4MH4A

Crystal structure of osmc-like protein from burkholderia cenocepacia j2315
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
SKIEKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAVDAEVDLGTAGNAYFLQARLNVSVPGLERDVAQRIVDAAHQTCPYSKATRGNIDVDIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of OsmC-like protein from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Protein binding
molecule keywords OsmC-like protein
total genus 31
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mh4A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4mh4A02
1K83I 3U50C 4LF8C 3VMHA 1KKGA 4B3MC 2E7GA 4JI0C 5FLXD 4A3CI 5BR8C 2ONFA 3J81D 2DE7A 5IP9I 1HNZC 3AF6A 1I6HI 3GTMS 2XR1A 1R9TI 5CM2M 2NVXI 3LUSA 4JI3C 1IBMC 1ZB9A 2DE6A 4A3GI 1I94C 4AQYC 1Y1WI 4DR5C 3GTQI 1VLAA 4JI7C 2ZM6C 4DR6C 4A3JI 4JYAC 1SFOI 1QYPA 3PO3I 5C44I 3GTPI 1RLYA 4JI1C 4LFCC 3GTGI 2QL8A 1RO4A 1USPA 3CJEA 4BXXI 4XX2A 4GKKC 1L2FA 3ESWA 2BJOA 1MKYA 1NYEA 2JNYA 1ML8A 4A3EI 2VQFC 2UUCC 2R7ZI 1UKKA 2PN2A 1NUIA 4A3LI 4DV6C 3H0GI 2UUBC 4B3TC 4JI6C 5IWAC 1HH2P 3K7AI 1TFIA 1EGAA 1XMQC 5LMUC 2R93I 4NBEA 1USPB 4X64C 2NVTI 3FKII 4JV5C 4NBGA 3VMGA 3S2DI 4JI8C 4A3BI 4A3FI 4DR2C 2DYJA 2YCBA 5LMNC 3VB9A 4NXMC 3I07A 2E5LC 1QWIA 1Y1VS 3EERA 1ZB8A 2B63I 3S15I 3CQZI 1LQLA 3GKUA 4YHHC 2UU9C 4A3II 3IEVA 3D6WA 2JA6I 4DCSA 4LFBC 1JOSA 3HOUI 2ASBA 2YU9I 2UXBC 3HOZI 4DR7C 4B3RC 4LF6C 3IEUA 1DL6A 3T1HC 4DV4C 4X62C 1HNXC 5C4XI 2F4VC 2E2JI 4NBHA 4NOZA 1X3WA 2NVQI 3S16I 1XNQC 2HF1A 1WW9A 4A3KI 3OTOC 2PT7G 3R9XA 4K0KC 4X65C 1N33C 1YUAA 4LF5C 1TWCI 3S1QI 3RZDI 2EGTA 3Q87A 1TWFI 1WH9A 1WF3A 3VMIA 3GTMI 3RZOI 4NBFA 2E2HI 3S1MI 3AF5A 4JI4C 4LF9C 4NXNC 4KHPC 1PA4A 4JI5C 4JI2C 2KPIA 4NBCA 1TWGI 2E2II 4BY1I 3GTLI 4NBAA 3HOXI 3PO3S 3GTJI 4OX9C 3T1YC 4QTUA 3HOYI 2JA8I 2UUAC 2J6AA 2P3YA 4BSZA 4BBSI 5C3EI 4MH4A 3HOWI 3HOVI 1I3QI 1K0RA 4B3SC 2F4MA 5A2QD 2UXCC 3PO2I 4DV0C 2D7VA 2OPLB 2NVYI 3JAMD 4LF4C 3GTKI 2HHHC 4NBDA 2AKLA 4LFAC 2PK7A 3S14I 1IBKC 4DCUA 4DV7C 4DR3C 2RBLA 2CY1A 1PFTA 4X6AI 2F4OA 2ATWA 2HJGA 4Y7NI 3GTOI 3M3YI 5IT9D 2JR6A 4DV2C 4YY3C 1X3ZA 4BBRI 1TWHI 3S2HI 2E8CA 2K5RA 3S1NI 3R9WA 2E8EA 4QTTA 4Y52I 4MTNA 2VUMI 1XNRC 1N32C 2OPLA 4DV3C 2E8FA 4NB8A 3S17I 4DUYC 3S1RI 3GKQA 1TWAI 2VQEC 2CXCA 4DUZC 4A3DI 4DV1C 5C4JI 2R92I 4BY7I 2KZFA 4X66C 1WCMI 1Y1VI 1N36C 1IBLC 1XMOC 4DR4C 4DCTA 4DCVA 3I4MI 2UXDC 5FLMI 5IP7I 3M4OI 4A93I 1L1OC 2DE5A 2JA5I 4A3MI 4NB9A 2JA7I 3I4NI 2JMPA 3GCFA 4DR1C 3H3VJ 1N34C 1J5EC 1HR0C 1N2FA 4LF7C 2JS4A 1HNWC 4DV5C 4GKJC 3J80D 1I50I 4NBBA 1FJGC
chains in the Genus database with same CATH superfamily
1KQSZ 2QVZX 1VQMZ 4R1LA 4A3CI 5T8TA 1RNIA 1WIIA 1HNZC 2XR1A 3GTMS 4KTVA 4G1IA 2P2BA 3CC2Z 2DE6A 4PUIA 4R1MA 1VQ91 2PMZA 1Y1WI 1VLAA 4DG9A 1QVGY 4A3JI 2QRDB 2ZZMA 2OOYB 5BURA 3CC21 3JAMf 3GTPI 3GTGI 3L8CA 1RO4A 4WV3A 1S721 4XX2A 2QEX1 4GKKC 3ESWA 2V8KA 3CCJ1 1ML8A 1NYEA 2IV2X 3MZKB 2JIPA 4DV6C 3MZLB 2QEXZ 5IWAC 4MD7A 1XMQC 1USPB 2OTLZ 4JV5C 3CMEZ 3VMGA 1RG9A 4A3BI 1MXAA 3NYRA 2DYJA 2YCBA 1QXFA 4NXMC 2IZ3A 4NH1C 5KYTA 3VNRA 4A3II 3NYQA 5FLXf 3GPCA 3D6WA 3CCUZ 5ADZA 1XS3A 2YWCA 1Q862 3HOUI 4RMNA 4GXQA 3RV2A 2QA41 2UXBC 1FDIA 2GTIA 3T1HC 4DV4C 4X62C 2F4VC 3JAMb 4NBHA 2M6NA 5A2Qb 2VZEA 1RY2A 4LF5C 1VQ5Z 1TWCI 3S1QI 3Q87A 1TWFI 3R44A 1WH9A 4MONA 4KHPC 2E2HI 3S1MI 2W04A 1XRBA 3ETOA 1KC82 4E32A 2G2KA 2WP0C 4MXUA 3NH8A 2JA8I 2J6AA 4BSZA 3B7WA 3HOWI 3HOVI 4L2ZA 2F4MA 2UXCC 2OPLB 3JAMD 3DLPX 5BSTA 2PK7A 4RVNA 2JUBA 1Q7Y1 4DR3C 2CU6A 1PFTA 1MDBA 3QWUA 1SIWA 2ATWA 2HJGA 3GTOI 3NPDA 3CC4Z 1TH5A 2JR6A 4OXIA 4DGLA 1X3ZA 2IZ4A 2QREB 1VQPZ 2ZZNA 4QTTA 4MTNA 1K8A1 4ZLPA 1K9M1 3F3FC 2MM9A 2OPLA 2E8FA 5E7QA 4DV3C 4GS5A 4DUYC 5AE3A 4CL1A 2VQEC 2YADA 2QVXX 4LFBC 5C4JI 2K3RA 1IBLC 1N36C 1VQ9Z 3NDJA 3NFZA 1L1OC 2JA5I 3KIHA 3GCFA 1HR0C 4LF7C 4ZJZA 5BSRA 1HNWC 1YIJZ 2D1QA 4L7IA 4GKJC 1FJGC 3PROC 4E2YA 1WJ2A 3OW2Z 2M5HA 1MXBA 4FTFA 2I3CA 3VMHA 4KTTA 2E7GA 5BR8C 2ONFA 2OO4A 3EQ6A 2DE7A 4D57A 3IF8A 1R9TI 4JI3C 2M48A 2E0GA 1YITZ 1ZH1A 1T5DX 3IMLA 3NDIA 4AQYC 3NI2A 4DR5C 2LIYA 3J81f 2ZM6C 4DR6C 1K8A2 5C44I 3N2QA 5BUQA 2LEXA 2OTJ1 3AY0A 1RLYA 3ETCA 3UX3A 2QL8A 3N54B 4LFCC 1V26A 1Z02A 1L2FA 1VQ51 1NP6A 1PG4A 2R7ZI 2PN2A 1NUIA 2WD9A 2Y4NA 1BA3A 5LL6f 3H0GI 2UUBC 1QF8A 3G711 1HH2P 3A25A 3K6RA 2V7BA 4PROC 3P5JB 4X64C 2RT9A 3OW2Y 4L4QA 1VQK1 1FUGA 1XRCA 5A1GA 5KEIA 3VB9A 2E5LC 1VQLZ 1XNQC 3GKUA 4YHHC 3CQZI 3VNSA 2UU9C 1FDOA 4DCSA 2RIQA 2P2FA 1X0TA 5A2Qf 1N8R1 1JOSA 2ASBA 1WCJA 2QVYX 3CC41 3SO4A 1Q861 4NOZA 1X3WA 1VQP1 5LCIA 4K0KC 1N33C 1WW9A 2JIOA 3LGXA 2PT7G 3R9XA 3J81b 4X65C 1YUAA 3CC71 2E7ZA 3G6EZ 4RV9A 3J7A4 4PHTA 1Z03A 3GTMI 4JI4C 1KKGA 2VUGA 3CPWZ 5BUSA 4NBCA 5T8SA 2E2II 2D27A 1Y8CA 3PO3S 1MD9A 2Q51A 4HGYA 4RVDA 3GTJI 1S72Z 1JWHC 2JIRA 3HOYI 3CCJZ 2OBVA 2YX1A 3LNOA 5CZVA 2P02A 3VNQA 3CPWY 4E30A 3IPLA 4B3SC 1YI2Z 3PO2I 4DV0C 2NVYI 1GPMA 4LF4C 2O53A 3I561 1VQ71 2QW0X 1VQ61 5BSUA 3S14I 1IBKC 3CME1 4DV7C 2CY1A 4ISBA 2LFUA 2F4OA 3IR7A 2Y27A 3GR1A 1LCIA 2WAQA 2KI7B 1YI21 3M3YI 4WS9A 4D4IA 5IT9D 2QR1B 4BBRI 2BH1X 2OOXB 3KIFA 3S2HI 2K5RA 3S1NI 4RM3A 1N32C 4LE5A 1M6XA 4NB8A 3TUFA 1M901 3CQ2A 3CCQZ 1TWAI 2AYAA 4A3DI 4RLFA 3RG2A 3BG0B 2R92I 1W2BZ 4X66C 1Y1VI 2OZKA 2JIMA 1O9TA 4DCTA 1Z01A 4DCVA 1O90A 1YJWZ 3CCQ1 4HH4A 1O93A 3CW9A 3DAYA 4RVOA 4A93I 3CCEZ 3I4NI 1N34C 1VQNZ 1J5EC 2ZAEB 5FLXb 2H85A 1N2FA 1P4EA 1VQKZ 4TNUA 4NBBA 1RO0A 1YJW1 5DV9A 1K83I 3U50C 2VPXA 3CCE1 4B3MC 5FLXD 1YUKA 5D1OB 3J81D 4E2ZA 5IP9I 3LNVA 2R6MA 2NVXI 2QRCB 2GTHA 1I94C 1KQSY 5AE1A 3GTQI 5JRHA 1SFOI 1QYPA 3PO3I 4R0MA 1NJI1 1VQ8Z 1VQL1 3O2EA 3E7WA 2D1RA 3CJEA 5KYVA 4G36A 3CC7Z 2BJOA 1VQOZ 1YJ9Z 2JNYA 2UUCC 3G6E1 3CXCZ 2VF1A 3DHVA 4B3TC 4BCAA 4JI6C 1KC81 5T64A 4E2WA 3T4NB 4FUTA 2W03A 4NBEA 2R93I 1XRAA 3CW8X 3CCR1 3S2DI 3CXCY 4RS4A 2YWBA 4A3FI 4PUHA 3CCMZ 1N8R2 1M1K2 3D9XA 3UOWA 3EERA 3EEDA 3NH4A 3CCRZ 1P9NA 4AYBA 4I9GA 4D4GA 2D1SA 1VQ6Z 3I55Z 1Q7Y2 1QVGZ 3HOZI 4DR7C 1V60A 4EATA 4LF6C 3G7SA 3IEUA 5IT9b 5H9UA 5BSMA 5C4XI 2JNVA 1YJ7A 4MD8A 1NJI2 1PG3A 2Y4OA 2HF1A 5AN9F 3IFUA 1YIT1 1YJN1 5BSVA 3CCS1 3A4IA 1WF3A 3RZOI 4HPVA 4NBFA 3FQQA 3TDEA 4LF9C 4NXNC 4BBYA 1PA4A 2HU9A 4JI2C 2KPIA 4RVFA 1Q812 5T67A 1YJNZ 3GTLI 2OTJZ 3E7XA 3CCL1 3I08A 3T1YC 2UUAC 4U5YD 2PM9A 4ODJA 3HKZA 2V45A 1VQN1 4BBSI 5C3EI 5K85A 1K0RA 5A2QD 2D7VA 4NFRA 3GTKI 2HHHC 4NBDA 4DG8A 1S7MA 2PROA 2VPZA 4X6AI 3CMA1 5A19A 1QVFY 1NY8A 2Q4ZA 2V3VA 2MMAB 2D28C 4YY3C 1TWHI 2P2QA 4IZ6A 3R9WA 1VQ4Z 4Y52I 5CZXA 3CMAZ 3D2LA 3S17I 4K0BA 3S1RI 1VQ41 3H2TA 2CXCA 1VQO1 4DUZC 4DV1C 4I9FA 1M6XC 1Q821 3A26A 4E31A 3NH5A 1Q811 4BC9A 1XMOC 4DR4C 3I4MI 3G4SZ 1M902 1P7LA 5IP7I 2JMPA 1UWDA 4A3MI 3CCU1 3IX0A 2Z51A 4HGZA 3H3VJ 1Q16A 2P2MA 2JS4A 4DV5C 3J80D 2P28A 1I50I 4B3RC 4MRIA 4LF8C 4JI0C 3C5EA 5IT9f 4IR7A 1QVFZ 1P4EC 3FQMA 2WB1A 3AF6A 1I6HI 3FCEA 5CM2M 1IBMC 3LUSA 1ZB9A 4A3GI 3FCCA 3TE5B 4EWCA 1RO2A 1KD12 3CCVZ 3UZ0A 5AE2A 4JI7C 3I56Z 1VQ7Z 4JYAC 3CCM1 2RHBA 5BSWA 2NCLA 4FUQA 1AMUA 4JI1C 1USPA 3CQ3A 3UX2A 2AYDA 4BXXI 3CCV1 1MKYA 2D1TA 3J80b 4A3EI 4TPSB 2VQFC 1UKKA 3CCSZ 3I551 4A3LI 4GXRA 3TDHB 4PUGA 3K7AI 1TFIA 1EGAA 1M1K1 5LMUC 1MDFA 2V8JA 3KXWA 3VTNA 2NVTI 3FKII 4NBGA 4E2XA 1AA6A 1K732 1JJ2Y 4RVHA 5T6BA 4JI8C 1VEHA 4DR2C 2QLVB 5A1IA 5LMNC 3I07A 1QWIA 3A9UA 1Y1VS 2B63I 1ZB8A 2KZ0A 3S15I 3IEVA 1LQLA 2P20A 2JA6I 1YHQZ 2RPRA 5D1PA 1QM4A 1XHJA 4MD9A 1JJ2Z 1MXCA 3CQ1A 3CD6Z 4DK1A 3CCLZ 2YU9I 1FLOA 2JIQA 1KD11 3PESA 3TR3A 1DL6A 1YHQ1 1WZNA 1HNXC 4DQYB 2OTL1 1KRLA 2E2JI 3CD61 1IB8A 2V8IA 4E33A 2NVQI 3S16I 4A3KI 5GTDA 5IFIA 3F3PC 3OTOC 2KDNA 2UXDC 4RLQA 1O92A 4D56A 3J80f 2EGTA 2Y0SA 3RZDI 4NDNA 3BG1B 3VMIA 1YIJ1 4S1TA 3AF5A 2M5OA 4JI5C 4BY1I 1TWGI 1VQ81 2DPLA 4NBAA 3HOXI 2P2JA 3G4S1 1W2BY 4OX9C 4QTUA 1K731 1YJ91 2P3YA 3LAXA 4JM1A 4OYCA 3UEBA 4MH4A 1I3QI 2JMOA 2VSQA 1RQFA 4LFAC 2AKLA 1ULTA 2DHMA 4DCUA 3GR0A 2RBLA 4RVGA 2QA4Z 3A9VA 4Y7NI 4DV2C 3MONA 2VPWA 4G37A 2E8CA 2E8EA 3S82A 3TQIA 3G71Z 2VUMI 1T5HX 1XNRC 3PBKA 2QKDA 5D1OA 3GKQA 3L95X 2VPYA 4BY7I 2KZFA 1WCMI 1PU1A 1K9M2 2MCQA 2O4HA 1V25A 4PZPA 5K8FA 5FLMI 3M4OI 2NAPA 2DE5A 1VQM1 2E9HA 4BC7A 4NB9A 2JA7I 4DR1C 2GU2A 1Q822 4RM2A
chains in the Genus database with same CATH topology
1KQSZ 2QVZX 1VQMZ 4R1LA 4A3CI 5T8TA 1RNIA 1WIIA 1HNZC 2XR1A 3GTMS 4KTVA 4G1IA 2P2BA 3CC2Z 2DE6A 4R1MA 1VQ91 2PMZA 1Y1WI 1VLAA 4DG9A 1QVGY 4A3JI 2QRDB 2OOYB 5BURA 3CC21 3JAMf 3GTPI 3GTGI 3L8CA 1RO4A 4WV3A 1S721 4XX2A 2QEX1 4GKKC 3ESWA 2V8KA 3CCJ1 1ML8A 1NYEA 3MZKB 4DV6C 3MZLB 2QEXZ 5IWAC 4MD7A 1XMQC 1USPB 2OTLZ 4JV5C 3CMEZ 3VMGA 1RG9A 4A3BI 1MXAA 3NYRA 2DYJA 2YCBA 4NXMC 2IZ3A 4NH1C 5KYTA 3VNRA 4A3II 3NYQA 5FLXf 3GPCA 3D6WA 3CCUZ 5ADZA 2YWCA 1Q862 3HOUI 4RMNA 4GXQA 3RV2A 2QA41 2UXBC 2GTIA 3T1HC 4DV4C 4X62C 2F4VC 3JAMb 4NBHA 2M6NA 5A2Qb 2VZEA 1RY2A 4LF5C 1VQ5Z 1TWCI 3S1QI 3Q87A 1TWFI 3R44A 1WH9A 4MONA 4KHPC 2E2HI 3S1MI 2W04A 1XRBA 3ETOA 1KC82 4E32A 2G2KA 2WP0C 4MXUA 3NH8A 2JA8I 2J6AA 4BSZA 3B7WA 3HOWI 3HOVI 4L2ZA 2F4MA 2UXCC 2OPLB 3JAMD 3DLPX 5BSTA 2PK7A 4RVNA 2JUBA 1Q7Y1 4DR3C 1PFTA 1MDBA 3QWUA 2ATWA 2HJGA 3GTOI 3NPDA 3CC4Z 2JR6A 4OXIA 4DGLA 1X3ZA 2IZ4A 2QREB 1VQPZ 4QTTA 4MTNA 1K8A1 4ZLPA 1K9M1 3F3FC 2OPLA 5E7QA 2E8FA 4DV3C 4GS5A 4DUYC 5AE3A 4CL1A 2VQEC 2YADA 2QVXX 4LFBC 5C4JI 2K3RA 1IBLC 1N36C 1VQ9Z 3NDJA 3NFZA 1L1OC 2JA5I 3KIHA 3GCFA 1HR0C 4LF7C 4ZJZA 5BSRA 1HNWC 1YIJZ 2D1QA 4L7IA 4GKJC 1FJGC 3PROC 4E2YA 3OW2Z 1MXBA 4FTFA 2I3CA 3VMHA 4KTTA 2E7GA 5BR8C 2ONFA 2OO4A 3EQ6A 2DE7A 4D57A 3IF8A 1R9TI 4JI3C 2M48A 2E0GA 1YITZ 1ZH1A 1T5DX 3IMLA 3NDIA 4AQYC 3NI2A 4DR5C 2LIYA 3J81f 2ZM6C 4DR6C 1K8A2 5C44I 3N2QA 5BUQA 2OTJ1 1RLYA 3ETCA 4LFCC 2QL8A 3N54B 1V26A 1Z02A 1L2FA 1VQ51 1NP6A 1PG4A 2R7ZI 2PN2A 1NUIA 2WD9A 2Y4NA 1BA3A 5LL6f 3H0GI 2UUBC 1QF8A 3G711 1HH2P 2V7BA 4PROC 3P5JB 4X64C 2RT9A 3OW2Y 4L4QA 1VQK1 1FUGA 1XRCA 5A1GA 5KEIA 3VB9A 2E5LC 1VQLZ 3GKUA 4YHHC 3CQZI 3VNSA 2UU9C 4DCSA 2RIQA 2P2FA 1X0TA 5A2Qf 1N8R1 1JOSA 2ASBA 2QVYX 3CC41 3SO4A 1Q861 4NOZA 1X3WA 1VQP1 4K0KC 1N33C 1WW9A 3R9XA 3LGXA 2PT7G 3J81b 4X65C 1YUAA 3CC71 3G6EZ 4RV9A 3J7A4 4PHTA 1Z03A 3GTMI 4JI4C 1KKGA 2VUGA 3CPWZ 5BUSA 4NBCA 5T8SA 2E2II 2D27A 3PO3S 1MD9A 2Q51A 4HGYA 4RVDA 3GTJI 1S72Z 1JWHC 3HOYI 3CCJZ 2OBVA 5CZVA 2P02A 3VNQA 3CPWY 4E30A 3IPLA 4B3SC 1YI2Z 3PO2I 4DV0C 2NVYI 1GPMA 4LF4C 2O53A 3I561 1VQ71 2QW0X 1VQ61 5BSUA 3S14I 1IBKC 3CME1 4DV7C 2CY1A 4ISBA 2LFUA 2F4OA 3GR1A 2Y27A 1LCIA 2WAQA 2KI7B 1YI21 3M3YI 4WS9A 4D4IA 5IT9D 2QR1B 4BBRI 2BH1X 2OOXB 3KIFA 3S2HI 2K5RA 3S1NI 4RM3A 1N32C 4LE5A 4NB8A 3TUFA 1M901 3CCQZ 1TWAI 2AYAA 4A3DI 4RLFA 3RG2A 3BG0B 2R92I 1W2BZ 4X66C 1Y1VI 2OZKA 1O9TA 4DCTA 1Z01A 4DCVA 1O90A 1YJWZ 3CCQ1 4HH4A 1O93A 3CW9A 3DAYA 4RVOA 4A93I 3CCEZ 3I4NI 1N34C 1VQNZ 1J5EC 2ZAEB 5FLXb 2H85A 1N2FA 1VQKZ 4TNUA 1YJW1 4NBBA 1RO0A 5DV9A 1K83I 3U50C 3CCE1 4B3MC 5FLXD 1YUKA 5D1OB 3J81D 4E2ZA 5IP9I 3LNVA 2R6MA 2NVXI 2QRCB 2GTHA 1I94C 1KQSY 5AE1A 3GTQI 5JRHA 1SFOI 1QYPA 3PO3I 4R0MA 1NJI1 1VQ8Z 1VQL1 3E7WA 2D1RA 3CJEA 5KYVA 4G36A 3CC7Z 2BJOA 1VQOZ 1YJ9Z 2JNYA 2UUCC 3G6E1 3CXCZ 2VF1A 3DHVA 4B3TC 4BCAA 4JI6C 1KC81 5T64A 4E2WA 3T4NB 4FUTA 2W03A 4NBEA 2R93I 1XRAA 3CW8X 3CCR1 3S2DI 3CXCY 4RS4A 2YWBA 4A3FI 3CCMZ 1N8R2 1M1K2 3D9XA 3UOWA 3EERA 3EEDA 3NH4A 3CCRZ 1P9NA 4AYBA 4I9GA 4D4GA 2D1SA 1VQ6Z 3I55Z 1Q7Y2 1QVGZ 3HOZI 4DR7C 4EATA 4LF6C 3G7SA 3IEUA 5IT9b 5H9UA 5BSMA 5C4XI 1YJ7A 4MD8A 1NJI2 1PG3A 2Y4OA 2HF1A 5AN9F 3IFUA 1YIT1 1YJN1 5BSVA 3CCS1 3A4IA 1WF3A 3RZOI 4HPVA 4NBFA 3FQQA 3TDEA 4LF9C 4NXNC 4BBYA 1PA4A 2HU9A 4JI2C 1Q812 2KPIA 4RVFA 5T67A 1YJNZ 3GTLI 2OTJZ 3E7XA 3CCL1 3I08A 3T1YC 2UUAC 4U5YD 2PM9A 4ODJA 3HKZA 1VQN1 4BBSI 5C3EI 5K85A 1K0RA 5A2QD 2D7VA 4NFRA 3GTKI 2HHHC 4NBDA 4DG8A 1S7MA 2PROA 4X6AI 3CMA1 5A19A 1QVFY 2Q4ZA 2D28C 4YY3C 1TWHI 2P2QA 4IZ6A 3R9WA 1VQ4Z 4Y52I 5CZXA 3CMAZ 3S17I 4K0BA 3S1RI 1VQ41 3H2TA 2CXCA 1VQO1 4DUZC 4DV1C 4I9FA 1Q821 4BC9A 4E31A 3NH5A 1Q811 1XMOC 4DR4C 3I4MI 3G4SZ 1M902 1P7LA 5IP7I 2JMPA 4A3MI 3CCU1 3IX0A 4HGZA 3H3VJ 2P2MA 2JS4A 4DV5C 3J80D 2P28A 1I50I 4B3RC 4MRIA 4LF8C 4JI0C 3C5EA 5IT9f 4IR7A 1QVFZ 3FQMA 2WB1A 3AF6A 1I6HI 3FCEA 5CM2M 1IBMC 3LUSA 1ZB9A 4A3GI 3FCCA 3TE5B 4EWCA 1RO2A 1KD12 3CCVZ 3UZ0A 5AE2A 4JI7C 3I56Z 1VQ7Z 4JYAC 3CCM1 2RHBA 5BSWA 1AMUA 4FUQA 4JI1C 1USPA 4BXXI 3CCV1 1MKYA 2D1TA 3J80b 4A3EI 4TPSB 2VQFC 1UKKA 3CCSZ 3I551 4A3LI 4GXRA 3TDHB 3K7AI 1TFIA 1EGAA 1M1K1 5LMUC 1MDFA 2V8JA 3KXWA 3VTNA 2NVTI 3FKII 4NBGA 4E2XA 1K732 4JI8C 1JJ2Y 4RVHA 5T6BA 4DR2C 2QLVB 5A1IA 5LMNC 3I07A 1QWIA 3A9UA 1Y1VS 2B63I 1ZB8A 3S15I 3IEVA 1LQLA 2P20A 2JA6I 1YHQZ 2RPRA 5D1PA 1QM4A 4MD9A 1JJ2Z 1MXCA 3CD6Z 4DK1A 3CCLZ 2YU9I 1KD11 3PESA 1DL6A 1YHQ1 1HNXC 4DQYB 2OTL1 1KRLA 2E2JI 3CD61 5IFIA 2V8IA 4E33A 2NVQI 3S16I 4A3KI 5GTDA 1XNQC 3F3PC 3OTOC 2UXDC 4RLQA 1O92A 4D56A 3J80f 2EGTA 2Y0SA 3RZDI 4NDNA 3BG1B 3VMIA 1YIJ1 4S1TA 3AF5A 4JI5C 4BY1I 1TWGI 1VQ81 2DPLA 4NBAA 3HOXI 2P2JA 3G4S1 1W2BY 4OX9C 4QTUA 1K731 1YJ91 2P3YA 3LAXA 4JM1A 4OYCA 4MH4A 1I3QI 2JMOA 2VSQA 1RQFA 4LFAC 2AKLA 1ULTA 4DCUA 3GR0A 2RBLA 4RVGA 2QA4Z 3A9VA 4Y7NI 4DV2C 3MONA 4G37A 2E8CA 2E8EA 3S82A 3TQIA 3G71Z 2VUMI 1T5HX 1XNRC 3PBKA 2QKDA 5D1OA 3GKQA 3L95X 4BY7I 2KZFA 1WCMI 1K9M2 2O4HA 1V25A 4PZPA 5K8FA 5FLMI 3M4OI 4DR1C 2DE5A 1VQM1 2E9HA 4BC7A 4NB9A 2JA7I 2GU2A 1Q822 4RM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 I;  3U50 C;  4LF8 C;  3VMH A;  1KKG A;  4B3M C;  2E7G A;  4JI0 C;  5FLX D;  4A3C I;  5BR8 C;  2ONF A;  3J81 D;  2DE7 A;  5IP9 I;  1HNZ C;  3AF6 A;  1I6H I;  3GTM S;  2XR1 A;  1R9T I;  5CM2 M;  2NVX I;  3LUS A;  4JI3 C;  1IBM C;  1ZB9 A;  2DE6 A;  4A3G I;  1I94 C;  4AQY C;  1Y1W I;  4DR5 C;  3GTQ I;  1VLA A;  4JI7 C;  2ZM6 C;  4DR6 C;  4A3J I;  4JYA C;  1SFO I;  1QYP A;  3PO3 I;  5C44 I;  3GTP I;  1RLY A;  4JI1 C;  4LFC C;  3GTG I;  2QL8 A;  1RO4 A;  1USP A;  3CJE A;  4BXX I;  4XX2 A;  4GKK C;  1L2F A;  3ESW A;  2BJO A;  1MKY A;  1NYE A;  2JNY A;  1ML8 A;  4A3E I;  2VQF C;  2UUC C;  2R7Z I;  1UKK A;  2PN2 A;  1NUI A;  4A3L I;  4DV6 C;  3H0G I;  2UUB C;  4B3T C;  4JI6 C;  5IWA C;  1HH2 P;  3K7A I;  1TFI A;  1EGA A;  1XMQ C;  5LMU C;  2R93 I;  4NBE A;  1USP B;  4X64 C;  2NVT I;  3FKI I;  4JV5 C;  4NBG A;  3VMG A;  3S2D I;  4JI8 C;  4A3B I;  4A3F I;  4DR2 C;  2DYJ A;  2YCB A;  5LMN C;  3VB9 A;  4NXM C;  3I07 A;  2E5L C;  1QWI A;  1Y1V S;  3EER A;  1ZB8 A;  2B63 I;  3S15 I;  3CQZ I;  1LQL A;  3GKU A;  4YHH C;  2UU9 C;  4A3I I;  3IEV A;  3D6W A;  2JA6 I;  4DCS A;  4LFB C;  1JOS A;  3HOU I;  2ASB A;  2YU9 I;  2UXB C;  3HOZ I;  4DR7 C;  4B3R C;  4LF6 C;  3IEU A;  1DL6 A;  3T1H C;  4DV4 C;  4X62 C;  1HNX C;  5C4X I;  2F4V C;  2E2J I;  4NBH A;  4NOZ A;  1X3W A;  2NVQ I;  3S16 I;  1XNQ C;  2HF1 A;  1WW9 A;  4A3K I;  3OTO C;  2PT7 G;  3R9X A;  4K0K C;  4X65 C;  1N33 C;  1YUA A;  4LF5 C;  1TWC I;  3S1Q I;  3RZD I;  2EGT A;  3Q87 A;  1TWF I;  1WH9 A;  1WF3 A;  3VMI A;  3GTM I;  3RZO I;  4NBF A;  2E2H I;  3S1M I;  3AF5 A;  4JI4 C;  4LF9 C;  4NXN C;  4KHP C;  1PA4 A;  4JI5 C;  4JI2 C;  2KPI A;  4NBC A;  1TWG I;  2E2I I;  4BY1 I;  3GTL I;  4NBA A;  3HOX I;  3PO3 S;  3GTJ I;  4OX9 C;  3T1Y C;  4QTU A;  3HOY I;  2JA8 I;  2UUA C;  2J6A A;  2P3Y A;  4BSZ A;  4BBS I;  5C3E I;  4MH4 A;  3HOW I;  3HOV I;  1I3Q I;  1K0R A;  4B3S C;  2F4M A;  5A2Q D;  2UXC C;  3PO2 I;  4DV0 C;  2D7V A;  2OPL B;  2NVY I;  3JAM D;  4LF4 C;  3GTK I;  2HHH C;  4NBD A;  2AKL A;  4LFA C;  2PK7 A;  3S14 I;  1IBK C;  4DCU A;  4DV7 C;  4DR3 C;  2RBL A;  2CY1 A;  1PFT A;  4X6A I;  2F4O A;  2ATW A;  2HJG A;  4Y7N I;  3GTO I;  3M3Y I;  5IT9 D;  2JR6 A;  4DV2 C;  4YY3 C;  1X3Z A;  4BBR I;  1TWH I;  3S2H I;  2E8C A;  2K5R A;  3S1N I;  3R9W A;  2E8E A;  4QTT A;  4Y52 I;  4MTN A;  2VUM I;  1XNR C;  1N32 C;  2OPL A;  4DV3 C;  2E8F A;  4NB8 A;  3S17 I;  4DUY C;  3S1R I;  3GKQ A;  1TWA I;  2VQE C;  2CXC A;  4DUZ C;  4A3D I;  4DV1 C;  5C4J I;  2R92 I;  4BY7 I;  2KZF A;  4X66 C;  1WCM I;  1Y1V I;  1N36 C;  1IBL C;  1XMO C;  4DR4 C;  4DCT A;  4DCV A;  3I4M I;  2UXD C;  5FLM I;  5IP7 I;  3M4O I;  4A93 I;  1L1O C;  2DE5 A;  2JA5 I;  4A3M I;  4NB9 A;  2JA7 I;  3I4N I;  2JMP A;  3GCF A;  4DR1 C;  3H3V J;  1N34 C;  1J5E C;  1HR0 C;  1N2F A;  4LF7 C;  2JS4 A;  1HNW C;  4DV5 C;  4GKJ C;  3J80 D;  1I50 I;  4NBB A;  1FJG C; 
#chains in the Genus database with same CATH topology
 1KQS Z;  2QVZ X;  1VQM Z;  4R1L A;  4A3C I;  5T8T A;  1RNI A;  1WII A;  1HNZ C;  2XR1 A;  3GTM S;  4KTV A;  4G1I A;  2P2B A;  3CC2 Z;  2DE6 A;  4PUI A;  4R1M A;  1VQ9 1;  2PMZ A;  1Y1W I;  1VLA A;  4DG9 A;  1QVG Y;  4A3J I;  2QRD B;  2ZZM A;  2OOY B;  5BUR A;  3CC2 1;  3JAM f;  3GTP I;  3GTG I;  3L8C A;  1RO4 A;  4WV3 A;  1S72 1;  4XX2 A;  2QEX 1;  4GKK C;  3ESW A;  2V8K A;  3CCJ 1;  1ML8 A;  1NYE A;  2IV2 X;  3MZK B;  2JIP A;  4DV6 C;  3MZL B;  2QEX Z;  5IWA C;  4MD7 A;  1XMQ C;  1USP B;  2OTL Z;  4JV5 C;  3CME Z;  3VMG A;  1RG9 A;  4A3B I;  1MXA A;  3NYR A;  2DYJ A;  2YCB A;  1QXF A;  4NXM C;  2IZ3 A;  4NH1 C;  5KYT A;  3VNR A;  4A3I I;  3NYQ A;  5FLX f;  3GPC A;  3D6W A;  3CCU Z;  5ADZ A;  1XS3 A;  2YWC A;  1Q86 2;  3HOU I;  4RMN A;  4GXQ A;  3RV2 A;  2QA4 1;  2UXB C;  1FDI A;  2GTI A;  3T1H C;  4DV4 C;  4X62 C;  2F4V C;  3JAM b;  4NBH A;  2M6N A;  5A2Q b;  2VZE A;  1RY2 A;  4LF5 C;  1VQ5 Z;  1TWC I;  3S1Q I;  3Q87 A;  1TWF I;  3R44 A;  1WH9 A;  4MON A;  4KHP C;  2E2H I;  3S1M I;  2W04 A;  1XRB A;  3ETO A;  1KC8 2;  4E32 A;  2G2K A;  2WP0 C;  4MXU A;  3NH8 A;  2JA8 I;  2J6A A;  4BSZ A;  3B7W A;  3HOW I;  3HOV I;  4L2Z A;  2F4M A;  2UXC C;  2OPL B;  3JAM D;  3DLP X;  5BST A;  2PK7 A;  4RVN A;  2JUB A;  1Q7Y 1;  4DR3 C;  2CU6 A;  1PFT A;  1MDB A;  3QWU A;  1SIW A;  2ATW A;  2HJG A;  3GTO I;  3NPD A;  3CC4 Z;  1TH5 A;  2JR6 A;  4OXI A;  4DGL A;  1X3Z A;  2IZ4 A;  2QRE B;  1VQP Z;  2ZZN A;  4QTT A;  4MTN A;  1K8A 1;  4ZLP A;  1K9M 1;  3F3F C;  2MM9 A;  2OPL A;  2E8F A;  5E7Q A;  4DV3 C;  4GS5 A;  4DUY C;  5AE3 A;  4CL1 A;  2VQE C;  2YAD A;  2QVX X;  4LFB C;  5C4J I;  2K3R A;  1IBL C;  1N36 C;  1VQ9 Z;  3NDJ A;  3NFZ A;  1L1O C;  2JA5 I;  3KIH A;  3GCF A;  1HR0 C;  4LF7 C;  4ZJZ A;  5BSR A;  1HNW C;  1YIJ Z;  2D1Q A;  4L7I A;  4GKJ C;  1FJG C;  3PRO C;  4E2Y A;  1WJ2 A;  3OW2 Z;  2M5H A;  1MXB A;  4FTF A;  2I3C A;  3VMH A;  4KTT A;  2E7G A;  5BR8 C;  2ONF A;  2OO4 A;  3EQ6 A;  2DE7 A;  4D57 A;  3IF8 A;  1R9T I;  4JI3 C;  2M48 A;  2E0G A;  1YIT Z;  1ZH1 A;  1T5D X;  3IML A;  3NDI A;  4AQY C;  3NI2 A;  4DR5 C;  2LIY A;  3J81 f;  2ZM6 C;  4DR6 C;  1K8A 2;  5C44 I;  3N2Q A;  5BUQ A;  2LEX A;  2OTJ 1;  3AY0 A;  1RLY A;  3ETC A;  3UX3 A;  2QL8 A;  3N54 B;  4LFC C;  1V26 A;  1Z02 A;  1L2F A;  1VQ5 1;  1NP6 A;  1PG4 A;  2R7Z I;  2PN2 A;  1NUI A;  2WD9 A;  2Y4N A;  1BA3 A;  5LL6 f;  3H0G I;  2UUB C;  1QF8 A;  3G71 1;  1HH2 P;  3A25 A;  3K6R A;  2V7B A;  4PRO C;  3P5J B;  4X64 C;  2RT9 A;  3OW2 Y;  4L4Q A;  1VQK 1;  1FUG A;  1XRC A;  5A1G A;  5KEI A;  3VB9 A;  2E5L C;  1VQL Z;  1XNQ C;  3GKU A;  4YHH C;  3CQZ I;  3VNS A;  2UU9 C;  1FDO A;  4DCS A;  2RIQ A;  2P2F A;  1X0T A;  5A2Q f;  1N8R 1;  1JOS A;  2ASB A;  1WCJ A;  2QVY X;  3CC4 1;  3SO4 A;  1Q86 1;  4NOZ A;  1X3W A;  1VQP 1;  5LCI A;  4K0K C;  1N33 C;  1WW9 A;  2JIO A;  3LGX A;  2PT7 G;  3R9X A;  3J81 b;  4X65 C;  1YUA A;  3CC7 1;  2E7Z A;  3G6E Z;  4RV9 A;  3J7A 4;  4PHT A;  1Z03 A;  3GTM I;  4JI4 C;  1KKG A;  2VUG A;  3CPW Z;  5BUS A;  4NBC A;  5T8S A;  2E2I I;  2D27 A;  1Y8C A;  3PO3 S;  1MD9 A;  2Q51 A;  4HGY A;  4RVD A;  3GTJ I;  1S72 Z;  1JWH C;  2JIR A;  3HOY I;  3CCJ Z;  2OBV A;  2YX1 A;  3LNO A;  5CZV A;  2P02 A;  3VNQ A;  3CPW Y;  4E30 A;  3IPL A;  4B3S C;  1YI2 Z;  3PO2 I;  4DV0 C;  2NVY I;  1GPM A;  4LF4 C;  2O53 A;  3I56 1;  1VQ7 1;  2QW0 X;  1VQ6 1;  5BSU A;  3S14 I;  1IBK C;  3CME 1;  4DV7 C;  2CY1 A;  4ISB A;  2LFU A;  2F4O A;  3IR7 A;  2Y27 A;  3GR1 A;  1LCI A;  2WAQ A;  2KI7 B;  1YI2 1;  3M3Y I;  4WS9 A;  4D4I A;  5IT9 D;  2QR1 B;  4BBR I;  2BH1 X;  2OOX B;  3KIF A;  3S2H I;  2K5R A;  3S1N I;  4RM3 A;  1N32 C;  4LE5 A;  1M6X A;  4NB8 A;  3TUF A;  1M90 1;  3CQ2 A;  3CCQ Z;  1TWA I;  2AYA A;  4A3D I;  4RLF A;  3RG2 A;  3BG0 B;  2R92 I;  1W2B Z;  4X66 C;  1Y1V I;  2OZK A;  2JIM A;  1O9T A;  4DCT A;  1Z01 A;  4DCV A;  1O90 A;  1YJW Z;  3CCQ 1;  4HH4 A;  1O93 A;  3CW9 A;  3DAY A;  4RVO A;  4A93 I;  3CCE Z;  3I4N I;  1N34 C;  1VQN Z;  1J5E C;  2ZAE B;  5FLX b;  2H85 A;  1N2F A;  1P4E A;  1VQK Z;  4TNU A;  4NBB A;  1RO0 A;  1YJW 1;  5DV9 A;  1K83 I;  3U50 C;  2VPX A;  3CCE 1;  4B3M C;  5FLX D;  1YUK A;  5D1O B;  3J81 D;  4E2Z A;  5IP9 I;  3LNV A;  2R6M A;  2NVX I;  2QRC B;  2GTH A;  1I94 C;  1KQS Y;  5AE1 A;  3GTQ I;  5JRH A;  1SFO I;  1QYP A;  3PO3 I;  4R0M A;  1NJI 1;  1VQ8 Z;  1VQL 1;  3O2E A;  3E7W A;  2D1R A;  3CJE A;  5KYV A;  4G36 A;  3CC7 Z;  2BJO A;  1VQO Z;  1YJ9 Z;  2JNY A;  2UUC C;  3G6E 1;  3CXC Z;  2VF1 A;  3DHV A;  4B3T C;  4BCA A;  4JI6 C;  1KC8 1;  5T64 A;  4E2W A;  3T4N B;  4FUT A;  2W03 A;  4NBE A;  2R93 I;  1XRA A;  3CW8 X;  3CCR 1;  3S2D I;  3CXC Y;  4RS4 A;  2YWB A;  4A3F I;  4PUH A;  3CCM Z;  1N8R 2;  1M1K 2;  3D9X A;  3UOW A;  3EER A;  3EED A;  3NH4 A;  3CCR Z;  1P9N A;  4AYB A;  4I9G A;  4D4G A;  2D1S A;  1VQ6 Z;  3I55 Z;  1Q7Y 2;  1QVG Z;  3HOZ I;  4DR7 C;  1V60 A;  4EAT A;  4LF6 C;  3G7S A;  3IEU A;  5IT9 b;  5H9U A;  5BSM A;  5C4X I;  2JNV A;  1YJ7 A;  4MD8 A;  1NJI 2;  1PG3 A;  2Y4O A;  2HF1 A;  5AN9 F;  3IFU A;  1YIT 1;  1YJN 1;  5BSV A;  3CCS 1;  3A4I A;  1WF3 A;  3RZO I;  4HPV A;  4NBF A;  3FQQ A;  3TDE A;  4LF9 C;  4NXN C;  4BBY A;  1PA4 A;  2HU9 A;  4JI2 C;  2KPI A;  4RVF A;  1Q81 2;  5T67 A;  1YJN Z;  3GTL I;  2OTJ Z;  3E7X A;  3CCL 1;  3I08 A;  3T1Y C;  2UUA C;  4U5Y D;  2PM9 A;  4ODJ A;  3HKZ A;  2V45 A;  1VQN 1;  4BBS I;  5C3E I;  5K85 A;  1K0R A;  5A2Q D;  2D7V A;  4NFR A;  3GTK I;  2HHH C;  4NBD A;  4DG8 A;  1S7M A;  2PRO A;  2VPZ A;  4X6A I;  3CMA 1;  5A19 A;  1QVF Y;  1NY8 A;  2Q4Z A;  2V3V A;  2MMA B;  2D28 C;  4YY3 C;  1TWH I;  2P2Q A;  4IZ6 A;  3R9W A;  1VQ4 Z;  4Y52 I;  5CZX A;  3CMA Z;  3D2L A;  3S17 I;  4K0B A;  3S1R I;  1VQ4 1;  3H2T A;  2CXC A;  1VQO 1;  4DUZ C;  4DV1 C;  4I9F A;  1M6X C;  1Q82 1;  3A26 A;  4E31 A;  3NH5 A;  1Q81 1;  4BC9 A;  1XMO C;  4DR4 C;  3I4M I;  3G4S Z;  1M90 2;  1P7L A;  5IP7 I;  2JMP A;  1UWD A;  4A3M I;  3CCU 1;  3IX0 A;  2Z51 A;  4HGZ A;  3H3V J;  1Q16 A;  2P2M A;  2JS4 A;  4DV5 C;  3J80 D;  2P28 A;  1I50 I;  4B3R C;  4MRI A;  4LF8 C;  4JI0 C;  3C5E A;  5IT9 f;  4IR7 A;  1QVF Z;  1P4E C;  3FQM A;  2WB1 A;  3AF6 A;  1I6H I;  3FCE A;  5CM2 M;  1IBM C;  3LUS A;  1ZB9 A;  4A3G I;  3FCC A;  3TE5 B;  4EWC A;  1RO2 A;  1KD1 2;  3CCV Z;  3UZ0 A;  5AE2 A;  4JI7 C;  3I56 Z;  1VQ7 Z;  4JYA C;  3CCM 1;  2RHB A;  5BSW A;  2NCL A;  4FUQ A;  1AMU A;  4JI1 C;  1USP A;  3CQ3 A;  3UX2 A;  2AYD A;  4BXX I;  3CCV 1;  1MKY A;  2D1T A;  3J80 b;  4A3E I;  4TPS B;  2VQF C;  1UKK A;  3CCS Z;  3I55 1;  4A3L I;  4GXR A;  3TDH B;  4PUG A;  3K7A I;  1TFI A;  1EGA A;  1M1K 1;  5LMU C;  1MDF A;  2V8J A;  3KXW A;  3VTN A;  2NVT I;  3FKI I;  4NBG A;  4E2X A;  1AA6 A;  1K73 2;  1JJ2 Y;  4RVH A;  5T6B A;  4JI8 C;  1VEH A;  4DR2 C;  2QLV B;  5A1I A;  5LMN C;  3I07 A;  1QWI A;  3A9U A;  1Y1V S;  2B63 I;  1ZB8 A;  2KZ0 A;  3S15 I;  3IEV A;  1LQL A;  2P20 A;  2JA6 I;  1YHQ Z;  2RPR A;  5D1P A;  1QM4 A;  1XHJ A;  4MD9 A;  1JJ2 Z;  1MXC A;  3CQ1 A;  3CD6 Z;  4DK1 A;  3CCL Z;  2YU9 I;  1FLO A;  2JIQ A;  1KD1 1;  3PES A;  3TR3 A;  1DL6 A;  1YHQ 1;  1WZN A;  1HNX C;  4DQY B;  2OTL 1;  1KRL A;  2E2J I;  3CD6 1;  1IB8 A;  2V8I A;  4E33 A;  2NVQ I;  3S16 I;  4A3K I;  5GTD A;  5IFI A;  3F3P C;  3OTO C;  2KDN A;  2UXD C;  4RLQ A;  1O92 A;  4D56 A;  3J80 f;  2EGT A;  2Y0S A;  3RZD I;  4NDN A;  3BG1 B;  3VMI A;  1YIJ 1;  4S1T A;  3AF5 A;  2M5O A;  4JI5 C;  4BY1 I;  1TWG I;  1VQ8 1;  2DPL A;  4NBA A;  3HOX I;  2P2J A;  3G4S 1;  1W2B Y;  4OX9 C;  4QTU A;  1K73 1;  1YJ9 1;  2P3Y A;  3LAX A;  4JM1 A;  4OYC A;  3UEB A;  4MH4 A;  1I3Q I;  2JMO A;  2VSQ A;  1RQF A;  4LFA C;  2AKL A;  1ULT A;  2DHM A;  4DCU A;  3GR0 A;  2RBL A;  4RVG A;  2QA4 Z;  3A9V A;  4Y7N I;  4DV2 C;  3MON A;  2VPW A;  4G37 A;  2E8C A;  2E8E A;  3S82 A;  3TQI A;  3G71 Z;  2VUM I;  1T5H X;  1XNR C;  3PBK A;  2QKD A;  5D1O A;  3GKQ A;  3L95 X;  2VPY A;  4BY7 I;  2KZF A;  1WCM I;  1PU1 A;  1K9M 2;  2MCQ A;  2O4H A;  1V25 A;  4PZP A;  5K8F A;  5FLM I;  3M4O I;  2NAP A;  2DE5 A;  1VQM 1;  2E9H A;  4BC7 A;  4NB9 A;  2JA7 I;  4DR1 C;  2GU2 A;  1Q82 2;  4RM2 A; 
#chains in the Genus database with same CATH homology
 1KQS Z;  2QVZ X;  1VQM Z;  4R1L A;  4A3C I;  5T8T A;  1RNI A;  1WII A;  1HNZ C;  2XR1 A;  3GTM S;  4KTV A;  4G1I A;  2P2B A;  3CC2 Z;  2DE6 A;  4R1M A;  1VQ9 1;  2PMZ A;  1Y1W I;  1VLA A;  4DG9 A;  1QVG Y;  4A3J I;  2QRD B;  2OOY B;  5BUR A;  3CC2 1;  3JAM f;  3GTP I;  3GTG I;  3L8C A;  1RO4 A;  4WV3 A;  1S72 1;  4XX2 A;  2QEX 1;  4GKK C;  3ESW A;  2V8K A;  3CCJ 1;  1ML8 A;  1NYE A;  3MZK B;  4DV6 C;  3MZL B;  2QEX Z;  5IWA C;  4MD7 A;  1XMQ C;  1USP B;  2OTL Z;  4JV5 C;  3CME Z;  3VMG A;  1RG9 A;  4A3B I;  1MXA A;  3NYR A;  2DYJ A;  2YCB A;  4NXM C;  2IZ3 A;  4NH1 C;  5KYT A;  3VNR A;  4A3I I;  3NYQ A;  5FLX f;  3GPC A;  3D6W A;  3CCU Z;  5ADZ A;  2YWC A;  1Q86 2;  3HOU I;  4RMN A;  4GXQ A;  3RV2 A;  2QA4 1;  2UXB C;  2GTI A;  3T1H C;  4DV4 C;  4X62 C;  2F4V C;  3JAM b;  4NBH A;  2M6N A;  5A2Q b;  2VZE A;  1RY2 A;  4LF5 C;  1VQ5 Z;  1TWC I;  3S1Q I;  3Q87 A;  1TWF I;  3R44 A;  1WH9 A;  4MON A;  4KHP C;  2E2H I;  3S1M I;  2W04 A;  1XRB A;  3ETO A;  1KC8 2;  4E32 A;  2G2K A;  2WP0 C;  4MXU A;  3NH8 A;  2JA8 I;  2J6A A;  4BSZ A;  3B7W A;  3HOW I;  3HOV I;  4L2Z A;  2F4M A;  2UXC C;  2OPL B;  3JAM D;  3DLP X;  5BST A;  2PK7 A;  4RVN A;  2JUB A;  1Q7Y 1;  4DR3 C;  1PFT A;  1MDB A;  3QWU A;  2ATW A;  2HJG A;  3GTO I;  3NPD A;  3CC4 Z;  2JR6 A;  4OXI A;  4DGL A;  1X3Z A;  2IZ4 A;  2QRE B;  1VQP Z;  4QTT A;  4MTN A;  1K8A 1;  4ZLP A;  1K9M 1;  3F3F C;  2OPL A;  5E7Q A;  2E8F A;  4DV3 C;  4GS5 A;  4DUY C;  5AE3 A;  4CL1 A;  2VQE C;  2YAD A;  2QVX X;  4LFB C;  5C4J I;  2K3R A;  1IBL C;  1N36 C;  1VQ9 Z;  3NDJ A;  3NFZ A;  1L1O C;  2JA5 I;  3KIH A;  3GCF A;  1HR0 C;  4LF7 C;  4ZJZ A;  5BSR A;  1HNW C;  1YIJ Z;  2D1Q A;  4L7I A;  4GKJ C;  1FJG C;  3PRO C;  4E2Y A;  3OW2 Z;  1MXB A;  4FTF A;  2I3C A;  3VMH A;  4KTT A;  2E7G A;  5BR8 C;  2ONF A;  2OO4 A;  3EQ6 A;  2DE7 A;  4D57 A;  3IF8 A;  1R9T I;  4JI3 C;  2M48 A;  2E0G A;  1YIT Z;  1ZH1 A;  1T5D X;  3IML A;  3NDI A;  4AQY C;  3NI2 A;  4DR5 C;  2LIY A;  3J81 f;  2ZM6 C;  4DR6 C;  1K8A 2;  5C44 I;  3N2Q A;  5BUQ A;  2OTJ 1;  1RLY A;  3ETC A;  4LFC C;  2QL8 A;  3N54 B;  1V26 A;  1Z02 A;  1L2F A;  1VQ5 1;  1NP6 A;  1PG4 A;  2R7Z I;  2PN2 A;  1NUI A;  2WD9 A;  2Y4N A;  1BA3 A;  5LL6 f;  3H0G I;  2UUB C;  1QF8 A;  3G71 1;  1HH2 P;  2V7B A;  4PRO C;  3P5J B;  4X64 C;  2RT9 A;  3OW2 Y;  4L4Q A;  1VQK 1;  1FUG A;  1XRC A;  5A1G A;  5KEI A;  3VB9 A;  2E5L C;  1VQL Z;  3GKU A;  4YHH C;  3CQZ I;  3VNS A;  2UU9 C;  4DCS A;  2RIQ A;  2P2F A;  1X0T A;  5A2Q f;  1N8R 1;  1JOS A;  2ASB A;  2QVY X;  3CC4 1;  3SO4 A;  1Q86 1;  4NOZ A;  1X3W A;  1VQP 1;  4K0K C;  1N33 C;  1WW9 A;  3R9X A;  3LGX A;  2PT7 G;  3J81 b;  4X65 C;  1YUA A;  3CC7 1;  3G6E Z;  4RV9 A;  3J7A 4;  4PHT A;  1Z03 A;  3GTM I;  4JI4 C;  1KKG A;  2VUG A;  3CPW Z;  5BUS A;  4NBC A;  5T8S A;  2E2I I;  2D27 A;  3PO3 S;  1MD9 A;  2Q51 A;  4HGY A;  4RVD A;  3GTJ I;  1S72 Z;  1JWH C;  3HOY I;  3CCJ Z;  2OBV A;  5CZV A;  2P02 A;  3VNQ A;  3CPW Y;  4E30 A;  3IPL A;  4B3S C;  1YI2 Z;  3PO2 I;  4DV0 C;  2NVY I;  1GPM A;  4LF4 C;  2O53 A;  3I56 1;  1VQ7 1;  2QW0 X;  1VQ6 1;  5BSU A;  3S14 I;  1IBK C;  3CME 1;  4DV7 C;  2CY1 A;  4ISB A;  2LFU A;  2F4O A;  3GR1 A;  2Y27 A;  1LCI A;  2WAQ A;  2KI7 B;  1YI2 1;  3M3Y I;  4WS9 A;  4D4I A;  5IT9 D;  2QR1 B;  4BBR I;  2BH1 X;  2OOX B;  3KIF A;  3S2H I;  2K5R A;  3S1N I;  4RM3 A;  1N32 C;  4LE5 A;  4NB8 A;  3TUF A;  1M90 1;  3CCQ Z;  1TWA I;  2AYA A;  4A3D I;  4RLF A;  3RG2 A;  3BG0 B;  2R92 I;  1W2B Z;  4X66 C;  1Y1V I;  2OZK A;  1O9T A;  4DCT A;  1Z01 A;  4DCV A;  1O90 A;  1YJW Z;  3CCQ 1;  4HH4 A;  1O93 A;  3CW9 A;  3DAY A;  4RVO A;  4A93 I;  3CCE Z;  3I4N I;  1N34 C;  1VQN Z;  1J5E C;  2ZAE B;  5FLX b;  2H85 A;  1N2F A;  1VQK Z;  4TNU A;  1YJW 1;  4NBB A;  1RO0 A;  5DV9 A;  1K83 I;  3U50 C;  3CCE 1;  4B3M C;  5FLX D;  1YUK A;  5D1O B;  3J81 D;  4E2Z A;  5IP9 I;  3LNV A;  2R6M A;  2NVX I;  2QRC B;  2GTH A;  1I94 C;  1KQS Y;  5AE1 A;  3GTQ I;  5JRH A;  1SFO I;  1QYP A;  3PO3 I;  4R0M A;  1NJI 1;  1VQ8 Z;  1VQL 1;  3E7W A;  2D1R A;  3CJE A;  5KYV A;  4G36 A;  3CC7 Z;  2BJO A;  1VQO Z;  1YJ9 Z;  2JNY A;  2UUC C;  3G6E 1;  3CXC Z;  2VF1 A;  3DHV A;  4B3T C;  4BCA A;  4JI6 C;  1KC8 1;  5T64 A;  4E2W A;  3T4N B;  4FUT A;  2W03 A;  4NBE A;  2R93 I;  1XRA A;  3CW8 X;  3CCR 1;  3S2D I;  3CXC Y;  4RS4 A;  2YWB A;  4A3F I;  3CCM Z;  1N8R 2;  1M1K 2;  3D9X A;  3UOW A;  3EER A;  3EED A;  3NH4 A;  3CCR Z;  1P9N A;  4AYB A;  4I9G A;  4D4G A;  2D1S A;  1VQ6 Z;  3I55 Z;  1Q7Y 2;  1QVG Z;  3HOZ I;  4DR7 C;  4EAT A;  4LF6 C;  3G7S A;  3IEU A;  5IT9 b;  5H9U A;  5BSM A;  5C4X I;  1YJ7 A;  4MD8 A;  1NJI 2;  1PG3 A;  2Y4O A;  2HF1 A;  5AN9 F;  3IFU A;  1YIT 1;  1YJN 1;  5BSV A;  3CCS 1;  3A4I A;  1WF3 A;  3RZO I;  4HPV A;  4NBF A;  3FQQ A;  3TDE A;  4LF9 C;  4NXN C;  4BBY A;  1PA4 A;  2HU9 A;  4JI2 C;  1Q81 2;  2KPI A;  4RVF A;  5T67 A;  1YJN Z;  3GTL I;  2OTJ Z;  3E7X A;  3CCL 1;  3I08 A;  3T1Y C;  2UUA C;  4U5Y D;  2PM9 A;  4ODJ A;  3HKZ A;  1VQN 1;  4BBS I;  5C3E I;  5K85 A;  1K0R A;  5A2Q D;  2D7V A;  4NFR A;  3GTK I;  2HHH C;  4NBD A;  4DG8 A;  1S7M A;  2PRO A;  4X6A I;  3CMA 1;  5A19 A;  1QVF Y;  2Q4Z A;  2D28 C;  4YY3 C;  1TWH I;  2P2Q A;  4IZ6 A;  3R9W A;  1VQ4 Z;  4Y52 I;  5CZX A;  3CMA Z;  3S17 I;  4K0B A;  3S1R I;  1VQ4 1;  3H2T A;  2CXC A;  1VQO 1;  4DUZ C;  4DV1 C;  4I9F A;  1Q82 1;  4BC9 A;  4E31 A;  3NH5 A;  1Q81 1;  1XMO C;  4DR4 C;  3I4M I;  3G4S Z;  1M90 2;  1P7L A;  5IP7 I;  2JMP A;  4A3M I;  3CCU 1;  3IX0 A;  4HGZ A;  3H3V J;  2P2M A;  2JS4 A;  4DV5 C;  3J80 D;  2P28 A;  1I50 I;  4B3R C;  4MRI A;  4LF8 C;  4JI0 C;  3C5E A;  5IT9 f;  4IR7 A;  1QVF Z;  3FQM A;  2WB1 A;  3AF6 A;  1I6H I;  3FCE A;  5CM2 M;  1IBM C;  3LUS A;  1ZB9 A;  4A3G I;  3FCC A;  3TE5 B;  4EWC A;  1RO2 A;  1KD1 2;  3CCV Z;  3UZ0 A;  5AE2 A;  4JI7 C;  3I56 Z;  1VQ7 Z;  4JYA C;  3CCM 1;  2RHB A;  5BSW A;  1AMU A;  4FUQ A;  4JI1 C;  1USP A;  4BXX I;  3CCV 1;  1MKY A;  2D1T A;  3J80 b;  4A3E I;  4TPS B;  2VQF C;  1UKK A;  3CCS Z;  3I55 1;  4A3L I;  4GXR A;  3TDH B;  3K7A I;  1TFI A;  1EGA A;  1M1K 1;  5LMU C;  1MDF A;  2V8J A;  3KXW A;  3VTN A;  2NVT I;  3FKI I;  4NBG A;  4E2X A;  1K73 2;  4JI8 C;  1JJ2 Y;  4RVH A;  5T6B A;  4DR2 C;  2QLV B;  5A1I A;  5LMN C;  3I07 A;  1QWI A;  3A9U A;  1Y1V S;  2B63 I;  1ZB8 A;  3S15 I;  3IEV A;  1LQL A;  2P20 A;  2JA6 I;  1YHQ Z;  2RPR A;  5D1P A;  1QM4 A;  4MD9 A;  1JJ2 Z;  1MXC A;  3CD6 Z;  4DK1 A;  3CCL Z;  2YU9 I;  1KD1 1;  3PES A;  1DL6 A;  1YHQ 1;  1HNX C;  4DQY B;  2OTL 1;  1KRL A;  2E2J I;  3CD6 1;  5IFI A;  2V8I A;  4E33 A;  2NVQ I;  3S16 I;  4A3K I;  5GTD A;  1XNQ C;  3F3P C;  3OTO C;  2UXD C;  4RLQ A;  1O92 A;  4D56 A;  3J80 f;  2EGT A;  2Y0S A;  3RZD I;  4NDN A;  3BG1 B;  3VMI A;  1YIJ 1;  4S1T A;  3AF5 A;  4JI5 C;  4BY1 I;  1TWG I;  1VQ8 1;  2DPL A;  4NBA A;  3HOX I;  2P2J A;  3G4S 1;  1W2B Y;  4OX9 C;  4QTU A;  1K73 1;  1YJ9 1;  2P3Y A;  3LAX A;  4JM1 A;  4OYC A;  4MH4 A;  1I3Q I;  2JMO A;  2VSQ A;  1RQF A;  4LFA C;  2AKL A;  1ULT A;  4DCU A;  3GR0 A;  2RBL A;  4RVG A;  2QA4 Z;  3A9V A;  4Y7N I;  4DV2 C;  3MON A;  4G37 A;  2E8C A;  2E8E A;  3S82 A;  3TQI A;  3G71 Z;  2VUM I;  1T5H X;  1XNR C;  3PBK A;  2QKD A;  5D1O A;  3GKQ A;  3L95 X;  4BY7 I;  2KZF A;  1WCM I;  1K9M 2;  2O4H A;  1V25 A;  4PZP A;  5K8F A;  5FLM I;  3M4O I;  4DR1 C;  2DE5 A;  1VQM 1;  2E9H A;  4BC7 A;  4NB9 A;  2JA7 I;  2GU2 A;  1Q82 2;  4RM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...