4MH4A

Crystal structure of osmc-like protein from burkholderia cenocepacia j2315
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
SKIEKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAVDAEVDLGTAGNAYFLQARLNVSVPGLERDVAQRIVDAAHQTCPYSKATRGNIDVDIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OsmC-like protein
publication title Crystal Structure of OsmC-like protein from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Protein binding
total genus 31
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mh4A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4mh4A02
1IBMC 3HOVI 2OPLA 4BXXI 3GTKI 1QWIA 3OTOC 2DE6A 3VMHA 3VMIA 4B3RC 3GTLI 4OX9C 4DV5C 4LFCC 1TWFI 4NBFA 3PO3I 5FLXD 4NBEA 4DV6C 4A3BI 1N32C 2KPIA 4A3JI 1RO4A 4JI7C 3S1MI 2UUAC 2VQEC 1J5EC 3PO3S 4JI1C 1XNRC 3GTPI 3S17I 4X6AI 2JA7I 3U50C 4A3EI 3GTOI 1USPB 1N34C 5C4XI 4DUYC 2JNYA 3GCFA 1ZB8A 4MH4A 2E7GA 4DUZC 5C3EI 2UXDC 4NOZA 4LFAC 4DV1C 4A3KI 4DCSA 2E2JI 2CXCA 4GKJC 2E2II 5LMNC 2NVYI 4DR6C 1SFOI 3LUSA 4LF7C 4DV3C 1XMOC 4BSZA 4DR3C 3GTMI 1NYEA 2UXBC 2NVQI 3HOXI 4MTNA 4B3SC 4DV0C 3GTJI 4JI4C 3Q87A 2VUMI 1TWGI 1K0RA 3CJEA 1R9TI 1Y1WI 1X3ZA 4AQYC 4DV7C 1L2FA 4DR5C 1I50I 4Y52I 4B3TC 1HNZC 3K7AI 4A3LI 4BBRI 4QTUA 3S14I 1I3QI 2PT7G 4JI3C 4DR7C 5IP9I 2PK7A 4X66C 1I6HI 3FKII 2DYJA 3S1QI 3RZOI 3VB9A 3S1RI 1TWHI 4DCTA 2E8CA 2K5RA 1DL6A 4LF8C 1WH9A 1WCMI 2NVTI 1HNXC 1ZB9A 2ONFA 4NXMC 4NBDA 2JS4A 3GKQA 4JI0C 1HR0C 3H3VJ 5IT9D 3D6WA 1KKGA 2RBLA 2R7ZI 3S2HI 2EGTA 4JI6C 2UUCC 5IWAC 4NXNC 1TWAI 3M3YI 3GTQI 2R92I 1N33C 4K0KC 1HNWC 3I4NI 1YUAA 5A2QD 2ASBA 1L1OC 2YU9I 3S15I 4NBGA 2B63I 4DV4C 2OPLB 2F4OA 3EERA 4LFBC 2P3YA 2J6AA 4DCVA 4GKKC 1X3WA 1I94C 4KHPC 1UKKA 4DV2C 3GTGI 3J80D 4DCUA 4A3FI 2UU9C 1TFIA 5IP7I 2ATWA 3PO2I 1FJGC 3R9WA 4NB9A 3HOUI 1RLYA 4NBCA 4X62C 2E8FA 2PN2A 3T1HC 2JA8I 4DR2C 2HHHC 3CQZI 1TWCI 1WW9A 2R93I 2DE7A 1HH2P 1JOSA 4QTTA 2JMPA 4JI5C 3I07A 5LMUC 2E2HI 1Y1VI 1N36C 2E8EA 5CM2M 4NBBA 1PA4A 1LQLA 4JV5C 4Y7NI 2NVXI 2HJGA 2UUBC 4JYAC 2D7VA 4YHHC 4A3II 3IEVA 1Y1VS 1IBKC 2DE5A 3VMGA 4LF6C 3I4MI 1VLAA 5BR8C 3HOYI 3S1NI 3S16I 2UXCC 4A3MI 1NUIA 3AF5A 3JAMD 4A3CI 1PFTA 4NBHA 3T1YC 3H0GI 3S2DI 4A3DI 2F4MA 5C4JI 2CY1A 2JR6A 3GKUA 2JA6I 4LF9C 4A3GI 3AF6A 4BY1I 1K83I 3M4OI 3R9XA 3RZDI 1XNQC 2XR1A 4LF4C 2KZFA 3IEUA 2BJOA 3HOWI 4DR1C 3ESWA 4LF5C 2QL8A 4DR4C 4JI8C 4BY7I 4B3MC 2VQFC 2F4VC 4XX2A 2E5LC 1ML8A 1USPA 4X65C 1IBLC 3HOZI 2YCBA 2AKLA 4X64C 1EGAA 3J81D 4NBAA 3GTMS 2HF1A 1XMQC 1QYPA 5C44I 2JA5I 2ZM6C 4BBSI 1WF3A 1MKYA 4YY3C 1N2FA 4NB8A 5FLMI 4JI2C 4A93I
chains in the Genus database with same CATH superfamily
5D1PA 5FLXf 1WCJA 1IBMC 1Q812 2RIQA 3HOVI 1P4EC 1VQ7Z 2OPLA 1VQ51 1Q862 5AN9F 3GTKI 4BXXI 1QWIA 3CPWY 3CW8X 1VQ4Z 3OTOC 2DE6A 3VMHA 3ETOA 3VMIA 4B3RC 3GR1A 3GTLI 3NPDA 4OX9C 4DV5C 4LFCC 3CCV1 1RNIA 1TWFI 4NBFA 3PO3I 3IX0A 3NYRA 4R1LA 5FLXD 4TPSB 4NBEA 4DV6C 4RVDA 1VQ61 4A3BI 4DQYB 1N32C 2KPIA 2D1QA 2Q4ZA 4A3JI 1VQM1 2R6MA 1RO4A 3EEDA 4JI7C 1N8R2 4RM2A 3S1MI 2UUAC 2QA41 1JJ2Z 2VQEC 3R44A 1J5EC 3PO3S 4JI1C 2RPRA 3LAXA 2M48A 4G36A 1Y8CA 3CMAZ 1XNRC 3NI2A 1NJI1 1KD11 2VPWA 3CCS1 1V26A 3CC7Z 3GTPI 3S17I 2OTLZ 2JA7I 4X6AI 1KRLA 1QXFA 3U50C 3G711 4A3EI 3GTOI 3CQ2A 1JJ2Y 1USPB 1W2BZ 3LNVA 4ISBA 1K8A1 4OYCA 4E2YA 5C4XI 1N34C 5A1GA 4E31A 4DUYC 4D57A 3CC2Z 3RG2A 2JNYA 3GCFA 2NAPA 1ZB8A 4FUTA 4MH4A 2E7GA 3O2EA 2JMOA 4DUZC 5T8TA 5C3EI 2QVZX 3NYQA 2V7BA 2UXDC 4NOZA 4LFAC 4DV1C 3G4S1 4A3KI 4DCSA 2GU2A 3P5JB 2Q51A 1YIJZ 1Q822 2E2JI 2CXCA 5E7QA 4GKJC 2E2II 4IZ6A 3CCE1 4R0MA 3FQQA 3SO4A 5IT9b 4KTTA 5LMNC 2NVYI 4DR6C 1BA3A 1SFOI 3LUSA 4ZLPA 3UEBA 4LF7C 3CCLZ 1PG4A 1XHJA 2OTJ1 1GPMA 3PBKA 4GS5A 4DV3C 1XMOC 4BCAA 5LCIA 3I561 1M1K1 3CCMZ 4L7IA 4RLFA 3MZKB 2BH1X 1NP6A 2QEX1 2MM9A 3UOWA 3TE5B 1HNXC 2KDNA 4BSZA 3I55Z 2GTIA 4DR3C 3J80f 1KC82 3GTMI 1VQOZ 1YUKA 2V45A 3HKZA 3QWUA 1NYEA 4L4QA 3CCR1 2ZZNA 2NVQI 2UXBC 3HOXI 5A2Qb 4MTNA 3I08A 2QVXX 2M6NA 2QLVB 4B3SC 4DV0C 3GTJI 3CC41 1VQ71 2JNVA 4JI4C 3Q87A 2VUMI 4MXUA 1FLOA 1VQ41 5BSRA 1TWGI 1K8A2 3L8CA 1YHQZ 1K0RA 3CJEA 3CD6Z 4DG8A 1R9TI 3UX3A 1Y1WI 1X3ZA 1S72Z 4RLQA 2ZZMA 1VQLZ 2WD9A 2P28A 3MONA 4AQYC 2G2KA 4DK1A 4DV7C 1L2FA 1O93A 1WIIA 4DR5C 1O92A 2P2QA 3G6EZ 1I50I 3OW2Z 4HGYA 4Y52I 4RV9A 5LL6f 2VUGA 4RVGA 4B3TC 1HNZC 2Z51A 2QRDB 1KQSZ 3K7AI 3PESA 5BUSA 1VQKZ 4D56A 3J80b 4A3LI 3NFZA 4HPVA 4BBRI 3OW2Y 2JIPA 2E7ZA 2RHBA 1I3QI 4QTUA 1YI2Z 3CMA1 3S14I 2PT7G 4JI3C 4DR7C 3EQ6A 5IP9I 2PK7A 3CC71 3UZ0A 2OTL1 2OOYB 4X66C 1I6HI 1KQSY 4U5YD 3FKII 2DYJA 1K732 4PUGA 3S1QI 3RZOI 1AMUA 2MMAB 1M1K2 3NDJA 3VB9A 5D1OA 4K0BA 5CZVA 3S1RI 3A26A 3CC21 4E30A 1TWHI 1QVGY 1K9M2 4DCTA 5K85A 3J81b 5BUQA 2WAQA 1M901 2E8CA 3H2TA 1XRCA 4KTVA 2IZ3A 2K5RA 4EATA 1DL6A 4LF8C 4HGZA 1Q7Y1 1VQ8Z 4I9GA 1YJ9Z 1Z01A 5IT9f 1YIJ1 3NH5A 1VEHA 1WH9A 1WCMI 2NVTI 2P2BA 3CCQZ 4D4IA 1ZB9A 5T67A 2ONFA 3S82A 1P4EA 2QREB 2MCQA 4NXMC 5T6BA 2YWBA 4NBDA 2JS4A 3GKQA 1TH5A 4JI0C 3C5EA 1HR0C 1QVFZ 2Y4NA 3VNSA 5AE1A 3CCL1 4IR7A 3H3VJ 5IT9D 3E7XA 3D6WA 1YITZ 1MDFA 4MD7A 3CCM1 4RMNA 1XS3A 1KKGA 2DHMA 4NDNA 3CQ1A 2RBLA 2R7ZI 3VNRA 4WV3A 3S2HI 1UWDA 3FCEA 2JIRA 1QVFY 2V8KA 5A2Qf 1RG9A 2EGTA 3I551 4JI6C 1M6XC 2UUCC 5IWAC 1XRBA 1VQ91 1VQO1 4NXNC 1TWAI 4CL1A 3M3YI 3GTQI 3CCUZ 3UX2A 2E0GA 4BC7A 2R92I 3TQIA 4LE5A 1N33C 3JAMb 4K0KC 2V3VA 1HNWC 4BBYA 3I4NI 1YUAA 5A2QD 2ASBA 2KI7B 1L1OC 2YU9I 3S15I 3VNQA 4NBGA 3TUFA 3GR0A 3IPLA 1X0TA 2IV2X 2B63I 1O90A 3NH8A 1Z03A 3IMLA 5A1IA 3CME1 1YHQ1 4JM1A 1VQNZ 1QM4A 3CD61 5BSWA 1VQL1 4DV4C 1M6XA 3D9XA 2OPLB 1PU1A 2F4OA 3G6E1 3J7A4 4ODJA 2DPLA 4RVNA 3TR3A 3FQMA 2QW0X 2YADA 3EERA 1Q811 4LFBC 1QF8A 2D28C 4FTFA 1Q861 2P3YA 2J6AA 1VQK1 4DCVA 4GKKC 3DHVA 2AYAA 2JIQA 3CQ3A 1X3WA 2LEXA 1YI21 1NJI2 1KD12 1I94C 4KHPC 2P2FA 5KYTA 1UKKA 3J80D 3GTGI 4DV2C 5GTDA 2LIYA 1FDOA 3NH4A 4DCUA 4A3FI 2UU9C 1V60A 1TFIA 5IP7I 3J81f 2ATWA 3PO2I 2Y0SA 1YJNZ 2O4HA 3F3PC 3TDHB 1FJGC 3CCJZ 4L2ZA 3N54B 1XRAA 2M5HA 4PUIA 3R9WA 1RQFA 4NB9A 5KYVA 2Y27A 2E9HA 5BSVA 1Z02A 1MXCA 1LCIA 3PROC 4RVOA 1ZH1A 2KZ0A 3HOUI 3A9VA 1RLYA 4NBCA 4ZJZA 3G7SA 4X62C 1RO2A 1VQ81 1JWHC 1P9NA 2JIMA 1YJ91 2D1RA 2E8FA 2PN2A 3A25A 5BURA 1Q16A 2P20A 5KEIA 2JA8I 5K8FA 3T1HC 3CCQ1 4DR2C 2HHHC 3CQZI 1TWCI 4GXRA 1WW9A 2R93I 2DE7A 4MD9A 3IF8A 4QTTA 1HH2P 1JOSA 2VSQA 1QVGZ 1YJWZ 2AYDA 2JMPA 4E32A 3I07A 1WJ2A 3KIFA 5LMUC 4JI5C 3L95X 2E2HI 1Y1VI 1N36C 2E8EA 5CM2M 4NBBA 1PA4A 2PM9A 1LQLA 4JV5C 4Y7NI 1YIT1 3BG1B 2RT9A 3KIHA 3A4IA 1MXBA 2NVXI 4R1MA 1VQPZ 4MONA 2HJGA 5IFIA 2UUBC 3BG0B 2GTHA 4JYAC 2D7VA 2PMZA 4NH1C 5AE3A 4YHHC 1MXAA 2CU6A 3A9UA 1AA6A 4RVFA 4A3II 3IEVA 1Y1VS 1IBKC 3JAMf 1RY2A 3CC4Z 4DGLA 2DE5A 3DLPX 3VMGA 3CCU1 1PG3A 2W03A 4E2WA 4LF6C 2VPXA 3I4MI 1VLAA 2YWCA 4WS9A 5BR8C 3HOYI 3S1NI 3S16I 2D27A 5BSMA 2UXCC 4A3MI 1NUIA 2VPYA 4D4GA 2V8IA 1YJ7A 3LGXA 2QR1B 3AF5A 2LFUA 3JAMD 5BSTA 4A3CI 3MZLB 1S7MA 1FDIA 1PFTA 4NBHA 2Y4OA 3T1YC 4PHTA 4E33A 1KC81 4PUHA 1VQN1 3H0GI 2O53A 1RO0A 3F3FC 2P02A 4G37A 5DV9A 3S2DI 4A3DI 2YX1A 3ETCA 2F4MA 3T4NB 2WB1A 5C4JI 2CY1A 2JR6A 2OO4A 2P2MA 3GKUA 4BC9A 2JA6I 3E7WA 4LF9C 1VQ5Z 1V25A 4DG9A 3RV2A 2VZEA 5FLXb 2M5OA 3AY0A 2H85A 3CCVZ 1T5HX 2OZKA 4GXQA 1IB8A 3DAYA 4PROC 4AYBA 4E2ZA 4A3GI 3AF6A 1VQ6Z 2I3CA 4BY1I 1W2BY 1K83I 1MD9A 3M4OI 5T64A 3GPCA 3TDEA 1VQMZ 4RS4A 1YJN1 1S721 1FUGA 2IZ4A 3R9XA 2QA4Z 3CCJ1 2D1SA 3RZDI 1XNQC 2XR1A 2WP0C 2JIOA 4OXIA 4LF4C 2KZFA 3IEUA 5CZXA 2BJOA 3IR7A 3HOWI 1M902 3CCSZ 2QRCB 2OOXB 2OBVA 4MRIA 1Q7Y2 4DR1C 2VF1A 5D1OB 3G71Z 4I9FA 4NFRA 3ESWA 3B7WA 4LF5C 4FUQA 4RM3A 4PZPA 5ADZA 1K731 4G1IA 4EWCA 2QL8A 2QKDA 4S1TA 5AE2A 4DR4C 2PROA 2K3RA 4JI8C 1YJW1 1K9M1 3KXWA 4HH4A 4BY7I 4B3MC 2VQFC 2F4VC 1WZNA 2D1TA 3CXCZ 1MDBA 4XX2A 1VQ9Z 1ML8A 2E5LC 5BSUA 1N8R1 3G4SZ 5A19A 2JUBA 1NY8A 1USPA 1VQP1 4X65C 1IBLC 3HOZI 2YCBA 3CW9A 4MD8A 4TNUA 2AKLA 2NCLA 3CCEZ 2QVYX 3CXCY 4X64C 1EGAA 1T5DX 2HU9A 3J81D 4NBAA 3GTMS 2HF1A 1XMQC 3FCCA 2OTJZ 1SIWA 4RVHA 3CMEZ 1QYPA 2W04A 3NDIA 3I56Z 5C44I 5T8SA 3K6RA 2JA5I 2QEXZ 5H9UA 2ZM6C 4BBSI 3VTNA 1WF3A 1ULTA 1MKYA 4YY3C 1N2FA 3N2QA 2P2JA 4NB8A 5FLMI 3IFUA 1O9TA 3CCRZ 2ZAEB 3CPWZ 2V8JA 4JI2C 1Q821 1P7LA 3LNOA 2VPZA 4E2XA 3D2LA 5JRHA 4A93I
chains in the Genus database with same CATH topology
5D1PA 5FLXf 1IBMC 1Q812 2RIQA 3HOVI 1VQ7Z 2OPLA 1VQ51 1Q862 5AN9F 3GTKI 4BXXI 1QWIA 3CPWY 3CW8X 1VQ4Z 3OTOC 2DE6A 3VMHA 3ETOA 3VMIA 4B3RC 3GR1A 3GTLI 3NPDA 4OX9C 4DV5C 4LFCC 3CCV1 1RNIA 1TWFI 4NBFA 3PO3I 3IX0A 3NYRA 4R1LA 5FLXD 4TPSB 4NBEA 4DV6C 4RVDA 1VQ61 4A3BI 4DQYB 1N32C 2KPIA 2D1QA 2Q4ZA 4A3JI 1VQM1 2R6MA 1RO4A 3EEDA 4JI7C 1N8R2 4RM2A 3S1MI 2UUAC 2QA41 1JJ2Z 2VQEC 3R44A 1J5EC 3PO3S 4JI1C 2RPRA 3LAXA 2M48A 4G36A 3CMAZ 1XNRC 3NI2A 1NJI1 1KD11 3CCS1 1V26A 3CC7Z 3GTPI 3S17I 2OTLZ 2JA7I 4X6AI 1KRLA 3U50C 3G711 4A3EI 3LNVA 3GTOI 4ISBA 1JJ2Y 1USPB 1W2BZ 1K8A1 4OYCA 4E2YA 5C4XI 1N34C 5A1GA 4E31A 4DUYC 4D57A 3CC2Z 3RG2A 2JNYA 3GCFA 4FUTA 1ZB8A 4MH4A 2E7GA 4DUZC 2JMOA 5T8TA 5C3EI 2QVZX 3NYQA 2V7BA 2UXDC 4NOZA 4LFAC 4DV1C 3G4S1 4A3KI 4DCSA 2GU2A 3P5JB 2Q51A 1YIJZ 1Q822 2E2JI 2CXCA 5E7QA 4GKJC 2E2II 4IZ6A 3CCE1 4R0MA 3FQQA 3SO4A 5IT9b 4KTTA 5LMNC 2NVYI 4DR6C 1BA3A 1SFOI 3LUSA 4ZLPA 4LF7C 3CCLZ 1PG4A 3PBKA 2OTJ1 1GPMA 4DV3C 4GS5A 1XMOC 4BCAA 3I561 1M1K1 3CCMZ 4L7IA 4RLFA 3MZKB 2BH1X 1NP6A 2QEX1 3UOWA 3TE5B 4BSZA 3I55Z 2GTIA 4DR3C 3J80f 1KC82 3GTMI 1VQOZ 1YUKA 3QWUA 3HKZA 4L4QA 1NYEA 3CCR1 2UXBC 2NVQI 3HOXI 5A2Qb 4MTNA 3I08A 2QVXX 2M6NA 2QLVB 4B3SC 4DV0C 3GTJI 3CC41 1VQ71 4JI4C 3Q87A 2VUMI 4MXUA 1VQ41 5BSRA 1TWGI 1K8A2 3L8CA 1YHQZ 1K0RA 3CJEA 3CD6Z 4DG8A 1R9TI 1Y1WI 1X3ZA 1S72Z 4RLQA 1VQLZ 2WD9A 2P28A 3MONA 4AQYC 2G2KA 4DK1A 4DV7C 1L2FA 1O93A 1WIIA 4DR5C 1O92A 2P2QA 3G6EZ 1I50I 3OW2Z 4HGYA 4Y52I 4RV9A 5LL6f 2VUGA 4RVGA 4B3TC 1HNZC 2QRDB 1KQSZ 3K7AI 3PESA 5BUSA 1VQKZ 4D56A 3J80b 4A3LI 3NFZA 4HPVA 4BBRI 3OW2Y 4QTUA 2RHBA 1I3QI 1YI2Z 3CMA1 3S14I 2PT7G 4JI3C 4DR7C 3EQ6A 5IP9I 2PK7A 3CC71 3UZ0A 2OTL1 2OOYB 4X66C 1I6HI 1KQSY 4U5YD 3FKII 2DYJA 1K732 3S1QI 3RZOI 1AMUA 1M1K2 3NDJA 3VB9A 5D1OA 4K0BA 5CZVA 3S1RI 3CC21 4E30A 1TWHI 1QVGY 1K9M2 4DCTA 5K85A 3J81b 5BUQA 2WAQA 1M901 2E8CA 3H2TA 1XRCA 4KTVA 2IZ3A 2K5RA 4EATA 1DL6A 4LF8C 4HGZA 1Q7Y1 1VQ8Z 4I9GA 1YJ9Z 1Z01A 5IT9f 1YIJ1 3NH5A 1WH9A 1WCMI 2NVTI 2P2BA 3CCQZ 4D4IA 1ZB9A 5T67A 2ONFA 3S82A 1HNXC 2QREB 4NXMC 5T6BA 2YWBA 4NBDA 2JS4A 3GKQA 4JI0C 3C5EA 1HR0C 1QVFZ 2Y4NA 3VNSA 5AE1A 3CCL1 4IR7A 3H3VJ 5IT9D 3E7XA 3D6WA 1YITZ 1MDFA 4MD7A 3CCM1 4RMNA 1KKGA 4NDNA 2RBLA 2R7ZI 3VNRA 4WV3A 3S2HI 3FCEA 1QVFY 2V8KA 5A2Qf 1RG9A 2EGTA 3I551 4JI6C 2UUCC 5IWAC 1XRBA 1VQ91 1VQO1 4NXNC 1TWAI 4CL1A 3M3YI 3GTQI 3CCUZ 2E0GA 4BC7A 2R92I 3TQIA 4LE5A 1N33C 3JAMb 4K0KC 1HNWC 4BBYA 3I4NI 1YUAA 5A2QD 2ASBA 2KI7B 1L1OC 2YU9I 3S15I 3VNQA 4NBGA 3TUFA 3GR0A 3IPLA 1X0TA 2B63I 1O90A 3NH8A 1Z03A 3IMLA 5A1IA 3CME1 1YHQ1 4JM1A 1VQNZ 1QM4A 3CD61 5BSWA 1VQL1 4DV4C 3D9XA 2OPLB 4ODJA 2F4OA 3G6E1 3J7A4 2DPLA 4RVNA 3FQMA 2QW0X 2YADA 3EERA 1Q811 4LFBC 1QF8A 2D28C 4FTFA 1Q861 2P3YA 2J6AA 1VQK1 4DCVA 4GKKC 3DHVA 2AYAA 1X3WA 1YI21 1NJI2 1KD12 1I94C 4KHPC 2P2FA 5KYTA 1UKKA 3J80D 3GTGI 4DV2C 5GTDA 2LIYA 3NH4A 4DCUA 4A3FI 2UU9C 1TFIA 5IP7I 3J81f 2ATWA 3PO2I 2Y0SA 1YJNZ 2O4HA 3F3PC 3TDHB 1FJGC 3CCJZ 4L2ZA 3N54B 1XRAA 3R9WA 1RQFA 4NB9A 5KYVA 2Y27A 2E9HA 5BSVA 1Z02A 1MXCA 1LCIA 3PROC 4RVOA 1ZH1A 3HOUI 3A9VA 1RLYA 4NBCA 4ZJZA 3G7SA 4X62C 1RO2A 1VQ81 1JWHC 1P9NA 2D1RA 1YJ91 2E8FA 2PN2A 5BURA 5KEIA 2P20A 3T1HC 2JA8I 5K8FA 3CCQ1 4DR2C 2HHHC 3CQZI 1TWCI 4GXRA 1WW9A 2R93I 2DE7A 4MD9A 3IF8A 4QTTA 1HH2P 1JOSA 2VSQA 1QVGZ 1YJWZ 2JMPA 4E32A 3I07A 4JI5C 3KIFA 5LMUC 3L95X 2E2HI 1Y1VI 1N36C 2E8EA 5CM2M 4NBBA 1PA4A 2PM9A 1LQLA 4JV5C 4Y7NI 1YIT1 3BG1B 2RT9A 3KIHA 3A4IA 1MXBA 2NVXI 4R1MA 1VQPZ 4MONA 2HJGA 5IFIA 2UUBC 3BG0B 2GTHA 4JYAC 2D7VA 2PMZA 4NH1C 5AE3A 4YHHC 1MXAA 3A9UA 4A3II 4RVFA 3IEVA 1Y1VS 1IBKC 3JAMf 1RY2A 3CC4Z 4DGLA 2DE5A 3DLPX 3VMGA 3CCU1 1PG3A 2W03A 4E2WA 4LF6C 3I4MI 1VLAA 2YWCA 4WS9A 5BR8C 3HOYI 3S1NI 3S16I 2D27A 5BSMA 2UXCC 4A3MI 1NUIA 4D4GA 2V8IA 1YJ7A 3LGXA 2QR1B 3AF5A 2LFUA 3JAMD 5BSTA 4A3CI 3MZLB 1S7MA 1PFTA 4NBHA 2Y4OA 3T1YC 4PHTA 4E33A 1KC81 1VQN1 3H0GI 2O53A 1RO0A 3F3FC 2P02A 4G37A 5DV9A 3S2DI 4A3DI 3ETCA 2F4MA 3T4NB 2WB1A 5C4JI 2CY1A 2JR6A 2OO4A 2P2MA 3GKUA 4BC9A 2JA6I 3E7WA 4LF9C 1VQ5Z 1V25A 4DG9A 3RV2A 2VZEA 5FLXb 2H85A 3CCVZ 1T5HX 2OZKA 4GXQA 3DAYA 4PROC 4AYBA 4E2ZA 4A3GI 3AF6A 1VQ6Z 2I3CA 4BY1I 1W2BY 1K83I 1MD9A 3M4OI 5T64A 3GPCA 3TDEA 1VQMZ 4RS4A 1YJN1 1S721 1FUGA 2IZ4A 3R9XA 2QA4Z 3CCJ1 2D1SA 3RZDI 1XNQC 2XR1A 2WP0C 4OXIA 4LF4C 2KZFA 3IEUA 5CZXA 2BJOA 3HOWI 1M902 3CCSZ 2QRCB 2OOXB 2OBVA 4MRIA 1Q7Y2 4DR1C 2VF1A 5D1OB 3G71Z 4I9FA 4NFRA 3ESWA 3B7WA 4LF5C 4FUQA 4RM3A 4PZPA 5ADZA 1K731 4G1IA 4EWCA 2QL8A 2QKDA 4S1TA 5AE2A 4DR4C 2PROA 2K3RA 4JI8C 1YJW1 1K9M1 3KXWA 4HH4A 4BY7I 4B3MC 2VQFC 2F4VC 2D1TA 3CXCZ 1MDBA 4XX2A 1VQ9Z 1ML8A 2E5LC 5BSUA 1N8R1 3G4SZ 5A19A 2JUBA 1USPA 1VQP1 4X65C 1IBLC 3HOZI 2YCBA 3CW9A 4MD8A 4TNUA 2AKLA 3CCEZ 2QVYX 3CXCY 4X64C 1EGAA 1T5DX 2HU9A 3J81D 4NBAA 3GTMS 2HF1A 1XMQC 3FCCA 2OTJZ 4RVHA 3CMEZ 1QYPA 2W04A 3NDIA 3I56Z 5C44I 5T8SA 2JA5I 2QEXZ 5H9UA 2ZM6C 4BBSI 3VTNA 1WF3A 1ULTA 1MKYA 4YY3C 1N2FA 3N2QA 2P2JA 4NB8A 5FLMI 3IFUA 1O9TA 3CCRZ 2ZAEB 3CPWZ 2V8JA 4JI2C 1Q821 1P7LA 4E2XA 5JRHA 4A93I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM C;  3HOV I;  2OPL A;  4BXX I;  3GTK I;  1QWI A;  3OTO C;  2DE6 A;  3VMH A;  3VMI A;  4B3R C;  3GTL I;  4OX9 C;  4DV5 C;  4LFC C;  1TWF I;  4NBF A;  3PO3 I;  5FLX D;  4NBE A;  4DV6 C;  4A3B I;  1N32 C;  2KPI A;  4A3J I;  1RO4 A;  4JI7 C;  3S1M I;  2UUA C;  2VQE C;  1J5E C;  3PO3 S;  4JI1 C;  1XNR C;  3GTP I;  3S17 I;  4X6A I;  2JA7 I;  3U50 C;  4A3E I;  3GTO I;  1USP B;  1N34 C;  5C4X I;  4DUY C;  2JNY A;  3GCF A;  1ZB8 A;  4MH4 A;  2E7G A;  4DUZ C;  5C3E I;  2UXD C;  4NOZ A;  4LFA C;  4DV1 C;  4A3K I;  4DCS A;  2E2J I;  2CXC A;  4GKJ C;  2E2I I;  5LMN C;  2NVY I;  4DR6 C;  1SFO I;  3LUS A;  4LF7 C;  4DV3 C;  1XMO C;  4BSZ A;  4DR3 C;  3GTM I;  1NYE A;  2UXB C;  2NVQ I;  3HOX I;  4MTN A;  4B3S C;  4DV0 C;  3GTJ I;  4JI4 C;  3Q87 A;  2VUM I;  1TWG I;  1K0R A;  3CJE A;  1R9T I;  1Y1W I;  1X3Z A;  4AQY C;  4DV7 C;  1L2F A;  4DR5 C;  1I50 I;  4Y52 I;  4B3T C;  1HNZ C;  3K7A I;  4A3L I;  4BBR I;  4QTU A;  3S14 I;  1I3Q I;  2PT7 G;  4JI3 C;  4DR7 C;  5IP9 I;  2PK7 A;  4X66 C;  1I6H I;  3FKI I;  2DYJ A;  3S1Q I;  3RZO I;  3VB9 A;  3S1R I;  1TWH I;  4DCT A;  2E8C A;  2K5R A;  1DL6 A;  4LF8 C;  1WH9 A;  1WCM I;  2NVT I;  1HNX C;  1ZB9 A;  2ONF A;  4NXM C;  4NBD A;  2JS4 A;  3GKQ A;  4JI0 C;  1HR0 C;  3H3V J;  5IT9 D;  3D6W A;  1KKG A;  2RBL A;  2R7Z I;  3S2H I;  2EGT A;  4JI6 C;  2UUC C;  5IWA C;  4NXN C;  1TWA I;  3M3Y I;  3GTQ I;  2R92 I;  1N33 C;  4K0K C;  1HNW C;  3I4N I;  1YUA A;  5A2Q D;  2ASB A;  1L1O C;  2YU9 I;  3S15 I;  4NBG A;  2B63 I;  4DV4 C;  2OPL B;  2F4O A;  3EER A;  4LFB C;  2P3Y A;  2J6A A;  4DCV A;  4GKK C;  1X3W A;  1I94 C;  4KHP C;  1UKK A;  4DV2 C;  3GTG I;  3J80 D;  4DCU A;  4A3F I;  2UU9 C;  1TFI A;  5IP7 I;  2ATW A;  3PO2 I;  1FJG C;  3R9W A;  4NB9 A;  3HOU I;  1RLY A;  4NBC A;  4X62 C;  2E8F A;  2PN2 A;  3T1H C;  2JA8 I;  4DR2 C;  2HHH C;  3CQZ I;  1TWC I;  1WW9 A;  2R93 I;  2DE7 A;  1HH2 P;  1JOS A;  4QTT A;  2JMP A;  4JI5 C;  3I07 A;  5LMU C;  2E2H I;  1Y1V I;  1N36 C;  2E8E A;  5CM2 M;  4NBB A;  1PA4 A;  1LQL A;  4JV5 C;  4Y7N I;  2NVX I;  2HJG A;  2UUB C;  4JYA C;  2D7V A;  4YHH C;  4A3I I;  3IEV A;  1Y1V S;  1IBK C;  2DE5 A;  3VMG A;  4LF6 C;  3I4M I;  1VLA A;  5BR8 C;  3HOY I;  3S1N I;  3S16 I;  2UXC C;  4A3M I;  1NUI A;  3AF5 A;  3JAM D;  4A3C I;  1PFT A;  4NBH A;  3T1Y C;  3H0G I;  3S2D I;  4A3D I;  2F4M A;  5C4J I;  2CY1 A;  2JR6 A;  3GKU A;  2JA6 I;  4LF9 C;  4A3G I;  3AF6 A;  4BY1 I;  1K83 I;  3M4O I;  3R9X A;  3RZD I;  1XNQ C;  2XR1 A;  4LF4 C;  2KZF A;  3IEU A;  2BJO A;  3HOW I;  4DR1 C;  3ESW A;  4LF5 C;  2QL8 A;  4DR4 C;  4JI8 C;  4BY7 I;  4B3M C;  2VQF C;  2F4V C;  4XX2 A;  2E5L C;  1ML8 A;  1USP A;  4X65 C;  1IBL C;  3HOZ I;  2YCB A;  2AKL A;  4X64 C;  1EGA A;  3J81 D;  4NBA A;  3GTM S;  2HF1 A;  1XMQ C;  1QYP A;  5C44 I;  2JA5 I;  2ZM6 C;  4BBS I;  1WF3 A;  1MKY A;  4YY3 C;  1N2F A;  4NB8 A;  5FLM I;  4JI2 C;  4A93 I; 
#chains in the Genus database with same CATH topology
 5D1P A;  5FLX f;  1WCJ A;  1IBM C;  1Q81 2;  2RIQ A;  3HOV I;  1P4E C;  1VQ7 Z;  2OPL A;  1VQ5 1;  1Q86 2;  5AN9 F;  3GTK I;  4BXX I;  1QWI A;  3CPW Y;  3CW8 X;  1VQ4 Z;  3OTO C;  2DE6 A;  3VMH A;  3ETO A;  3VMI A;  4B3R C;  3GR1 A;  3GTL I;  3NPD A;  4OX9 C;  4DV5 C;  4LFC C;  3CCV 1;  1RNI A;  1TWF I;  4NBF A;  3PO3 I;  3IX0 A;  3NYR A;  4R1L A;  5FLX D;  4TPS B;  4NBE A;  4DV6 C;  4RVD A;  1VQ6 1;  4A3B I;  4DQY B;  1N32 C;  2KPI A;  2D1Q A;  2Q4Z A;  4A3J I;  1VQM 1;  2R6M A;  1RO4 A;  3EED A;  4JI7 C;  1N8R 2;  4RM2 A;  3S1M I;  2UUA C;  2QA4 1;  1JJ2 Z;  2VQE C;  3R44 A;  1J5E C;  3PO3 S;  4JI1 C;  2RPR A;  3LAX A;  2M48 A;  4G36 A;  1Y8C A;  3CMA Z;  1XNR C;  3NI2 A;  1NJI 1;  1KD1 1;  2VPW A;  3CCS 1;  1V26 A;  3CC7 Z;  3GTP I;  3S17 I;  2OTL Z;  2JA7 I;  4X6A I;  1KRL A;  1QXF A;  3U50 C;  3G71 1;  4A3E I;  3GTO I;  3CQ2 A;  1JJ2 Y;  1USP B;  1W2B Z;  3LNV A;  4ISB A;  1K8A 1;  4OYC A;  4E2Y A;  5C4X I;  1N34 C;  5A1G A;  4E31 A;  4DUY C;  4D57 A;  3CC2 Z;  3RG2 A;  2JNY A;  3GCF A;  2NAP A;  1ZB8 A;  4FUT A;  4MH4 A;  2E7G A;  3O2E A;  2JMO A;  4DUZ C;  5T8T A;  5C3E I;  2QVZ X;  3NYQ A;  2V7B A;  2UXD C;  4NOZ A;  4LFA C;  4DV1 C;  3G4S 1;  4A3K I;  4DCS A;  2GU2 A;  3P5J B;  2Q51 A;  1YIJ Z;  1Q82 2;  2E2J I;  2CXC A;  5E7Q A;  4GKJ C;  2E2I I;  4IZ6 A;  3CCE 1;  4R0M A;  3FQQ A;  3SO4 A;  5IT9 b;  4KTT A;  5LMN C;  2NVY I;  4DR6 C;  1BA3 A;  1SFO I;  3LUS A;  4ZLP A;  3UEB A;  4LF7 C;  3CCL Z;  1PG4 A;  1XHJ A;  2OTJ 1;  1GPM A;  3PBK A;  4GS5 A;  4DV3 C;  1XMO C;  4BCA A;  5LCI A;  3I56 1;  1M1K 1;  3CCM Z;  4L7I A;  4RLF A;  3MZK B;  2BH1 X;  1NP6 A;  2QEX 1;  2MM9 A;  3UOW A;  3TE5 B;  1HNX C;  2KDN A;  4BSZ A;  3I55 Z;  2GTI A;  4DR3 C;  3J80 f;  1KC8 2;  3GTM I;  1VQO Z;  1YUK A;  2V45 A;  3HKZ A;  3QWU A;  1NYE A;  4L4Q A;  3CCR 1;  2ZZN A;  2NVQ I;  2UXB C;  3HOX I;  5A2Q b;  4MTN A;  3I08 A;  2QVX X;  2M6N A;  2QLV B;  4B3S C;  4DV0 C;  3GTJ I;  3CC4 1;  1VQ7 1;  2JNV A;  4JI4 C;  3Q87 A;  2VUM I;  4MXU A;  1FLO A;  1VQ4 1;  5BSR A;  1TWG I;  1K8A 2;  3L8C A;  1YHQ Z;  1K0R A;  3CJE A;  3CD6 Z;  4DG8 A;  1R9T I;  3UX3 A;  1Y1W I;  1X3Z A;  1S72 Z;  4RLQ A;  2ZZM A;  1VQL Z;  2WD9 A;  2P28 A;  3MON A;  4AQY C;  2G2K A;  4DK1 A;  4DV7 C;  1L2F A;  1O93 A;  1WII A;  4DR5 C;  1O92 A;  2P2Q A;  3G6E Z;  1I50 I;  3OW2 Z;  4HGY A;  4Y52 I;  4RV9 A;  5LL6 f;  2VUG A;  4RVG A;  4B3T C;  1HNZ C;  2Z51 A;  2QRD B;  1KQS Z;  3K7A I;  3PES A;  5BUS A;  1VQK Z;  4D56 A;  3J80 b;  4A3L I;  3NFZ A;  4HPV A;  4BBR I;  3OW2 Y;  2JIP A;  2E7Z A;  2RHB A;  1I3Q I;  4QTU A;  1YI2 Z;  3CMA 1;  3S14 I;  2PT7 G;  4JI3 C;  4DR7 C;  3EQ6 A;  5IP9 I;  2PK7 A;  3CC7 1;  3UZ0 A;  2OTL 1;  2OOY B;  4X66 C;  1I6H I;  1KQS Y;  4U5Y D;  3FKI I;  2DYJ A;  1K73 2;  4PUG A;  3S1Q I;  3RZO I;  1AMU A;  2MMA B;  1M1K 2;  3NDJ A;  3VB9 A;  5D1O A;  4K0B A;  5CZV A;  3S1R I;  3A26 A;  3CC2 1;  4E30 A;  1TWH I;  1QVG Y;  1K9M 2;  4DCT A;  5K85 A;  3J81 b;  5BUQ A;  2WAQ A;  1M90 1;  2E8C A;  3H2T A;  1XRC A;  4KTV A;  2IZ3 A;  2K5R A;  4EAT A;  1DL6 A;  4LF8 C;  4HGZ A;  1Q7Y 1;  1VQ8 Z;  4I9G A;  1YJ9 Z;  1Z01 A;  5IT9 f;  1YIJ 1;  3NH5 A;  1VEH A;  1WH9 A;  1WCM I;  2NVT I;  2P2B A;  3CCQ Z;  4D4I A;  1ZB9 A;  5T67 A;  2ONF A;  3S82 A;  1P4E A;  2QRE B;  2MCQ A;  4NXM C;  5T6B A;  2YWB A;  4NBD A;  2JS4 A;  3GKQ A;  1TH5 A;  4JI0 C;  3C5E A;  1HR0 C;  1QVF Z;  2Y4N A;  3VNS A;  5AE1 A;  3CCL 1;  4IR7 A;  3H3V J;  5IT9 D;  3E7X A;  3D6W A;  1YIT Z;  1MDF A;  4MD7 A;  3CCM 1;  4RMN A;  1XS3 A;  1KKG A;  2DHM A;  4NDN A;  3CQ1 A;  2RBL A;  2R7Z I;  3VNR A;  4WV3 A;  3S2H I;  1UWD A;  3FCE A;  2JIR A;  1QVF Y;  2V8K A;  5A2Q f;  1RG9 A;  2EGT A;  3I55 1;  4JI6 C;  1M6X C;  2UUC C;  5IWA C;  1XRB A;  1VQ9 1;  1VQO 1;  4NXN C;  1TWA I;  4CL1 A;  3M3Y I;  3GTQ I;  3CCU Z;  3UX2 A;  2E0G A;  4BC7 A;  2R92 I;  3TQI A;  4LE5 A;  1N33 C;  3JAM b;  4K0K C;  2V3V A;  1HNW C;  4BBY A;  3I4N I;  1YUA A;  5A2Q D;  2ASB A;  2KI7 B;  1L1O C;  2YU9 I;  3S15 I;  3VNQ A;  4NBG A;  3TUF A;  3GR0 A;  3IPL A;  1X0T A;  2IV2 X;  2B63 I;  1O90 A;  3NH8 A;  1Z03 A;  3IML A;  5A1I A;  3CME 1;  1YHQ 1;  4JM1 A;  1VQN Z;  1QM4 A;  3CD6 1;  5BSW A;  1VQL 1;  4DV4 C;  1M6X A;  3D9X A;  2OPL B;  1PU1 A;  2F4O A;  3G6E 1;  3J7A 4;  4ODJ A;  2DPL A;  4RVN A;  3TR3 A;  3FQM A;  2QW0 X;  2YAD A;  3EER A;  1Q81 1;  4LFB C;  1QF8 A;  2D28 C;  4FTF A;  1Q86 1;  2P3Y A;  2J6A A;  1VQK 1;  4DCV A;  4GKK C;  3DHV A;  2AYA A;  2JIQ A;  3CQ3 A;  1X3W A;  2LEX A;  1YI2 1;  1NJI 2;  1KD1 2;  1I94 C;  4KHP C;  2P2F A;  5KYT A;  1UKK A;  3J80 D;  3GTG I;  4DV2 C;  5GTD A;  2LIY A;  1FDO A;  3NH4 A;  4DCU A;  4A3F I;  2UU9 C;  1V60 A;  1TFI A;  5IP7 I;  3J81 f;  2ATW A;  3PO2 I;  2Y0S A;  1YJN Z;  2O4H A;  3F3P C;  3TDH B;  1FJG C;  3CCJ Z;  4L2Z A;  3N54 B;  1XRA A;  2M5H A;  4PUI A;  3R9W A;  1RQF A;  4NB9 A;  5KYV A;  2Y27 A;  2E9H A;  5BSV A;  1Z02 A;  1MXC A;  1LCI A;  3PRO C;  4RVO A;  1ZH1 A;  2KZ0 A;  3HOU I;  3A9V A;  1RLY A;  4NBC A;  4ZJZ A;  3G7S A;  4X62 C;  1RO2 A;  1VQ8 1;  1JWH C;  1P9N A;  2JIM A;  1YJ9 1;  2D1R A;  2E8F A;  2PN2 A;  3A25 A;  5BUR A;  1Q16 A;  2P20 A;  5KEI A;  2JA8 I;  5K8F A;  3T1H C;  3CCQ 1;  4DR2 C;  2HHH C;  3CQZ I;  1TWC I;  4GXR A;  1WW9 A;  2R93 I;  2DE7 A;  4MD9 A;  3IF8 A;  4QTT A;  1HH2 P;  1JOS A;  2VSQ A;  1QVG Z;  1YJW Z;  2AYD A;  2JMP A;  4E32 A;  3I07 A;  1WJ2 A;  3KIF A;  5LMU C;  4JI5 C;  3L95 X;  2E2H I;  1Y1V I;  1N36 C;  2E8E A;  5CM2 M;  4NBB A;  1PA4 A;  2PM9 A;  1LQL A;  4JV5 C;  4Y7N I;  1YIT 1;  3BG1 B;  2RT9 A;  3KIH A;  3A4I A;  1MXB A;  2NVX I;  4R1M A;  1VQP Z;  4MON A;  2HJG A;  5IFI A;  2UUB C;  3BG0 B;  2GTH A;  4JYA C;  2D7V A;  2PMZ A;  4NH1 C;  5AE3 A;  4YHH C;  1MXA A;  2CU6 A;  3A9U A;  1AA6 A;  4RVF A;  4A3I I;  3IEV A;  1Y1V S;  1IBK C;  3JAM f;  1RY2 A;  3CC4 Z;  4DGL A;  2DE5 A;  3DLP X;  3VMG A;  3CCU 1;  1PG3 A;  2W03 A;  4E2W A;  4LF6 C;  2VPX A;  3I4M I;  1VLA A;  2YWC A;  4WS9 A;  5BR8 C;  3HOY I;  3S1N I;  3S16 I;  2D27 A;  5BSM A;  2UXC C;  4A3M I;  1NUI A;  2VPY A;  4D4G A;  2V8I A;  1YJ7 A;  3LGX A;  2QR1 B;  3AF5 A;  2LFU A;  3JAM D;  5BST A;  4A3C I;  3MZL B;  1S7M A;  1FDI A;  1PFT A;  4NBH A;  2Y4O A;  3T1Y C;  4PHT A;  4E33 A;  1KC8 1;  4PUH A;  1VQN 1;  3H0G I;  2O53 A;  1RO0 A;  3F3F C;  2P02 A;  4G37 A;  5DV9 A;  3S2D I;  4A3D I;  2YX1 A;  3ETC A;  2F4M A;  3T4N B;  2WB1 A;  5C4J I;  2CY1 A;  2JR6 A;  2OO4 A;  2P2M A;  3GKU A;  4BC9 A;  2JA6 I;  3E7W A;  4LF9 C;  1VQ5 Z;  1V25 A;  4DG9 A;  3RV2 A;  2VZE A;  5FLX b;  2M5O A;  3AY0 A;  2H85 A;  3CCV Z;  1T5H X;  2OZK A;  4GXQ A;  1IB8 A;  3DAY A;  4PRO C;  4AYB A;  4E2Z A;  4A3G I;  3AF6 A;  1VQ6 Z;  2I3C A;  4BY1 I;  1W2B Y;  1K83 I;  1MD9 A;  3M4O I;  5T64 A;  3GPC A;  3TDE A;  1VQM Z;  4RS4 A;  1YJN 1;  1S72 1;  1FUG A;  2IZ4 A;  3R9X A;  2QA4 Z;  3CCJ 1;  2D1S A;  3RZD I;  1XNQ C;  2XR1 A;  2WP0 C;  2JIO A;  4OXI A;  4LF4 C;  2KZF A;  3IEU A;  5CZX A;  2BJO A;  3IR7 A;  3HOW I;  1M90 2;  3CCS Z;  2QRC B;  2OOX B;  2OBV A;  4MRI A;  1Q7Y 2;  4DR1 C;  2VF1 A;  5D1O B;  3G71 Z;  4I9F A;  4NFR A;  3ESW A;  3B7W A;  4LF5 C;  4FUQ A;  4RM3 A;  4PZP A;  5ADZ A;  1K73 1;  4G1I A;  4EWC A;  2QL8 A;  2QKD A;  4S1T A;  5AE2 A;  4DR4 C;  2PRO A;  2K3R A;  4JI8 C;  1YJW 1;  1K9M 1;  3KXW A;  4HH4 A;  4BY7 I;  4B3M C;  2VQF C;  2F4V C;  1WZN A;  2D1T A;  3CXC Z;  1MDB A;  4XX2 A;  1VQ9 Z;  1ML8 A;  2E5L C;  5BSU A;  1N8R 1;  3G4S Z;  5A19 A;  2JUB A;  1NY8 A;  1USP A;  1VQP 1;  4X65 C;  1IBL C;  3HOZ I;  2YCB A;  3CW9 A;  4MD8 A;  4TNU A;  2AKL A;  2NCL A;  3CCE Z;  2QVY X;  3CXC Y;  4X64 C;  1EGA A;  1T5D X;  2HU9 A;  3J81 D;  4NBA A;  3GTM S;  2HF1 A;  1XMQ C;  3FCC A;  2OTJ Z;  1SIW A;  4RVH A;  3CME Z;  1QYP A;  2W04 A;  3NDI A;  3I56 Z;  5C44 I;  5T8S A;  3K6R A;  2JA5 I;  2QEX Z;  5H9U A;  2ZM6 C;  4BBS I;  3VTN A;  1WF3 A;  1ULT A;  1MKY A;  4YY3 C;  1N2F A;  3N2Q A;  2P2J A;  4NB8 A;  5FLM I;  3IFU A;  1O9T A;  3CCR Z;  2ZAE B;  3CPW Z;  2V8J A;  4JI2 C;  1Q82 1;  1P7L A;  3LNO A;  2VPZ A;  4E2X A;  3D2L A;  5JRH A;  4A93 I; 
#chains in the Genus database with same CATH homology
 5D1P A;  5FLX f;  1IBM C;  1Q81 2;  2RIQ A;  3HOV I;  1VQ7 Z;  2OPL A;  1VQ5 1;  1Q86 2;  5AN9 F;  3GTK I;  4BXX I;  1QWI A;  3CPW Y;  3CW8 X;  1VQ4 Z;  3OTO C;  2DE6 A;  3VMH A;  3ETO A;  3VMI A;  4B3R C;  3GR1 A;  3GTL I;  3NPD A;  4OX9 C;  4DV5 C;  4LFC C;  3CCV 1;  1RNI A;  1TWF I;  4NBF A;  3PO3 I;  3IX0 A;  3NYR A;  4R1L A;  5FLX D;  4TPS B;  4NBE A;  4DV6 C;  4RVD A;  1VQ6 1;  4A3B I;  4DQY B;  1N32 C;  2KPI A;  2D1Q A;  2Q4Z A;  4A3J I;  1VQM 1;  2R6M A;  1RO4 A;  3EED A;  4JI7 C;  1N8R 2;  4RM2 A;  3S1M I;  2UUA C;  2QA4 1;  1JJ2 Z;  2VQE C;  3R44 A;  1J5E C;  3PO3 S;  4JI1 C;  2RPR A;  3LAX A;  2M48 A;  4G36 A;  3CMA Z;  1XNR C;  3NI2 A;  1NJI 1;  1KD1 1;  3CCS 1;  1V26 A;  3CC7 Z;  3GTP I;  3S17 I;  2OTL Z;  2JA7 I;  4X6A I;  1KRL A;  3U50 C;  3G71 1;  4A3E I;  3LNV A;  3GTO I;  4ISB A;  1JJ2 Y;  1USP B;  1W2B Z;  1K8A 1;  4OYC A;  4E2Y A;  5C4X I;  1N34 C;  5A1G A;  4E31 A;  4DUY C;  4D57 A;  3CC2 Z;  3RG2 A;  2JNY A;  3GCF A;  4FUT A;  1ZB8 A;  4MH4 A;  2E7G A;  4DUZ C;  2JMO A;  5T8T A;  5C3E I;  2QVZ X;  3NYQ A;  2V7B A;  2UXD C;  4NOZ A;  4LFA C;  4DV1 C;  3G4S 1;  4A3K I;  4DCS A;  2GU2 A;  3P5J B;  2Q51 A;  1YIJ Z;  1Q82 2;  2E2J I;  2CXC A;  5E7Q A;  4GKJ C;  2E2I I;  4IZ6 A;  3CCE 1;  4R0M A;  3FQQ A;  3SO4 A;  5IT9 b;  4KTT A;  5LMN C;  2NVY I;  4DR6 C;  1BA3 A;  1SFO I;  3LUS A;  4ZLP A;  4LF7 C;  3CCL Z;  1PG4 A;  3PBK A;  2OTJ 1;  1GPM A;  4DV3 C;  4GS5 A;  1XMO C;  4BCA A;  3I56 1;  1M1K 1;  3CCM Z;  4L7I A;  4RLF A;  3MZK B;  2BH1 X;  1NP6 A;  2QEX 1;  3UOW A;  3TE5 B;  4BSZ A;  3I55 Z;  2GTI A;  4DR3 C;  3J80 f;  1KC8 2;  3GTM I;  1VQO Z;  1YUK A;  3QWU A;  3HKZ A;  4L4Q A;  1NYE A;  3CCR 1;  2UXB C;  2NVQ I;  3HOX I;  5A2Q b;  4MTN A;  3I08 A;  2QVX X;  2M6N A;  2QLV B;  4B3S C;  4DV0 C;  3GTJ I;  3CC4 1;  1VQ7 1;  4JI4 C;  3Q87 A;  2VUM I;  4MXU A;  1VQ4 1;  5BSR A;  1TWG I;  1K8A 2;  3L8C A;  1YHQ Z;  1K0R A;  3CJE A;  3CD6 Z;  4DG8 A;  1R9T I;  1Y1W I;  1X3Z A;  1S72 Z;  4RLQ A;  1VQL Z;  2WD9 A;  2P28 A;  3MON A;  4AQY C;  2G2K A;  4DK1 A;  4DV7 C;  1L2F A;  1O93 A;  1WII A;  4DR5 C;  1O92 A;  2P2Q A;  3G6E Z;  1I50 I;  3OW2 Z;  4HGY A;  4Y52 I;  4RV9 A;  5LL6 f;  2VUG A;  4RVG A;  4B3T C;  1HNZ C;  2QRD B;  1KQS Z;  3K7A I;  3PES A;  5BUS A;  1VQK Z;  4D56 A;  3J80 b;  4A3L I;  3NFZ A;  4HPV A;  4BBR I;  3OW2 Y;  4QTU A;  2RHB A;  1I3Q I;  1YI2 Z;  3CMA 1;  3S14 I;  2PT7 G;  4JI3 C;  4DR7 C;  3EQ6 A;  5IP9 I;  2PK7 A;  3CC7 1;  3UZ0 A;  2OTL 1;  2OOY B;  4X66 C;  1I6H I;  1KQS Y;  4U5Y D;  3FKI I;  2DYJ A;  1K73 2;  3S1Q I;  3RZO I;  1AMU A;  1M1K 2;  3NDJ A;  3VB9 A;  5D1O A;  4K0B A;  5CZV A;  3S1R I;  3CC2 1;  4E30 A;  1TWH I;  1QVG Y;  1K9M 2;  4DCT A;  5K85 A;  3J81 b;  5BUQ A;  2WAQ A;  1M90 1;  2E8C A;  3H2T A;  1XRC A;  4KTV A;  2IZ3 A;  2K5R A;  4EAT A;  1DL6 A;  4LF8 C;  4HGZ A;  1Q7Y 1;  1VQ8 Z;  4I9G A;  1YJ9 Z;  1Z01 A;  5IT9 f;  1YIJ 1;  3NH5 A;  1WH9 A;  1WCM I;  2NVT I;  2P2B A;  3CCQ Z;  4D4I A;  1ZB9 A;  5T67 A;  2ONF A;  3S82 A;  1HNX C;  2QRE B;  4NXM C;  5T6B A;  2YWB A;  4NBD A;  2JS4 A;  3GKQ A;  4JI0 C;  3C5E A;  1HR0 C;  1QVF Z;  2Y4N A;  3VNS A;  5AE1 A;  3CCL 1;  4IR7 A;  3H3V J;  5IT9 D;  3E7X A;  3D6W A;  1YIT Z;  1MDF A;  4MD7 A;  3CCM 1;  4RMN A;  1KKG A;  4NDN A;  2RBL A;  2R7Z I;  3VNR A;  4WV3 A;  3S2H I;  3FCE A;  1QVF Y;  2V8K A;  5A2Q f;  1RG9 A;  2EGT A;  3I55 1;  4JI6 C;  2UUC C;  5IWA C;  1XRB A;  1VQ9 1;  1VQO 1;  4NXN C;  1TWA I;  4CL1 A;  3M3Y I;  3GTQ I;  3CCU Z;  2E0G A;  4BC7 A;  2R92 I;  3TQI A;  4LE5 A;  1N33 C;  3JAM b;  4K0K C;  1HNW C;  4BBY A;  3I4N I;  1YUA A;  5A2Q D;  2ASB A;  2KI7 B;  1L1O C;  2YU9 I;  3S15 I;  3VNQ A;  4NBG A;  3TUF A;  3GR0 A;  3IPL A;  1X0T A;  2B63 I;  1O90 A;  3NH8 A;  1Z03 A;  3IML A;  5A1I A;  3CME 1;  1YHQ 1;  4JM1 A;  1VQN Z;  1QM4 A;  3CD6 1;  5BSW A;  1VQL 1;  4DV4 C;  3D9X A;  2OPL B;  4ODJ A;  2F4O A;  3G6E 1;  3J7A 4;  2DPL A;  4RVN A;  3FQM A;  2QW0 X;  2YAD A;  3EER A;  1Q81 1;  4LFB C;  1QF8 A;  2D28 C;  4FTF A;  1Q86 1;  2P3Y A;  2J6A A;  1VQK 1;  4DCV A;  4GKK C;  3DHV A;  2AYA A;  1X3W A;  1YI2 1;  1NJI 2;  1KD1 2;  1I94 C;  4KHP C;  2P2F A;  5KYT A;  1UKK A;  3J80 D;  3GTG I;  4DV2 C;  5GTD A;  2LIY A;  3NH4 A;  4DCU A;  4A3F I;  2UU9 C;  1TFI A;  5IP7 I;  3J81 f;  2ATW A;  3PO2 I;  2Y0S A;  1YJN Z;  2O4H A;  3F3P C;  3TDH B;  1FJG C;  3CCJ Z;  4L2Z A;  3N54 B;  1XRA A;  3R9W A;  1RQF A;  4NB9 A;  5KYV A;  2Y27 A;  2E9H A;  5BSV A;  1Z02 A;  1MXC A;  1LCI A;  3PRO C;  4RVO A;  1ZH1 A;  3HOU I;  3A9V A;  1RLY A;  4NBC A;  4ZJZ A;  3G7S A;  4X62 C;  1RO2 A;  1VQ8 1;  1JWH C;  1P9N A;  2D1R A;  1YJ9 1;  2E8F A;  2PN2 A;  5BUR A;  5KEI A;  2P20 A;  3T1H C;  2JA8 I;  5K8F A;  3CCQ 1;  4DR2 C;  2HHH C;  3CQZ I;  1TWC I;  4GXR A;  1WW9 A;  2R93 I;  2DE7 A;  4MD9 A;  3IF8 A;  4QTT A;  1HH2 P;  1JOS A;  2VSQ A;  1QVG Z;  1YJW Z;  2JMP A;  4E32 A;  3I07 A;  4JI5 C;  3KIF A;  5LMU C;  3L95 X;  2E2H I;  1Y1V I;  1N36 C;  2E8E A;  5CM2 M;  4NBB A;  1PA4 A;  2PM9 A;  1LQL A;  4JV5 C;  4Y7N I;  1YIT 1;  3BG1 B;  2RT9 A;  3KIH A;  3A4I A;  1MXB A;  2NVX I;  4R1M A;  1VQP Z;  4MON A;  2HJG A;  5IFI A;  2UUB C;  3BG0 B;  2GTH A;  4JYA C;  2D7V A;  2PMZ A;  4NH1 C;  5AE3 A;  4YHH C;  1MXA A;  3A9U A;  4A3I I;  4RVF A;  3IEV A;  1Y1V S;  1IBK C;  3JAM f;  1RY2 A;  3CC4 Z;  4DGL A;  2DE5 A;  3DLP X;  3VMG A;  3CCU 1;  1PG3 A;  2W03 A;  4E2W A;  4LF6 C;  3I4M I;  1VLA A;  2YWC A;  4WS9 A;  5BR8 C;  3HOY I;  3S1N I;  3S16 I;  2D27 A;  5BSM A;  2UXC C;  4A3M I;  1NUI A;  4D4G A;  2V8I A;  1YJ7 A;  3LGX A;  2QR1 B;  3AF5 A;  2LFU A;  3JAM D;  5BST A;  4A3C I;  3MZL B;  1S7M A;  1PFT A;  4NBH A;  2Y4O A;  3T1Y C;  4PHT A;  4E33 A;  1KC8 1;  1VQN 1;  3H0G I;  2O53 A;  1RO0 A;  3F3F C;  2P02 A;  4G37 A;  5DV9 A;  3S2D I;  4A3D I;  3ETC A;  2F4M A;  3T4N B;  2WB1 A;  5C4J I;  2CY1 A;  2JR6 A;  2OO4 A;  2P2M A;  3GKU A;  4BC9 A;  2JA6 I;  3E7W A;  4LF9 C;  1VQ5 Z;  1V25 A;  4DG9 A;  3RV2 A;  2VZE A;  5FLX b;  2H85 A;  3CCV Z;  1T5H X;  2OZK A;  4GXQ A;  3DAY A;  4PRO C;  4AYB A;  4E2Z A;  4A3G I;  3AF6 A;  1VQ6 Z;  2I3C A;  4BY1 I;  1W2B Y;  1K83 I;  1MD9 A;  3M4O I;  5T64 A;  3GPC A;  3TDE A;  1VQM Z;  4RS4 A;  1YJN 1;  1S72 1;  1FUG A;  2IZ4 A;  3R9X A;  2QA4 Z;  3CCJ 1;  2D1S A;  3RZD I;  1XNQ C;  2XR1 A;  2WP0 C;  4OXI A;  4LF4 C;  2KZF A;  3IEU A;  5CZX A;  2BJO A;  3HOW I;  1M90 2;  3CCS Z;  2QRC B;  2OOX B;  2OBV A;  4MRI A;  1Q7Y 2;  4DR1 C;  2VF1 A;  5D1O B;  3G71 Z;  4I9F A;  4NFR A;  3ESW A;  3B7W A;  4LF5 C;  4FUQ A;  4RM3 A;  4PZP A;  5ADZ A;  1K73 1;  4G1I A;  4EWC A;  2QL8 A;  2QKD A;  4S1T A;  5AE2 A;  4DR4 C;  2PRO A;  2K3R A;  4JI8 C;  1YJW 1;  1K9M 1;  3KXW A;  4HH4 A;  4BY7 I;  4B3M C;  2VQF C;  2F4V C;  2D1T A;  3CXC Z;  1MDB A;  4XX2 A;  1VQ9 Z;  1ML8 A;  2E5L C;  5BSU A;  1N8R 1;  3G4S Z;  5A19 A;  2JUB A;  1USP A;  1VQP 1;  4X65 C;  1IBL C;  3HOZ I;  2YCB A;  3CW9 A;  4MD8 A;  4TNU A;  2AKL A;  3CCE Z;  2QVY X;  3CXC Y;  4X64 C;  1EGA A;  1T5D X;  2HU9 A;  3J81 D;  4NBA A;  3GTM S;  2HF1 A;  1XMQ C;  3FCC A;  2OTJ Z;  4RVH A;  3CME Z;  1QYP A;  2W04 A;  3NDI A;  3I56 Z;  5C44 I;  5T8S A;  2JA5 I;  2QEX Z;  5H9U A;  2ZM6 C;  4BBS I;  3VTN A;  1WF3 A;  1ULT A;  1MKY A;  4YY3 C;  1N2F A;  3N2Q A;  2P2J A;  4NB8 A;  5FLM I;  3IFU A;  1O9T A;  3CCR Z;  2ZAE B;  3CPW Z;  2V8J A;  4JI2 C;  1Q82 1;  1P7L A;  4E2X A;  5JRH A;  4A93 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...