4MH4A

Crystal structure of osmc-like protein from burkholderia cenocepacia j2315
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
SKIEKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAVDAEVDLGTAGNAYFLQARLNVSVPGLERDVAQRIVDAAHQTCPYSKATRGNIDVDIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of OsmC-like protein from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Protein binding
molecule keywords OsmC-like protein
total genus 31
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mh4A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4mh4A02
3ESWA 1I50I 4NBHA 2F4VC 2UXBC 4AQYC 2JA8I 4GKKC 1TWFI 4DV3C 3S16I 4LF8C 3HOZI 2HF1A 3GKQA 1L2FA 1RLYA 1I6HI 1HNWC 5IT9D 3GTOI 5BR8C 4QTTA 2E8FA 2XR1A 4NB8A 4A3LI 4MH4A 4DV6C 4DR3C 4DR5C 3HOWI 4JI7C 4BBSI 4DV1C 4DCVA 4A3CI 2VQEC 1XMQC 1IBLC 3M4OI 2E5LC 2HJGA 3S15I 1WCMI 4A3II 2EGTA 3AF5A 5LMUC 3PO3I 3S1RI 4BXXI 1K83I 4LF4C 4MTNA 5LMNC 1N34C 1N33C 3R9WA 1X3WA 4X66C 5C4JI 4DCTA 3HOXI 1HNXC 4NOZA 4GKJC 3S2HI 2YU9I 4NBCA 3M3YI 4LF5C 2NVXI 1ZB8A 2CY1A 4DV2C 4A3BI 4XX2A 3K7AI 4NXMC 1WH9A 2PN2A 2B63I 2UU9C 3GTMS 1XNRC 1I3QI 1IBKC 2ATWA 1TWAI 4DCUA 2DE5A 4A3JI 2E2II 2VQFC 4B3SC 4LF6C 3S1MI 4NBBA 2YCBA 2AKLA 2NVTI 3HOUI 3J80D 3T1YC 2UUCC 1ZB9A 3VMIA 4X6AI 3JAMD 3HOYI 1K0RA 1PA4A 3IEUA 4JI3C 2ONFA 4YY3C 4Y7NI 1DL6A 4DCSA 4NBDA 5IP7I 4DR6C 1NUIA 4JV5C 3H0GI 4YHHC 4DR4C 1N32C 1WW9A 3EERA 3RZDI 5C4XI 2JA6I 1MKYA 2UUBC 2JA7I 2E8CA 4DUYC 1J5EC 4A3GI 4DR2C 4B3MC 3VMGA 1UKKA 3GTLI 2J6AA 1L1OC 2OPLB 2NVYI 2QL8A 1JOSA 4JI0C 3OTOC 2RBLA 1N36C 3S1QI 2JS4A 4X65C 4NBGA 4A3KI 4JI8C 1ML8A 5C44I 1X3ZA 3J81D 4DV7C 3PO2I 4JI4C 4X62C 4BY1I 3GKUA 2UUAC 2UXCC 4A3EI 4DUZC 1TWGI 4KHPC 1SFOI 4LFCC 1TFIA 4A3DI 1N2FA 1HR0C 2ZM6C 4B3RC 1USPA 1EGAA 3GTGI 1FJGC 2JR6A 4BSZA 1PFTA 1RO4A 2E8EA 1QWIA 3Q87A 3GTMI 2F4MA 5FLMI 1USPB 3GTQI 4Y52I 4DV5C 2PK7A 4JI6C 4LFAC 2OPLA 1I94C 4BY7I 2R92I 2HHHC 4X64C 4NB9A 3AF6A 3S17I 4B3TC 3CQZI 3VMHA 5A2QD 5IP9I 1VLAA 4NBEA 3S2DI 1WF3A 4JI5C 2E2HI 1KKGA 2NVQI 3H3VJ 4BBRI 4JI2C 2E2JI 4JYAC 1TWCI 2KZFA 1TWHI 1IBMC 1XNQC 4DR7C 3LUSA 2P3YA 3S1NI 2DYJA 4A3MI 2E7GA 4NXNC 4DR1C 1Y1VI 3FKII 1QYPA 3PO3S 2JNYA 4DV0C 3U50C 2UXDC 2BJOA 2JA5I 3CJEA 1Y1WI 3GTPI 2ASBA 1R9TI 2F4OA 3IEVA 4A3FI 2KPIA 3GCFA 3I4MI 4A93I 1HH2P 1XMOC 4LF9C 4LFBC 3I4NI 3R9XA 4K0KC 3D6WA 4QTUA 1LQLA 2DE7A 2VUMI 3RZOI 2R93I 2JMPA 1HNZC 3S14I 3I07A 2CXCA 1YUAA 4NBFA 4JI1C 2K5RA 4LF7C 4NBAA 3GTJI 4DV4C 5C3EI 2PT7G 3HOVI 3VB9A 2R7ZI 2DE6A 1Y1VS 5IWAC 3GTKI 5FLXD 1NYEA 4OX9C 3T1HC 2D7VA 5CM2M
chains in the Genus database with same CATH superfamily
4NBHA 1I50I 2F4VC 2NCLA 3F3PC 1Q861 2JA8I 4TNUA 1QVGZ 1KRLA 1TWFI 5A19A 3S16I 4RVFA 2HF1A 2I3CA 1KC82 1RLYA 2PM9A 2PMZA 5IT9D 3GTOI 1QXFA 4DR5C 3HOWI 4I9GA 4BBSI 4DCVA 3CCJZ 1Q7Y2 3FQQA 3UEBA 1KQSZ 2V8JA 2M5HA 4AYBA 2QVZX 4X66C 2QA4Z 1V60A 1AA6A 3S2HI 4L2ZA 1FLOA 1Q822 3M3YI 4LF5C 2NVXI 4D57A 1YJWZ 3GTMS 1I3QI 1IBKC 1RO2A 1NJI2 3CC21 4B3SC 4NBBA 2YCBA 2VZEA 4ISBA 3J80D 1W2BZ 4RVGA 2YWBA 3CCL1 3IEUA 4JI3C 2ONFA 4Y7NI 2RPRA 1YI2Z 1DL6A 4NBDA 4JV5C 5FLXb 5KEIA 2E0GA 1WW9A 2GU2A 1VQPZ 3RZDI 3DAYA 2E8CA 1VQNZ 1XRCA 1KD11 3AY0A 1UKKA 1L1OC 3J81b 2OPLB 2QL8A 5LCIA 3IMLA 5FLXf 1JOSA 4JI0C 3TDEA 2RBLA 3KXWA 1VQ5Z 4E32A 1Q811 3TUFA 1X3ZA 1VQM1 4DV7C 1YJ91 2UUAC 4KHPC 3UX3A 5A1IA 4A3DI 3G7SA 2M6NA 1MXAA 2ZM6C 1HR0C 3C5EA 2G2KA 2Q4ZA 4BSZA 1RO4A 1K731 1NY8A 3GTMI 3GTQI 1RG9A 2E8EA 1USPB 3H2TA 1BA3A 2D1TA 4NB9A 2W03A 1NP6A 2QKDA 2IZ4A 1RY2A 1M6XC 2QREB 1QVGY 3BG1B 1V25A 3NI2A 4HGZA 2E2JI 4DGLA 3CW9A 5K8FA 1IBMC 2Y4OA 4DR7C 3LUSA 2DYJA 4A3MI 4NXNC 4DR1C 1VQ9Z 2ZZNA 2BJOA 3CJEA 1R9TI 4E30A 2F4OA 3D9XA 3OW2Y 2KPIA 2WP0C 1K8A1 2OO4A 4PZPA 4E2YA 3D6WA 3LNOA 4RM2A 3RZOI 2JMPA 1X0TA 2LFUA 1YUAA 2ZAEB 4NBFA 3KIHA 2K5RA 4NBAA 4D4GA 3CMAZ 4ZJZA 3L8CA 5DV9A 3LAXA 4EWCA 3I55Z 1YIJ1 2DE6A 1Y1VS 3GTKI 5FLXD 4RVDA 1VQL1 2V3VA 4JM1A 1M6XA 1MXBA 4GXRA 3VNRA 4AQYC 1Q862 4RVNA 3ETCA 2MMAB 3UZ0A 3TQIA 2VPXA 3HOZI 3GKQA 3J80b 1KC81 1L2FA 5BUQA 2MCQA 5BR8C 4QTTA 2XR1A 1HNWC 4JI7C 3N2QA 4RS4A 1YIJZ 3DHVA 5T64A 4A3CI 2QW0X 2ZZMA 2E5LC 5ADZA 3CD61 3NH8A 1YJ7A 4BCAA 2WB1A 4MD7A 3CXCY 2V7BA 4ODJA 4LF4C 2Y0SA 4MTNA 1N34C 3CCRZ 2AYDA 2Y27A 3CCU1 1VQK1 1HNXC 2OOYB 4GKJC 4NBCA 1RNIA 4OXIA 3IF8A 4A3BI 4XX2A 3K7AI 3EEDA 3CCEZ 2UU9C 2B63I 3QWUA 1XNRC 2P02A 4IR7A 2ATWA 4MD9A 4NH1C 4A3JI 5IT9b 4LF6C 3HOUI 5BSRA 3CMEZ 3NDJA 4X6AI 3JAMD 1PA4A 3J80f 2OZKA 5AE2A 2JIQA 1K9M2 4D4IA 3I56Z 2JIOA 1WIIA 3EERA 2YWCA 5C4XI 2JA6I 2P2QA 4DR2C 1KD12 2E7ZA 3VMGA 4B3MC 3CXCZ 3NH5A 3FCCA 2V8KA 1VQKZ 3S1QI 3IR7A 3CCR1 2MM9A 1ZH1A 4A3KI 5D1PA 4K0BA 4JI4C 2P2MA 4BY1I 1YJ9Z 1T5HX 3GKUA 3CCV1 5BUSA 2OTJ1 4LFCC 3NDIA 4MXUA 5AE1A 1XS3A 1N2FA 4B3RC 2GTHA 4RLFA 1EGAA 1O90A 4FUTA 1PFTA 3NYQA 1K732 2YADA 4DV5C 5CZVA 4LFAC 2PK7A 2QRDB 1V26A 2DPLA 2Q51A 5A2Qb 2OPLA 3N54B 4R0MA 2HHHC 2VPZA 2D28C 4B3TC 2P20A 3CQZI 2HU9A 1VLAA 2M48A 2D1RA 3S2DI 1WF3A 4G1IA 2E2HI 2KDNA 4JI2C 3CCLZ 4L4QA 2KI7B 1TWCI 2KZFA 3LNVA 4JYAC 2O4HA 2GTIA 3S1NI 3FQMA 4E2WA 3CC2Z 1YUKA 3PO3S 2UXDC 4MRIA 1PU1A 4KTTA 5T6BA 2V8IA 3CCMZ 3GTPI 4LE5A 3CCQ1 3A9VA 3A25A 1RQFA 2JIRA 3GCFA 1YJNZ 2QA41 3I4MI 1K8A2 5LL6f 4A93I 1IB8A 4LF9C 4K0KC 3R9XA 3I561 5H9UA 5AN9F 3CC4Z 2P2BA 4BC7A 1HNZC 2AYAA 4LF7C 2QVYX 3GR0A 3GTJI 3ETOA 5IWAC 3CC41 4ZLPA 1NYEA 5AE3A 3T1HC 1YHQZ 1JJ2Z 2UXBC 2CU6A 4LF8C 2BH1X 4FUQA 2WAQA 3CCM1 4I9FA 4NB8A 4DV6C 2RHBA 4D56A 2VQEC 3CCSZ 1O93A 1IBLC 1FDOA 1RO0A 3S15I 2HJGA 3A26A 1WCMI 3GPCA 3AF5A 5LMUC 3PO3I 2KZ0A 1VQMZ 4BXXI 3G6EZ 3PROC 1WZNA 2Y4NA 4RM3A 3R44A 1N33C 3NFZA 4RMNA 1X3WA 4DCTA 3I08A 2OOXB 1O92A 2JMOA 1ZB8A 5KYVA 4DV2C 4RLQA 1WH9A 1VQN1 3VTNA 1VQP1 2NAPA 1O9TA 1TWAI 2JIPA 1YIT1 2VQFC 2IZ3A 1FDIA 2NVTI 2UUCC 1ZB9A 3G6E1 1M1K2 3HOYI 4DG9A 1YI21 4YY3C 1VQO1 4DCSA 1P4EA 4DR6C 1NUIA 1K9M1 3JAMf 1VQ4Z 4DR4C 2K3RA 2Z51A 1YJW1 1QVFZ 3SO4A 1MKYA 2UUBC 4DUYC 1J5EC 1JJ2Y 4FTFA 2P2JA 3LGXA 2NVYI 2QVXX 4DK1A 2D1QA 3TDHB 2WD9A 2JS4A 3IX0A 4NBGA 1YHQ1 1QVFY 3TR3A 4JI8C 4WS9A 1Y8CA 1ML8A 1Z01A 3NH4A 4RV9A 5C44I 4GXQA 5T8TA 5KYTA 1PG3A 2RIQA 1YITZ 4WV3A 1SFOI 1N8R2 1TH5A 3L95X 1Q16A 1USPA 5D1OB 3G4SZ 1P7LA 3NPDA 2V45A 3CCE1 3Q87A 1QWIA 5FLMI 3F3FC 5IT9f 2VPYA 2VF1A 2O53A 1LCIA 3MZLB 4BY7I 4NFRA 2QEXZ 1T5DX 3CCQZ 4X64C 3CCUZ 4E31A 3RV2A 2QR1B 5BSVA 3EQ6A 5IP9I 1S7MA 3BG0B 4JI5C 4OYCA 3H3VJ 3IPLA 4BBRI 1VQ6Z 2VUGA 5BSUA 3CD6Z 1MDFA 2JNVA 2E7GA 2QEX1 4DV0C 3U50C 4R1MA 1Y1WI 4RVHA 4A3FI 2P28A 1XMOC 4G36A 5A1GA 1MD9A 1SIWA 1JWHC 4NDNA 3RG2A 5JRHA 2DE7A 2CXCA 2M5OA 4HGYA 3I551 3CPWY 1M901 5BURA 1Z03A 4GKKC 4OX9C 1ULTA 3ESWA 2VPWA 2OBVA 1QM4A 3D2LA 3S82A 3JAMb 4MONA 4DV3C 2QLVB 4HH4A 1I6HI 1MXCA 3GR1A 3UX2A 2E8FA 4A3LI 1VQ41 4MH4A 2DHMA 4DR3C 4DV1C 3NYRA 1VQOZ 2RT9A 3J81f 3PESA 1Q7Y1 1XMQC 1VEHA 2LEXA 3M4OI 1XRAA 3J7A4 4A3II 2EGTA 2P2FA 3CC7Z 4CL1A 3CCJ1 2W04A 3S1RI 1S721 1K83I 5LMNC 1KQSY 5A2Qf 4U5YD 5BSTA 3R9WA 5C4JI 4PUIA 3HOXI 4NOZA 4E2XA 2YU9I 2IV2X 4MD8A 3KIFA 1Q821 3B7WA 5K85A 2E9HA 2CY1A 2QRCB 4NXMC 2YX1A 2PN2A 1UWDA 1AMUA 1NJI1 4DCUA 2DE5A 3VNSA 2E2II 2VSQA 3G711 3S1MI 3T1YC 2AKLA 3CQ1A 4PUGA 3VMIA 3DLPX 1VQ61 1M1K1 1K0RA 3E7WA 4S1TA 2PROA 5IP7I 3T4NB 4PHTA 4DG8A 3H0GI 3UOWA 4YHHC 1VQ51 5IFIA 3P5JB 4PUHA 4BBYA 1N32C 3TE5B 2JA7I 3CQ2A 1QF8A 3GTLI 4TPSB 2J6AA 2R6MA 1VQ71 3G4S1 3OTOC 1WJ2A 2JUBA 1N36C 4X65C 1Z02A 2OTLZ 2D27A 1S72Z 3E7XA 3FCEA 1Q812 3MZKB 3CME1 5BSWA 3PO2I 3CC71 4X62C 3J81D 4KTVA 2UXCC 4LFBC 4A3EI 4DUZC 1TWGI 1P9NA 1TFIA 2JIMA 1GPMA 1N8R1 3A4IA 1FJGC 3GTGI 1YJN1 2JR6A 1WCJA 4L7IA 2F4MA 1VQ81 4Y52I 4JI6C 1VQ8Z 4E2ZA 1I94C 2R92I 1XHJA 3AF6A 5T67A 5CZXA 3S17I 2D1SA 5BSMA 3VMHA 5A2QD 1VQ91 3HKZA 4NBEA 1KKGA 2NVQI 4GS5A 4EATA 4BC9A 3MONA 2LIYA 1XNQC 1TWHI 3CQ3A 2P3YA 2OTL1 4HPVA 1Y1VI 3FKII 1QYPA 3O2EA 2JNYA 5T8SA 1VQ7Z 4RVOA 3IFUA 3CW8X 3CPWZ 2JA5I 4PROC 2ASBA 1PG4A 1W2BY 1VQLZ 3IEVA 3PBKA 4G37A 1HH2P 2H85A 3VNQA 4DQYB 3I4NI 5E7QA 4IZ6A 5D1OA 4QTUA 2OTJZ 1LQLA 2VUMI 3CMA1 2R93I 1MDBA 3A9UA 1P4EC 3CCVZ 3S14I 3I07A 4R1LA 3OW2Z 4E33A 1XRBA 4JI1C 1FUGA 1M902 4DV4C 5C3EI 3CCS1 2PT7G 3HOVI 3VB9A 2R7ZI 3G71Z 3K6RA 4A3GI 5GTDA 2D7VA 5CM2M
chains in the Genus database with same CATH topology
4NBHA 1I50I 2F4VC 3F3PC 1Q861 2JA8I 4TNUA 1QVGZ 1KRLA 1TWFI 5A19A 3S16I 4RVFA 2HF1A 2I3CA 1KC82 1RLYA 2PM9A 2PMZA 5IT9D 3GTOI 4DR5C 3HOWI 4I9GA 4BBSI 4DCVA 3CCJZ 1Q7Y2 3FQQA 1KQSZ 2V8JA 4AYBA 2QVZX 4X66C 2QA4Z 4L2ZA 3S2HI 1Q822 3M3YI 4LF5C 2NVXI 4D57A 1YJWZ 3GTMS 1I3QI 1IBKC 1RO2A 1NJI2 3CC21 4B3SC 4NBBA 2YCBA 2VZEA 4ISBA 3J80D 1W2BZ 4RVGA 2YWBA 3CCL1 3IEUA 4JI3C 2ONFA 4Y7NI 2RPRA 1YI2Z 1DL6A 4NBDA 4JV5C 5FLXb 5KEIA 2E0GA 1WW9A 2GU2A 1VQPZ 3RZDI 3DAYA 2E8CA 1VQNZ 1XRCA 1KD11 1UKKA 1L1OC 3J81b 2OPLB 2QL8A 3IMLA 5FLXf 1JOSA 4JI0C 3TDEA 2RBLA 3KXWA 1VQ5Z 4E32A 1Q811 3TUFA 1X3ZA 1VQM1 4DV7C 1YJ91 2UUAC 4KHPC 5A1IA 4A3DI 3G7SA 2M6NA 1MXAA 2ZM6C 1HR0C 3C5EA 2G2KA 2Q4ZA 4BSZA 1RO4A 1K731 2E8EA 3GTMI 3GTQI 1RG9A 1USPB 3H2TA 1BA3A 2D1TA 4NB9A 2W03A 1NP6A 2QKDA 2IZ4A 1RY2A 2QREB 1QVGY 3BG1B 1V25A 3NI2A 4HGZA 2E2JI 4DGLA 3CW9A 5K8FA 1IBMC 2Y4OA 4DR7C 3LUSA 2DYJA 4A3MI 4NXNC 4DR1C 1VQ9Z 2BJOA 3CJEA 1R9TI 4E30A 2F4OA 3D9XA 3OW2Y 2KPIA 2WP0C 1K8A1 2OO4A 4PZPA 4E2YA 3D6WA 4RM2A 3RZOI 2JMPA 1X0TA 2LFUA 1YUAA 2ZAEB 4NBFA 3KIHA 2K5RA 4NBAA 4D4GA 3CMAZ 4ZJZA 3L8CA 5DV9A 3LAXA 4EWCA 3I55Z 1YIJ1 2DE6A 1Y1VS 3GTKI 5FLXD 4RVDA 1VQL1 4JM1A 1MXBA 4GXRA 3VNRA 4AQYC 1Q862 4RVNA 3ETCA 3UZ0A 3TQIA 3HOZI 3GKQA 3J80b 1KC81 1L2FA 5BUQA 5BR8C 4QTTA 2XR1A 1HNWC 4JI7C 3N2QA 4RS4A 1YIJZ 3DHVA 5T64A 4A3CI 2QW0X 2E5LC 5ADZA 3CD61 3NH8A 1YJ7A 4BCAA 2WB1A 4MD7A 3CXCY 2V7BA 4ODJA 4LF4C 2Y0SA 4MTNA 1N34C 3CCRZ 2Y27A 3CCU1 1VQK1 1HNXC 2OOYB 4GKJC 4NBCA 1RNIA 4OXIA 3IF8A 4A3BI 4XX2A 3K7AI 3EEDA 3CCEZ 2UU9C 2B63I 3QWUA 1XNRC 2P02A 4IR7A 2ATWA 4MD9A 4NH1C 4A3JI 5IT9b 4LF6C 3HOUI 5BSRA 3CMEZ 3NDJA 4X6AI 3JAMD 1PA4A 3J80f 2OZKA 5AE2A 1K9M2 4D4IA 3I56Z 3EERA 1WIIA 2YWCA 5C4XI 2JA6I 2P2QA 4DR2C 1KD12 4B3MC 3VMGA 3CXCZ 3NH5A 3FCCA 2V8KA 1VQKZ 3S1QI 3CCR1 1ZH1A 4A3KI 5D1PA 4K0BA 4JI4C 2P2MA 4BY1I 1YJ9Z 1T5HX 3GKUA 3CCV1 5BUSA 2OTJ1 4LFCC 3NDIA 4MXUA 5AE1A 1N2FA 4B3RC 2GTHA 4RLFA 1EGAA 1O90A 4FUTA 1PFTA 3NYQA 1K732 2YADA 4DV5C 5CZVA 4LFAC 2PK7A 2QRDB 1V26A 2DPLA 2Q51A 5A2Qb 2OPLA 3N54B 4R0MA 2HHHC 2D28C 4B3TC 2P20A 3CQZI 2HU9A 1VLAA 2M48A 2D1RA 3S2DI 1WF3A 4G1IA 2E2HI 4JI2C 3CCLZ 4L4QA 2KI7B 1TWCI 2KZFA 3LNVA 4JYAC 2O4HA 2GTIA 3S1NI 3FQMA 4E2WA 3CC2Z 1YUKA 3PO3S 2UXDC 4MRIA 4KTTA 5T6BA 2V8IA 3CCMZ 3GTPI 4LE5A 3CCQ1 3A9VA 1AMUA 1RQFA 4LFBC 3GCFA 1YJNZ 2QA41 3I4MI 1K8A2 5LL6f 4A93I 4LF9C 4K0KC 3R9XA 3I561 5H9UA 5AN9F 3CC4Z 2P2BA 4BC7A 1HNZC 2AYAA 4LF7C 2QVYX 3GR0A 3GTJI 3ETOA 5IWAC 3CC41 4ZLPA 1NYEA 5AE3A 3T1HC 1YHQZ 1JJ2Z 2UXBC 4LF8C 2BH1X 4FUQA 2WAQA 3CCM1 4I9FA 4NB8A 4DV6C 2RHBA 4D56A 2VQEC 3CCSZ 1O93A 1IBLC 1RO0A 2HJGA 3S15I 1WCMI 3GPCA 3AF5A 5LMUC 3PO3I 1VQMZ 4BXXI 3G6EZ 3PROC 2Y4NA 4RM3A 3R44A 1N33C 3NFZA 4RMNA 1X3WA 4DCTA 3I08A 2OOXB 1O92A 2JMOA 1ZB8A 5KYVA 4DV2C 4RLQA 1WH9A 1VQN1 3VTNA 1VQP1 1O9TA 1TWAI 1YIT1 2VQFC 2IZ3A 2NVTI 2UUCC 1ZB9A 3G6E1 1M1K2 3HOYI 4DG9A 1YI21 4YY3C 1VQO1 4DCSA 4DR6C 1NUIA 1K9M1 3JAMf 1VQ4Z 4DR4C 2K3RA 1YJW1 1QVFZ 3SO4A 1MKYA 2UUBC 4DUYC 1J5EC 1JJ2Y 4FTFA 2P2JA 3LGXA 2NVYI 2QVXX 4DK1A 2D1QA 3TDHB 2WD9A 2JS4A 3IX0A 4NBGA 1YHQ1 1QVFY 4JI8C 4WS9A 3NH4A 1ML8A 1Z01A 4RV9A 5C44I 4GXQA 5T8TA 5KYTA 1PG3A 2RIQA 1YITZ 4WV3A 1SFOI 1N8R2 3L95X 1USPA 5D1OB 3G4SZ 1P7LA 3NPDA 3CCE1 3Q87A 1QWIA 5FLMI 3F3FC 5IT9f 2VF1A 2O53A 1LCIA 3MZLB 4BY7I 4NFRA 2QEXZ 1T5DX 3CCQZ 4X64C 3CCUZ 4E31A 3RV2A 2QR1B 5BSVA 3EQ6A 5IP9I 1S7MA 3BG0B 4JI5C 4OYCA 3H3VJ 3IPLA 4BBRI 1VQ6Z 2VUGA 5BSUA 3CD6Z 1MDFA 2E7GA 2QEX1 4DV0C 3U50C 4R1MA 1Y1WI 4RVHA 4A3FI 2P28A 1XMOC 4G36A 5A1GA 1MD9A 1JWHC 4NDNA 3RG2A 5JRHA 2DE7A 2CXCA 4HGYA 3I551 3CPWY 1M901 5BURA 1Z03A 4GKKC 4OX9C 1ULTA 3ESWA 2OBVA 1QM4A 3S82A 3JAMb 4MONA 4DV3C 2QLVB 4HH4A 1I6HI 1MXCA 3GR1A 2E8FA 4A3LI 1VQ41 4MH4A 4DR3C 4DV1C 3NYRA 1VQOZ 2RT9A 3J81f 3PESA 1Q7Y1 1XMQC 1XRAA 3M4OI 3J7A4 4A3II 2EGTA 2P2FA 3CC7Z 4CL1A 3CCJ1 2W04A 3S1RI 1S721 1K83I 5LMNC 1KQSY 5A2Qf 4U5YD 5BSTA 3R9WA 5C4JI 3HOXI 4NOZA 4E2XA 2YU9I 4MD8A 3KIFA 1Q821 3B7WA 5K85A 2E9HA 2CY1A 2QRCB 4NXMC 2PN2A 1NJI1 4DCUA 2DE5A 3VNSA 2E2II 2VSQA 3G711 3S1MI 3T1YC 2AKLA 3VMIA 3DLPX 1VQ61 1M1K1 1K0RA 3E7WA 4S1TA 2PROA 5IP7I 3T4NB 4PHTA 4DG8A 3H0GI 3UOWA 4YHHC 1VQ51 5IFIA 3P5JB 4BBYA 1N32C 3TE5B 2JA7I 1QF8A 3GTLI 4TPSB 2J6AA 2R6MA 1VQ71 3G4S1 3OTOC 2JUBA 1N36C 4X65C 1Z02A 2OTLZ 2D27A 1S72Z 3E7XA 3FCEA 1Q812 3MZKB 3CME1 5BSWA 3PO2I 3CC71 4X62C 3J81D 4KTVA 2UXCC 4A3EI 4DUZC 1TWGI 1P9NA 1TFIA 1GPMA 1N8R1 3A4IA 1FJGC 3GTGI 1YJN1 2JR6A 4L7IA 2F4MA 1VQ81 4Y52I 4JI6C 1VQ8Z 4E2ZA 1I94C 2R92I 3AF6A 5T67A 5CZXA 3S17I 2D1SA 5BSMA 3VMHA 5A2QD 1VQ91 3HKZA 4NBEA 1KKGA 2NVQI 4GS5A 4EATA 4BC9A 3MONA 2LIYA 1XNQC 1TWHI 2P3YA 2OTL1 4HPVA 1Y1VI 3FKII 1QYPA 2JNYA 5T8SA 1VQ7Z 4RVOA 3IFUA 3CW8X 3CPWZ 2JA5I 4PROC 2ASBA 1PG4A 1W2BY 1VQLZ 3IEVA 3PBKA 4G37A 1HH2P 2H85A 3VNQA 4DQYB 3I4NI 5E7QA 4IZ6A 5D1OA 4QTUA 2OTJZ 1LQLA 2VUMI 3CMA1 2R93I 1MDBA 3A9UA 3CCVZ 3S14I 3I07A 4R1LA 3OW2Z 4E33A 1XRBA 4JI1C 1FUGA 1M902 4DV4C 5C3EI 3CCS1 2PT7G 3HOVI 3VB9A 2R7ZI 3G71Z 4A3GI 5GTDA 2D7VA 5CM2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESW A;  1I50 I;  4NBH A;  2F4V C;  2UXB C;  4AQY C;  2JA8 I;  4GKK C;  1TWF I;  4DV3 C;  3S16 I;  4LF8 C;  3HOZ I;  2HF1 A;  3GKQ A;  1L2F A;  1RLY A;  1I6H I;  1HNW C;  5IT9 D;  3GTO I;  5BR8 C;  4QTT A;  2E8F A;  2XR1 A;  4NB8 A;  4A3L I;  4MH4 A;  4DV6 C;  4DR3 C;  4DR5 C;  3HOW I;  4JI7 C;  4BBS I;  4DV1 C;  4DCV A;  4A3C I;  2VQE C;  1XMQ C;  1IBL C;  3M4O I;  2E5L C;  2HJG A;  3S15 I;  1WCM I;  4A3I I;  2EGT A;  3AF5 A;  5LMU C;  3PO3 I;  3S1R I;  4BXX I;  1K83 I;  4LF4 C;  4MTN A;  5LMN C;  1N34 C;  1N33 C;  3R9W A;  1X3W A;  4X66 C;  5C4J I;  4DCT A;  3HOX I;  1HNX C;  4NOZ A;  4GKJ C;  3S2H I;  2YU9 I;  4NBC A;  3M3Y I;  4LF5 C;  2NVX I;  1ZB8 A;  2CY1 A;  4DV2 C;  4A3B I;  4XX2 A;  3K7A I;  4NXM C;  1WH9 A;  2PN2 A;  2B63 I;  2UU9 C;  3GTM S;  1XNR C;  1I3Q I;  1IBK C;  2ATW A;  1TWA I;  4DCU A;  2DE5 A;  4A3J I;  2E2I I;  2VQF C;  4B3S C;  4LF6 C;  3S1M I;  4NBB A;  2YCB A;  2AKL A;  2NVT I;  3HOU I;  3J80 D;  3T1Y C;  2UUC C;  1ZB9 A;  3VMI A;  4X6A I;  3JAM D;  3HOY I;  1K0R A;  1PA4 A;  3IEU A;  4JI3 C;  2ONF A;  4YY3 C;  4Y7N I;  1DL6 A;  4DCS A;  4NBD A;  5IP7 I;  4DR6 C;  1NUI A;  4JV5 C;  3H0G I;  4YHH C;  4DR4 C;  1N32 C;  1WW9 A;  3EER A;  3RZD I;  5C4X I;  2JA6 I;  1MKY A;  2UUB C;  2JA7 I;  2E8C A;  4DUY C;  1J5E C;  4A3G I;  4DR2 C;  4B3M C;  3VMG A;  1UKK A;  3GTL I;  2J6A A;  1L1O C;  2OPL B;  2NVY I;  2QL8 A;  1JOS A;  4JI0 C;  3OTO C;  2RBL A;  1N36 C;  3S1Q I;  2JS4 A;  4X65 C;  4NBG A;  4A3K I;  4JI8 C;  1ML8 A;  5C44 I;  1X3Z A;  3J81 D;  4DV7 C;  3PO2 I;  4JI4 C;  4X62 C;  4BY1 I;  3GKU A;  2UUA C;  2UXC C;  4A3E I;  4DUZ C;  1TWG I;  4KHP C;  1SFO I;  4LFC C;  1TFI A;  4A3D I;  1N2F A;  1HR0 C;  2ZM6 C;  4B3R C;  1USP A;  1EGA A;  3GTG I;  1FJG C;  2JR6 A;  4BSZ A;  1PFT A;  1RO4 A;  2E8E A;  1QWI A;  3Q87 A;  3GTM I;  2F4M A;  5FLM I;  1USP B;  3GTQ I;  4Y52 I;  4DV5 C;  2PK7 A;  4JI6 C;  4LFA C;  2OPL A;  1I94 C;  4BY7 I;  2R92 I;  2HHH C;  4X64 C;  4NB9 A;  3AF6 A;  3S17 I;  4B3T C;  3CQZ I;  3VMH A;  5A2Q D;  5IP9 I;  1VLA A;  4NBE A;  3S2D I;  1WF3 A;  4JI5 C;  2E2H I;  1KKG A;  2NVQ I;  3H3V J;  4BBR I;  4JI2 C;  2E2J I;  4JYA C;  1TWC I;  2KZF A;  1TWH I;  1IBM C;  1XNQ C;  4DR7 C;  3LUS A;  2P3Y A;  3S1N I;  2DYJ A;  4A3M I;  2E7G A;  4NXN C;  4DR1 C;  1Y1V I;  3FKI I;  1QYP A;  3PO3 S;  2JNY A;  4DV0 C;  3U50 C;  2UXD C;  2BJO A;  2JA5 I;  3CJE A;  1Y1W I;  3GTP I;  2ASB A;  1R9T I;  2F4O A;  3IEV A;  4A3F I;  2KPI A;  3GCF A;  3I4M I;  4A93 I;  1HH2 P;  1XMO C;  4LF9 C;  4LFB C;  3I4N I;  3R9X A;  4K0K C;  3D6W A;  4QTU A;  1LQL A;  2DE7 A;  2VUM I;  3RZO I;  2R93 I;  2JMP A;  1HNZ C;  3S14 I;  3I07 A;  2CXC A;  1YUA A;  4NBF A;  4JI1 C;  2K5R A;  4LF7 C;  4NBA A;  3GTJ I;  4DV4 C;  5C3E I;  2PT7 G;  3HOV I;  3VB9 A;  2R7Z I;  2DE6 A;  1Y1V S;  5IWA C;  3GTK I;  5FLX D;  1NYE A;  4OX9 C;  3T1H C;  2D7V A;  5CM2 M; 
#chains in the Genus database with same CATH topology
 4NBH A;  1I50 I;  2F4V C;  2NCL A;  3F3P C;  1Q86 1;  2JA8 I;  4TNU A;  1QVG Z;  1KRL A;  1TWF I;  5A19 A;  3S16 I;  4RVF A;  2HF1 A;  2I3C A;  1KC8 2;  1RLY A;  2PM9 A;  2PMZ A;  5IT9 D;  3GTO I;  1QXF A;  4DR5 C;  3HOW I;  4I9G A;  4BBS I;  4DCV A;  3CCJ Z;  1Q7Y 2;  3FQQ A;  3UEB A;  1KQS Z;  2V8J A;  2M5H A;  4AYB A;  2QVZ X;  4X66 C;  2QA4 Z;  1V60 A;  1AA6 A;  3S2H I;  4L2Z A;  1FLO A;  1Q82 2;  3M3Y I;  4LF5 C;  2NVX I;  4D57 A;  1YJW Z;  3GTM S;  1I3Q I;  1IBK C;  1RO2 A;  1NJI 2;  3CC2 1;  4B3S C;  4NBB A;  2YCB A;  2VZE A;  4ISB A;  3J80 D;  1W2B Z;  4RVG A;  2YWB A;  3CCL 1;  3IEU A;  4JI3 C;  2ONF A;  4Y7N I;  2RPR A;  1YI2 Z;  1DL6 A;  4NBD A;  4JV5 C;  5FLX b;  5KEI A;  2E0G A;  1WW9 A;  2GU2 A;  1VQP Z;  3RZD I;  3DAY A;  2E8C A;  1VQN Z;  1XRC A;  1KD1 1;  3AY0 A;  1UKK A;  1L1O C;  3J81 b;  2OPL B;  2QL8 A;  5LCI A;  3IML A;  5FLX f;  1JOS A;  4JI0 C;  3TDE A;  2RBL A;  3KXW A;  1VQ5 Z;  4E32 A;  1Q81 1;  3TUF A;  1X3Z A;  1VQM 1;  4DV7 C;  1YJ9 1;  2UUA C;  4KHP C;  3UX3 A;  5A1I A;  4A3D I;  3G7S A;  2M6N A;  1MXA A;  2ZM6 C;  1HR0 C;  3C5E A;  2G2K A;  2Q4Z A;  4BSZ A;  1RO4 A;  1K73 1;  1NY8 A;  3GTM I;  3GTQ I;  1RG9 A;  2E8E A;  1USP B;  3H2T A;  1BA3 A;  2D1T A;  4NB9 A;  2W03 A;  1NP6 A;  2QKD A;  2IZ4 A;  1RY2 A;  1M6X C;  2QRE B;  1QVG Y;  3BG1 B;  1V25 A;  3NI2 A;  4HGZ A;  2E2J I;  4DGL A;  3CW9 A;  5K8F A;  1IBM C;  2Y4O A;  4DR7 C;  3LUS A;  2DYJ A;  4A3M I;  4NXN C;  4DR1 C;  1VQ9 Z;  2ZZN A;  2BJO A;  3CJE A;  1R9T I;  4E30 A;  2F4O A;  3D9X A;  3OW2 Y;  2KPI A;  2WP0 C;  1K8A 1;  2OO4 A;  4PZP A;  4E2Y A;  3D6W A;  3LNO A;  4RM2 A;  3RZO I;  2JMP A;  1X0T A;  2LFU A;  1YUA A;  2ZAE B;  4NBF A;  3KIH A;  2K5R A;  4NBA A;  4D4G A;  3CMA Z;  4ZJZ A;  3L8C A;  5DV9 A;  3LAX A;  4EWC A;  3I55 Z;  1YIJ 1;  2DE6 A;  1Y1V S;  3GTK I;  5FLX D;  4RVD A;  1VQL 1;  2V3V A;  4JM1 A;  1M6X A;  1MXB A;  4GXR A;  3VNR A;  4AQY C;  1Q86 2;  4RVN A;  3ETC A;  2MMA B;  3UZ0 A;  3TQI A;  2VPX A;  3HOZ I;  3GKQ A;  3J80 b;  1KC8 1;  1L2F A;  5BUQ A;  2MCQ A;  5BR8 C;  4QTT A;  2XR1 A;  1HNW C;  4JI7 C;  3N2Q A;  4RS4 A;  1YIJ Z;  3DHV A;  5T64 A;  4A3C I;  2QW0 X;  2ZZM A;  2E5L C;  5ADZ A;  3CD6 1;  3NH8 A;  1YJ7 A;  4BCA A;  2WB1 A;  4MD7 A;  3CXC Y;  2V7B A;  4ODJ A;  4LF4 C;  2Y0S A;  4MTN A;  1N34 C;  3CCR Z;  2AYD A;  2Y27 A;  3CCU 1;  1VQK 1;  1HNX C;  2OOY B;  4GKJ C;  4NBC A;  1RNI A;  4OXI A;  3IF8 A;  4A3B I;  4XX2 A;  3K7A I;  3EED A;  3CCE Z;  2UU9 C;  2B63 I;  3QWU A;  1XNR C;  2P02 A;  4IR7 A;  2ATW A;  4MD9 A;  4NH1 C;  4A3J I;  5IT9 b;  4LF6 C;  3HOU I;  5BSR A;  3CME Z;  3NDJ A;  4X6A I;  3JAM D;  1PA4 A;  3J80 f;  2OZK A;  5AE2 A;  2JIQ A;  1K9M 2;  4D4I A;  3I56 Z;  2JIO A;  1WII A;  3EER A;  2YWC A;  5C4X I;  2JA6 I;  2P2Q A;  4DR2 C;  1KD1 2;  2E7Z A;  3VMG A;  4B3M C;  3CXC Z;  3NH5 A;  3FCC A;  2V8K A;  1VQK Z;  3S1Q I;  3IR7 A;  3CCR 1;  2MM9 A;  1ZH1 A;  4A3K I;  5D1P A;  4K0B A;  4JI4 C;  2P2M A;  4BY1 I;  1YJ9 Z;  1T5H X;  3GKU A;  3CCV 1;  5BUS A;  2OTJ 1;  4LFC C;  3NDI A;  4MXU A;  5AE1 A;  1XS3 A;  1N2F A;  4B3R C;  2GTH A;  4RLF A;  1EGA A;  1O90 A;  4FUT A;  1PFT A;  3NYQ A;  1K73 2;  2YAD A;  4DV5 C;  5CZV A;  4LFA C;  2PK7 A;  2QRD B;  1V26 A;  2DPL A;  2Q51 A;  5A2Q b;  2OPL A;  3N54 B;  4R0M A;  2HHH C;  2VPZ A;  2D28 C;  4B3T C;  2P20 A;  3CQZ I;  2HU9 A;  1VLA A;  2M48 A;  2D1R A;  3S2D I;  1WF3 A;  4G1I A;  2E2H I;  2KDN A;  4JI2 C;  3CCL Z;  4L4Q A;  2KI7 B;  1TWC I;  2KZF A;  3LNV A;  4JYA C;  2O4H A;  2GTI A;  3S1N I;  3FQM A;  4E2W A;  3CC2 Z;  1YUK A;  3PO3 S;  2UXD C;  4MRI A;  1PU1 A;  4KTT A;  5T6B A;  2V8I A;  3CCM Z;  3GTP I;  4LE5 A;  3CCQ 1;  3A9V A;  3A25 A;  1RQF A;  2JIR A;  3GCF A;  1YJN Z;  2QA4 1;  3I4M I;  1K8A 2;  5LL6 f;  4A93 I;  1IB8 A;  4LF9 C;  4K0K C;  3R9X A;  3I56 1;  5H9U A;  5AN9 F;  3CC4 Z;  2P2B A;  4BC7 A;  1HNZ C;  2AYA A;  4LF7 C;  2QVY X;  3GR0 A;  3GTJ I;  3ETO A;  5IWA C;  3CC4 1;  4ZLP A;  1NYE A;  5AE3 A;  3T1H C;  1YHQ Z;  1JJ2 Z;  2UXB C;  2CU6 A;  4LF8 C;  2BH1 X;  4FUQ A;  2WAQ A;  3CCM 1;  4I9F A;  4NB8 A;  4DV6 C;  2RHB A;  4D56 A;  2VQE C;  3CCS Z;  1O93 A;  1IBL C;  1FDO A;  1RO0 A;  3S15 I;  2HJG A;  3A26 A;  1WCM I;  3GPC A;  3AF5 A;  5LMU C;  3PO3 I;  2KZ0 A;  1VQM Z;  4BXX I;  3G6E Z;  3PRO C;  1WZN A;  2Y4N A;  4RM3 A;  3R44 A;  1N33 C;  3NFZ A;  4RMN A;  1X3W A;  4DCT A;  3I08 A;  2OOX B;  1O92 A;  2JMO A;  1ZB8 A;  5KYV A;  4DV2 C;  4RLQ A;  1WH9 A;  1VQN 1;  3VTN A;  1VQP 1;  2NAP A;  1O9T A;  1TWA I;  2JIP A;  1YIT 1;  2VQF C;  2IZ3 A;  1FDI A;  2NVT I;  2UUC C;  1ZB9 A;  3G6E 1;  1M1K 2;  3HOY I;  4DG9 A;  1YI2 1;  4YY3 C;  1VQO 1;  4DCS A;  1P4E A;  4DR6 C;  1NUI A;  1K9M 1;  3JAM f;  1VQ4 Z;  4DR4 C;  2K3R A;  2Z51 A;  1YJW 1;  1QVF Z;  3SO4 A;  1MKY A;  2UUB C;  4DUY C;  1J5E C;  1JJ2 Y;  4FTF A;  2P2J A;  3LGX A;  2NVY I;  2QVX X;  4DK1 A;  2D1Q A;  3TDH B;  2WD9 A;  2JS4 A;  3IX0 A;  4NBG A;  1YHQ 1;  1QVF Y;  3TR3 A;  4JI8 C;  4WS9 A;  1Y8C A;  1ML8 A;  1Z01 A;  3NH4 A;  4RV9 A;  5C44 I;  4GXQ A;  5T8T A;  5KYT A;  1PG3 A;  2RIQ A;  1YIT Z;  4WV3 A;  1SFO I;  1N8R 2;  1TH5 A;  3L95 X;  1Q16 A;  1USP A;  5D1O B;  3G4S Z;  1P7L A;  3NPD A;  2V45 A;  3CCE 1;  3Q87 A;  1QWI A;  5FLM I;  3F3F C;  5IT9 f;  2VPY A;  2VF1 A;  2O53 A;  1LCI A;  3MZL B;  4BY7 I;  4NFR A;  2QEX Z;  1T5D X;  3CCQ Z;  4X64 C;  3CCU Z;  4E31 A;  3RV2 A;  2QR1 B;  5BSV A;  3EQ6 A;  5IP9 I;  1S7M A;  3BG0 B;  4JI5 C;  4OYC A;  3H3V J;  3IPL A;  4BBR I;  1VQ6 Z;  2VUG A;  5BSU A;  3CD6 Z;  1MDF A;  2JNV A;  2E7G A;  2QEX 1;  4DV0 C;  3U50 C;  4R1M A;  1Y1W I;  4RVH A;  4A3F I;  2P28 A;  1XMO C;  4G36 A;  5A1G A;  1MD9 A;  1SIW A;  1JWH C;  4NDN A;  3RG2 A;  5JRH A;  2DE7 A;  2CXC A;  2M5O A;  4HGY A;  3I55 1;  3CPW Y;  1M90 1;  5BUR A;  1Z03 A;  4GKK C;  4OX9 C;  1ULT A;  3ESW A;  2VPW A;  2OBV A;  1QM4 A;  3D2L A;  3S82 A;  3JAM b;  4MON A;  4DV3 C;  2QLV B;  4HH4 A;  1I6H I;  1MXC A;  3GR1 A;  3UX2 A;  2E8F A;  4A3L I;  1VQ4 1;  4MH4 A;  2DHM A;  4DR3 C;  4DV1 C;  3NYR A;  1VQO Z;  2RT9 A;  3J81 f;  3PES A;  1Q7Y 1;  1XMQ C;  1VEH A;  2LEX A;  3M4O I;  1XRA A;  3J7A 4;  4A3I I;  2EGT A;  2P2F A;  3CC7 Z;  4CL1 A;  3CCJ 1;  2W04 A;  3S1R I;  1S72 1;  1K83 I;  5LMN C;  1KQS Y;  5A2Q f;  4U5Y D;  5BST A;  3R9W A;  5C4J I;  4PUI A;  3HOX I;  4NOZ A;  4E2X A;  2YU9 I;  2IV2 X;  4MD8 A;  3KIF A;  1Q82 1;  3B7W A;  5K85 A;  2E9H A;  2CY1 A;  2QRC B;  4NXM C;  2YX1 A;  2PN2 A;  1UWD A;  1AMU A;  1NJI 1;  4DCU A;  2DE5 A;  3VNS A;  2E2I I;  2VSQ A;  3G71 1;  3S1M I;  3T1Y C;  2AKL A;  3CQ1 A;  4PUG A;  3VMI A;  3DLP X;  1VQ6 1;  1M1K 1;  1K0R A;  3E7W A;  4S1T A;  2PRO A;  5IP7 I;  3T4N B;  4PHT A;  4DG8 A;  3H0G I;  3UOW A;  4YHH C;  1VQ5 1;  5IFI A;  3P5J B;  4PUH A;  4BBY A;  1N32 C;  3TE5 B;  2JA7 I;  3CQ2 A;  1QF8 A;  3GTL I;  4TPS B;  2J6A A;  2R6M A;  1VQ7 1;  3G4S 1;  3OTO C;  1WJ2 A;  2JUB A;  1N36 C;  4X65 C;  1Z02 A;  2OTL Z;  2D27 A;  1S72 Z;  3E7X A;  3FCE A;  1Q81 2;  3MZK B;  3CME 1;  5BSW A;  3PO2 I;  3CC7 1;  4X62 C;  3J81 D;  4KTV A;  2UXC C;  4LFB C;  4A3E I;  4DUZ C;  1TWG I;  1P9N A;  1TFI A;  2JIM A;  1GPM A;  1N8R 1;  3A4I A;  1FJG C;  3GTG I;  1YJN 1;  2JR6 A;  1WCJ A;  4L7I A;  2F4M A;  1VQ8 1;  4Y52 I;  4JI6 C;  1VQ8 Z;  4E2Z A;  1I94 C;  2R92 I;  1XHJ A;  3AF6 A;  5T67 A;  5CZX A;  3S17 I;  2D1S A;  5BSM A;  3VMH A;  5A2Q D;  1VQ9 1;  3HKZ A;  4NBE A;  1KKG A;  2NVQ I;  4GS5 A;  4EAT A;  4BC9 A;  3MON A;  2LIY A;  1XNQ C;  1TWH I;  3CQ3 A;  2P3Y A;  2OTL 1;  4HPV A;  1Y1V I;  3FKI I;  1QYP A;  3O2E A;  2JNY A;  5T8S A;  1VQ7 Z;  4RVO A;  3IFU A;  3CW8 X;  3CPW Z;  2JA5 I;  4PRO C;  2ASB A;  1PG4 A;  1W2B Y;  1VQL Z;  3IEV A;  3PBK A;  4G37 A;  1HH2 P;  2H85 A;  3VNQ A;  4DQY B;  3I4N I;  5E7Q A;  4IZ6 A;  5D1O A;  4QTU A;  2OTJ Z;  1LQL A;  2VUM I;  3CMA 1;  2R93 I;  1MDB A;  3A9U A;  1P4E C;  3CCV Z;  3S14 I;  3I07 A;  4R1L A;  3OW2 Z;  4E33 A;  1XRB A;  4JI1 C;  1FUG A;  1M90 2;  4DV4 C;  5C3E I;  3CCS 1;  2PT7 G;  3HOV I;  3VB9 A;  2R7Z I;  3G71 Z;  3K6R A;  4A3G I;  5GTD A;  2D7V A;  5CM2 M; 
#chains in the Genus database with same CATH homology
 4NBH A;  1I50 I;  2F4V C;  3F3P C;  1Q86 1;  2JA8 I;  4TNU A;  1QVG Z;  1KRL A;  1TWF I;  5A19 A;  3S16 I;  4RVF A;  2HF1 A;  2I3C A;  1KC8 2;  1RLY A;  2PM9 A;  2PMZ A;  5IT9 D;  3GTO I;  4DR5 C;  3HOW I;  4I9G A;  4BBS I;  4DCV A;  3CCJ Z;  1Q7Y 2;  3FQQ A;  1KQS Z;  2V8J A;  4AYB A;  2QVZ X;  4X66 C;  2QA4 Z;  4L2Z A;  3S2H I;  1Q82 2;  3M3Y I;  4LF5 C;  2NVX I;  4D57 A;  1YJW Z;  3GTM S;  1I3Q I;  1IBK C;  1RO2 A;  1NJI 2;  3CC2 1;  4B3S C;  4NBB A;  2YCB A;  2VZE A;  4ISB A;  3J80 D;  1W2B Z;  4RVG A;  2YWB A;  3CCL 1;  3IEU A;  4JI3 C;  2ONF A;  4Y7N I;  2RPR A;  1YI2 Z;  1DL6 A;  4NBD A;  4JV5 C;  5FLX b;  5KEI A;  2E0G A;  1WW9 A;  2GU2 A;  1VQP Z;  3RZD I;  3DAY A;  2E8C A;  1VQN Z;  1XRC A;  1KD1 1;  1UKK A;  1L1O C;  3J81 b;  2OPL B;  2QL8 A;  3IML A;  5FLX f;  1JOS A;  4JI0 C;  3TDE A;  2RBL A;  3KXW A;  1VQ5 Z;  4E32 A;  1Q81 1;  3TUF A;  1X3Z A;  1VQM 1;  4DV7 C;  1YJ9 1;  2UUA C;  4KHP C;  5A1I A;  4A3D I;  3G7S A;  2M6N A;  1MXA A;  2ZM6 C;  1HR0 C;  3C5E A;  2G2K A;  2Q4Z A;  4BSZ A;  1RO4 A;  1K73 1;  2E8E A;  3GTM I;  3GTQ I;  1RG9 A;  1USP B;  3H2T A;  1BA3 A;  2D1T A;  4NB9 A;  2W03 A;  1NP6 A;  2QKD A;  2IZ4 A;  1RY2 A;  2QRE B;  1QVG Y;  3BG1 B;  1V25 A;  3NI2 A;  4HGZ A;  2E2J I;  4DGL A;  3CW9 A;  5K8F A;  1IBM C;  2Y4O A;  4DR7 C;  3LUS A;  2DYJ A;  4A3M I;  4NXN C;  4DR1 C;  1VQ9 Z;  2BJO A;  3CJE A;  1R9T I;  4E30 A;  2F4O A;  3D9X A;  3OW2 Y;  2KPI A;  2WP0 C;  1K8A 1;  2OO4 A;  4PZP A;  4E2Y A;  3D6W A;  4RM2 A;  3RZO I;  2JMP A;  1X0T A;  2LFU A;  1YUA A;  2ZAE B;  4NBF A;  3KIH A;  2K5R A;  4NBA A;  4D4G A;  3CMA Z;  4ZJZ A;  3L8C A;  5DV9 A;  3LAX A;  4EWC A;  3I55 Z;  1YIJ 1;  2DE6 A;  1Y1V S;  3GTK I;  5FLX D;  4RVD A;  1VQL 1;  4JM1 A;  1MXB A;  4GXR A;  3VNR A;  4AQY C;  1Q86 2;  4RVN A;  3ETC A;  3UZ0 A;  3TQI A;  3HOZ I;  3GKQ A;  3J80 b;  1KC8 1;  1L2F A;  5BUQ A;  5BR8 C;  4QTT A;  2XR1 A;  1HNW C;  4JI7 C;  3N2Q A;  4RS4 A;  1YIJ Z;  3DHV A;  5T64 A;  4A3C I;  2QW0 X;  2E5L C;  5ADZ A;  3CD6 1;  3NH8 A;  1YJ7 A;  4BCA A;  2WB1 A;  4MD7 A;  3CXC Y;  2V7B A;  4ODJ A;  4LF4 C;  2Y0S A;  4MTN A;  1N34 C;  3CCR Z;  2Y27 A;  3CCU 1;  1VQK 1;  1HNX C;  2OOY B;  4GKJ C;  4NBC A;  1RNI A;  4OXI A;  3IF8 A;  4A3B I;  4XX2 A;  3K7A I;  3EED A;  3CCE Z;  2UU9 C;  2B63 I;  3QWU A;  1XNR C;  2P02 A;  4IR7 A;  2ATW A;  4MD9 A;  4NH1 C;  4A3J I;  5IT9 b;  4LF6 C;  3HOU I;  5BSR A;  3CME Z;  3NDJ A;  4X6A I;  3JAM D;  1PA4 A;  3J80 f;  2OZK A;  5AE2 A;  1K9M 2;  4D4I A;  3I56 Z;  3EER A;  1WII A;  2YWC A;  5C4X I;  2JA6 I;  2P2Q A;  4DR2 C;  1KD1 2;  4B3M C;  3VMG A;  3CXC Z;  3NH5 A;  3FCC A;  2V8K A;  1VQK Z;  3S1Q I;  3CCR 1;  1ZH1 A;  4A3K I;  5D1P A;  4K0B A;  4JI4 C;  2P2M A;  4BY1 I;  1YJ9 Z;  1T5H X;  3GKU A;  3CCV 1;  5BUS A;  2OTJ 1;  4LFC C;  3NDI A;  4MXU A;  5AE1 A;  1N2F A;  4B3R C;  2GTH A;  4RLF A;  1EGA A;  1O90 A;  4FUT A;  1PFT A;  3NYQ A;  1K73 2;  2YAD A;  4DV5 C;  5CZV A;  4LFA C;  2PK7 A;  2QRD B;  1V26 A;  2DPL A;  2Q51 A;  5A2Q b;  2OPL A;  3N54 B;  4R0M A;  2HHH C;  2D28 C;  4B3T C;  2P20 A;  3CQZ I;  2HU9 A;  1VLA A;  2M48 A;  2D1R A;  3S2D I;  1WF3 A;  4G1I A;  2E2H I;  4JI2 C;  3CCL Z;  4L4Q A;  2KI7 B;  1TWC I;  2KZF A;  3LNV A;  4JYA C;  2O4H A;  2GTI A;  3S1N I;  3FQM A;  4E2W A;  3CC2 Z;  1YUK A;  3PO3 S;  2UXD C;  4MRI A;  4KTT A;  5T6B A;  2V8I A;  3CCM Z;  3GTP I;  4LE5 A;  3CCQ 1;  3A9V A;  1AMU A;  1RQF A;  4LFB C;  3GCF A;  1YJN Z;  2QA4 1;  3I4M I;  1K8A 2;  5LL6 f;  4A93 I;  4LF9 C;  4K0K C;  3R9X A;  3I56 1;  5H9U A;  5AN9 F;  3CC4 Z;  2P2B A;  4BC7 A;  1HNZ C;  2AYA A;  4LF7 C;  2QVY X;  3GR0 A;  3GTJ I;  3ETO A;  5IWA C;  3CC4 1;  4ZLP A;  1NYE A;  5AE3 A;  3T1H C;  1YHQ Z;  1JJ2 Z;  2UXB C;  4LF8 C;  2BH1 X;  4FUQ A;  2WAQ A;  3CCM 1;  4I9F A;  4NB8 A;  4DV6 C;  2RHB A;  4D56 A;  2VQE C;  3CCS Z;  1O93 A;  1IBL C;  1RO0 A;  2HJG A;  3S15 I;  1WCM I;  3GPC A;  3AF5 A;  5LMU C;  3PO3 I;  1VQM Z;  4BXX I;  3G6E Z;  3PRO C;  2Y4N A;  4RM3 A;  3R44 A;  1N33 C;  3NFZ A;  4RMN A;  1X3W A;  4DCT A;  3I08 A;  2OOX B;  1O92 A;  2JMO A;  1ZB8 A;  5KYV A;  4DV2 C;  4RLQ A;  1WH9 A;  1VQN 1;  3VTN A;  1VQP 1;  1O9T A;  1TWA I;  1YIT 1;  2VQF C;  2IZ3 A;  2NVT I;  2UUC C;  1ZB9 A;  3G6E 1;  1M1K 2;  3HOY I;  4DG9 A;  1YI2 1;  4YY3 C;  1VQO 1;  4DCS A;  4DR6 C;  1NUI A;  1K9M 1;  3JAM f;  1VQ4 Z;  4DR4 C;  2K3R A;  1YJW 1;  1QVF Z;  3SO4 A;  1MKY A;  2UUB C;  4DUY C;  1J5E C;  1JJ2 Y;  4FTF A;  2P2J A;  3LGX A;  2NVY I;  2QVX X;  4DK1 A;  2D1Q A;  3TDH B;  2WD9 A;  2JS4 A;  3IX0 A;  4NBG A;  1YHQ 1;  1QVF Y;  4JI8 C;  4WS9 A;  3NH4 A;  1ML8 A;  1Z01 A;  4RV9 A;  5C44 I;  4GXQ A;  5T8T A;  5KYT A;  1PG3 A;  2RIQ A;  1YIT Z;  4WV3 A;  1SFO I;  1N8R 2;  3L95 X;  1USP A;  5D1O B;  3G4S Z;  1P7L A;  3NPD A;  3CCE 1;  3Q87 A;  1QWI A;  5FLM I;  3F3F C;  5IT9 f;  2VF1 A;  2O53 A;  1LCI A;  3MZL B;  4BY7 I;  4NFR A;  2QEX Z;  1T5D X;  3CCQ Z;  4X64 C;  3CCU Z;  4E31 A;  3RV2 A;  2QR1 B;  5BSV A;  3EQ6 A;  5IP9 I;  1S7M A;  3BG0 B;  4JI5 C;  4OYC A;  3H3V J;  3IPL A;  4BBR I;  1VQ6 Z;  2VUG A;  5BSU A;  3CD6 Z;  1MDF A;  2E7G A;  2QEX 1;  4DV0 C;  3U50 C;  4R1M A;  1Y1W I;  4RVH A;  4A3F I;  2P28 A;  1XMO C;  4G36 A;  5A1G A;  1MD9 A;  1JWH C;  4NDN A;  3RG2 A;  5JRH A;  2DE7 A;  2CXC A;  4HGY A;  3I55 1;  3CPW Y;  1M90 1;  5BUR A;  1Z03 A;  4GKK C;  4OX9 C;  1ULT A;  3ESW A;  2OBV A;  1QM4 A;  3S82 A;  3JAM b;  4MON A;  4DV3 C;  2QLV B;  4HH4 A;  1I6H I;  1MXC A;  3GR1 A;  2E8F A;  4A3L I;  1VQ4 1;  4MH4 A;  4DR3 C;  4DV1 C;  3NYR A;  1VQO Z;  2RT9 A;  3J81 f;  3PES A;  1Q7Y 1;  1XMQ C;  1XRA A;  3M4O I;  3J7A 4;  4A3I I;  2EGT A;  2P2F A;  3CC7 Z;  4CL1 A;  3CCJ 1;  2W04 A;  3S1R I;  1S72 1;  1K83 I;  5LMN C;  1KQS Y;  5A2Q f;  4U5Y D;  5BST A;  3R9W A;  5C4J I;  3HOX I;  4NOZ A;  4E2X A;  2YU9 I;  4MD8 A;  3KIF A;  1Q82 1;  3B7W A;  5K85 A;  2E9H A;  2CY1 A;  2QRC B;  4NXM C;  2PN2 A;  1NJI 1;  4DCU A;  2DE5 A;  3VNS A;  2E2I I;  2VSQ A;  3G71 1;  3S1M I;  3T1Y C;  2AKL A;  3VMI A;  3DLP X;  1VQ6 1;  1M1K 1;  1K0R A;  3E7W A;  4S1T A;  2PRO A;  5IP7 I;  3T4N B;  4PHT A;  4DG8 A;  3H0G I;  3UOW A;  4YHH C;  1VQ5 1;  5IFI A;  3P5J B;  4BBY A;  1N32 C;  3TE5 B;  2JA7 I;  1QF8 A;  3GTL I;  4TPS B;  2J6A A;  2R6M A;  1VQ7 1;  3G4S 1;  3OTO C;  2JUB A;  1N36 C;  4X65 C;  1Z02 A;  2OTL Z;  2D27 A;  1S72 Z;  3E7X A;  3FCE A;  1Q81 2;  3MZK B;  3CME 1;  5BSW A;  3PO2 I;  3CC7 1;  4X62 C;  3J81 D;  4KTV A;  2UXC C;  4A3E I;  4DUZ C;  1TWG I;  1P9N A;  1TFI A;  1GPM A;  1N8R 1;  3A4I A;  1FJG C;  3GTG I;  1YJN 1;  2JR6 A;  4L7I A;  2F4M A;  1VQ8 1;  4Y52 I;  4JI6 C;  1VQ8 Z;  4E2Z A;  1I94 C;  2R92 I;  3AF6 A;  5T67 A;  5CZX A;  3S17 I;  2D1S A;  5BSM A;  3VMH A;  5A2Q D;  1VQ9 1;  3HKZ A;  4NBE A;  1KKG A;  2NVQ I;  4GS5 A;  4EAT A;  4BC9 A;  3MON A;  2LIY A;  1XNQ C;  1TWH I;  2P3Y A;  2OTL 1;  4HPV A;  1Y1V I;  3FKI I;  1QYP A;  2JNY A;  5T8S A;  1VQ7 Z;  4RVO A;  3IFU A;  3CW8 X;  3CPW Z;  2JA5 I;  4PRO C;  2ASB A;  1PG4 A;  1W2B Y;  1VQL Z;  3IEV A;  3PBK A;  4G37 A;  1HH2 P;  2H85 A;  3VNQ A;  4DQY B;  3I4N I;  5E7Q A;  4IZ6 A;  5D1O A;  4QTU A;  2OTJ Z;  1LQL A;  2VUM I;  3CMA 1;  2R93 I;  1MDB A;  3A9U A;  3CCV Z;  3S14 I;  3I07 A;  4R1L A;  3OW2 Z;  4E33 A;  1XRB A;  4JI1 C;  1FUG A;  1M90 2;  4DV4 C;  5C3E I;  3CCS 1;  2PT7 G;  3HOV I;  3VB9 A;  2R7Z I;  3G71 Z;  4A3G I;  5GTD A;  2D7V A;  5CM2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...