A 3HOVI 1YJNZ 3A9UA 2OTLZ 1ULTA 3VNRA 1JJ2Z 3T4NB 3GTOI 3G711 1WIIA 4G1IA 4JI2C 4MH4A 4BC9A 2R92I 1YIT1 2P2FA 1TWGI 4E2WA 1BA3A 2BJOA 4YHHC 4DV1C 1VQP1 2Y0SA 4NB8A 3GTMS 3FQMA 3IEVA 1KKGA 3I07A 2OZKA 4BBSI 5IT9f 1M901 1O93A 1VQ81 2OPLB 1M902 4DK1A 5BUQA 5FLXD 4NBHA 3CCV1 4D4IA 1KD12 3G71Z 1I94C 1YUAA 3CC21 2WP0C 5A2QD 1TWFI 3GKQA 1QM4A 4A3BI 4DV5C 2P2MA 4RLFA 1N32C 2GTHA 1QVFZ 3GTLI 5JRHA 5BR8C 2NVQI 2YWCA 5BSWA 3ESWA 4D57A 4KTVA 3CJEA 1NJI2 2D7VA 1Z02A 1IBLC 3CQZI 1X0TA 4L7IA 4E2XA 3S16I 3AF5A 1HNZC 4S1TA 1ML8A 2D28C 4LF9C 1VQ7Z 1Y1VS 3RZOI 4B3RC 2UU9C 4KHPC 2PM9A 1YJWZ 1NJI1 4EATA 1RO0A 4RM3A 1R9TI 5CZXA 2OTL1 4A93I 2Q51A 3P5JB 2NVYI 1S72Z 5LMUC 4BXXI 3HOWI 4RVNA 1Q821 1NYEA 5T8TA 1PFTA 2JMOA 4JI3C 4LFCC 3CD6Z 5AE1A 1J5EC 1VQ51 1RO2A 2E0GA 3GKUA 1YI21 5A2Qf 1RLYA 2RPRA 4RLQA 4JV5C 1S7MA 5T6BA 4YY3C 4DR7C 3CMEZ 5BUSA 4K0BA 1NP6A 1Q811 3NFZA 2NVTI 4XX2A 4A3EI 2UXDC 5BSVA 2ZAEB 5K8FA 5BSTA 1USPB 5KYTA 2VZEA 2E7GA 2PN2A 2HF1A 4RMNA 3I4MI 3EQ6A 1RO4A 4Y52I 4B3SC 4NFRA 2V8IA 3PROC 3J80b 4E2ZA 1JOSA 1NUIA 4ZLPA 4NBDA 3VMGA 4R1LA 5IP7I 3BG1B 1TWHI 2QA4Z 4PROC 1VQ91 4FUTA 3M4OI 2VQEC 1KQSY 1Q7Y2 3NYRA 2EGTA 5T64A 3PESA 1VQ61 4MONA 1XRBA 1K83I 4DV6C 3A9VA 2R6MA 2KZFA 4GKJC 2JMPA 4DR1C 1RY2A 2ASBA 2Y4NA 4DUZC 1XRCA 4DG8A 1VQ6Z 3G6E1 2B63I 5KEIA 3GCFA 2P02A 3T1YC 3NDIA 4NBEA 3S1RI 1TWAI 1SFOI 4NXNC 2F4MA 3FQQA 2HJGA 4JI6C 1RNIA 4GKKC 4NBGA 3CCQZ 4I9GA 3GR0A 2UUBC 5DV9A 3CMA1 2HU9A 5BSUA 1VQOZ 1O92A 4A3LI 1XMQC 4MRIA 3I56Z 3N2QA 5LL6f 2IZ3A 2QEX1 4E2YA 1MDBA 4JI5C 2W03A 3S14I 4D4GA 5BURA 2D1QA 2YWBA 2O4HA 2R7ZI 1YJN1 5AE3A 3VTNA 4NDNA 4PZPA 4NXMC 4JYAC 2J6AA 5E7QA 2P2BA 3J81f 3HOZI 5K85A 4A3II 1HNWC 1KC81 2QR1B 3EERA 4DV2C 2VSQA 3GPCA 3I4NI 4MD8A 2JNYA 2PROA 1GPMA 2W04A 2QKDA 4HPVA 3D6WA 2VF1A 5FLXf 1HR0C 3D9XA 3NH4A 1N36C 2D1TA 2K5RA 3LNVA 2CY1A 3HOXI 3S15I 4IZ6A 2YCBA 4X62C 4NBCA 3CCU1 2UUAC 3FCCA 1VLAA 1YHQ1 4GXQA 1O9TA 5H9UA 4DUYC 3RG2A 2F4OA 1YIJ1 3G7SA 3DAYA 3CC7Z 4NBAA 4KTTA 2WAQA 1V25A 4JI4C 5C4XI 4DGLA 3DHVA 3PO2I 2QW0X 4I9FA 1JWHC 1RG9A 2P2JA 2JS4A 3KIHA 3CCVZ 1K0RA 3NDJA 2P2QA 5ADZA 3J80D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W I;  3RZD I;  2E8C A;  4JV5 C;  4YY3 C;  3VMI A;  1WF3 A;  4DR7 C;  3IEU A;  4MTN A;  2YU9 I;  3GTG I;  1N34 C;  4LF7 C;  1WCM I;  4NOZ A;  4XX2 A;  4QTU A;  3U50 C;  4A3E I;  2NVT I;  4DV0 C;  4LFB C;  2UXD C;  1TFI A;  3HOY I;  3PO3 I;  1USP B;  2UXC C;  2R93 I;  2E7G A;  2PN2 A;  2HF1 A;  4LF8 C;  2E2J I;  3I4M I;  1RO4 A;  2NVX I;  2JA7 I;  4DV4 C;  3M3Y I;  4BBR I;  4Y52 I;  4BY1 I;  4DV5 C;  4B3S C;  2UXB C;  1N2F A;  3S1N I;  1L1O C;  1MKY A;  1JOS A;  4DV7 C;  2AKL A;  2DE5 A;  1NUI A;  4DCU A;  3AF6 A;  4NBD A;  3VMG A;  4X64 C;  4B3T C;  4K0K C;  2VUM I;  5IP7 I;  3LUS A;  4NB9 A;  3H3V J;  3VB9 A;  1TWH I;  3M4O I;  1IBM C;  1I3Q I;  2JA6 I;  4DCS A;  2VQE C;  3GTM I;  2EGT A;  3GTQ I;  1HH2 P;  1UKK A;  2PT7 G;  2JA8 I;  2UUC C;  4OX9 C;  4LF6 C;  2E8E A;  1K83 I;  4DV6 C;  2HHH C;  4NBB A;  2KZF A;  4GKJ C;  2KPI A;  2DYJ A;  2JMP A;  4DR1 C;  4JI8 C;  3OTO C;  2ASB A;  2OPL A;  1X3Z A;  4DUZ C;  4DR3 C;  3PO3 S;  1XMO C;  1N33 C;  4BSZ A;  2E2H I;  4JI1 C;  3K7A I;  4X66 C;  4X6A I;  3R9W A;  5IT9 D;  2B63 I;  1XNR C;  1QYP A;  4DV3 C;  3VMH A;  4A3J I;  5LMN C;  3GCF A;  4DR2 C;  3T1Y C;  1HNW C;  3H0G I;  1I50 I;  4NBE A;  3R9X A;  1FJG C;  3Q87 A;  2PK7 A;  3S17 I;  4LFA C;  2JA5 I;  4DR6 C;  3S1R I;  1TWA I;  1TWC I;  1SFO I;  1DL6 A;  4NXN C;  2F4M A;  3HOV I;  2HJG A;  4JI6 C;  1LQL A;  3GTJ I;  2ATW A;  3HOU I;  4GKK C;  4NBG A;  2UUB C;  3GTO I;  2P3Y A;  3S2H I;  1HNX C;  4JI2 C;  5FLM I;  1IBK C;  4MH4 A;  1WH9 A;  4DCT A;  2RBL A;  4Y7N I;  2R92 I;  2ZM6 C;  4A3L I;  2QL8 A;  4DR5 C;  1XMQ C;  1TWG I;  4BY7 I;  2BJO A;  1XNQ C;  1ZB9 A;  4A3K I;  4YHH C;  1ZB8 A;  3S1M I;  1Y1V I;  4DV1 C;  4A3M I;  2F4V C;  3J81 D;  4JI5 C;  4AQY C;  3S14 I;  1EGA A;  4NB8 A;  3GTM S;  3IEV A;  1KKG A;  2R7Z I;  2DE7 A;  3JAM D;  3I07 A;  1WW9 A;  4BBS I;  2OPL B;  5C44 I;  5FLX D;  4NXM C;  4NBF A;  5C4J I;  4NBH A;  4JYA C;  2J6A A;  1I94 C;  1YUA A;  2JR6 A;  3GTP I;  3HOZ I;  1TWF I;  3GKQ A;  4A3I I;  4A3B I;  1L2F A;  4DCV A;  3EER A;  5IP9 I;  3S1Q I;  1I6H I;  4DV2 C;  3I4N I;  1PA4 A;  1N32 C;  2JNY A;  3GTL I;  5BR8 C;  2NVQ I;  3ESW A;  3FKI I;  1X3W A;  3D6W A;  3CJE A;  1HR0 C;  2D7V A;  1N36 C;  2K5R A;  3T1H C;  1IBL C;  2CY1 A;  3CQZ I;  3HOX I;  3S15 I;  4B3M C;  4X65 C;  1HNZ C;  3S16 I;  3AF5 A;  4JI7 C;  2YCB A;  3S2D I;  1ML8 A;  4NBC A;  4A3G I;  4X62 C;  2UUA C;  2DE6 A;  4A3C I;  4LF4 C;  1VLA A;  1Y1V S;  3RZO I;  4LF9 C;  4A3D I;  2UU9 C;  4B3R C;  4KHP C;  4DUY C;  4QTT A;  4LF5 C;  2E2I I;  2F4O A;  5CM2 M;  5C3E I;  1R9T I;  3GTK I;  4A93 I;  5IWA C;  2E5L C;  1USP A;  2NVY I;  5LMU C;  4NBA A;  4DR4 C;  4BXX I;  1QWI A;  4JI4 C;  5C4X I;  3HOW I;  2E8F A;  4A3F I;  2CXC A;  3PO2 I;  1NYE A;  1PFT A;  2ONF A;  4JI3 C;  4LFC C;  2JS4 A;  1K0R A;  1J5E C;  4JI0 C;  5A2Q D;  3J80 D;  3GKU A;  2XR1 A;  2VQF C;  1RLY A; 
#chains in the Genus database with same CATH topology
 3ETC A;  2OOX B;  3VMI A;  1WF3 A;  1K9M 2;  3DLP X;  2VUG A;  4AYB A;  1K73 1;  2YU9 I;  1K73 2;  4LF7 C;  3J7A 4;  5D1P A;  1QVG Z;  2VPW A;  4LFB C;  3VNS A;  3NH8 A;  4L4Q A;  3KIF A;  2E2J I;  4DV4 C;  1Z03 A;  2OO4 A;  3IX0 A;  2D1S A;  2P20 A;  4B3T C;  1VQL 1;  1VQM Z;  3LUS A;  4NB9 A;  2QLV B;  3A26 A;  4DCS A;  5A1I A;  1VQL Z;  3GTM I;  1VQK 1;  3N54 B;  3J80 f;  1KD1 1;  2JA8 I;  2E8E A;  2HHH C;  1MD9 A;  2KPI A;  2DYJ A;  3G4S Z;  1X3Z A;  4DR3 C;  2IV2 X;  4LE5 A;  1MDF A;  3NPD A;  1XMO C;  1N33 C;  3CME 1;  1K8A 2;  4X66 C;  1FDO A;  1XNR C;  1XRA A;  4A3J I;  5LMN C;  1AA6 A;  3CCR 1;  2MMA B;  1I50 I;  1W2B Z;  3Q87 A;  2PK7 A;  3C5E A;  2JA5 I;  4RV9 A;  1FLO A;  1Q7Y 1;  1DL6 A;  2ATW A;  1LQL A;  3GTJ I;  2BH1 X;  4E32 A;  4GXR A;  3HOU I;  1YUK A;  1S72 1;  4TPS B;  1QVG Y;  2QVZ X;  2P3Y A;  1M1K 2;  2LFU A;  3CC4 1;  3S2H I;  4E33 A;  3CCS 1;  5FLM I;  1YJW 1;  1WH9 A;  5GTD A;  2MCQ A;  3MON A;  4DR5 C;  4BY7 I;  1V26 A;  4FUQ A;  4A3K I;  1ZB8 A;  3S1M I;  1Y1V I;  1Q86 2;  4G36 A;  3J81 D;  4GS5 A;  3CPW Z;  3F3F C;  5A1G A;  3JAM D;  2DPL A;  2P28 A;  5D1O A;  3L8C A;  5C44 I;  3UZ0 A;  4DQY B;  4E30 A;  3MZK B;  5IT9 b;  3UOW A;  4RVG A;  3GTP I;  4DR2 C;  5D1O B;  3S1Q I;  1UWD A;  4HGY A;  3F3P C;  1PA4 A;  3FKI I;  2V8J A;  1Z01 A;  4RM2 A;  1VQP Z;  1N8R 1;  3QWU A;  4X65 C;  1KRL A;  3CCE 1;  3FCE A;  4JI7 C;  4CL1 A;  1T5D X;  2JIP A;  3IFU A;  1YIT Z;  4A3C I;  2Y4O A;  3CC4 Z;  4PHT A;  4QTT A;  1W2B Y;  3I55 Z;  5CM2 M;  5IWA C;  5C3E I;  5CZV A;  4RVD A;  3TDH B;  2E5L C;  1USP A;  3CCL Z;  4DR4 C;  2E8F A;  3LNO A;  3E7X A;  1VQN 1;  2E7Z A;  2ONF A;  1K9M 1;  4G37 A;  5BSM A;  1K8A 1;  2JNV A;  1MXB A;  1WCJ A;  2ZZM A;  4JM1 A;  1VQM 1;  2E8C A;  2H85 A;  2DHM A;  2GU2 A;  1RQF A;  3GTG I;  3LAX A;  1AMU A;  1Y8C A;  1SIW A;  2IZ4 A;  1MXC A;  4QTU A;  1YHQ Z;  4RS4 A;  3TQI A;  4RVF A;  3CCL 1;  1TFI A;  4PUG A;  3HOY I;  2V3V A;  3PO3 I;  5KYV A;  4R0M A;  1M1K 1;  4LF8 C;  1LCI A;  2NVX I;  2JA7 I;  2WB1 A;  3CCJ Z;  3GR1 A;  2RHB A;  4BBR I;  3IF8 A;  4BY1 I;  4OYC A;  2QRD B;  1N2F A;  2JIO A;  3B7W A;  1YI2 Z;  5AE2 A;  1L1O C;  1MKY A;  4DCU A;  4BCA A;  3AF6 A;  1YIJ Z;  5A2Q b;  3KXW A;  4K0K C;  1FUG A;  3ETO A;  1I3Q I;  2JA6 I;  3RV2 A;  3NH5 A;  4OX9 C;  1HH2 P;  2QVY X;  2UUC C;  4WS9 A;  3OW2 Y;  2Y27 A;  3I08 A;  3IPL A;  4NBB A;  3H2T A;  2M6N A;  2Q4Z A;  2V7B A;  2QEX Z;  4JI8 C;  4FTF A;  2OPL A;  4WV3 A;  4MD7 A;  4BBY A;  4BSZ A;  4JI1 C;  1VQO 1;  5IT9 D;  2O53 A;  3CCU Z;  4IR7 A;  4ISB A;  5FLX b;  2WD9 A;  1VQ4 1;  3CPW Y;  2AYA A;  2E9H A;  1FJG C;  3IML A;  4PUI A;  4LFA C;  4D56 A;  3LGX A;  1TWC I;  1PG4 A;  3J81 b;  1Q81 2;  1P7L A;  3L95 X;  1O90 A;  1VQ8 Z;  3CCM 1;  4DG9 A;  3TE5 B;  1Q86 1;  3CD6 1;  1HNX C;  1IBK C;  3JAM f;  4DCT A;  1V60 A;  2RBL A;  4Y7N I;  2ZM6 C;  2QL8 A;  4NH1 C;  3CCS Z;  1XNQ C;  1ZB9 A;  3CCJ 1;  4RVH A;  3CC2 Z;  4A3M I;  2F4V C;  4AQY C;  2QRC B;  1VQ7 1;  1EGA A;  3I56 1;  3R44 A;  2DE7 A;  3G4S 1;  2I3C A;  1WW9 A;  2G2K A;  4HGZ A;  4EWC A;  4NBF A;  4RVO A;  5C4J I;  2QA4 1;  1QVF Y;  3S82 A;  3TUF A;  3CMA Z;  1ZH1 A;  2JR6 A;  5T67 A;  1VQN Z;  1N8R 2;  3CCQ 1;  1VQK Z;  1L2F A;  4OXI A;  5IP9 I;  4DCV A;  2OTJ Z;  1I6H I;  2KI7 B;  4MD9 A;  3E7W A;  1X3W A;  3I55 1;  4ODJ A;  3T1H C;  2GTI A;  4B3M C;  2QRE B;  3S2D I;  2OTJ 1;  4A3G I;  4PUH A;  4LF4 C;  1VQ9 Z;  2DE6 A;  5AN9 F;  4DR6 C;  2LIY A;  2JIR A;  4A3D I;  4LF5 C;  2E2I I;  3GTK I;  5T8S A;  1QXF A;  3CCM Z;  3JAM b;  2OOY B;  3CCE Z;  1KC8 2;  1QWI A;  4L2Z A;  3MZL B;  4A3F I;  2CXC A;  4ZJZ A;  4TNU A;  1MXA A;  2D1R A;  1YJ7 A;  3NI2 A;  4JI0 C;  2XR1 A;  2VQF C;  1WJ2 A;  3A25 A;  1Y1W I;  3RZD I;  3IEU A;  4MTN A;  2YAD A;  3OW2 Z;  2RT9 A;  2VPZ A;  3D2L A;  1N34 C;  1WCM I;  2QVX X;  1QF8 A;  4NOZ A;  3U50 C;  1YJ9 Z;  4DV0 C;  2VPY A;  3CC7 1;  3CQ2 A;  3A4I A;  2R93 I;  2UXC C;  5BSR A;  2YX1 A;  2JIM A;  1VQ4 Z;  2RIQ A;  3M3Y I;  5IFI A;  1IB8 A;  3SO4 A;  2UXB C;  1WZN A;  3PBK A;  1FDI A;  2CU6 A;  3S1N I;  3TDE A;  3VNQ A;  3AY0 A;  4MXU A;  3CXC Z;  4DV7 C;  2AKL A;  2DE5 A;  1KQS Z;  4X64 C;  2VUM I;  3H3V J;  3VB9 A;  3EED A;  3CCR Z;  3CW8 X;  1YJ9 1;  5LCI A;  1IBM C;  3GTQ I;  2PT7 G;  1UKK A;  4BC7 A;  3TR3 A;  4LF6 C;  3UEB A;  1PG3 A;  2PMZ A;  4U5Y D;  1P9N A;  3NYQ A;  3OTO C;  1JJ2 Y;  3CQ1 A;  1XHJ A;  2M48 A;  4HH4 A;  1Q82 2;  3PO3 S;  3CXC Y;  2E2H I;  1T5H X;  3BG0 B;  3K7A I;  3CW9 A;  4X6A I;  5A19 A;  3R9W A;  1VQ5 Z;  3HKZ A;  2OBV A;  1QYP A;  4DV3 C;  3VMH A;  2K3R A;  2V8K A;  2D27 A;  3H0G I;  3R9X A;  2M5H A;  4R1M A;  3S17 I;  3G6E Z;  2JUB A;  2KDN A;  4E31 A;  3HOV I;  1YJN Z;  3A9U A;  2OTL Z;  1ULT A;  3VNR A;  1JJ2 Z;  3T4N B;  3GTO I;  3G71 1;  1WII A;  4G1I A;  4JI2 C;  4MH4 A;  4BC9 A;  2R92 I;  1YIT 1;  2P2F A;  1TWG I;  4E2W A;  1BA3 A;  3K6R A;  2BJO A;  4YHH C;  4DV1 C;  1VQP 1;  2Y0S A;  4NB8 A;  3GTM S;  3FQM A;  3IEV A;  1KKG A;  3I07 A;  2OZK A;  4BBS I;  5IT9 f;  1M90 1;  1O93 A;  1VQ8 1;  2OPL B;  2LEX A;  4DK1 A;  1M90 2;  5BUQ A;  4NBH A;  3CCV 1;  5FLX D;  4D4I A;  1KD1 2;  3G71 Z;  1I94 C;  1YUA A;  3CC2 1;  2WP0 C;  5A2Q D;  1TWF I;  3GKQ A;  1QM4 A;  4A3B I;  4DV5 C;  2P2M A;  4RLF A;  1N32 C;  2GTH A;  1QVF Z;  3GTL I;  5JRH A;  5BR8 C;  2NVQ I;  1NY8 A;  2YWC A;  3ESW A;  4D57 A;  5BSW A;  4KTV A;  3CJE A;  1NJI 2;  2D7V A;  1Z02 A;  1IBL C;  3CQZ I;  1X0T A;  4L7I A;  4E2X A;  3S16 I;  3AF5 A;  1HNZ C;  4S1T A;  2M5O A;  1ML8 A;  2D28 C;  4LF9 C;  1VQ7 Z;  1Y1V S;  3RZO I;  4B3R C;  2UU9 C;  4KHP C;  2PM9 A;  1YJW Z;  1NJI 1;  4EAT A;  1RO0 A;  4RM3 A;  1R9T I;  5CZX A;  2OTL 1;  4A93 I;  1M6X A;  2Q51 A;  3P5J B;  2NVY I;  1S72 Z;  5LMU C;  4BXX I;  3HOW I;  2Z51 A;  4RVN A;  1Q82 1;  1NYE A;  5T8T A;  1PFT A;  2JMO A;  4JI3 C;  4LFC C;  3CD6 Z;  5AE1 A;  1J5E C;  1VQ5 1;  1RO2 A;  2E0G A;  3GKU A;  1YI2 1;  5A2Q f;  1RLY A;  2RPR A;  4RLQ A;  4JV5 C;  1S7M A;  5T6B A;  4YY3 C;  4DR7 C;  3CME Z;  5BUS A;  4K0B A;  1NP6 A;  1Q81 1;  3NFZ A;  2NVT I;  4XX2 A;  4A3E I;  2UXD C;  5BSV A;  2ZAE B;  5K8F A;  5BST A;  1USP B;  5KYT A;  2VZE A;  2E7G A;  2PN2 A;  2HF1 A;  4RMN A;  3I4M I;  3EQ6 A;  2AYD A;  1RO4 A;  4Y52 I;  4B3S C;  4NFR A;  2V8I A;  3PRO C;  3J80 b;  4E2Z A;  1JOS A;  3UX2 A;  1NUI A;  4ZLP A;  4NBD A;  3VMG A;  1PU1 A;  4R1L A;  5IP7 I;  3BG1 B;  3IR7 A;  1TWH I;  2QA4 Z;  4PRO C;  1VQ9 1;  4FUT A;  3M4O I;  2NCL A;  2VQE C;  1KQS Y;  1M6X C;  1Q7Y 2;  3NYR A;  2EGT A;  5T64 A;  3PES A;  1P4E A;  1VQ6 1;  4MON A;  1XRB A;  1K83 I;  4DV6 C;  3A9V A;  3UX3 A;  2R6M A;  2KZF A;  4GKJ C;  2JMP A;  4DR1 C;  1RY2 A;  2ASB A;  2Y4N A;  4DUZ C;  1XRC A;  4DG8 A;  1VQ6 Z;  3G6E 1;  2B63 I;  5KEI A;  3GCF A;  2P02 A;  3T1Y C;  3NDI A;  4NBE A;  3S1R I;  1TWA I;  1SFO I;  4NXN C;  2F4M A;  3FQQ A;  2HJG A;  4JI6 C;  1RNI A;  4GKK C;  4NBG A;  3CCQ Z;  4I9G A;  3GR0 A;  2UUB C;  5DV9 A;  2NAP A;  3CMA 1;  2HU9 A;  2MM9 A;  5BSU A;  1VQO Z;  1O92 A;  4A3L I;  1XMQ C;  4MRI A;  2JIQ A;  1TH5 A;  3I56 Z;  3N2Q A;  5LL6 f;  2IZ3 A;  2QEX 1;  4E2Y A;  1MDB A;  4JI5 C;  2W03 A;  3S14 I;  4D4G A;  5BUR A;  2D1Q A;  2YWB A;  2O4H A;  2R7Z I;  1YJN 1;  5AE3 A;  3VTN A;  4NDN A;  4PZP A;  1VEH A;  4NXM C;  4JYA C;  2J6A A;  5E7Q A;  2P2B A;  3J81 f;  3HOZ I;  5K85 A;  4A3I I;  1HNW C;  1KC8 1;  2QR1 B;  3EER A;  2VPX A;  2VSQ A;  3GPC A;  3I4N I;  4DV2 C;  4MD8 A;  2JNY A;  2PRO A;  1GPM A;  1XS3 A;  2W04 A;  2QKD A;  4HPV A;  3D6W A;  2VF1 A;  5FLX f;  1HR0 C;  3D9X A;  3NH4 A;  1N36 C;  2D1T A;  2K5R A;  3LNV A;  2CY1 A;  3HOX I;  3S15 I;  4IZ6 A;  2YCB A;  4X62 C;  4NBC A;  3CCU 1;  2V45 A;  2UUA C;  3FCC A;  1VLA A;  1YHQ 1;  4GXQ A;  1O9T A;  5H9U A;  4DUY C;  3RG2 A;  2F4O A;  1YIJ 1;  3O2E A;  3G7S A;  3CQ3 A;  3DAY A;  3CC7 Z;  4NBA A;  4KTT A;  2WAQ A;  1V25 A;  2ZZN A;  4JI4 C;  5C4X I;  1Q16 A;  4DGL A;  3DHV A;  3PO2 I;  2QW0 X;  4I9F A;  1JWH C;  1RG9 A;  2P2J A;  2JS4 A;  3KIH A;  3CCV Z;  1K0R A;  3NDJ A;  2P2Q A;  1P4E C;  5ADZ A;  2KZ0 A;  3J80 D; 
#chains in the Genus database with same CATH homology
 3ETC A;  2OOX B;  3VMI A;  1WF3 A;  1K9M 2;  3DLP X;  2VUG A;  4AYB A;  1K73 1;  2YU9 I;  1K73 2;  4LF7 C;  3J7A 4;  5D1P A;  1QVG Z;  4LFB C;  3VNS A;  3NH8 A;  4L4Q A;  3KIF A;  2E2J I;  4DV4 C;  1Z03 A;  2OO4 A;  3IX0 A;  2D1S A;  2P20 A;  4B3T C;  1VQL 1;  1VQM Z;  3LUS A;  4NB9 A;  2QLV B;  4DCS A;  5A1I A;  1VQL Z;  3GTM I;  1VQK 1;  3N54 B;  3J80 f;  1KD1 1;  2JA8 I;  2E8E A;  2HHH C;  1MD9 A;  2KPI A;  2DYJ A;  3G4S Z;  1X3Z A;  4DR3 C;  4LE5 A;  1MDF A;  3NPD A;  1XMO C;  1N33 C;  3CME 1;  1K8A 2;  4X66 C;  1XNR C;  1XRA A;  4A3J I;  5LMN C;  3CCR 1;  1I50 I;  1W2B Z;  3Q87 A;  2PK7 A;  3C5E A;  2JA5 I;  4RV9 A;  1Q7Y 1;  1DL6 A;  2ATW A;  1LQL A;  3GTJ I;  2BH1 X;  4E32 A;  4GXR A;  3HOU I;  1YUK A;  1S72 1;  4TPS B;  1QVG Y;  2QVZ X;  2P3Y A;  1M1K 2;  2LFU A;  3CC4 1;  3S2H I;  4E33 A;  3CCS 1;  5FLM I;  1YJW 1;  1WH9 A;  5GTD A;  3MON A;  4DR5 C;  4BY7 I;  1V26 A;  4FUQ A;  4A3K I;  1ZB8 A;  3S1M I;  1Y1V I;  1Q86 2;  4G36 A;  3J81 D;  4GS5 A;  3CPW Z;  3F3F C;  5A1G A;  3JAM D;  2DPL A;  2P28 A;  5D1O A;  3L8C A;  5C44 I;  3UZ0 A;  4DQY B;  4E30 A;  3MZK B;  5IT9 b;  3UOW A;  4RVG A;  3GTP I;  4DR2 C;  5D1O B;  3S1Q I;  4HGY A;  3F3P C;  1PA4 A;  3FKI I;  2V8J A;  1Z01 A;  4RM2 A;  1VQP Z;  1N8R 1;  3QWU A;  4X65 C;  1KRL A;  3CCE 1;  3FCE A;  4JI7 C;  4CL1 A;  1T5D X;  3IFU A;  1YIT Z;  4A3C I;  2Y4O A;  3CC4 Z;  4PHT A;  4QTT A;  1W2B Y;  3I55 Z;  5CM2 M;  5IWA C;  5C3E I;  5CZV A;  4RVD A;  3TDH B;  2E5L C;  1USP A;  3CCL Z;  4DR4 C;  2E8F A;  3E7X A;  1VQN 1;  2ONF A;  1K9M 1;  4G37 A;  5BSM A;  1K8A 1;  1MXB A;  4JM1 A;  1VQM 1;  2E8C A;  2H85 A;  2GU2 A;  1RQF A;  3GTG I;  3LAX A;  1AMU A;  2IZ4 A;  1MXC A;  4QTU A;  1YHQ Z;  4RS4 A;  3TQI A;  4RVF A;  3CCL 1;  1TFI A;  3HOY I;  3PO3 I;  5KYV A;  4R0M A;  1M1K 1;  4LF8 C;  1LCI A;  2NVX I;  2JA7 I;  2WB1 A;  3CCJ Z;  3GR1 A;  2RHB A;  4BBR I;  3IF8 A;  4BY1 I;  4OYC A;  2QRD B;  1N2F A;  3B7W A;  1YI2 Z;  5AE2 A;  1L1O C;  1MKY A;  4DCU A;  4BCA A;  3AF6 A;  1YIJ Z;  5A2Q b;  3KXW A;  4K0K C;  1FUG A;  3ETO A;  1I3Q I;  2JA6 I;  3RV2 A;  3NH5 A;  4OX9 C;  1HH2 P;  2QVY X;  2UUC C;  4WS9 A;  3OW2 Y;  2Y27 A;  3I08 A;  3IPL A;  4NBB A;  3H2T A;  2M6N A;  2Q4Z A;  2V7B A;  2QEX Z;  4JI8 C;  4FTF A;  2OPL A;  4WV3 A;  4MD7 A;  4BBY A;  4BSZ A;  4JI1 C;  1VQO 1;  5IT9 D;  2O53 A;  3CCU Z;  4IR7 A;  4ISB A;  5FLX b;  2WD9 A;  1VQ4 1;  3CPW Y;  2AYA A;  2E9H A;  1FJG C;  3IML A;  4LFA C;  4D56 A;  3LGX A;  1TWC I;  1PG4 A;  3J81 b;  1Q81 2;  1P7L A;  3L95 X;  1O90 A;  1VQ8 Z;  3CCM 1;  4DG9 A;  3TE5 B;  1Q86 1;  3CD6 1;  1HNX C;  1IBK C;  3JAM f;  4DCT A;  2RBL A;  4Y7N I;  2ZM6 C;  2QL8 A;  4NH1 C;  3CCS Z;  1XNQ C;  1ZB9 A;  3CCJ 1;  4RVH A;  3CC2 Z;  4A3M I;  2F4V C;  4AQY C;  2QRC B;  1VQ7 1;  1EGA A;  3I56 1;  3R44 A;  2DE7 A;  3G4S 1;  2I3C A;  1WW9 A;  2G2K A;  4HGZ A;  4EWC A;  4NBF A;  4RVO A;  5C4J I;  2QA4 1;  1QVF Y;  3S82 A;  3TUF A;  3CMA Z;  1ZH1 A;  2JR6 A;  5T67 A;  1VQN Z;  1N8R 2;  3CCQ 1;  1VQK Z;  1L2F A;  4OXI A;  5IP9 I;  4DCV A;  2OTJ Z;  1I6H I;  2KI7 B;  4MD9 A;  3E7W A;  1X3W A;  3I55 1;  4ODJ A;  3T1H C;  2GTI A;  4B3M C;  2QRE B;  3S2D I;  2OTJ 1;  4A3G I;  4LF4 C;  4DR6 C;  1VQ9 Z;  2DE6 A;  5AN9 F;  2LIY A;  4A3D I;  4LF5 C;  2E2I I;  3GTK I;  5T8S A;  3CCM Z;  3JAM b;  2OOY B;  3CCE Z;  1KC8 2;  1QWI A;  4L2Z A;  3MZL B;  4A3F I;  2CXC A;  4ZJZ A;  4TNU A;  1MXA A;  2D1R A;  1YJ7 A;  3NI2 A;  4JI0 C;  2XR1 A;  2VQF C;  1Y1W I;  3RZD I;  3IEU A;  4MTN A;  2YAD A;  3OW2 Z;  2RT9 A;  1N34 C;  1WCM I;  2QVX X;  1QF8 A;  4NOZ A;  3U50 C;  1YJ9 Z;  4DV0 C;  3CC7 1;  2UXC C;  3A4I A;  2R93 I;  5BSR A;  1VQ4 Z;  2RIQ A;  3M3Y I;  5IFI A;  3SO4 A;  2UXB C;  3PBK A;  3TDE A;  3S1N I;  3VNQ A;  4MXU A;  3CXC Z;  4DV7 C;  2AKL A;  2DE5 A;  1KQS Z;  4X64 C;  2VUM I;  3H3V J;  3VB9 A;  3EED A;  3CCR Z;  3CW8 X;  1YJ9 1;  1IBM C;  3GTQ I;  2PT7 G;  1UKK A;  4BC7 A;  4LF6 C;  1PG3 A;  2PMZ A;  4U5Y D;  1P9N A;  3NYQ A;  3OTO C;  1JJ2 Y;  2M48 A;  4HH4 A;  1Q82 2;  3PO3 S;  3CXC Y;  2E2H I;  1T5H X;  3BG0 B;  3K7A I;  3CW9 A;  4X6A I;  5A19 A;  3R9W A;  1VQ5 Z;  3HKZ A;  2OBV A;  1QYP A;  4DV3 C;  3VMH A;  2K3R A;  2V8K A;  2D27 A;  3H0G I;  3R9X A;  4R1M A;  3S17 I;  3G6E Z;  2JUB A;  4E31 A;  3HOV I;  1YJN Z;  3A9U A;  2OTL Z;  1ULT A;  3VNR A;  1JJ2 Z;  3T4N B;  3GTO I;  3G71 1;  1WII A;  4G1I A;  4JI2 C;  4MH4 A;  4BC9 A;  2R92 I;  1YIT 1;  2P2F A;  1TWG I;  4E2W A;  1BA3 A;  2BJO A;  4YHH C;  4DV1 C;  1VQP 1;  2Y0S A;  4NB8 A;  3GTM S;  3FQM A;  3IEV A;  1KKG A;  3I07 A;  2OZK A;  4BBS I;  5IT9 f;  1M90 1;  1O93 A;  1VQ8 1;  2OPL B;  1M90 2;  4DK1 A;  5BUQ A;  5FLX D;  4NBH A;  3CCV 1;  4D4I A;  1KD1 2;  3G71 Z;  1I94 C;  1YUA A;  3CC2 1;  2WP0 C;  5A2Q D;  1TWF I;  3GKQ A;  1QM4 A;  4A3B I;  4DV5 C;  2P2M A;  4RLF A;  1N32 C;  2GTH A;  1QVF Z;  3GTL I;  5JRH A;  5BR8 C;  2NVQ I;  2YWC A;  5BSW A;  3ESW A;  4D57 A;  4KTV A;  3CJE A;  1NJI 2;  2D7V A;  1Z02 A;  1IBL C;  3CQZ I;  1X0T A;  4L7I A;  4E2X A;  3S16 I;  3AF5 A;  1HNZ C;  4S1T A;  1ML8 A;  2D28 C;  4LF9 C;  1VQ7 Z;  1Y1V S;  3RZO I;  4B3R C;  2UU9 C;  4KHP C;  2PM9 A;  1YJW Z;  1NJI 1;  4EAT A;  1RO0 A;  4RM3 A;  1R9T I;  5CZX A;  2OTL 1;  4A93 I;  2Q51 A;  3P5J B;  2NVY I;  1S72 Z;  5LMU C;  4BXX I;  3HOW I;  4RVN A;  1Q82 1;  1NYE A;  5T8T A;  1PFT A;  2JMO A;  4JI3 C;  4LFC C;  3CD6 Z;  5AE1 A;  1J5E C;  1VQ5 1;  1RO2 A;  2E0G A;  3GKU A;  1YI2 1;  5A2Q f;  1RLY A;  2RPR A;  4RLQ A;  4JV5 C;  1S7M A;  5T6B A;  4YY3 C;  4DR7 C;  3CME Z;  5BUS A;  4K0B A;  1NP6 A;  1Q81 1;  3NFZ A;  2NVT I;  4XX2 A;  4A3E I;  2UXD C;  5BSV A;  2ZAE B;  5K8F A;  5BST A;  1USP B;  5KYT A;  2VZE A;  2E7G A;  2PN2 A;  2HF1 A;  4RMN A;  3I4M I;  3EQ6 A;  1RO4 A;  4Y52 I;  4B3S C;  4NFR A;  2V8I A;  3PRO C;  3J80 b;  4E2Z A;  1JOS A;  1NUI A;  4ZLP A;  4NBD A;  3VMG A;  4R1L A;  5IP7 I;  3BG1 B;  1TWH I;  2QA4 Z;  4PRO C;  1VQ9 1;  4FUT A;  3M4O I;  2VQE C;  1KQS Y;  1Q7Y 2;  3NYR A;  2EGT A;  5T64 A;  3PES A;  1VQ6 1;  4MON A;  1XRB A;  1K83 I;  4DV6 C;  3A9V A;  2R6M A;  2KZF A;  4GKJ C;  2JMP A;  4DR1 C;  1RY2 A;  2ASB A;  2Y4N A;  4DUZ C;  1XRC A;  4DG8 A;  1VQ6 Z;  3G6E 1;  2B63 I;  5KEI A;  3GCF A;  2P02 A;  3T1Y C;  3NDI A;  4NBE A;  3S1R I;  1TWA I;  1SFO I;  4NXN C;  2F4M A;  3FQQ A;  2HJG A;  4JI6 C;  1RNI A;  4GKK C;  4NBG A;  3CCQ Z;  4I9G A;  3GR0 A;  2UUB C;  5DV9 A;  3CMA 1;  2HU9 A;  5BSU A;  1VQO Z;  1O92 A;  4A3L I;  1XMQ C;  4MRI A;  3I56 Z;  3N2Q A;  5LL6 f;  2IZ3 A;  2QEX 1;  4E2Y A;  1MDB A;  4JI5 C;  2W03 A;  3S14 I;  4D4G A;  5BUR A;  2D1Q A;  2YWB A;  2O4H A;  2R7Z I;  1YJN 1;  5AE3 A;  3VTN A;  4NDN A;  4PZP A;  4NXM C;  4JYA C;  2J6A A;  5E7Q A;  2P2B A;  3J81 f;  3HOZ I;  5K85 A;  4A3I I;  1HNW C;  1KC8 1;  2QR1 B;  3EER A;  4DV2 C;  2VSQ A;  3GPC A;  3I4N I;  4MD8 A;  2JNY A;  2PRO A;  1GPM A;  2W04 A;  2QKD A;  4HPV A;  3D6W A;  2VF1 A;  5FLX f;  1HR0 C;  3D9X A;  3NH4 A;  1N36 C;  2D1T A;  2K5R A;  3LNV A;  2CY1 A;  3HOX I;  3S15 I;  4IZ6 A;  2YCB A;  4X62 C;  4NBC A;  3CCU 1;  2UUA C;  3FCC A;  1VLA A;  1YHQ 1;  4GXQ A;  1O9T A;  5H9U A;  4DUY C;  3RG2 A;  2F4O A;  1YIJ 1;  3G7S A;  3DAY A;  3CC7 Z;  4NBA A;  4KTT A;  2WAQ A;  1V25 A;  4JI4 C;  5C4X I;  4DGL A;  3DHV A;  3PO2 I;  2QW0 X;  4I9F A;  1JWH C;  1RG9 A;  2P2J A;  2JS4 A;  3KIH A;  3CCV Z;  1K0R A;  3NDJ A;  2P2Q A;  5ADZ A;  3J80 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...