4MH4A

Crystal structure of osmc-like protein from burkholderia cenocepacia j2315
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
SKIEKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAVDAEVDLGTAGNAYFLQARLNVSVPGLERDVAQRIVDAAHQTCPYSKATRGNIDVDIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OsmC-like protein
publication title Crystal Structure of OsmC-like protein from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Protein binding
total genus 31
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mh4A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4mh4A02
2F4MA 4LF6C 4B3RC 3IEVA 3GTOI 4X62C 2ZM6C 2BJOA 2ASBA 2DE7A 2VUMI 4B3MC 3HOUI 4X66C 2NVTI 2F4VC 2KPIA 2VQEC 2ATWA 4NBCA 3GTJI 4DV3C 1XMOC 4NB8A 4B3TC 4MH4A 2YU9I 1TWGI 1TWFI 4DCVA 4NBHA 3K7AI 1I6HI 2ONFA 3H0GI 2HJGA 2K5RA 1I50I 3S2HI 3S15I 3S2DI 4LF9C 1NYEA 2AKLA 2CY1A 3S14I 1HH2P 3GTMI 4BSZA 2J6AA 2QL8A 3HOXI 3I4MI 1HR0C 1ML8A 1MKYA 3VMGA 1QWIA 4X6AI 3GTQI 4A3MI 2E2HI 4DV5C 4A93I 2DYJA 3HOZI 2UUBC 1I3QI 1X3WA 3HOVI 1XMQC 2NVQI 1L1OC 4DR2C 4B3SC 4LFBC 1XNRC 2HF1A 4A3GI 1TWCI 4DR6C 1WW9A 4OX9C 1NUIA 3M3YI 4NB9A 4NXNC 1XNQC 4DCTA 1JOSA 5IP9I 2E5LC 3EERA 1WF3A 1ZB9A 4QTTA 4MTNA 3GTKI 1WH9A 3J81D 3S1QI 1J5EC 4QTUA 3U50C 3H3VJ 4JI5C 4K0KC 1TWHI 1PFTA 4LFAC 1WCMI 1Y1VS 3PO3I 2E8FA 4X65C 1K0RA 5C3EI 2XR1A 1KKGA 4DR3C 1EGAA 1TWAI 4DUZC 4BXXI 2R7ZI 4NOZA 2UXCC 3HOWI 2UU9C 4NXMC 4JI6C 3I07A 1UKKA 3CQZI 5C4JI 5IP7I 4YY3C 3VB9A 4Y52I 4XX2A 4A3EI 2OPLB 1RO4A 3FKII 1LQLA 1SFOI 4A3II 3RZOI 3AF6A 4BBSI 3IEUA 4BBRI 1IBKC 2NVXI 2E2JI 1USPA 3JAMD 4LFCC 2PN2A 3Q87A 3VMHA 2JNYA 3RZDI 1I94C 2PT7G 1N33C 4A3LI 3LUSA 3GKQA 3J80D 2PK7A 1K83I 4DV4C 3D6WA 5IWAC 2DE5A 4KHPC 1ZB8A 3ESWA 3I4NI 4NBEA 5A2QD 1N2FA 4DV2C 2UUCC 4JI8C 3AF5A 1IBLC 4JI0C 1FJGC 4DUYC 2E8CA 2VQFC 3VMIA 4JYAC 1R9TI 1Y1WI 4LF7C 2NVYI 3R9WA 1HNXC 2B63I 4GKJC 4NBBA 4DV7C 4DV6C 4LF5C 4A3CI 1HNZC 4BY7I 3GTMS 4JI3C 2P3YA 5FLMI 3GTLI 3R9XA 2JA7I 4A3BI 2CXCA 2E7GA 2KZFA 3S16I 4JI7C 4AQYC 4DR7C 5FLXD 2UUAC 2YCBA 5IT9D 2DE6A 1RLYA 4A3DI 4A3JI 4NBFA 2JA8I 4GKKC 4DR4C 4Y7NI 5C4XI 4BY1I 1PA4A 3GKUA 4YHHC 4X64C 2D7VA 4JI4C 3T1YC 1IBMC 2F4OA 2R93I 2RBLA 2JMPA 1TFIA 3PO2I 3GTPI 1Y1VI 5LMNC 4JI2C 2JR6A 4LF4C 3S1NI 2UXBC 1VLAA 4DR1C 4A3KI 5CM2M 3GTGI 3PO3S 3CJEA 2E8EA 4NBAA 1QYPA 5BR8C 1HNWC 5C44I 3S17I 4DV1C 4DCSA 4DV0C 2JA6I 2HHHC 3HOYI 4LF8C 1USPB 2JS4A 2E2II 4NBGA 2EGTA 1X3ZA 4DR5C 2JA5I 4DCUA 1N32C 1N34C 2R92I 3OTOC 4JV5C 3M4OI 4NBDA 3GCFA 3T1HC 1L2FA 5LMUC 1N36C 4A3FI 2UXDC 2OPLA 3S1MI 1YUAA 1DL6A 4JI1C 3S1RI
chains in the Genus database with same CATH superfamily
5K8FA 2F4MA 4LF6C 2D1SA 1W2BY 4B3RC 2V45A 3IEVA 3GTOI 4X62C 2MM9A 3IMLA 2JIMA 5CZVA 3F3FC 4G36A 2ZM6C 1FDIA 2NAPA 1Z03A 2K3RA 2BJOA 1YIT1 1VQL1 2ASBA 2DE7A 2VUMI 2MMAB 2OTJZ 4B3MC 4E30A 3HOUI 4X66C 2NVTI 3IFUA 4E2ZA 1RNIA 2F4VC 1Z02A 3TE5B 1VQPZ 2Q4ZA 2KPIA 2VQEC 2V8KA 3LGXA 3TR3A 1NJI1 3F3PC 3NPDA 5AE3A 1Q811 2ATWA 2LFUA 3GPCA 4NBCA 2P2JA 3L8CA 1KQSZ 4PUHA 4E2YA 3GTJI 2YWCA 2G2KA 1W2BZ 1RY2A 2AYDA 2QREB 2JMOA 4DV3C 1YJ9Z 1XMOC 4NB8A 3IX0A 1XRAA 5BSWA 4B3TC 4MH4A 3NYRA 1VEHA 2YU9I 1TWGI 2D1RA 1V26A 1TWFI 2RT9A 5BSUA 4DCVA 2JIQA 4NBHA 3K6RA 1VQM1 2E9HA 3K7AI 1I6HI 5AE1A 1FLOA 4RVOA 2ONFA 3H0GI 5GTDA 2HJGA 5FLXf 2K5RA 3KIFA 1MXAA 1I50I 3S2HI 4PUIA 3S15I 2QEXZ 3FQQA 1VQ81 2VPYA 3A26A 4NDNA 3S2DI 5IT9f 3CQ1A 4RMNA 4LF9C 1NYEA 2P28A 4I9GA 2AKLA 2I3CA 2CY1A 1VQ51 2QVYX 1RO2A 4PHTA 2OZKA 2KI7B 3S14I 1HH2P 2E0GA 4GXRA 1P4EC 3GTMI 2IZ3A 3VTNA 3CCV1 1WIIA 2D1QA 2JNVA 2E7ZA 4BSZA 5A1GA 3CXCY 2J6AA 3E7WA 4OYCA 3IPLA 2QL8A 2V3VA 3NYQA 3HOXI 3I4MI 1MD9A 3ETOA 1HR0C 5DV9A 2RHBA 1ML8A 1MKYA 4WS9A 5D1OB 3VMGA 1X0TA 2QRDB 1PU1A 3J81b 1QWIA 2P2QA 4G1IA 4X6AI 3GTQI 4A3MI 1YJWZ 1KRLA 2E2HI 4DV5C 4A93I 4RM2A 3GR1A 3CCU1 2DYJA 3HOZI 2R6MA 1VQ71 3CC7Z 3C5EA 2VUGA 1Q862 3CXCZ 1QVFY 2RPRA 3CQ2A 2UUBC 2H85A 3CC41 1VQKZ 4CL1A 1WCJA 1I3QI 3TDHB 1X3WA 3CCJZ 3HOVI 4RVDA 4RLFA 1XMQC 1P7LA 2NVQI 1YJNZ 5LL6f 4R1MA 1L1OC 3G4SZ 4DR2C 2LIYA 1KD11 2WAQA 3OW2Y 4TPSB 4DG9A 3CC21 4B3SC 4LFBC 4DGLA 1Y8CA 1XNRC 1O93A 3UX3A 2HF1A 4AYBA 4A3GI 3CCE1 1TWCI 4PUGA 2JIOA 4DR6C 1Q861 1QF8A 1WW9A 3CMEZ 4KTTA 1RQFA 2WB1A 4OX9C 1NUIA 3M3YI 2PM9A 4NB9A 2QKDA 1S72Z 1M6XC 4NXNC 1XNQC 4DCTA 1JOSA 5IP9I 4FUQA 1QVFZ 3EERA 2E5LC 1WF3A 1ZB9A 3FQMA 1AA6A 1VQO1 3CQ3A 4QTTA 4ISBA 4MTNA 3NH4A 3GTKI 1WH9A 4E32A 3J81D 3G7SA 3S1QI 3KXWA 2HU9A 4NFRA 3OW2Z 1J5EC 4QTUA 3U50C 1T5DX 3ETCA 1VQ61 3H3VJ 3VNSA 1KQSY 2YADA 3CCS1 4ZJZA 4JI5C 1TWHI 4K0KC 1PFTA 4LFAC 1WCMI 3CCMZ 1Y1VS 1YHQ1 3J7A4 2V7BA 1VQ9Z 3PO3I 2E8FA 5A19A 3G6EZ 3DLPX 1WZNA 4X65C 1K0RA 5C3EI 2XR1A 1KKGA 2PROA 1PG4A 5KYVA 2KDNA 4DR3C 3JAMb 1EGAA 4MRIA 1K9M2 3G711 5T8TA 1TWAI 4DUZC 4BXXI 5CZXA 2R7ZI 1VQN1 3I551 4NOZA 1YIJ1 2UXCC 3KIHA 4BBYA 3MZKB 3A4IA 4ZLPA 3HOWI 2UU9C 4NXMC 4JI6C 1YJ7A 2GU2A 3I07A 2WP0C 3CCRZ 3CW8X 5ADZA 3I56Z 4GXQA 1UKKA 3CQZI 2O53A 2OOXB 1K9M1 2P20A 4RLQA 5C4JI 4RVHA 3J80b 1QXFA 2LEXA 2BH1X 1K8A2 1KC82 5IP7I 3BG1B 3E7XA 2JUBA 4YY3C 1V25A 3VB9A 4Y52I 1MDBA 2OTJ1 4XX2A 1UWDA 3MZLB 4A3EI 1O90A 2OPLB 1RO4A 3CCVZ 4LE5A 3CW9A 4RVFA 5A2Qb 3FKII 1LCIA 1LQLA 2ZZMA 1VQP1 1SFOI 4R1LA 2P02A 5T8SA 3RG2A 3AY0A 2VPZA 1MDFA 5BSRA 4A3II 1Q822 3RZOI 2P2FA 3TDEA 1K8A1 1FUGA 5BURA 3AF6A 1KC81 4D57A 4BBSI 2YWBA 2VPWA 3IEUA 2OTLZ 3UEBA 4BBRI 1IBKC 2NVXI 3EQ6A 2E2JI 1USPA 3JAMD 1YJ91 3VNQA 4LFCC 3D2LA 2M5OA 3A9UA 3CD6Z 2PN2A 3FCEA 4RVGA 3Q87A 3VMHA 2JNYA 3RZDI 1I94C 3EEDA 1TH5A 2RIQA 2M48A 2PT7G 5BSTA 1N33C 5JRHA 4A3LI 4BCAA 3LUSA 2QEX1 1P4EA 3GKQA 1JJ2Z 4HGZA 2PK7A 5D1PA 4I9FA 3J80D 1K83I 3I08A 4DV4C 3NI2A 1RO0A 3D6WA 3PBKA 5AE2A 5IWAC 2DE5A 3CCQZ 4KHPC 4BC9A 1ZB8A 3ESWA 1YI2Z 3I4NI 4NBEA 2VF1A 3CCEZ 2OBVA 1VQ4Z 2VSQA 5A2QD 3B7WA 1N2FA 1JWHC 2Y0SA 2Q51A 3NDIA 5BSMA 2OOYB 3CMAZ 1P9NA 4DV2C 3QWUA 2UUCC 3CPWY 4JI8C 2JIPA 3AF5A 1IBLC 4TNUA 4JI0C 1YUKA 3D9XA 5FLXb 1FJGC 1K732 4PZPA 2E8CA 5T64A 3CCLZ 4DUYC 1YJW1 2ZZNA 2VQFC 1M1K2 2GTHA 2QA4Z 5IT9b 4L7IA 3VMIA 1Z01A 3CCSZ 1XRBA 4JYAC 1R9TI 3S82A 2JIRA 1Y1WI 3TUFA 4LF7C 3CC71 3T4NB 2NVYI 2VZEA 1Q7Y2 1Q16A 1YITZ 1VQLZ 2B63I 1VQK1 2Y4OA 3O2EA 3UX2A 1HNXC 3R9WA 4L4QA 4GKJC 3CCJ1 4NBBA 4DV7C 3CPWZ 1XS3A 2CU6A 4E33A 1YJN1 5A2Qf 1M1K1 3G4S1 4DV6C 4A3CI 4LF5C 2QLVB 3NH8A 3TQIA 1HNZC 4BY7I 3GTMS 4JI3C 1M6XA 2P3YA 5FLMI 1Q7Y1 3GTLI 3CME1 2JA7I 3R9XA 4A3BI 2CXCA 2E7GA 2NCLA 4D4IA 2KZFA 3S16I 1S721 2P2MA 4KTVA 4U5YD 1NP6A 1MXCA 4JM1A 4EATA 4JI7C 5T6BA 5LCIA 4NH1C 1NJI2 1Q812 4AQYC 5BUQA 4DR7C 4HH4A 1VQMZ 3UZ0A 5FLXD 2PMZA 3IR7A 5BUSA 2MCQA 5A1IA 2UUAC 4EWCA 2YCBA 3J81f 3MONA 5IT9D 2DE6A 3NFZA 2OO4A 1RLYA 2D28C 1VQ8Z 5KEIA 1T5HX 3SO4A 3LAXA 4A3DI 3CCM1 5D1OA 1VQ5Z 5AN9F 1M902 2Z51A 4A3JI 1VQ91 3L95X 4NBFA 3G6E1 2JA8I 4GKKC 4DR4C 3LNVA 3NDJA 3BG0B 4Y7NI 2QR1B 4S1TA 1BA3A 2Y27A 1JJ2Y 5C4XI 2VPXA 2DPLA 4BY1I 1QM4A 1PA4A 1M901 3VNRA 3GKUA 4YHHC 2QVZX 1NY8A 5H9UA 2D7VA 2V8IA 4X64C 4JI4C 3CCR1 2DHMA 3PESA 3P5JB 1ZH1A 3I561 3T1YC 4PROC 5E7QA 3PROC 1IBMC 2F4OA 1Q821 1IB8A 4E31A 4ODJA 3CCUZ 1QVGY 2R93I 2RBLA 4DQYB 4MONA 2JMPA 2W04A 4FTFA 2D1TA 3N2QA 4WV3A 2V8JA 1TFIA 5BSVA 1VQ7Z 3PO2I 3GTPI 1Y1VI 1N8R2 5LMNC 4RV9A 3LNOA 3R44A 4BC7A 4JI2C 3CC4Z 1V60A 2JR6A 4RM3A 4R0MA 4LF4C 3S1NI 2IZ4A 2UXBC 1VLAA 2P2BA 1S7MA 4DR1C 4A3KI 5CM2M 4HPVA 4E2WA 1XRCA 2ZAEB 3CC2Z 3GTGI 4D4GA 3HKZA 4E2XA 1SIWA 3PO3S 4L2ZA 2QVXX 3CJEA 4OXIA 4RVNA 2E8EA 4NBAA 2OTL1 3N54B 3RV2A 1N8R1 1QYPA 1WJ2A 5BR8C 1RG9A 1ULTA 1XHJA 2GTIA 1HNWC 5C44I 1QVGZ 3S17I 4DV1C 4DCSA 3DHVA 3CD61 3JAMf 1O92A 1KD12 4DV0C 1GPMA 4RS4A 3A9VA 1VQOZ 4MXUA 2WD9A 3GR0A 2D27A 5K85A 2JA6I 2HHHC 4K0BA 3HOYI 5T67A 4LF8C 1USPB 1VQ6Z 2W03A 2JS4A 2E2II 4NBGA 2M6NA 2EGTA 1O9TA 4HGYA 3A25A 4D56A 3NH5A 3J80f 1X3ZA 2Y4NA 3CCQ1 4DR5C 2JA5I 4GS5A 1YHQZ 2QW0X 2IV2X 1YI21 4DCUA 1N32C 1VQ41 1N34C 1K731 1FDOA 4DK1A 4G37A 2R92I 2O4HA 3FCCA 3OTOC 4JV5C 5KYTA 3CMA1 3M4OI 3H2TA 4NBDA 3GCFA 3G71Z 3T1HC 1L2FA 4MD7A 5LMUC 3UOWA 2AYAA 2YX1A 1N36C 4A3FI 1MXBA 1VQNZ 3I55Z 1AMUA 1YIJZ 2UXDC 2KZ0A 2OPLA 4FUTA 3DAYA 3S1MI 4DG8A 5IFIA 4IZ6A 1YUAA 4MD8A 3CCL1 1DL6A 4IR7A 4JI1C 2QRCB 4MD9A 3S1RI 2M5HA 3IF8A 1PG3A 2QA41
chains in the Genus database with same CATH topology
5K8FA 2F4MA 4LF6C 2D1SA 1W2BY 4B3RC 3IEVA 3GTOI 4X62C 3IMLA 5CZVA 3F3FC 4G36A 2ZM6C 1Z03A 2K3RA 2BJOA 1YIT1 1VQL1 2ASBA 2DE7A 2VUMI 2OTJZ 4B3MC 4E30A 3HOUI 4X66C 2NVTI 3IFUA 4E2ZA 1RNIA 2F4VC 1Z02A 3TE5B 1VQPZ 2Q4ZA 2KPIA 2VQEC 2V8KA 3LGXA 1NJI1 3F3PC 3NPDA 5AE3A 1Q811 2ATWA 2LFUA 3GPCA 4NBCA 2P2JA 3L8CA 1KQSZ 4E2YA 3GTJI 2YWCA 2G2KA 1W2BZ 1RY2A 2QREB 2JMOA 4DV3C 1YJ9Z 1XMOC 4NB8A 3IX0A 1XRAA 5BSWA 4B3TC 4MH4A 3NYRA 2YU9I 1TWGI 2D1RA 1V26A 1TWFI 2RT9A 5BSUA 4DCVA 4NBHA 1VQM1 2E9HA 3K7AI 1I6HI 5AE1A 4RVOA 2ONFA 3H0GI 5GTDA 2HJGA 5FLXf 2K5RA 3KIFA 1MXAA 1I50I 3S2HI 3S15I 2QEXZ 3FQQA 1VQ81 4NDNA 3S2DI 5IT9f 4RMNA 4LF9C 1NYEA 2P28A 4I9GA 2AKLA 2I3CA 2CY1A 1VQ51 2QVYX 1RO2A 4PHTA 2OZKA 2KI7B 3S14I 1HH2P 2E0GA 4GXRA 3GTMI 2IZ3A 3VTNA 3CCV1 1WIIA 2D1QA 4BSZA 5A1GA 3CXCY 2J6AA 3E7WA 4OYCA 3IPLA 2QL8A 3NYQA 3HOXI 3I4MI 1MD9A 3ETOA 1HR0C 5DV9A 2RHBA 1ML8A 1MKYA 4WS9A 5D1OB 3VMGA 1X0TA 2QRDB 3J81b 1QWIA 2P2QA 4G1IA 4X6AI 3GTQI 4A3MI 1YJWZ 1KRLA 2E2HI 4DV5C 4A93I 4RM2A 3GR1A 3CCU1 2DYJA 3HOZI 2R6MA 1VQ71 3CC7Z 3C5EA 2VUGA 1Q862 3CXCZ 1QVFY 2RPRA 2UUBC 2H85A 3CC41 1VQKZ 4CL1A 1I3QI 3TDHB 1X3WA 3CCJZ 3HOVI 4RVDA 4RLFA 1XMQC 1P7LA 2NVQI 1YJNZ 5LL6f 4R1MA 1L1OC 3G4SZ 4DR2C 2LIYA 1KD11 2WAQA 3OW2Y 4TPSB 4DG9A 3CC21 4B3SC 4LFBC 4DGLA 1XNRC 1O93A 2HF1A 4AYBA 4A3GI 3CCE1 1TWCI 4DR6C 1Q861 1QF8A 1WW9A 3CMEZ 4KTTA 1RQFA 2WB1A 4OX9C 1NUIA 3M3YI 2PM9A 4NB9A 2QKDA 1S72Z 4NXNC 1XNQC 4DCTA 1JOSA 5IP9I 4FUQA 1QVFZ 3EERA 2E5LC 1WF3A 1ZB9A 3FQMA 1VQO1 4QTTA 4ISBA 4MTNA 3NH4A 3GTKI 1WH9A 4E32A 3J81D 3G7SA 3S1QI 3KXWA 2HU9A 4NFRA 3OW2Z 1J5EC 4QTUA 3U50C 1T5DX 3ETCA 1VQ61 3H3VJ 3VNSA 1KQSY 2YADA 3CCS1 4ZJZA 4JI5C 1TWHI 4K0KC 1PFTA 4LFAC 1WCMI 3CCMZ 1Y1VS 1YHQ1 3J7A4 2V7BA 1VQ9Z 3PO3I 2E8FA 5A19A 3G6EZ 3DLPX 4X65C 1K0RA 5C3EI 2XR1A 1KKGA 2PROA 1PG4A 5KYVA 4DR3C 3JAMb 1EGAA 4MRIA 1K9M2 3G711 5T8TA 1TWAI 4DUZC 4BXXI 5CZXA 2R7ZI 1VQN1 3I551 4NOZA 1YIJ1 2UXCC 3KIHA 4BBYA 3MZKB 3A4IA 4ZLPA 3HOWI 2UU9C 4NXMC 4JI6C 1YJ7A 2GU2A 3I07A 2WP0C 3CCRZ 3CW8X 5ADZA 3I56Z 4GXQA 1UKKA 3CQZI 2O53A 2OOXB 1K9M1 2P20A 4RLQA 5C4JI 4RVHA 3J80b 2BH1X 1K8A2 1KC82 5IP7I 3BG1B 3E7XA 2JUBA 4YY3C 1V25A 3VB9A 4Y52I 1MDBA 2OTJ1 4XX2A 3MZLB 4A3EI 1O90A 2OPLB 1RO4A 3CCVZ 4LE5A 3CW9A 4RVFA 5A2Qb 3FKII 1LCIA 1LQLA 1VQP1 1SFOI 4R1LA 2P02A 5T8SA 3RG2A 1MDFA 5BSRA 4A3II 1Q822 3RZOI 2P2FA 3TDEA 1K8A1 1FUGA 5BURA 3AF6A 1KC81 4D57A 4BBSI 2YWBA 3IEUA 2OTLZ 4BBRI 1IBKC 2NVXI 3EQ6A 2E2JI 1USPA 3JAMD 1YJ91 3VNQA 4LFCC 3A9UA 3CD6Z 2PN2A 3FCEA 4RVGA 3Q87A 3VMHA 2JNYA 3RZDI 1I94C 3EEDA 2RIQA 2M48A 2PT7G 5BSTA 1N33C 5JRHA 4A3LI 4BCAA 3LUSA 2QEX1 3GKQA 1JJ2Z 4HGZA 2PK7A 5D1PA 4I9FA 3J80D 1K83I 3I08A 4DV4C 3NI2A 1RO0A 3D6WA 3PBKA 5AE2A 5IWAC 2DE5A 3CCQZ 4KHPC 4BC9A 1ZB8A 3ESWA 1YI2Z 3I4NI 4NBEA 2VF1A 3CCEZ 2OBVA 1VQ4Z 2VSQA 5A2QD 3B7WA 1N2FA 1JWHC 2Y0SA 2Q51A 3NDIA 5BSMA 2OOYB 3CMAZ 1P9NA 4DV2C 3QWUA 2UUCC 3CPWY 4JI8C 3AF5A 1IBLC 4TNUA 4JI0C 1YUKA 3D9XA 5FLXb 1FJGC 1K732 4PZPA 2E8CA 5T64A 3CCLZ 4DUYC 1YJW1 2VQFC 1M1K2 2GTHA 2QA4Z 5IT9b 4L7IA 3VMIA 1Z01A 3CCSZ 1XRBA 4JYAC 1R9TI 3S82A 1Y1WI 3TUFA 4LF7C 3CC71 3T4NB 2NVYI 2VZEA 1Q7Y2 1YITZ 1VQLZ 2B63I 1VQK1 2Y4OA 1HNXC 3R9WA 4L4QA 4GKJC 3CCJ1 4NBBA 4DV7C 3CPWZ 4E33A 1YJN1 5A2Qf 1M1K1 3G4S1 4DV6C 4A3CI 4LF5C 2QLVB 3NH8A 3TQIA 1HNZC 4BY7I 3GTMS 4JI3C 2P3YA 5FLMI 1Q7Y1 3GTLI 3CME1 2JA7I 3R9XA 4A3BI 2CXCA 2E7GA 4D4IA 2KZFA 3S16I 1S721 2P2MA 4KTVA 4U5YD 1NP6A 1MXCA 4JM1A 4EATA 4JI7C 5T6BA 4NH1C 1NJI2 1Q812 4AQYC 5BUQA 4DR7C 4HH4A 1VQMZ 3UZ0A 5FLXD 2PMZA 5BUSA 5A1IA 2UUAC 4EWCA 2YCBA 3J81f 3MONA 5IT9D 2DE6A 3NFZA 2OO4A 1RLYA 2D28C 1VQ8Z 5KEIA 1T5HX 3SO4A 3LAXA 4A3DI 3CCM1 5D1OA 1VQ5Z 5AN9F 1M902 4A3JI 1VQ91 3L95X 4NBFA 3G6E1 2JA8I 4GKKC 4DR4C 3LNVA 3NDJA 3BG0B 4Y7NI 2QR1B 4S1TA 1BA3A 2Y27A 1JJ2Y 5C4XI 2DPLA 4BY1I 1QM4A 1PA4A 1M901 3VNRA 3GKUA 4YHHC 2QVZX 5H9UA 2D7VA 2V8IA 4X64C 4JI4C 3CCR1 3PESA 3P5JB 1ZH1A 3I561 3T1YC 4PROC 5E7QA 3PROC 1IBMC 2F4OA 1Q821 4E31A 4ODJA 3CCUZ 1QVGY 2R93I 2RBLA 4DQYB 4MONA 2JMPA 2W04A 4FTFA 2D1TA 3N2QA 4WV3A 2V8JA 1TFIA 5BSVA 1VQ7Z 3PO2I 3GTPI 1Y1VI 1N8R2 5LMNC 4RV9A 3R44A 4BC7A 4JI2C 3CC4Z 2JR6A 4RM3A 4R0MA 4LF4C 3S1NI 2IZ4A 2UXBC 1VLAA 2P2BA 1S7MA 4DR1C 4A3KI 5CM2M 4HPVA 4E2WA 1XRCA 2ZAEB 3CC2Z 3GTGI 4D4GA 3HKZA 4E2XA 3PO3S 4L2ZA 2QVXX 3CJEA 4OXIA 4RVNA 2E8EA 4NBAA 2OTL1 3N54B 3RV2A 1N8R1 1QYPA 5BR8C 1RG9A 1ULTA 2GTIA 1HNWC 5C44I 1QVGZ 3S17I 4DV1C 4DCSA 3DHVA 3CD61 3JAMf 1O92A 1KD12 4DV0C 1GPMA 4RS4A 3A9VA 1VQOZ 4MXUA 2WD9A 3GR0A 2D27A 5K85A 2JA6I 2HHHC 4K0BA 3HOYI 5T67A 4LF8C 1USPB 1VQ6Z 2W03A 2JS4A 2E2II 4NBGA 2M6NA 2EGTA 1O9TA 4HGYA 4D56A 3NH5A 3J80f 1X3ZA 2Y4NA 3CCQ1 4DR5C 2JA5I 4GS5A 1YHQZ 2QW0X 1YI21 4DCUA 1N32C 1VQ41 1N34C 1K731 4DK1A 4G37A 2R92I 2O4HA 3FCCA 3OTOC 4JV5C 5KYTA 3CMA1 3M4OI 3H2TA 4NBDA 3GCFA 3G71Z 3T1HC 1L2FA 4MD7A 5LMUC 3UOWA 2AYAA 1N36C 4A3FI 1MXBA 1VQNZ 3I55Z 1AMUA 1YIJZ 2UXDC 2OPLA 4FUTA 3DAYA 3S1MI 4DG8A 5IFIA 4IZ6A 1YUAA 4MD8A 3CCL1 1DL6A 4IR7A 4JI1C 3S1RI 2QRCB 4MD9A 3IF8A 1PG3A 2QA41
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4M A;  4LF6 C;  4B3R C;  3IEV A;  3GTO I;  4X62 C;  2ZM6 C;  2BJO A;  2ASB A;  2DE7 A;  2VUM I;  4B3M C;  3HOU I;  4X66 C;  2NVT I;  2F4V C;  2KPI A;  2VQE C;  2ATW A;  4NBC A;  3GTJ I;  4DV3 C;  1XMO C;  4NB8 A;  4B3T C;  4MH4 A;  2YU9 I;  1TWG I;  1TWF I;  4DCV A;  4NBH A;  3K7A I;  1I6H I;  2ONF A;  3H0G I;  2HJG A;  2K5R A;  1I50 I;  3S2H I;  3S15 I;  3S2D I;  4LF9 C;  1NYE A;  2AKL A;  2CY1 A;  3S14 I;  1HH2 P;  3GTM I;  4BSZ A;  2J6A A;  2QL8 A;  3HOX I;  3I4M I;  1HR0 C;  1ML8 A;  1MKY A;  3VMG A;  1QWI A;  4X6A I;  3GTQ I;  4A3M I;  2E2H I;  4DV5 C;  4A93 I;  2DYJ A;  3HOZ I;  2UUB C;  1I3Q I;  1X3W A;  3HOV I;  1XMQ C;  2NVQ I;  1L1O C;  4DR2 C;  4B3S C;  4LFB C;  1XNR C;  2HF1 A;  4A3G I;  1TWC I;  4DR6 C;  1WW9 A;  4OX9 C;  1NUI A;  3M3Y I;  4NB9 A;  4NXN C;  1XNQ C;  4DCT A;  1JOS A;  5IP9 I;  2E5L C;  3EER A;  1WF3 A;  1ZB9 A;  4QTT A;  4MTN A;  3GTK I;  1WH9 A;  3J81 D;  3S1Q I;  1J5E C;  4QTU A;  3U50 C;  3H3V J;  4JI5 C;  4K0K C;  1TWH I;  1PFT A;  4LFA C;  1WCM I;  1Y1V S;  3PO3 I;  2E8F A;  4X65 C;  1K0R A;  5C3E I;  2XR1 A;  1KKG A;  4DR3 C;  1EGA A;  1TWA I;  4DUZ C;  4BXX I;  2R7Z I;  4NOZ A;  2UXC C;  3HOW I;  2UU9 C;  4NXM C;  4JI6 C;  3I07 A;  1UKK A;  3CQZ I;  5C4J I;  5IP7 I;  4YY3 C;  3VB9 A;  4Y52 I;  4XX2 A;  4A3E I;  2OPL B;  1RO4 A;  3FKI I;  1LQL A;  1SFO I;  4A3I I;  3RZO I;  3AF6 A;  4BBS I;  3IEU A;  4BBR I;  1IBK C;  2NVX I;  2E2J I;  1USP A;  3JAM D;  4LFC C;  2PN2 A;  3Q87 A;  3VMH A;  2JNY A;  3RZD I;  1I94 C;  2PT7 G;  1N33 C;  4A3L I;  3LUS A;  3GKQ A;  3J80 D;  2PK7 A;  1K83 I;  4DV4 C;  3D6W A;  5IWA C;  2DE5 A;  4KHP C;  1ZB8 A;  3ESW A;  3I4N I;  4NBE A;  5A2Q D;  1N2F A;  4DV2 C;  2UUC C;  4JI8 C;  3AF5 A;  1IBL C;  4JI0 C;  1FJG C;  4DUY C;  2E8C A;  2VQF C;  3VMI A;  4JYA C;  1R9T I;  1Y1W I;  4LF7 C;  2NVY I;  3R9W A;  1HNX C;  2B63 I;  4GKJ C;  4NBB A;  4DV7 C;  4DV6 C;  4LF5 C;  4A3C I;  1HNZ C;  4BY7 I;  3GTM S;  4JI3 C;  2P3Y A;  5FLM I;  3GTL I;  3R9X A;  2JA7 I;  4A3B I;  2CXC A;  2E7G A;  2KZF A;  3S16 I;  4JI7 C;  4AQY C;  4DR7 C;  5FLX D;  2UUA C;  2YCB A;  5IT9 D;  2DE6 A;  1RLY A;  4A3D I;  4A3J I;  4NBF A;  2JA8 I;  4GKK C;  4DR4 C;  4Y7N I;  5C4X I;  4BY1 I;  1PA4 A;  3GKU A;  4YHH C;  4X64 C;  2D7V A;  4JI4 C;  3T1Y C;  1IBM C;  2F4O A;  2R93 I;  2RBL A;  2JMP A;  1TFI A;  3PO2 I;  3GTP I;  1Y1V I;  5LMN C;  4JI2 C;  2JR6 A;  4LF4 C;  3S1N I;  2UXB C;  1VLA A;  4DR1 C;  4A3K I;  5CM2 M;  3GTG I;  3PO3 S;  3CJE A;  2E8E A;  4NBA A;  1QYP A;  5BR8 C;  1HNW C;  5C44 I;  3S17 I;  4DV1 C;  4DCS A;  4DV0 C;  2JA6 I;  2HHH C;  3HOY I;  4LF8 C;  1USP B;  2JS4 A;  2E2I I;  4NBG A;  2EGT A;  1X3Z A;  4DR5 C;  2JA5 I;  4DCU A;  1N32 C;  1N34 C;  2R92 I;  3OTO C;  4JV5 C;  3M4O I;  4NBD A;  3GCF A;  3T1H C;  1L2F A;  5LMU C;  1N36 C;  4A3F I;  2UXD C;  2OPL A;  3S1M I;  1YUA A;  1DL6 A;  4JI1 C;  3S1R I; 
#chains in the Genus database with same CATH topology
 5K8F A;  2F4M A;  4LF6 C;  2D1S A;  1W2B Y;  4B3R C;  2V45 A;  3IEV A;  3GTO I;  4X62 C;  2MM9 A;  3IML A;  2JIM A;  5CZV A;  3F3F C;  4G36 A;  2ZM6 C;  1FDI A;  2NAP A;  1Z03 A;  2K3R A;  2BJO A;  1YIT 1;  1VQL 1;  2ASB A;  2DE7 A;  2VUM I;  2MMA B;  2OTJ Z;  4B3M C;  4E30 A;  3HOU I;  4X66 C;  2NVT I;  3IFU A;  4E2Z A;  1RNI A;  2F4V C;  1Z02 A;  3TE5 B;  1VQP Z;  2Q4Z A;  2KPI A;  2VQE C;  2V8K A;  3LGX A;  3TR3 A;  1NJI 1;  3F3P C;  3NPD A;  5AE3 A;  1Q81 1;  2ATW A;  2LFU A;  3GPC A;  4NBC A;  2P2J A;  3L8C A;  1KQS Z;  4PUH A;  4E2Y A;  3GTJ I;  2YWC A;  2G2K A;  1W2B Z;  1RY2 A;  2AYD A;  2QRE B;  2JMO A;  4DV3 C;  1YJ9 Z;  1XMO C;  4NB8 A;  3IX0 A;  1XRA A;  5BSW A;  4B3T C;  4MH4 A;  3NYR A;  1VEH A;  2YU9 I;  1TWG I;  2D1R A;  1V26 A;  1TWF I;  2RT9 A;  5BSU A;  4DCV A;  2JIQ A;  4NBH A;  3K6R A;  1VQM 1;  2E9H A;  3K7A I;  1I6H I;  5AE1 A;  1FLO A;  4RVO A;  2ONF A;  3H0G I;  5GTD A;  2HJG A;  5FLX f;  2K5R A;  3KIF A;  1MXA A;  1I50 I;  3S2H I;  4PUI A;  3S15 I;  2QEX Z;  3FQQ A;  1VQ8 1;  2VPY A;  3A26 A;  4NDN A;  3S2D I;  5IT9 f;  3CQ1 A;  4RMN A;  4LF9 C;  1NYE A;  2P28 A;  4I9G A;  2AKL A;  2I3C A;  2CY1 A;  1VQ5 1;  2QVY X;  1RO2 A;  4PHT A;  2OZK A;  2KI7 B;  3S14 I;  1HH2 P;  2E0G A;  4GXR A;  1P4E C;  3GTM I;  2IZ3 A;  3VTN A;  3CCV 1;  1WII A;  2D1Q A;  2JNV A;  2E7Z A;  4BSZ A;  5A1G A;  3CXC Y;  2J6A A;  3E7W A;  4OYC A;  3IPL A;  2QL8 A;  2V3V A;  3NYQ A;  3HOX I;  3I4M I;  1MD9 A;  3ETO A;  1HR0 C;  5DV9 A;  2RHB A;  1ML8 A;  1MKY A;  4WS9 A;  5D1O B;  3VMG A;  1X0T A;  2QRD B;  1PU1 A;  3J81 b;  1QWI A;  2P2Q A;  4G1I A;  4X6A I;  3GTQ I;  4A3M I;  1YJW Z;  1KRL A;  2E2H I;  4DV5 C;  4A93 I;  4RM2 A;  3GR1 A;  3CCU 1;  2DYJ A;  3HOZ I;  2R6M A;  1VQ7 1;  3CC7 Z;  3C5E A;  2VUG A;  1Q86 2;  3CXC Z;  1QVF Y;  2RPR A;  3CQ2 A;  2UUB C;  2H85 A;  3CC4 1;  1VQK Z;  4CL1 A;  1WCJ A;  1I3Q I;  3TDH B;  1X3W A;  3CCJ Z;  3HOV I;  4RVD A;  4RLF A;  1XMQ C;  1P7L A;  2NVQ I;  1YJN Z;  5LL6 f;  4R1M A;  1L1O C;  3G4S Z;  4DR2 C;  2LIY A;  1KD1 1;  2WAQ A;  3OW2 Y;  4TPS B;  4DG9 A;  3CC2 1;  4B3S C;  4LFB C;  4DGL A;  1Y8C A;  1XNR C;  1O93 A;  3UX3 A;  2HF1 A;  4AYB A;  4A3G I;  3CCE 1;  1TWC I;  4PUG A;  2JIO A;  4DR6 C;  1Q86 1;  1QF8 A;  1WW9 A;  3CME Z;  4KTT A;  1RQF A;  2WB1 A;  4OX9 C;  1NUI A;  3M3Y I;  2PM9 A;  4NB9 A;  2QKD A;  1S72 Z;  1M6X C;  4NXN C;  1XNQ C;  4DCT A;  1JOS A;  5IP9 I;  4FUQ A;  1QVF Z;  3EER A;  2E5L C;  1WF3 A;  1ZB9 A;  3FQM A;  1AA6 A;  1VQO 1;  3CQ3 A;  4QTT A;  4ISB A;  4MTN A;  3NH4 A;  3GTK I;  1WH9 A;  4E32 A;  3J81 D;  3G7S A;  3S1Q I;  3KXW A;  2HU9 A;  4NFR A;  3OW2 Z;  1J5E C;  4QTU A;  3U50 C;  1T5D X;  3ETC A;  1VQ6 1;  3H3V J;  3VNS A;  1KQS Y;  2YAD A;  3CCS 1;  4ZJZ A;  4JI5 C;  1TWH I;  4K0K C;  1PFT A;  4LFA C;  1WCM I;  3CCM Z;  1Y1V S;  1YHQ 1;  3J7A 4;  2V7B A;  1VQ9 Z;  3PO3 I;  2E8F A;  5A19 A;  3G6E Z;  3DLP X;  1WZN A;  4X65 C;  1K0R A;  5C3E I;  2XR1 A;  1KKG A;  2PRO A;  1PG4 A;  5KYV A;  2KDN A;  4DR3 C;  3JAM b;  1EGA A;  4MRI A;  1K9M 2;  3G71 1;  5T8T A;  1TWA I;  4DUZ C;  4BXX I;  5CZX A;  2R7Z I;  1VQN 1;  3I55 1;  4NOZ A;  1YIJ 1;  2UXC C;  3KIH A;  4BBY A;  3MZK B;  3A4I A;  4ZLP A;  3HOW I;  2UU9 C;  4NXM C;  4JI6 C;  1YJ7 A;  2GU2 A;  3I07 A;  2WP0 C;  3CCR Z;  3CW8 X;  5ADZ A;  3I56 Z;  4GXQ A;  1UKK A;  3CQZ I;  2O53 A;  2OOX B;  1K9M 1;  2P20 A;  4RLQ A;  5C4J I;  4RVH A;  3J80 b;  1QXF A;  2LEX A;  2BH1 X;  1K8A 2;  1KC8 2;  5IP7 I;  3BG1 B;  3E7X A;  2JUB A;  4YY3 C;  1V25 A;  3VB9 A;  4Y52 I;  1MDB A;  2OTJ 1;  4XX2 A;  1UWD A;  3MZL B;  4A3E I;  1O90 A;  2OPL B;  1RO4 A;  3CCV Z;  4LE5 A;  3CW9 A;  4RVF A;  5A2Q b;  3FKI I;  1LCI A;  1LQL A;  2ZZM A;  1VQP 1;  1SFO I;  4R1L A;  2P02 A;  5T8S A;  3RG2 A;  3AY0 A;  2VPZ A;  1MDF A;  5BSR A;  4A3I I;  1Q82 2;  3RZO I;  2P2F A;  3TDE A;  1K8A 1;  1FUG A;  5BUR A;  3AF6 A;  1KC8 1;  4D57 A;  4BBS I;  2YWB A;  2VPW A;  3IEU A;  2OTL Z;  3UEB A;  4BBR I;  1IBK C;  2NVX I;  3EQ6 A;  2E2J I;  1USP A;  3JAM D;  1YJ9 1;  3VNQ A;  4LFC C;  3D2L A;  2M5O A;  3A9U A;  3CD6 Z;  2PN2 A;  3FCE A;  4RVG A;  3Q87 A;  3VMH A;  2JNY A;  3RZD I;  1I94 C;  3EED A;  1TH5 A;  2RIQ A;  2M48 A;  2PT7 G;  5BST A;  1N33 C;  5JRH A;  4A3L I;  4BCA A;  3LUS A;  2QEX 1;  1P4E A;  3GKQ A;  1JJ2 Z;  4HGZ A;  2PK7 A;  5D1P A;  4I9F A;  3J80 D;  1K83 I;  3I08 A;  4DV4 C;  3NI2 A;  1RO0 A;  3D6W A;  3PBK A;  5AE2 A;  5IWA C;  2DE5 A;  3CCQ Z;  4KHP C;  4BC9 A;  1ZB8 A;  3ESW A;  1YI2 Z;  3I4N I;  4NBE A;  2VF1 A;  3CCE Z;  2OBV A;  1VQ4 Z;  2VSQ A;  5A2Q D;  3B7W A;  1N2F A;  1JWH C;  2Y0S A;  2Q51 A;  3NDI A;  5BSM A;  2OOY B;  3CMA Z;  1P9N A;  4DV2 C;  3QWU A;  2UUC C;  3CPW Y;  4JI8 C;  2JIP A;  3AF5 A;  1IBL C;  4TNU A;  4JI0 C;  1YUK A;  3D9X A;  5FLX b;  1FJG C;  1K73 2;  4PZP A;  2E8C A;  5T64 A;  3CCL Z;  4DUY C;  1YJW 1;  2ZZN A;  2VQF C;  1M1K 2;  2GTH A;  2QA4 Z;  5IT9 b;  4L7I A;  3VMI A;  1Z01 A;  3CCS Z;  1XRB A;  4JYA C;  1R9T I;  3S82 A;  2JIR A;  1Y1W I;  3TUF A;  4LF7 C;  3CC7 1;  3T4N B;  2NVY I;  2VZE A;  1Q7Y 2;  1Q16 A;  1YIT Z;  1VQL Z;  2B63 I;  1VQK 1;  2Y4O A;  3O2E A;  3UX2 A;  1HNX C;  3R9W A;  4L4Q A;  4GKJ C;  3CCJ 1;  4NBB A;  4DV7 C;  3CPW Z;  1XS3 A;  2CU6 A;  4E33 A;  1YJN 1;  5A2Q f;  1M1K 1;  3G4S 1;  4DV6 C;  4A3C I;  4LF5 C;  2QLV B;  3NH8 A;  3TQI A;  1HNZ C;  4BY7 I;  3GTM S;  4JI3 C;  1M6X A;  2P3Y A;  5FLM I;  1Q7Y 1;  3GTL I;  3CME 1;  2JA7 I;  3R9X A;  4A3B I;  2CXC A;  2E7G A;  2NCL A;  4D4I A;  2KZF A;  3S16 I;  1S72 1;  2P2M A;  4KTV A;  4U5Y D;  1NP6 A;  1MXC A;  4JM1 A;  4EAT A;  4JI7 C;  5T6B A;  5LCI A;  4NH1 C;  1NJI 2;  1Q81 2;  4AQY C;  5BUQ A;  4DR7 C;  4HH4 A;  1VQM Z;  3UZ0 A;  5FLX D;  2PMZ A;  3IR7 A;  5BUS A;  2MCQ A;  5A1I A;  2UUA C;  4EWC A;  2YCB A;  3J81 f;  3MON A;  5IT9 D;  2DE6 A;  3NFZ A;  2OO4 A;  1RLY A;  2D28 C;  1VQ8 Z;  5KEI A;  1T5H X;  3SO4 A;  3LAX A;  4A3D I;  3CCM 1;  5D1O A;  1VQ5 Z;  5AN9 F;  1M90 2;  2Z51 A;  4A3J I;  1VQ9 1;  3L95 X;  4NBF A;  3G6E 1;  2JA8 I;  4GKK C;  4DR4 C;  3LNV A;  3NDJ A;  3BG0 B;  4Y7N I;  2QR1 B;  4S1T A;  1BA3 A;  2Y27 A;  1JJ2 Y;  5C4X I;  2VPX A;  2DPL A;  4BY1 I;  1QM4 A;  1PA4 A;  1M90 1;  3VNR A;  3GKU A;  4YHH C;  2QVZ X;  1NY8 A;  5H9U A;  2D7V A;  2V8I A;  4X64 C;  4JI4 C;  3CCR 1;  2DHM A;  3PES A;  3P5J B;  1ZH1 A;  3I56 1;  3T1Y C;  4PRO C;  5E7Q A;  3PRO C;  1IBM C;  2F4O A;  1Q82 1;  1IB8 A;  4E31 A;  4ODJ A;  3CCU Z;  1QVG Y;  2R93 I;  2RBL A;  4DQY B;  4MON A;  2JMP A;  2W04 A;  4FTF A;  2D1T A;  3N2Q A;  4WV3 A;  2V8J A;  1TFI A;  5BSV A;  1VQ7 Z;  3PO2 I;  3GTP I;  1Y1V I;  1N8R 2;  5LMN C;  4RV9 A;  3LNO A;  3R44 A;  4BC7 A;  4JI2 C;  3CC4 Z;  1V60 A;  2JR6 A;  4RM3 A;  4R0M A;  4LF4 C;  3S1N I;  2IZ4 A;  2UXB C;  1VLA A;  2P2B A;  1S7M A;  4DR1 C;  4A3K I;  5CM2 M;  4HPV A;  4E2W A;  1XRC A;  2ZAE B;  3CC2 Z;  3GTG I;  4D4G A;  3HKZ A;  4E2X A;  1SIW A;  3PO3 S;  4L2Z A;  2QVX X;  3CJE A;  4OXI A;  4RVN A;  2E8E A;  4NBA A;  2OTL 1;  3N54 B;  3RV2 A;  1N8R 1;  1QYP A;  1WJ2 A;  5BR8 C;  1RG9 A;  1ULT A;  1XHJ A;  2GTI A;  1HNW C;  5C44 I;  1QVG Z;  3S17 I;  4DV1 C;  4DCS A;  3DHV A;  3CD6 1;  3JAM f;  1O92 A;  1KD1 2;  4DV0 C;  1GPM A;  4RS4 A;  3A9V A;  1VQO Z;  4MXU A;  2WD9 A;  3GR0 A;  2D27 A;  5K85 A;  2JA6 I;  2HHH C;  4K0B A;  3HOY I;  5T67 A;  4LF8 C;  1USP B;  1VQ6 Z;  2W03 A;  2JS4 A;  2E2I I;  4NBG A;  2M6N A;  2EGT A;  1O9T A;  4HGY A;  3A25 A;  4D56 A;  3NH5 A;  3J80 f;  1X3Z A;  2Y4N A;  3CCQ 1;  4DR5 C;  2JA5 I;  4GS5 A;  1YHQ Z;  2QW0 X;  2IV2 X;  1YI2 1;  4DCU A;  1N32 C;  1VQ4 1;  1N34 C;  1K73 1;  1FDO A;  4DK1 A;  4G37 A;  2R92 I;  2O4H A;  3FCC A;  3OTO C;  4JV5 C;  5KYT A;  3CMA 1;  3M4O I;  3H2T A;  4NBD A;  3GCF A;  3G71 Z;  3T1H C;  1L2F A;  4MD7 A;  5LMU C;  3UOW A;  2AYA A;  2YX1 A;  1N36 C;  4A3F I;  1MXB A;  1VQN Z;  3I55 Z;  1AMU A;  1YIJ Z;  2UXD C;  2KZ0 A;  2OPL A;  4FUT A;  3DAY A;  3S1M I;  4DG8 A;  5IFI A;  4IZ6 A;  1YUA A;  4MD8 A;  3CCL 1;  1DL6 A;  4IR7 A;  4JI1 C;  2QRC B;  4MD9 A;  3S1R I;  2M5H A;  3IF8 A;  1PG3 A;  2QA4 1; 
#chains in the Genus database with same CATH homology
 5K8F A;  2F4M A;  4LF6 C;  2D1S A;  1W2B Y;  4B3R C;  3IEV A;  3GTO I;  4X62 C;  3IML A;  5CZV A;  3F3F C;  4G36 A;  2ZM6 C;  1Z03 A;  2K3R A;  2BJO A;  1YIT 1;  1VQL 1;  2ASB A;  2DE7 A;  2VUM I;  2OTJ Z;  4B3M C;  4E30 A;  3HOU I;  4X66 C;  2NVT I;  3IFU A;  4E2Z A;  1RNI A;  2F4V C;  1Z02 A;  3TE5 B;  1VQP Z;  2Q4Z A;  2KPI A;  2VQE C;  2V8K A;  3LGX A;  1NJI 1;  3F3P C;  3NPD A;  5AE3 A;  1Q81 1;  2ATW A;  2LFU A;  3GPC A;  4NBC A;  2P2J A;  3L8C A;  1KQS Z;  4E2Y A;  3GTJ I;  2YWC A;  2G2K A;  1W2B Z;  1RY2 A;  2QRE B;  2JMO A;  4DV3 C;  1YJ9 Z;  1XMO C;  4NB8 A;  3IX0 A;  1XRA A;  5BSW A;  4B3T C;  4MH4 A;  3NYR A;  2YU9 I;  1TWG I;  2D1R A;  1V26 A;  1TWF I;  2RT9 A;  5BSU A;  4DCV A;  4NBH A;  1VQM 1;  2E9H A;  3K7A I;  1I6H I;  5AE1 A;  4RVO A;  2ONF A;  3H0G I;  5GTD A;  2HJG A;  5FLX f;  2K5R A;  3KIF A;  1MXA A;  1I50 I;  3S2H I;  3S15 I;  2QEX Z;  3FQQ A;  1VQ8 1;  4NDN A;  3S2D I;  5IT9 f;  4RMN A;  4LF9 C;  1NYE A;  2P28 A;  4I9G A;  2AKL A;  2I3C A;  2CY1 A;  1VQ5 1;  2QVY X;  1RO2 A;  4PHT A;  2OZK A;  2KI7 B;  3S14 I;  1HH2 P;  2E0G A;  4GXR A;  3GTM I;  2IZ3 A;  3VTN A;  3CCV 1;  1WII A;  2D1Q A;  4BSZ A;  5A1G A;  3CXC Y;  2J6A A;  3E7W A;  4OYC A;  3IPL A;  2QL8 A;  3NYQ A;  3HOX I;  3I4M I;  1MD9 A;  3ETO A;  1HR0 C;  5DV9 A;  2RHB A;  1ML8 A;  1MKY A;  4WS9 A;  5D1O B;  3VMG A;  1X0T A;  2QRD B;  3J81 b;  1QWI A;  2P2Q A;  4G1I A;  4X6A I;  3GTQ I;  4A3M I;  1YJW Z;  1KRL A;  2E2H I;  4DV5 C;  4A93 I;  4RM2 A;  3GR1 A;  3CCU 1;  2DYJ A;  3HOZ I;  2R6M A;  1VQ7 1;  3CC7 Z;  3C5E A;  2VUG A;  1Q86 2;  3CXC Z;  1QVF Y;  2RPR A;  2UUB C;  2H85 A;  3CC4 1;  1VQK Z;  4CL1 A;  1I3Q I;  3TDH B;  1X3W A;  3CCJ Z;  3HOV I;  4RVD A;  4RLF A;  1XMQ C;  1P7L A;  2NVQ I;  1YJN Z;  5LL6 f;  4R1M A;  1L1O C;  3G4S Z;  4DR2 C;  2LIY A;  1KD1 1;  2WAQ A;  3OW2 Y;  4TPS B;  4DG9 A;  3CC2 1;  4B3S C;  4LFB C;  4DGL A;  1XNR C;  1O93 A;  2HF1 A;  4AYB A;  4A3G I;  3CCE 1;  1TWC I;  4DR6 C;  1Q86 1;  1QF8 A;  1WW9 A;  3CME Z;  4KTT A;  1RQF A;  2WB1 A;  4OX9 C;  1NUI A;  3M3Y I;  2PM9 A;  4NB9 A;  2QKD A;  1S72 Z;  4NXN C;  1XNQ C;  4DCT A;  1JOS A;  5IP9 I;  4FUQ A;  1QVF Z;  3EER A;  2E5L C;  1WF3 A;  1ZB9 A;  3FQM A;  1VQO 1;  4QTT A;  4ISB A;  4MTN A;  3NH4 A;  3GTK I;  1WH9 A;  4E32 A;  3J81 D;  3G7S A;  3S1Q I;  3KXW A;  2HU9 A;  4NFR A;  3OW2 Z;  1J5E C;  4QTU A;  3U50 C;  1T5D X;  3ETC A;  1VQ6 1;  3H3V J;  3VNS A;  1KQS Y;  2YAD A;  3CCS 1;  4ZJZ A;  4JI5 C;  1TWH I;  4K0K C;  1PFT A;  4LFA C;  1WCM I;  3CCM Z;  1Y1V S;  1YHQ 1;  3J7A 4;  2V7B A;  1VQ9 Z;  3PO3 I;  2E8F A;  5A19 A;  3G6E Z;  3DLP X;  4X65 C;  1K0R A;  5C3E I;  2XR1 A;  1KKG A;  2PRO A;  1PG4 A;  5KYV A;  4DR3 C;  3JAM b;  1EGA A;  4MRI A;  1K9M 2;  3G71 1;  5T8T A;  1TWA I;  4DUZ C;  4BXX I;  5CZX A;  2R7Z I;  1VQN 1;  3I55 1;  4NOZ A;  1YIJ 1;  2UXC C;  3KIH A;  4BBY A;  3MZK B;  3A4I A;  4ZLP A;  3HOW I;  2UU9 C;  4NXM C;  4JI6 C;  1YJ7 A;  2GU2 A;  3I07 A;  2WP0 C;  3CCR Z;  3CW8 X;  5ADZ A;  3I56 Z;  4GXQ A;  1UKK A;  3CQZ I;  2O53 A;  2OOX B;  1K9M 1;  2P20 A;  4RLQ A;  5C4J I;  4RVH A;  3J80 b;  2BH1 X;  1K8A 2;  1KC8 2;  5IP7 I;  3BG1 B;  3E7X A;  2JUB A;  4YY3 C;  1V25 A;  3VB9 A;  4Y52 I;  1MDB A;  2OTJ 1;  4XX2 A;  3MZL B;  4A3E I;  1O90 A;  2OPL B;  1RO4 A;  3CCV Z;  4LE5 A;  3CW9 A;  4RVF A;  5A2Q b;  3FKI I;  1LCI A;  1LQL A;  1VQP 1;  1SFO I;  4R1L A;  2P02 A;  5T8S A;  3RG2 A;  1MDF A;  5BSR A;  4A3I I;  1Q82 2;  3RZO I;  2P2F A;  3TDE A;  1K8A 1;  1FUG A;  5BUR A;  3AF6 A;  1KC8 1;  4D57 A;  4BBS I;  2YWB A;  3IEU A;  2OTL Z;  4BBR I;  1IBK C;  2NVX I;  3EQ6 A;  2E2J I;  1USP A;  3JAM D;  1YJ9 1;  3VNQ A;  4LFC C;  3A9U A;  3CD6 Z;  2PN2 A;  3FCE A;  4RVG A;  3Q87 A;  3VMH A;  2JNY A;  3RZD I;  1I94 C;  3EED A;  2RIQ A;  2M48 A;  2PT7 G;  5BST A;  1N33 C;  5JRH A;  4A3L I;  4BCA A;  3LUS A;  2QEX 1;  3GKQ A;  1JJ2 Z;  4HGZ A;  2PK7 A;  5D1P A;  4I9F A;  3J80 D;  1K83 I;  3I08 A;  4DV4 C;  3NI2 A;  1RO0 A;  3D6W A;  3PBK A;  5AE2 A;  5IWA C;  2DE5 A;  3CCQ Z;  4KHP C;  4BC9 A;  1ZB8 A;  3ESW A;  1YI2 Z;  3I4N I;  4NBE A;  2VF1 A;  3CCE Z;  2OBV A;  1VQ4 Z;  2VSQ A;  5A2Q D;  3B7W A;  1N2F A;  1JWH C;  2Y0S A;  2Q51 A;  3NDI A;  5BSM A;  2OOY B;  3CMA Z;  1P9N A;  4DV2 C;  3QWU A;  2UUC C;  3CPW Y;  4JI8 C;  3AF5 A;  1IBL C;  4TNU A;  4JI0 C;  1YUK A;  3D9X A;  5FLX b;  1FJG C;  1K73 2;  4PZP A;  2E8C A;  5T64 A;  3CCL Z;  4DUY C;  1YJW 1;  2VQF C;  1M1K 2;  2GTH A;  2QA4 Z;  5IT9 b;  4L7I A;  3VMI A;  1Z01 A;  3CCS Z;  1XRB A;  4JYA C;  1R9T I;  3S82 A;  1Y1W I;  3TUF A;  4LF7 C;  3CC7 1;  3T4N B;  2NVY I;  2VZE A;  1Q7Y 2;  1YIT Z;  1VQL Z;  2B63 I;  1VQK 1;  2Y4O A;  1HNX C;  3R9W A;  4L4Q A;  4GKJ C;  3CCJ 1;  4NBB A;  4DV7 C;  3CPW Z;  4E33 A;  1YJN 1;  5A2Q f;  1M1K 1;  3G4S 1;  4DV6 C;  4A3C I;  4LF5 C;  2QLV B;  3NH8 A;  3TQI A;  1HNZ C;  4BY7 I;  3GTM S;  4JI3 C;  2P3Y A;  5FLM I;  1Q7Y 1;  3GTL I;  3CME 1;  2JA7 I;  3R9X A;  4A3B I;  2CXC A;  2E7G A;  4D4I A;  2KZF A;  3S16 I;  1S72 1;  2P2M A;  4KTV A;  4U5Y D;  1NP6 A;  1MXC A;  4JM1 A;  4EAT A;  4JI7 C;  5T6B A;  4NH1 C;  1NJI 2;  1Q81 2;  4AQY C;  5BUQ A;  4DR7 C;  4HH4 A;  1VQM Z;  3UZ0 A;  5FLX D;  2PMZ A;  5BUS A;  5A1I A;  2UUA C;  4EWC A;  2YCB A;  3J81 f;  3MON A;  5IT9 D;  2DE6 A;  3NFZ A;  2OO4 A;  1RLY A;  2D28 C;  1VQ8 Z;  5KEI A;  1T5H X;  3SO4 A;  3LAX A;  4A3D I;  3CCM 1;  5D1O A;  1VQ5 Z;  5AN9 F;  1M90 2;  4A3J I;  1VQ9 1;  3L95 X;  4NBF A;  3G6E 1;  2JA8 I;  4GKK C;  4DR4 C;  3LNV A;  3NDJ A;  3BG0 B;  4Y7N I;  2QR1 B;  4S1T A;  1BA3 A;  2Y27 A;  1JJ2 Y;  5C4X I;  2DPL A;  4BY1 I;  1QM4 A;  1PA4 A;  1M90 1;  3VNR A;  3GKU A;  4YHH C;  2QVZ X;  5H9U A;  2D7V A;  2V8I A;  4X64 C;  4JI4 C;  3CCR 1;  3PES A;  3P5J B;  1ZH1 A;  3I56 1;  3T1Y C;  4PRO C;  5E7Q A;  3PRO C;  1IBM C;  2F4O A;  1Q82 1;  4E31 A;  4ODJ A;  3CCU Z;  1QVG Y;  2R93 I;  2RBL A;  4DQY B;  4MON A;  2JMP A;  2W04 A;  4FTF A;  2D1T A;  3N2Q A;  4WV3 A;  2V8J A;  1TFI A;  5BSV A;  1VQ7 Z;  3PO2 I;  3GTP I;  1Y1V I;  1N8R 2;  5LMN C;  4RV9 A;  3R44 A;  4BC7 A;  4JI2 C;  3CC4 Z;  2JR6 A;  4RM3 A;  4R0M A;  4LF4 C;  3S1N I;  2IZ4 A;  2UXB C;  1VLA A;  2P2B A;  1S7M A;  4DR1 C;  4A3K I;  5CM2 M;  4HPV A;  4E2W A;  1XRC A;  2ZAE B;  3CC2 Z;  3GTG I;  4D4G A;  3HKZ A;  4E2X A;  3PO3 S;  4L2Z A;  2QVX X;  3CJE A;  4OXI A;  4RVN A;  2E8E A;  4NBA A;  2OTL 1;  3N54 B;  3RV2 A;  1N8R 1;  1QYP A;  5BR8 C;  1RG9 A;  1ULT A;  2GTI A;  1HNW C;  5C44 I;  1QVG Z;  3S17 I;  4DV1 C;  4DCS A;  3DHV A;  3CD6 1;  3JAM f;  1O92 A;  1KD1 2;  4DV0 C;  1GPM A;  4RS4 A;  3A9V A;  1VQO Z;  4MXU A;  2WD9 A;  3GR0 A;  2D27 A;  5K85 A;  2JA6 I;  2HHH C;  4K0B A;  3HOY I;  5T67 A;  4LF8 C;  1USP B;  1VQ6 Z;  2W03 A;  2JS4 A;  2E2I I;  4NBG A;  2M6N A;  2EGT A;  1O9T A;  4HGY A;  4D56 A;  3NH5 A;  3J80 f;  1X3Z A;  2Y4N A;  3CCQ 1;  4DR5 C;  2JA5 I;  4GS5 A;  1YHQ Z;  2QW0 X;  1YI2 1;  4DCU A;  1N32 C;  1VQ4 1;  1N34 C;  1K73 1;  4DK1 A;  4G37 A;  2R92 I;  2O4H A;  3FCC A;  3OTO C;  4JV5 C;  5KYT A;  3CMA 1;  3M4O I;  3H2T A;  4NBD A;  3GCF A;  3G71 Z;  3T1H C;  1L2F A;  4MD7 A;  5LMU C;  3UOW A;  2AYA A;  1N36 C;  4A3F I;  1MXB A;  1VQN Z;  3I55 Z;  1AMU A;  1YIJ Z;  2UXD C;  2OPL A;  4FUT A;  3DAY A;  3S1M I;  4DG8 A;  5IFI A;  4IZ6 A;  1YUA A;  4MD8 A;  3CCL 1;  1DL6 A;  4IR7 A;  4JI1 C;  3S1R I;  2QRC B;  4MD9 A;  3IF8 A;  1PG3 A;  2QA4 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...