4MH4A

Crystal structure of osmc-like protein from burkholderia cenocepacia j2315
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
SKIEKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAVDAEVDLGTAGNAYFLQARLNVSVPGLERDVAQRIVDAAHQTCPYSKATRGNIDVDIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords OsmC-like protein
publication title Crystal Structure of OsmC-like protein from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
total genus 31
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mh4A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4mh4A02
3S2HI 2UUAC 2YU9I 5FLMI 3S2DI 1ML8A 4B3TC 4Y52I 1N33C 3S14I 3GTKI 1RLYA 4LFBC 3HOYI 2R93I 1N34C 2ZM6C 1MKYA 4JI5C 2F4MA 1I6HI 1WW9A 4A3II 3I07A 4BXXI 3HOVI 4LF7C 4NBBA 3PO2I 5C4XI 1N32C 4QTTA 1XMOC 2JR6A 2F4OA 3S17I 1TFIA 2JA8I 4DUZC 2VQEC 2AKLA 4DCTA 4A3GI 2KZFA 4NBEA 4A3LI 1N36C 1NUIA 3S1NI 2DYJA 2UXCC 3T1HC 2CXCA 5IWAC 3GTMI 3J80D 1IBKC 3AF5A 3CQZI 1TWCI 2PK7A 2JA7I 2NVTI 1R9TI 5IP7I 4LF6C 4JV5C 5IP9I 4OX9C 1FJGC 3I4MI 4DR1C 3EERA 4B3SC 2DE6A 2HHHC 5BR8C 4BY1I 2UUBC 1WCMI 2E2JI 1Y1VI 2VUMI 4B3MC 4BSZA 3PO3I 3FKII 3R9XA 3H0GI 3H3VJ 4A3EI 4AQYC 2PN2A 2E8CA 3M4OI 4X64C 4NBCA 5C44I 2B63I 1I3QI 1TWHI 4QTUA 2XR1A 4DV7C 4Y7NI 1X3WA 4A3FI 2NVQI 4DV1C 3GTMS 2J6AA 4LF4C 2P3YA 4DR3C 2CY1A 1NYEA 4NBDA 3GKUA 2YCBA 3LUSA 4DV5C 4A3JI 3VMGA 1JOSA 3HOXI 5A2QD 4LF5C 1QWIA 4NBFA 2QL8A 4LF8C 4JYAC 4LFAC 3D6WA 1PA4A 4JI7C 3R9WA 4A3MI 2R92I 4JI4C 2OPLB 2F4VC 1Y1VS 4DV3C 3PO3S 2UXDC 1HNWC 2E5LC 1XNQC 3IEVA 4LF9C 2UUCC 2ASBA 2JA6I 1HR0C 2JA5I 4BBRI 1X3ZA 4DR5C 4JI2C 4DV0C 4A3CI 2RBLA 2E8FA 1L2FA 3GCFA 3HOZI 1PFTA 4X66C 4DUYC 5FLXD 1K0RA 3GTGI 4NXNC 4JI3C 4YHHC 2HF1A 4DV2C 4YY3C 1J5EC 4JI8C 2OPLA 3HOUI 2E2II 1I94C 5C3EI 4X65C 3HOWI 4X62C 3OTOC 5LMUC 2KPIA 4JI0C 1UKKA 1KKGA 2NVXI 5CM2M 4JI6C 2PT7G 4DV4C 1L1OC 5IT9D 4NB8A 3VB9A 4NBAA 1USPA 1XNRC 1HNZC 2UXBC 2E2HI 1SFOI 4DCVA 2JNYA 1HH2P 3S16I 1WH9A 3M3YI 3CJEA 2ONFA 4MTNA 4DR6C 3GTJI 4DR2C 3U50C 1ZB8A 1IBMC 3K7AI 4NB9A 2NVYI 1I50I 2K5RA 4BY7I 2D7VA 4XX2A 1YUAA 4A3DI 3T1YC 5LMNC 4DR4C 3S1RI 1EGAA 1TWFI 1DL6A 3GTQI 4K0KC 4KHPC 2EGTA 1N2FA 4DCUA 1QYPA 1IBLC 3J81D 4LFCC 2E8EA 1TWGI 4DCSA 3ESWA 2UU9C 4BBSI 4NBHA 1K83I 3AF6A 3RZDI 3IEUA 2ATWA 4GKJC 1LQLA 1USPB 4A93I 2R7ZI 2DE7A 1WF3A 4JI1C 2BJOA 2VQFC 3GKQA 1XMQC 1HNXC 3S1QI 1TWAI 3Q87A 1RO4A 1Y1WI 1ZB9A 4DV6C 2DE5A 4X6AI 4A3KI 5C4JI 3I4NI 3GTOI 4MH4A 3RZOI 1VLAA 2JS4A 4NOZA 3GTLI 4A3BI 3JAMD 2E7GA 3VMHA 2HJGA 4NBGA 4NXMC 2JMPA 4DR7C 3VMIA 3S15I 4B3RC 3S1MI 3GTPI 4GKKC
chains in the Genus database with same CATH superfamily
3S2HI 3NFZA 3CQ2A 2UUAC 1YJ9Z 3NI2A 5BSTA 2D1QA 2QA4Z 2YU9I 5FLMI 1XRBA 4IR7A 3S2DI 1ML8A 4B3TC 3L95X 2GTIA 1MDBA 3CCRZ 4RVNA 4Y52I 3J80b 1N33C 3S14I 3E7WA 4G37A 3I551 2ZZMA 2QR1B 1T5DX 1RY2A 1MXAA 3CCJ1 1VQ81 3GTKI 1M1K2 4PROC 1W2BZ 1RLYA 3ETCA 4ISBA 1TH5A 4LFBC 3HOYI 1VQ7Z 3A9VA 2R93I 4CL1A 3NH4A 3CCQ1 1GPMA 1N34C 5AN9F 5AE3A 1WIIA 2ZM6C 3NDJA 1YJN1 1MKYA 1M1K1 3UZ0A 3D9XA 2F4MA 3CD61 4JI5C 1VEHA 3CC71 1I6HI 3G6E1 2M5OA 4BBYA 1WW9A 2Y0SA 1YJWZ 4A3II 3KIFA 4ZLPA 1P9NA 3G7SA 3I07A 5BSRA 3RV2A 4BXXI 3HOVI 4LF7C 3MZLB 4NBBA 2DPLA 3GPCA 3PO2I 2IV2X 5C4XI 1P4EA 3CMAZ 2OBVA 1N32C 4QTTA 1VQLZ 1VQ51 2QW0X 3FCCA 5A1IA 1XMOC 2W04A 2JR6A 2F4OA 3CC4Z 4G1IA 3S17I 1XHJA 1QVFZ 1Q7Y2 4WV3A 3CCM1 4RLFA 1TFIA 4RMNA 2JA8I 4PHTA 4D57A 1WZNA 3A4IA 4DUZC 2VQEC 2W03A 1VQK1 2AKLA 1XRAA 3EEDA 1VQNZ 4DCTA 4WS9A 4A3GI 2KZFA 4NBEA 4A3LI 1N36C 1NUIA 1Q7Y1 4I9GA 3S1NI 2DYJA 5D1PA 2UXCC 3CME1 4G36A 3T1HC 2P02A 1VQ6Z 3RG2A 4AYBA 4E32A 2CXCA 5IWAC 4MRIA 3KXWA 3GTMI 2V45A 5LCIA 3J80D 3NH8A 1KC82 2E0GA 1IBKC 3AF5A 2JUBA 2Z51A 2VUGA 3CQZI 1O93A 4HGYA 1TWCI 1S721 2GTHA 1RO2A 2PK7A 3T4NB 2M6NA 1V26A 2JA7I 2NVTI 3PESA 1KC81 2NAPA 1VQPZ 1R9TI 3SO4A 2IZ4A 1QVGZ 2LFUA 3S82A 5IP7I 5CZXA 4LF6C 1YUKA 1PG3A 4JV5C 4R1MA 3FQMA 3TQIA 5IP9I 4HPVA 2QEX1 4BC9A 4OX9C 3I4MI 2YX1A 1FJGC 4DR1C 3MONA 1M6XA 4PUGA 3EERA 1JJ2Y 1MXBA 5BSWA 2K3RA 3CCLZ 1AMUA 4D4IA 2IZ3A 3CC2Z 2G2KA 4JM1A 2LEXA 2KZ0A 2DE6A 2HHHC 2OOXB 3A26A 5BUSA 5BR8C 4B3SC 4BY1I 2UUBC 1WCMI 1NJI1 2E2JI 1Y1VI 2VUMI 4B3MC 2OOYB 3OW2Y 3CPWY 3PO3I 4L4QA 4BSZA 3FKII 5A2Qb 1K732 1FUGA 5H9UA 2P28A 2Q4ZA 3H0GI 1M902 3R9XA 3HKZA 3JAMf 3H3VJ 1MXCA 4A3EI 3CQ3A 2RHBA 4AQYC 2PN2A 2V8KA 2VZEA 1FDOA 2E8CA 3CCV1 1T5HX 2OZKA 3M4OI 4FUQA 4X64C 1JWHC 4NBCA 5C44I 1VQ41 1M901 5K85A 2B63I 1I3QI 5CZVA 3TE5B 2AYDA 3D2LA 1TWHI 4QTUA 3IFUA 1Q821 2XR1A 2JIQA 4DV7C 2O4HA 3VNRA 1Q812 2Y4OA 1RNIA 1YJ91 4Y7NI 3F3PC 1O92A 4I9FA 4E2XA 1X3WA 2QA41 1YIJZ 1P7LA 4BCAA 3TUFA 4S1TA 2VPZA 3J81b 4A3FI 2NVQI 2H85A 4E33A 1Q811 1YI21 5KYTA 4GS5A 4DV1C 1KQSY 3GTMS 2J6AA 2WAQA 3A25A 2MMAB 2QVXX 3CCSZ 4R0MA 4LF4C 5BSVA 5D1OA 2P3YA 2QRDB 1VQ71 4DR3C 4DK1A 2CY1A 1BA3A 1NYEA 4NBDA 3GKUA 2DHMA 2YCBA 1QF8A 3LUSA 2WB1A 4DV5C 1M6XC 5IFIA 3VTNA 4E2ZA 4A3JI 3VMGA 1JOSA 1O9TA 3HOXI 4RVFA 1ULTA 5A2QD 4LF5C 5ADZA 1QWIA 4GXRA 4NBFA 2QL8A 4LF8C 2E7ZA 4LFAC 5FLXb 4JYAC 2V8IA 3D6WA 1W2BY 3UOWA 3FCEA 3CMA1 1PA4A 4K0BA 3IR7A 4JI7C 2D1SA 4KTVA 3R9WA 4ODJA 3DLPX 3KIHA 4A3MI 3CC41 2R92I 2V7BA 4JI4C 5JRHA 3CQ1A 2KI7B 4RVDA 2OPLB 1RG9A 2F4VC 1Y1VS 4DV3C 4RVGA 3PO3S 1VQN1 4MD9A 2V3VA 1XS3A 1VQMZ 3EQ6A 2O53A 3FQQA 1Q16A 4DG9A 2Y27A 2Y4NA 2UXDC 1HNWC 2E5LC 2P2JA 5IT9b 1XNQC 3IEVA 4LF9C 1NY8A 2UUCC 3J80f 1VQKZ 4L7IA 2ZZNA 3JAMb 3QWUA 2QVZX 2ASBA 2JA6I 3G4SZ 1KRLA 3CXCZ 5A1GA 1HR0C 3CMEZ 2M48A 1UWDA 5A19A 3DHVA 2YWCA 2JA5I 4MXUA 4BBRI 2R6MA 1X3ZA 4DR5C 4E2YA 4JI2C 4BC7A 3IMLA 1VQP1 5T8SA 4DV0C 4A3CI 2RBLA 2E8FA 1L2FA 1VQOZ 3I561 1Z02A 3GCFA 1NJI2 2PMZA 3HOZI 3LNVA 3CCEZ 2OTJZ 2VSQA 1KD12 1PFTA 3CCL1 3F3FC 4X66C 1RO0A 1YHQZ 5D1OB 1AA6A 2NCLA 4DUYC 3L8CA 2HU9A 5FLXD 1K0RA 3GTGI 4NXNC 2CU6A 4JI3C 5AE1A 4YHHC 3CC21 3GR0A 2HF1A 4EWCA 4DV2C 4YY3C 2D1RA 1J5EC 1KD11 4FTFA 4JI8C 2OPLA 1QVGY 1WCJA 3HOUI 2E2II 1I94C 4PUHA 5C3EI 4LE5A 4X65C 2JIRA 3G711 3HOWI 4X62C 3OTOC 5LMUC 2KPIA 4JI0C 1Q822 1UKKA 2LIYA 1KKGA 4EATA 1Y8CA 2NVXI 5BUQA 2OTL1 5E7QA 2VF1A 4GXQA 5CM2M 1LCIA 5T8TA 4JI6C 2PT7G 3J7A4 2PM9A 3BG1B 4DV4C 1K8A2 1L1OC 5DV9A 2BH1X 5IT9D 4NB8A 3VB9A 3N2QA 5K8FA 4DGLA 1SIWA 4NDNA 4NBAA 4D4GA 4DQYB 2RPRA 2KDNA 2JMOA 1USPA 1XNRC 1HNZC 1YITZ 1VQ9Z 2UXBC 1K8A1 1V25A 2E2HI 1SFOI 3N54B 1VQ4Z 4RM2A 4DCVA 2JNYA 3CCUZ 2M5HA 4E2WA 1HH2P 3CCR1 2D27A 3S16I 4E31A 2YADA 1WH9A 3M3YI 2YWBA 3TDHB 3E7XA 3CJEA 2ONFA 3PBKA 2MM9A 4MTNA 4ZJZA 4PUIA 4DR6C 2I3CA 2QLVB 3GTJI 5KYVA 4DR2C 3U50C 1ZB8A 1Z03A 1K9M2 2QVYX 5KEIA 3P5JB 1RQFA 3TR3A 1IBMC 3CCS1 3K6RA 2QREB 3K7AI 3I55Z 4NB9A 2P2MA 3BG0B 1YI2Z 3DAYA 3O2EA 2WD9A 4RVOA 2NVYI 2RT9A 3CCJZ 4MD7A 1VQ8Z 1I50I 1K9M1 3MZKB 4RLQA 5GTDA 2K5RA 4BY7I 1YJW1 1MD9A 3CCQZ 2D7VA 3C5EA 2ZAEB 3VNQA 1N8R2 5A2Qf 3I08A 1QM4A 4OYCA 4XX2A 1YUAA 4A3DI 1V60A 3T1YC 1YJNZ 2JIOA 1VQL1 3CD6Z 5LMNC 3CC7Z 4DR4C 3G6EZ 2QKDA 2RIQA 3S1RI 1EGAA 2PROA 2VPWA 1TWFI 1DL6A 4KTTA 2WP0C 1N8R1 3GTQI 4K0KC 4NH1C 1PG4A 4KHPC 2EGTA 4TPSB 2JIPA 1VQ5Z 3LAXA 1XRCA 1FLOA 1N2FA 4DCUA 1YJ7A 1QYPA 1S7MA 3AY0A 1IBLC 5T67A 3IF8A 3J81D 1VQM1 3CCMZ 4LFCC 1VQ61 2E8EA 2D1TA 1TWGI 4DCSA 3J81f 4HH4A 1X0TA 3ESWA 2UU9C 1Q862 4BBSI 4NBHA 1QVFY 1K83I 2V8JA 3AF6A 3RZDI 3IEUA 3CW8X 2ATWA 4GKJC 1LQLA 1USPB 5BURA 4A93I 1IB8A 3G4S1 2R7ZI 2DE7A 1WF3A 2VPYA 3A9UA 5BSUA 4IZ6A 4RS4A 5T6BA 1Q861 3LGXA 2E9HA 2OO4A 1QXFA 1JJ2Z 4JI1C 2BJOA 5AE2A 2P2BA 3PROC 4R1LA 2QRCB 3NYRA 4DG8A 4D56A 1S72Z 2VPXA 3GR1A 5BSMA 4TNUA 4OXIA 2VQFC 4MD8A 1VQO1 3GKQA 1XMQC 1NP6A 5T64A 1HNXC 3S1QI 3CCE1 2OTJ1 1TWAI 2P2QA 3CW9A 3Q87A 1RO4A 4RM3A 3UEBA 3IX0A 3UX3A 1ZH1A 3CXCY 3OW2Z 3CPWZ 1YHQ1 4FUTA 5FLXf 4NFRA 2QEXZ 1Y1WI 2Q51A 1ZB9A 1PU1A 2D28C 4RV9A 4DV6C 2DE5A 3I56Z 3LNOA 3H2TA 4X6AI 2MCQA 4E30A 4RVHA 2GU2A 4A3KI 1WJ2A 3NDIA 4MONA 5C4JI 3B7WA 3ETOA 3NYQA 3I4NI 3UX2A 4U5YD 3VNSA 3TDEA 3GTOI 4PZPA 1O90A 2JNVA 4MH4A 3RZOI 2P20A 2JIMA 1VLAA 2JS4A 4NOZA 3G71Z 3GTLI 4A3BI 5IT9f 3JAMD 2E7GA 3VMHA 2HJGA 4NBGA 1P4EC 1MDFA 3NH5A 3CCVZ 2OTLZ 2P2FA 4HGZA 1YIJ1 1KQSZ 1YIT1 3NPDA 4NXMC 1VQ91 2JMPA 1Z01A 1K731 3VMIA 4DR7C 3S15I 4L2ZA 2AYAA 3R44A 5LL6f 3IPLA 3CCU1 4B3RC 3S1MI 3GTPI 1FDIA 4GKKC
chains in the Genus database with same CATH topology
3S2HI 3NFZA 2UUAC 1YJ9Z 3NI2A 5BSTA 2D1QA 2QA4Z 2YU9I 5FLMI 1XRBA 4IR7A 3S2DI 1ML8A 4B3TC 3L95X 2GTIA 1MDBA 3CCRZ 4RVNA 4Y52I 3J80b 1N33C 3S14I 3E7WA 4G37A 3I551 2QR1B 1T5DX 1RY2A 1MXAA 3CCJ1 1VQ81 3GTKI 1M1K2 4PROC 1W2BZ 1RLYA 3ETCA 4ISBA 4LFBC 3HOYI 1VQ7Z 3A9VA 2R93I 4CL1A 3NH4A 3CCQ1 1GPMA 1N34C 5AN9F 5AE3A 1WIIA 2ZM6C 3NDJA 1YJN1 1MKYA 1M1K1 3UZ0A 3D9XA 2F4MA 3CD61 4JI5C 3CC71 1I6HI 3G6E1 4BBYA 1WW9A 2Y0SA 1YJWZ 4A3II 3KIFA 4ZLPA 1P9NA 3G7SA 3I07A 5BSRA 3RV2A 4BXXI 3HOVI 4LF7C 3MZLB 4NBBA 2DPLA 3GPCA 3PO2I 5C4XI 3CMAZ 2OBVA 1N32C 4QTTA 1VQLZ 1VQ51 2QW0X 3FCCA 5A1IA 1XMOC 2W04A 2JR6A 2F4OA 3CC4Z 4G1IA 3S17I 1QVFZ 1Q7Y2 4WV3A 3CCM1 4RLFA 1TFIA 4RMNA 2JA8I 4PHTA 4D57A 3A4IA 4DUZC 2VQEC 2W03A 1VQK1 2AKLA 1XRAA 3EEDA 1VQNZ 4DCTA 4WS9A 4A3GI 2KZFA 4NBEA 4A3LI 1N36C 1NUIA 1Q7Y1 4I9GA 3S1NI 2DYJA 5D1PA 2UXCC 3CME1 4G36A 3T1HC 2P02A 1VQ6Z 3RG2A 4AYBA 4E32A 2CXCA 5IWAC 4MRIA 3KXWA 3GTMI 3J80D 3NH8A 1KC82 2E0GA 1IBKC 3AF5A 2JUBA 2VUGA 3CQZI 1O93A 4HGYA 1TWCI 1S721 2GTHA 1RO2A 2PK7A 3T4NB 2M6NA 1V26A 2JA7I 2NVTI 3PESA 1KC81 1VQPZ 1R9TI 3SO4A 2IZ4A 1QVGZ 2LFUA 3S82A 5IP7I 5CZXA 4LF6C 1YUKA 1PG3A 4JV5C 4R1MA 3FQMA 3TQIA 5IP9I 4HPVA 2QEX1 4BC9A 4OX9C 3I4MI 1FJGC 4DR1C 3MONA 3EERA 1JJ2Y 1MXBA 5BSWA 2K3RA 3CCLZ 1AMUA 4D4IA 2IZ3A 3CC2Z 2G2KA 4JM1A 4B3SC 2DE6A 2HHHC 2OOXB 5BUSA 5BR8C 4BY1I 2UUBC 1WCMI 1NJI1 2E2JI 1Y1VI 2VUMI 4B3MC 2OOYB 3OW2Y 3CPWY 3PO3I 4L4QA 4BSZA 3FKII 5A2Qb 1K732 1FUGA 5H9UA 2P28A 2Q4ZA 3H0GI 1M902 3R9XA 3HKZA 3JAMf 3H3VJ 1MXCA 4A3EI 4AQYC 2RHBA 2PN2A 2V8KA 2VZEA 2E8CA 3CCV1 1T5HX 2OZKA 3M4OI 4FUQA 4X64C 1JWHC 4NBCA 5C44I 1VQ41 1M901 5K85A 2B63I 1I3QI 5CZVA 3TE5B 1TWHI 4QTUA 3IFUA 1Q821 2XR1A 4DV7C 2O4HA 3VNRA 1Q812 2Y4OA 1RNIA 1YJ91 4Y7NI 3F3PC 1O92A 4I9FA 4E2XA 1X3WA 2QA41 1YIJZ 1P7LA 4BCAA 3TUFA 4S1TA 3J81b 4A3FI 2NVQI 2H85A 4E33A 1Q811 1YI21 5KYTA 4GS5A 4DV1C 1KQSY 3GTMS 2J6AA 2WAQA 2QVXX 3CCSZ 4R0MA 4LF4C 5BSVA 5D1OA 2P3YA 2QRDB 1VQ71 4DR3C 4DK1A 2CY1A 1BA3A 1NYEA 4NBDA 3GKUA 2YCBA 1QF8A 3LUSA 2WB1A 4DV5C 5IFIA 3VTNA 4E2ZA 4A3JI 3VMGA 1JOSA 1O9TA 3HOXI 4RVFA 1ULTA 5A2QD 4LF5C 5ADZA 1QWIA 4GXRA 4NBFA 2QL8A 4LF8C 4JYAC 4LFAC 5FLXb 2V8IA 3D6WA 1W2BY 3UOWA 3FCEA 3CMA1 1PA4A 4K0BA 4JI7C 2D1SA 4KTVA 3R9WA 4ODJA 3DLPX 3KIHA 4A3MI 3CC41 2R92I 2V7BA 4JI4C 5JRHA 2KI7B 4RVDA 2OPLB 1RG9A 2F4VC 1Y1VS 4DV3C 4RVGA 3PO3S 1VQN1 4MD9A 1VQMZ 3EQ6A 2O53A 3FQQA 4DG9A 2Y27A 2Y4NA 2UXDC 1HNWC 2E5LC 2P2JA 5IT9b 1XNQC 3IEVA 4LF9C 2UUCC 3J80f 1VQKZ 4L7IA 3JAMb 3QWUA 2QVZX 2ASBA 2JA6I 3G4SZ 1KRLA 3CXCZ 5A1GA 1HR0C 3CMEZ 2M48A 5A19A 3DHVA 2YWCA 2JA5I 4MXUA 4BBRI 2R6MA 1X3ZA 4DR5C 4E2YA 4JI2C 4BC7A 3IMLA 1VQP1 5T8SA 4DV0C 4A3CI 2RBLA 2E8FA 1L2FA 1VQOZ 3I561 1Z02A 3GCFA 1NJI2 2PMZA 3HOZI 3LNVA 3CCEZ 2OTJZ 2VSQA 1KD12 1PFTA 3CCL1 3F3FC 4X66C 1RO0A 1YHQZ 5D1OB 4DUYC 3L8CA 2HU9A 5FLXD 1K0RA 3GTGI 4NXNC 4JI3C 5AE1A 4YHHC 3CC21 3GR0A 2HF1A 4EWCA 4DV2C 4YY3C 2D1RA 1J5EC 1KD11 4FTFA 4JI8C 2OPLA 1QVGY 3HOUI 2E2II 1I94C 5C3EI 4LE5A 4X65C 3HOWI 3G711 4X62C 3OTOC 5LMUC 2KPIA 4JI0C 1Q822 1UKKA 2LIYA 1KKGA 4EATA 2NVXI 5BUQA 2OTL1 5E7QA 2VF1A 4GXQA 5CM2M 1LCIA 5T8TA 4JI6C 2PT7G 3J7A4 2PM9A 3BG1B 4DV4C 1K8A2 1L1OC 5DV9A 2BH1X 5IT9D 4NB8A 3VB9A 3N2QA 5K8FA 4DGLA 4NDNA 4NBAA 4D4GA 4DQYB 2RPRA 2JMOA 1USPA 1XNRC 1HNZC 1YITZ 1VQ9Z 2UXBC 1K8A1 1V25A 2E2HI 1SFOI 3N54B 1VQ4Z 4RM2A 4DCVA 2JNYA 3CCUZ 4E2WA 1HH2P 3CCR1 2D27A 3S16I 4E31A 2YADA 1WH9A 3M3YI 2YWBA 3TDHB 3E7XA 3CJEA 2ONFA 3PBKA 4MTNA 4ZJZA 4DR6C 2I3CA 2QLVB 3GTJI 5KYVA 4DR2C 3U50C 1ZB8A 1Z03A 1K9M2 2QVYX 5KEIA 3P5JB 1RQFA 1IBMC 3CCS1 2QREB 3K7AI 3I55Z 4NB9A 2P2MA 3BG0B 1YI2Z 3DAYA 2WD9A 4RVOA 2NVYI 2RT9A 3CCJZ 4MD7A 1VQ8Z 1I50I 1K9M1 3MZKB 4RLQA 5GTDA 2K5RA 4BY7I 1YJW1 1MD9A 3CCQZ 2D7VA 3C5EA 2ZAEB 3VNQA 1N8R2 5A2Qf 3I08A 1QM4A 4OYCA 4XX2A 1YUAA 4A3DI 3T1YC 1YJNZ 1VQL1 3CD6Z 5LMNC 3CC7Z 4DR4C 3G6EZ 2QKDA 2RIQA 3S1RI 1EGAA 2PROA 1TWFI 1DL6A 4KTTA 2WP0C 1N8R1 3GTQI 4K0KC 4NH1C 1PG4A 4KHPC 2EGTA 4TPSB 1VQ5Z 3LAXA 1XRCA 1N2FA 4DCUA 1YJ7A 1QYPA 1S7MA 1IBLC 5T67A 3IF8A 3J81D 1VQM1 3CCMZ 4LFCC 1VQ61 2E8EA 2D1TA 1TWGI 4DCSA 3J81f 4HH4A 1X0TA 3ESWA 2UU9C 1Q862 4BBSI 4NBHA 1QVFY 1K83I 2V8JA 3AF6A 3RZDI 3IEUA 3CW8X 2ATWA 4GKJC 1LQLA 1USPB 5BURA 4A93I 3G4S1 2R7ZI 2DE7A 1WF3A 3A9UA 5BSUA 4IZ6A 4RS4A 5T6BA 1Q861 3LGXA 2E9HA 2OO4A 1JJ2Z 4JI1C 2BJOA 5AE2A 2P2BA 3PROC 4R1LA 2QRCB 3NYRA 4DG8A 4D56A 1S72Z 3GR1A 5BSMA 4TNUA 4OXIA 2VQFC 4MD8A 1VQO1 3GKQA 1XMQC 1NP6A 5T64A 1HNXC 3S1QI 3CCE1 2OTJ1 1TWAI 2P2QA 3CW9A 3Q87A 1RO4A 4RM3A 3IX0A 1ZH1A 3CXCY 3OW2Z 3CPWZ 1YHQ1 4FUTA 5FLXf 4NFRA 2QEXZ 1Y1WI 2Q51A 1ZB9A 2D28C 4RV9A 4DV6C 2DE5A 3I56Z 3H2TA 4X6AI 4E30A 4RVHA 2GU2A 4A3KI 3NDIA 4MONA 5C4JI 3B7WA 3ETOA 3NYQA 3I4NI 4U5YD 3VNSA 3TDEA 3GTOI 4PZPA 1O90A 4MH4A 3RZOI 2P20A 1VLAA 2JS4A 4NOZA 3G71Z 3GTLI 4A3BI 5IT9f 3JAMD 2E7GA 3VMHA 2HJGA 4NBGA 1MDFA 3NH5A 3CCVZ 2OTLZ 2P2FA 4HGZA 1YIJ1 1KQSZ 1YIT1 3NPDA 4NXMC 1VQ91 2JMPA 1Z01A 1K731 3VMIA 4DR7C 3S15I 4L2ZA 4B3RC 3R44A 5LL6f 3IPLA 3CCU1 3S1MI 3GTPI 2AYAA 4GKKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2H I;  2UUA C;  2YU9 I;  5FLM I;  3S2D I;  1ML8 A;  4B3T C;  4Y52 I;  1N33 C;  3S14 I;  3GTK I;  1RLY A;  4LFB C;  3HOY I;  2R93 I;  1N34 C;  2ZM6 C;  1MKY A;  4JI5 C;  2F4M A;  1I6H I;  1WW9 A;  4A3I I;  3I07 A;  4BXX I;  3HOV I;  4LF7 C;  4NBB A;  3PO2 I;  5C4X I;  1N32 C;  4QTT A;  1XMO C;  2JR6 A;  2F4O A;  3S17 I;  1TFI A;  2JA8 I;  4DUZ C;  2VQE C;  2AKL A;  4DCT A;  4A3G I;  2KZF A;  4NBE A;  4A3L I;  1N36 C;  1NUI A;  3S1N I;  2DYJ A;  2UXC C;  3T1H C;  2CXC A;  5IWA C;  3GTM I;  3J80 D;  1IBK C;  3AF5 A;  3CQZ I;  1TWC I;  2PK7 A;  2JA7 I;  2NVT I;  1R9T I;  5IP7 I;  4LF6 C;  4JV5 C;  5IP9 I;  4OX9 C;  1FJG C;  3I4M I;  4DR1 C;  3EER A;  4B3S C;  2DE6 A;  2HHH C;  5BR8 C;  4BY1 I;  2UUB C;  1WCM I;  2E2J I;  1Y1V I;  2VUM I;  4B3M C;  4BSZ A;  3PO3 I;  3FKI I;  3R9X A;  3H0G I;  3H3V J;  4A3E I;  4AQY C;  2PN2 A;  2E8C A;  3M4O I;  4X64 C;  4NBC A;  5C44 I;  2B63 I;  1I3Q I;  1TWH I;  4QTU A;  2XR1 A;  4DV7 C;  4Y7N I;  1X3W A;  4A3F I;  2NVQ I;  4DV1 C;  3GTM S;  2J6A A;  4LF4 C;  2P3Y A;  4DR3 C;  2CY1 A;  1NYE A;  4NBD A;  3GKU A;  2YCB A;  3LUS A;  4DV5 C;  4A3J I;  3VMG A;  1JOS A;  3HOX I;  5A2Q D;  4LF5 C;  1QWI A;  4NBF A;  2QL8 A;  4LF8 C;  4JYA C;  4LFA C;  3D6W A;  1PA4 A;  4JI7 C;  3R9W A;  4A3M I;  2R92 I;  4JI4 C;  2OPL B;  2F4V C;  1Y1V S;  4DV3 C;  3PO3 S;  2UXD C;  1HNW C;  2E5L C;  1XNQ C;  3IEV A;  4LF9 C;  2UUC C;  2ASB A;  2JA6 I;  1HR0 C;  2JA5 I;  4BBR I;  1X3Z A;  4DR5 C;  4JI2 C;  4DV0 C;  4A3C I;  2RBL A;  2E8F A;  1L2F A;  3GCF A;  3HOZ I;  1PFT A;  4X66 C;  4DUY C;  5FLX D;  1K0R A;  3GTG I;  4NXN C;  4JI3 C;  4YHH C;  2HF1 A;  4DV2 C;  4YY3 C;  1J5E C;  4JI8 C;  2OPL A;  3HOU I;  2E2I I;  1I94 C;  5C3E I;  4X65 C;  3HOW I;  4X62 C;  3OTO C;  5LMU C;  2KPI A;  4JI0 C;  1UKK A;  1KKG A;  2NVX I;  5CM2 M;  4JI6 C;  2PT7 G;  4DV4 C;  1L1O C;  5IT9 D;  4NB8 A;  3VB9 A;  4NBA A;  1USP A;  1XNR C;  1HNZ C;  2UXB C;  2E2H I;  1SFO I;  4DCV A;  2JNY A;  1HH2 P;  3S16 I;  1WH9 A;  3M3Y I;  3CJE A;  2ONF A;  4MTN A;  4DR6 C;  3GTJ I;  4DR2 C;  3U50 C;  1ZB8 A;  1IBM C;  3K7A I;  4NB9 A;  2NVY I;  1I50 I;  2K5R A;  4BY7 I;  2D7V A;  4XX2 A;  1YUA A;  4A3D I;  3T1Y C;  5LMN C;  4DR4 C;  3S1R I;  1EGA A;  1TWF I;  1DL6 A;  3GTQ I;  4K0K C;  4KHP C;  2EGT A;  1N2F A;  4DCU A;  1QYP A;  1IBL C;  3J81 D;  4LFC C;  2E8E A;  1TWG I;  4DCS A;  3ESW A;  2UU9 C;  4BBS I;  4NBH A;  1K83 I;  3AF6 A;  3RZD I;  3IEU A;  2ATW A;  4GKJ C;  1LQL A;  1USP B;  4A93 I;  2R7Z I;  2DE7 A;  1WF3 A;  4JI1 C;  2BJO A;  2VQF C;  3GKQ A;  1XMQ C;  1HNX C;  3S1Q I;  1TWA I;  3Q87 A;  1RO4 A;  1Y1W I;  1ZB9 A;  4DV6 C;  2DE5 A;  4X6A I;  4A3K I;  5C4J I;  3I4N I;  3GTO I;  4MH4 A;  3RZO I;  1VLA A;  2JS4 A;  4NOZ A;  3GTL I;  4A3B I;  3JAM D;  2E7G A;  3VMH A;  2HJG A;  4NBG A;  4NXM C;  2JMP A;  4DR7 C;  3VMI A;  3S15 I;  4B3R C;  3S1M I;  3GTP I;  4GKK C; 
#chains in the Genus database with same CATH topology
 3S2H I;  3NFZ A;  3CQ2 A;  2UUA C;  1YJ9 Z;  3NI2 A;  5BST A;  2D1Q A;  2QA4 Z;  2YU9 I;  5FLM I;  1XRB A;  4IR7 A;  3S2D I;  1ML8 A;  4B3T C;  3L95 X;  2GTI A;  1MDB A;  3CCR Z;  4RVN A;  4Y52 I;  3J80 b;  1N33 C;  3S14 I;  3E7W A;  4G37 A;  3I55 1;  2ZZM A;  2QR1 B;  1T5D X;  1RY2 A;  1MXA A;  3CCJ 1;  1VQ8 1;  3GTK I;  1M1K 2;  4PRO C;  1W2B Z;  1RLY A;  3ETC A;  4ISB A;  1TH5 A;  4LFB C;  3HOY I;  1VQ7 Z;  3A9V A;  2R93 I;  4CL1 A;  3NH4 A;  3CCQ 1;  1GPM A;  1N34 C;  5AN9 F;  5AE3 A;  1WII A;  2ZM6 C;  3NDJ A;  1YJN 1;  1MKY A;  1M1K 1;  3UZ0 A;  3D9X A;  2F4M A;  3CD6 1;  4JI5 C;  1VEH A;  3CC7 1;  1I6H I;  3G6E 1;  2M5O A;  4BBY A;  1WW9 A;  2Y0S A;  1YJW Z;  4A3I I;  3KIF A;  4ZLP A;  1P9N A;  3G7S A;  3I07 A;  5BSR A;  3RV2 A;  4BXX I;  3HOV I;  4LF7 C;  3MZL B;  4NBB A;  2DPL A;  3GPC A;  3PO2 I;  2IV2 X;  5C4X I;  1P4E A;  3CMA Z;  2OBV A;  1N32 C;  4QTT A;  1VQL Z;  1VQ5 1;  2QW0 X;  3FCC A;  5A1I A;  1XMO C;  2W04 A;  2JR6 A;  2F4O A;  3CC4 Z;  4G1I A;  3S17 I;  1XHJ A;  1QVF Z;  1Q7Y 2;  4WV3 A;  3CCM 1;  4RLF A;  1TFI A;  4RMN A;  2JA8 I;  4PHT A;  4D57 A;  1WZN A;  3A4I A;  4DUZ C;  2VQE C;  2W03 A;  1VQK 1;  2AKL A;  1XRA A;  3EED A;  1VQN Z;  4DCT A;  4WS9 A;  4A3G I;  2KZF A;  4NBE A;  4A3L I;  1N36 C;  1NUI A;  1Q7Y 1;  4I9G A;  3S1N I;  2DYJ A;  5D1P A;  2UXC C;  3CME 1;  4G36 A;  3T1H C;  2P02 A;  1VQ6 Z;  3RG2 A;  4AYB A;  4E32 A;  2CXC A;  5IWA C;  4MRI A;  3KXW A;  3GTM I;  2V45 A;  5LCI A;  3J80 D;  3NH8 A;  1KC8 2;  2E0G A;  1IBK C;  3AF5 A;  2JUB A;  2Z51 A;  2VUG A;  3CQZ I;  1O93 A;  4HGY A;  1TWC I;  1S72 1;  2GTH A;  1RO2 A;  2PK7 A;  3T4N B;  2M6N A;  1V26 A;  2JA7 I;  2NVT I;  3PES A;  1KC8 1;  2NAP A;  1VQP Z;  1R9T I;  3SO4 A;  2IZ4 A;  1QVG Z;  2LFU A;  3S82 A;  5IP7 I;  5CZX A;  4LF6 C;  1YUK A;  1PG3 A;  4JV5 C;  4R1M A;  3FQM A;  3TQI A;  5IP9 I;  4HPV A;  2QEX 1;  4BC9 A;  4OX9 C;  3I4M I;  2YX1 A;  1FJG C;  4DR1 C;  3MON A;  1M6X A;  4PUG A;  3EER A;  1JJ2 Y;  1MXB A;  5BSW A;  2K3R A;  3CCL Z;  1AMU A;  4D4I A;  2IZ3 A;  3CC2 Z;  2G2K A;  4JM1 A;  2LEX A;  2KZ0 A;  2DE6 A;  2HHH C;  2OOX B;  3A26 A;  5BUS A;  5BR8 C;  4B3S C;  4BY1 I;  2UUB C;  1WCM I;  1NJI 1;  2E2J I;  1Y1V I;  2VUM I;  4B3M C;  2OOY B;  3OW2 Y;  3CPW Y;  3PO3 I;  4L4Q A;  4BSZ A;  3FKI I;  5A2Q b;  1K73 2;  1FUG A;  5H9U A;  2P28 A;  2Q4Z A;  3H0G I;  1M90 2;  3R9X A;  3HKZ A;  3JAM f;  3H3V J;  1MXC A;  4A3E I;  3CQ3 A;  2RHB A;  4AQY C;  2PN2 A;  2V8K A;  2VZE A;  1FDO A;  2E8C A;  3CCV 1;  1T5H X;  2OZK A;  3M4O I;  4FUQ A;  4X64 C;  1JWH C;  4NBC A;  5C44 I;  1VQ4 1;  1M90 1;  5K85 A;  2B63 I;  1I3Q I;  5CZV A;  3TE5 B;  2AYD A;  3D2L A;  1TWH I;  4QTU A;  3IFU A;  1Q82 1;  2XR1 A;  2JIQ A;  4DV7 C;  2O4H A;  3VNR A;  1Q81 2;  2Y4O A;  1RNI A;  1YJ9 1;  4Y7N I;  3F3P C;  1O92 A;  4I9F A;  4E2X A;  1X3W A;  2QA4 1;  1YIJ Z;  1P7L A;  4BCA A;  3TUF A;  4S1T A;  2VPZ A;  3J81 b;  4A3F I;  2NVQ I;  2H85 A;  4E33 A;  1Q81 1;  1YI2 1;  5KYT A;  4GS5 A;  4DV1 C;  1KQS Y;  3GTM S;  2J6A A;  2WAQ A;  3A25 A;  2MMA B;  2QVX X;  3CCS Z;  4R0M A;  4LF4 C;  5BSV A;  5D1O A;  2P3Y A;  2QRD B;  1VQ7 1;  4DR3 C;  4DK1 A;  2CY1 A;  1BA3 A;  1NYE A;  4NBD A;  3GKU A;  2DHM A;  2YCB A;  1QF8 A;  3LUS A;  2WB1 A;  4DV5 C;  1M6X C;  5IFI A;  3VTN A;  4E2Z A;  4A3J I;  3VMG A;  1JOS A;  1O9T A;  3HOX I;  4RVF A;  1ULT A;  5A2Q D;  4LF5 C;  5ADZ A;  1QWI A;  4GXR A;  4NBF A;  2QL8 A;  4LF8 C;  2E7Z A;  4LFA C;  5FLX b;  4JYA C;  2V8I A;  3D6W A;  1W2B Y;  3UOW A;  3FCE A;  3CMA 1;  1PA4 A;  4K0B A;  3IR7 A;  4JI7 C;  2D1S A;  4KTV A;  3R9W A;  4ODJ A;  3DLP X;  3KIH A;  4A3M I;  3CC4 1;  2R92 I;  2V7B A;  4JI4 C;  5JRH A;  3CQ1 A;  2KI7 B;  4RVD A;  2OPL B;  1RG9 A;  2F4V C;  1Y1V S;  4DV3 C;  4RVG A;  3PO3 S;  1VQN 1;  4MD9 A;  2V3V A;  1XS3 A;  1VQM Z;  3EQ6 A;  2O53 A;  3FQQ A;  1Q16 A;  4DG9 A;  2Y27 A;  2Y4N A;  2UXD C;  1HNW C;  2E5L C;  2P2J A;  5IT9 b;  1XNQ C;  3IEV A;  4LF9 C;  1NY8 A;  2UUC C;  3J80 f;  1VQK Z;  4L7I A;  2ZZN A;  3JAM b;  3QWU A;  2QVZ X;  2ASB A;  2JA6 I;  3G4S Z;  1KRL A;  3CXC Z;  5A1G A;  1HR0 C;  3CME Z;  2M48 A;  1UWD A;  5A19 A;  3DHV A;  2YWC A;  2JA5 I;  4MXU A;  4BBR I;  2R6M A;  1X3Z A;  4DR5 C;  4E2Y A;  4JI2 C;  4BC7 A;  3IML A;  1VQP 1;  5T8S A;  4DV0 C;  4A3C I;  2RBL A;  2E8F A;  1L2F A;  1VQO Z;  3I56 1;  1Z02 A;  3GCF A;  1NJI 2;  2PMZ A;  3HOZ I;  3LNV A;  3CCE Z;  2OTJ Z;  2VSQ A;  1KD1 2;  1PFT A;  3CCL 1;  3F3F C;  4X66 C;  1RO0 A;  1YHQ Z;  5D1O B;  1AA6 A;  2NCL A;  4DUY C;  3L8C A;  2HU9 A;  5FLX D;  1K0R A;  3GTG I;  4NXN C;  2CU6 A;  4JI3 C;  5AE1 A;  4YHH C;  3CC2 1;  3GR0 A;  2HF1 A;  4EWC A;  4DV2 C;  4YY3 C;  2D1R A;  1J5E C;  1KD1 1;  4FTF A;  4JI8 C;  2OPL A;  1QVG Y;  1WCJ A;  3HOU I;  2E2I I;  1I94 C;  4PUH A;  5C3E I;  4LE5 A;  4X65 C;  2JIR A;  3G71 1;  3HOW I;  4X62 C;  3OTO C;  5LMU C;  2KPI A;  4JI0 C;  1Q82 2;  1UKK A;  2LIY A;  1KKG A;  4EAT A;  1Y8C A;  2NVX I;  5BUQ A;  2OTL 1;  5E7Q A;  2VF1 A;  4GXQ A;  5CM2 M;  1LCI A;  5T8T A;  4JI6 C;  2PT7 G;  3J7A 4;  2PM9 A;  3BG1 B;  4DV4 C;  1K8A 2;  1L1O C;  5DV9 A;  2BH1 X;  5IT9 D;  4NB8 A;  3VB9 A;  3N2Q A;  5K8F A;  4DGL A;  1SIW A;  4NDN A;  4NBA A;  4D4G A;  4DQY B;  2RPR A;  2KDN A;  2JMO A;  1USP A;  1XNR C;  1HNZ C;  1YIT Z;  1VQ9 Z;  2UXB C;  1K8A 1;  1V25 A;  2E2H I;  1SFO I;  3N54 B;  1VQ4 Z;  4RM2 A;  4DCV A;  2JNY A;  3CCU Z;  2M5H A;  4E2W A;  1HH2 P;  3CCR 1;  2D27 A;  3S16 I;  4E31 A;  2YAD A;  1WH9 A;  3M3Y I;  2YWB A;  3TDH B;  3E7X A;  3CJE A;  2ONF A;  3PBK A;  2MM9 A;  4MTN A;  4ZJZ A;  4PUI A;  4DR6 C;  2I3C A;  2QLV B;  3GTJ I;  5KYV A;  4DR2 C;  3U50 C;  1ZB8 A;  1Z03 A;  1K9M 2;  2QVY X;  5KEI A;  3P5J B;  1RQF A;  3TR3 A;  1IBM C;  3CCS 1;  3K6R A;  2QRE B;  3K7A I;  3I55 Z;  4NB9 A;  2P2M A;  3BG0 B;  1YI2 Z;  3DAY A;  3O2E A;  2WD9 A;  4RVO A;  2NVY I;  2RT9 A;  3CCJ Z;  4MD7 A;  1VQ8 Z;  1I50 I;  1K9M 1;  3MZK B;  4RLQ A;  5GTD A;  2K5R A;  4BY7 I;  1YJW 1;  1MD9 A;  3CCQ Z;  2D7V A;  3C5E A;  2ZAE B;  3VNQ A;  1N8R 2;  5A2Q f;  3I08 A;  1QM4 A;  4OYC A;  4XX2 A;  1YUA A;  4A3D I;  1V60 A;  3T1Y C;  1YJN Z;  2JIO A;  1VQL 1;  3CD6 Z;  5LMN C;  3CC7 Z;  4DR4 C;  3G6E Z;  2QKD A;  2RIQ A;  3S1R I;  1EGA A;  2PRO A;  2VPW A;  1TWF I;  1DL6 A;  4KTT A;  2WP0 C;  1N8R 1;  3GTQ I;  4K0K C;  4NH1 C;  1PG4 A;  4KHP C;  2EGT A;  4TPS B;  2JIP A;  1VQ5 Z;  3LAX A;  1XRC A;  1FLO A;  1N2F A;  4DCU A;  1YJ7 A;  1QYP A;  1S7M A;  3AY0 A;  1IBL C;  5T67 A;  3IF8 A;  3J81 D;  1VQM 1;  3CCM Z;  4LFC C;  1VQ6 1;  2E8E A;  2D1T A;  1TWG I;  4DCS A;  3J81 f;  4HH4 A;  1X0T A;  3ESW A;  2UU9 C;  1Q86 2;  4BBS I;  4NBH A;  1QVF Y;  1K83 I;  2V8J A;  3AF6 A;  3RZD I;  3IEU A;  3CW8 X;  2ATW A;  4GKJ C;  1LQL A;  1USP B;  5BUR A;  4A93 I;  1IB8 A;  3G4S 1;  2R7Z I;  2DE7 A;  1WF3 A;  2VPY A;  3A9U A;  5BSU A;  4IZ6 A;  4RS4 A;  5T6B A;  1Q86 1;  3LGX A;  2E9H A;  2OO4 A;  1QXF A;  1JJ2 Z;  4JI1 C;  2BJO A;  5AE2 A;  2P2B A;  3PRO C;  4R1L A;  2QRC B;  3NYR A;  4DG8 A;  4D56 A;  1S72 Z;  2VPX A;  3GR1 A;  5BSM A;  4TNU A;  4OXI A;  2VQF C;  4MD8 A;  1VQO 1;  3GKQ A;  1XMQ C;  1NP6 A;  5T64 A;  1HNX C;  3S1Q I;  3CCE 1;  2OTJ 1;  1TWA I;  2P2Q A;  3CW9 A;  3Q87 A;  1RO4 A;  4RM3 A;  3UEB A;  3IX0 A;  3UX3 A;  1ZH1 A;  3CXC Y;  3OW2 Z;  3CPW Z;  1YHQ 1;  4FUT A;  5FLX f;  4NFR A;  2QEX Z;  1Y1W I;  2Q51 A;  1ZB9 A;  1PU1 A;  2D28 C;  4RV9 A;  4DV6 C;  2DE5 A;  3I56 Z;  3LNO A;  3H2T A;  4X6A I;  2MCQ A;  4E30 A;  4RVH A;  2GU2 A;  4A3K I;  1WJ2 A;  3NDI A;  4MON A;  5C4J I;  3B7W A;  3ETO A;  3NYQ A;  3I4N I;  3UX2 A;  4U5Y D;  3VNS A;  3TDE A;  3GTO I;  4PZP A;  1O90 A;  2JNV A;  4MH4 A;  3RZO I;  2P20 A;  2JIM A;  1VLA A;  2JS4 A;  4NOZ A;  3G71 Z;  3GTL I;  4A3B I;  5IT9 f;  3JAM D;  2E7G A;  3VMH A;  2HJG A;  4NBG A;  1P4E C;  1MDF A;  3NH5 A;  3CCV Z;  2OTL Z;  2P2F A;  4HGZ A;  1YIJ 1;  1KQS Z;  1YIT 1;  3NPD A;  4NXM C;  1VQ9 1;  2JMP A;  1Z01 A;  1K73 1;  3VMI A;  4DR7 C;  3S15 I;  4L2Z A;  2AYA A;  3R44 A;  5LL6 f;  3IPL A;  3CCU 1;  4B3R C;  3S1M I;  3GTP I;  1FDI A;  4GKK C; 
#chains in the Genus database with same CATH homology
 3S2H I;  3NFZ A;  2UUA C;  1YJ9 Z;  3NI2 A;  5BST A;  2D1Q A;  2QA4 Z;  2YU9 I;  5FLM I;  1XRB A;  4IR7 A;  3S2D I;  1ML8 A;  4B3T C;  3L95 X;  2GTI A;  1MDB A;  3CCR Z;  4RVN A;  4Y52 I;  3J80 b;  1N33 C;  3S14 I;  3E7W A;  4G37 A;  3I55 1;  2QR1 B;  1T5D X;  1RY2 A;  1MXA A;  3CCJ 1;  1VQ8 1;  3GTK I;  1M1K 2;  4PRO C;  1W2B Z;  1RLY A;  3ETC A;  4ISB A;  4LFB C;  3HOY I;  1VQ7 Z;  3A9V A;  2R93 I;  4CL1 A;  3NH4 A;  3CCQ 1;  1GPM A;  1N34 C;  5AN9 F;  5AE3 A;  1WII A;  2ZM6 C;  3NDJ A;  1YJN 1;  1MKY A;  1M1K 1;  3UZ0 A;  3D9X A;  2F4M A;  3CD6 1;  4JI5 C;  3CC7 1;  1I6H I;  3G6E 1;  4BBY A;  1WW9 A;  2Y0S A;  1YJW Z;  4A3I I;  3KIF A;  4ZLP A;  1P9N A;  3G7S A;  3I07 A;  5BSR A;  3RV2 A;  4BXX I;  3HOV I;  4LF7 C;  3MZL B;  4NBB A;  2DPL A;  3GPC A;  3PO2 I;  5C4X I;  3CMA Z;  2OBV A;  1N32 C;  4QTT A;  1VQL Z;  1VQ5 1;  2QW0 X;  3FCC A;  5A1I A;  1XMO C;  2W04 A;  2JR6 A;  2F4O A;  3CC4 Z;  4G1I A;  3S17 I;  1QVF Z;  1Q7Y 2;  4WV3 A;  3CCM 1;  4RLF A;  1TFI A;  4RMN A;  2JA8 I;  4PHT A;  4D57 A;  3A4I A;  4DUZ C;  2VQE C;  2W03 A;  1VQK 1;  2AKL A;  1XRA A;  3EED A;  1VQN Z;  4DCT A;  4WS9 A;  4A3G I;  2KZF A;  4NBE A;  4A3L I;  1N36 C;  1NUI A;  1Q7Y 1;  4I9G A;  3S1N I;  2DYJ A;  5D1P A;  2UXC C;  3CME 1;  4G36 A;  3T1H C;  2P02 A;  1VQ6 Z;  3RG2 A;  4AYB A;  4E32 A;  2CXC A;  5IWA C;  4MRI A;  3KXW A;  3GTM I;  3J80 D;  3NH8 A;  1KC8 2;  2E0G A;  1IBK C;  3AF5 A;  2JUB A;  2VUG A;  3CQZ I;  1O93 A;  4HGY A;  1TWC I;  1S72 1;  2GTH A;  1RO2 A;  2PK7 A;  3T4N B;  2M6N A;  1V26 A;  2JA7 I;  2NVT I;  3PES A;  1KC8 1;  1VQP Z;  1R9T I;  3SO4 A;  2IZ4 A;  1QVG Z;  2LFU A;  3S82 A;  5IP7 I;  5CZX A;  4LF6 C;  1YUK A;  1PG3 A;  4JV5 C;  4R1M A;  3FQM A;  3TQI A;  5IP9 I;  4HPV A;  2QEX 1;  4BC9 A;  4OX9 C;  3I4M I;  1FJG C;  4DR1 C;  3MON A;  3EER A;  1JJ2 Y;  1MXB A;  5BSW A;  2K3R A;  3CCL Z;  1AMU A;  4D4I A;  2IZ3 A;  3CC2 Z;  2G2K A;  4JM1 A;  4B3S C;  2DE6 A;  2HHH C;  2OOX B;  5BUS A;  5BR8 C;  4BY1 I;  2UUB C;  1WCM I;  1NJI 1;  2E2J I;  1Y1V I;  2VUM I;  4B3M C;  2OOY B;  3OW2 Y;  3CPW Y;  3PO3 I;  4L4Q A;  4BSZ A;  3FKI I;  5A2Q b;  1K73 2;  1FUG A;  5H9U A;  2P28 A;  2Q4Z A;  3H0G I;  1M90 2;  3R9X A;  3HKZ A;  3JAM f;  3H3V J;  1MXC A;  4A3E I;  4AQY C;  2RHB A;  2PN2 A;  2V8K A;  2VZE A;  2E8C A;  3CCV 1;  1T5H X;  2OZK A;  3M4O I;  4FUQ A;  4X64 C;  1JWH C;  4NBC A;  5C44 I;  1VQ4 1;  1M90 1;  5K85 A;  2B63 I;  1I3Q I;  5CZV A;  3TE5 B;  1TWH I;  4QTU A;  3IFU A;  1Q82 1;  2XR1 A;  4DV7 C;  2O4H A;  3VNR A;  1Q81 2;  2Y4O A;  1RNI A;  1YJ9 1;  4Y7N I;  3F3P C;  1O92 A;  4I9F A;  4E2X A;  1X3W A;  2QA4 1;  1YIJ Z;  1P7L A;  4BCA A;  3TUF A;  4S1T A;  3J81 b;  4A3F I;  2NVQ I;  2H85 A;  4E33 A;  1Q81 1;  1YI2 1;  5KYT A;  4GS5 A;  4DV1 C;  1KQS Y;  3GTM S;  2J6A A;  2WAQ A;  2QVX X;  3CCS Z;  4R0M A;  4LF4 C;  5BSV A;  5D1O A;  2P3Y A;  2QRD B;  1VQ7 1;  4DR3 C;  4DK1 A;  2CY1 A;  1BA3 A;  1NYE A;  4NBD A;  3GKU A;  2YCB A;  1QF8 A;  3LUS A;  2WB1 A;  4DV5 C;  5IFI A;  3VTN A;  4E2Z A;  4A3J I;  3VMG A;  1JOS A;  1O9T A;  3HOX I;  4RVF A;  1ULT A;  5A2Q D;  4LF5 C;  5ADZ A;  1QWI A;  4GXR A;  4NBF A;  2QL8 A;  4LF8 C;  4JYA C;  4LFA C;  5FLX b;  2V8I A;  3D6W A;  1W2B Y;  3UOW A;  3FCE A;  3CMA 1;  1PA4 A;  4K0B A;  4JI7 C;  2D1S A;  4KTV A;  3R9W A;  4ODJ A;  3DLP X;  3KIH A;  4A3M I;  3CC4 1;  2R92 I;  2V7B A;  4JI4 C;  5JRH A;  2KI7 B;  4RVD A;  2OPL B;  1RG9 A;  2F4V C;  1Y1V S;  4DV3 C;  4RVG A;  3PO3 S;  1VQN 1;  4MD9 A;  1VQM Z;  3EQ6 A;  2O53 A;  3FQQ A;  4DG9 A;  2Y27 A;  2Y4N A;  2UXD C;  1HNW C;  2E5L C;  2P2J A;  5IT9 b;  1XNQ C;  3IEV A;  4LF9 C;  2UUC C;  3J80 f;  1VQK Z;  4L7I A;  3JAM b;  3QWU A;  2QVZ X;  2ASB A;  2JA6 I;  3G4S Z;  1KRL A;  3CXC Z;  5A1G A;  1HR0 C;  3CME Z;  2M48 A;  5A19 A;  3DHV A;  2YWC A;  2JA5 I;  4MXU A;  4BBR I;  2R6M A;  1X3Z A;  4DR5 C;  4E2Y A;  4JI2 C;  4BC7 A;  3IML A;  1VQP 1;  5T8S A;  4DV0 C;  4A3C I;  2RBL A;  2E8F A;  1L2F A;  1VQO Z;  3I56 1;  1Z02 A;  3GCF A;  1NJI 2;  2PMZ A;  3HOZ I;  3LNV A;  3CCE Z;  2OTJ Z;  2VSQ A;  1KD1 2;  1PFT A;  3CCL 1;  3F3F C;  4X66 C;  1RO0 A;  1YHQ Z;  5D1O B;  4DUY C;  3L8C A;  2HU9 A;  5FLX D;  1K0R A;  3GTG I;  4NXN C;  4JI3 C;  5AE1 A;  4YHH C;  3CC2 1;  3GR0 A;  2HF1 A;  4EWC A;  4DV2 C;  4YY3 C;  2D1R A;  1J5E C;  1KD1 1;  4FTF A;  4JI8 C;  2OPL A;  1QVG Y;  3HOU I;  2E2I I;  1I94 C;  5C3E I;  4LE5 A;  4X65 C;  3HOW I;  3G71 1;  4X62 C;  3OTO C;  5LMU C;  2KPI A;  4JI0 C;  1Q82 2;  1UKK A;  2LIY A;  1KKG A;  4EAT A;  2NVX I;  5BUQ A;  2OTL 1;  5E7Q A;  2VF1 A;  4GXQ A;  5CM2 M;  1LCI A;  5T8T A;  4JI6 C;  2PT7 G;  3J7A 4;  2PM9 A;  3BG1 B;  4DV4 C;  1K8A 2;  1L1O C;  5DV9 A;  2BH1 X;  5IT9 D;  4NB8 A;  3VB9 A;  3N2Q A;  5K8F A;  4DGL A;  4NDN A;  4NBA A;  4D4G A;  4DQY B;  2RPR A;  2JMO A;  1USP A;  1XNR C;  1HNZ C;  1YIT Z;  1VQ9 Z;  2UXB C;  1K8A 1;  1V25 A;  2E2H I;  1SFO I;  3N54 B;  1VQ4 Z;  4RM2 A;  4DCV A;  2JNY A;  3CCU Z;  4E2W A;  1HH2 P;  3CCR 1;  2D27 A;  3S16 I;  4E31 A;  2YAD A;  1WH9 A;  3M3Y I;  2YWB A;  3TDH B;  3E7X A;  3CJE A;  2ONF A;  3PBK A;  4MTN A;  4ZJZ A;  4DR6 C;  2I3C A;  2QLV B;  3GTJ I;  5KYV A;  4DR2 C;  3U50 C;  1ZB8 A;  1Z03 A;  1K9M 2;  2QVY X;  5KEI A;  3P5J B;  1RQF A;  1IBM C;  3CCS 1;  2QRE B;  3K7A I;  3I55 Z;  4NB9 A;  2P2M A;  3BG0 B;  1YI2 Z;  3DAY A;  2WD9 A;  4RVO A;  2NVY I;  2RT9 A;  3CCJ Z;  4MD7 A;  1VQ8 Z;  1I50 I;  1K9M 1;  3MZK B;  4RLQ A;  5GTD A;  2K5R A;  4BY7 I;  1YJW 1;  1MD9 A;  3CCQ Z;  2D7V A;  3C5E A;  2ZAE B;  3VNQ A;  1N8R 2;  5A2Q f;  3I08 A;  1QM4 A;  4OYC A;  4XX2 A;  1YUA A;  4A3D I;  3T1Y C;  1YJN Z;  1VQL 1;  3CD6 Z;  5LMN C;  3CC7 Z;  4DR4 C;  3G6E Z;  2QKD A;  2RIQ A;  3S1R I;  1EGA A;  2PRO A;  1TWF I;  1DL6 A;  4KTT A;  2WP0 C;  1N8R 1;  3GTQ I;  4K0K C;  4NH1 C;  1PG4 A;  4KHP C;  2EGT A;  4TPS B;  1VQ5 Z;  3LAX A;  1XRC A;  1N2F A;  4DCU A;  1YJ7 A;  1QYP A;  1S7M A;  1IBL C;  5T67 A;  3IF8 A;  3J81 D;  1VQM 1;  3CCM Z;  4LFC C;  1VQ6 1;  2E8E A;  2D1T A;  1TWG I;  4DCS A;  3J81 f;  4HH4 A;  1X0T A;  3ESW A;  2UU9 C;  1Q86 2;  4BBS I;  4NBH A;  1QVF Y;  1K83 I;  2V8J A;  3AF6 A;  3RZD I;  3IEU A;  3CW8 X;  2ATW A;  4GKJ C;  1LQL A;  1USP B;  5BUR A;  4A93 I;  3G4S 1;  2R7Z I;  2DE7 A;  1WF3 A;  3A9U A;  5BSU A;  4IZ6 A;  4RS4 A;  5T6B A;  1Q86 1;  3LGX A;  2E9H A;  2OO4 A;  1JJ2 Z;  4JI1 C;  2BJO A;  5AE2 A;  2P2B A;  3PRO C;  4R1L A;  2QRC B;  3NYR A;  4DG8 A;  4D56 A;  1S72 Z;  3GR1 A;  5BSM A;  4TNU A;  4OXI A;  2VQF C;  4MD8 A;  1VQO 1;  3GKQ A;  1XMQ C;  1NP6 A;  5T64 A;  1HNX C;  3S1Q I;  3CCE 1;  2OTJ 1;  1TWA I;  2P2Q A;  3CW9 A;  3Q87 A;  1RO4 A;  4RM3 A;  3IX0 A;  1ZH1 A;  3CXC Y;  3OW2 Z;  3CPW Z;  1YHQ 1;  4FUT A;  5FLX f;  4NFR A;  2QEX Z;  1Y1W I;  2Q51 A;  1ZB9 A;  2D28 C;  4RV9 A;  4DV6 C;  2DE5 A;  3I56 Z;  3H2T A;  4X6A I;  4E30 A;  4RVH A;  2GU2 A;  4A3K I;  3NDI A;  4MON A;  5C4J I;  3B7W A;  3ETO A;  3NYQ A;  3I4N I;  4U5Y D;  3VNS A;  3TDE A;  3GTO I;  4PZP A;  1O90 A;  4MH4 A;  3RZO I;  2P20 A;  1VLA A;  2JS4 A;  4NOZ A;  3G71 Z;  3GTL I;  4A3B I;  5IT9 f;  3JAM D;  2E7G A;  3VMH A;  2HJG A;  4NBG A;  1MDF A;  3NH5 A;  3CCV Z;  2OTL Z;  2P2F A;  4HGZ A;  1YIJ 1;  1KQS Z;  1YIT 1;  3NPD A;  4NXM C;  1VQ9 1;  2JMP A;  1Z01 A;  1K73 1;  3VMI A;  4DR7 C;  3S15 I;  4L2Z A;  4B3R C;  3R44 A;  5LL6 f;  3IPL A;  3CCU 1;  3S1M I;  3GTP I;  2AYA A;  4GKK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...