3R9XA

Crystal structure of era in complex with mggdpnp, nucleotides 1506-1542 of 16s ribosomal rna, and ksga
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
302
structure length
302
Chain Sequence
b'HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase Era
molecule tags Hydrolase/transferase/rna
source organism Aquifex aeolicus
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
total genus 102
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3r9xA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9xA01
1Q1ZA 1U99A 3IQXA 1EK0A 3KUCA 1XJ0A 4BLPA 1FZQA 2GCOA 2PH1A 1W49A 3F8TA 1QHIA 3GEHA 3KZ1E 4B32A 1ZD9A 3CM0A 1XMJA 3NBXX 4OHVA 3SC3A 1NBME 2WJGA 3SYNA 3TIFA 1W2GA 3I8SA 1O3YA 3T1QA 4HB3A 1FP7A 3FVQA 4LGMA 3P1JA 1UBGA 2OFWA 1Q20A 1CIPA 4C4PA 1VHTA 5HCIA 2ZJ5A 1XFAA 4M53A 4I81A 4DEYA 1E79A 4IKEA 3GLIB 5CYOA 2O8EA 3THYB 3FOZA 1G4AE 2WWXA 3SJAA 3AEZA 4NXNC 4IJMA 4DIDA 1W36B 1S1MA 3FHCB 3H86A 4PR0A 1L8QA 2BOVA 2PT5A 2XEXA 4G1UC 3VMFA 4D82A 4F92B 1XX6A 1U9IA 1CULC 2GCNA 4E03A 2V54A 4PZZA 3W34A 2Q9AA 4F93B 4KJZA 4B76A 4PSKA 3ND8A 1PZNA 1K0RA 3FHTA 4U02A 1SKYB 5JHHB 2QPOA 1GNPA 1IY0A 1N2FA 2EYUA 4LHWA 2ONFA 4JLJA 2QQEA 1DAMA 1TF7A 2ZS8A 4EPXA 3ZVNA 3BAFA 3MUFA 3VU9A 4AKIA 2EQBA 1U94A 2BJWA 3IEUA 1Q3TA 2ZYVX 2XR1A 1KIMA 1RC8A 2Q21A 5ANRB 3HDTA 4I1VA 2J3EA 1C1YA 4TLBA 2Z4RA 1CS4C 1YJ5A 1XMIA 4OI0A 3K9HA 3AF0A 4LC0A 4QBGB 2O8CB 2ZR7A 2ERXA 2IW3A 1MRNA 2ODWA 5FOTA 1OH7A 1HQYE 5KYKA 3O8DA 1JXMA 4DV1C 4PHGA 3ZD7A 2WSSD 2X2EA 2QBYA 2ODEA 4IEIA 2GJSA 4OHZA 1X1RA 4DWJA 2A5GA 1KKMA 3AKEA 1N5JA 3I1FA 3FHOA 3IBYA 3U3RA 1XTJA 1U2RA 4DV4C 3R7WB 3UWOA 3OHMA 4XVQA 3W9YA 2DWPA 1QG4A 2IHBA 4IVRA 4TT3A 3WXMA 1AN0A 4DV2C 1EFHA 1ZINA 1ZM4A 3EIEA 2PEZA 4G5GA 1KDPA 2W6IA 3U44B 3MJHA 3RRMA 3EPLA 3DDCA 3T35A 3VAAA 4LHYA 4LJ4A 3CNNA 1CTQA 4RD1A 1KJZA 4TN1A 1XF9A 5KDDA 3EPJA 1DTSA 2RGBA 4JL5A 1AGPA 2R9VA 1RW4A 4EKDA 3L8ZA 4Q19A 4DT1A 1P61B 4A9AA 2FEMA 1GILA 2GCPA 4PTLA 4G5QA 2FU5C 2Q9CA 3H1TA 1X8LA 2BV3A 2RH5A 3AVQA 1N5IA 4N3NA 1IM2A 1YU9A 4ESHA 4HUQB 4JBXA 2WM9B 5FUXA 4B47A 3TVDA 1ZM7A 1LB1B 3CR8A 3TH5A 3EIQA 4JVNA 2O0JA 2UVQA 3CPEA 4M4SA 3LD9A 4V0ME 1Q57A 3ZZUA 1U0JA 2B92A 3LUSA 2FSHA 3OIVA 4XVRA 4IDHA 2R8RA 1V43A 5JS7A 3QSYA 3TJZA 4WZAE 2WJIA 1E9FA 2YC2C 3EARA 4JLKA 4KODA 3B5JA 3GLFB 2B7BA 1P7CA 5GVSA 4DUYC 1R5OA 3ZIAD 1XEXA 1T9HA 5J40A 2YOFA 3GJ3A 1G20E 1Z5ZA 5FL3A 2F3TA 2YINC 2O8FA 1CP2A 4U00A 2V55B 1GRNA 3GJ0A 4ZDJA 2EGTA 3KKMA 4M9SA 4GOJA 3O8RA 2D7CA 2GKSA 2ANCA 2ZRMA 1J70A 2OLKA 4B3MC 4P0TA 1XPOA 3W8RA 3KJEA 4HDOB 2V7QA 1E32A 4BLQA 3FGNA 1E4VA 2FPLA 5L3QA 2L0XA 4C0SA 5KO2A 3KKNA 5L8VA 4NCKA 1W0JD 4NCHA 2QENA 1TUEA 1IY1A 4KO8A 5CIWA 4RZ2A 2SHKA 1G3MA 2RKOA 1PUIA 2OPLB 3HYRA 2KBFA 2VBCA 3LLMA 2FX3A 1ZU5A 3J80D 4WW0A 3LQRA 5FOSA 1R0XA 1DAHA 1YZKA 2BBOA 3EZ2A 3TAHA 4I1UA 2FDCA 1UM8A 3UATA 2CBZA 1F2TB 2BBWA 2WJJA 3DEFA 2I4IA 1G41A 2BKEA 4F38A 1YZUA 1Z63A 2B8WA 2ZRAA 2HF9A 2ZXUA 4LFBC 1BS1A 3CH5A 4F4JA 2ZR9A 1GL6A 3MJRA 4Q1AA 2C9CA 1Q44A 2OEPA 5CM8B 4C0JA 221PA 4JI5C 4DR6C 4B3TC 1G291 1PLLA 3LXXA 4P33A 2CVHA 3QKSA 1SVMA 4PSAA 4BFZA 4BLOA 2LCFA 3PITA 3C41J 4URWR 5GJBA 1MO6A 2HT6A 5KDOA 2HUPA 4LJ6A 2D7DA 4FMDF 2O8EB 4BFUA 5JWRA 2RGNA 4JBYA 2CE2X 4JKYA 4V02A 3MMPA 1H65A 5EXTA 4LYAA 4C2UA 1I2DA 1JR6A 3K0CC 3RS7A 3AVTA 2VLIA 2FPMA 3RRNA 3TRFA 4DLRA 1NG9A 4A82A 4MRVA 1ZU4A 1YZGA 3QENA 2FWRA 3K09A 4MH0R 4OHXA 1OKKA 3AVPA 1M74A 3B9PA 2F55A 1GRRA 4V0NA 2WIAA 3V4RA 2OCAA 4MGIR 2ZRNA 1HV8A 2QP4A 3T5GA 1KI1A 3RSLA 4MGZR 2FSFA 1UJ2A 4RCZA 1X6VA 4BUJA 2DR3A 1CEEA 2J7KA 4HATA 4QL3A 3CR7A 2IYSA 4Q1FA 1K8RA 3MWYW 1J2JA 5FTNA 4Q4JB 4AIIA 4CEJB 5GJWC 1HE8B 2GAAA 1M2OB 2XTZA 3SYLA 2MSCB 4WBSA 3PEUA 1XEFA 4DR1C 3BS4A 1EX7A 4TWZA 1FFHA 3R20A 2WVJA 1LNZA 4OKSA 1TQ2A 3GFPA 2AR7A 1Z6TA 5JRZA 3PUYA 5SZJA 4NYIQ 4TTQA 3U4QB 4Z54A 2UZIR 5JS8A 1BYUA 5C4MA 4XD7D 2F9MA 1G19A 3L43A 5FBRB 3BFVA 3AF1A 5K8IA 3KQUA 5TV2A 4HB0A 2H1LA 1T0JB 5B64A 1LVGA 2QMOA 2GJ9A 5FTKA 1Z6GA 3W6OA 2OAP1 4BRWA 3G0HA 4D26A 2HLDA 2ZJYA 3FKSD 3JZMA 2DB3A 4QKQA 3QVUA 4A6PA 2GCOB 4R7ZA 1EFTA 1PLJA 4JJZA 1TL7C 5C2JB 1T4GA 1M6NA 1KJWA 4NYJR 2KE5A 4IRUB 2WTUA 4ZCLA 5JHGB 3JVUA 4Q02A 2D4HA 1E9SA 2H5EA 1UKEA 4M9XA 5DH9A 3BFKA 2NPIA 4RSGA 2OM2A 4R71A 3TR5A 3T1TA 3MLEA 3N5CA 1K5GA 3CZQA 1P60A 1LFDB 2VSOA 4JVSB 1VIYA 3H4MA 1NVXQ 5J4HA 2ZYTX 5IHPA 2FE4A 4DR5C 1Q22A 1JQLB 3R9WA 1WF3A 1XDBA 3VR1A 2G1KA 1DS6A 1US8B 1E1QD 3LWNA 3FE2A 4JYAC 2UUAC 1G6OA 5DI3B 1N6OA 2GVZC 1F2UB 5CB8A 4UXIA 1YRBA 1NY6A 4Q7MB 2IS4A 4Q7KA 2V4ZA 4IXMA 3EWSA 3R8FA 3K9NA 3KKPA 3K70B 4PC1A 2QSYA 2V9PA 4Q9KA 3QG5A 1XD8A 4TL8A 1PLKA 1COWD 2UXBC 4W5WA 1P2UA 4QM6A 1Q1QA 3VU9B 2RGXA 4L5BA 2EFDB 2XJ9A 3J81k 1VMAA 1CU1A 1ZAKA 3JZAA 4UNSA 2CCKA 2ZSAA 4DUZC 3VKGA 1N2CE 2ZRKA 3CX7A 2V3CC 2IYXA 4NYJQ 1R2QA 4Z8XA 1NMZA 1KGDA 4B75A 2ZYWX 2A30A 2W0MA 4A15A 2O8BA 3QPVA 4JYBA 4IDQA 1HR0C 2IYRA 2W6ID 1W0KD 1YQTA 1JQJC 2YVUA 3GMTA 3KQNA 1G5RA 2PZFA 1WXQA 3U2QA 4PQRA 3MAAC 1Z29A 4WXPA 2FF7A 2H16A 1PA4A 2BHRA 4UJ3A 1SKQA 5CLLA 4D0LB 3CB4A 4PQFA 3TSZA 2QL6A 4XH9B 4Q5IA 3KKOA 4CRWB 1XBTA 5BWMA 4TYYA 3R9XA 1I2MA 2BBTA 5EQTA 4Q9HA 4RD6A 1I94C 1G7CA 2Q6TA 1B0UA 1VHLA 1RFLA 5DN6A 3GLHE 4LYFA 4DLUA 5KSOA 4N0EA 5SZKB 2CLCX 1RPZA 2WKRA 1F3OA 2XB4A 1MKYA 3FMPB 2W2XA 1SXJD 4V0MA 4BSZA 4TTPA 5FH9A 2W0SA 4IHQA 4YMSA 2GEUA 4DIEA 1ZVQA 1XCMA 2C96A 4C0QC 2IT1A 4DLVA 3FWYA 1ZJ6A 4KSBA 4AQYC 3PENA 4Q4AA 1E2IA 2QM8A 4C0HA 8OHMA 1P2SA 1BMFA 1ZIPA 2XTNA 4MYTA 4Z8YA 5F98A 4ZDWA 3WNBA 1HEIA 4D4JA 2QMUA 2OXCA 3QVVA 2GAOA 2ONKA 2FFHA 4DR3C 4Z51A 5AUQA 3ZD6A 1GUAA 4LX0A 4AYWA 3I3SR 2C9OA 3EZ6A 4DR4C 3Q5EA 1NVWQ 4ZKDA 1D2MA 2PLFA 1IBKC 5AJZA 1UDWA 1SHKA 2HJGA 3AF2A 4IDOA 1IN5A 1GITA 1MABB 1OYYA 2FGKA 3L2OB 4BFXA 4DBLC 4D4MA 2KZFA 5JEEA 3OIUA 4NXMC 2V1XA 1WH9A 1CR1A 2JLVA 4D25A 4OK5A 3KXLA 4A0RA 1TQ4A 3I4LA 3A1UA 4JS0A 4ZDKA 1E2KA 1KZGB 4UXHA 4C0AC 1YZTA 2PZGA 3VHXA 1G4UR 2J0UB 3CRQA 4BQSA 3RS3A 1KKGA 2IYWA 1I4TD 2C98A 1XWIA 5CB6A 1MO3A 4HDCA 4P3YA 5HZHA 1R5BA 1KO1A 2AL7A 4TQAA 3QXJA 1WQ1R 2AKAB 3MRSA 1S9HA 1SVLA 3N70A 3ZJYA 4ARZA 4CIDA 4TSFA 2J87A 4D0GA 2IXFA 4AK9A 1RE0A 1WP9A 1LS6A 4OK6A 5CK4A 2XNSA 3JVVA 2KWIA 3TBKA 3NWJA 5AJYA 3CZPA 1DG3A 4QNRA 2PJRA 1E2FA 4II7A 1E9AA 4OJQA 2ZTSA 1MRSA 4I99A 3AV0B 421PA 3IO3A 1P73A 1NKTA 4FMBB 4R98A 2VHTA 5FPHA 4S2EA 4AURA 4C0BA 1TUIA 5BYJA 4TYWA 721PA 1DPFA 4B2IA 3D7MA 4H1VA 1XNJA 2C78A 3HU1A 1W0KA 2WKPA 4A0HA 3M1IA 4M1TA 4M1KA 1AJEA 4K0KC 4P4SB 3X1YA 1GP2A 4IOLA 4CF7A 3T1HC 2V6IA 3NVAA 2CHQA 2NZJA 3Q7QA 1S0UA 2JIZA 2WAXA 3WHKA 3KB2A 5HKKD 1N6LA 1NLYA 3IBGA 1G6HA 1MO4A 2E1RA 2FN4A 5D3MA 1GVNB 1CLUA 1OH8A 1ZBDA 2B8TA 1S3SA 1ZUIA 1P4SA 2HDNB 3ZVMA 3SJCA 4XSGA 3GJ7A 5FUWA 2AX4A 2VP5A 3CH4B 1IOZA 4M22A 2BDTA 4Q4JA 5DYGA 3TKLA 3B1XA 3LW8A 1UKYA 5H1YA 1E96A 1TX4B 3TQCA 3M6AA 1UBFA 1N6HA 2IYZA 4MA4A 4MTNA 2QROA 4BZXA 5LDDC 1U98A 2ZANA 3B9QA 4FMCF 3WRYC 4LJYA 4KBFA 3K0EA 4RFVA 3MWKA 4RZXA 2DYKA 1R5NA 1E2JA 2EWWA 2QT0A 3IQWA 3NDPA 2JJ2A 2WWIA 4BZQA 5L3SA 2E87A 2G9NA 2R65A 1WCV1 3L0PA 1J7KA 3SFZA 1OB2A 4POAA 3SOPA 2JEOA 3EPHA 2J0QA 1MOZA 2FMXA 1FUKA 4MRNA 1E2NA 3UIEA 2LKDA 4B2LA 1NL3A 3OIWA 3WYGA 5FPKA 1E9CA 4PC3A 1OV4A 4URUR 4LJ5A 4M1WA 2H8KA 1K5DA 2D06A 2OO7A 1LV7A 4E07A 1RYFA 2QRZA 3HP1A 5CM9C 4HLQB 2QGNA 2NO0A 2G0NA 4D0NA 1OIWA 1UDXA 1NN3A 5JFGA 3I73A 1DELA 1VCOA 2AFIE 2ERYA 2G6BA 1NY5A 1KK0A 2VIIA 2RGCA 4DR2C 3KX2A 1JEEA 1OFTA 2ZAOA 2IUSA 3WMGA 3CX8A 2CNWD 3SHWA 1UAAA 2ZJAA 3GFTA 3VR3A 1VG8A 5BYKA 1G8YA 4X65C 1E1RA 4HB2A 3K53A 2VH5R 3BFXA 1W36D 5DISB 5A5GA 1OHHD 2QRNA 3BH6A 1W1WA 3ADBA 4LRWA 3RS4A 1UBCA 2QQ0A 1ETUA 1II0A 3PXGA 5JWOA 3LH5A 4LF7C 4ESVA 2PCLA 1U0LA 4C7OB 1SXJB 3ZQJA 2CL7X 4NH0A 1NNEA 4LDJA 3DM5A 3LX8A 4DDUA 1KZ7B 1DOAA 2J5XA 1MT0A 1GKUB 2JA1A 5IF9A 2WMOB 5BW8A 4GZMA 4URVR 1TEVA 1WDTA 2JJ1D 3LY5A 5LPNA 3K0SA 1DO0A 4PXAA 4A92A 2KI5A 4OK3A 1IBLC 2OUKA 1SVIA 2Q3HA 4HUTA 1EGAA 1P2VA 2ZREA 3DOFA 4MYCA 4JL8A 4LBWA 4DLTA 1R7RA 3OAAA 2R6DA 2NO9A 4GMXA 5G40A 1II8B 2V7QD 1UPTA 2J46A 2WV9A 2VHCA 3OFND 4L4UA 2ZVQX 3BWDD 3HPQA 3A1SA 1PUJA 2VP2A 2DY1A 2ZI4A 1F5NA 2D74A 3KDSE 1P72A 1XZPA 1U81A 2E8FA 1N0UA 4TLAA 5LBIA 1ZMXA 2RHMA 3UG6A 2W2TA 4PPNA 2FPKA 3KJGA 1FMJA 3AF4A 4B44A 4GI7A 4DSUA 3DZ8A 2QMEA 3NEYA 3EPKA 1NSTA 2NO6A 5HZKA 1OXXK 1XPUA 4M1MA 1A2KC 3BK7A 3GLGE 3TUZC 3WBKA 5JRJA 1NI3A 4ZIRA 1EWQA 1GL7A 2QAGA 2GJ8A 4ZPXA 4P32A 2IS1A 1OJLA 5LMNC 1XCPA 4LUCA 3UMRA 3EAQA 1E69A 5FR2A 2RGDA 2BBSA 2CLSA 4XD7A 4WIAA 1E4YA 2X77A 1OFUX 2A9KA 4GZLA 4RFSB 5HPYB 4LK2A 1EFRA 2JLQA 3AUYA 3RRZA 3AGQA 3EW9A 3REFA 1XNQC 4MDEA 4TTRA 4MKGA 2XZLA 2Z43A 1W4BA 1YVDA 2WOOA 2NTYC 1TU3A 2F7SA 5EE1A 5G3ZA 4JI6C 2RGEA 2EVWX 1W48A 5FBLB 5KSYA 2ZSBA 4B33A 2VQFC 3H2YA 3PQCA 5GADl 2P6UA 3GP8A 2V1UA 5DNYB 1G3QA 5KU1A 3VKHA 1N32C 1IBRA 3KUDA 3P26A 4EPWA 3ZVLA 3WNDA 3U7GA 2IK8A 2J59A 4NYIR 3ZVRA 5FBVB 3EWAA 4I4LA 5KPDA 3SJBA 2GK7A 4M21A 4TLEA 1E9EA 3RAPR 1T8UA 2AHOA 4JLVA 1GDDA 4LFCC 1NSFA 1GOTA 1P2TA 2FEOA 3AVYA 1RRFA 1X86B 3HJNA 4M9ZA 4U5XA 1R8QA 3B85A 1DAFA 1ZM2A 4NONA 4YDSA 4R2HA 5DHFA 2J45A 1ZCAA 5F3WB 2CXCA 4HZUB 3Q85A 4TL6A 1JJ7A 4DRZA 3SNHA 4DDTA 2WSSA 2QMHA 4EPVA 1XD9A 3NC0C 2ZUDA 4KITB 1G3UA 3TNFA 4CEIB 1Z47A 2JLWA 4BFSA 4CT4B 3QG1A 2D3WA 3ZZ0A 4MITA 1N0VC 1AA9A 2J1LA 2B6HA 4OQXA 3SFVA 1Q12A 3CPJB 4JBWA 4TMZA 5J4KA 1E0SA 1BKDR 2ZUBA 4KV9A 1FOEB 3CONA 4ASUA 3AKYA 4DLWA 1KKLA 3IPYA 4MRSA 1P62B 4DLXA 2OHFA 3CNOA 4DT1B 1II8A 5G41A 4QRHA 2FGJA 2NPFA 1USPA 5TB5A 1TEXA 4I1SA 2ZJ2A 5D3QA 2VPPA 2ZS9A 4LF5C 2ZU6A 1VYUA 1MV5A 2PEYA 2Q0HA 1D5CA 4KXFB 4PO9A 2UXDC 5FTJA 2A5DA 2BIFA 1UEJA 2REXB 1YR7A 1ZRHA 5TXGA 2P2LA 4DKXA 1MO5A 3NEJA 2NGRA 2ZPTX 4HLUC 2BM0A 3QF4B 1JOSA 3GJXC 2EW1A 1CXZA 1E94E 1RRGA 1CRQA 5AWFC 1GIAA 5C4GB 4DCUA 3S1AB 4NYMR 1N0WA 4Q01A 2OAQ1 3PIRA 3B13B 1FJGC 1JI0A 4BLSA 4C30A 2O0HA 2PMDA 4MGKR 4QHYA 3PUVA 5A0FA 5G53C 3GEIA 3ICQB 1HT2E 2FZ4A 2JCSA 1TPZA 3W5IA 2PT7A 3SHFA 1CF4A 3LQQA 2X1VA 2P67A 2H57A 4U7DA 1KSHA 1SKYE 1D2EA 2BKUA 3K0CA 4P31A 4DV5C 2EFGA 2GA8A 4O3MA 4Q9JA 1S9DA 4G5OA 5FFMA 5CIQA 1GG2A 4B43A 5B30A 4UJ5A 3LO5A 1S4QA 3KJHA 5E4FA 5TVKA 3KTAB 1W44A 2ZE5A 2IUTA 1JNYA 1GSIA 2WAYA 4L8GA 3OFNA 4LBYA 4UNPA 2ZETA 1G21E 3WBJA 1A82A 1X3SA 1DAIA 4KLZA 2O8DA 2WWFA 2P65A 5BQ5A 4B6FA 5KHOC 2ZM6C 1TADA 1XTRA 2Z0MA 5CITA 1E2DA 4NPHA 2F9LA 3NBFA 3UANA 4QXAA 4B35A 4MDFA 3HU3A 2JATA 5HE9A 4Q18A 1J90A 1G5TA 4MGYR 2DFKB 3HYTA 1R0WA 2WBLC 4Q4HB 5CDFE 1E6CA 3CPHA 5LMUC 3T1OA 2ZAMA 4YLGA 5BN5A 2J41A 2VHUA 2GVDC 4LF4C 3VKWA 4JI2C 1G3IA 2QL8A 2IWRA 3UKDA 4PO8A 4US0R 4AWXA 2GTPA 1SVOA 5F2EA 5KUTA 5FL7D 2W6JD 2GK6A 2A3RA 4YC7A 4QG7A 5KSZA 4OHYA 4HLUA 4M0LA 4FMDB 2F6RA 4FMCB 1GKIA 2BJOA 3QKTA 4A2WA 1ZW6A 2PLRA 3QPWA 4ABYA 3K0AA 3ZDQA 3C5CA 4PPGA 5H68A 3MWLA 4A2QA 3EG5A 4UNNA 5AUOB 5DHAA 3EXAA 3K8YA 4DLSA 2F43B 2AK2A 5IRCD 3DMDA 3TAUA 2E8CA 2CMKA 2BCJQ 3N2IA 4BLTA 5L3SB 2FFBA 2XTMA 3A36A 4Q66C 2IXEA 4A1FA 4E09A 1G7TA 1ZM3A 1N6IA 3W6NA 3AF5A 2YYZA 3PUZA 2QT1A 4Q4AB 3U3MA 2QA5A 1IN8A 2VF8A 1Z6YA 2ZRLA 4DR7C 2KSQA 1H8HA 2IXGA 4LHVA 4NTZA 1C9KA 2PX3A 4KCGA 2N1BA 2HV8A 2G0TA 4BFYA 4CYMA 4WVFA 3QBVA 3ZS8A 5K8LA 3Q3JB 4URYR 1ZUNB 2HXSA 3IO5A 1N6PA 4DUGD 1SVSA 1AS0A 3IIJA 5HCNA 3K0AB 1FL9A 1GNQA 3AVWA 3C8UA 121PA 5EP2A 1IN7A 2Z6VA 3LRPA 4GFDA 3PEWA 3LAWA 2XX3A 1YZQA 4AC9A 1FUUA 2F43A 3F5FA 5JLJA 1E3MA 5EUQB 5LD2B 5J47A 1NJGA 2REOA 4B3RC 1E2QA 4NYMQ 4P4SA 4BGDA 2AXPA 2PL3A 4KYIB 4QFMA 1OW3B 4ZI3A 1QVAA 2X19A 2VRWA 2AWOA 3AQ4A 3LV8A 5KDLA 2DPXA 5KTYA 1EESA 4BRUA 4EIWA 5KPJA 4QM7A 2ZI3A 1E2HA 4JLPA 1U8AA 3NIBA 1O87A 3N2EA 4IW3B 1CBUA 5FI0B 4XJXA 1SVKA 5BR8C 2W6JA 3AP2A 3VFDA 5JCZA 1BYIA 2CCJA 1Q21A 3GKUA 1JALA 2WSMA 4FD2A 1W0JA 1HT1E 1G8GA 2ZI5A 621PA 2DYJA 1ZCBA 1D2NA 3ADCA 1HE1C 3NBYC 3IGFA 2CHVA 3CRMA 1Z0KA 1KI9A 2VHJA 1Z2CA 3BC1A 1DBSA 4D4LA 5IWAC 3LX5A 4JMPA 3O8CA 4TL7A 1E1RD 3C7KA 4UQOA 3G82C 3UMFA 1FQJA 2P6RA 3SEAA 2J0VA 1XJQA 1U90A 1E0JA 2O0KA 4QOSA 2VYFA 1Z06A 4DSOA 2ZJZA 1F60A 1P9RA 1VG0B 1QZXA 2P3SA 2PMKA 3QBTA 1B23P 1JXOA 2C99A 1H8HD 1Z07A 4GKJC 2OCBA 3A1VA 3EERA 3NC1C 4KI0A 5K8UA 3U61B 1HYQA 1HY3A 2DWOA 5EZ6B 1G9XA 5DIFA 1YE8A 2QAGC 1BO6A 2CDNA 1OKKD 1NJFA 1U9IC 3UWKA 3SN6A 1QHXA 1G17A 4LPKA 1IN6A 4Q21A 4CZ2A 1YZNA 1PJRA 4US2R 4DSNA 3QXXA 3U3OA 2QP3A 4JSYA 1E9RA 1OIXA 1Y3AA 5AJVB 4BLRA 4EPYA 4AI6A 4ZV4A 3IHLA 1N6NA 3FYHA 2JLZA 2ZYUX 3ZS9A 4TMXA 521PA 5E3HA 4C2TA 1KYIA 3PFIA 1X8JA 1JBKA 4KFTA 2GWHA 4Q03A 4W7SA 1F2TA 2UKDA 1ZUHA 2PJZA 1ZD8A 4EAQA 2NOAA 4G5RA 4JKIA 4LSGA 4RJLA 4B73A 1E0KA 4DCNA 1N6RA 5LB4A 1CR2A 1GRQA 1CJVC 3MGCA 5JJKA 2ZM5A 4NBSA 1TQ6A 3EASA 3RWMB 2P6NA 1QWIA 4G5SA 5DSZA 1DARA 3ZIAA 2EYQA 3KQLA 1FX0A 1FW6A 5DLQC 4IFBA 4RZUA 1KO5A 1WRBA 2HLDD 3OF5A 3U4QA 1Z6XA 2XSZA 4AYTA 4S35A 1EFRD 4FCWA 1KHTA 5AJXA 1TNDA 1E2MA 3D31A 2BCGY 4C0KA 3I61A 4NE2A 2QM7A 3I92A 2J9RA 4CT5A 5BN3A 1OIVA 5SZHB 2AK3A 4FIDA 1TF2A 5J4YA 1QBKC 4Q1BA 1DVRA 4MKFA 4ILEA 1D9ZA 4IVPA 3H0KA 1XRJA 2CE7A 1NN5A 4EFNA 1G8PA 2J0UA 1US8A 4HEJA 2D7VA 1R10A 1XTSA 2D2FA 2B7CA 5EJEA 3UG7A 4QJ4A 1KO4A 4TLDA 2ZE8A 1ZNZA 3DO6A 1NBMD 1VPLA 2EFHB 1JR3E 2QG6A 2IWHA 1P9WA 2C5LA 2IA5A 1Z28A 2Z5FA 2FNAA 2NG1A 2XZPA 1KJYA 2A78A 2G3YA 2ODNA 3QXCA 4IVQA 3SBEA 4LV6A 4TMWA 3ADDA 1E2EA 2GILA 1OSNA 4FI3C 5IT5A 1JB1A 2ZI9A 2XITA 4CEHA 3DPUA 1KTVA 2BMJA 2OBLA 2ORVA 2ZRBA 1XJCA 4B3SC 2VP9A 2XNDA 2YJTD 2DFNA 3FPAA 4JI3C 3AVXA 1KAGA 1H8EA 2ZE7A 3TW4A 1XMQC 4HSEA 4FCVA 3D6TB 1XD2B 4V03A 1J99A 4NU0A 4MYHA 3GLFA 1KK1A 1OXVA 3GLIE 4JIMA 2NIPA 1E79D 2JLUA 1ODFA 5TMPA 1ZNWA 4NOZA 2HF8A 3BRWD 5FUVA 5EE0A 2Y8EA 3PR1A 3NKVA 3NH6A 1AZTA 4OJKA 1USPB 3OESA 2YWFA 4OI2A 5FL7A 5J5CA 5UKDA 1SGWA 2G77B 1XXHA 1LQLA 4FINA 4JT4A 1JR3A 4P4TA 4Y0VA 4JLBA 5DI9A 3TUJC 5EXXA 2OV2A 4LOAA 2WHXA 1NVUQ 4OHWA 2N46A 4HLCA 2FJUA 1G64A 4URZR 1EFUA 1NMYA 2HEIA 4TYNA 2GZDA 3X1XA 2X8AA 5JWHA 2OBMA 2PX0A 4A2PA 1AS3A 1CJMA 2QSZA 4DLZA 4XWKA 1EG7A 1OXSC 4F7WA 2QP9X 3QIAA 3EIHA 4W5HA 5A4JA 3B1YA 2Z83A 1FNNA 4OL0A 3REGA 1T5IA 1KSGA 3THWB 2DBYA 3CIOA 1W46A 3KFXA 5JMTA 2QEQA 4AG5A 1NBMA 2CK3A 4OQFA 2C77A 1N36C 4HAXA 4KHPC 3U44A 1IXSB 4LI0A 4EFLA 1FTSA 3PV0A 3CWZA 2WJVA 1L2FA 3IHWA 2GNOA 1Z2AA 3BJIC 5FPSA 2OESA 1VECA 2R62A 4WXRA 1KY2A 1NVVR 3RSOA 5AR1A 1XXHE 2FG5A 3MFYA 1OHHA 4JLDA 1IXZA 1Z08A 4PHFA 3EA5A 3UXMA 1R8SA 2BJVA 2XB2A 3VR2A 1QRAA 3AVOA 4A4DA 2ZJBA 1QHYA 2BWJA 1KY3A 4BFWA 3V00A 5JBQA 2JDID 3BB1A 1HNWC 2OLJA 5HE8A 1AKEA 4JI7C 2OXRA 2IHYA 1E99A 1XD2A 4TQUS 2UUCC 1VIAA 1HH2P 3EC1A 2C95A 3U3KA 2VL7A 3TW8B 3IEVA 1TF5A 2ZS7A 2OPLA 2V6JA 1KI3A 1VYVA 4LJ8A 1CJTC 4X8MA 4C0LA 2UU9C 2HXYA 2V8OA 4QGFA 4OI1A 2WWYA 4ACAA 2BMDA 1TAGA 2LWIA 3W6PA 3EC2A 2ORIA 1BH2A 2C2HA 1KI8A 2WPDD 1NIJA 3R7WA 2RGAA 5L3QB 2Q3MA 4QHSA 4GNKA 3PJRA 1Z0DA 3B2EA 3B78A 1OB5A 3FTQA 4DV7C 4F91B 4HAVA 3HR7A 4NMMA 4V0LA 3GLGB 4D6PA 4RZ3A 3VTKA 2JGNA 4HUQA 5DN6D 1VCMA 3VX4A 2EU8A 2IS6A 4QBFA 4FWTA 1A1VA 2ZSEA 3WP0A 3W8NA 4FXPA 1IXRC 2AFHE 2GJKA 2AWNA 3IUYA 4KFRA 2WWHA 4HLDA 2ASEA 5KNBA 1DAGA 4KAXA 3THWA 1VG1A 2YOHA 2B21A 2QNRA 3SQWA 2IEZA 2HYDA 4TL9A 5CLQA 2I1QA 1KMQA 3U60B 3VX3A 1II9A 2WICA 4LHZA 4YMWA 3BERA 3FMFA 3WYFA 3R9IA 2DFTA 3U6KA 4AY2A 1L7VC 2VA8A 3WY9A 3EZ7A 4DLYA 1XB2A 4PANA 1WBDA 1ML8A 3GJ4A 4ZCIA 3ICEA 3LBNA 2MMCA 3DVLA 3VHLB 1XXHB 1R4AA 2ZR0A 2WZQA 2LKCA 3GEEA 4Q7LA 4ERNA 5JSZB 1XEWX 1OXUA 4QC2A 1CRPA 3CF2A 4WAUA 4Z1MD 5CK5A 4Z1MA 1PV4A 2FZLA 3ASZA 4IEEA 1Q3HA 4F4CA 1CR0A 4TQ9A 2Z4SA 3T06B 4MUAA 4EJSC 1Q0UA 2VHQA 1UKVY 3F0TA 3QNUA 1N33C 4GRAA 4B3CA 3O8BA 3RS5A 5GJVC 5LD2C 3EX7C 4DC9A 3EZ9A 2PT7G 1YR8A 4O25A 2QPAA 4XTCS 4JVLA 1T8TA 4PQYA 1UADA 1W2HA 2ZRDA 5H70A 1WBBA 4QBIA 2ORWA 2ZE6A 2IEYA 4J0QA 1FX0B 2PZEA 2VSFA 3QUSA 1YHNA 3LLUA 2JJ2D 2Q3FA 3RS2A 4JLOA 2A5YB 2BMEA 1KSFX 1QVRA 4AKHA 3QY0A 4KYUA 5FBWB 5B2ZA 1X1SA 2QI9C 3SYKA 1NN0A 4PO1A 1JAHA 2H7VA 2YWGA 3HPRA 4TMKA 2K5UA 4RD2A 3TK1A 3KFVA 2OFXA 5ELXA 2ZI7A 1XU4A 4ZCMA 4JVMA 2PCJA 3CNLA 5DGXA 1GNRA 1RJ9A 5FOWA 3CRVA 4R2IA 1VKJA 3SZRA 2QU8A 3B1VA 1NLFA 1SVWA 2G88A 4TT3D 1NVVQ 3D3QA 3PEVA 4K46A 4N0DA 3BH7A 2JJ8A 4L15A 3X1WA 1SXJC 4OBEA 3B1WA 4YMUA 1AM4D 3CO5A 5BN4A 4LFAC 4LPSA 2QORA 1QHHB 3LA6A 3CRRA 1T5LA 4ARZB 1ELOA 2WJYA 3OZXA 2GXUA 2ATXA 2ZIAA 5FOXA 5CJ2A 5DI3A 3A4NA 1UKKA 1KOFA 3L8YA 2PBRA 4AG6A 1DG1G 2XNDD 4W9MC 4M1OA 3VNVA 1RIFA 5HTKA 3U7HB 3FFBA 1YR9A 5AUPB 1A2BA 5FR1A 5J4LA 1G18A 1KMHA 4EFMA 1JJVA 2I3BA 3U5ZB 4B3BA 1H8ED 2O8CA 1XPRA 2GBLA 1GL9B 2VQEC 2DWQA 1J5EC 4IDNA 3LW7A 3PEYA 3CX6A 4JI4C 3ECCA 1W47A 4MRRA 4RD3A 3CKLA 1GFIA 3KQKA 2HYIC 2F1HA 4A8JB 4WA7A 1N5KA 4US1R 3NXSA 3RS0A 3D8BA 2IC5A 3C15C 5TARA 4DCTA 2H17A 2DHRA 2OBNA 2YC4C 3B1ZA 1NKSA 4B2PA 4LZZA 2CXXA 3SU8A 1AK2A 5IDVA 1QHNA 2XZOA 1NF3A 2IL1A 3SE0A 4CVNA 2GZAA 3K70C 5EP1A 2CHGA 2VTKA 4LYJA 3SS8A 1Z0FA 2CVFA 3X2SA 2QE7D 2FH5B 2IF2A 2HT1A 1HUQA 2OT3B 4Q1CA 1D8TA 3X1DA 3WNCA 1WMSA 5LB2A 3ZYCA 3U7FB 3CF6R 3QE0A 4LJ7A 1Z6AA 1FP6A 2EWVA 2A2ZA 4HB4A 5J4VA 4GOKA 3U6BA 2VF7A 2ZU0C 4JJKA 5FTMA 1ESNA 4IOMA 5EP4A 4OX9C 1RVDA 2JAQA 2OCPA 3BXZA 2F4VC 1Z8FA 5E95A 3K09C 3KL4A 4L9WA 4C9BA 2I1VB 2IBMA 3RC8A 2ZEJA 4NCJA 1VLAA 3PCRB 4V0OA 4MUBA 4WOPA 3OEHD 1U0HC 3Q72A 1KK2A 4RD0A 4NDZA 3GJ8A 3PG5A 4LJAA 5AUNB 2RGNC 3SR0A 4PPQA 4EPRA 3ZGXA 2A7QA 4YY3C 2GETA 2IS2A 2ONJA 5HR5A 2AXNA 3L0OA 5FBQB 1M8PA 2GRJA 2DFLA 2IX3A 1QHGA 4FW9A 4GBMA 2R6FA 4DDWA 1KO8A 2YOGA 4V0KA 1XMOC 1X8KA 2QZ4A 5DO9A 3U7EB 4H9GA 4BFVA 2VP6A 2UZ3A 3RDPA 4EPTA 1EXMA 4PZLA 1N3BA 1U8YA 2ZROA 3A8TA 2G1JA 3QKSB 3TQFA 4A0FA 3TSWA 3NBZC 4RCYA 3G5UA 4OQMA 2J7PA 5FOUA 3I8XA 2CEAA 3QF4A 5DE3A 2E5LC 3RVBA 2Q9BA 1T91A 2FFAA 2ZRIA 2D62A 3TUIC 5JJIA 4JI1C 1DO2A 1TTTA 1S96A 4RY2A 4IFEA 4LHXA 3B60A 4JYCA 1Z0JA 2R6GA 1OE0A 821PA 4MQBA 4DDVA 4TZ6A 4DJTA 2C8VA 1E2PA 3HR8A 4DV0C 3ND9A 4YXWD 3A58B 4OYHA 1BMFD 4UXJA 5EXSA 4PC2A 5CYPA 1AQYA 2E9SA 2ECKA 1KI4A 1LF0A 3QKUA 2BEJA 4LBZA 4CW7A 2VSXA 3FMOB 5EE3A 3CUEF 3CRW1 4B6EA 1OH6A 4LF6C 1QHSA 5EE5B 1OLOA 1UEIA 2R6AA 3J81D 1P3JA 2XSZD 4Q47A 3RC3A 1OT3A 3QQ5A 1DAKA 4EQ6B 1QHHA 1HNXC 4CGZA 3K9GA 4HZIA 4JLMA 1M7BA 1RKBA 3I5YA 4WZBE 4BE7B 4L9SA 3VR5A 5D3MB 3CBQA 4QHTA 1RJ9B 1ZP6A 2GHIA 3I32A 3OAAD 4PAMA 4Q48A 4QNMA 1FTNA 3T15A 3B7GA 4GDFA 4FN5A 2O52A 2WMNB 1S2MA 1EFCA 1RZ3A 1DE0A 4Q9IA 5FI1B 1JECA 1G7SA 1W4CA 1NMXA 4LBVA 2IUUA 3ZH9B 3BGWA 2XJ4A 2A5FA 3RRYA 3ETLA 5JSZA 2H92A 1NIPA 4KFUA 1HURA 1XEWY 5B58C 1GAJA 2BM1A 4RKFA 1AIPA 3P20A 1IJFA 4MH4A 3QPUA 3WYAA 2W2VA 1AKYA 4YDHB 2XOKD 3QEOA 5FPYA 3I5XA 2O8BB 3LVQE 4DB4A 2R2AA 2NZ8A 4ITRC 2RGGA 2FOLA 5DYIA 1M1YE 1OFIA 3I07A 1Z0AA 4BASA 4GPTA 1KSJA 1FQKA 5JECA 2AN9A 1ONBA 2RHDA 4JT2A 4XWAA 1V5WA 3LBHA 3F3YA 3BB3A 2GXSA 1KO7A 1XTIA 5KNDA 3PVSA 1I4LD 3DL0A 5F9HA 3NDBB 2QTVB 3ZLJA 3Q9LA 4PC7A 3QOFA 3VQTA 2UUBC 2CCGA 4KSCA 1IONA 2ZITA 4DVGA 3VNUA 2W58A 1SULA 2ZRGA 3AF3A 3EA0A 4ZKEA 4DZZA 5G3YA 4EUNA 3A6PC 3LFUA 1HA3A 2QPTA 4CDGA 3QXHA 5FUYA 4P4UA 3X1ZA 1RYHA 2GEVA 2YHSA 4ACBA 3I62A 1C4OA 2JLSA 3MWJA 4NP6A 2JLRA 4OQLA 3VR6A 2J0SA 4HAWA 4TZ0A 3ASYA 2QE7A 3RWOA 1E9BA 3BD9A 4B3DA 4BZPA 3K1JA 3GLHA 3A4MA 4HDQB 3ADKA 4LF9C 4WZ6A 3T61A 1SXJE 2XGJA 1LW7A 1JR3D 2C03A 1S1CA 2QAGB 1ZC4A 3V4FA 2CL6X 1G1MA 2ZRJA 3GJ5A 4NCIA 4W5JA 2OSBA 3T1YC 5JI2E 5M04A 3SQXA 2FSIA 1GM5A 2ZRPA 3AUXA 2OILA 3WMEA 1E0AA 4DHEA 2BVNA 1G8FA 4G3XA 4LCBA 2P5TB 4X8HA 4X64C 1COWA 4LJ9A 2JMPA 3S1AA 1W4RA 4IOKA 4PZYA 4X8LA 3RLFA 2WKQA 5FOVA 2O8DB 1OPXA 4QJ3A 4X8OA 4PFSA 3QXSA 1IHUA 1W5TA 2TMKA 2RAPA 3FDIA 1W7AA 3AVUA 2VP4A 3C14C 3GQBA 4X62C 5FTLA 1KI6A 1KI7A 1L4YA 3TSOA 5C18A 2OFOA 5IT9D 3RANA 3DKPA 1Q1EA 1R6BX 1E98A 2MSEB 4Q4HA 3W3ZB 1FMLA 4M2LA 2R6CA 4HAUA 4F4IA 1E9DA 2AD5A 1JPJA 1UFQA 3C16C 2IYUA 3NHBA 4GP7A 4MKIA 4PHHA 4R9UC 4RFSA 3ZZTA 2BC9A 2E7GA 3JAMD 4B74A 2HHHC 1M7HA 3HU2A 1DAEA 4G0NA 5IK2A 1NYEA 2DCUA 1XTKA 4GP6A 2BEKA 5H8WA 1HH4A 3T5DA 3OTOC 4PAOA 2YWEA 2CNWA 3ONWA 2JLYA 1NP6A 4B3XA 3W90A 3DMNA 1VCIA 2OE2A 2JASA 4C7OA 4M9QA 3OEHA 1ZYUA 4IOJA 1G3RA 1ZB8A 3B82A 2O8FB 2UXCC 1HTWA 1SZPA 5E7MA 3BH0A 3TE6A 4L16A 2ODBA 4YHHC 1E1QA 1G7RA 4K81B 4EJSB 2WPDA 3AKCA 1ZD1A 4B34A 4CEJA 2F1IA 1L2TA 2GBLC 2HJVA 2O5VA 3NTUA 4EQ6A 1HNZC 1XTQA 2IF0A 1N6KA 1DEKA 1TMKA 1T3HA 4TYQA 4K8OA 4A6XA 1J8MF 3GLHB 3OE7A 2OG2A 3FKQA 3OE7D 3DHWC 3RNLA 2ZVPX 1W36C 2YWHA 4C3ZA 1ZM9A 4YQFA 1P5ZB 1XP8A 5IK2D 2GXQA 4B48A 1XZQA 1GWNA 4ZIRB 2X2FA 3DOEA 2QTHA 3KB1A 3E1SA 3L82B 4NKRA 3Q7PA 5JEDA 4JI8C 1XEXB 2QTFA 4GKKC 3KXKA 2GDJA 3QEJA 3SBDA 1SXJA 2ATVA 3A1WA 2F1RA 4JV5C 4XX2A 1JEDA 3LVRE 4BPBA 5AJWA 1AQUA 4LV8B 4Q7JB 4GMDA 1VTKA 1GTVA 1A4RA 2E8EA 1Y63A 2REBA 3I72A 5E7JA 4QJ5A 4KLNA 2ZQ5A 2FA9A 4UNRA 2YNMA 2W83A 2A5JA 1P75A 1QDEA 3CW2A 1D9XA 2J7PD 3MSXA 5C46F 1IBMC 2ZI6A 4ZO4A 3KJIA 3VR4A 4BEJA 4CEIA 3PUXA 1E2LA 5P21A 1T3LA 4YMTA 4TMVA 4TLCA 4DCSA 2VEDA 4GL2A 2JIZD 3WHLA 2GESA 1ZC3A 5EP3A 2ATWA 3AB3A 4HZUA 1UKZA 3UPUA 3BOSA 1KI2A 5BXQC 1SQ5A 3AVVA 1IN4A 4PHTA 3TLXA 4O2LA 3RABA 1P9NA 1YZLA 3LBIA 4KVGA 4D81A 4AKGA 3QF7A 3NHAA 4CEHB 1KDTA 2WWGA 1LTQA 2F1JA 1VG9B 1F6BA 2ZRHA 3DM9B 4XOIA 5EUMA 3WMFA 4EJSA 3QI2A 4PAQA 2RCNA 3P32A 4NZYA 3W5JA 2IYQA 3T12A 4Q00A 4UNQA 2H18A 4XVUA 4XSHA 1KNQA 2RB4A 3MCAA 4MYUA 4XTRA 3TGPA 2QY9A 3B6EA 2HCJB 3FB4A 3L0IB 1UF9A 3E2IA 4LV5B 3BIFA 1BIFA 4B71A 1RRCA 4A8JC 4IDPA 2G83A 3C4JA 4QGAA 3GFOA 4PSVA 4DV3C 1S3GA 1VDZA 1SHZA 3BE4A 3L0SA 3AH8A 1E2GA 4TYPA 4B3GA 2R44A 3IDQA 4Y0AA 1K6MA 1MH1A 1T3SA 3NH9A 3AF6A 1EX6A 2CL0X 3GLGA 1NN1A 1KNXA 5JJLA 1ZB9A 1DADA 1J8YF 4KHZA 3K9LA 4BEBA 2AD1A 2BMFA 5GJCA 4LYHA 1ZNXA 4FWIB 3T34A 2NMVA 1CKEA 4GSYA 4FCTA 4JLAA 3NG1A 2PN2A 1QG2A 4Q1EA 5TY0A 1OH5A 3ZQ6A 5EXPA 2GF0A 2QUZA 1GZSA 1A5TA 2EFEB 1VYTA 2OZEA 5A2QD 2C04A 1FPMA 1S8FA 2XAUA 1ESMA 1I4DD 3FFAA 1LF5A 3E70C 2KB0A 4ON9A 1XMSA 2FFQA 2KJQA 4PPFA 4PX9A 3Q8XB 3SDZA 3AM1A 4KFSA 4AYXA 1NG1A 2D2EA 5SZIA 2WIBA 4HYYA 3C5HA 2ZSDA 4LC1A 2FSGA 3T1VA 2QN6A 1AS2A 2N42A 1WB9A 5AK0A 4ASUD 4KBGA 3LDAA 4KVAA 1G16A 2GEDA 1EWRA 2YCBA 1M7GA 1T6NA 1ZNYA 1CJKC 2JJ1A 1N5LA 3IPXA 3GD7A 1OFHA 1IAQA 1ANKA 3KQHA 1JPNA 2ZJ8A 3H84A 3K0FB 4JL6A 4M1SA 1IQPA 1UBEA 4D4KA 2VP0A 2JLXA 2P5SA 2QAJA 2YKGA 4M1YA 3A1TA 3LNCA 1KMHB 2WJHA 5JZVA 1IY2A 2EFCB 5KOYA 2ASBA 1M34E 2CJWA 2ANBA 4DB2A 1Q1BA 1NLZA 4ZDIA 1W5SA 3A4LA 5FLXD 3OEED 2YZ2A 4OQNA 5FPTA 4JSTA 4PC6A 3AGPA 4E5UA 2IYYA 2W00A 3IILA 4D80A 4JLNA 4QBHA 4TMTA 4A8JA 4AD8A 1A7JA 4NCNA 4EDHA 1N34C 1CJUC 1XNRC 3KXIA 1NRJB 4TSFD 5CJPA 5KNCA 1TU4A 4ZI2A 3GPLA 6Q21A 5EZ5A 3THXB 1OXTA 4XIGS 3WRXC 1GKYA 1G8HA 3AKDA 4I1OA 2VQSA 4DUGA 4A0GA 3P4XA 4KU4A 4DV6C 1HQCA 1YKSA 2F3RA 2IYTA 4N1AA 1QF9A 5L3RA 4Q9LA 5E7IA 1PVOA 2MMGA 5GVRA 3A37A 3THYA 3O47A 5F9FA 1G5PA 2GXAA 5C1BA 2ZUCA 3E5HA 2GF9A 4QGGA 2YV5A 1KI6B 3M4YA 2AKYA 4RKEA 3LXRA 5TDHA 1VCNA 5EE9A 2IYLD 3SI7A 3CWQA 3THOA 3GJ6A 4BWYA 2CJWB 1AGRA 3BB4A 3QKRA 1R0YA 4YMVA 1D6JA 4A36A 3MD0A 3CLVA 3IIMA 3GCGA 3TR0A 3K70D 3MG9A 2VO1A 2KBEA 3TVTA 4YONB 1R0ZA 2ZJOA 5HKKA 3DZDA 4LWZA 5KSPA 2CK3D 3PUWA 4MRPA 1YRAA 4B3FX 3KTAA 4JI0C 4MKHA 3WP1B 1L4UA 2XOKA 3UMSA 3RHFA 5JI3E 2XXAA 1Z3IX 2C9YA 2IYVA 3AP1A 3Q5DA 2FV8A 2ZRCA 1OYWA 2OCYC 3QKRB 4GOXA 4H1UA 5JCPA 2WWWA 2QBYB 4RD4A 3GLFE 3GLIA 3CF0A 1KDOA 3IIKA 4M8NE 4NHOA 1N25A 3UK6A 1OF1A 1F2UA 5B57C 1T0HB 1Z0IA 3IKJA 3QJYA 4DCVA 3OIYA 1XCGB 3R8CA 4BECA 4DEXA 2ZSFA 5K8TA 1MABA 3EZFA 4HI0E 2JDIA 2WOJA 1MR3F 3W3AA 2XXAB 3RYTC 2RMKA 4G01B 4HAYA 4BFTA 2NO7A 3M0EA 1WE2A 2HCBA 1AZSC 3P4YA 1KDRA 1IJEA 3TMKA 4E22A 3HWSA 4IXNA 1TQDA 4OI4A 4XWOA 1U8ZA 3THXA 4RVCA 1KAOA 4AKEA 1FNMA 1ZIOA 2MSDB 4JZKA 3BBPA 4URXR 4X66C 1LY1A 2GZHA 4HAZA 3U3JA 3BORA 2GJAA 5L3VA 2P0EA 1LS1A 3FKSA 3CJEA 1JAIA 1RRPA 3FMIA 2CY1A 1BOFA 1XMVA 3P27A 4YXWA 3OEEA 4UKDA 5CDFA 1KK3A 1YR6A 2NQ2C 4Q1DA 4LY6A 2QGZA 3SJZA 1WA5A 3DKVA 2ZRFA 3B8HA 4DSTA 1W4AA 3AP3A 1P6XA 2CLDX 3K0FA 1Z83A 1F48A 4QGHA 4O0MA 4NL4H 4LF8C 2NO1A 4GT1A 4O2RA 4D2IA 4Q4LA 4DXAA 3V9PA 1Z22A 1CR4A 3KKQA
chains in the Genus database with same CATH superfamily
1EK0A 2UAGA 4M9CA 2J33A 1CQJA 3KUCA 3WZMA 3IR6A 4KZPA 5JVDF 2PH1A 4R9NA 1I7PA 3AUAA 4B32A 3X44A 4G41A 3O2NA 2XE4A 4H35A 2O7QA 1N7GA 4RPCA 1NBME 2WJGA 5DPMA 4RK5A 3AR2A 3Q6NA 1QYDA 2FN3A 3DHVA 3SYNA 3TIFA 2NNLD 1O3YA 5F51A 1ZGZA 4EUKA 1O0BA 1FP7A 1SBYA 1WCWA 2QR2A 4LGMA 4N49A 5KX5B 4JUBA 1V7CA 3G59A 1QK3A 2X1HA 1XFAA 2VK2A 2ZAIA 1I5OA 2B4TO 3VH2A 3PP8A 3GLIB 3GCXA 5CYOA 4QXOA 3AX6A 1H2YA 2GTHA 2O5RA 1VHQA 1G4AE 2CDAA 2EX1A 1NUUA 1A0OA 2RKBA 1RYDA 1PT6A 1XVTA 1CP3A 3E27A 2YS7A 1P17A 4IHKA 1S1MA 3KPJA 4DV5B 2VXOA 4BV9A 2PT5A 2XEXA 1KJJA 1G8SA 1XELA 2FW9A 1XX6A 2EW2A 3KD3A 3KYCB 4CCSA 4F5ZA 5A1JA 4ENUA 2ZSJA 1E6EA 2OQIA 3EQ7A 3T7CA 4ZJYA 1SKYB 1U1GA 2QPOA 1GNPA 3P9IA 5TJHA 3TCKA 5HNKA 2ONFA 3RIMA 5ADUS 1JI3A 5H0IA 1DAMA 3PC2A 3R6DA 3ZVNA 3BAFA 2XUZA 1U5BA 1WXHA 5DWDA 5AKLA 1L3CA 2OUIA 1X39A 2DG2A 5ALGA 2ZYVX 3AESB 2C94A 2XB8A 1Y9JA 2V7TA 5DTMA 3N2GB 4GSLA 1VHWA 5ANRB 2VRCD 3TKAA 3HDTA 3CUUA 3ZIUA 4BMNA 1C1YA 4N5MA 1KETA 2NP6A 3TR3A 3ZE8A 1CS4C 1YJ5A 1L4LA 1XKTA 2XKAA 2YTZA 2ZTHA 3GJQA 4MB2A 3K9HA 3AF0A 4LC0A 4QBGB 5IMSA 2ZR7A 5JNVA 2IW3A 2ODWA 1MRNA 3IXLA 3NHYA 3RRFA 1OAAA 2CUTA 1PQYA 4PHGA 2G7MC 2QBYA 1ZPDA 1EE2A 3C1TA 2HK7A 3ST7A 4DWJA 4U2FA 5JNRA 2WDZA 3OY2A 1N5JA 2R97A 2RHHA 2YXNA 4N65A 1EGMB 4IS3A 5JROA 4DV4C 3KYIB 3R7WB 4B4KA 3NGLA 2DWPA 2EATA 1DKOA 1HE3A 4NDAA 2FCAA 3U4AA 4DCJA 1PGNA 1ZM4A 3JQGA 5AVXA 2VDPB 2WY2D 4RH0A 1C0PA 2RBKA 4EVRA 5JYDA 3ZHZA 2VK4A 1KJZA 3HJCA 4F5DA 1WG8A 3CLUC 1A1SA 1NP3A 1Z25A 4HQLA 1XZBA 2ASVA 1MCZA 1E1LA 1JIQA 3L8ZA 3O0TA 1JG3A 1QCCA 2C2YA 3LQ1A 2GCPA 4PTLA 4ZCQA 4DM4A 5K03A 4HDKA 1XZEA 4ZXFA 4G5QA 2Q9CA 3S2IA 2BV3A 3N87A 1YU9A 5F1KA 4L5JA 3BHJA 2WM9B 1OGJA 3PQ4A 4P9NA 5FUXA 1YBMA 2OCIA 2Q8NA 1ZM7A 2DQYA 3TVDA 3ZWCA 4C6SA 5KWIA 1ABEA 2P9HA 4JVNA 3L7KA 4O2BB 4RAOA 4LTDA 2O0JA 5DNUA 4XWWA 2NSJA 4E14A 5CGQB 3LUSA 4NOMA 5JTTA 1X7YA 4G25A 4XVRA 4PBRA 4IDHA 2J6BA 3AEXA 1QYVA 2YWJA 1D6NA 3A6EA 3LHKA 1F17A 3RFCA 4PLZA 3CVWA 2WJIA 3IR7A 1EUCB 2OV4A 1UPXA 2EOAA 1E9FA 3FUCA 8LDHA 3V8BA 4JLKA 4Z4HA 3B5JA 1KH3A 3GLFB 4I3HA 5AKJA 1J33A 1THGA 3ZIAD 1N7IA 2FLVA 2K4MA 1B1AA 1PT9A 1RMQA 1T9HA 3PA8A 5J40A 4P4LA 2ZSHA 3E3OA 3ROXA 1PSDA 3W9BA 1Z5ZA 5AKKA 1RPJA 3W3AH 4ZHQB 5DXFA 1IU9A 1USIA 1IUKA 2O8FA 2ZLBA 4U00A 5T4BA 2ZAGA 3GJ0A 3O3CA 4WOJA 3G2LA 3H7AA 4KXXA 1Y34E 3GPBA 5THXA 4HDSB 3FCUB 4LX8A 3O8RA 3DLAA 1HMPA 3QUTA 3IAXA 1E3EA 2GBGA 5J9FA 1J70A 3DE6X 5A3RA 2FEXA 3MQ4A 5KC9A 1XPOA 2XGGA 3KJEA 1TI7A 1TZBA 4NE7A 3UHPA 3IAUA 1TC1A 4NBKA 1TMYA 2IDZA 2VHEA 1E4VA 2FPLA 1RYNA 1E3QA 2FW1A 4LHSA 4C4AA 3ND6A 3KKNA 3MOGA 2PLWA 4WN9A 4GBGA 2EKDA 4NCKA 1DC7A 1SAYA 4NCHA 2QENA 3HU5A 2C83A 5TMDA 1JIVA 4U3JB 3RC7A 4KO8A 4I66A 4M8SA 2F59A 4MA0A 5FDFA 2VBCA 4Q3OA 4WW0A 1ZJ5A 1ZU5A 3J80D 5FOSA 4DEXA 4ED9A 1Z4LA 3CCCA 1DX6A 4ABYA 4OX9Y 1UM8A 2JEYA 1S2IA 1G2OA 4HN9A 3EXHA 2YDYA 4JB8A 1H23A 5FLEX 3VBCA 2UVPB 1XALA 2I4IA 5CXQA 4E1AA 2AOTA 1YZUA 4DGQA 5I7EA 5KWSA 2J6HA 1DEAA 2FE1A 2IEBA 3CLRC 4H7PA 3KUXA 5CGZA 4E46A 4BATA 2ZR9A 1R3UA 4CIBA 1XZJA 1DCMA 2OEPA 5CW2A 1I2ZA 1KVSA 221PA 4B3TC 1G291 3OU2A 1P1CA 4PZCA 3A4IA 4TWIA 1NJSA 3PITA 4URWR 5SYNA 5JO0A 1ZY2A 1Z12A 2F1KA 2O2HA 3LU1A 4FMDF 4BFUA 3TIGA 5JC8A 1A5AB 1T3TA 1LK0A 4JBYA 1WHTA 4FUQA 1DCKA 6NULA 1Q0PA 4N0PA 2HZBA 4ALIA 1TGYA 3NUZA 4R3WA 2I87A 1N34B 3K0CC 4UVDA 3GG9A 1SQ0A 2BD0A 4FOOA 4DLRA 2NTEA 1JHMA 2EDAA 3H5IA 5ER9A 3HXQA 1NG9A 4Q7EA 2BGLA 4G8DA 1YZGA 4CM4B 5CCEA 2F55A 4U7HA 5AVJA 1GRRA 1WX1A 1G20B 4TKUA 3VR5D 2WIAA 4J1TA 2PNJA 4MGIR 1K9SA 4E1BA 1A2OA 3NPDA 1GZ6A 3FY4A 3HBJA 3NAMA 3M6XA 4MGZR 1UJ2A 4RCZA 4RF4A 1X7HA 1XMPA 2DR3A 2J7KA 4HATA 4IFTA 4OYLA 4L9AA 1TW3A 3TZKA 2EXXA 4D9FA 1HDXA 2JK1A 4YLYA 2QJOA 2IYSA 3D1JA 2QRGA 3D4BA 1D4ZA 1GARA 2GAAA 1I9CA 2MSCB 3MS2A 1F6WA 2C5HA 1M6XA 2PWBA 3BS4A 4DUYB 4ND8A 5EMLA 1VL6A 1Z4MA 6GPBA 2QLNA 4ND4A 1TQ2A 3DA8A 3I64A 4RHTA 3WOHA 4AZTA 2OYSA 4Z3OA 5THKA 3F2IA 1E6KA 3ZCVA 3K2QA 3EGCA 3FNIA 5E2AA 5BT9A 2F9MA 2X22A 3AJ9A 5E6UA 3JQ9A 1RRVA 5T6BA 2WJWA 3KQUA 5TV2A 4HB0A 3LQKA 3DV0B 4RK4A 2HKIA 2QMOA 3E35A 2GJ9A 1DHTA 3IDOA 5FTKA 3U4HA 1B2LA 4F1WA 2H29A 2OAP1 4D46A 1U7WA 5KQRA 3G0HA 3WL5A 1KF0A 1Y3BE 3GGGA 4L08A 3TFWA 1NBEA 5JATA 3RS9A 3HRIA 4LK3A 1R9MA 4JJZA 2G07A 2QLFA 1TL7C 3HBFA 4YAGA 1B76A 1UOEA 1T4GA 1IY9A 4XGIA 1K4YA 2KE5A 2QRUA 3Q9NA 1ODTC 4DPKA 1YVRA 3JVUA 4HGOA 1NQWA 2D4HA 2EP8A 5LXTA 2IOYA 3SX4A 1N9GB 2NVUA 3AHGA 2EAUA 4BU0A 1OI4A 1QFYA 3DL4A 3T1TA 2BFEA 1DI0A 2BR3A 3HKCA 1BXGB 3P9CA 2VSOA 1WF6A 4L0QA 3GVHA 3D43A 2C82A 3VDNB 4MVYA 2ZYTX 3U81A 1SQSA 2H7XA 3PLRA 2X9GA 1Q22A 1Y9DA 4ZVRA 2FZGA 3ULKA 3FNRA 3R9WA 1XDBA 3VR1A 2CGEA 1US8B 1UXHA 3ENWA 3HBNA 3FE2A 1G6OA 1U80A 3LWNA 4E5NA 1FDTA 1N6OA 3O7WA 1F2UB 5CB8A 4UXIA 2HN9A 1NMSA 3LUPA 2C2XA 3I6MA 3OSZA 4Q7KA 4IXMA 3R8FA 3K9NA 2I6QA 2PV0A 3WLPA 1M2VA 2RD2A 3P2MA 3QG5A 4LI3X 2IP1A 3B1FA 3CJQA 2VYVD 1ZUD1 3HB1A 1T6YA 1QYRA 3R3XA 3RC9A 5KNDD 3JAKB 4PGFA 4B9EA 2QLLA 2EEPA 4K9RA 1IQUA 1EVZA 2AQKA 2ZBUA 3N6RA 4RTPA 1Q92A 2QY6A 3QWIA 4ZCPA 5ALUA 5I45A 4MYRA 3ROTA 1U5AA 1ZEMA 2GOYA 4C88A 4CM9D 3TPFA 4RVOA 3DE3X 1Y8AA 5D7BA 3PR3A 2X3YA 2YXEA 2AG1A 1HNWB 5CVJA 4YRQA 2XTJA 1W581 3GFVA 1O1YA 3KJXA 4L2ZA 1R2QA 1NMZA 3NTRA 1EWYA 3RASA 4B75A 3F8SA 3PGA1 4LNAA 5KINB 6REQA 1IN1A 3IP5A 1IBLB 1BC5A 1SA0B 1UXJA 3LYLA 3K2IA 2IE8A 4XD2A 5A19A 2XYRA 4JYBA 3OP1A 1PEDA 4NMWA 1ISFA 5EMKA 4MUEA 2IYRA 5DBFA 3OQNA 2G0AA 2NQ8A 1GUZA 4K26A 2Y1WA 1VE9A 1N5MA 2VJMA 3RLIA 1WXQA 5DIZA 1W4LA 3M6UA 1Z29A 4TGLA 1TM5E 4D0LB 1PA4A 1O6FA 1T34A 1UBOS 1V4VA 3ETDA 4KQJA 5E3IA 1OX4B 3TMAA 1QH1A 4XH9B 1B0AA 3LUDA 3HL4A 5HKBA 5AJUA 4B09A 5KWVA 5DK4A 4GS5A 4XYLA 1I2MA 4YJDA 3HVIA 3ND7A 1M2NA 4RD6A 4Q9AA 5AHOA 3EVTA 5A1IA 1RFLA 2VS1A 2YXBA 2ODPA 3QITA 4HDNA 4K6CA 4N0EA 3D3KA 3ELBA 3RADC 2YMQA 3T9AA 1RPZA 1FDIA 2XB4A 2I6GA 5GOTA 1S01A 1Y7TA 4PZEA 4UBOA 1TJYA 2XT6A 4V0MA 3SR3A 4HVTA 2W0SA 1L1FA 4YMSA 1C0LA 4ZQIA 3UC9A 4MS3A 1UBTS 3JQBC 5I9SA 2Y93A 3F6SA 5A7HA 4MV3A 4YECA 2R7LA 2J9XB 1P39A 1WEHA 3R76A 2O7VA 3WLJA 4DLVA 5SICE 1CR6A 2F3QA 4CTKA 1ZJ6A 3PLNA 1EK6A 3H8SA 3C2QA 1E2IA 1OC2A 1WIWA 3COZA 1ISRA 1YIOA 3K2BA 1P2SA 1EH5A 1P8AA 3ZGVA 8OHMA 3T1YB 1SVUA 1NVKA 3C3XA 5F98A 1HEIA 1V3UA 1ECFA 3IP9A 3USES 2R66A 2HRZA 2OXCA 3QVVA 2ONKA 2FFHA 4P98A 2ZZKA 1GUAA 3BMQB 1KRHA 3AY0A 4MW4A 5EJ4A 1GZ4A 2IODA 4FFBA 4DLPA 4EWLA 5AM3A 4DR4C 3MBOA 3GAFA 2B3TA 2JD0A 2PLFA 3FR7A 4KGVA 1IBKC 3FFXA 3O6VA 3AF2A 2HJGA 4IDOA 2PROA 3KPVA 3C3EA 5K51A 3NYIA 5DTIA 2EIHA 1T9CA 1B4DA 1V7ZA 2FGKA 4ND7A 4OFWA 4P8RA 4QXPA 3GN1A 4OAPA 4G26A 2OZVA 4D4MA 2KZFA 1SC9A 3B6MA 3ENKA 1YOVA 2IQIA 2V1XA 1TCUA 3A9WA 3HY4A 3GOQA 1RLTA 3OIUA 5CCDA 5CT6A 4JS0A 3A1UA 2CBGA 8MHTA 1J5XA 3CE9A 4BVFA 1KU6A 2CLLB 4C0AC 4J29A 1YZTA 4F3CA 3OVMA 2HRBA 1JGTA 3ROGA 3ANNA 2GCGA 1KKGA 2IYWA 3HJAA 5EC8A 1PR5A 2X41A 1RWXA 2RGUA 3E03A 3JZFA 4JCOA 3S40A 3WIUA 4XYBA 3QXJA 1WQ1R 2LIPA 4RJTA 1SVLA 1F06A 2CXSA 1RABA 2AOWA 2XA2A 1BXRA 1RE0A 2BR4A 4I55F 2Q0SA 2QR5A 4JOCA 3VSBA 3HCBA 1JP7A 2D5CA 3AUTA 4RHUA 5AJYA 3W05A 4DR5B 1RJFA 4YTEA 2VR1A 4O02B 3ABSB 2PZJA 3PCTA 4EOGA 1P9LA 4N03A 3RIHA 4IIEA 4S2EA 3SJUA 3A9RA 1LNSA 5DB4A 3RARA 5AVZA 5KJ1A 3B2NA 3DWEX 1U8XX 3AY6A 5JD5A 1XNJA 2CYAA 1C4WA 1R27A 4DJFC 3LNOA 3HU1A 1QIIA 3WK7A 5A4FS 2OY0A 4CIWA 5AW1A 3GPIA 2N9UA 1UWVA 4MAAA 2H2HA 5H3LA 5HG0A 3M1IA 4A0HA 1QU2A 2YJ4A 3I6YA 4MVJM 1GP2A 4CF7A 3NHLA 4OXXA 3INTA 2V6IA 3ETGA 4E2YA 1I0LA 2IU6A 3D4IA 1D1TA 1NRIA 1S2OA 4N7BA 5JSYA 4P3XA 1W5EA 3ZDFA 3DOJA 1NVMB 1NWCA 2NZJA 2QZZA 3KEGA 5IBPA 1E18A 1S0UA 1L5RA 3W3AD 5HKKD 2BMAA 2PBFA 1N6LA 1XU7A 2FSVA 3JALB 2F1OA 1GVNB 4JEIA 1UJCA 1T9GR 4ISCA 1OH8A 1OXBB 4L6AA 1ZBDA 2B8TA 2YMMA 4NARA 5CDGA 4KTTE 1QGYA 2HDNB 1NA5A 2YZMA 4MX8A 3ZVMA 3SJCA 3B38A 4IRXA 3ICPA 3A9TA 3KHKA 1IOZA 1TM3E 4Q4JA 5LXTB 1F8YA 1PEKE 3DBRB 3IVRA 4LY0A 3J7TA 3B1XA 4L7IA 3LW8A 4V3CA 2H4ZA 2GBFA 3KV3O 5FP0A 1BE0A 1LLDA 2Y67A 2I34A 3I2KA 3OZ7A 3DXYA 4IGFA 3V32A 3PBKA 2O2IA 1EEHA 1NZFA 3OLYA 4DA6A 1JNXX 2HB6A 3TTXA 4B0PA 2P9JA 5GIOE 5GM2A 3M6WA 3L7LA 3MWKA 2CD9A 4G9GA 5GQSA 3WR5A 3DD5A 1R5NA 2DBZA 1L4MA 2JJ2A 3PX3A 4CETA 2D6FA 4R1SA 13PKA 3O1HB 4OPMA 4M1QA 1J7KA 1UXOA 3QVXA 4POAA 5ARCA 2WP0C 1MJFA 3EPHA 1T2DA 2FMXA 3MQFA 4HF7A 1FUKA 1R37A 1E2NA 3MWDA 4MCAA 4MRNA 3IOEA 4H77A 1YL5A 4B2LA 1NL3A 1GAWA 3TS1A 2WJ6A 4QYIA 1NE2A 4ZVVA 3V3TA 1OVMA 4V1CA 2Y2VA 2YRXA 3GHHA 4PC3A 2HSZA 5KJCA 3BWVA 1B14A 3G2QA 3EZLA 4H3SA 5CM9C 1UXKA 2PIAA 3BTUA 2XUJA 3BIXA 3NKLA 2NO0A 3R4VA 4ZPJA 3I8OA 3KSZO 3WS7A 4D0NA 2VJBA 1Q14A 2WG2A 1JQKA 1VCOA 2G6BA 4PS0A 1YMUA 4MLDA 1KK0A 1ECCA 3V4ZA 2RGCA 4DR2C 1VIDA 2ZAOA 1NHGA 1PG4A 4NG5A 4L4ZA 1OI2A 3C5EA 2F8LA 5GONA 5HS6A 1OC4A 4FWBA 2Y1GA 5F73A 3CINA 4GX2A 3WFIA 5DV9A 5EJMA 1HWYA 4OAQA 3KT0A 3GDHA 4HB2A 1ULSA 1O94D 3K53A 1QPBA 3H8WA 3BFXA 4QGBA 1W36D 2AQIA 3EHEA 4CV0A 3MTEA 3K1YA 5DISB 1OHHD 4ARVA 1ZN7A 3TD6A 3BH6A 2SNIE 1HT3A 3OLWA 3YASA 5BOSB 2XNCA 3JQ7B 2NSHA 2QQ0A 4ER3A 1NXSA 4J43A 5JWOA 1WKVA 2QTZA 5COBA 4B1FA 1XK6A 1NYRA 4FDUA 3ZQJA 4MJXA 3A6GA 3DM5A 1A7AA 3LX8A 3UGQA 4TPKA 2MIIA 1KZ1A 2O2CA 3HB0A 1AQ6A 1P91A 1WMFA 1DOAA 4OXNA 4ZT5A 3ZNPA 5A6SA 1P5JA 5HJ5A 4HFJA 1APBA 1MGPA 5A71A 4UNIA 1TZCA 2WMOB 3L5KA 1MC5A 1GEEA 3GGDA 4BNLA 5BW8A 2QM0A 1TEVA 1WDTA 3NGXA 1HDRA 3CGGA 2JGDA 1SC3A 2YY5A 3K0SA 1DO0A 4PXAA 4G37A 3CZ5A 3TFQA 4OK3A 3CG4A 1SVIA 1CDOA 2Q3HA 5A7FA 4FM9A 4AP9A 1QNLA 4J2OA 4HNSA 5FNVB 5SYMA 2C4KA 2LTAA 1KP9A 1F2VA 3DOFA 1RZVA 2DWUA 3I9FA 4JL8A 4KTTA 4JI3B 5ALLA 4DCOA 4WINA 3MVEA 2OOKA 3IRUA 4XQ0A 3OZAA 3W2IA 1K2WA 1OZGA 1Z4JA 1V4NA 3CKYA 4AM8A 4RTNA 3UT0A 3PGLA 3GJSA 3WK9A 5LBUA 5KTPA 2J46A 2BFOA 2WV9A 4FB4A 4G07A 3OFND 3ZGNA 1ISMA 3A1SA 1PUJA 2VP2A 2DY1A 1F5NA 2D74A 1P72A 2A0YA 5FKJA 1G20A 1LLUA 1MA0A 1QLWA 2R8BA 1U81A 1QIGA 2F48A 4GYKA 1N0UA 4M0UA 3HO6A 5EMJA 3QXGA 4GPEA 1TEHA 3UG6A 2W2TA 2H1FA 3OIFA 3ZW8A 4L5YA 3DAOA 1DU4A 1FMJA 2GN4A 2WU4A 1L7XA 3KJGA 4MB6A 4O5AA 4R2KA 4YCAA 3BTOA 3DZ8A 1BJRE 4M37A 2AJTA 3TOCA 1NSTA 3R3VA 5HZKA 4EGCB 3BA6A 3LC1O 3ROMA 3H05A 3PT5A 1ONPA 2LCQA 2BFPA 4MMYB 5JRJA 1T6BY 5EUCA 4ZPXA 3CJRA 2ZYDA 3ISJA 3RFTA 1HDOA 2A3NA 3CGWA 2QVBA 5EQJB 1PU1A 1YV9A 3RU7A 5FI5A 4ARBA 2GEKA 2CLSA 4WIAA 2X77A 4M7WA 1ULUA 4GZLA 4RFSB 4GKBA 5TS2A 3TLBA 5IJ9B 5A6SB 1TO1E 3AUYA 5HFNA 1N7JA 2RGWA 3EW9A 5D2CA 1XNQC 3HM9A 3ZU6A 1SQFA 2GN9A 2H52A 2HHCA 4M9UA 3CR3C 4DRXB 2UUAB 2ALJA 2F8SA 3MEQA 1W4BA 2WOOA 2QVZX 1TC2A 2ZCVA 2SKEA 2IZZA 5HMLA 4C06A 1JTEA 1XRMA 2WUDA 2M5HA 1MPXA 4L8YA 2VHXA 2XMRA 4MGEA 1YUNA 5LN1A 4BJ6A 2BFWA 4BMYA 3AZPA 4MUXA 4H1TA 1W48A 5ALZA 5FBLB 3RM3A 2ZSBA 4AJNA 5FF9A 5KSYA 2V1UA 1EP2B 1P7ZA 2NXNA 1KE1A 1X74A 3D2BA 4MS4B 4BN5A 4F3NA 5DNYB 5HQ3A 2MDTA 5KU1A 2B5OA 2IEIA 2X40A 3AMVA 2WWTA 3P26A 1JAZA 5CNMA 5BNIA 5DT9A 3WNDA 4F2HA 3R7NA 4BBYA 2G4VA 3EEQA 5D6OA 1GDTA 1X80A 1FJHA 4Z9FA 5FBVB 1ZQ1A 3B7WA 3PFFA 1RAGA 5KPDA 5A62A 4TLLB 4DRYA 3AFMA 4MWTA 3U7JA 1E9EA 3OPQA 1T8UA 1UFRA 5EYPA 5I9NA 4R6WA 1X7ZB 3G68A 4TVKA 1UT8A 2QTMA 2CJXA 4LFCC 1NONA 3FRJA 1FP2A 4WJZA 2WFLA 1XRRA 3TLEA 3WGVA 5JZBA 3ZCPA 1P2TA 1VJRA 1KRXA 1X86B 3C7CB 4U5XA 2ON6A 2OB1A 1DAFA 1M8KA 1ND6A 1ZM2A 1O54A 3B85A 3AR3A 4UM9D 5ULLA 2PUCA 4H3HB 3QYFA 4EI7A 3ZG6A 3EOZA 4L8LA 2UZAA 1ZCAA 1ZOOA 1E4EB 2VJPA 3UC5A 4TL6A 4IIBA 1BN7A 1IYZA 1JJ7A 1L8XA 1LZLA 4ND5A 1FLDA 2VDWA 1UPCA 3SNHA 3GBPA 1K06A 5HWSA 1AMNA 4BHTA 1THTA 3U26A 1F4VA 2O4UX 3QQPA 4NX2A 1UAAA 2MSKA 3QVMA 1SXHA 4DAOA 3JZDA 3E82A 1G3UA 2P62A 2XD4A 1V8PA 3FDJA 1DEXA 1XTTA 4UHBA 1J2TA 5FHQA 3PPYA 1XROA 1Z18A 4CT4B 1RHKA 3CNEA 4ISBA 1MENA 3V1LA 1LI5A 2Q8QA 4R0VA 2VTEA 2WF7A 3LQ4A 3P9SA 4MITA 4N0MA 5ERYA 5J1SB 1N0VC 1UJNA 1KQOA 4WLFA 4Q4CA 2V45A 3PR2B 3K4QA 3TSCA 4N76A 1VMEA 2YIDA 4HKTA 5FRDA 3WVNA 4W9NC 2ZUBA 2ORYA 1FOEB 3A6JA 1H5NA 4UTXA 1Z13A 2LW7A 3AKYA 2GRAA 5TNXA 3WB9A 1KDZA 4F04A 3DGFC 4LHEA 5GZ1A 2MYNA 5JT1A 1M72A 4FSDA 1PWEA 1GRVA 3X43A 2II6A 4FR2A 5ICMA 2Z8XA 4I1SA 3PUKA 4H17A 4DLBA 4EEXA 2EKBA 3M4ZA 4LF5C 4B6JA 5TGTA 1J9EA 5L45A 4TSKA 1IM5A 4MPPA 1MJGM 1SOAA 5B1HA 3ZCRA 2KLHA 1UEJA 2LPMA 1FS5A 1NM5C 1YR7A 2P9QA 3OLXA 3DKKA 4BCDA 5CVUA 2RHRA 3JATA 3NHSA 3QF4B 4LOHA 2UYCA 3GJXC 4A6DA 4KXQA 2HH9A 1AO0A 4B6QA 3IUPA 2VN8A 5JXHA 1GPNA 4RAQA 1CDEA 1N0WA 1TA9A 1ULAA 3ZJ4A 1SZCA 4DM3A 2VFAA 1VKHA 1NOJA 3DHEA 2OAQ1 3PIRA 1FJGC 2P27A 4BLSA 2I7TA 4AUNA 4C30A 2Q2NA 4CPDA 1I1NA 2PMDA 4MGKR 3SS9X 3PUVA 1OFUA 3BYZA 2IKQA 2Y6UA 3E3LA 3GEIA 4FFLA 4YX9A 3JQ7A 4IDGA 4PFJA 1NF9A 3TZBA 3UT6A 1QV7A 1TPZA 3GVPA 3V48A 2I03A 1Z33A 2JZCA 1AKUA 2G63A 2XDAA 3G85A 4BO3A 4U7DA 4HK4A 5ES3A 1KSHA 1G5FA 2H3HA 3TLAA 3G1UA 1X9GA 1GADO 1U9CA 3SXPA 3DAHA 4AWAA 3OCVA 4Q9JA 1QYIA 2MINB 4LNUA 5FFMA 3PRYA 4IWYA 4QU5A 3LO5A 1WOYA 2K2WA 3RIXA 3V6MA 2FPWA 1S4QA 4RS4A 4EECA 4ZZ0A 1LBIA 1VDMA 3HZRA 3MGAA 3NASA 1N8TA 2GR9A 2ZE5A 3ZGLA 3OFNA 4Z53A 4I2NA 4PUHA 2VCYA 2X86A 2ZETA 5DXJA 2APJA 2JLCA 4WLVA 4BXOB 3A6DA 4KLZA 2IIPA 5DBGA 2O8DA 2PANA 1LPMA 2WWFA 5DP2A 2WT4A 1TADA 1XTRA 4PCVA 2G06A 5HHTA 3ZTYA 2FDRA 3EE6A 3JQDA 3DLCA 4QXAA 5KYGA 5HE9A 1EXNA 1K6EA 4Q18A 4L8FA 3C1AA 1G5TA 1UOOA 3KKEA 1QAMA 1Q74A 1PJAA 3OT1B 2WBLC 3M82A 1ZDMA 4Q4HB 5HF8A 3VPBA 5CFMA 5CDFE 2VQEB 4QLAA 2IUFA 1ONOA 4CHTA 2FPIA 4HS4A 3JQAD 4MWDA 5EWJB 1UKBA 1WUHS 2J41A 2XXBA 3B3QA 3G13A 3HCDA 3CFYA 4L07A 4S24A 1A72A 5HKAA 4JI2C 3DDZX 5JYBA 3LOUA 4IDBA 1SVOA 1SU4A 4HDRA 1UXIA 2HU2A 2PY6A 3GEGA 4IIJA 5JRHA 3NAGA 5FL7D 3G7NA 5C5CA 2ADFA 3AV3A 4Y1FA 3TD2A 5CFRA 3WGIA 1E20A 5I8ZA 2I1WA 1QS0B 2EKPA 2XW6A 4HLUA 5CT5A 4AP6A 1XTUA 3H2IA 3WISA 1P4JA 3QKTA 2QV7A 5LYJB 3PDJA 3LDGA 2PLRA 1K88A 3QPWA 1S89A 3R5SA 3C5CA 4OHKA 3A0RB 1C7EA 1U2EA 3EG5A 3MWLA 3NS7A 4UAUA 5JH7A 3UXEA 3AESA 1ZOIA 4IDFA 4WFQA 1SQGA 2XY4A 2PGOA 2AK2A 1PR1A 2E8CA 2CMKA 2MSLA 3N2IA 4KG7A 2TMYA 1CEYA 4NVRA 2FUG6 3UUEA 2X0KA 2C88A 4Y2UA 4WBNA 2IXEA 3CLTC 1RZRA 1N6IA 2C4TA 3W6NA 3NIFB 3AF5A 4EYGA 2H1RA 4DR1B 1MAAA 1ODKA 3PQEA 3U3MA 5IKPA 4FZRA 2V6FA 3GAAA 4ZLPA 4DR7C 3LT4A 3P52A 1LW6E 3V1UA 2DCMA 4ND1A 4Z9XA 1C9KA 1PR9A 3GDOA 4C4XA 4KMSA 1A9SA 2NU8A 2IXBA 4AKSA 5F5LA 3ORYA 4RNCA 3QBVA 2X8JB 3CT4A 1LC0A 2B8EA 3NXKA 4ZODA 3SIRA 3WGHA 5IZCA 1KZHA 2DT5A 3VNQA 1ZUNB 2E18A 2PH7A 3FOAA 4IMJB 5KX5A 2ZGVA 1IM8A 3BIOA 1RADA 3G17A 2FMHA 3UMCA 3JRNA 4AUKA 1K8XB 3IIJA 1Q5PA 2G9UA 3GEDA 4KJXA 3U7IA 4ZXPA 1RQLA 3LP6A 1CPYA 3R41A 3OJXA 4KMMA 5HIMA 1IN7A 1H5QA 1NPTO 4EHFA 1K68A 4PGAA 3MCWA 1W85A 3UOGA 4AC9A 3TOVA 4JXZA 2F43A 4WY2A 4XLZA 2Z51A 1E3MA 1KYVA 3R3HA 1E2QA 3WGZA 1FFSA 2PL3A 2MYUA 4KXWA 5DGDA 1OW3B 1SG0A 2PFSA 3GLRA 3IEKA 3AQ4A 3ECAA 1EESA 1V3QE 2IQ5A 1Q50A 4M36A 4M3NA 4A3SA 1OV6A 1O87A 2ZT6A 4R7GA 1CBUA 5E6SA 4UMEA 3UGKA 4J3FA 2W6JA 4H0FA 4X84A 4QAJA 2GM3A 5D7NA 5JCZA 1J0BA 4QTXA 3PQ7A 4TV9B 2HHLA 3OTGA 4OHBA 2COKA 1WCIB 1SPXA 5JNUA 4CIVA 3DXXA 2JKZA 1W0JA 2PRYA 1G8GA 4FD2A 2DYJA 1ZCBA 3V8EA 3EVZA 3ZY4A 1T9KA 3NBYC 1SOMA 3IGFA 1ZXXA 4PTZA 5IJXA 1DHRA 3WDSA 4NFLA 1Z0KA 1ZA2A 4FE4A 2AOUA 1ZFNA 3LX5A 1TIKA 3NCHA 1TK3A 1WZUA 3WTBA 4ARIA 4TS1A 2C0PA 3G82C 4F9EA 5I8WA 4C78A 3HK2A 3R0VA 1YF3A 1ODJA 3PHGA 3A9SA 4IXTA 2XHZA 4RLHA 4EGFA 3VUFA 3WAGA 2V9CA 2IV7A 5MFZA 4QTTB 4A03A 2YIVX 1MW8X 1YRWA 1TO2E 1VG0B 1QZXA 2O1WA 2P3SA 3HDJA 3QBTA 4OKNA 4LFCB 3JD1A 4MZDA 2CXTA 4K3VA 3T8YA 3JQQA 4J0HA 3EDQA 1BXGA 3UJCA 3EERA 1TXGA 2DTEA 1GG9A 3U61B 5T8TA 4P4GA 2UDPA 3U4GA 4BWFB 3EBPA 4INAA 3WSWA 1U04A 4PQGA 2Z3VA 3SN6A 1QHXA 1HETA 3OCJA 3CO0S 4US2R 5JU6A 1YZNA 1PJRA 2B1IA 2JFBA 2ZSKA 1MMFB 4CL2A 2WQZA 1IZYA 3EAFA 1PJCA 3N3AC 3T3IA 3WGNA 5I9MA 2AH5A 1KEZA 2QP3A 4JSYA 1NOIA 1E9RA 1AKWA 1OIXA 4AP5A 4BLRA 4EPYA 5IVDA 2XRZA 1RBQA 4BMPB 3KRTA 4J1NA 4ZV4A 1F8GA 3LDUA 2W7TA 3FYHA 3GT3A 2ZYUX 2BGMA 3HVUA 3ISTA 3JRWA 3PFWO 521PA 4G0ZA 1FYEA 1KYIA 1R0LA 3HYLA 3S0JA 1JBKA 4H4DA 4Z4IA 3ZWXA 3FMGA 3WDKA 3KOYA 1PJ2A 1Q0HA 4NS1A 5LUBA 4D8TA 4S1PA 2Q3LA 1ZD8A 4EAQA 4HQ0A 4HO1X 4G5RA 5COQA 3HDQA 1XNQB 3N28A 4DCNA 3BXFA 2XYVA 4D9GA 5LM3A 3VHXB 4S1OA 5ITWA 1A96A 1GRQA 4NU6A 1H2HA 1C9DB 1T26A 2NZUG 4D97A 3FNHA 1H4VB 5JJKA 2EBFX 3SF8B 1QVZA 3GLSA 2NZ2A 2H1CA 1PK9A 1AKQA 3AOGA 4Y6OA 2OHXA 2K87A 1LRLA 4LXQA 4QNNA 3DEIA 5DSZA 3DMTA 1RR6A 3BRQA 5MGBA 1ADYA 2EYQA 1FX0A 1FP4B 1FW6A 3WKAA 4IFBA 3DL7A 3L4SO 2TSYB 1BN6A 4AN0A 4ZQBA 4MQ6A 2PH5A 5EIOA 3TZLA 4KLRA 1Z6XA 2JIPA 1PAUA 1ZESA 4S35A 5KNBH 1KHTA 4U9UA 3EISA 3T1NA 4O4JA 1PZHA 4O4IA 5A02A 2YWRA 3QKIA 2VUSA 4X95A 4C0KA 5EIHA 3SDSA 4CF6A 5HIAA 3ORFA 1NI4A 2W4QA 3KSDO 3ZC3A 4WLNA 3OPYB 4CT5A 5JYCA 4J7AA 4WXEA 5SZHB 1O6BA 1TF2A 2QRVB 1VL5A 1QBKC 2YCLA 3H99A 3ITEA 4GR9A 4I5EA 4J0GA 4IICA 5EHIA 1DVRA 3AI3A 3UK7A 4MQUA 3HEBA 3KZXA 1QHFA 4K9MA 1FQOA 3E6AA 3RG2A 4YT5A 3AJEA 4EFNA 3VR4D 4JXKA 1G8PA 3KSMA 3BIJA 4XFJA 3WLTA 3O9VA 1DKQA 2UZ1B 4JY7A 2MINA 2J9ZB 2FEKA 1MB9A 1ZKMA 4TLDA 2ZE8A 1ZNZA 3DO6A 2EFHB 1VPLA 3IUNA 3JR3A 2IWHA 3KALA 1WR8A 2JIDA 1Y6ZA 3WSTA 1Z