3R9XA

Crystal structure of era in complex with mggdpnp, nucleotides 1506-1542 of 16s ribosomal rna, and ksga
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase Era
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/transferase/rna
total genus 102
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3r9xA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9xA01
4CF7A 4R71A 1N5IA 2C9YA 1PLLA 5TMPA 2AD5A 1T5IA 3HJNA 3UANA 2AX4A 2GJKA 3M0EA 4TYYA 1H8EA 2XJ4A 3LO5A 4KFRA 3V00A 1PLJA 1GKYA 1WRBA 3GFTA 4IDHA 1NJFA 3I5XA 1S3SA 5AJXA 4V0ME 2BJWA 2QG6A 3VNVA 2QU8A 1E0AA 1NJGA 3WMEA 1TUIA 5IWAC 5J40A 4CT5A 4Z1MA 3WNDA 5CLQA 3EPLA 4M0LA 2QMEA 1TX4B 1HR0C 1YU9A 3G82C 2QAGB 4TLDA 3SYLA 3AQ4A 2FX3A 1WMSA 2JLVA 1LVGA 2O8DA 5JCZA 2FSFA 2O52A 3HYRA 2PH1A 2ZJ8A 3L0PA 4LHZA 3TH5A 3P4XA 3L8YA 2QEQA 4PO9A 5KPJA 3O8RA 1DO0A 2EU8A 3U4QB 1IM2A 3OE7A 3CB4A 5EZ5A 1JQLB 5KNBA 5GADl 3U7HB 1YZLA 2YYZA 1DAMA 4NYMQ 2ZI3A 2DFKB 3DOFA 1XJ0A 3UG6A 1VCIA 2OZEA 1RRCA 3ZQ6A 3SOPA 3K70D 2QM8A 1NKSA 2QP3A 1M1YE 4DUYC 3EA5A 4PPFA 2V1XA 2CCGA 3VU9B 4DLXA 3NKVA 3QPUA 1DELA 1XBTA 3NHAA 4CEIB 1W5TA 1YZKA 3FDIA 1L2FA 1SZPA 1ZUIA 1GSIA 2B92A 3LY5A 2YOGA 2HJVA 1W0JD 4OYHA 1G8HA 4LV8B 4JLKA 1E9FA 3ZH9B 1OFHA 1TL7C 1FP6A 3UG7A 2O8EB 1S0UA 2XJ9A 1CBUA 4G5QA 2C77A 2Z4RA 3C4JA 3GCGA 5CK4A 1E79D 4HZUA 4URVR 5JS8A 4JL6A 4W9MC 3DOEA 1G20E 5FFMA 3VNUA 2QUZA 2RHMA 3Q9LA 1IN7A 4JJZA 3R8CA 3CZQA 3P27A 1F2TA 3X2SA 1DG3A 3IKJA 5HR5A 2EFHB 4A92A 3ND8A 3NBXX 3G5UA 3T5DA 2IBMA 4GMDA 4JYBA 1FPMA 5D3MB 1QHXA 4ZCMA 1TTTA 1MKYA 2H7VA 3K8YA 1QF9A 3O8CA 2ZRCA 5LB2A 3SR0A 4EPYA 1W49A 1ZNZA 2GJAA 4TL9A 1G8PA 2VP2A 2Z83A 4I1UA 2F7SA 2HF9A 8OHMA 2HCJB 3BB1A 1S2MA 4DJTA 4XSHA 1NMXA 1ZM2A 2FG5A 1W0JA 4NYJR 4U7DA 1VCMA 3CO5A 3IQWA 3CF2A 2QGZA 4JL5A 4NTZA 3QVVA 4QRHA 3RNLA 3FKSD 4GOXA 4LYHA 3UIEA 3X1DA 3ZYCA 5DSZA 1Y63A 4B3DA 4GOJA 4Q1FA 3IEUA 4L15A 4JBYA 4PQFA 1DS6A 4A0HA 4E22A 2GJSA 1N0UA 1QHYA 4GDFA 4GP6A 2WJVA 2ZVQX 4RKFA 3CUEF 2BWJA 2ZM6C 4XJXA 2I3BA 2WJIA 4TMWA 5EP1A 4OQXA 4D0GA 4QJ3A 3W9YA 4F93B 5H68A 2B6HA 3RRNA 3K09A 3KXKA 2CHVA 2BBWA 2WWGA 3IGFA 1KI9A 4D0NA 4I1OA 1Z47A 2IYVA 2NTYC 1AQUA 2WMNB 4OQFA 3VR2A 2ZJBA 5JRJA 2ZS8A 3CX7A 4C0JA 4URYR 1NP6A 1VCNA 4IOMA 4US0R 1ELOA 1UDWA 2D3WA 4Q18A 1R10A 3HU1A 5CM9C 5JJIA 2JLRA 1OE0A 4URWR 1XD9A 4HAWA 1G7RA 3M1IA 3DKVA 5B2ZA 2NQ2C 5GJVC 5EQTA 2IEZA 3FKQA 5G53C 4A8JB 4DKXA 1CJMA 4FMDF 2NG1A 1HA3A 4EFNA 2PX0A 3FKSA 4Q7LA 1Z5ZA 4NXMC 2OXCA 1IXRC 1FL9A 4Q1DA 5L3RA 3CLVA 2OG2A 4DLYA 4D26A 4TT3A 2UUAC 3KQNA 3GLFB 4AKGA 3QI2A 5CYPA 2UXBC 2FN4A 4DEYA 1DOAA 3R7WA 3GPLA 3WP1B 4LF6C 3AP2A 4EPWA 3GKUA 2J41A 2CHQA 4A9AA 2BVNA 2KZFA 4LBWA 2ZE6A 1SXJB 2ZRBA 4B3GA 3HR7A 1OH7A 2PCLA 4NCJA 2P3SA 5JWHA 5IRCD 4NZYA 5BYKA 4CRWB 1LW7A 1P2UA 2OAP1 3OIUA 1JXOA 1MOZA 1Q44A 2PLFA 4TL7A 2BHRA 4M1OA 2F1JA 3BH6A 1XMVA 3C16C 5AJZA 5EE3A 4F38A 1TF2A 3QPVA 1Z6XA 3KFVA 4AKIA 4MKFA 1E2EA 1LS1A 1US8B 4QBGB 2FPLA 4ZI3A 3AVOA 1KDRA 1U9IA 4HATA 1JOSA 1E0KA 4M22A 1NNEA 6Q21A 3UKDA 4B3BA 2J0QA 3KKOA 2IUUA 4PQYA 1HURA 3LFUA 1T3HA 2VPPA 1E9EA 3O8DA 5JS7A 5K8TA 3AVWA 1ZNXA 3KZ1E 4MH0R 4X62C 1DO2A 2IYYA 2DCUA 4OHXA 5FPYA 1LY1A 4LC1A 4ZDIA 5CB6A 3GLGB 2HT6A 4JLDA 3BORA 3OHMA 4X8MA 4DC9A 5J4HA 1KAGA 4IEIA 1LF0A 2XSZD 1OLOA 1BYIA 1T0HB 3K1JA 1UKYA 4F4IA 4LHWA 2RGGA 1XEWY 4US2R 2WM9B 4BLPA 3THXB 1QRAA 4Q4HA 2YOFA 2J59A 1IJFA 5CIWA 2W2XA 2JLYA 2QAJA 1IHUA 1VG8A 1VCOA 2JASA 3BS4A 3THWB 4TYPA 1VG0B 3IIJA 2C78A 2GDJA 1X8LA 3BH0A 4G1UC 2CJWB 2Q9AA 1Q22A 1E2FA 3T06B 4DLZA 2OXRA 4AK9A 3B5JA 5A5GA 1G8FA 3GLHE 3HYTA 3EZ7A 2MMGA 3A4MA 4MDEA 3WBKA 4A4DA 4A2QA 1E9RA 1XCMA 4LF5C 2G0NA 4B34A 1QHGA 4MRNA 4EPTA 1RYFA 3K9GA 1YZGA 1RZ3A 2EFGA 1LFDB 3DZ8A 5ANRB 3SJZA 3LVQE 4DB2A 4OKSA 4MYTA 3CBQA 3KB2A 2UZIR 1E2GA 3A36A 2ANCA 4DZZA 5SZJA 1ZM3A 3O47A 1T8UA 2IXGA 3IDQA 2GCOA 1S96A 1Z0KA 3BFVA 1Z07A 1T91A 1NBME 3AGPA 3H84A 4K8OA 1V43A 3X1YA 1NKTA 3A1TA 2G0TA 3E5HA 3DZDA 1MO3A 3D8BA 1IY1A 2HDNB 1QHSA 2W58A 1TEXA 3U4QA 1XJCA 1E3MA 3KDSE 5K8IA 3U5ZB 1G7SA 4GFDA 1JI0A 2JLXA 4LHXA 4MITA 2CLDX 2R6FA 2W0MA 1NVVQ 3K09C 1KSGA 3SU8A 1H65A 2CXXA 1ZP6A 3P26A 1XJQA 2E8FA 2ODEA 1P60A 1GKIA 3DHWC 3TE6A 3UMRA 2JMPA 1XEXB 3VU9A 3BWDD 1XMQC 1LTQA 5KNDA 1J5EC 1VG1A 1W0KD 4CEIA 1Z6AA 1CRQA 1SKYE 3QF4B 4TLEA 2JIZD 2ZUCA 1XD8A 1W4AA 2YWEA 3KKQA 4HAYA 4TMXA 5JHHB 2XZPA 3RSOA 1YKSA 2ZYVX 1RRPA 221PA 2FU5C 4TMVA 4PAQA 5H70A 5CDFE 3KL4A 3ZD6A 2QSZA 2O8EA 1DAKA 3BFKA 1P4SA 3RHFA 1Z6TA 1L2TA 2Z5FA 2ZRIA 3T34A 3A6PC 5J4YA 3GJ5A 3AGQA 4OK6A 2IHBA 4WZBE 2F6RA 3LBIA 2ZRFA 4Q1BA 4F91B 3I61A 1N5LA 2NO0A 4ARZB 4OL0A 4IOJA 1WF3A 3QVUA 1OH6A 1KI6B 2QI9C 2I1VB 4JLOA 1N25A 5CB8A 2WWIA 1AS2A 3JVUA 3TGPA 1ZUNB 1YR9A 5AR1A 2ZSFA 5D3MA 2O8BB 3GLIE 4JVMA 5FI1B 2RMKA 5BWMA 3I8SA 4MRRA 3ZS9A 2AXNA 5FBRB 3K0SA 1SVSA 4QM6A 1FMJA 4RJLA 4B44A 1CRPA 2QL6A 2V7QA 5EZ6B 4B43A 4JT2A 4Q01A 2ZUBA 5UKDA 5BN4A 1EWQA 1FOEB 3EPJA 4B3TC 2JIZA 2PBRA 2GRJA 5C1BA 4TQ9A 5EJEA 5K8UA 2AFIE 4Q66C 4YLGA 2O5VA 1U9IC 3W34A 2A30A 2C99A 1ZAKA 3R8FA 4LF9C 3KJGA 4C4PA 2QBYB 2PEZA 1U94A 3MWLA 2HXYA 2DR3A 1FW6A 5FOSA 2WJGA 4IKEA 4KFUA 4Q03A 1F3OA 1OYYA 4LV6A 4JSYA 1GZSA 4ESVA 3T12A 5IT5A 1FX0B 2RAPA 5FL7D 5K8LA 3T1OA 2VHUA 2PZEA 2VRWA 3OAAD 4AG5A 2BC9A 3QG5A 1X1SA 4B73A 3J81D 2Z4SA 3TVDA 1KO1A 4MQBA 4LC0A 4PHHA 4C2TA 5AK0A 3FHTA 3U3MA 1G3QA 2XNSA 2GKSA 1IXSB 3SS8A 3R20A 4C0SA 2HJGA 1OHHD 4C0LA 2J0UB 4Q1EA 3C5CA 5B30A 4PANA 1XPOA 2YJTD 2ZI5A 4TSFD 3AVTA 2ATWA 1UJ2A 4PXAA 5LDDC 2ZRAA 1OIWA 1QWIA 4NH0A 1NBMD 2VYFA 5BN5A 1OXUA 1NIPA 1OKKD 2JDID 4JI8C 5HE9A 3C5HA 1KK2A 2QSYA 1E1RA 3EZ6A 5B64A 4D82A 5HZHA 4OBEA 4A8JA 1E0JA 3QY0A 1R2QA 1XZQA 4O3MA 2H5EA 4NMMA 5H1YA 4KFSA 2FDCA 1EFTA 2ZJ2A 2OE2A 2ZI7A 3PEYA 2ATVA 1VMAA 3LDAA 2EFEB 2D62A 2OPLB 4QGFA 3GLFA 1BS1A 3EIHA 3CIOA 4MYHA 4RFSB 1E2IA 4X8LA 1HT2E 1ZD1A 4P32A 4XTCS 2A5DA 1PUJA 2QP4A 5FL7A 4KLNA 4DLTA 2VL7A 2GZAA 1D8TA 1EX6A 3KQUA 2WWYA 3OAAA 4LFCC 2H18A 2WJJA 4QKQA 1ZINA 3IPXA 1SXJA 5JWRA 4DIDA 1Z0JA 4ESHA 4MH4A 4B32A 3QXHA 1N6PA 2ZSAA 2VQFC 4KO8A 4GI7A 4MGYR 5LD2B 4H1UA 4QXAA 3B82A 1OHHA 2PMDA 1G3IA 2EWWA 4M53A 4MRSA 1KI2A 5AJVB 1CULC 5TXGA 4C2UA 4D4MA 1T9HA 1XZPA 3RS4A 4EQ6A 1NMZA 1KMHB 3CPHA 4AKHA 1KZ7B 2E7GA 2A7QA 3NBZC 5FOVA 1US8A 1NBMA 3TUZC 4CEJB 1MT0A 3LVRE 4EFLA 4JKYA 2JDIA 4Q4AB 5F3WB 2NO6A 4TLBA 5BR8C 4LYAA 2ONFA 3SI7A 2JJ1D 1L8QA 1P73A 5LPNA 1RIFA 1E2KA 2P5TB 2OCAA 4AKEA 1CJVC 4LSGA 3GLGA 1W4BA 4LJ4A 2NIPA 2RGBA 1VLAA 3ZZUA 1P62B 3DM5A 2GETA 3CNLA 4EKDA 2V4ZA 3PENA 4LYFA 4YQFA 2IS1A 2JJ2A 3AP3A 4II7A 1G9XA 1KMQA 4Y0AA 3ND9A 2BKUA 1I2MA 3AVPA 3EZ2A 3THXA 3TQFA 4HLUA 1KK3A 1UM8A 2D06A 3BFXA 3O8BA 2IT1A 1YJ5A 1JAHA 1Y3AA 2VHCA 5DHFA 4BUJA 4F7WA 4IDPA 1TUEA 2FPKA 3THWA 1MABB 1QHNA 2ZIAA 4NCIA 2WWWA 5LB4A 1GVNB 4D81A 2CJWA 2W2VA 5FOXA 4AY2A 1OIXA 5KSOA 1AM4D 3MJHA 4BFXA 5JLJA 1YR7A 4L8GA 2D7CA 2X1VA 1E4VA 2OFXA 1R4AA 4AD8A 4MGZR 1G16A 4IJMA 4O25A 2Q3MA 3QEJA 2J0VA 2FF7A 4DLWA 4LPKA 4FW9A 2JATA 1E99A 2ZETA 1HE8B 2IS2A 1TPZA 4H9GA 3F0TA 2ZI4A 4MGKR 2ZITA 2V6IA 4D25A 2QMHA 1W36B 2BM0A 3PFIA 4BZPA 2A3RA 3AF6A 1KO5A 1K8RA 1GL6A 3QE0A 3TLXA 4Q02A 3NVAA 3OEED 4QBIA 2DWPA 2VTKA 3ASYA 2ERYA 5CIQA 3NC1C 3TSOA 1M34E 2OAQ1 4UNNA 5DYIA 2XR1A 1CTQA 4OHWA 3WBJA 1ZIPA 3HPRA 2WSSD 5GVRA 1Z6GA 3B6EA 3SDZA 3PUYA 5EUQB 3E70C 2Z43A 4DB4A 4JI6C 1TMKA 1KKLA 3NDPA 3AB3A 3HR8A 4NYMR 2ZJYA 4B6EA 4WVFA 1SVOA 3RC3A 2YWHA 3CM0A 2OESA 3QF7A 4L4UA 1XEXA 1JNYA 1G64A 2GA8A 3SEAA 2KJQA 4JMPA 5DI3B 1FUKA 2Q0HA 3BBPA 4NCKA 3QF4A 1ZVQA 2LCFA 3PIRA 1TQ2A 4YHHC 1IAQA 3FB4A 2IS6A 2MMCA 4BFVA 1BO6A 4P4SB 1N2FA 1YRBA 2LWIA 2XAUA 4BEJA 1B0UA 1F6BA 2XX3A 3BIFA 1R0ZA 1II9A 1SQ5A 2PN2A 2REBA 4OHZA 1Q1QA 4HEJA 1SVMA 4I4LA 4M9ZA 4PZZA 1D2EA 1S8FA 4FMCF 1VECA 4KODA 4DSTA 1GFIA 1XRJA 2AK2A 2Q3FA 3VHXA 2P5SA 4KHPC 4ARZA 4N0DA 3B1ZA 2YCBA 3OEEA 3RWOA 2QT0A 1KI6A 3TK1A 4DR3C 3RRMA 1YR8A 1E69A 4B33A 1OXTA 4HDOB 5FTMA 1OJLA 2PZGA 1U81A 2GILA 1DAHA 4Z1MD 3PITA 2O8BA 1GTVA 3VHLB 3RANA 2IYXA 2QPTA 1E2LA 2B7CA 4MUAA 2VP9A 2A5FA 3OFND 2A2ZA 3A58B 1R0YA 4NYIQ 1S9DA 3W6OA 1ETUA 3IILA 2XITA 2O0JA 4PC1A 4HZIA 4CW7A 2OCBA 4B3CA 3FMFA 421PA 1E9SA 1KI7A 4BWYA 3J81k 2BM1A 5JJLA 5EXTA 5KHOC 4LRWA 4PAOA 2ZI9A 3PR1A 2QBYA 4V0OA 1NYEA 4PSKA 5KYKA 1G7CA 2TMKA 3TUIC 2A78A 3SQWA 4TTRA 1NY6A 3EASA 1OXXK 1P3JA 4BEBA 2E8EA 3JZMA 2F1IA 5JBQA 1YZUA 5CITA 3V9PA 1FX0A 1Z8FA 1NVWQ 4QFMA 3OZXA 2AKYA 5TARA 2ZAMA 1XXHB 1I4TD 2D2EA 4Q4JB 1HH2P 3L0SA 4BFWA 1EWRA 3W6PA 3QKUA 3OIVA 1NG1A 4W5JA 1IQPA 1W2GA 2WHXA 3U44B 1X1RA 3IO5A 1FFHA 4XD7A 5DH9A 1N0WA 1E2MA 3EXAA 1D2NA 2R8RA 4IEEA 2KBEA 2J0UA 4E5UA 3PUVA 1RC8A 3OFNA 2QTHA 1KTVA 1CR4A 1Z22A 2FGJA 3EZ9A 1AKEA 3OTOC 5CK5A 2IX3A 2OM2A 1N36C 2Q9CA 1L7VC 3A1UA 2ZJZA 2ZYUX 1S3GA 1W1WA 1KI8A 1U8ZA 3RSLA 3ZD7A 1SVKA 2A9KA 4G0NA 4NXNC 5EXXA 3DL0A 4A82A 1P61B 4FMDB 2BV3A 4DUGD 4Q9JA 4DV1C 2XOKD 4QJ5A 3REGA 2HYDA 4JVNA 5IF9A 2ZAOA 4M1WA 4CDGA 3OIWA 3WRYC 1R5BA 2L0XA 4B3SC 2OPLA 4RFVA 3EG5A 3SQXA 1P2TA 4RFSA 4B3FX 3VR4A 3T15A 3LUSA 4JLPA 4XIGS 4JLMA 2R6AA 4AYTA 4JYAC 1TAGA 1ZU5A 4DDTA 1GM5A 1HE1C 3I92A 2P0EA 1UAAA 4ASUA 1ZB8A 1G19A 4QBFA 3T61A 3WMGA 2Q3HA 1D9ZA 3F5FA 3I62A 3SZRA 2IWHA 1R0XA 1R5NA 5JEDA 4UNPA 1HYQA 2Y8EA 1S1MA 4JVSB 1M6NA 1Z0DA 3ADDA 1KSFX 1HQYE 3WYFA 1GNPA 3TRFA 1KMHA 4KU4A 3ECCA 4NOZA 3QOFA 4CEJA 1COWD 1M8PA 1A7JA 3NHBA 4Q4AA 1CJUC 4EJSC 3CR7A 3KKNA 4JVLA 4GKJC 2JGNA 4B76A 2W6ID 5P21A 2ZE5A 3I32A 4DUGA 3FYHA 1A5TA 4PC7A 2ZXUA 4EAQA 4W5WA 1NG9A 2XOKA 4FCTA 4MA4A 2E5LC 1GOTA 1ZM9A 2ZRDA 2CVFA 4DLVA 2GNOA 3UMSA 1J70A 3C8UA 3KTAB 4LI0A 3IBGA 5L3VA 3K0CA 4JI2C 3RS3A 4H1VA 4JLBA 3QKSB 4XWOA 3HWSA 2KSQA 3Q5EA 4P4TA 4OI1A 1KJZA 4RD2A 2C04A 1USPB 1E94E 3N5CA 4I1SA 5CLLA 5G40A 2J46A 4OJKA 4Q9KA 2CL7X 4HAXA 1XCGB 2ZE8A 1EFHA 1GP2A 2R62A 1GKUB 4TT3D 2WAXA 5AUOB 1NLFA 4MKGA 1MABA 3OF5A 2WKRA 1GRNA 2FJUA 4BLTA 2H92A 1TADA 1D9XA 1XX6A 3PUXA 3LX8A 3MGCA 2B21A 2W00A 4JZKA 3TAHA 1T8TA 2V1UA 1COWA 1MO4A 4D4KA 2C9OA 4EPVA 2FSHA 4CEHB 4FWTA 2UUBC 4M9SA 1RYHA 2W6IA 1MR3F 1EFCA 4L16A 3B1WA 5SZIA 1DAEA 4L5BA 2ANBA 5TY0A 1IN4A 4AI6A 2REXB 3TKLA 2J0SA 3AUXA 1Z6YA 4WXPA 1SGWA 1EFRA 4KFTA 2ECKA 3ZIAD 2G6BA 1QZXA 4XSGA 4ZDJA 3EA0A 4Q1AA 3A4NA 4WAUA 2IC5A 4M21A 4FWIB 2EWVA 3T1HC 4DR7C 2A5GA 2FMXA 4DR6C 3SFZA 4WZAE 4A0FA 1U8AA 1U2RA 4M1SA 4DDWA 4RY2A 5GVSA 1IBLC 1UBFA 2ZR0A 4QGHA 1FUUA 3UWOA 1Q1BA 2ZR9A 4M1TA 2IYSA 3EPHA 2FV8A 1RJ9B 5L8VA 1NVVR 2ZVPX 1CR2A 5E95A 1C9KA 4HDCA 3DMNA 2PEYA 4Q19A 2YVUA 2FFHA 3TSWA 4FD2A 3W8NA 5BN3A 2G77B 2FNAA 3MCAA 4X8OA 4CT4B 1T6NA 3LLUA 1Z2AA 2FSGA 5HE8A 2RB4A 3UWKA 1PA4A 1OXVA 3D31A 3D6TB 5EXSA 1VKJA 1OV4A 2CEAA 1E4YA 4WA7A 1G41A 2CCJA 4D2IA 4P4SA 2F1RA 2UXCC 4OI4A 4NPHA 2GAAA 4LYJA 1NF3A 4GZMA 4R98A 5FR1A 5E7MA 1X8JA 2OV2A 4I81A 1ZC4A 4IXNA 1U0JA 3RLFA 2GHIA 3W3ZB 3ONWA 1J8MF 3SC3A 3W5IA 3I3SR 3E1SA 4X66C 2XNDD 2EYUA 2QORA 5LBIA 2A5YB 4X65C 3MJRA 3ZQJA 1OSNA 3ZIAA 1VDZA 3LNCA 1NLZA 4M9XA 4TTPA 3OIYA 2D7DA 2JLWA 3D7MA 4HB3A 4B2IA 1HTWA 5A4JA 2ONKA 3PJRA 1XNRC 1DBSA 5E3HA 5HPYB 2BIFA 2J9RA 5JI2E 2OCYC 3LW7A 2BDTA 3QXJA 1Q0UA 4B71A 1A82A 1H8HD 5FH9A 3V4FA 1ZD8A 2BBSA 3ZVMA 3AVQA 3BH7A 2SHKA 1VG9B 3ICQB 1HUQA 2E8CA 3GEEA 2DWQA 4RD0A 2OLJA 4FMBB 4LDJA 4MYCA 2AN9A 4B48A 3ADKA 2E87A 4UXHA 1JR3A 1EFUA 1P9WA 4K0KC 2H17A 2R2AA 2F43B 3QXCA 4OI2A 4ZO4A 4OQLA 3GLFE 1M7GA 1KNXA 3U6BA 2WVJA 5KNCA 4JLAA 1JJ7A 4NYJQ 3SBDA 1E2QA 3LA6A 3L0OA 4TN1A 3R9IA 2OFOA 5JRZA 4TQUS 5FBVB 1E9DA 4Q9HA 2C8VA 1DE0A 3K70C 2BEJA 1SXJE 2XNDA 2LKCA 2XB4A 3GJ3A 3U3RA 3VAAA 2O8CB 5BYJA 1P2VA 2GWHA 4V0KA 121PA 4ZDWA 2UZ3A 3VR5A 4B35A 1XXHA 1J8YF 1S9HA 3OESA 2WWHA 2KB0A 1AS3A 2ASEA 1KHTA 3I8XA 4OJQA 3LWNA 4ON9A 2YV5A 3P4YA 4DSOA 1H8HA 3U44A 3AV0B 2QNRA 1TF7A 2IYTA 1AGPA 3C14C 2QAGA 1MRSA 4Y0VA 4G5OA 1NI3A 4QNRA 4D6PA 4JIMA 1DAIA 4P3YA 3HPQA 5B57C 2W83A 1C4OA 2V3CC 1MRNA 1ZM4A 1NMYA 4S2EA 1E2JA 4R7ZA 1ZNWA 2QTFA 1U0LA 4D4JA 3REFA 3AVVA 3GLGE 1FJGC 4PPGA 4RD4A 1XEWX 3UXMA 3PEVA 4DV7C 4JBWA 1MO5A 4MUBA 1N6LA 4GMXA 3TW8B 4EFMA 2P67A 3ZS8A 3M4YA 4FINA 2VHTA 1QHIA 2V7QD 5AWFC 2C9CA 4KAXA 3K0EA 1JQJC 3B1XA 1CP2A 3AF4A 1OFIA 2FFAA 1J7KA 1BMFD 2V8OA 3WRXC 2ATXA 5AJWA 3QIAA 4URZR 5J4VA 5KDDA 4DLUA 4QGAA 3GP8A 4DDVA 4C0KA 3PUWA 2AWOA 1OB2A 4Q4LA 4Q5IA 621PA 4PSAA 5IK2D 2O8FB 4DR1C 2CY1A 1FQJA 2ZRNA 2P2LA 3K9HA 4FCWA 1AIPA 4TZ0A 4KYUA 1HNZC 3TR5A 3U7EB 1KGDA 4FCVA 4DT1B 4ZPXA 3NTUA 1II0A 1LB1B 1UEIA 1VHLA 1XDBA 1DAFA 4PSVA 1KDPA 3RABA 2DB3A 4BGDA 1G3MA 4RD1A 3S1AB 3ZVRA 1NIJA 4BLRA 1C1YA 4GL2A 1YVDA 3KKMA 3KQHA 4KVGA 4DWJA 1W47A 3CRMA 3IO3A 1NVXQ 2PJZA 1XTQA 3PV0A 4O0MA 5EE9A 1FTNA 3LH5A 1R6BX 1P72A 2PLRA 2VLIA 3AP1A 5JZVA 5CJ2A 1UBEA 2RGDA 2P65A 5TB5A 3UK6A 821PA 2WWFA 3KTAA 4A6PA 1G1MA 3Q3JB 4CYMA 2GF0A 1LQLA 2K5UA 1KI4A 3QKSA 3VR6A 1E1RD 1BMFA 2D7VA 2P6UA 4OK3A 1KJWA 1YZQA 4HUTA 1USPA 4WXRA 1HNXC 3BOSA 1R5OA 4LJ5A 5BQ5A 1KKMA 4EPXA 3T1VA 1DVRA 2HT1A 2F3RA 4LF8C 3QXXA 2N46A 2N1BA 3MLEA 5IK2A 1XNQC 3EW9A 2GXQA 1ZC3A 3UPUA 2IXFA 3CRW1 4ILEA 1U90A 2JLZA 4HAVA 4ITRC 4A1FA 2H16A 2WWXA 3LXRA 3GJ6A 3WP0A 3WNCA 3EZFA 4DRZA 1A2BA 3UATA 4C9BA 3AVXA 1KDOA 1SXJD 1OH5A 4QG7A 4DV6C 1E2HA 3A1WA 1GITA 1CIPA 4CEHA 4B2LA 4RCYA 2GBLA 3MWYW 3GD7A 1VYVA 2ZU6A 4RD3A 3B9PA 3PCRB 2F1HA 3X1XA 2WPDA 3CKLA 1EGAA 3L2OB 4UJ5A 3CX8A 1DEKA 1N6KA 3FHCB 1TU4A 2ODBA 1HNWC 3MWJA 5FPSA 3ICEA 2ZI6A 1EG7A 2C2HA 3SYKA 2CE7A 5JCPA 3IIMA 1NLYA 1W4RA 1KYIA 2VEDA 3WYAA 4LJAA 1J90A 2IL1A 3KUDA 2OILA 5C46F 3B9QA 4DEXA 3IIKA 2ZU0C 4YONB 1RJ9A 2VA8A 4KBGA 2YC4C 4LJYA 2JJ2D 3Q7PA 4R2HA 1W48A 2QAGC 1T0JB 3B85A 5KSPA 3I5YA 2PCJA 2G83A 1R7RA 4NE2A 2WJHA 4FIDA 5HCIA 4QOSA 5FBLB 1OW3B 2EYQA 1JXMA 4JI4C 4G5SA 4NU0A 2ZE7A 2G1JA 2E9SA 3AEZA 3WMFA 4UNSA 2ORWA 1UADA 4KYIB 4YMWA 1XTIA 2VSOA 4K81B 4DXAA 4LF4C 3T35A 4A2WA 4B3XA 1UKZA 5KPDA 3EC1A 2BBTA 1NVUQ 5FPTA 2ZJ5A 2CCKA 2J7KA 2MSEB 1XCPA 2X19A 3CPJB 3CNOA 1K0RA 2UUCC 2V9PA 2CXCA 4IW3B 1P7CA 3TQCA 1N32C 1IN8A 1OFUX 2UVQA 4LX0A 1XU4A 3TJZA 1OH8A 3NH6A 1R8QA 1UFQA 5FPHA 1GL7A 3TVTA 1T3LA 1ZYUA 1ML8A 2Q21A 1ZD9A 2R6CA 4KI0A 1X8KA 4QL3A 3NBYC 1KDTA 4YDHB 2EFCB 1ZRHA 1RRFA 1E2PA 3F3YA 1IJEA 2ZPTX 2VP4A 1T3SA 3ZZTA 4DCSA 3X1WA 2YC2C 3B8HA 2NOAA 2ONJA 3JZAA 2RGAA 1DAGA 1E0SA 1OIVA 3A4LA 2J3EA 2YHSA 1SVIA 5AUNB 3KX2A 5FUVA 4DCVA 3CX6A 4U00A 2DY1A 3QBTA 4DSNA 4YDSA 1QDEA 2VQSA 2JEOA 1QVRA 1N6NA 3L0IB 3CZPA 1SHKA 5J47A 4M1YA 2ZYWX 1ONBA 1J2JA 2WKPA 2MSCB 1IBKC 3GJXC 3W6NA 5DHAA 2XXAB 3TR0A 3CH5A 3H1TA 3FMOB 3KQLA 2HEIA 5AJYA 2AK3A 1CR1A 3EC2A 3C41J 2PX3A 1XMJA 4GZLA 4A2PA 1YRAA 2CE2X 2GJ8A 4PZYA 4F4JA 2E1RA 4OQMA 1N5KA 2ZYTX 3LQQA 4G5GA 4DIEA 4PHFA 2GK7A 3VX3A 2CL0X 4DV0C 2ZRPA 4TMKA 4DBLC 2R6GA 1WBBA 5JECA 3VQTA 2GESA 1YR6A 1QG4A 3EX7C 3ZJYA 2AKAB 1G8YA 4LZZA 4JT4A 3T1QA 4XTRA 1HQCA 4JLVA 4B6FA 1R0WA 1Q1ZA 1EESA 1U0HC 2ASBA 2XTZA 3TAUA 4AQYC 1BOFA 3CWQA 4KXFB 2ZRHA 4PFSA 2H1LA 2WAYA 1JBKA 3ZVLA 3BE4A 4ERNA 1Z0FA 1Q21A 1P6XA 1QHHB 4V02A 1XD2B 1P75A 4JS0A 1DTSA 1GUAA 2FH5B 2ZUDA 2KE5A 3AKYA 4EUNA 2RH5A 4IOLA 3CRVA 5KO2A 1SHZA 2IF2A 2VSXA 1UKKA 2BBOA 1KK1A 3UMFA 3H2YA 2EFDB 1ZU4A 3AUYA 1HEIA 1TQDA 4PHTA 3PQCA 4ZDKA 2GBLC 1KO8A 2BMFA 4CVNA 3FFAA 4QBHA 2DFTA 3RRZA 5DN6D 3EIEA 1RW4A 2RGNA 1KO7A 4BPBA 1S4QA 3FMIA 3IPYA 1B23P 1O87A 4A8JC 4DSUA 2AL7A 3BJIC 3N2EA 4RSGA 2Q9BA 1VHTA 2O8FA 3R7WB 3LLMA 4BFSA 3KFXA 5SZKB 3T1TA 2DPXA 1ESNA 5EE0A 4WZ6A 3B78A 2RCNA 1L4UA 1D6JA 4PO8A 4DT1A 2W6JD 2YNMA 3NH9A 1YQTA 1KNQA 4JI1C 2CDNA 3P32A 1U98A 2XTNA 1Z06A 3S1AA 1FZQA 4PQRA 4TZ6A 4US1R 4NL4H 1DADA 4XD7D 2B8WA 4N0EA 4C30A 2EGTA 2FZ4A 1ZJ6A 1SXJC 1YZTA 4LK2A 1N6OA 3Q7QA 1KSJA 2IXEA 2CNWD 2VO1A 3OEHD 3MSXA 4TL8A 3FTQA 1TU3A 2C96A 3WNBA 2VP6A 4M9QA 5JSZB 4ACBA 2F9LA 1FP7A 1V5WA 3GJ8A 2IEYA 1SVWA 4QC2A 4IXMA 3FFBA 1KKGA 4GSYA 4RZ2A 5FUXA 5FLXD 1FNNA 4V0LA 2C03A 5IDVA 1CS4C 4DCNA 5DN6A 2F4VC 2QT1A 1SULA 1ZCAA 5EUMA 3CRRA 4JL8A 3ADBA 4NP6A 1ZBDA 3U3JA 2IYUA 4IOKA 5KOYA 1MO6A 2JA1A 4HLQB 3VTKA 4L9WA 3WXMA 4E03A 5JFGA 3M6AA 2NMVA 5HKKA 3W8RA 4IHQA 1ZIOA 2ZRJA 4V03A 1OXSC 2OLKA 2CHGA 2P6RA 4LCBA 5JHGB 1G291 4PC2A 3RS0A 3R9WA 1NN5A 2ZJOA 4IDQA 1NN1A 3TNFA 4EDHA 2OSBA 1G3UA 3J80D 2W6JA 5LMUC 4KVAA 1HY3A 4ASUD 1J99A 4DR4C 5EXPA 3DO6A 4O2RA 3PVSA 3QUSA 4UNQA 4X8HA 1WXQA 3ADCA 4HLUC 3VKWA 3HP1A 1E9BA 4LGMA 2CLSA 1JEEA 1IONA 2CNWA 4BRUA 1ZM7A 2QPOA 4Z54A 4MKHA 2ZROA 3OEHA 4LJ7A 4RKEA 3D3QA 1RKBA 2OBNA 5GJCA 4GNKA 1TEVA 4F92B 2RKOA 1BKDR 1DPFA 3MG9A 4NCNA 1CLUA 4BECA 1Q20A 1IY0A 1G6OA 4V0NA 3I72A 5TDHA 5FR2A 1UEJA 4POAA 3RVBA 1OB5A 1OFTA 3JVVA 1R8SA 4HLCA 4L9SA 4FI3C 4LHVA 1GILA 2GCOB 3B13B 4NDZA 3CONA 4JKIA 1ZUHA 2JAQA 2C95A 1JB1A 2R9VA 3A1SA 2WJYA 1ANKA 3PEWA 1X3SA 5FOTA 1OPXA 1CU1A 1JR3E 4BLOA 3C7KA 4B3MC 4IDNA 1NY5A 2Z6VA 1Q1EA 4NBSA 1W4CA 3SYNA 4A0RA 1MH1A 1XWIA 2HHHC 1M2OB 2ZSEA 4HSEA 5IT9D 1Q12A 4PC6A 5ELXA 1K6MA 2DWOA 4MTNA 4YY3C 5FOUA 2V54A 3DPUA 2BOVA 3BGWA 1E1QA 3QSYA 2IYWA 4AYWA 3GJ0A 1IY2A 1XTKA 2FEMA 4EIWA 3QJYA 3KQKA 2P6NA 2IYQA 2OBLA 4KHZA 2O0KA 2QZ4A 4MDFA 2ZM5A 1AGRA 2GEUA 4IVRA 3TIFA 4ZCIA 4XOIA 2Z0MA 1KK0A 3PEUA 4G3XA 1XXHE 3KXIA 4URUR 4LBZA 5HCNA 4BLQA 5L3QB 1M7BA 4JV5C 3CF0A 2VH5R 3A37A 3ZGXA 3I1FA 1AA9A 3WHLA 3DDCA 2ZTSA 3VKGA 3K0AB 4LFAC 1PV4A 4Q48A 1AKYA 2QY9A 1YE8A 1BYUA 1XMSA 2RGNC 2CBZA 1W36D 3BB3A 4AG6A 3L8ZA 1A2KC 4WIAA 1E9AA 5CJPA 3DEFA 4WOPA 4XX2A 1EFRD 5D3QA 4P0TA 2V55B 5HZKA 1BIFA 4HDQB 3G0HA 1GRRA 2QTVB 2G3YA 2UXDC 1FQKA 3AF5A 5TVKA 1Q3HA 1XNJA 3CW2A 4YMSA 4HYYA 3W5JA 3DVLA 1IOZA 4URXR 1G7TA 5H8WA 1XP8A 2GCNA 3QPWA 2WSMA 4MGIR 2IWRA 1O3YA 2XTMA 1XPRA 4QHTA 4RZUA 3VR3A 2AFHE 4PR0A 3A8TA 2FPMA 2RGXA 3EPKA 1BH2A 1KY2A 4RCZA 4IDOA 2XXAA 3FPAA 2EW1A 2WTUA 1E79A 1HV8A 2C5LA 4JI0C 3Q5DA 4N1AA 4RZ3A 1F5NA 3TW4A 1VIAA 2G1KA 1M7HA 4M1KA 4LUCA 3GQBA 2J7PD 2XZOA 4JJKA 4M1MA 1WB9A 4Q9IA 5FTKA 4MYUA 4JSTA 4BRWA 4CGZA 2WIAA 4F4CA 1XEFA 1DG1G 5HTKA 1FNMA 5G41A 2WOJA 1G4AE 4IFEA 1RE0A 2RHDA 3ASZA 2BMJA 3DM9B 4JLJA 4C0HA 5C18A 5C2JB 3THYB 3U3KA 2IF0A 4A15A 2GAOA 1FMLA 3C15C 3ZLJA 1QHHA 3Q72A 2X8AA 1PZNA 1XD2A 5M04A 1D5CA 1ESMA 4DV3C 3P1JA 4UJ3A 1PJRA 3T1YC 3GEHA 1TQ4A 4JBXA 3U7GA 2GCPA 2CMKA 2OUKA 4FXPA 3L82B 5EP3A 5FBWB 4LPSA 2F9MA 1JR3D 5DI3A 2KWIA 2VP0A 2J45A 3R9XA 4I99A 3MRSA 2D74A 4DCTA 1IN6A 5J4KA 1U99A 3TBKA 4GBMA 2HCBA 1L4YA 3K0FB 3IHWA 4UXJA 3SHWA 1I2DA 5IHPA 2YKGA 3ETLA 4YMUA 1N33C 3FOZA 4B47A 4DUZC 2B8TA 1II8B 2VHJA 1KI1A 2J7PA 2D4HA 4E07A 2EVWX 4TTQA 4C0QC 3NIBA 2AR7A 3EERA 2QMOA 2NO9A 3IEVA 1GG2A 2VP5A 4LJ9A 3U60B 2H8KA 2R65A 2PL3A 2HLDD 3GLHB 2XGJA 2FGKA 4CZ2A 3GJ7A 4C0AC 4HB4A 3AVUA 4BFUA 3LBNA 3SN6A 1UKEA 1AS0A 3SBEA 1WP9A 2NO1A 2HV8A 4PO1A 4D0LB 2X77A 4TLAA 1NN3A 5KU1A 4V0MA 5FI0B 4NHOA 5KUTA 1E9CA 2UKDA 5DO9A 4EQ6B 3H0KA 1Z0IA 3EARA 1I94C 2YWGA 3NDBB 3I07A 2OEPA 5LD2C 2QPAA 1N0VC 2WOOA 3MAAC 1Z28A 3SE0A 3PUZA 4BZXA 4NKRA 5JSZA 5CM8B 4BZQA 4LWZA 4ZKEA 3TMKA 1YHNA 2QL8A 4YMVA 5C4MA 3FWYA 3LX5A 2KBFA 4AC9A 4HUQB 4G01B 5KDLA 2QM7A 2QA5A 1ODFA 4TYQA 3BD9A 2A5JA 3GMTA 3T5GA 3U7FB 3K9NA 2JLQA 1KZGB 3VKHA 3K0CC 2HLDA 1PLKA 1SKYB 4X64C 3AF3A 3NG1A 4K46A 4C7OB 4Q4JA 5JJKA 2CLCX 4TL6A 1LF5A 5JI3E 3SJAA 4IVPA 5E7JA 3CF6R 2VHQA 2FSIA 2ORVA 4QHYA 5E4FA 5FTNA 2G9NA 3FVQA 1WDTA 4Z51A 3ZDQA 1UBCA 1WH9A 1N3BA 4JI3C 4FN5A 3RS2A 5F9FA 5F98A 2HXSA 4BFTA 5G3YA 3GJ4A 3AVYA 2PT7A 4S35A 3RRYA 3AH8A 3QG1A 2Q6TA 2FOLA 4I1VA 4MRVA 4OHVA 2ZRKA 2B7BA 5DISB 4DCUA 1ZMXA 4AIIA 3BAFA 2IYRA 2R6DA 2ERXA 3H4MA 4YMTA 3N70A 4XWAA 5FUWA 3SJCA 2LKDA 4MRPA 3B1YA 3GLIB 3QKRB 4DDUA 2OFWA 3KJIA 1U8YA 4WBSA 721PA 1LS6A 4LV5B 4MKIA 2JLSA 3QQ5A 4P4UA 3BXZA 2XSZA 2VSFA 4LJ6A 2FWRA 4Q00A 1EX7A 3MUFA 1G3RA 1W36C 2AD1A 1GDDA 2C98A 2NZ8A 3LW8A 3QXSA 5G3ZA 4J0QA 3CJEA 4DV5C 4Q7KA 5FTLA 2I4IA 2YWFA 4XVUA 4OHYA 1T4GA 1UKVY 3VMFA 2OT3B 1I4LD 3I73A 5F2EA 1PUIA 2YINC 3NBFA 4GT1A 4BFZA 5A2QD 5J5CA 1GNRA 2GXAA 1MV5A 4EJSB 1ZB9A 3NEYA 2GK6A 4DV2C 1VYTA 2YOHA 1XFAA 1AK2A 2VBCA 4RZXA 4LJ8A 4PTLA 4Q47A 1UDXA 4LBYA 5L3QA 1N34C 4DR5C 4P33A 1N6HA 3AKEA 2IW3A 3THOA 3BB4A 4ABYA 1JJVA 5GJWC 1KIMA 2GZHA 1G21E 2DBYA 1GAJA 5CYOA 3K0AA 1P9NA 4QGGA 1KY3A 5EE1A 4JI7C 1JPJA 2PT5A 1F2UB 2ZQ5A 3I4LA 3AF1A 4XVQA 3AF2A 1HT1E 2GJ9A 3E2IA 2ZANA 4IRUB 4JLNA 2WPDD 2GEVA 2VF8A 2DFLA 2DYJA 5DE3A 2ZRLA 1K5GA 5EE5B 4TMTA 4XH9B 3QEOA 3BERA 4D80A 4M4SA 5KTYA 1UPTA 1TNDA 4R9UC 4DLSA 4LF7C 2QE7D 1AZTA 4CIDA 1TQ6A 2ZRMA 3LV8A 1CR0A 2GVDC 4BE7B 4Q7MB 2EQBA 3KKPA 5FOWA 2XB2A 2X2EA 2IUSA 4ZIRB 4HB2A 4A0GA 2IYLD 3NXSA 1QBKC 4O2LA 5L3SB 1W0KA 3BC1A 2REOA 3V4RA 2RGCA 4B2PA 4HLDA 4BFYA 5FPKA 1Z83A 2QRNA 1Z29A 4Z8YA 4KSCA 3NWJA 2WKQA 1WQ1R 1Q57A 2X2FA 2ZRGA 3GEIA 3NC0C 2ZREA 5KSYA 2RGEA 3CH4B 1OF1A 2CL6X 1W2HA 3H86A 2IUTA 2NPIA 2FA9A 1RPZA 3EWAA 1E6CA 3RAPR 2HF8A 4AURA 5AUQA 2PMKA 3CR8A 4KSBA 5E7IA 2WICA 4LBVA 1CJKC 2FE4A 2FFQA 2KI5A 2ODWA 1GIAA 1N6IA 2O0HA 3DMDA 3KJEA 4G5RA 5C4GB 3ZVNA 2I1QA 1CXZA 5LMNC 4EPRA 2BKEA 2AHOA 4QHSA 3IQXA 5DNYB 1G17A 3THYA 3FE2A 2QE7A 1N2CE 2QRZA 2O8DB 4DHEA 4Q1CA 1KAOA 1SVLA 2GVZC 1E98A 4DVGA 2OO7A 4KLZA 3EWSA 4GKKC 2NZJA 2DFNA 2FZLA 5BW8A 1CF4A 1XTRA 1W5SA 3LBHA 4M8NE 1WBDA 5GJBA 2ZEJA 4TQAA 2N42A 1D2MA 2OCPA 2VQEC 2HUPA 2J1LA 2NPFA 2BMEA 1NRJB 4ACAA 4D4LA 1W7AA 1WE2A 4PHGA 1Z0AA 4KCGA 3B7GA 4UXIA 4BASA 5DYGA 2BCJQ 1EXMA 4HI0E 3K0FA 3RDPA 5A0FA 1RFLA 1XTSA 5JEEA 1RRGA 1SKQA 5DIFA 3WY9A 3KB1A 3HU2A 2D2FA 4KITB 1II8A 3MD0A 3P20A 4R2IA 1XB2A 3W3AA 1E96A 1IBRA 3K53A 3AKCA 4YXWD 4QJ4A 3LXXA 4FMCB 3JAMD 1RVDA 4PX9A 1P5ZB 1KJYA 1S1CA 4XVRA 1NL3A 2NGRA 4HZUB 1IN5A 3GLHA 2IA5A 4JYCA 1E2DA 4PPQA 1NN0A 4DLRA 1AQYA 2QN6A 4NCHA 1IXZA 4Z8XA 4GP7A 4IFBA 1XTJA 1F2TB 3QNUA 1LNZA 4TSFA 4BSZA 1GL9B 4N3NA 1G5TA 5FL3A 2BJVA 4ZCLA 3Q8XB 3RS7A 3B2EA 2XZLA 1NSFA 5J4LA 1Z3IX 3SJBA 3GFPA 4P31A 2GTPA 3AF0A 3HU3A 1DARA 2F3TA 2H57A 4OQNA 1OKKA 3X1ZA 2OHFA 2BCGY 4UNRA 4LFBC 2CK3D 5JMTA 4HAUA 4HB0A 1G18A 3LRPA 4NYIR 3TSZA 1XMIA 2VF7A 2F43A 1M74A 4E09A 4QNMA 1Q3TA 2DHRA 2IHYA 1GRQA 2PZFA 3N2IA 3K70B 4LOAA 3W90A 4C3ZA 4B74A 4AYXA 4ZV4A 4A36A 5KDOA 1UBGA 3IUYA 3HDTA 1Z63A 4Q9LA 1IBMC 3BRWD 2QENA 3RC8A 4TWZA 2ODNA 4HUQA 4PPNA 1JALA 3MMPA 1G6HA 2QGNA 2PT7G 2IYZA 2W2TA 1G5PA 1GWNA 4YXWA 4OK5A 3PXGA 2IS4A 1AZSC 4IVQA 2O8CA 3U2QA 4ZKDA 2PJRA 2WBLC 3CNNA 3B60A 4TMZA 3CPEA 4C7OA 4BLSA 3PG5A 3EAQA 3QENA 5DI9A 1E32A 1OT3A 1NSTA 3DKPA 2F55A 2R44A 2J5XA 2ZSBA 5CDFA 2FEOA 2QROA 3VR1A 2HYIC 4TYNA 1JECA 2QMUA 4KV9A 3L43A 2WMOB 2QP9X 2WIBA 1ZW6A 3VFDA 4Q21A 1T5LA 2AWNA 5SZHB 3U3OA 2BJOA 1KO4A 2GXSA 2GEDA 2ZSDA 2DYKA 1F60A 1E2NA 2CK3A 3Q85A 4NONA 1QG2A 2G88A 4DR2C 2JJ1A 1N5JA 2QQEA 5BXQC 5F9HA 3CWZA 4PC3A 3EIQA 3RWMB 1JEDA 1N6RA 2GF9A 3SNHA 2ZS9A 1X86B 1CEEA 3GLIA 2ORIA 3QKRA 3WHKA 5AUPB 1Z08A 3FMPB 2W0SA 2VIIA 3K9LA 3U61B 4C0BA 4GOKA 3SHFA 3NEJA 4ZI2A 1WCV1 4LHYA 1XMOC 3IBYA 4W7SA 4KJZA 4OI0A 5KSZA 3BK7A 4UKDA 1YZNA 1G4UR 1VIYA 1JR6A 1CKEA 4TLCA 1UF9A 3A1VA 4U5XA 3ZZ0A 4JI5C 3AKDA 2BEKA 1VTKA 2MSDB 4TYWA 1G5RA 1XF9A 2GZDA 4PAMA 5FTJA 5HKKD 5EP4A 3QKTA 1XPUA 4EJSA 1OYWA 4B3RC 4HAZA 5EP2A 2IK8A 4GRAA 4PZLA 1EK0A 4XWKA 3TUJC 2UU9C 5DGXA 3RS5A 3KJHA 2WZQA 4QM7A 2YZ2A 4GPTA 1JPNA 4B75A 1A1VA 2ZS7A 3F8TA 4UQOA 3LQRA 4W5HA 4DV4C 3VX4A 2ZJAA 3RYTC 3KXLA 2GXUA 1I4DD 1FTSA 1Z2CA 1G8GA 3KUCA 3MFYA 3AM1A 3WYGA 2ZR7A 1WA5A 3GFOA 1F2UA 1W46A 1H8ED 5FUYA 1ZNYA 4Q7JB 4M2LA 1LV7A 5B58C 2BMDA 2V6JA 3LD9A 1P2SA 1KSHA 2CVHA 4KBFA 4RD6A 1AJEA 4A6XA 1P9RA 1TF5A 1CJTC 1AN0A 3CRQA 1VYUA 3FHOA 2QQ0A 4LY6A 1W44A 2WSSA 1KOFA 3U6KA 3SFVA 1KI3A 2XEXA 1X6VA 2NO7A 1F48A 1GNQA 521PA 2WV9A 4U02A 3QBVA 4ZIRA 2J87A 2JJ8A 4YC7A 1ZCBA 2JLUA 3OE7D 1K5DA 5JWOA 5L3SA 1PVOA 4OX9C 4Q4HB 3FGNA 1A4RA 3IHLA 5FBQB 4RVCA 4AWXA 4BQSA 5TV2A 1JAIA 2JCSA 3MWKA 2OBMA 1HH4A 1VPLA 3B1VA 4WW0A 5DLQC 1E1QD 2AXPA 3LAWA 1QVAA 2FFBA
chains in the Genus database with same CATH superfamily
3VU8A 1GLVA 2W2PA 1K06A 4V38A 4JJGA 5BOSB 4WLVA 2C9YA 4J1QA 4C6TB 4FOSA 1Y6GA 2Y0BA 1U2GA 4DDKA 3BSFA 2R8YA 3QOXA 3S5UA 3WBBA 4MYRA 4QREA 4GKBA 1N9GA 5CA1F 2NYUA 4COOA 2VQDA 5AH0A 1JDPA 2XJ4A 2PZJA 1EA7A 1W7AA 1PLJA 1WRBA 2Q0QA 5EC8A 5COBA 3GFTA 5IJXA 1JLLB 4ETNA 3I5XA 4V0ME 2SKEA 2Z3WA 2A67A 1LPPA 2JHAA 2QG6A 3AY0A 2R5FA 3FNEA 3OWOA 4MQEA 1HDOA 3VNVA 4CT5A 4E1VA 2ZTMA 2D7JA 3P9RA 5KYWA 3G9UA 5CLQA 2IHKA 3VTFA 2QJRA 1KEVA 3QVGA 4HMQA 4RACA 1R6XA 3G82C 2O2ZA 3JD0A 3EVDA 3EDMA 1Y5MA 2FX3A 5B6PA 3R0JA 3T41A 5JD3A 2FSFA 1ZCZA 5KQSA 3EHDA 5KTMA 5IVKA 4LHZA 4BXOA 3IBCA 3P4XA 1R6VA 3K2IA 5GONA 5KPJA 1EVEA 2JFZA 1IM2A 1ZH6A 2ZWVA 1Q11A 3L8EA 4FEEA 1JQLB 2VQFB 4UD2A 3LCMA 3U7HB 1YH3A 2FW1A 4H59A 3ZIUA 1C3VA 1YZLA 4OXNA 3SLRA 1DAMA 2R7NA 1GQFA 4D9FA 3AR7A 2OKGA 2PM8A 5K3SA 1PZXA 3I39X 4HDKA 3S28A 4WLUA 3BQNB 4X20A 3SOPA 2QM8A 5F5NA 1NKSA 3EA5A 4PPFA 1UDAA 2ONZA 2V1XA 2NVUB 3VU9B 1F14A 1CX9B 3NKVA 3QPUA 3H9CA 4QOGA 3ROTA 4CEIB 4MWSA 4FGSA 1UBMS 2L17A 1GGJA 2R60A 4K05A 2RK6A 1P4JA 1UZNA 2HJVA 3ZDEA 1LNQA 5I9TA 4LV8B 1GCAA 2REQA 3HCFA 4JLKA 5ALRA 3ZH9B 1A3CA 1DJOA 5C80A 2P79A 5JW6A 1FP6A 4LRQA 5I5GA 1QTQA 2O8EB 1CBUA 2CMHA 3FYUA 2Z4RA 4G5QA 3U1VA 4HZUA 4N6OA 4YXFA 2BGLA 4HNVA 2JVJA 4IHJF 2HU5A 2G1AA 3EOZA 4N0PA 5EJIA 2RHMA 2RD2A 2QUIA 2OCGA 4L95C 2CDBA 2C92A 2H4JA 3P27A 3X2SA 5LLSA 4RTPA 3DFKA 1DG3A 4EHDA 1QP7A 1RYZA 3M1YA 2DTEA 2H54A 2QR5A 3CJTA 5HR5A 4MUHA 3OM8A 3NBXX 4TQGA 2IBMA 4GMDA 3HYNA 1XDUA 1EAMA 1EZZA 3AUJB 1ZOIA 1BOOA 3NUQA 4U2KA 4CKCB 3ER8A 1YF3A 2C1EA 2R66A 2H7VA 4PZDA 2R6HA 3K8YA 4TV9B 5JDIA 3KB8A 1QF9A 2FLWA 1SD1A 2WWRA 4WZAB 4JGBA 4JJ8A 4O33A 1W49A 2X6RA 3KQYA 1ZNZA 5JAZA 2E4ZA 4TL9A 2VP2A 1JFFA 2AJTA 2HFKA 2Z83A 5M29A 2HF9A 3K6JA 2FI1A 4MHSA 5BN4B 2PUWA 4BJ3A 1FLNA 4WKPA 1ODIA 4DJTA 2X7HA 4XSHA 1ZM2A 5K03A 3TLJA 2G1PA 1W0JA 1PG2A 2WT8A 4NYJR 4U7DA 1WZ2A 4NY1A 3A2LA 3C7CB 4J4TA 3BMQA 3CF2A 1O6BA 3ZGLA 2ZIXB 2PV0A 4QRHA 3RNLA 4KMMA 3X1DA 3ZU3A 1EP2B 3EMBA 4B3DA 1KH1A 5BR1A 1NDQA 3W9BA 1AV6A 3MZ0A 5H4HA 4TPKA 4PQFA 2WHYA 1DS6A 2Q5IA 2D5LA 1MDFA 3QFCA 4RZIA 2ZVQX 3RJ9A 4RKFA 1AUQA 1LBSA 2I3BA 1NBIA 3WGOA 2CT8A 2XVMA 4AQYB 3LY8A 1K6JA 4P3OA 5ECGC 4TXJA 4D0GA 1KJIA 3GJZA 2DLCX 3RUEA 2PYIA 3GHYA 3GV0A 1CQJA 4TGLA 3LL4A 1Q83A 1YGPA 2CHVA 4NESA 5FHRA 3RF6A 3GF4A 3VXKA 2X15A 3OICA 1KA9H 2WWGA 3IGFA 3OLVA 1KI9A 3PNLA 1F0PA 1Z47A 2IYVA 2WMNB 4I1OA 4NF2A 1RKUA 5HBRA 3RVPA 3VR2A 3K0HA 3CX7A 4QGBA 2V7PA 2PFKA 1BNCA 2PMWB 4ZLPA 4QUGA 1PFKA 2DH5A 1B1CA 1MX3A 1YQEA 3HU1A 1PVDA 2F1KA 2WSBA 3QQPA 4N7BA 1YZFA 1N7IA 5DMHA 2AF3C 5BN5B 4AG3A 1OE0A 1T9GR 2XE7A 1CYEA 1S89A 3DV2A 5TE9A 1ZGCA 5I4CA 4HDNA 3BXGA 4LIPD 2XGOA 3ZX4A 5B2ZA 2F8TA 3LS2A 4FD3A 3P97A 4DKXA 4LJKA 3S8EA 4O1HA 1XO1A 2Q1UA 2JGDB 4EFNA 2YHIB 4LXGA 1USUA 3V46A 4NXMC 2QLNA 1CERA 4Q1DA 5LKAA 1E8DA 3CLVA 3HKEB 3I37X 4F3NA 3ECAA 3GUUA 5EUCA 3ROFA 1JXQA 4TT3A 3KLOA 5KYYA 1F8UA 4MQUA 2QD1A 2JLCA 3NTOA 4X1YB 3DMYA 3G5TA 4JN6B 5CYPA 2PA0A 1EEXB 3FDFA 4LYGA 3LZDA 1EXNA 4LOKA 3R7WA 2H7XA 3UUGA 2COEA 2XPCA 3KT0A 3F1LA 3R23A 3GKUA 2J41A 4MP6A 3JQFC 2QXUA 2B8EA 2UZ1A 2ZRBA 4QXMA 2GERA 4Z0NA 1XZAA 1C9DB 2JRCA 2PCLA 4L5JA 2P3SA 4GWGA 3RC2A 3V2UA 5LVAA 4O0LA 4AXXA 1P2UA 1P4GA 2P8JA 4RGBA 4PAWA 3HN7A 5B58T 2GZ1A 1P4RA 4M1OA 4H16A 3ETDA 5EE3A 2CLEB 4MJ7A 1TF2A 1MC8A 3AU9A 3QPVA 1Z6XA 1ZUWA 4J2TA 1HDXA 1P2DA 4MKFA 1LS1A 2OCDA 4QBGB 2FPLA 2EKQA 1BFDA 1JWLA 4MEJA 3A26A 1K92A 3OLXA 1J9GA 4G0UA 3OHSX 4L28A 4EUSA 5A3RA 4PCAA 3RIGA 1UJNA 3E9YA 3ZD9A 1ADCA 3IQGX 1E9EA 3EGXA 4CMBA 5K8TA 4TLLB 3KZ1E 4YRKA 5CLGA 1RT9A 4FDAA 3ZWCA 1XP5A 1DO2A 1GLGA 3N3AC 4H08A 1VRWA 3TL3A 4LC1A 4WOJA 4C7BA 3T3OA 4JLDA 4DADA 3KXWA 4ZO8A 2XLBA 1R12A 1KAGA 1Q6ZA 1R50A 1HE4A 1LF0A 3GUVA 4ND6A 2X9VA 4C43A 3A3YA 4FJ0A 2PX2A 3JQ6A 1WMEA 4JYMA 1A9SA 2DE0X 2AN4A 1NX9A 3O4RA 4WLOA 5HCUA 5F76A 1XEWY 4XUGB 3SR3A 3WLPA 3CVYA 1F8YA 5HNKA 3THXB 4Q4HA 3W5AA 1K4YA 4X63A 3ZBUA 2W2KB 1IJFA 3HGQA 1TE2A 1VG8A 1Y82A 2JASA 4YV0A 1W8DA 4O6VA 4TYPA 3THWB 3K7EA 2X0FA 4BLWA 1LC3A 1Z5OA 2D13A 2CJWB 4G8CA 4EGSA 4Z4IA 1Q22A 5BWBA 4ER3A 2FMHA 1TJ5A 3P71T 5JFTA 3B5JA 2ORYA 2VAMA 3BVPA 1IY9A 3HYTA 1Y9JA 4AB1A 1NNLA 2NUBA 2NQ8A 1N1GA 3IV9A 3H3FA 3L1JA 2PROA 1ILWA 2G0NA 1DX6A 4MB6A 4Q3LA 1RYFA 3TTVA 1DEXA 1LFDB 2AG8A 3DZ8A 1TD9A 5DGIA 3LAXA 1YE3A 3CZMA 3VYRB 1FMTA 2AJDA 2J5QA 1E2GA 3D0KA 2ANCA 3H19A 5JCJA 1J20A 1QVZA 2A6PA 4WCFB 4BRZA 4DZZA 1T8UA 1UMDB 3UFXB 3M6UA 2IXGA 5A4KA 5KOJA 1Z0KA 2ZJ6A 4LDZA 1WKVA 3KVVA 2FWAA 3TLAA 3A1TA 4OJTA 4BO5A 4ENSA 3ZTYA 4YY3B 1SU4A 3BRSA 1MO3A 1WS6A 2BGKA 3D8BA 4MIKA 1GDTA 3ESXA 2Q0SA 3S2FA 2HDNB 2W58A 1XRCA 3SSNA 3LF2A 5C8DA 3I01A 4ZJUA 2PZ8A 5K8IA 3AM4A 5C7LO 1M66A 1JI0A 1O9BA 1ODJA 2WF7A 1F9EA 3GHHA 3PJFA 3QHAA 4OHCA 2G5PA 4YRCA 1MIOB 1U0GA 2FK7A 1JHZA 5SY6A 4YT8A 2AXEA 3KQOA 3T0IA 3BJMA 2G09A 1H65A 2FR8A 3HFJA 3SU8A 3HBJA 4UM9B 2B98A 2E8FA 1Z2PX 1M2HA 1U8CB 4JV5B 2YDYA 2JMPA 4MQ6A 3LHSA 4ARVA 1J5EC 5KNDA 1VG1A 1Z6AA 4HJXA 1CRQA 3IAXA 3JQGA 3JD1A 4M7WA 4TLEA 2XCQA 2JIZD 1H6CA 4LFAB 2YWEA 1W4AA 1A9ZA 4TMXA 2XZPA 2ZYVX 4XIFA 3L95X 3HJGA 1KEEB 221PA 3GFRA 1YFLA 2YZKA 3IR6A 4EDFA 2FW7A 3HVIA 1LX7A 3JPWA 5TF4A 2C7RA 1JQBA 2O5CA 1MA3A 4EZBA 3RVSA 1KL7A 4CGYA 3A6PC 3AGQA 1FDUA 1MU0A 3F5MA 5DTJA 5C51B 4C5CA 4RH0A 3LBIA 5JARA 3AZOA 1Q7RA 1RM3A 1LX6A 2B8NA 3HL4A 3NHYA 4MPDA 1LDNA 4ZGWA 3VHXB 3OQNA 4W7HA 2PUCA 1FNBA 2EJWA 3UMYA 1D2HA 3WGGA 4AF6A 4D9EA 1NZDA 1EQUA 1EVJA 1GTSA 2IYEA 2OY0A 2GPTA 4GW3A 4JLOA 1N25A 1SA0B 3FAZA 3GNLA 3JQAB 4WY5A 5FWXA 5AR1A 4XM1A 4D43A 5JXWA 4Z4FA 1Y8QB 3IOYA 3VKUA 2RMKA 1U5BB 4OQZA 4NV3A 1ZHFA 1SVSA 3IE0A 1L5SA 4NCXA 1EYZA 4ICIA 4EG7A 1ZGAA 1ZXXA 3LK7A 1FMJA 3DBLA 3N0WA 4RJLA 4DQKA 3WGKA 2V7QA 5EZ6B 4JC4A 1CUAA 1Y6JA 4CPDA 1R4ZA 3RG8A 2FN7A 3OY2A 4B3TC 1RHRA 1DG9A 2NZVG 3M6VA 1W88A 2Q7OE 5EJEA 2Y0PA 5K8UA 2PS1A 4GEGA 4NABA 2O5VA 2A30A 1Y8AA 1ZAKA 1UJ5A 3BA6A 4OB6A 2I7XA 3PXAA 2OXTA 4BKOA 5LP6A 4QU5A 3LUFA 2RIRA 3HRHA 1TQ8A 1U94A 1TKRA 1AV7A 1PJSA 3G2NA 3TOXA 3MWLA 2H1CA 2DR3A 1QIIA 4TTVA 2VN8A 2WJGA 3NWPA 3EZNA 4FILA 4IKEA 3GGDA 4Q03A 1OYYA 4ESVA 3NUZA 5IANA 5IYZA 2VTBA 4H6VA 3DBOB 1D8AA 4KXQA 3ZWYA 3IUNA 1R4NB 2Z5GA 3FBWA 3MTBA 5H7XA 3T1OA 2PMEA 4KAJA 5IEJA 2VRWA 1XMXA 4ZMRA 4I9FA 5A9SA 4KPEC 3QVMA 1BROA 3J81D 1N1MA 5DBIA 3UHPA 4D45A 3PUIA 3NTQA 1VIVA 4MQBA 1RRKA 4RTKA 3V1TC 1G3QA 1W59A 2GKSA 3O94A 5E1OA 3U4CA 3SS8A 1DRWA 1Z7GA 1OHHD 1WCIA 2BHSA 2JL1A 2J0UB 3DZGA 3R20A 4Z99A 1H42A 1KZHA 1ZKMA 3C5CA 3QM1A 4DW8A 1C2YA 4HXYA 3AVTA 2ZIFA 5H5JA 1J06A 4Y2YA 1UJ2A 2FR0A 1XRBA 3D6UA 4HLNA 4PXAA 2ZRAA 3D8UA 4BX3A 1D1PA 1QWIA 4K9KA 1NBMD 4MS4B 5JADA 3FOCA 1LQTA 3DXXA 1Q0SA 2PDAA 3PC8A 4JI8C 4QODA 3ZCVA 5B64A 1PD1A 4L3WA 4D82A 4OBEA 2DXIA 1PG5A 2FRVA 1E5DA 2H5EA 3OOEA 4MUYA 1S8NA 3NWBA 2NXEA 3TLKA 1QS0B 2EW8A 1XQYA 2ZJ2A 3GZ4A 4QLBA 4ZJZA 1WSAA 2PKQO 2YZMA 3KB6A 2GZ3A 1J0XO 3W4IA 4CM1A 3EIHA 3CIOA 3OOYA 4MYHA 4X8LA 4UTZA 1HT2E 2PV7A 4TTTS 5IUNC 1ADYA 4KR6A 4KLNA 2VSNA 5DBOA 2VL7A 1H4TA 2WFLA 3GBPA 1EX6A 3L41A 4XPIB 3OZCA 3ZWVA 4RMHA 2YFQA 3F7OA 4LFCC 3EFBA 5T8SA 3BJRA 2WJJA 2CUZA 4L4SA 3C3WA 4QKQA 3DT9A 4FEGA 1T8SA 3VYUB 2VOEA 4DIDA 1SZDA 2RH8A 4YP9A 1UOQA 5JWRA 1L7QA 4B32A 4L08A 1N6PA 5I3CA 2VQFC 1CEQA 3M2PA 4GI7A 4OY3A 4RWZA 1TIPA 1IM5A 1KI2A 3T7SA 3GNQA 4F2PA 4D4MA 5K0FA 2IBTA 2CVQA 4IQ8A 2BHLA 1NMZA 3PR2B 1ENPA 4AKHA 3UEBA 3ENVA 3NBZC 4R6WA 2R751 3TUZC 1A27A 2C3YA 4ND1A 3E3MA 1MT0A 3DFUA 3P52A 4BBJA 4EFLA 3D1VA 2NO6A 4A8PA 4CLRA 4P82A 1WHTB 2I4RA 3MJTA 4BMVA 3QFSA 4MVYA 1UKBA 4LYAA 1RXWA 2IYAA 3G0OA 3K1AA 4TM8A 3BHJA 3GH1A 4PZ9A 3N07A 1QGAA 5KVAA 1FUEA 3IUPA 4PN3A 1XROA 4O4LB 1E2KA 2NT3A 2OCAA 3OZBA 1JHUA 2OV6A 4I50B 3STUA 4AKEA 1OZGA 3T7AA 2L2QA 4K9PA 2VHWA 4LE1A 5GIPE 1NF8A 2RGBA 1VLAA 1P62B 3F6CA 3CNLA 2JLAA 3OPYA 2V4ZA 2XUOA 3NJ4A 4XLTA 1CFJA 4IJWA 3TLBA 1XC7A 3ZYZA 1R27A 4XR4A 1GR1A 1ZA2A 4RH1A 1LUAA 2A57A 4GXNA 2A9RA 2BEUB 3TQFA 5E9QA 1KK3A 3O8BA 4U8HA 3UK7A 3CLRC 2BGTA 2VHCA 1JVSA 4KXXA 1QR6A 3IDZA 4YK7A 5DHFA 4Z0PA 5MN5A 4IDPA 1VPWA 4EGQA 4GWKA 1SCUB 1JFRA 4I9UA 1TVKB 2PUDA 5F77A 1JR2A 4MVWA 1Q17A 4D81A 3IERA 4CL8A 4L4RA 5CCEA 1EX9A 5C3MA 4E5SA 4NK4A 2DPLA 3BE6A 4L6AA 3IAS6 1E5QA 3UXEA 2P40A 5JQGF 1ZSNA 2X1VA 2R8XA 5E6SB 2YBEA 3FUVA 3QBJA 3F4LA 4AICA 5CDYA 4PG6A 4HYQA 4IJMA 4Y18A 2Q3MA 1WOMA 3QEJA 4N3CA 2CV0A 4LPKA 4YQZA 2JATA 3D5TA 2HGZA 2I6GA 1T0IA 4JOBA 2DY0A 2EL7A 1UK8A 3LIIA 1QF6A 1T3GA 4E13A 5JAMA 2ZITA 3R4CA 4GI3A 1NUAA 1TUBB 1XVIA 2H06A 2QQ5A 2BM0A 2W4QA 3DD1A 3PFIA 1N4AA 5ITSA 4KDRA 5LBTA 2NV0A 5I7HA 4V1CI 3TQHA 2IPLA 1IAVA 5KTNA 3T7KA 3IAHA 3VH1A 3HKDA 3DKKA 5HWSA 4QBIA 3PNVA 1XZNA 2MR6A 3ASYA 3ZG6A 1HNNA 3REQA 4OYLA 1K7XB 5JH7A 2I1WA 3H5NA 1WUHS 2RBKA 3JQAD 3LBFA 3NOQA 2ZPAA 4KDFA 3ZD6A 3RKRA 2YJZA 2JI4A 1ZIPA 4AWAA 2QW0X 5B1EA 2GN4A 2PVPA 1XVLA 3FJ1A 3NT5A 1UR5A 4QPDA 2VPYA 1EJ0A 5DX0A 2X0EA 3VNRA 4JI6C 1ZQ1A 4DV2B 4KQWA 3FCEA 4OMCA 3E0XA 3RGGA 1QGUA 2ZJYA 3EOBI 3ZHXA 3KRTA 4WVFA 1SVOA 3RC3A 3WJ2A 4NOJA 3PP8A 4I4TB 3AIMA 5BN3B 1XGKA 2OD2A 1XEXA 1JNYA 2VAPA 1WMFA 2BKLA 3NYWA 1ADFA 2W6NA 2OBYA 3HB9A 1ZVQA 3PIRA 5AHKA 5EUBA 5CFNA 3FVVA 2NX2A 1Z39A 1EK2A 2DUUA 4JI7B 2IS6A 1AF7A 2HA7A 1BO6A 1UKAA 2HIGA 3CTMA 3BWEA 1KOJA 3IUBA 4BEJA 4G5XA 1UMCA 1O0CA 3OHPA 4EO9A 2HR1A 1BVRA 1KBOA 1IZZA 1R0ZA 2BMWA 3WLRA 3GLQA 1WMAA 4ZODA 4ZD6A 2ALJA 4BX0A 1UBJS 4A16A 1Q1QA 3HH8A 4I4LA 1SVMA 1YQDA 5BUCA 5KIAA 1FDWA 3UHJA 2QYTA 1S8FA 1RHMA 4FMCF 4UUQA 1KVSA 2VJQA 5LN1A 1HM5A 1UDBA 1GFIA 4KPUA 2WFZA 2G7MC 2Q3FA 3KDPA 2DC1A 4RGQA 2ISCA 3HV2A 4KHPC 3V3KA 4ARZA 3NOOA 4N0DA 3OEEA 3RWOA 2EIHA 3OZTA 5HF6A 4ARSA 3H5VA 1KI6A 3AUTA 1BX0A 3ELWA 3K16A 3WFZA 1G6Q1 3ZLJA 2GFHA 3OPXA 1OXTA 1OJLA 2O8BA 4OHBA 4ZCPA 3PITA 3TB4A 4Q4CA 3GYGA 5ISMA 2VYCA 2XBLA 1EJ6A 1EVQA 1X7WA 2Q28A 3HUUA 1TU0A 3UENA 2YHAA 1SU8A 4MUAA 2VP9A 3IE2A 2A5FA 5CCXA 4MDYA 3BA1A 3DE1X 4H7DA 1R0YA 4NYIQ 4WUTA 3IR5A 5CTAA 3H9JA 3SC4A 1QLHA 1SXHA 2POCA 3FOWA 4J03A 1THTA 5SYMA 3UV7A 1SXGA 4CW7A 4RDCA 3UT5B 3RUDA 2QX7A 3U49A 1DHRA 421PA 5I9NA 5E9WA 4ZZ2A 4W5TA 4YCBA 1A9XA 1H1TA 3R7LA 5HJ7A 2CLLB 1YNSA 1C8KA 5J63A 2W42A 1NYEA 1AUXA 1BVYF 4TRRA 3P9PA 4CV1A 2F9FA 5JZBA 2C0CA 5EJFA 2WP8J 5J2TA 1W9MA 1BWSA 4UM7A 1FYXA 3SQWA 3R6TA 3DNFA 5E2IA 3TLGB 4ALLA 1P3JA 4BEBA 4DNFA 5DM2A 2AE2A 1W73A 1YZUA 3TL2A 1FX0A 2FJPA 4QFMA 3OZXA 3ZPXA 1KOLA 2HLNA 4EW3A 1XXHB 4KDEA 3PRKE 1EWRA 1X15A 3HDQA 1QZUA 4FHEA 3QKUA 4XZ3A 3OIVA 2QKYA 2A1TR 2WU0A 2VTDA 5E0KB 5JJ5A 4GKKB 2WHXA 3U44B 4IEFB 1X1RA 1JHQA 1FFHA 3CN7A 5JV5A 4HMOA 4E5UA 1ILEA 3RGWS 5FQNA 3L4BA 1RC8A 5HJ5A 2W70A 2QTHA 3CF4A 3KPUA 3K9WA 3R0ZA 3OTOC 2BRUC 1RPTA 1EZ4A 1S7CA 3NHUA 4RL6A 2EF1A 5DHSA 3OP4A 1JIVA 2QTGA 4NJEB 2DWUA 5EKXA 4QYWA 3QVJA 1PQYA 3TX6A 3U19A 2UVPB 3AFOA 1FRVA 3G8DA 2JHPA 2ENWA 3MJCA 1C9EA 4K0RA 1SVKA 4G0NA 3VUFA 4CFSA 3L9XA 1VJRA 2O7QA 3T3NA 2EBWA 2NUTB 4CIWA 2BV3A 3PHLA 1I5EA 4II3A 4X6XA 2WILA 2XOKD 2BI4A 4Q9JA 3REGA 3ZNPA 4CNQA 4JVNA 3GDWA 2JD1A 1CJCA 4REOA 4M1WA 1U3DA 1KEWA 2TS1A 3ET5A 3PE3A 4UHKA 1U0TA 5BSHA 3DZFA 3C5EA 2L0XA 4B3SC 2OPLA 3VSAA 3EG5A 5HM6A 4DRXA 5HKBA 1E3IA 2R6AA 3CUYA 5H59A 1Y0BA 4X45A 4ZT4A 3T3DA 2PGLA 3B2NA 4MW6A 3PXCX 2ZUFA 2DTDA 2VDWB 3QLJA 2F3QA 3HC7A 4MGEA 1XKQA 4O2AB 4MVCA 1GM5A 4ITUA 5DEOA 2P0EA 3H1FA 3RC9A 1PIWA 1X0VA 2BFCB 1ZB8A 2ZLBA 3BQ9A 1FFAA 4QBFA 1N7HA 2Q3HA 2EWMA 3JXEA 3I62A 3OT5A 1WBJB 3SZRA 4B6QA 2EHJA 1UWVA 2HRCA 3QVKA 5JEDA 4UNPA 5MN4A 2QL7A 2Y8EA 3MUOA 3QVTA 3RU9A 4EG8A 4JVSB 5F2KA 3ELYA 1Z0DA 3ADDA 3N0XA 3WYFA 4KU4A 4QUIA 2QS9A 1G66A 4ZCSA 3V1MA 1O8BA 4CEJA 1A7JA 1EE2A 4Q4AA 3WMXA 2XVZA 5FUQA 4EJSC 1P6QA 3PNQA 1IBMB 3AX6A 4JVLA 2JGNA 4PQEA 1M0SA 4PUIA 5JPCA 3PPWA 1P33A 5P21A 1LLCA 3P5BA 3QELA 3EEOA 5B55A 1VIMA 3OWXA 4W5WA 1M72A 3Q3HA 4LXIA 4MA4A 3U9LA 4EAQA 2ZRDA 3RFFA 1IY8A 3GFQA 3ASVA 3O1HB 4N5LA 4FGUA 3NDJA 1MC5A 2Z58A 4DA6A 5A3JA 3BRQA 4LI0A 1I6WA 4JI2C 2VG8A 2ZUUA 2VP3A 3AJEA 2RHOA 5G4LA 3QKSB 3W90A 1A5AB 2O57A 1WMBA 1AOXA 3VBEA 3DVRX 4OXYA 4FQ7A 2F48A 4G6ZA 4YIHA 2R2GA 4KO4S 3NWOA 5A5EA 5E8RA 1FZTA 1BDHA 4I1SA 1LV8A 3BKWA 1WU7A 2J46A 3IHTA 4Y2UA 4OJKA 4DPMA 2CL7X 4ZN6A 2ZE8A 3DF9A 3SPXA 1EFHA 5LYJF 4GXQA 4R1MA 2R62A 4TT3D 1NFQA 2E37A 2WAXA 4BJHB 4MXDA 4YRDA 2XCUA 1NLFA 3EXG2 1KIFA 2YHUA 3A3PA 3A25A 4KNWA 4KXNA 2XWSA 4OSEA 4XQ0A 4Z7QB 4OP2A 2VUSA 4RZSA 1E4EB 3V7UA 2XB6A 3DE5X 3Q6NA 3WI7A 2BZ1A 1XTVA 3MGCA 4ZP1A 3NKLA 1JSXA 1QKJA 1T8TA 2V1UA 5BR7A 2Y9PB 4EI7A 5GPBA 1MO4A 2NUPA 3KO8A 4H77A 1NU8A 4RBNA 1UMBA 4UMDA 2FSHA 1WEHA 4RY9A 2ODQA 3GDFA 1OXKB 5HIJA 4L16A 3SGLA 3B1WA 3AHEA 3ROMA 3GYBA 2QAIA 3QPBA 4BY9E 3DB1A 4K28A 1N1EA 2DT5A 5DWQA 3TKLA 4AI6A 1U6IA 3PWZA 4IIXA 2AG6A 1S01A 2OZKA 3I2HA 1U2GC 2Z8XA 3C6ZA 3O4JA 4KFTA 2GSWA 1HDGO 1QZXA 4IGAA 4UCQA 5K20A 3D8TA 2IC5A 3UAGA 3ROKA 3VAYA 2PXHA 5AXCA 3LSTA 3AEXA 2AMLA 3DPIA 3FDJA 5AOBA 3SFZA 1V3VA 1U2RA 1RBQA 4LQ4A 4M1SA 1MF7A 4ND5A 4OCZA 4RA9A 4RMNA 1H66A 5IM5A 4DDWA 4RY2A 3STXA 3QE4A 3UWOA 1Q1BA 3ZU6A 4M1TA 5C5DA 4NI5A 1K4MA 2G70A 4QDUA 2UU9B 2ZVPX 4FVTA 2A92A 3W8EA 5A0VA 4IDAA 1WUTA 3CLUD 1C9KA 3VH3A 2AFRA 2XIQA 3DMNA 2PEYA 4Q19A 5KNLA 3LYUA 2FNAA 2OR3A 4YMHA 1B2LA 3WR5A 2Y3IA 1HTTA 4BU0A 4UULA 1T6NA 4FB4A 4DBLE 1WXHA 2FSGA 3E6AA 3HRKA 5EXSA 2FRDA 1M8GA 1VKJA 1K9SA 1KJ8A 2QDKA 4IIVA 1C7FA 2SBTA 1X70A 4P4SA 3NAMA 4KOEC 3ANSA 4YJFA 3ZGYA 1Y1KE 1NVAA 4NPHA 1JIQA 2GAAA 4LYJA 4NENA 3QBDA 4P5PA 5JNUA 1FTYA 3NEAA 1JQAA 4ZEOA 5HM8A 1U0JA 2Z6QA 1CY2A 1YIAA 1J8MF 5DM0A 1D4FA 2AIRA 3I3SR 3E1SA 4I3HA 3W5IA 3EF3A 2QORA 3N58A 1LDYA 3INTA 1PS0A 1JV2B 3LNCA 5EHXA 2D5IA 3NCTA 3RASA 3VR5D 2XV1A 3P2OA 4HB3A 5A4JA 3FHJA 4YJHB 4F11A 3PJRA 1XNRC 3RB8A 1QP8A 5HPYB 2BELA 4C7MA 2J9RA 1B0PA 2OCYC 2BDTA 1FDVA 1Q0UA 5T6MA 1DU4A 1Z34A 3FYUC 1ZD8A 3V4FA 1FS5A 1PQ4A 4O02B 4KPYA 5JO0A 1HF3A 1G4HA 3FA2A 2X23A 2YWCA 4ODIA 2M6LA 2DJIA 3GEEA 2DWQA 3EWNA 2OLJA 1A7UA 1I1HA 4FMBB 3PYLA 4LDJA 4MYCA 3S1LA 3WLJA 4FIZA 1K3FA 4FFBA 2C7QA 2E87A 5LL6P 1JR3A 1K68A 1EFUA 1KH3A 3GLUA 4TV9F 4TN5A 5E6RA 4HWPA 4OG2A 2V7BA 4RQUA 1FXUA 4G5YA 1CQZA 1YMQA 2W2QA 3QVLA 1M7GA 4G4SO 1ZIDA 5K0JA 1U7DA 2WVJA 1SIUA 1J2TA 3S81A 4GYKA 3KZXA 2H0AA 1RP1A 2GYWA 1BE6A 4TN1A 2RHJA 2WNIA 4EGAA 4QPJC 5JDIC 3E9NA 1E9DA 3FHLA 3GAMA 4JSRA 5KNDD 1F0NA 4CUJA 1ZZEA 5DX8A 1KQGA 2Y66A 4YI3A 1NYQA 1IZ7A 2XB4A 2XNDA 1ZEMA 2P7IA 3EPPA 4GBJA 4LG1A 3VAAA 1P2VA 3WKDA 3U60B 2GEKA 1JDSA 1CNMA 1JHRA 4V0KA 121PA 4QSHA 3R7BA 4AMUA 1RXCA 4ZC1A 4BE9A 4B35A 3H5WA 4HGRA 1S9HA 1PKEA 2WWHA 4PZCA 5G0VA 4MRMB 2KB0A 3I8XA 2A35A 1KHTA 2R48A 4MIEA 4OJQA 4BNIA 5KHLB 1AGXA 1ZNQO 1U3TA 2A0YA 4MHTA 1QHFA 3UAWA 3WXBA 5HIMA 1AGPA 5IP5A 3DO8A 1MRSA 4NLLA 1I4EB 1PJAA 1DAIA 4P3YA 1XDDA 5IFIA 1JEQB 4LXXA 4X6YA 4OGGA 4RJIA 5JSFA 1ZM4A 1NMYA 4S2EA 1CUEA 1T2VA 1PNTA 3NFYA 2OZLB 4DUYB 1ZNWA 2QTFA 1DP4A 4F5ZA 4D4JA 4BGUA 4LQCA 3GLGE 2G04A 5G1PA 1DC3A 4BTVA 3FB1A 4LA4A 3UXMA 1KY5A 1PSWA 3ZI0A 3PEVA 4EKYA 4JBWA 2UZAA 2AJBA 1MO5A 1VBFA 2IEAA 1WABA 3R6WA 5BQ3A 1N6LA 2EZUA 3C3CA 2P67A 3VBCA 3ZS8A 4MVJM 5GGYA 4UARA 2CU6A 2V7QD 4Y7DA 2ZJ0A 4OAQA 3H9EO 5F7JA 4C3OB 4KAXA 1CRZA 1JHYA 2VK8A 4H4EA 4Q7EA 2HC9A 5ITVA 3B1XA 1KZ6A 1LZLA 3AF4A 3BN3A 3E3OA 3IQZA 4GRDA 4OQEA 1NDUA 2V8OA 2G07A 3KOYA 1E1KA 3IT3A 5EIWA 5HIAA 3UJNA 5HP4A 5AJWA 1BSVA 4HNRA 2ZIEA 5J4VA 5KDDA 2AFHA 3GP8A 4DDVA 5CBPB 1M2KA 1YVUA 4C0KA 5GOZA 3FAKA 4DCCA 4PYQA 4E5DA 4EGFA 4Q5IA 1OB2A 4X54A 4J07A 3S0JA 1MBZA 1IJKA 4RKRA 3W2TA 4N5HX 2CV1A 3P0EA 5HRAA 1WCWA 1M5TA 1GLNA 2I4NA 2X4LA 6AT1A 4C14A 3LUKA 3GR0A 1ABEA 4MQFA 4BC7A 3L7OA 4R81A 3TR5A 4KQJA 1NPYA 4C0XA 4IQFA 4DT1B 4HVLA 1THZA 1LB1B 1UEIA 1YO6A 2H0QA 3GROA 5CXXA 5IBCA 3S1AB 2ACVA 4Q16A 1GZHB 2BKXA 2EX0A 1C1YA 1YS7A 2OHOA 2PRSA 5G0TA 1FE8A 9ATCA 4CMIB 2R86A 4MVJP 4B7ZA 1HI9A 3CRNA 1VLZA 3IO3A 4NBWA 3F78A 5U4QA 4ZQIA 4CR7A 3H8SA 3LVFO 1SBQA 1XAHA 4I9GA 1YB7A 4HHEA 3WK9A 4MWZA 1FEZA 1FTNA 3BXPA 1PEDA 5JZVA 5CJ2A 1ZFNA 2HA6A 2YFYA 2P65A 3BZWA 3GFBA 5DHUA 2WNSA 1XV5A 2WAAA 5FF9A 3SIPA 4ATNA 1VJ1A 3EGOA 1G1MA 1XFDA 4A6PA 1PCXA 2GF0A 2VWHA 3VR6A 5LQKA 1FXWF 1IOWA 3TD6A 2XH8A 1VKNA 4XUCA 2JKVA 4KIJA 4K9SA 3C2QA 3AUFA 5EJAA 2MMAB 4A6DA 1AH2A 3PLNA 4Q05A 2XMPA 1C41A 3C3BA 4HWGA 2VS1A 2FCRA 4F96A 2LIPA 2N3ZA 2BTQA 2ZT7A 2F3RA 3BWVA 5LZ4A 1Z5VA 3FG9A 1XNQC 5ADVA 5FX2A 4UUBA 2GXQA 3KCQA 4OTZA 3OTWA 3S99A 4G1VA 1IPEA 1BN6A 1U90A 4ILEA 4PRYA 3S27A 3WLIA 2VXOA 2DCMA 4KH0A 3LGAA 1K2WA 1Q2XA 1YIDA 3AFIA 4BN4A 4MJ3A 3PJDA 3GLVA 3K2EA 1VZ3A 4DV6C 1E2HA 1OQAA 4IR7A 3A1WA 5J1TB 4BB6A 4CEHA 5CUQA 4IGFA 4KK4A 3TRKA 2I78A 4RDXA 4FI3F 1IDN1 1N1DA 2PZMA 3DVQX 5JSQA 1P6UA 2XMBA 1SCIA 4WOCA 2GARA 2D28C 4ESEA 2WPDA 1DJPA 3DT6A 2AEEA 3MJ4A 5JNVA 3EA4A 3Q8LA 3CKLA 3R5KA 1K5HA 3L2OB 3CX8A 3KE9A 5AKLA 4ZGGA 1EM8B 3L4SO 1DEKA 4PEVA 3DJFA 5J2UF 1W581 3DUWA 2FUNB 2NU8B 3L8MA 1QLWA 3MWJA 5AK4A 3DFZA 5FPSA 4IV5A 1GTRA 1U0BB 2UXBB 3A9UA 1K75A 2C2HA