3R9XA

Crystal structure of era in complex with mggdpnp, nucleotides 1506-1542 of 16s ribosomal rna, and ksga
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
302
structure length
302
Chain Sequence
b'HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase Era
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/transferase/rna
total genus 102
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3r9xA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9xA01
3CF2A 2C9YA 3CPHA 1YZLA 5DI3B 1P73A 2H8KA 4UQOA 3FMOB 3BJIC 2F4VC 4V0MA 3U7HB 2FE4A 4FW9A 5KNBA 1U94A 3W9YA 3CIOA 2NO0A 2WWGA 5DI9A 1CJVC 1SXJA 1XNRC 1P75A 1U8YA 4ZDKA 1E2MA 3G0HA 1T3HA 2N46A 1ZNWA 2VHUA 2ZXUA 4MYUA 3B9PA 2QQ0A 1PJRA 1XJQA 1CRPA 4PZYA 1J90A 2R6DA 2G6BA 1N5KA 2D06A 3W8NA 4ABYA 4DBLC 4PPFA 4C4PA 2QTHA 3J80D 3F8TA 5KDDA 3P27A 2OZEA 4IEIA 2ZIAA 3T15A 5BR8C 2VL7A 3LA6A 4IDOA 4Z51A 2PCJA 4R9UC 2O8FB 4I4LA 1D8TA 1YR9A 4WW0A 1T4GA 1YHNA 3KXIA 2QTFA 3CB4A 4Q4HA 3O8DA 2DFLA 1X86B 2EFDB 3EERA 2ECKA 3HR7A 2GBLA 2YOHA 3IHLA 4HI0E 4NCJA 1OFHA 1OJLA 3GLHE 3QEOA 3T1TA 2QMUA 1KMHB 3ZDQA 5FBVB 1R0WA 1MV5A 4LBZA 721PA 2YINC 1KNQA 4JYCA 4DV7C 1RZ3A 4DC9A 4OI1A 2NQ2C 1G7RA 1W4CA 3QOFA 1CS4C 3AF3A 4R71A 4WZAE 3THYA 1NP6A 2N42A 1II8A 1QHSA 1RIFA 3KB2A 2DWQA 2QAGA 2BC9A 2ZJ5A 1KDPA 2BOVA 4Q7LA 2A5FA 2HV8A 1E0KA 2ATWA 3CX6A 5G53C 5KPDA 3GLGB 2O8CB 1CIPA 2MMGA 5FFMA 3NG1A 1HURA 2F7SA 5FPYA 1N2FA 1T91A 3E5HA 1G5PA 3JZAA 4XTCS 1N6LA 4KFTA 1XPOA 1OV4A 1AQYA 5FI1B 4QNRA 4A0FA 4FCTA 1OB5A 5G3ZA 1FMJA 4GKJC 4PZZA 3MCAA 4LC1A 3OZXA 4ZIRB 4M53A 1BIFA 4YDSA 4C2UA 3D3QA 3DVLA 3P26A 4UXJA 2YVUA 4CIDA 2W83A 4NBSA 4DDUA 5DYGA 4DUGD 1ZIPA 4KBGA 1G3QA 4DLXA 4F91B 3EWSA 2FMXA 3TR5A 3FKSA 1TUIA 2HCJB 1GRRA 3BRWD 3D8BA 3GQBA 3KJIA 4TL9A 3AP3A 1YE8A 4A15A 4MH4A 1WBBA 3F5FA 1WH9A 2AFHE 4Y0VA 1A4RA 3EXAA 4YQFA 2GXSA 5TY0A 2QENA 4Q9KA 4A4DA 3CONA 4MRRA 1DS6A 3SN6A 2R65A 4DDTA 1RRCA 2GAOA 4RZ3A 1Q22A 1G6HA 1IN5A 3P4YA 4B2LA 2GF0A 5JEEA 2ZS7A 1LS1A 4Q1EA 3SI7A 5LB4A 4D82A 3BORA 3C8UA 4PC7A 3TVTA 1NMZA 1I4TD 1K6MA 3G5UA 4M21A 2WWYA 4QGHA 1XMQC 1X3SA 3B13B 6Q21A 1UDWA 1G16A 4CEIB 4D81A 5JCPA 4OBEA 1LS6A 4UJ5A 4JZKA 4O2RA 2X8AA 2ZR0A 5FBRB 4DCVA 1Z2AA 5G40A 4HZUA 5KNCA 2H57A 1OLOA 2V8OA 4PTLA 3X1DA 2GAAA 2OFXA 4NTZA 2LCFA 2VHQA 3THOA 5HKKA 4JT2A 5CIWA 4CW7A 3I32A 3AVXA 4QFMA 1VCOA 1Z83A 4EAQA 3GLGE 1UPTA 1X6VA 1W0JD 3KJHA 3A4NA 3LX5A 3NHAA 3QXXA 2ZRLA 5EE0A 1G8HA 2ORVA 1CR1A 1F2UA 2WPDD 1OFUX 2C96A 2HYIC 4DCTA 4TT3A 2QM7A 1YQTA 2G83A 4TTRA 2NO6A 4V0KA 1FP7A 3TNFA 1ZP6A 2NO1A 1R5OA 2CE7A 3DHWC 3FHOA 3TH5A 2DWPA 4LGMA 3X1WA 3TGPA 2UUAC 3K1JA 2V9PA 1XFAA 1AM4D 4M1YA 2JLZA 5DIFA 4WAUA 5FOSA 1OIWA 4L9SA 2RB4A 4MKFA 1F5NA 4UKDA 2WZQA 4B43A 1A2BA 4GRAA 5BYJA 4A2WA 4XWAA 3AVOA 3WBJA 5CLQA 4FI3C 3TW4A 5BXQC 2BM1A 1SKQA 1FZQA 5FUXA 3ADBA 1GKIA 4V0LA 3U3KA 4ZO4A 4PPGA 1E3MA 4UNNA 1T5LA 5D3QA 3B7GA 3RAPR 2UZ3A 1G20E 2V1XA 2GCNA 4N3NA 1LQLA 3ICQB 2GDJA 5KTYA 2YOGA 4LBVA 1TEVA 3ZVMA 2B7BA 1HT2E 2QSYA 2QP4A 1NVWQ 1ONBA 3U6BA 2R6GA 2ZI7A 4I81A 1T0HB 3AVWA 3B78A 3TR0A 1CF4A 2LKDA 4V0NA 2IYVA 4LJ4A 3NBYC 4OHZA 5EJEA 1SVLA 2VBCA 3GLFA 4HUQA 3OEEA 3T35A 3D31A 2WSSD 3CR8A 2C95A 4BUJA 2C99A 4Q21A 3W5JA 4JLDA 3H2YA 4B3FX 4LYAA 4GPTA 4BPBA 4LF8C 2HHHC 1S96A 2IYUA 2ZE7A 4PANA 1GSIA 1R4AA 3GLIB 4BGDA 3EZ2A 3U3OA 1IXRC 2J59A 2XJ9A 3HU1A 1Y63A 3EPJA 1HH2P 1D2MA 2IXFA 1XBTA 1UEJA 2KBEA 5AUNB 3J81D 3P4XA 4WA7A 3UPUA 4GMDA 4XD7A 4L9WA 2JCSA 3AF4A 2BBTA 1HA3A 1AA9A 5KUTA 4MUBA 4PAOA 3T06B 4G3XA 1G41A 1FTNA 1KK0A 4TZ6A 2CDNA 2E8CA 2QPTA 4P31A 4OHXA 1TQ4A 1KDTA 2JIZA 3UMSA 5EUMA 1MT0A 1Z07A 2GEDA 2LKCA 4ACBA 5BN4A 3CNOA 4QGGA 4YMWA 4O2LA 3VR3A 4Q1DA 3VAAA 1E2PA 1KSJA 4NXNC 2ASEA 4OX9C 2WMOB 3O8BA 4JI6C 1S0UA 3DL0A 3PV0A 2W2TA 1Z0FA 2AWNA 5EP2A 2IWRA 3SNHA 4NCNA 1OF1A 1YR6A 2Z4SA 5KYKA 2JGNA 1OH5A 1L4YA 1E99A 1ZD1A 1BO6A 1XXHB 2AKAB 3A4LA 2GXAA 3MWLA 4TLBA 1IBLC 2QRZA 1NBME 1UKZA 1MO5A 1YZNA 2QROA 3REFA 4LK2A 5LDDC 2VRWA 3LQQA 1TNDA 3ZS9A 2J0UA 1J7KA 1HQYE 4WIAA 4CEHA 4A0RA 3TMKA 3NEJA 1VIYA 1C9KA 4HLUC 3ZVRA 1CJKC 2GETA 1U0JA 5EZ5A 1N2CE 3ND9A 4JBXA 4FXPA 3IPXA 5B58C 621PA 2PMDA 2GTPA 2EU8A 1KZGB 2B21A 1SVIA 4PR0A 1QZXA 1OXSC 1DADA 1S9DA 2WM9B 1FNMA 4HLUA 2A5JA 4ZKDA 3ZD6A 4LYFA 2GVDC 1JR6A 4ZDJA 3CM0A 2R8RA 3CJEA 1DAGA 2VO1A 2C8VA 2ZRFA 2FFQA 4QXAA 1VTKA 3GLIE 4KFSA 3I4LA 1MH1A 2IYRA 2VP4A 1CJTC 1U9IC 1O3YA 4NYIQ 1AIPA 4P33A 2J5XA 3SHWA 3GP8A 4LPSA 3LXRA 4NYIR 1NN1A 3LW7A 5FUYA 4YDHB 3SBDA 1N6NA 2O5VA 4QRHA 4G5GA 1QWIA 1ZRHA 3BERA 1SHZA 3RYTC 1GKUB 4MRSA 5EP4A 1L8QA 4OI4A 1R8QA 5BN3A 2O8DA 3DDCA 4A1FA 4XSGA 1N6OA 2WWHA 3AGPA 2FZLA 2IL1A 4P4UA 2KZFA 2VQSA 5HZKA 1Z22A 4RKEA 2JLRA 5TMPA 4DLTA 1RE0A 1T3SA 1JR3D 2BCJQ 1NNEA 3TKLA 2F55A 3W5IA 4BEJA 1E96A 3CW2A 3QSYA 4C2TA 3OEHD 4G0NA 3R7WB 4RFVA 3UG6A 2WKQA 5CYOA 3X1YA 5GVSA 1IY0A 4FN5A 5EXTA 3ZVNA 3T5DA 1WBDA 1MABB 2UXCC 3QXHA 1GOTA 4BLOA 5LMNC 2F1RA 1XXHE 4MRPA 4B73A 1X8JA 4EDHA 5TB5A 1LTQA 3LV8A 2CVFA 3NKVA 4MDEA 1XCGB 4PQRA 4CEJA 1FNNA 2XB2A 4Z8XA 4MGIR 1IN8A 3KDSE 2P6NA 1ZNZA 4ZDIA 4MYCA 5D3MA 2Z43A 3GJ8A 4JIMA 2XR1A 2REBA 4Z54A 3ZS8A 4B3TC 3TUIC 4DUGA 4Q4JB 1XEFA 3QKRA 4IHQA 2E1RA 3IEUA 3MSXA 3K0CC 4C0JA 4DRZA 1CKEA 2CL6X 2H5EA 4KODA 1PLKA 4KCGA 2P3SA 2Q9AA 1OKKD 3LAWA 1VMAA 4Q9HA 4XX2A 1Z28A 1VKJA 3KXLA 1I4LD 4TQUS 2P5TB 5EE5B 5C4GB 2H92A 4JBWA 3K0CA 3T1HC 1KI6B 4TMKA 3X2SA 5JI3E 1KI3A 2KSQA 1ZB8A 2ZSAA 3UK6A 2YHSA 3X1ZA 1R0XA 2O0HA 2C9CA 3W90A 1CLUA 3GMTA 1HE1C 1KZ7B 4IKEA 1N6HA 1NF3A 3QKSB 3I07A 2GEVA 4L5BA 1KI7A 2GEUA 3SJCA 3ZZTA 2V6IA 3OE7D 4Q18A 3U6KA 3ZD7A 3SBEA 3I1FA 3DKVA 2FSFA 3THWA 4OJQA 3P1JA 4DLWA 1U8AA 2PLRA 3ZGXA 1M7HA 1OIXA 3RS7A 1YZTA 3Q72A 4HDQB 4MTNA 1M1YE 1IBMC 2WJYA 4L16A 4HZIA 2BM0A 3SQXA 2VSFA 1ZUHA 1G8FA 1DPFA 2PX3A 2JA1A 3IO3A 1VDZA 2CL7X 2EWWA 4KLNA 3K8YA 4GP6A 4PHHA 4EJSB 1ZB9A 2XOKD 1WCV1 1XEXB 1W0JA 3IQXA 3RVBA 4DLUA 2RHMA 3PIRA 2O8BB 5AJVB 3VR4A 2WPDA 1I2MA 2YYZA 3T1QA 1HT1E 5KNDA 5A4JA 2XAUA 5LB2A 2OHFA 2ZRGA 4LF5C 3FFAA 3DM9B 4URVR 1EFCA 1W36D 1HQCA 2DR3A 5CDFE 2G1JA 4JI3C 2WBLC 3CRQA 4DJTA 2Z5FA 4DSNA 1XMVA 4PQFA 1G8YA 1HV8A 2WMNB 4DIEA 3O8CA 2JEOA 2OLKA 4LFAC 3R9IA 1JEEA 2Q3MA 2DBYA 5FR2A 3H84A 3BFVA 2IHBA 4YMSA 4Q48A 2AL7A 5G41A 3IGFA 4RVCA 4B35A 1KY2A 3C15C 1E2LA 4IEEA 5CB6A 4WBSA 1W5TA 1XD9A 1WQ1R 3IBGA 4KFUA 5HE9A 4AC9A 1X8LA 4ASUA 1GNPA 1IQPA 1KMQA 2G1KA 1ZYUA 1P6XA 2WJHA 2YNMA 1NMYA 2QNRA 3SEAA 4BFVA 1HYQA 3Q7PA 3OIUA 4URXR 5K8TA 4JI1C 4AQYC 1NN0A 3QIAA 3V4RA 4Q19A 2ZJ8A 2BJOA 2PEZA 2AN9A 1FFHA 4TL6A 1E0JA 2ANBA 1P3JA 4M1OA 5CLLA 2VSXA 3GJ6A 2W0MA 3NXSA 4GBMA 2CLSA 4BLPA 2IX3A 3PUZA 4PHGA 1Z06A 3AH8A 2EGTA 3LWNA 1F3OA 1N5LA 2DHRA 2H7VA 4PZLA 1GL7A 5DISB 4EPWA 3FPAA 1EG7A 4RFSA 3SS8A 3CKLA 4B3MC 3BH0A 2A30A 2Q3FA 4EPVA 3H0KA 1Q1ZA 2IF0A 2E8EA 4YHHC 4DIDA 1FUKA 4JV5C 4AK9A 4ESVA 2RGAA 4JLNA 4D6PA 1XTJA 3B8HA 1YR7A 3OAAD 4RD4A 3QPVA 5E7IA 3RS3A 2ODBA 5FPSA 1W2GA 2GK7A 4IDHA 4NZYA 4CT5A 1MO6A 2ZM5A 3FFBA 1E69A 2VLIA 3T1YC 1QVRA 4PXAA 3B85A 2OE2A 2RGCA 4B76A 4NH0A 4DLRA 3HR8A 4MKIA 4BLQA 3K70C 3U5ZB 4DUZC 4ERNA 1Z08A 2A5GA 4Q1AA 5AJXA 4PO8A 2GNOA 4LF4C 2TMKA 1UKEA 5GADl 3D7MA 2ZRDA 4NCIA 1CU1A 1ZNYA 4LSGA 1USPB 2ONJA 2FU5C 1SGWA 3CRMA 1KK1A 4X8MA 1M2OB 4V0ME 1XD2A 2F43B 4G01B 1HNWC 4EFMA 1G7SA 4X8LA 2GCOB 5EXXA 4B2PA 2HT6A 2CLCX 121PA 4DHEA 5JWRA 2J9RA 1JI0A 1X8KA 4M9ZA 4M9QA 1YR8A 4D4MA 2FFHA 2ZU0C 1F6BA 1G5RA 4M0LA 1HUQA 4O0MA 1DG3A 3ONWA 5A0FA 5KPJA 2IW3A 4FMCB 3CWZA 4S2EA 4LJ7A 3PJRA 2YWGA 2GJ9A 1KO1A 3BB4A 3FHCB 3ZVLA 2OAP1 1EESA 2GJKA 1SQ5A 2MSCB 3QI2A 4GKKC 3BK7A 2UVQA 3MGCA 4PHFA 4BFXA 1P2UA 2BDTA 2F9LA 4Q7KA 1PUIA 2ZUBA 1ZW6A 3QPUA 1GAJA 3RRNA 4B6EA 4BZQA 2FX3A 5HCIA 1FMLA 2FPMA 5HTKA 4EPRA 3LBNA 5IF9A 1TQDA 4KVAA 5DGXA 2CLDX 1LW7A 1E2FA 3THXA 2BEKA 4Q7JB 1P4SA 4IDQA 3PXGA 4CGZA 1COWD 1FX0A 2E87A 4I1UA 1NSTA 4POAA 4Q00A 1BOFA 3MRSA 1RRGA 1K5DA 4JLKA 2KE5A 3RS4A 4RJLA 4D0NA 2OXCA 2IF2A 4HB2A 5IK2D 1WA5A 4BRUA 2ZS8A 3HYRA 2DFKB 3B82A 4DR6C 1SXJC 4A8JA 4IVRA 3BFKA 5FOTA 4PFSA 3U61B 3FKQA 1XJCA 4AD8A 2BVNA 1P9NA 3TQCA 1WB9A 1R6BX 3ADKA 3IKJA 3MG9A 1JR3A 3RSOA 3I8SA 4UJ3A 1AZSC 1JEDA 3A1VA 2GJSA 2E5LC 4W5WA 1N0WA 4GP7A 1E0SA 3OEHA 1AKYA 3KL4A 3LO5A 4D80A 1AQUA 1W0KD 4Q1FA 2HXSA 2V55B 4U5XA 2HT1A 2XITA 3LLUA 3U3RA 3RABA 4M1KA 2DYKA 3K9LA 2OG2A 3Q5DA 2EFEB 2A5DA 4JT4A 5FL3A 1UKKA 3EARA 4EPTA 3DM5A 2ZM6C 4B3DA 3QY0A 1GG2A 3RSLA 2QSZA 4YLGA 3QQ5A 2V6JA 2GBLC 5J40A 5FTLA 5K8LA 4LOAA 1V43A 3U7FB 3K0FB 1N36C 4W7SA 4C0HA 2IA5A 4U7DA 2V1UA 1CR0A 3Q85A 4GFDA 4IXNA 4URYR 2QP9X 2GRJA 4IXMA 3M4YA 4XSHA 1G18A 2CJWA 2JJ2A 4C7OA 1A2KC 1Z6TA 1OKKA 2QM8A 1XMSA 1U90A 5JI2E 4JI0C 3C16C 5AJZA 3QF4B 4JL6A 4OYHA 4DWJA 2PN2A 1RVDA 1DTSA 3GFPA 4PO9A 4HEJA 2QAGC 2XZPA 2NIPA 2Z0MA 1GRQA 2BBOA 8OHMA 1XPUA 1XRJA 2L0XA 2QAJA 1LFDB 2FH5B 1E2NA 3KZ1E 4V0OA 1NKSA 4Q1BA 4R98A 1RRPA 2ZSEA 1U8ZA 2QE7D 1NLZA 2FGJA 1GM5A 2QQEA 4DT1B 1IXSB 4KXFB 3OIYA 2EFHB 3GLFB 4A9AA 2ONFA 1Z47A 5DH9A 4E22A 2CHVA 1RJ9A 1UBEA 1KNXA 2J0QA 4B3BA 2H16A 2QA5A 4TYNA 4BFTA 1JXOA 4B75A 1G7TA 2ZRMA 3AF6A 1ESNA 1W4AA 3VR2A 1P5ZB 3K0AB 2IS4A 2J7PD 4IFEA 2HYDA 3KUCA 4ZCMA 4DSTA 2WWFA 4K46A 1AS3A 1NBMD 5K8UA 2XXAB 4JSTA 4A82A 2A3RA 2XOKA 4U00A 4O25A 4LJ6A 3QXSA 3CRRA 4KSBA 3PFIA 1R0ZA 3DOEA 1FQJA 1PVOA 4C0AC 1Z0IA 1E9SA 3FWYA 4AG6A 2DCUA 2QBYB 3SR0A 5E4FA 2R9VA 2XB4A 3EZ6A 3MLEA 521PA 1ZM4A 4M1WA 1VG1A 2ZI9A 1N33C 4DDWA 2WSMA 1XZQA 4D25A 1CEEA 4IDNA 1G3IA 4RD2A 2GKSA 2G0TA 2CL0X 2ZU6A 2ONKA 3I92A 4TYQA 4OHYA 4ARZA 5F9FA 3LRPA 1A5TA 1L4UA 1G3MA 1G19A 4TLEA 1Z0DA 4W5HA 3EAQA 3LLMA 3VU9B 4ACAA 1W4BA 3TK1A 1MKYA 1A7JA 2J1LA 4MDFA 1E98A 5FOUA 4LV6A 1YZQA 4JL8A 4NMMA 3VX3A 4LC0A 3IIMA 2ZE8A 5CJPA 1OSNA 5BYKA 3GLHA 2VQFC 4BEBA 2F6RA 2RAPA 2FDCA 3GJ5A 1R8SA 4Q4AA 2BJWA 1TU3A 3LBHA 1ZINA 3W3AA 4MGKR 1ZM2A 2H18A 2PZEA 2E8FA 4IW3B 1XWIA 4NPHA 1A1VA 1DBSA 2OCYC 5J47A 4P4TA 2D2EA 4YMUA 5EP3A 3U44B 1TPZA 2YKGA 1JXMA 4NDZA 1DE0A 5BW8A 1XPRA 4I1OA 2CHQA 1XNJA 5CJ2A 3GLFE 3V4FA 1ML8A 4K0KC 5SZHB 1D2EA 5JWOA 4S35A 2J3EA 3KTAA 5IT9D 2JLUA 1BKDR 4HLQB 2DFTA 4LHYA 4MKHA 4CDGA 2NTYC 4BZXA 4X66C 2RGEA 3AKYA 1I4DD 4JLPA 4OHWA 5DI3A 2YOFA 3K09C 1ZU5A 5FH9A 1E9FA 1BYIA 3UKDA 1E2JA 1GL9B 3OAAA 4GZMA 3L0OA 2BHRA 3ZQJA 2G3YA 1NLYA 4D2IA 4JKIA 3PVSA 1G6OA 2FSIA 3K09A 1AZTA 4EPYA 1XTRA 3L0SA 3VX4A 5L3QB 3KQKA 3I5YA 1CBUA 1MO3A 2BMEA 3W8RA 1FOEB 1DAHA 1LF5A 1I2DA 3GD7A 1T3LA 2CK3D 3LVQE 4RD0A 1BYUA 3P32A 1OIVA 2IYSA 5AUQA 4XWKA 5IHPA 2F9MA 3EZFA 1Z0AA 4G5RA 1GITA 4Q01A 4CT4B 2OAQ1 2JDID 1G4UR 1P62B 2QEQA 5DN6A 4DCNA 3NBZC 5CM8B 2ATVA 3A1WA 4EIWA 1JOSA 3U3MA 2NOAA 1KAOA 1XB2A 1WRBA 3TAHA 3FGNA 4MGZR 1E9DA 2IYTA 3B60A 1G9XA 4IDPA 1E2EA 1NG9A 1HR0C 1OXTA 1CJUC 3L43A 2DWOA 5DLQC 821PA 3PEVA 5IRCD 1M74A 2IYWA 2OPLB 3AKEA 4D4LA 1R2QA 2QG6A 2C03A 2ATXA 1Z8FA 2YC4C 3U4QB 2ZJZA 2DB3A 1GVNB 5L3SB 2UXDC 1NJFA 1W4RA 3LY5A 4X8HA 3FVQA 2HDNB 3IIJA 1QDEA 5LD2B 4CF7A 2CY1A 4DV2C 2J7KA 1LNZA 1G3UA 3RDPA 4B74A 1KO8A 4HLCA 3OIWA 3AVTA 2D74A 1P9WA 4H1UA 5HR5A 4F4CA 3HPRA 4NCHA 3DZ8A 1ZIOA 3EA5A 3IBYA 2O52A 1E9BA 3TSWA 3KQLA 2O8CA 4TQ9A 1CR2A 1IY2A 1U81A 3AGQA 2REXB 2O0KA 4IVPA 4G5SA 3SYKA 5BN5A 2QGNA 2ZE6A 3SOPA 1YVDA 1G5TA 1VPLA 4UNRA 1COWA 3A37A 1YKSA 1WF3A 1R0YA 2GXUA 4H9GA 2YWFA 4KI0A 5JHGB 4XH9B 2JLSA 4EQ6A 4OL0A 4LY6A 5GJVC 2IUSA 3WNCA 4ZIRA 3R9XA 5IK2A 2NMVA 4LHWA 2ZRJA 1ZMXA 2ZJAA 3G82C 1TL7C 1KSFX 3CF0A 4DR7C 4HAVA 3I3SR 3CZPA 4V02A 2CCJA 4WZBE 4EKDA 5GJBA 1P7CA 4M1SA 3N5CA 2V7QD 4FWIB 5TV2A 4B44A 1DVRA 4DEYA 1AS0A 1US8B 3SDZA 3ASYA 3BD9A 4QJ3A 3MD0A 3DZDA 1T0JB 4PO1A 2G9NA 1KI2A 1DARA 5KU1A 4KVGA 3KKOA 1W0KA 1HNXC 3T61A 4PPQA 1Z0JA 5J4YA 5JHHB 1IONA 3FMFA 1II9A 5B30A 2IBMA 2BMDA 1EXMA 1FL9A 1TEXA 2IS6A 4US2R 3CNLA 3M1IA 4HAUA 3RWOA 1PLLA 2WVJA 2WJGA 4P4SA 2Q6TA 1EX6A 4HB0A 1UDXA 3W6OA 2YJTD 3C5CA 3U7EB 2NPIA 1W1WA 2D62A 4M8NE 3BH6A 4Q1CA 4BFYA 1EFTA 1UBFA 3DPUA 4TMWA 3L0PA 3R8FA 4W9MC 2UXBC 2ORIA 2FFAA 2PT7A 2WAXA 4CVNA 2R6AA 3QXJA 4OQFA 1TF2A 2AXNA 1N5JA 3BGWA 4DV0C 1H8HD 2IYYA 3DMDA 3Q3JB 1DAFA 3GFTA 5FLXD 4ZPXA 3E1SA 3RRYA 2RGNA 5F9HA 3D6TB 5EE3A 2QMHA 4AIIA 3AB3A 3FE2A 4BSZA 3GJ7A 3PUVA 5JSZA 4YC7A 1PA4A 3K9GA 1AJEA 3EA0A 4TYWA 4NKRA 1T9HA 1XNQC 2K5UA 4ZI3A 2OCAA 3VMFA 2CNWD 3TBKA 3FOZA 3FMPB 4RY2A 3VHLB 3ASZA 4OI2A 2O8EB 3U60B 1QHHA 1VYUA 2WAYA 2X2FA 1II0A 4Z1MD 2QE7A 2C04A 3RS2A 2ERXA 1TTTA 1L2TA 3OFND 2ZRIA 3S1AA 5EQTA 4JVMA 4M1TA 1J8YF 4M9SA 3ZIAD 2QL6A 4DR4C 4LBYA 2UKDA 1T8TA 4LHVA 2ZRAA 2GA8A 1GDDA 1M7GA 1Z5ZA 3HWSA 2AFIE 2ZUDA 1JALA 4QJ5A 5FPHA 4G1UC 4DV3C 2RCNA 2J41A 2J7PA 2EFCB 2IEZA 2WJJA 4LJAA 3AVPA 4MGYR 1S2MA 3TE6A 2OEPA 4R2IA 5LD2C 1S1MA 2Q3HA 2IEYA 4JLMA 1PLJA 2I1VB 2YZ2A 4QOSA 3A4MA 1NRJB 3CR7A 5KHOC 1VLAA 2BJVA 5CK4A 1UBGA 4TZ0A 5JJLA 2WIAA 5LMUC 3PENA 4Q47A 1U98A 1YZGA 2ZITA 1DAMA 4PSVA 3R9WA 3RRZA 3PUXA 4UNPA 1IJEA 4UXHA 4AWXA 4ZV4A 4JI5C 2B92A 1KKMA 1VCNA 4GOXA 4B71A 1O87A 1GIAA 1JQLB 1H8ED 1ZUIA 1XEWY 3SYNA 4F38A 3MJRA 1MR3F 1XEWX 1Q12A 1Q3TA 2QT0A 3C41J 2RGXA 4C0SA 1FUUA 1SULA 1VG9B 1XTSA 4PX9A 2IK8A 2IUUA 3K70B 2DPXA 3KX2A 4DR3C 2HCBA 3QJYA 2XNDD 4PSAA 2C2HA 3QVVA 1JECA 2VP0A 2FEMA 4IOLA 5AUPB 4ZI2A 5FOXA 2FZ4A 2CHGA 4JLBA 4HUTA 2A7QA 5GJCA 3AF0A 2IYZA 1KDOA 3CUEF 3VR1A 4JBYA 5IWAC 3SYLA 1KGDA 2IC5A 1P2SA 5JJKA 5FOVA 1A82A 2A2ZA 1IHUA 2F1HA 2PT5A 5M04A 3DEFA 3MAAC 4RZ2A 3LW8A 5FUVA 4PPNA 2OFWA 1G1MA 1W47A 4ZKEA 3BOSA 3NDPA 5P21A 2GCPA 2SHKA 2W6JD 1VIAA 2QRNA 3B1ZA 1IOZA 5CB8A 2UU9C 2XSZD 4FD2A 5J4HA 1P2TA 5CK5A 4OHVA 4DEXA 3GCGA 4L4UA 2UZIR 3GEIA 2H17A 3IQWA 4GSYA 1PUJA 4XTRA 4EUNA 1UFQA 2PEYA 5H8WA 1LV7A 4QM6A 4HAZA 1KAGA 1BH2A 4FINA 5ANRB 1M8PA 1GNQA 3HJNA 2PMKA 1FQKA 2V54A 1ZM7A 4B3XA 1OH7A 4NCKA 3BIFA 4IVQA 2XTMA 4OK6A 3CF6R 4D0LB 5HPYB 4G5OA 3DO6A 2CK3A 1KTVA 3AF1A 1P2VA 1GWNA 2QY9A 2VF8A 1ZVQA 2MSDB 5DYIA 1F2TA 1J5EC 1RYFA 1T8UA 1YZUA 3A36A 2IS1A 2JDIA 1J2JA 2BKEA 3NBFA 1SXJB 3WY9A 3HPQA 4JKYA 2ZYWX 1UBCA 5TXGA 1XCPA 1CRQA 3KQUA 2QGZA 4GOKA 4MYHA 2IWHA 1KK2A 1VYTA 1E2KA 4XIGS 421PA 4AKIA 1M7BA 5FL7D 4BFSA 3AVUA 3WNBA 1AKEA 2QT1A 3DKPA 3CX7A 3RC8A 2EFGA 1OE0A 2WSSA 2WV9A 4R2HA 2GHIA 5JJIA 4I1SA 3PUYA 1G291 2VTKA 2WHXA 2G88A 4ILEA 1SHKA 3QNUA 5E95A 1Q44A 4KV9A 4Q66C 4Q4HB 3PUWA 3QKUA 3REGA 3I73A 2XJ4A 1HE8B 2RMKA 3ZLJA 2CJWB 2WWWA 4M2LA 1L2FA 2ZI6A 2EW1A 4DZZA 2GXQA 2JLVA 4RKFA 1VHLA 2JLYA 4X62C 2YWHA 1D2NA 1ZC3A 1DO2A 1Z6AA 1G3RA 1SVWA 3JAMD 1KOFA 1ANKA 3JVUA 1MABA 3CH5A 4WXRA 1NIJA 5DHFA 4AKEA 4ZDWA 3THYB 2HJVA 2Z6VA 1YZKA 1BMFD 1II8B 2QAGB 4ESHA 2BKUA 5EP1A 1H65A 1E9EA 1FJGC 1N5IA 3BE4A 4B3SC 1F48A 2A5YB 4AYXA 1RJ9B 4DV6C 4NYMQ 1E9CA 4GNKA 3KB1A 4MRNA 5JRJA 1VCIA 4N0DA 4NYMR 4LJ9A 2IHYA 4PHTA 4Q4JA 3K0SA 2ZR7A 4Q9JA 2V4ZA 1T5IA 1ZNXA 3NH9A 3QG1A 4KLZA 5IDVA 4B34A 1G17A 1GFIA 1NKTA 3BC1A 4B3GA 4QHSA 4GMXA 1VHTA 1ESMA 1JR3E 1W2HA 5FOWA 5JWHA 1C4OA 3CZQA 4PC6A 3VNUA 1RYHA 3IDQA 1SXJE 1WXQA 2I3BA 2ZE5A 4QKQA 1KI6A 2D3WA 2PL3A 4DLSA 4AG5A 3HDTA 1ZD8A 2FGKA 3BB3A 1JPJA 2GZAA 1OW3B 4F92B 1KI1A 3SJAA 1GZSA 2OBNA 3UWOA 2BMJA 1Z2CA 3AF2A 3QKSA 4Z8YA 2FPLA 1QHGA 3TSZA 2OLJA 4B32A 4N0EA 1VCMA 1NMXA 4ARZB 4P0TA 3A1UA 3IUYA 4PAQA 5B57C 2ZPTX 2YCBA 3AF5A 1OB2A 2QTVB 4OQXA 1H8HA 1W5SA 3EC1A 4HSEA 5SZIA 1UAAA 2EYQA 3QG5A 2PLFA 1IXZA 3ICEA 2OFOA 3WXMA 1XMOC 1G8PA 2WICA 3CRVA 3QEJA 4MRVA 1E2DA 2IYXA 4A8JC 4DLZA 3FTQA 1IM2A 1Q0UA 3EIHA 4XVQA 1UM8A 4RD1A 3VKWA 5J5CA 3PEYA 4EJSA 4AKGA 5JFGA 4IJMA 1XEXA 4Q4AB 4XD7D 4B33A 5J4KA 2O8BA 4OKSA 5HCNA 3NH6A 1KJZA 2ZRCA 2CNWA 2PT7G 2AHOA 1OXVA 1YU9A 2UUBC 3MWJA 2P0EA 4X64C 4R7ZA 3A1SA 4Z1MA 4X8OA 1Z6YA 1N32C 4HZUB 3OFNA 5DNYB 3PR1A 3UIEA 3RNLA 2GJ8A 3ZIAA 1EX7A 1R5NA 4WXPA 3EC2A 1HNZC 4BZPA 4IOJA 1VG8A 3AP2A 2FEOA 2GJAA 3WNDA 1TF7A 2JJ1D 1F2UB 3EIQA 3BFXA 4K8OA 1KJWA 4YY3C 4IFBA 2PZFA 1OHHD 1SKYB 1EGAA 4JMPA 1OFTA 4OQLA 4BLRA 5FTJA 1QVAA 1NY5A 1E32A 3LFUA 3CBQA 2Q21A 3NVAA 4KU4A 4C0QC 5AUOB 3CNNA 4HATA 2GK6A 1Z29A 4E5UA 4L8GA 3AUXA 1SVKA 2QI9C 4KAXA 1WP9A 1XU4A 1OYYA 1XTQA 1FP6A 1OXUA 5FBQB 4TMVA 3DOFA 2E9SA 2XGJA 1S3GA 2KB0A 4XVRA 2XZOA 3GJ3A 3QXCA 1NVUQ 1E79D 1E4VA 1H8EA 3FHTA 3LNCA 2P6RA 2CXXA 5FBWB 4NONA 2WOJA 3X1XA 3H4MA 3UMRA 2ZYTX 1S1CA 4XVUA 3I8XA 3QPWA 2ZJBA 4URZR 2FSHA 1NLFA 5DSZA 3NWJA 1EWRA 1IN7A 2H1LA 1KDRA 5AWFC 1GP2A 2XNDA 2VEDA 2BV3A 5L3RA 4QHYA 5C2JB 5DO9A 4QBGB 1M6NA 2B8TA 1IAQA 1RPZA 2ZAMA 5HZHA 4I99A 1JJ7A 1GNRA 4HAYA 3TJZA 3OE7A 4C0BA 1EFRD 3AKCA 2IUTA 3GEEA 2AK2A 1E9AA 4HUQB 4M1MA 2J0SA 3SU8A 5G3YA 3ADDA 3PG5A 2OBMA 1KSGA 4A0GA 5L3VA 1L7VC 4JLVA 5F2EA 1IN6A 2JAQA 4W5JA 1EWQA 1KI8A 2CBZA 3Q7QA 3WRXC 2P2LA 2CXCA 4BFZA 4LZZA 4LJ5A 1W44A 1GTVA 1HTWA 3OF5A 1W36C 2EVWX 3EASA 4JJZA 4MH0R 4NYJQ 1ZAKA 1M34E 4NYJR 4BWYA 1XTKA 1E1RD 2F1IA 1E2HA 1JQJC 4NP6A 5GJWC 1E2IA 3EWAA 4C3ZA 3C4JA 4JVNA 3V00A 2W6JA 1KO7A 4M9XA 3I62A 2XSZA 4Q9LA 2NZJA 4F4IA 1XX6A 3BAFA 5J4LA 1N3BA 4RCYA 3CPJB 5AR1A 4PC3A 3ZH9B 1XTIA 4MA4A 3RLFA 5CIQA 1AN0A 1P72A 1SKYE 4MITA 2GESA 2FOLA 5SZKB 4F4JA 1USPA 4TTQA 5E7JA 3B5JA 3F3YA 1NG1A 2IXGA 3WMFA 2F43A 2NGRA 5HE8A 4EQ6B 2WTUA 2GCOA 2Y8EA 1Z0KA 5KDLA 4GZLA 1KY3A 2OILA 2ASBA 2W6ID 3NC0C 3B1XA 4FMCF 3ZZUA 1JNYA 4A2QA 5JZVA 4AY2A 4LFCC 4AYTA 3T5GA 4JL5A 4YMTA 4TMTA 2VP2A 1GKYA 1U0LA 2MMCA 2C98A 3LX8A 4PAMA 2W2XA 1KYIA 4QBFA 3EZ7A 4AKHA 4JI7C 3MWKA 3TUJC 1IBKC 2J46A 221PA 2OCPA 2RGBA 3M6AA 4D0GA 1B0UA 1D9ZA 1LVGA 2VQEC 2J0UB 2XEXA 2ZVQX 3GJXC 4J0QA 4YXWD 1PV4A 3CLVA 4CEHB 3NTUA 2ZEJA 3WP0A 4N1AA 4LX0A 2NPFA 1CULC 5DE3A 4CZ2A 3PEUA 3LXXA 5FL7A 3U7GA 2OT3B 5EE9A 3BB1A 1D6JA 3Q8XB 4P4SB 4A6XA 2F3RA 3NIBA 4MYTA 4KHZA 3W3ZB 5JS7A 1PZNA 2BBSA 2F1JA 2X1VA 3SFZA 1TQ6A 2W00A 2ZJOA 4JSYA 2BIFA 2W0SA 3IHWA 5AJYA 1DELA 4TSFD 2VP5A 4NL4H 4LI0A 4OJKA 3RWMB 4LF6C 2QPAA 4LV5B 5KSYA 3UG7A 2CMKA 1QG4A 2ZAOA 3EPKA 4H1VA 1CR4A 3WRYC 2QMOA 3ZZ0A 2R2AA 5H1YA 3FB4A 5LBIA 2I4IA 5JSZB 3IO5A 2PJRA 2C77A 1S9HA 3QBTA 2IT1A 1ZUNB 4ZCLA 3GPLA 4OI0A 3OESA 4RSGA 3VTKA 3RS5A 1JBKA 2O8DB 1AS2A 1N6RA 5AJWA 2D7DA 1Q20A 4TN1A 4A6PA 3K9HA 1E9RA 1QHHB 4IRUB 2A78A 4LFBC 1BMFA 1HEIA 2BEJA 3U3JA 2YV5A 4C0KA 1NL3A 2OSBA 4TTPA 3S1AB 3B1YA 4G5QA 5CITA 4BQSA 1NVXQ 4HAWA 4DB4A 2VP6A 2O8FA 3K0FA 3OIVA 5C46F 3Q9LA 3KQNA 1RC8A 4LV8B 4JLOA 3SHFA 1R7RA 2ZRNA 4F93B 4B48A 2Q0HA 4D4KA 1FW6A 2J0VA 1KKGA 3TAUA 2FN4A 5DHAA 1NJGA 3QF4A 4P32A 4ASUD 2FNAA 4CEJB 3A6PC 1KMHA 5E3HA 3FYHA 1JB1A 3KJEA 4HB3A 4B6FA 1SVSA 3CX8A 4JI4C 3IPYA 3KKMA 5D3MB 1UF9A 1XCMA 2VHTA 3JZMA 4NXMC 2R62A 1GRNA 2YC2C 1ZM3A 3A8TA 3QKRB 4Q03A 4K81B 4TL7A 4DLYA 4LUCA 4US1R 1Q1EA 3AQ4A 1XMIA 3AEZA 1TU4A 4DT1A 4QJ4A 4URWR 5EUQB 1U2RA 3AVYA 1Q57A 4LHXA 3GLGA 1KKLA 1S3SA 2KBFA 4YONB 1NN5A 4DKXA 4OQNA 1MRSA 2JLXA 4ON9A 5FBLB 4II7A 1TX4B 1SVMA 2X19A 3QUSA 4RZUA 4FWTA 2JASA 4DSUA 3K0AA 3KKQA 4D4JA 5FPKA 5KSZA 4GOJA 4KYUA 4LJ8A 4QBHA 4NE2A 3B2EA 4MUAA 4HB4A 2X2EA 2XXAA 2OCBA 2OESA 4I1VA 4DB2A 3EG5A 3ADCA 3VHXA 2HJGA 2WJVA 4BRWA 4BFUA 3THWB 2ZS9A 3NEYA 5FUWA 2DY1A 4GT1A 5JEDA 3EX7C 2QBYA 3BS4A 5AK0A 1XJ0A 3E70C 4Q5IA 4M4SA 5C18A 5C4MA 3N2EA 2Z4RA 5KO2A 2PBRA 4DSOA 5BWMA 1LF0A 3CO5A 4OQMA 2QP3A 4HLDA 5JMTA 4E09A 3VKHA 1FTSA 1U0HC 2QN6A 2ZI3A 4DV1C 1F60A 3NBXX 2D4HA 1Z3IX 3CWQA 4DUYC 2QMEA 4EFLA 3RRMA 4TYYA 3IEVA 2JMPA 1NN3A 3CRW1 4QG7A 4A92A 2JJ1A 1NVVQ 2C9OA 2O0JA 2VPPA 2KWIA 1J99A 3QF7A 4C9BA 4E07A 5GVRA 3VU9A 1NVVR 3K70D 1ETUA 1OYWA 1XF9A 1EFHA 4X65C 2FPKA 1OHHA 4DR1C 2BCGY 1QRAA 5TDHA 3TIFA 2FV8A 1NSFA 3K0EA 3ECCA 3TLXA 2UUCC 3B6EA 1AGRA 3AV0B 4BLSA 3AM1A 3L8YA 4GL2A 5L8VA 3W34A 2PH1A 4FCWA 4FCVA 4LYHA 1ODFA 3KFXA 2VHCA 2RGNC 1VG0B 2HXYA 4U02A 1Z6XA 1KHTA 4TLCA 1B23P 2P67A 5FTMA 3WMGA 4AURA 1WMSA 4A36A 4UXIA 3T34A 3ZQ6A 3WYAA 3C7KA 4CEIA 4DCUA 4HAXA 3GKUA 1DAEA 5F3WB 3U2QA 1FPMA 1JJVA 1UEIA 2QPOA 4RCZA 2ERYA 3HP1A 2OO7A 1XMJA 1ZU4A 1RKBA 4UNSA 3R8CA 2PCLA 3U44A 3HU3A 1E79A 3B9QA 4LYJA 4URUR 3UATA 1F2TB 3WP1B 4GDFA 2BMFA 1OPXA 1AK2A 2IXEA 3HU2A 3T12A 5JCZA 4DDVA 2AR7A 2CVHA 2DFNA 5F98A 3LH5A 4RD6A 3MWYW 4TQAA 4EFNA 2VHJA 2C78A 5IT5A 3WHLA 1YJ5A 2Z83A 1K0RA 4KO8A 4QNMA 1NY6A 1CTQA 4LPKA 1Q21A 2XZLA 1W48A 2ORWA 2W2VA 1V5WA 3F0TA 3SJZA 3AVQA 1EFRA 5EZ6B 3SZRA 5BQ5A 2G77B 2ODEA 2HLDD 1DG1G 1OXXK 3NC1C 1E1QD 1JPNA 1U99A 4JI8C 2EWVA 2ZSBA 3CPEA 4A0HA 4AI6A 1N0UA 4XWOA 5JLJA 5L3QA 1TF5A 2FF7A 3ND8A 2D7CA 1E2GA 1QHIA 2I1QA 3QKTA 3KJGA 1U9IA 4IOKA 4RFSB 3SE0A 3BXZA 3WYGA 4IOMA 5KOYA 3QE0A 1ZCAA 5E7MA 5TARA 3R20A 1K5GA 2WKRA 1CP2A 2G0NA 3H1TA 1Q1QA 2ZRBA 3TQFA 4KFRA 3VKGA 4TMZA 1G8GA 5FTKA 2IS2A 2HUPA 1QF9A 1NBMA 1E94E 1R5BA 5UKDA 1DAKA 2AK3A 4HDOB 4E03A 2IYQA 2WIBA 1E1RA 1SXJD 2XTNA 3A58B 3V9PA 3AVVA 3KXKA 1DO0A 1KI4A 2ZJ2A 2WWIA 4LBWA 1OH6A 5EXSA 1CXZA 3HYTA 5FPTA 3RC3A 4DV5C 2J45A 1CJMA 2Q9CA 2ZRKA 1MOZA 3SJBA 1P61B 2ZR9A 4LHZA 2RH5A 3LUSA 4QM7A 1YRBA 3KUDA 3RHFA 1J8MF 1OT3A 1Z63A 4Q9IA 2PZGA 3RANA 2OBLA 3KKPA 4DXAA 2OPLA 4TLAA 4JI2C 5TVKA 4US0R 1S8FA 2V3CC 1LY1A 3VFDA 2W6IA 4EPXA 2OXRA 1KI9A 3U4QA 5CYPA 4FMBB 5L3SA 2A9KA 3TUZC 5JBQA 4KSCA 3LQRA 3GLIA 1RW4A 2R6FA 4LRWA 4KITB 1EK0A 2N1BA 1JAHA 3ETLA 3N2IA 4WOPA 2VA8A 2VF7A 1TAGA 2REOA 4JVSB 2ZQ5A 3N70A 3I61A 2JJ2D 3L2OB 1XD2B 2VH5R 4QGAA 2ZJYA 4MKGA 2QL8A 1KJYA 3SQWA 1N0VC 3I5XA 3GFOA 5K8IA 3T1VA 4YXWA 2AWOA 3E2IA 4FMDB 2GZDA 3AP1A 4F7WA 4NOZA 2LWIA 4GI7A 2ZYVX 2Q9BA 4V03A 1E2QA 1TADA 2AXPA 4DLVA 4AYWA 4YMVA 3KKNA 1K8RA 3QBVA 3MUFA 3W6NA 5JECA 1WDTA 4BE7B 3KQHA 2FFBA 2B8WA 3BBPA 3BWDD 2VP9A 2GILA 2JATA 2ZTSA 1TMKA 3WBKA 4JLAA 4TSFA 5J4VA 4QC2A 3VQTA 1OFIA 5EE1A 4A2PA 5CM9C 2QUZA 1AGPA 2RHDA 4HYYA 4RZXA 1IN4A 1KIMA 1XXHA 2ZETA 2F3TA 2B7CA 4KYIB 4TYPA 4B3CA 3THXB 3M0EA 1FX0B 3IIKA 5A5GA 2R44A 4ZCIA 2C5LA 1US8A 2AX4A 2QZ4A 1E4YA 3WMEA 5KSPA 3DMNA 3EIEA 2ODNA 1ELOA 3I72A 3MFYA 4PSKA 2X77A 1UKVY 4L15A 4BFWA 2EQBA 4XJXA 2AKYA 5KSOA 4A8JB 5JRZA 3GJ4A 1G4AE 1ZCBA 1T6NA 2P6UA 2VYFA 4DV4C 3CH4B 4C30A 3FKSD 2MSEB 2E7GA 1P60A 4RD3A 5FR1A 2QU8A 1YRAA 4QGFA 1Q3HA 5EXPA 2J87A 2ODWA 1G64A 3O47A 2JJ8A 4JYBA 4WVFA 2CCGA 3AKDA 2JLWA 4B3RC 4FIDA 3PEWA 2PJZA 2BWJA 3J81k 4DCSA 2QORA 3JVVA 4NHOA 2ZUCA 1MO4A 5B2ZA 2FG5A 1EFUA 2ZYUX 3IILA 3NDBB 1WE2A 3K53A 1E6CA 4JVLA 5FI0B 2CE2X 1BS1A 1RRFA 1UKYA 3PQCA 4P3YA 2XTZA 4B47A 1XD8A 2FJUA 5LPNA 2NO7A 3LBIA 3KFVA 5JS8A 2VIIA 4KHPC 1GILA 2OM2A 4QBIA 2O8EA 1UJ2A 1SZPA 4O3MA 2CCKA 2NZ8A 3B1VA 2DYJA 3L0IB 1DEKA 1IBRA 4XOIA 1N6KA 1QG2A 3ZYCA 3GJ0A 4C7OB 1GL6A 3VNVA 4LF9C 3UWKA 1DOAA 2R6CA 4Q4LA 2FSGA 5HKKD 4PC1A 3T1OA 1D9XA 2GVZC 2GF9A 1N25A 2WWXA 3QVUA 3R7WA 1IY1A 1SVOA 3UXMA 3C14C 2HF9A 3GEHA 2BBWA 2ZI5A 4HDCA 1RFLA 5H68A 3RS0A 3TRFA 2KI5A 5CDFA 1QHNA 2ZANA 4TT3D 1N6PA 4JJKA 2AD5A 3OTOC 3C5HA 1DAIA 1QHYA 3FDIA 2ZI4A 1OH8A 3W6PA 1X1RA 2WKPA 2ZRHA 1QHXA 4CYMA 1LB1B 2IYLD 2XNSA 2ANCA 3TW8B 1GUAA 1KK3A 2GWHA 4Q7MB 2EYUA 3LDAA 1QBKC 1C1YA 3H86A 4LF7C 2V7QA 2ZSFA 5H70A 1JAIA 3TSOA 1XDBA 4M22A 3VR5A 1NI3A 2B6HA 3AUYA 1VECA 3BH7A 3L82B 3Q5EA 1ZD9A 2D7VA 5B64A 3MJHA 1IJFA 1J70A 2P65A 3ZJYA 4DVGA 3O8RA 1MRNA 1XP8A 4JLJA 4BASA 4CRWB 3PCRB 4NU0A 5DN6D 2KJQA 2P5SA 4Y0AA 3UANA 1KO4A 1W46A 1W7AA 1KO5A 2CEAA 1ZC4A 3K9NA 3VR6A 2NO9A 1W36B 1R10A 1KSHA 5ELXA 4BECA 4LDJA 5FTNA 3MMPA 4QHTA 4LWZA 4MQBA 1N6IA 3B1WA 1I94C 4KBFA 4FMDF 3OEED 3L8ZA 2OV2A 2RKOA 2RGDA 2FA9A 3EZ9A 3WYFA 1S4QA 1Z6GA 4B2IA 4PC2A 4TMXA 4EJSC 3OHMA 4JYAC 3SC3A 1N34C 1VYVA 4DR5C 3NHBA 2WJIA 3PITA 2NG1A 1W49A 4OK3A 4D26A 2XX3A 4UNQA 4OK5A 1G7CA 3GLHB 4LCBA 4Q02A 1UADA 1ZJ6A 4ITRC 4BLTA 4C0LA 3QENA 2ZSDA 1XZPA 4KJZA 4DR2C 1P9RA 1HH4A 5KDOA 1Q1BA 2ZROA 2ZVPX 3LD9A 4PQYA 4TL8A 1D5CA 1ZBDA 5C1BA 1G21E 2FWRA 1TQ2A 1X1SA 3TVDA 2HF8A 3LVRE 3SFVA 2W58A 4TLDA 1Y3AA 1NIPA 2HEIA 5SZJA 3EPLA 2VSOA 3A1TA 2PX0A 3EW9A 2JIZD 4TWZA 1HY3A 4LJYA 2HLDA 2WOOA 1NYEA 2ZREA 2ZRPA 4WZ6A 3UMFA 1E1QA 1E0AA 4QL3A 1ZM9A 2AD1A 2RGGA 3P20A 1TUEA 2D2FA 3WHKA 2OUKA 2JLQA 2YWEA 3KTAB 3FMIA 4JS0A 2GZHA 5A2QD 3EPHA
chains in the Genus database with same CATH superfamily
4OYCA 1FBTA 1FTQA 2WKSA 3BMCB 2ZUFA 4B7UA 2ZT5A 3HI6A 5H4HA 3KEOA 1EP2B 3EVEA 2XB6A 5K4GA 2WF7A 3EXFA 4EHIA 3BF7A 1L5KA 2Z8YM 3LPMA 1MJNA 4JZYA 4OFXA 4DA6A 2NO0A 2D00A 4FSDA 4E21A 2VUSA 1XNRC 3ETOA 4KXNA 4GPBA 3FUTA 2UYHA 1GZ5A 4X1IA 3UT5B 2ZSIA 2VHUA 1Y7HA 2DSTA 1ZK3A 1RR6A 4WJKB 3Q2OA 5K6AA 2ZXUA 1XJQA 3BWYA 4CLEA 2DHMA 4M0KA 4PYNA 2QNIA 1BS9A 3GAMA 2R6DA 3AV3A 2FG7C 1OU4A 2G6BA 2XD4A 3LFTA 4BBYA 3BEOA 3PXXA 3EIWA 4DBLC 4PPFA 4LGCA 1ZHHA 3V33A 4C4PA 1Z2DA 4EY5A 1QP0A 5KDDA 3KOXA 1MIHA 2VBIA 3PNVA 4L75A 4RH3A 1UM9B 2A4MA 3JX9A 3B5EA 4J0JA 3LA6A 2VL7A 3TLBA 2PCJA 4R9UC 3KYDB 4E30A 3ZBQA 1YR9A 1HEUA 1HTTA 1JMKC 3LIPA 3OFSA 4UCWA 4K2AA 5JNUA 2I2FA 1JIXA 3CB4A 4UU8A 2G72A 3O8DA 3OVMA 2DFLA 4AY5A 1PGPA 3HR7A 3IR7A 1RT9A 1YRYE 1ZRNA 4XQGA 2ZYDA 3IP9A 1UH5A 4OA8A 5AVOA 3PS9A 3FYSA 4U2FA 3GLHE 2IV3A 1T2NA 3FRHA 3G2NA 2PZLA 4RHFA 4OHUA 3ZDQA 5FBVB 3HRKA 1MV5A 4ESOA 3K5PA 3QLJA 4W6ZA 3WQBA 2EGHA 4DV7C 1EUDA 2OWDA 3GFGA 4HGYA 2FQQA 1MFZA 4FUTA 2ZBFA 1JT9A 2X7XA 3KSDO 2QMYA 2WIFA 4P3NA 3SQMA 4IJ5A 3T9CA 2LR0A 5JNVA 3THYA 4C5CA 1LLCA 5LXTA 1EZZA 4LY9A 4XXHA 3MINB 1QHSA 2FB9A 1X15A 2QAGA 1RC0A 1X80B 1MXBA 1KDPA 1XT6A 2ATEA 1VMDA 4HDMA 4KR0A 4TV8F 1L5ZA 2HV8A 2R96A 2VLBA 3MQFA 5FO0A 2Q3DA 1TFUA 4IRMA 5G53C 5KPDA 3BE5A 1PL8A 2IXTA 1E5TA 4W99A 5BN5B 2IUEA 4CBVA 4WFKA 3GNLA 5AT1A 5FWNA 4XTCS 3OLVA 4KFTA 4JDPA 1OV4A 1AQYA 2OQ2A 2CB9A 3IEMA 4BCBA 4IJVA 1VSTA 4FCTA 4WESB 5EJMA 3RTDA 3QFTA 5G3ZA 1M2NA 2CYAA 4GKJC 2VSYA 3NHJA 1TIPA 3UAXA 5J1SB 2H0AA 4N0PA 1ATIA 1OZAA 4PZZA 4Y2VA 3CF4A 5DFAA 5A6VA 1FFEA 5EPUA 3C3JA 1N75A 4LDPA 3I01M 3MD9A 3B6KA 4YRIA 2BGJA 1O0SA 2J4FA 5DYGA 5HJ5A 4P7JA 1N7GA 4KBGA 4DLXA 5DNWA 3KUKA 3TR5A 2BR3A 3EOZA 2HCJB 4OLFA 1AQIA 4E5SA 4AWBA 3D8BA 1OUMA 4JXZA 2FXVA 1XOIA 3PSAA 5DTQA 3EDOA 5LDHA 1ULTA 1XZNA 1WBBA 4I4IA 3F5FA 1EFKA 4GXRA 5FA5A 2VUIB 2W2LA 4Y0VA 3UHFA 3CVYA 4AO6A 1M6YA 1A4RA 4PGAA 2CXUA 4X00A 2GXSA 1G0OA 2KHZA 2QENA 3H5VA 5TY0A 2R66A 5AP9A 3AIIA 4Q9KA 3CONA 4MRRA 4JSRA 2Z95A 3U7RA 5JYEA 1Q22A 2BL4A 1G6HA 4TM8A 4B2LA 1VPTA 2GH1A 2XVZA 5JEEA 2O8NA 1ZH6A 2XMZA 3D6HA 1FFSA 5DOZA 1WCIA 3S29A 4D82A 2PWPA 2QLJA 3QVLA 2SCUA 1K6MA 4X65B 1V0JA 4TUYF 2WHYA 3L4KA 1JH9A 2FSPA 5A03A 5JCPA 1EM6A 4NPCA 4UJ5A 1SCJA 4IS3A 4O2RA 1BU8A 5AKJA 5FBRB 1RABA 1Z2AA 2D5AA 2GYWA 1CF9A 1U4OA 5EIFA 4DILA 5KNCA 3E3NA 1XRRA 1H0RA 4BKUA 4LIPD 4NTZA 3ZK7A 3DZFA 5FNVB 2FPSA 4CW7A 2C2ZA 2DLCX 3AVXA 2C7QA 1KZYC 2YJ4A 1VCOA 4CMGA 4EAQA 2OY0A 5LQAA 4XPIB 1Z7GA 3L5OA 1HDGO 1UPTA 1NUHA 1W0JD 1X6VA 3A4NA 3QXXA 4JY7A 1VQ1A 1T3GA 2A86A 3B2NA 2BHLA 2C9ZA 1F2UA 3OCVA 2C96A 3U9TA 3VR6H 2UZ1A 5JAHA 3IR5A 4DPMA 4RV5A 4TT3A 2PH3A 2Q62A 4NBKA 3ZXYA 3LPDA 4TTRA 1IVYA 2NO6A 4P3XA 4YJGA 3JW8A 3PPWA 5F1OA 2VPXA 3OH8A 5H5JA 3ZV5A 3TNFA 3JWGA 1W52X 3V7WA 2XRZA 1HTBA 3DHWC 5MHTA 2YFHA 4LGMA 3UPDA 3K15A 2I3DA 2Q2OA 4MYDA 4DNXA 3S82A 2UUAC 4QVKA 2V9PA 4GIBA 1IUPA 3BTVA 4AJHA 1CZKA 3GR1A 2QTWB 3IEXA 3CY6A 5A4AA 4IPTA 4FFVA 4HYEA 4J03A 4QECA 1PV2A 2WYWA 4WAUA 1T6BY 1OIWA 2HCRA 2IIBA 2JANA 4E31A 1XELA 1F5NA 4UKDA 5FWYB 2F4NA 1B4DA 5BYJA 1QMGA 4A2WA 5K8FA 5K3BA 4XWAA 1XWFA 5FBKA 4FQ5A 2E4ZA 4PU0A 3WBJA 4Z7OB 2G8LA 2Z2YA 1GXSB 2J09A 1SKQA 3GG2A 5FUXA 2OZPA 4DMGA 3AUFA 5DBIA 2C5HA 3TSYA 1RWPA 3GCXA 2GCNA 4N3NA 1DC8A 1P81A 1ODLA 2HGZA 3R44A 4XWWA 1HPLA 4XDGA 1TEVA 3ZVMA 3IKMB 2ZI7A 1DZIA 1PD1A 2PA0A 4I81A 1NF2A 2D8AA 1SBHA 2OWEA 3NFRA 2HKIA 3TMYA 3H0CA 2HPVA 3D6FA 3GZ4A 3I04M 3NBYC 4QUKA 4BQPA 2Q5CA 4QYWA 1SVLA 2VBCA 1PG0A 3AOGA 3IQGX 1UWKA 3OTQA 3NATA 3OEEA 3DZKA 5THKA 1KDZA 4WNAA 3TS1A 2C95A 4KN6A 2UAGA 2C99A 4JFAA 4MMYB 4Q21A 3SF0A 4FGZA 3VOBA 5K0ZA 3H2YA 2O3UA 5HF9A 5C5CA 1T6XA 4QO8A 2ZE7A 2P2NA 1R4AA 4PANA 4PS1A 4B4VA 3U3OA 4CV3A 4TWBA 4DS3A 1KQFA 1Q0ZA 4PEVA 4RIHA 1LWNA 1YCFA 1CLEA 1C7QA 3NHKA 4DARA 1D2MA 2IXFA 1XBTA 1UEJA 4IDGA 5LCIA 3QM1A 3J81D 3FIUA 5AUNB 3UPUA 1L9KA 5IVPA 3KELA 1N8NA 3AF4A 1DMSA 1AA9A 1HA3A 4EBBA 1UWLA 2Y1KA 3FBGA 1ZK0A 2Y6VA 4PAOA 4HCJA 2Y0EA 1UOOA 2OC9A 1FTNA 1KK0A 1QPBA 2QPTA 3KKKA 1VJTA 3IELA 4OYYA 4WOJA 3U37A 3CGGA 2PDAA 2OHJA 4QU0A 1KDTA 2JZOA 4MPTA 3C39A 3UMSA 1MT0A 1BGXT 1Z07A 4GR4A 4KX5A 5TPZA 2FZGA 4F3RA 2DXIA 2YJZA 4JASB 3DOIA 5CVTA 2LKCA 2P3LA 4ACBA 4XD2A 2VYCA 4QGGA 2H85A 3OM1A 4Q1DA 1KSJA 1QS0A 2ASEA 2J3QA 5C8YB 1ISPA 3O8BA 4ME6A 2QG9A 1S0UA 3KR2A 3H7AA 2W2TA 3LUBA 4WH0A 5A2QA 4LJKA 1OF1A 5KYKA 3DO5A 2HSZA 1L4YA 1V41E 1E99A 5CVEA 1BO6A 4U2GA 1T9BA 3GMDA 2R8OA 3U4DA 5DCLA 2MU1A 4UMVA 1XDDA 4TLBA 2QRZA 4LE1A 1SC4A 4QXQA 1Y5IA 1YSCA 4LK2A 3WA7A 2C31A 1QTIA 3HDYA 4K9OA 4R8LA 3LQQA 4I55F 1CD5A 2VWGA 2WT8A 4Y1RA 1YR2A 1KJ9A 1B1CA 4GKBA 4YYEA 1HQYE 4UUMA 5C7OO 2GPNA 2E4XA 2G40A 3NEJA 4WBNA 3C3BA 2FKNA 3VPSA 2DHQA 3AEQA 2FWIA 4DEVA 1JEQB 1CJKC 3GO4A 3I39X 4GRIA 1HDYA 4JEUA 3W4IA 4TX1A 4U7PB 3U9LA 1RLIA 3NVMB 3TFOA 2BGKA 2DHEA 3VYVA 621PA 2R25B 3WADA 2C7BA 3DBLA 2O2ZA 1SVIA 2CKDA 1OWOA 2ECOA 5B12A 2CLKB 2K2WA 3OLCX 4R5MA 1DADA 2DU8A 1FNMA 4KVZA 2H2IA 1WCXA 3ZD6A 4R1LA 2GVDC 3G2MA 3OT4A 4HLNA 5ALNA 4XE5A 4XIFA 3EPRA 2R8RA 4G5XA 2VO1A 2DG2A 4IQ8A 1P4JA 2QUJA 5CH8A 2PWYA 2IZZA 2C8VA 2JH3A 2ZRFA 5LOVF 5LYJF 4Z4EA 2UYYA 3GLIE 1KARA 3EXIB 3I4LA 3OOJA 4RX1A 3TX2A 3ZE9A 3V9AA 4KO2S 1AIPA 2WW8A 4PXSA 3C5EA 1HQDA 2J5XA 4L57A 4RVHA 1TJ4A 3RNOA 5BN1A 1OCEA 3TWOA 1JHDA 3TTTA 3RUDA 3SBDA 3AYZB 2P4SA 3K9BA 4QRHA 1SURA 1ULHA 3RAJA 3LFHA 2Q3EA 1QYWA 2C97A 2O2EA 1R8QA 3AW9A 3KEGA 4FHDA 2O1WA 3D54D 4A1FA 3U5TA 4NAHA 3L40A 1DCKA 4NCXA 3AGPA 2AMLA 2PIAA 1LSJA 2FZLA 2BKLA 2IL1A 4WGFA 5H16A 4CMEC 4RTLA 5KMGB 2QY6A 3LQ4A 4RKEA 4UFOA 3DE6X 3BXHA 5FPPA 2QDKA 4DLTA 1U5CA 3FVVA 5AHXA 3NKLA 4PG6A 3TKLA 2F55A 4KHPB 3CNBA 4HC4A 2EDCA 2NNWB 3PRJA 1U0BB 4MMXB 4C2TA 3OEHD 4G0NA 3R7WB 3WL3A 2DPLA 4RFVA 2WKQA 3URMA 1V8OA 1G5FA 4UU7A 2BE9A 4FN5A 3MOGA 3ML1A 2JGDA 4X71A 3ZE1B 4OJMX 4WQMA 2QRVA 2JAWA 3PF8A 1JHRA 1PFVA 4MRPA 2OG1A 4EY4A 4B73A 2Y2VA 4FKBA 2M2IA 5TB5A 3T9FA 3ZWDA 4EDHA 4O8CA 5CEJA 2B2NA 2VOJA 3NKVA 3BWCA 4MDEA 1P5FA 3N74A 2X2OA 2E4YA 5IM4A 2XB2A 1QIIA 3R7AA 1N3LA 2V4UA 1OFUA 1YL6A 5JW6A 4WECA 2YHIB 1YB2A 2IHKA 1AUOA 1ZNZA 4MYCA 5D3MA 4FSHA 4OHBA 4Z4HA 1EBUA 2HY7A 3FPJA 2ZR8A 2WHRA 2XDYA 5T3YA 5AI6A 1Y9DA 1DDOA 1XEFA 3QKRA 1IWBB 2E1RA 8MHTA 3CU5A 2IOQA 4C0JA 5AW9A 3G9QA 3PWTA 3PNYA 5BNWA 2FY8A 1VEHA 5KNCH 4HN9A 2J0EA 2H5EA 1KL7A 2O2HA 3VPXA 3LL4A 4EJ0A 4JJ7A 1V16A 2WY2D 3AFMA 3LAWA 1VMAA 4JUDX 3LNVA 2HBYA 4XX2A 1HZZC 3DZBA 3KXLA 1I4LD 1QHEA 2VAWA 4TQUS 1JZTA 4Z0PA 5HFJA 5EE5B 3HVHA 1CUBA 4BNUA 1ZG3A 3TIGA 5JNLA 2XVMA 1ODIA 2FEXA 3IQIX 2BI8A 1MPTA 1ZB8A 1JXQA 5DBGA 3X1JA 1ZO8A 3S81A 2R1VB 2HR1A 1EDBA 2PFSA 2ZJ4A 5IAKA 2CMGA 3ND6A 2O0HA 5BSKA 3BWBA 1GQSA 1NKVA 1RG9A 1KZ7B 4FE7A 4BP3A 3QKSB 4V3CA 5AQEA 4H1TA 4L5BA 1KI7A 1J2RA 1D4AA 4IZIA 3OU7A 3I6ZA 3OE7D 2VK4A 1I6WA 3G3EA 4PBTA 3UO8B 1VYHA 1ORWA 3I1FA 2R87A 3ACCA 3DKVA 2I2DA 4GBGA 5CNMA 3P1JA 3CQ3A 2IU6A 1A8IA 1BXRB 5EQJB 4FUQA 2X5KO 3QHQA 1Z74A 3TXAA 4XUGB 5DIZA 1CQPA 1OIXA 2XUKA 3OX4A 1ZGZA 1XRAA 4N0MA 1M1YE 5DNDA 1S5PA 1NMQA 2D0IA 1NW8A 3EEYA 3QE4A 3F74A 4FDAA 3VR2D 3AY6A 3BILA 3VPDA 2MINA 2VSFA 5ETJA 3SQXA 2JFYA 4HNQA 4D8TA 2P2YA 4HNTA 2PX3A 2MTBA 3IO3A 5KCZA 2CL7X 2XCRB 1ZX1A 1WETA 1XKQA 2HA7A 2D59A 2XXJA 2YDXA 4O4JF 5ALOA 3EUEA 1W0JA 4FJ0A 4DLUA 1YNOA 2RHMA 2PT6A 3PIRA 4R5HA 5FDFA 1K86A 4DR5B 1MZPA 3D0QA 1H2AS 3C3XA 1HT1E 3OIFA 1NSYA 3C3WA 1SZCA 3OURA 5LB2A 1D2HA 5ICGA 2OHFA 3A6KA 4LF5C 1WPGA 3A6HA 4Z9XA 4V0SA 1EFCA 4ZU1X 5JNTA 5G0WA 3EVFA 3G17A 2FZWA 2YQ5A 1NW7A 2P7HA 3QVMA 1Z8NA 4UHFA 1RXIA 3BGOS 1OQAA 1NE7A 1XMVA 2FPWA 3CGWA 3NOVA 4PQFA 4DSNA 1G8YA 1DBWA 1HV8A 1KJIA 3IDAA 4G0ZA 2YQZA 3LYLA 2OLKA 4IR7A 1JEEA 1U80A 1XYGA 1VA4A 3WICA 3IRVA 2GFHA 3M3DA 1T0PA 4LNHA 2BD0A 5FR2A 3H84A 2IHBA 2YWBA 1R66A 2AL7A 2NW6A 3EBOA 1XHFA 2VWPA 2P79A 1KY2A 4RVCA 2MCFA 1XZCA 3C15C 3FGZA 3CZ5A 3HKDB 4PLFA 1U2DA 3RV4A 5EUCA 4DMCA 3WQSB 5CB6A 1PWYE 1W5TA 2L18A 4P3KA 4FYYA 4XGKA 3IUBA 4KFUA 1X8LA 3CWCA 3JZDA 3TQSA 3VO9A 5ARBA 2A1TS 2VZ0A 3JQQA 4UCXA 5K5EA 4BXOB 3AEXA 2WTAA 1IQPA 3ONNA 1YZVA 1KMQA 4WY2A 3OQNA 1JFTA 1EINA 2R8EA 3SEAA 1HYQA 2QVGA 2O3SA 2C3UA 4JC5A 2ADMA 4AQYC 4QPZA 3H9QA 3FFWA 2PEZA 2AN9A 1FFHA 2JHAA 3FPHA 3I09A 4CL0A 4EG0A 1W96A 3N8DA 3DLBA 2ANBA 1F38A 2DFVA 1KVRA 5KVQA 5CLLA 4DA9A 3GJ6A 4XIYA 4DJJA 4A92A 1RY2A 1GGJA 3BULA 3KTDA 3DXZA 2BGUA 4ZAYA 4AVYA 2IX3A 3EYAA 5CEFA 5EZYF 2H4WA 4PHGA 1Z06A 4ZV9A 2Z04A 1K2VN 1XAIA 5IC6A 3F4LA 2VG8A 3LHIA 1XRBA 1GAEO 3SS8A 3EA4A 4YRCA 1Y3DE 1XRCA 1M1XB 3L92A 4QTXA 4H08A 2G08A 5HOQA 2HIMA 3B38A 2NZWA 4AK9A 3SSOA 4EOGA 5BR8B 3AINA 2P40A 4HJRA 4RPJA 3OAAD 1DBRA 2Z09A 4K6CA 3J81A 4X9XA 1CUUA 3QPVA 1N1EA 5FI3A 1JI3A 2VR1A 2GK7A 1P0MA 3E8SA 4IJKA 4IDHA 2TYSB 4AF6A 4DGQA 3KQPA 4BNNA 3G0OA 3LZ6A 1MO6A 1SAYA 5F4ZA 1KQGA 2GUWA 1DRJA 2VLIA 2WJPA 2JGMA 3WTBA 4ERXA 4ZARA 4TKVA 2R97A 4PXAA 3B85A 2OE2A 1ZMOA 4NH0A 1Y3FE 1YOVA 3NDIA 2W6NA 5IH7A 1NW6A 1O5OA 1YUBA 3CMCO 2NZYA 3NDJA 2WM8A 1SD5A 4R81A 2Y27A 2DFDA 1W85B 2Z8ZA 1Z08A 4HAOA 1IEWA 3A1FA 3O26A 4DABA 1KP9A 4Q1AA 3O92A 3ZWBA 1BDJA 2V0CA 4OJYA 1FTGA 3GP3A 4PF1A 4PO8A 2GNOA 4LF4C 3WBBA 1BW9B 4YRPA 3P9ZA 3WBFA 5BWLA 1G8JA 1LBQA 3FHJA 4S1TA 4ZXPA 3CISA 3RB8A 3D7MA 2ZRDA 4DDKA 1N2GA 1QAMA 2QRPA 4IDDA 3L7YA 1BQ3A 1CU1A 1ZNYA 1ZXXA 1K7CA 2QIPA 3DNMA 3Q3VA 4LSGA 3RVRA 3MT7A 1MFPA 4XGQA 1CC1S 4OPMA 1KYVA 1KK1A 1M2OB 4F3CA 3KT8A 3D7RA 4X8LA 2GCOB 3WLLA 1PDOA 2CLCX 3I0NA 5ES4B 1YT5A 4MWZA 1X8KA 3R0XA 1ZGGA 1YR8A 4D4MA 4BKOA 1YWGO 1F6BA 2OVFA 1YJAA 4M0LA 1N5MA 4MUEA 1Y42X 2H52A 2J5RA 3BBLA 3ONWA 4LKRA 4MA5A 4TKLA 4FMCB 4RZHA 1B41A 5FLKA 2CFSA 4YP9A 1DUVG 4Z99A 3V8MA 5JT1A 1EESA 2D1TA 1Y8RA 1H5UA 3KQSA 3QI2A 4GKKC 2IYPA 3RUAA 3SXJA 1ZUD1 4BNJA 3MGCA 4PHFA 4BFXA 3L9WA 2R7LA 1VCHA 1PUIA 4JBHA 2ZUTA 2WTNA 3BGIA 3NBQA 1GPH1 1VRVA 3RRNA 1ZR4A 4ZQIA 1Z37A 3R7DA 4KMOA 1FMLA 1ZK1A 4U9UA 1Q14A 1MNAA 2CLDX 4G0WA 1BKSB 1E2FA 2BEKA 4Q7JB 1QP8A 4IDQA 1X1DA 5ESRA 1COWD 4X7RA 3TDKA 1NSTA 2ZT7A 1RZRD 2QVCA 2ZUWA 4RYLA 3DFKA 1KPGA 5FT9A 3MRSA 1NZFA 1N1GA 4AT1A 3VZQA 3S55A 3WLNA 3R3SA 2KE5A 2I7CA 1V7PC 4IX9A 1LJLA 3SEFA 4D9JA 1KZ4A 2HB6A 4BRUA 5BUCA 2D54A 1MQAA 3UBMA 3NAZA 3U61B 5DBEX 3L4SO 3C48A 1K6JA 4LXIA 2PXAA 1P9NA 2I2AA 1UFOA 1R6BX 2P9CA 1SVUA 3ADKA 3K1TA 4UE2A 4XQCA 3RSOA 1Q7RA 2VWHA 3I8SA 4ZK2A 1XMQB 1JEDA 3A1VA 4S05A 2HU5A 4GP7A 3WJAA 1NC1A 3OEHA 3LWBA 2NUTB 3LO5A 4D80A 4YMIA 3QU4A 1EMDA 2BJHA 3TIVA 3LBYA 2HXSA 2V55B 4B7AA 5CX1A 2OCKA 3K1ZA 4U5XA 2CD7A 2H65A 3LLUA 4X1KA 4CKZA 2AXEA 2D4AA 3RABA 2C4HA 2OG2A 3DR5A 4NG4A 1NM5C 3KPUA 3EARA 4EPTA 2ZM6C 3A0RB 2ALJA 3QY0A 4XUDA 3ZHSA 1HX7A 3K9QO 3QQ5A 3UHJA 2GBLC 1BE0A 5J40A 1E6UA 2NTEA 2QLNA 1DKLA 4JC4A 4LOAA 4R7TA 1VMKA 3JD3A 4F6RA 3K0FB 1N36C 4DYHA 5C9ZA 1J1ZA 4U3JA 4U7DA 4N12A 2X42A 3U3DA 1PQ4A 1CR0A 3I9OA 4YP5A 3ACDA 2GRJA 2WT4A 3PHJA 4YUAA 4XSHA 2OLEA 2CJWA 4C21A 2WU3A 2QM8A 4RIIA 1U90A 4ZOEA 3C16C 4AJLA 2M5HA 4M7RA 1JSRA 2OMKA 2PLNA 3E4CA 4ZRNA 1Z88A 3JWEA 4IUBS 4OYHA 4DN6A 4PYJA 1JQEA 2PN2A 1XZJA 2VXOA 3GFPA 4KLCA 3HB5X 4PIMA 2X0IA 4HEJA 4I4TA 2XZPA 1GRQA 1U28A 3JSXA 2BBOA 5CRIA 2QL9A 5AW0A 4F71A 4PWZA 1RBZA 5FBHA 1LFDB 3RYFB 3RJZA 2FEAA 3M8KA 4XRRA 1Z25A 4TT8A 4LHSA 1NKSA 4M7WA 3U48A 1BCRA 1P5RA 1T1EA 2IHVA 2ZSEA 2FQWA 1U8ZA 1GT6A 3PGLA 1ZZGA 4JJ4A 2QQEA 4LXXA 4NLLA 2R11A 3OIYA 4HRAA 2PY6A 3WK5A 2EFHB 4A9AA 4LDRA 2ONFA 4AP5A 4ALKA 1MJGM 3NHFA 1UBEA 2EJCA 1B0PA 4CMJA 2EKBA 2LP4Y 1TJ5A 3TW8A 1DCMA 1QIFA 4BNTA 4I9FA 3X2FA 1RWMA 4TYNA 4MQFA 4DXDA 4F60A 2VK8A 1Z4LA 4B75A 1JQBA 1G7TA 1NZJA 2VT6A 4MP3A 5HZMA 1G8AA 3CZRA 1P5ZB 1XK7A 3B36A 2J7PD 3VR2A 3RAFC 2MMAB 3GZTB 4BX9A 4ZCMA 1EGQA 4DSTA 2WWFA 3Q9NA 4RTPA 1NBMD 2AOUA 1D2AA 2AN4A 1YS1X 4JSTA 2CD9A 2O2IA 4PRZA 1Y6RA 4LF8B 5ITZA 4U00A 3BVPA 5B7GA 5AVQA 3CRRA 3PFIA 3WRXA 4ISBA 1FQJA 1F0KA 4ZODA 3ZD9A 4YAIA 2D1SA 5FJJA 2NVUA 1KP2A 3U4GA 2WTMA 5WRFA 4UM9B 2ZRQA 5ITVA 3SR0A 3OQIB 3U19A 2R9VA 4XUCA 2RHLA 521PA 5TVGA 1I2ZA 1ZM4A 4PIPA 3V8NA 4I36A 5LZ8A 2ZI9A 3M49A 3RC1A 4YUXA 1N33C 5K3OA 5ILOA 2WSMA 1V6SA 1KPHA 1CEEA 4GYJA 3Q8MA 1ZN2A 2CL0X 2ZU6A 2JD2A 2YV3A 2OR3A 3EMVA 1XRMA 3R3ZA 2G4VA 1TVEA 3R5JA 3WC4A 4OHYA 3DYIA 5K4HA 2FK7A 1G3MA 1G19A 1C30B 1QGUB 2EFJA 3EOAI 4HMOA 4TLEA 5G4KB 3L1VA 2ZB2A 2IOYA 4PGFA 2I3AA 4MVXA 5LA6A 1G6Q1 3FLEA 5BQOA 1YBMA 3WHPA 3V1TC 5K7SA 4DADA 1WY5A 3S8EA 1WQ3A 3SHVA 1L3BA 1WMAA 4M49A 1OSNA 2J3DA 4TWRA 2RI6A 3ENKA 1W9MA 4B45A 3V7NA 2ZZKA 4XEUA 2P4HX 3GJ5A 1R8SA 1CUAA 4KB5A 2BJWA 2J6BA 3R5HA 3LBHA 1QRTA 4DYDA 4B82A 1ZM2A 3I23A 2PZEA 3EQZA 1GQFA 4P3PA 2JFFA 1W8DA 4EYOA 1AMNA 4QDXA 4QSMA 2J85A 1IBLB 1MC5A 3TTVA 4QEDA 2ZBEA 1E3WA 3O93A 2V97A 4P4TA 2NM0A 1QO7A 1RD4A 1XK6A 3QX7A 4BGVA 2MM9A 1FFBA 3H5LA 5EP3A 3VPCA 5AESA 5AW3A 1QPZA 5H9UA 5C32A 1QCYA 3M6WA 4ITVA 4P54A 1ZVMA 3IDSA 2LZ0A 2QYHA 3PQ3A 4M1EA 3PCTA 4XUEA 5JS2A 4EUFA 1M34A 3KPYA 4XQEA 1PGQA 1C2TA 4S35A 5SZHB 3V97A 1XU9A 4CFZA 1BKDR 4G9BA 3FR8A 3SLGA 2RGEA 3BMCA 4JA2A 3SHTA 4OHWA 1UQUA 1HLFA 3WIDA 4R6WA 5IAEA 3P2YA 5GOTA 2DR2A 5FH9A 3UXHA 4RKQA 1E9FA 4BX0A 2O7QA 1E2JA 1GL9B 3OAAA 3L0OA 1CQWA 1FYXA 4DM3A 1HSZA 1XDSA 2H59A 1S7GA 2V6FA 3N2KB 1TJNA 3JQCA 3G2PA 3PROC 3L0SA 4YRZA 4HX2A 3UT5A 5L3QB 2IHUA 5A3RA 1NQTA 4CE6A 1HF3A 5FADA 2BMEA 3BHJA 1D1SA 4BAUA 1C8BA 1DAHA 2V7UA 3GD7A 1T3LA 2FZEA 1PZFA 3L6BA 1BYUA 1OIVA 3HJAA 2AR9A 2MYTA 2G06A 5AUQA 3FYCA 4XWKA 1K97A 3ORQA 3IAS6 1CJBA 1J42A 1LPAB 3EVDA 4Q9AA 3AC0A 1JVSA 1JHMA 1X70A 2Q8QA 5DLPA 5DN6A 3NBZC 3NTXA 3QVTA 1UJCA 2P8JA 5CM8B 1YASA 3WZLA 1U6IA 3KYDA 4WBXC 4LMBA 4G24A 1WRBA 1CV2A 3MLBA 2HPAA 1VSUA 3FGNA 2IYTA 4E13A 1G9XA 3DMTA 2X40A 1C9JA 3DKIA 4MVJF 4MVWA 5DW3A 1NG9A 1HR0C 5CIYA 2YICA 3OF2A 4IYJA 3TLEA 1QU3A 3L43A 2JFWA 4E51A 2BEVB 821PA 1GU7A 3HJGA 4XDHA 4MQ6A 1YDMA 4XAQA 1PEKE 1Q92A 3KBOA 5DPMA 2PZKA 5EWJB 5LMNB 2YC4C 1TT7A 3A4TA 3NWOA 3SDSA 4F2WA 2YWDA 4JP2A 2DOKA 5L3SB 3H2HA 3BXPA 3LY5A 4MZDA 4X8HA 1QLWA 3TNDA 2O6HA 3N0RA 3THXA 5LD2B 1V4VA 1EXNA 1I0ZA 3MWDA 4MW0A 3WTCA 5HS4A 3NHWA 5J2TA 1PJSA 1UMKA 1OYOA 3HNOA 3RDPA 1KO8A 2WFLB 4B74A 4CU2A 3MINA 3BL6A 3F3MA 3URKA 3ZG6A 1P9WA 3HB7A 4N8SA 5A7GA 5CYGA 3RCBA 1X80A 1VE9A 4KPYA 4OJTA 2V7TA 3F6SA 4HGOA 1VJCA 1EHCA 2XE6A 2XMDA 2GO7A 2PGAA 2ZIWB 1E9BA 2BEWB 3DD5A 3EA5A 3IBYA 4RJJA 3W79A 2B1IA 5CDYA 3E5NA 2HMSA 2O0KA 3NASA 1PSWA 4HAIA 4IVPA 3IHKA 2XUZA 4RMHA 3ROTA 3SYKA 3EZGA 4G81A 5BN5A 1P1JA 5LR6A 5GPBA 3SOPA 3W2EA 3OMWA 1WU7A 3KLBA 1GCGA 1L7BA 1COWA 5THQA 3IAUA 1R0YA 1SUIA 4WESA 3GZJA 2VT7A 4KI0A 4BCAA 3C43A 3NHYA 1DBIA 3BD7A 1UOQA 3B6JA 2ZSKA 2WJ3A 3OOSA 4TTTS 4HH0A 4LHWA 3N7AA 2N1MA 4WJZA 4L5JA 3IYLW 4RCVA 5B3LA 4D4GA 2ZB7A 1NVKA 3WE7A 4BVKA 1FSZA 2AJTA 5ABPA 3SMVA 3K92A 4HAVA 1V6AA 3CZPA 5TMBA 4YXFA 2VHZA 1PYOA 2WG1A 2CFRA 3N5CA 3A6FA 3CCCA 4P8RA 5TV2A 4B44A 5GP1A 6YASA 3N07A 3W5DA 3BJMA 1V7ZA 6AT1A 2PANA 5F76A 4QJ3A 3MD0A 4ZYWA 3BWVA 1DARA 4MRAA 5JMWA 1WHSB 5K2MA 3KKOA 1H69A 1IBMB 4PS0A 1JFVA 4N18A 5J4YA 5JHHB 1PJ2A 1II9A 1ZS9A 3R7FA 1TEXA 5BWOA 4JUBA 2IS6A 1VSQA 2HHAA 3IEKA 1D0VA 1FUIA 3CNLA 3K5WA 4Y18A 1RZUA 3G8CA 3OT1A 1D04A 1DXQA 1A5BB 2WJGA 3FETA 3OTGA 2Q6TA 3JQ7B 5KWIA 1EX6A 1YAJA 1UDXA 3W6OA 3C5CA 3DDOA 3OOWA 1U7OA 3SYTA 1JAYA 5AQ1A 4G25A 1YMVA 4GE0A 5EIBD 1WSWA 3GMSA 4KKXB 5FB3A 2FFRA 1E5XA 1A3CA 1EFTA 1Y6JA 2X0DA 4W9MC 2CUTA 3BHNA 1UP4A 4CG2A 5LMZA 2P77A 4KP7A 3HEBA 4ID9A 5JMPA 2CSUA 3GXBA 1WKBA 4OQFA 5SYAA 1UXOA 3BGWA 1H8HD 3OCZA 4UDYX 3OU6A 4PSDA 5IJZA 3GFTA 4EZEA 1UC8A 3LQYA 4QPDA 2RGNA 1R0SA 3BRCA 3D6TB 1KPIA 4CMIA 5EE3A 3T94A 1EGHA 5K6TA 2C0QA 3AB3A 1Y5RA 3VSEA 2D13A 4D3XA 4GAEA 4ZZ2A 1PUXA 2YN0A 3GJ7A 2C3PA 4IQ4A 2OORC 2P6OA 5A5DA 1ID8A 3WGIA 4JHLA 1VXRA 2XLBA 1AZWA 3I6QA 4XPIA 2VYVA 4AP9A 1AJEA 3EA0A 1UCFA 4O2BA 5B7QA 1T0UA 4CM9D 4ZI3A 1ZCFA 4KWEA 2OCAA 1HDXA 2CNWD 3JQ8B 3FOZA 2O8EB 3VHLB 3EGXB 4GMGA 2JLAA 2BFDA 3U60B 2WAYA 1VYUA 2X2FA 2AMVA 5TX7A 5EJ6A 4GMHA 3RADC 4Z1MD 1MDBA 1EUZA 1TTTA 2ERXA 2POQX 3P5BA 1L2TA 4AP6A 1LSSA 5EQTA 1FVXA 4JVMA 4JI1B 2IUFA 3FHLA 3UGTA 4DR4C 2VYQA 2UKDA 4LHVA 2GBGA 1KDVA 2ABWA 3TLAA 3ZUGA 5A9SB 2IBSA 1AV7A 1P9OA 5JPCA 1R0KA 1SQSA 1IHYA 1HKHA 4NMLA 2G80A 2AFIE 3VJKA 1U1DA 2H7YA 1E61A 3AHCA 2VP3A 1J8FA 3HCAA 3GOHA 4B5LA 2G5PA 1I6KA 1MGPA 2A8YA 2J7PA 2R3SA 2RCNA 1VBNA 1X74A 2IEZA 1GTJ1 4NZNA 5EHIA 4BNGA 4F97A 2G4CA 4MGYR 4F56A 1JG3A 3RJTA 1MXCA 1GXSA 3MTBA 1Z8DA 2I1VB 2YZ2A 2ZDHA 5AOCA 3RGGA 3JAWA 5BVGB 1LTHR 1X7WB 4YHHB 3V34A 4JV5B 4TZ0A 2AOWA 5T6BA 2WIAA 4IXWA 5LQMA 1YZGA 4DFDA 4PSVA 4DMLA 4KNWA 3F6CA 1TH5A 1BWSA 5JTTA 1ZWLA 2B92A 1E7MA 1VCNA 1T43A 2B1JA 4NZPA 4B71A 1GIAA 1JQLB 1H8ED 1R16A 2PA3A 2PKYX 2QN9A 1XEWY 1P4EA 1XKLA 3MJRA 2RJOA 1XEWX 3KYCA 3P8ZA 1DUIA 2IGBA 3FTNA 3T1YB 1H6BA 2VNKA 4MW6A 1NJ2A 1N8SA 1PJCA 3QU2A 3H04A 1VG9B 1XTSA 3V32A 2QF7A 4KXMA 5BQPA 5AVVA 3UJNA 3K70B 2QUHA 3KX2A 1YO6A 3OQBA 4R0VA 1LD3A 1EEXB 2XNDD 3KOZA 4L8YA 3RSFA