3R9XA

Crystal structure of era in complex with mggdpnp, nucleotides 1506-1542 of 16s ribosomal rna, and ksga
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/transferase/rna
molecule keywords GTPase Era
total genus 102
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3r9xA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9xA01
3AV0B 2QTFA 3FB4A 3GJ5A 1P62B 4AD8A 4AG6A 5HR5A 5IHPA 3GLFB 2ORIA 2WSSD 5JJLA 4LJ6A 4R2IA 4RCZA 1BYIA 1DG1G 1QHGA 3LW8A 1MH1A 1M8PA 5CIWA 3RS4A 1Z6TA 3A1SA 3BGWA 4Z8XA 1A7JA 5JI3E 2FFHA 2B7CA 2AK2A 3K8YA 3WHLA 6Q21A 3X1XA 2PBRA 2HT6A 4R9UC 2UKDA 2RHMA 4O2RA 1GNRA 2GEUA 5IRCD 5G41A 2CNWD 1DO0A 1X1RA 1D9ZA 1JB1A 4LJ8A 1YU9A 2DWQA 1U94A 1Q44A 2QY9A 2GDJA 3PIRA 4UXIA 3J80D 2VIIA 2ZYVX 4I1SA 5FUWA 5FBQB 2AK3A 4XX2A 2J59A 3I8XA 2PH1A 4HEJA 4PX9A 4D0GA 1BO6A 1ZYUA 3ASZA 4BEBA 1IHUA 4BFYA 2A78A 2SHKA 1NSTA 1SXJC 5TV2A 4FD2A 4U00A 2ZE8A 2WOOA 2WIAA 2V6IA 2ZJOA 2OEPA 1QDEA 3BB3A 1SVLA 2A30A 2C9YA 2NO9A 2VTKA 4LUCA 1R5BA 4Z1MD 1II8A 1CJVC 1KDRA 4DV4C 5DI9A 5EE0A 3THWB 1W36D 2CJWB 4LBZA 2EVWX 4CRWB 4TZ0A 4B35A 4JI0C 4HYYA 5LMNC 4LPKA 1USPA 4OJQA 2QA5A 3SHWA 4B71A 3NEJA 1T91A 3QEJA 4RZUA 3W6OA 1E6CA 2BHRA 4S35A 1LB1B 4FCVA 2QBYB 2ZRKA 1JJ7A 2QG6A 1P9NA 3L2OB 4DUGA 2GA8A 1GOTA 1TNDA 2IYZA 2Z83A 3WP1B 1N0VC 2FJUA 4DZZA 1GITA 3SBDA 2IW3A 3RWOA 2XNDD 3L8YA 4M1WA 1TQ6A 2ZR0A 4JI5C 3JVUA 3DKPA 1F60A 2O8FB 1Q21A 2C5LA 2F43B 1FPMA 1W5SA 4N3NA 3WMEA 5HCIA 1FMLA 1SXJD 5FPTA 3W34A 2OBNA 1Q12A 5A5GA 3K09A 5KSPA 4DEYA 3P32A 1W1WA 3M1IA 3E70C 4PAOA 3T1HC 2JA1A 5JSZB 1F5NA 5JJIA 3BOSA 1QHHB 2Q3MA 1E2GA 2Z4RA 4QBIA 4PO9A 1IY2A 3N2IA 1EWRA 2H57A 5JS7A 1M2OB 1XJCA 4YMSA 2OCPA 2XNSA 4AYXA 3CR8A 3W5JA 1ESMA 3PENA 2JLUA 1DTSA 1CKEA 1E9FA 1SXJE 4XVUA 1SKYB 3HWSA 4RD1A 4PQFA 3CPEA 2FSHA 4KVAA 1LQLA 3CX7A 4TTRA 4TZ6A 1SVKA 3H0KA 4Q1FA 4QJ4A 5GADl 3WMFA 5JLJA 2VP6A 4KV9A 2J7PD 1JEEA 1Q3TA 2GHIA 3C4JA 2C78A 3NHBA 1PUIA 3CO5A 5B30A 3RS2A 4F4CA 1NY5A 2IS1A 4JLKA 5P21A 4C0BA 1E1QA 4LZZA 1I4LD 4UJ5A 4TT3D 1JALA 1W0JA 4LJ4A 2P0EA 3THOA 1GZSA 1UF9A 1UAAA 1SULA 2B21A 1GKIA 4OI0A 4HAWA 2VSOA 1MOZA 3KQHA 3FOZA 3IEUA 2YJTD 4LF9C 1P72A 3CNNA 4HUTA 2FEOA 2H18A 2PJRA 2XJ4A 1ZAKA 2PN2A 4LCBA 5DYIA 4F92B 5M04A 1ZNWA 4NPHA 4JYCA 4A9AA 1GVNB 1AN0A 3DHWC 1E79A 1OHHA 1XCMA 1M7BA 3NG1A 4URZR 1PA4A 4MUAA 5FL7A 2AD5A 2IWRA 3QIAA 2F3TA 1G8YA 4EJSA 2O52A 4CEJA 3ZQ6A 2GJAA 4NBSA 4WXPA 2VEDA 2J0QA 1E9BA 1KDTA 1ZNYA 4QL3A 3ICEA 2EFGA 2H7VA 3GFTA 1GILA 2Q0HA 4E09A 5FUXA 2XXAA 1JECA 2ZETA 1XTJA 4JI3C 2ZROA 3LDAA 4NYIQ 3EPHA 3VNUA 1T0HB 2ZJ2A 2QP3A 2WBLC 2IS4A 1LTQA 2QN6A 1AZTA 4O3MA 4KSCA 5DIFA 2QQEA 4D81A 4PAMA 2WICA 5UKDA 1W0JD 3L8ZA 1DADA 3ZVNA 2JJ2A 2GAAA 3QOFA 1E1RD 2IYTA 1FNNA 2XTNA 3IGFA 1MT0A 3K53A 1FZQA 1OFTA 1KI1A 4DLWA 4M9QA 3LW7A 2VQEC 1TF7A 4A0GA 1X3SA 4IHQA 3WRXC 1W47A 2OPLB 1EXMA 1E96A 3SJZA 4IVQA 1P2TA 2F55A 3SDZA 4XOIA 1YR9A 3OEEA 3CF6R 3Q3JB 4FWIB 1X1SA 5CJ2A 4A1FA 3TQCA 2IBMA 4QM6A 2XOKD 2G1JA 4FCWA 5IT9D 3B2EA 3FMOB 2JLXA 2JDID 3GJ3A 2E8FA 1E0AA 1D2EA 2FOLA 3LNCA 2P67A 1IAQA 2YWHA 4HLUC 4Q47A 4CYMA 2NPFA 4M1TA 3LLUA 1S1MA 4A4DA 2DPXA 2CMKA 2JLSA 2CJWA 5TB5A 1OFHA 1P60A 2OFWA 4OI4A 1KI6A 4JL8A 3QPWA 1WH9A 2BM1A 1MABA 3KTAA 3Q5EA 821PA 4G5QA 4LSGA 4KHPC 3L82B 5EE1A 2J46A 4WZAE 2V3CC 3WMGA 2LKCA 2ZI3A 5F9HA 2ZAMA 3K9NA 3LXXA 3KUCA 2FU5C 4RSGA 4GFDA 1E1RA 2VQSA 2PZEA 4YHHC 1BKDR 4FCTA 3THYB 2GXUA 2OUKA 3V4FA 4XTRA 3OIYA 1DELA 1IY1A 4Q7LA 1XEWX 3IO3A 2FGJA 2J9RA 2TMKA 4M9SA 5IK2A 4A2WA 4PPQA 3WYGA 3RC3A 4CT5A 4L5BA 1E2EA 1W2HA 2BMEA 3THXB 1E9SA 2MMCA 2G83A 4BLSA 3LBHA 2YKGA 2PT7G 3FHTA 3DOEA 3ZYCA 1II9A 1XDBA 1HY3A 2BEJA 4DSTA 1MKYA 2Q9CA 2ZRCA 1ZM3A 2B8TA 1Z0FA 2FZ4A 4LRWA 4WXRA 3KXIA 2XTZA 3A4NA 3TK1A 2GCPA 2XEXA 1EX6A 4Q4AB 1UBCA 3HPQA 3RSLA 1GIAA 3CR7A 3WY9A 4LX0A 3E2IA 4M4SA 5AJYA 2G9NA 3EWSA 1G3QA 3R9IA 3AVWA 3B85A 2YZ2A 3Q72A 4ILEA 4Q02A 1QG4A 1Z2AA 3PFIA 1SHKA 3EG5A 4MKGA 1P2SA 4M1MA 4C2TA 3ZQJA 1KJZA 1W36C 3CLVA 3SYLA 4HLDA 2FH5B 1KGDA 2HCBA 4DVGA 4Q5IA 5K8IA 1TEXA 1KK0A 5KDDA 3K0CC 1K6MA 1WMSA 4NH0A 1YE8A 2GTPA 2QT0A 1E99A 2CL7X 3S1AA 4W5HA 2PMKA 2WSSA 2J87A 4DR5C 4CT4B 1KK1A 4TWZA 1N25A 1Z6XA 3PCRB 4E22A 5FTLA 1ETUA 2R9VA 1N32C 1CLUA 1OPXA 2XOKA 4Q1BA 3GJ8A 1XPOA 1KMHA 1U0JA 1GL7A 3QY0A 2KBFA 1U99A 1F48A 2QTHA 3BWDD 4IVPA 4EPRA 1P2UA 2PX0A 3U3OA 1HE1C 4DV7C 4IOMA 3BB4A 4LBYA 2F1HA 4Q7KA 2Z6VA 2UVQA 5JS8A 4Q03A 2HXSA 4MGYR 3SE0A 1Z0DA 1AKEA 2VBCA 1CU1A 4AC9A 3IEVA 2VF7A 2GVZC 3ZIAD 2OILA 3RVBA 1E2MA 3JZAA 1G5RA 1R8QA 1T5IA 2YOFA 4O25A 1MO5A 2H17A 3VFDA 2JJ2D 3GQBA 3SYNA 4B34A 1KO4A 2NPIA 2A2ZA 3K1JA 1ZD1A 4C3ZA 4BSZA 2Q6TA 1O87A 4FW9A 2IL1A 4IEEA 1OF1A 2WWHA 3UMFA 1T8UA 1KDPA 2IYYA 4PC6A 2WJHA 3G82C 4LGMA 1KKLA 2MSCB 1QZXA 4XWAA 2JGNA 3AF6A 4U02A 4PZLA 4TMVA 3CRQA 4Y0VA 5DYGA 4DDVA 1KMHB 3TRFA 5FBLB 2KZFA 2B92A 3W3AA 1WCV1 4V0NA 2H16A 2JMPA 4NKRA 2V8OA 3VTKA 4B3CA 2NQ2C 2PX3A 2IYSA 4JLNA 1Q0UA 1ZU4A 4P31A 4B73A 1N2CE 3LX5A 2HCJB 3U6KA 1NP6A 4RZ2A 3NBFA 1GL6A 5KUTA 1BMFA 1E2IA 4Q00A 4DCVA 1ZUHA 3Q7PA 5EP3A 1GNPA 1JR3D 1KI9A 1U2RA 1G64A 2E1RA 2GXSA 3AF4A 4C7OA 3JAMD 1IM2A 3HYTA 4CF7A 1Z29A 1DBSA 5DHFA 3QKUA 4D6PA 4DBLC 4QJ5A 4Q4LA 5AUNB 3FWYA 2CBZA 3LBNA 4DUZC 1FMJA 3I62A 1TU4A 5A2QD 4ZDJA 3RLFA 1TUIA 1ZIOA 1E98A 1WA5A 4M53A 1GDDA 4P33A 3RS7A 4DV2C 3LQRA 2JLRA 2JIZA 2ZJBA 2CCKA 1IN4A 1ZM7A 1SVMA 2ZPTX 4MRPA 4PHGA 2OESA 4JBWA 1IN6A 2ZSAA 1Z6AA 4V02A 3PJRA 2VRWA 5TDHA 4LJAA 1W4BA 1XMJA 4X64C 3P1JA 4Q48A 2WWIA 2EFCB 3NH9A 2WOJA 4D80A 2QGNA 2I1QA 2UUAC 3THYA 5BN3A 2D06A 1HNXC 2GJKA 4B32A 4I1VA 2QMHA 3L0SA 4TLBA 2W6JD 4ARZA 3UWOA 1F6BA 5SZJA 3VU9A 2DFKB 1T3SA 1S3SA 4OHZA 4Q4AA 1JQLB 3EZ2A 5DI3A 5L3SB 3GLHA 2YWGA 2B8WA 4Q19A 2O0HA 1M34E 3AP3A 4MDEA 1HT2E 1OW3B 1AIPA 4FN5A 2H92A 1V43A 3TUZC 1N36C 1O3YA 2XB4A 3KQNA 2D2EA 1KI6B 3KKPA 3KXLA 1G17A 5CYOA 3GD7A 3LUSA 1LFDB 3WNDA 2YOHA 1F2UA 2FSGA 2ZE5A 4OHXA 4KXFB 2FGKA 5B64A 2R6CA 4PPFA 1CJUC 3I61A 3SI7A 4AI6A 2HT1A 1OXTA 2ZS7A 1KI8A 3IILA 5J4HA 2ZEJA 3MD0A 3QG5A 2ZITA 5TMPA 3KJIA 2Q3FA 1ZC4A 1WRBA 3KXKA 2ORWA 3VR1A 3O47A 2ZRAA 2JDIA 1UBGA 3TE6A 2PEYA 3H84A 1XXHB 3EA0A 5H8WA 4TYQA 1T4GA 1FP6A 3D3QA 2KI5A 2ODNA 5LD2B 3LQQA 3FFAA 3EC1A 5KU1A 1M1YE 1N6NA 4ON9A 2IYQA 1LY1A 2F1RA 1EFUA 1P9RA 2F43A 3K09C 3QF7A 3SHFA 1CEEA 5CITA 3UIEA 1AZSC 1NVUQ 3MFYA 1PLKA 3KB2A 4W5WA 2V7QD 1L2FA 1XEWY 1IONA 3U5ZB 4QXAA 5FOXA 2FWRA 2QSYA 3SZRA 1NI3A 4TQAA 5GVSA 4PFSA 3FHOA 4QG7A 1UDWA 4P32A 2P5SA 2L0XA 3QKRA 1RJ9B 4IDQA 4TN1A 2I4IA 4GL2A 4KODA 2V9PA 1XTKA 3PV0A 4M8NE 4B3DA 3QI2A 1N2FA 3MWJA 2GESA 1RYFA 1E2NA 1X8LA 3GLGB 3BD9A 2BM0A 1YR8A 2Z4SA 4TTQA 2RGGA 1G5PA 2WPDD 1ZRHA 5FOSA 2OV2A 4MH0R 3TUJC 2OO7A 5E3HA 4DSUA 2RGCA 4NU0A 4AYWA 5KYKA 2FPKA 2JAQA 4NZYA 3QSYA 1Z06A 5C18A 1YKSA 2OLKA 2YC2C 1CR2A 4JVSB 4TSFA 5JECA 1C9KA 1I2MA 1W0KD 3LFUA 5L8VA 4KO8A 3WYFA 1K0RA 1RRPA 1ZC3A 3TIFA 5JI2E 3UPUA 1VCNA 1DPFA 3U2QA 1G7TA 1XRJA 3NBZC 3AM1A 4FMCB 2ZI7A 5K8UA 2XGJA 3NDBB 4B3RC 4HZUB 1LNZA 4QRHA 4OQNA 2PZFA 2QPAA 5H70A 2NZ8A 2ZUBA 1OXXK 2CXCA 4XTCS 4EPYA 5HTKA 4JL6A 2AX4A 3T15A 1R10A 1GG2A 2J5XA 3ZJYA 3GLIB 4MYHA 2O8BB 3L0OA 1N6IA 2HLDA 1XB2A 3RS0A 3CB4A 4HLUA 4XSHA 2OCAA 2ONFA 1NY6A 1G21E 4DIDA 2QNRA 1GFIA 3QG1A 4IRUB 3T1QA 4JI7C 1EG7A 1GP2A 1Z8FA 3EIEA 3AF0A 3FHCB 3FFBA 3TJZA 3AVUA 2KE5A 3AVOA 3ZD7A 2MMGA 4OQLA 4DCNA 2Q3HA 1RZ3A 4DLUA 2F1IA 5FOVA 2ATXA 1ZINA 1TQ4A 3A37A 1ONBA 3QQ5A 2G88A 1ZB9A 3A1VA 3K0FB 4FINA 2VLIA 1M7GA 4HB3A 3ND9A 3IBGA 3BXZA 5EE9A 3B6EA 1ZUIA 3SC3A 1I4DD 1L4UA 4DSNA 1SXJB 1FUUA 4HUQA 1XBTA 4Q9LA 1LF0A 3IUYA 1SKYE 4G01B 4JLOA 2QP9X 4QNRA 2GNOA 2GZAA 4RD2A 3THWA 4OBEA 2AHOA 3OAAA 1Z07A 2W0SA 5IF9A 1ML8A 4C0AC 5JEDA 2R62A 2D7DA 3R9XA 2FN4A 3G5UA 3OZXA 2J41A 5J47A 5FOUA 4LHVA 3GP8A 1QHIA 1XD2A 3R7WB 3P27A 2OXRA 1XZPA 2XSZA 1XWIA 3KKNA 3T61A 4A8JB 4QBFA 1RFLA 2G1KA 2VL7A 1WQ1R 4NYJR 1G6OA 3SFZA 4UQOA 3Q9LA 2R6AA 2PLFA 1IXSB 5FI0B 4TLAA 5BN5A 2IX3A 4CEIB 5HCNA 221PA 5HKKA 3IO5A 5AJVB 4KBFA 2A5JA 2HEIA 1RE0A 1K5DA 2QL8A 5DSZA 1EFHA 4TLDA 2W6IA 1G7RA 3ICQB 3D31A 4TYYA 3FTQA 5KSOA 2R65A 3FYHA 1H8HD 5KOYA 1DO2A 1ZUNB 2CHQA 2QPTA 2ZRLA 1C4OA 1G20E 1Z22A 1Q1BA 4B3GA 5FL7D 2WKPA 3NKVA 4DV1C 3U7EB 4B43A 4BLRA 3M6AA 4DT1B 1GTVA 3CKLA 3W6NA 3TNFA 1S9HA 5A0FA 1DAGA 1KO5A 1MO6A 1WF3A 5CM8B 3PEUA 1QHYA 3PQCA 4URYR 1G6HA 4G5SA 4A82A 4BQSA 3IIMA 2Q9BA 5FFMA 1ZIPA 1SQ5A 5JWRA 4A0HA 2ODWA 1IOZA 1U81A 5FPHA 1E1QD 1ZNZA 2RGDA 1Q20A 3R8FA 5EXPA 1U8YA 2AKAB 1RRCA 2GCOB 2XZLA 1NKSA 2P3SA 3RRMA 1H8ED 4ZDKA 3BERA 1YR7A 4TMZA 2VP2A 4AK9A 4BEJA 4QC2A 2CNWA 2WJIA 2EFHB 5DN6A 1DG3A 2XJ9A 1BS1A 4R98A 1J8MF 3KJEA 4C0KA 3LWNA 4DV5C 1FQJA 1NIPA 1OJLA 3ASYA 5HE9A 1NBMA 3ADBA 4CGZA 1QG2A 2WKRA 4FMBB 1N6OA 2ZXUA 1R8SA 1V5WA 4LFBC 3B82A 1H8EA 1JXMA 1D8TA 1G3UA 2PJZA 4FMCF 4AIIA 3NXSA 4M2LA 5J5CA 1UBFA 5C46F 4UNSA 1ZM9A 1VG0B 3LBIA 1NBME 4AKEA 3B1XA 4DR7C 5CK4A 3SYKA 1YHNA 4RY2A 1DEKA 1EX7A 2R2AA 2WJYA 3QJYA 2EQBA 1E2QA 2WM9B 2IYUA 4YDSA 3TAHA 4OJKA 4Q9IA 5AR1A 4OHYA 3CJEA 1JJVA 5E4FA 3SU8A 2ZRDA 1E9CA 4UNNA 1DAIA 2DB3A 4DKXA 1YRAA 5AJWA 4FWTA 2ATWA 4YC7A 4YXWA 3K9GA 4WAUA 2IS2A 2O8FA 1TEVA 1E0SA 1OYYA 1GKUB 2GEDA 1R5OA 2VHCA 1KK3A 4GKKC 1H65A 5CM9C 1HYQA 5D3QA 4LDJA 2QORA 2ASEA 1ZD8A 2X19A 1X8KA 4B2LA 2NG1A 4Z51A 1E2KA 2ZS9A 1FFHA 2ZYWX 3T35A 2EU8A 2V6JA 1HH2P 4LF8C 1G8HA 3ZS8A 5FUVA 2RHDA 4TQUS 4DLTA 3CRMA 4JLDA 5L3QB 4MKFA 3CNOA 4HATA 3KFVA 5SZIA 1BH2A 3REFA 1J90A 1R2QA 3H1TA 2WAYA 1VCOA 4Q7MB 2A5DA 1CJTC 1TF5A 1MV5A 5DLQC 4GMXA 3QEOA 3Q7QA 3CPHA 1NJGA 5C4MA 2CVFA 3X2SA 1KSFX 5FPKA 1R4AA 3ONWA 5B58C 3U7GA 1XPRA 2JASA 1NVVQ 4Q9HA 4CZ2A 1KNQA 3FE2A 3HJNA 3K70B 2RGBA 4TMTA 4GNKA 5LBIA 4OQFA 5F2EA 3K70C 4ESVA 3OHMA 4CEIA 4GI7A 1VKJA 4KYIB 1DAFA 2FG5A 4WBSA 2XAUA 2QMUA 4XD7D 4EPXA 3U61B 1G41A 1I4TD 2LWIA 3X1YA 4KJZA 5JRZA 2VP0A 4GBMA 4EPVA 2AFIE 3BS4A 2J0SA 2GK6A 4PXAA 3EARA 5JEEA 1W44A 1W5TA 4AG5A 1Q1QA 4PC7A 3AVPA 1ZW6A 4HAYA 1XZQA 2F9MA 4DR1C 4GT1A 2ODBA 1AM4D 4WZBE 3EPKA 2XTMA 1ELOA 4M1KA 4EJSC 4L4UA 4US0R 1UFQA 4ESHA 4F93B 2YV5A 2HF9A 1UBEA 4IDNA 3LVRE 4B74A 4BECA 2P5TB 4NYIR 1QVAA 2O8DB 2FE4A 1G9XA 3K0EA 4O0MA 4V0KA 3ZGXA 1SVSA 1UKEA 3IDQA 5E7IA 1NMYA 4BE7B 3PEYA 3NEYA 4D26A 1JBKA 2X77A 3BJIC 2F6RA 4MYTA 4NOZA 3AVVA 4LC1A 4AWXA 4KU4A 2Y8EA 4Q4HB 3ZIAA 4X62C 3A4MA 1TU3A 3EWAA 4US1R 3IHWA 4OHVA 1S2MA 4E03A 3HPRA 1DAKA 5LB4A 4KYUA 2C03A 3ECCA 2NO7A 5KPDA 1ZB8A 1YVDA 3TSOA 3K0FA 4LJ5A 2QAGA 1W4CA 3V4RA 3OE7A 3SFVA 2V54A 3WXMA 4JJKA 4LYAA 4JBXA 3I32A 1FW6A 2JLYA 2EFDB 4YY3C 1WXQA 2QRZA 3CF2A 1KO7A 1CXZA 2JLVA 1M7HA 1OYWA 2FF7A 3SJAA 5ANRB 1XMOC 4YMVA 4JZKA 5GJVC 2CLDX 1TTTA 1G4AE 1Z6YA 1S9DA 2X8AA 3B9PA 1II8B 2BC9A 5IDVA 2J0UB 4D4JA 4BGDA 4LJYA 3TGPA 5K8LA 5CB8A 2ZUDA 4A92A 4TMWA 1G3MA 2DWPA 3KDSE 3ADDA 3FKSD 4RZXA 3RS3A 3SS8A 1OH8A 1NKTA 4W9MC 4QM7A 1TAGA 5KNBA 1E4YA 2GBLC 1HNWC 2FPMA 5DN6D 2N1BA 3B1YA 1OXVA 3BFXA 4MRRA 3EW9A 5FPYA 4NMMA 2Z5FA 4XH9B 2C95A 3KZ1E 1HT1E 1AGRA 2RH5A 3ZD6A 1Y63A 3BK7A 2P2LA 4DJTA 4NYMR 2ZU6A 1G18A 1XF9A 4V0ME 3REGA 1D9XA 4B6FA 5AUOB 1E32A 4DT1A 3VHXA 2Q9AA 2N42A 1US8A 4GZLA 4JT4A 1W46A 4LV8B 3G0HA 1PV4A 4XD7A 4F4IA 3IIJA 2C98A 2CK3D 3U3MA 1G16A 4QGGA 3OTOC 1FUKA 3AF5A 1HNZC 1GNQA 2AXPA 5A4JA 2NO1A 2N46A 3O8CA 4RKFA 1PLJA 3KKOA 5SZHB 1VCMA 1NVXQ 2HDNB 4JS0A 4FMDF 2QMEA 2J0UA 4EFNA 5TY0A 3QENA 4G0NA 4XWKA 2QRNA 3QXJA 4ZDWA 3QPVA 4RD6A 3T1VA 5FI1B 2UUCC 2ZI5A 4HAUA 3B13B 1NLYA 1HQYE 1UEIA 4P4UA 1J5EC 2J45A 3GJ6A 4L8GA 3PUXA 4C0JA 1NJFA 1IN7A 1Z5ZA 2X1VA 5HKKD 4ZKDA 2BMJA 1KTVA 2R44A 2HLDD 3PITA 3AF1A 2VP9A 2QPOA 1R0WA 1S0UA 2YCBA 2VO1A 3FMIA 4ZI2A 1EFRD 2CL6X 2A3RA 1GAJA 3QKRB 5J40A 1XX6A 1AKYA 2REOA 3AEZA 1E94E 1NSFA 5BYJA 2ZR9A 2D74A 3CH4B 2AWNA 2C2HA 1E2HA 3OAAD 4LF6C 3LO5A 2C99A 2LCFA 2ZYTX 5AWFC 1VYVA 1XCPA 3JZMA 2WIBA 1E0JA 2QP4A 4GOXA 5B2ZA 3TSZA 3TQFA 3ZDQA 4UJ3A 4B6EA 4HAZA 2A5FA 4D4LA 1OIWA 4D25A 2E9SA 4TL6A 4JI1C 3R9WA 2GXAA 2I3BA 3GLGA 1ODFA 2BOVA 4LHYA 1OKKD 2PMDA 2YINC 4N0DA 4D0NA 5JRJA 2QAGC 1EFCA 1KZ7B 1IBKC 1KIMA 2R6GA 1NN1A 3KKQA 3OEED 1G3RA 5CJPA 3UXMA 2WPDA 1JR3E 1FL9A 3VR6A 3A1WA 2ZRGA 3AKCA 4KFRA 4JI6C 3GLIE 4ACBA 1FOEB 5G3YA 5EQTA 1N6PA 4HZUA 2ANCA 4C4PA 1E3MA 1E69A 3DZDA 4V03A 4M0LA 3F0TA 1WBDA 4PC2A 4B3SC 1R5NA 3CH5A 4MYUA 3B78A 4YMWA 1GRNA 3GLFA 2J0VA 421PA 3CWQA 2OXCA 4F7WA 4JBYA 3RYTC 1USPB 3BH0A 4BZPA 3T12A 1HH4A 3UWKA 4BASA 1XXHE 2WWGA 2X2FA 4OQXA 2NO0A 5J4YA 2QROA 2MSDB 2IUTA 4TL8A 3C5CA 3AVYA 1HV8A 1ZMXA 2GJ8A 5EXSA 4B33A 5JBQA 2CY1A 2GF0A 5EZ6B 4YONB 4HZIA 4N0EA 4PSAA 1A5TA 2WVJA 3V00A 4LOAA 1CJMA 2NTYC 1SGWA 4UNQA 1Z47A 1KI2A 2PT5A 3J81k 1JXOA 1MR3F 1N5JA 4AQYC 1TF2A 3RRYA 4BWYA 1D5CA 1QHXA 1KO8A 1TQDA 3SBEA 4Z1MA 4DLRA 4A15A 2VSXA 4P4SB 3VKGA 1OV4A 2FFBA 2QQ0A 2YYZA 3T5GA 2D2FA 1VPLA 1XD9A 3B1VA 3SOPA 4RFSB 3QBVA 5EUMA 3AH8A 1NG9A 5CB6A 3TBKA 4XVQA 121PA 1UEJA 1XTIA 4HLQB 1VHLA 1WP9A 3MLEA 1US8B 1OKKA 3C8UA 5AJZA 3DM9B 4G1UC 1N6RA 4LPSA 3QUSA 4KI0A 4KFUA 4UNPA 1N33C 4TMXA 4A8JA 3EPLA 2YC4C 4JSTA 3U3KA 5FTJA 5LMUC 2GBLA 2EYQA 3TR0A 1HQCA 3EZ9A 5J4KA 1KOFA 2DFTA 5CDFA 3F8TA 2QAJA 4JVMA 4DLVA 1E2PA 3Q8XB 4R71A 3KKMA 2F3RA 4AKIA 3M0EA 2IHBA 2PLRA 2ZTSA 4I4LA 2JJ8A 2VF8A 4JLVA 1LS1A 4Q4HA 4DCUA 1N0WA 2ZRNA 3BRWD 3TW4A 2FDCA 4IDHA 1SVWA 4TT3A 2UZIR 3I73A 1JR6A 2YWEA 5DH9A 5EUQB 1KK2A 2IYWA 1VG1A 4HLCA 2IF2A 4LV5B 3R8CA 4GOJA 3TR5A 1Q1ZA 2KJQA 4RFSA 4LHZA 3SEAA 3U60B 2ZI6A 1Q3HA 4BFTA 4QOSA 3O8DA 1ZP6A 4M9ZA 1Z83A 1W49A 4CVNA 1IXZA 2RAPA 2VP5A 1FP7A 1KJWA 1SKQA 2JLWA 3RRNA 3VKWA 2ZI9A 4Z8YA 3T06B 5J4LA 4MGZR 2QUZA 3DO6A 1CP2A 4ZCLA 2NIPA 2A5YB 1BOFA 3BORA 3E5HA 1S1CA 4ARZB 3Q5DA 1JEDA 1PZNA 2GRJA 2FX3A 1CJKC 3NHAA 2RGEA 1JNYA 1X8JA 4YDHB 2ZRJA 1G19A 3WBJA 1Z2CA 1OH6A 4MKHA 4JIMA 3CZPA 3LY5A 4NTZA 3ZVLA 4IJMA 4DEXA 1P6XA 4JI4C 1CRQA 4X66C 4HB0A 3BE4A 3CPJB 3UMRA 3CX6A 3RHFA 1JR3A 1JPNA 1VHTA 1XNQC 2FEMA 1YJ5A 2D7CA 5J4VA 4A0FA 1EFTA 4EJSB 4EDHA 1CR4A 1A4RA 4KLZA 1ZM2A 2BBTA 4URXR 4JLPA 4G5OA 5IT5A 2NO6A 1IBMC 2Q21A 1N6HA 2W6ID 3GLGE 3PUWA 5FUYA 2ERXA 1COWD 4DRZA 4YQFA 4BFSA 5AUQA 3RSOA 3EZ7A 1VIAA 3SJCA 3RABA 4LBVA 4DV3C 4OX9C 4M9XA 1RIFA 3LVQE 3CUEF 5FTNA 1YZLA 3CRW1 2JIZD 3FMPB 5DGXA 2WMNB 2VQFC 3SQXA 5EXTA 2RGNA 4JKYA 2AL7A 4URUR 2DFLA 2GF9A 3HR8A 4LHWA 3C15C 1TUEA 3QXXA 1OFIA 4ABYA 1VLAA 2C04A 1XEXB 1GL9B 4K8OA 2H8KA 1IN8A 1VCIA 3MJRA 8OHMA 5FOTA 4HDOB 1KAOA 2WKQA 4I1UA 1L8QA 2CE7A 2JLQA 4JJZA 4DWJA 1E2JA 3IBYA 1OE0A 2W0MA 4GPTA 1U0HC 2AWOA 2RKOA 2G6BA 4OL0A 2YOGA 1AA9A 1NN5A 4C0SA 1NRJB 1IJFA 4BRWA 1YZNA 5KTYA 4QFMA 4B2IA 1EGAA 3FVQA 1SHZA 1MO4A 4BLTA 2BIFA 4X8HA 2CE2X 4D4MA 3HP1A 3L0IB 2XITA 3DDCA 4V0MA 5D3MB 2BJVA 3UG6A 5C2JB 1GKYA 2OSBA 1CRPA 3BC1A 4DLSA 3X1DA 1S96A 1NL3A 4A6PA 4FI3C 4FMDB 4X65C 4JLBA 1OXSC 3O8BA 1RRFA 5JHGB 3THXA 1G5TA 1J2JA 2FA9A 2OFXA 1R0YA 3AKDA 3UG7A 2HYDA 4UXHA 5JMTA 5JCPA 4RVCA 4D82A 2DYJA 1E2DA 1PUJA 1JAIA 4KLNA 2NOAA 2YVUA 1BIFA 4PQRA 3ZZTA 3U4QB 3SJBA 4B2PA 1J7KA 1DAMA 2WWWA 1F2TB 1HEIA 3L43A 1NMXA 5C4GB 3RC8A 1W0KA 3I72A 4F91B 1XTRA 2CCGA 2ZSBA 4DXAA 3QF4A 3AP2A 3IQWA 3CF0A 2ZM5A 2JJ1D 1VDZA 2GEVA 1KSJA 5KNCA 2WWYA 5AJXA 2CEAA 5GJCA 1KSGA 5LDDC 3SNHA 1RYHA 3VMFA 2Z43A 1T3HA 3K0AB 1D2MA 4Q66C 5KHOC 2Z0MA 3VR2A 2GETA 3UMSA 2IT1A 1A1VA 2IYXA 1XXHA 1SVOA 2OBLA 2ZM6C 2B6HA 4NCIA 4DB2A 4PANA 2IXFA 3BB1A 3T1TA 3B1WA 1ANKA 4Q9KA 5LB2A 1QBKC 2W58A 4LWZA 3RANA 1L7VC 2C77A 2EFEB 2W2TA 3GKUA 1TQ2A 2OCYC 2P65A 2WSMA 3MWKA 3EIHA 1ZD9A 1DS6A 4TMKA 4PR0A 3VNVA 4PC1A 3U7FB 2WWFA 4IOLA 4US2R 2VYFA 5JFGA 2OFOA 4ASUD 1W36B 4PPNA 4DUYC 2QE7D 3GEHA 4GMDA 2FPLA 4QHSA 1E9RA 3W8RA 4EPTA 4X8LA 3I5YA 1SVIA 2QENA 2D3WA 4ZV4A 3A1UA 2J1LA 1GRQA 4Y0AA 5B57C 3QXHA 3TKLA 2VPPA 2HV8A 2WWXA 1ZVQA 2QTVB 4B48A 1Q57A 1OB2A 2JCSA 1N0UA 2IYRA 2OCBA 3LD9A 2DR3A 4Q1CA 3NVAA 2FZLA 4QKQA 1ZM4A 2K5UA 4RD3A 2ZYUX 2GCOA 2ZRIA 2NZJA 2J7KA 1HA3A 3I92A 3VR4A 4D2IA 1UDXA 2FSFA 4AKHA 2W2VA 4AYTA 1Z3IX 4C9BA 3LV8A 3A1TA 3N70A 3KL4A 1G8GA 1HTWA 1NBMD 1WE2A 1AK2A 4R7ZA 2E87A 4POAA 4GDFA 2REBA 1G4UR 3CNLA 3EERA 4P3YA 2XNDA 4KFSA 4Q7JB 1ZCBA 3K0CA 5FR1A 5G3ZA 1KZGB 4Q1EA 3W8NA 4Q4JB 3AVXA 2GZHA 4LYFA 5FTKA 1ESNA 2REXB 3MWYW 3TMKA 2QM7A 4H9GA 5BYKA 1OH5A 4TLEA 3QKSB 4M21A 4EQ6B 4TYPA 2O8EA 1RPZA 5FLXD 3AGQA 4BFWA 4C7OB 1HURA 2ZS8A 4BLPA 1CULC 1NG1A 4OYHA 2CDNA 1U9IA 4V0LA 2IEZA 3CW2A 2XXAB 4FIDA 2ANBA 3B7GA 4G3XA 3V9PA 2O8EB 3TUIC 1CBUA 1VTKA 2BCJQ 2YNMA 1CS4C 1G7CA 4A36A 1GRRA 4CEJB 3OEHA 1KY3A 2F7SA 5JWHA 4ZCMA 1HR0C 4B3TC 3W3ZB 2GVDC 3D7MA 3AP1A 2GILA 3RS5A 4BUJA 1VG8A 4LV6A 5FTMA 3K9LA 2PCJA 3AQ4A 2E8EA 4PHTA 4BFXA 5AUPB 4KBGA 1QHSA 3FKQA 4JMPA 3GEIA 3HR7A 1IXRC 1E79D 1OHHD 1VYTA 3UANA 1P4SA 2OAQ1 4PPGA 1KYIA 1G1MA 2XZPA 2AR7A 3I3SR 3B60A 3NC1C 5H1YA 2X2EA 1HUQA 2CCJA 4RFVA 1XD2B 4RCYA 3FGNA 4RZ3A 1A2KC 4V0OA 2KWIA 4ASUA 1UPTA 2ZRHA 1MO3A 3C16C 4LBWA 3X1WA 4CDGA 1VECA 2UXBC 1JQJC 2ZJAA 4QHYA 3WNBA 2PL3A 4DR6C 1VIYA 2QSZA 1IBRA 4II7A 3BIFA 1GUAA 3QXCA 3MWLA 4WZ6A 3EA5A 3MJHA 4GKJC 5KNDA 3KX2A 2F4VC 3GLHB 2O8BA 1NMZA 2P6UA 3PUZA 5KDOA 2FV8A 1NLZA 4ERNA 3CWZA 5E95A 4DLXA 4CEHB 2GK7A 2ZI4A 1RW4A 3U4QA 1L2TA 2ZUCA 1P9WA 3F5FA 4IW3B 4B47A 3WBKA 4PQYA 3P4YA 2IWHA 4EIWA 3LX8A 3OF5A 4L9SA 1Z0IA 2QT1A 1G291 1PLLA 2AXNA 2ZIAA 3MMPA 3RNLA 4XWOA 3TH5A 3KJHA 4JLMA 4ZKEA 2OLJA 2WTUA 2QAGB 4OKSA 2HUPA 2CHGA 5KSYA 2OG2A 3U3JA 1YZUA 3OEHD 4C0HA 4M1YA 4I81A 4PZZA 3T5DA 5FH9A 1WDTA 4JSYA 4NYJQ 3BFVA 1AS3A 4DCSA 1QRAA 1R0XA 1U98A 2BBOA 2UXDC 1FTNA 3KB1A 4ITRC 4E07A 2O8DA 1N3BA 4NP6A 2XR1A 4LK2A 1GSIA 1EFRA 2XZOA 5CIQA 5L3RA 1KHTA 3A8TA 3MCAA 3K0AA 4HSEA 4NCNA 3VX3A 1T3LA 5TVKA 1K8RA 3B9QA 1I94C 2KB0A 2ZE6A 2ZREA 3BFKA 2ONJA 3RDPA 2BJWA 4MA4A 1CR1A 1G8FA 3D6TB 4QNMA 4NCHA 5BWMA 4Q1AA 1QHHA 4WVFA 1TMKA 1KKGA 4P0TA 1KNXA 4I1OA 4I99A 4KFTA 5SZKB 5BR8C 4P4TA 4MRVA 3DZ8A 3IHLA 2H1LA 2IXEA 3C7KA 3AF3A 3K70D 2ORVA 2LKDA 3DMDA 2CHVA 1F2UB 3B1ZA 4H1UA 1J70A 4PTLA 5F98A 1XMIA 1OLOA 3AUYA 1P5ZB 4XIGS 2E7GA 3ZS9A 2BKEA 1T9HA 4J0QA 3SQWA 4ZIRA 4L9WA 2NGRA 3PG5A 4YLGA 2IEYA 4B44A 5FOWA 3KQUA 4EAQA 1I2DA 4DLZA 2G0NA 4WW0A 5JHHB 1QHNA 5EE3A 2V55B 3KQKA 1FX0A 4PHFA 1NNEA 1NLFA 5AK0A 1QWIA 5KO2A 2UU9C 4DDTA 3VU9B 1C1YA 2BEKA 3EZ6A 1W2GA 4OI1A 3VQTA 5FPSA 5CDFE 3TVTA 5JWOA 1SZPA 3C5HA 4MKIA 5E7JA 4URWR 4BLQA 1D6JA 2GJSA 1TX4B 1W4AA 2WZQA 3AF2A 1GWNA 3WP0A 1G8PA 2MSEB 4M22A 4DR4C 5JCZA 3QKSA 4EQ6A 2O8CB 5BQ5A 3T1OA 4TSFD 1J99A 3NH6A 4TL7A 1NYEA 4KAXA 2CLCX 5G53C 2HXYA 5LD2C 1MRSA 2C9CA 1Z6GA 2WV9A 4X8MA 4IVRA 4IKEA 4KVGA 3WHKA 1R7RA 1KI3A 4K0KC 2DY1A 4C0LA 4DDWA 1P7CA 3M4YA 3CM0A 4OK5A 1XJ0A 2R6FA 3PVSA 4QBHA 2D4HA 2C96A 4WOPA 4XVRA 1KSHA 3ADKA 3EC2A 1KKMA 1NN3A 4NL4H 5FR2A 3ZVRA 4UKDA 3NIBA 2D7VA 3MAAC 2ZSEA 2O0KA 5EE5B 3DEFA 3IQXA 5HZKA 4MTNA 4A6XA 3K0SA 1OT3A 2ZJZA 4TLCA 2FFQA 1W7AA 5L3QA 3TVDA 1U8AA 3VAAA 3J81D 1XMSA 4B3FX 1GM5A 3QBTA 2NMVA 4K46A 3T34A 4YXWD 2OPLA 2AFHE 3A4LA 2WMOB 3N5CA 2IC5A 1CIPA 1DAHA 3CONA 4RKEA 4BZXA 1OH7A 1DOAA 3RAPR 1TL7C 5D3MA 1AJEA 1W48A 2ONKA 1XTQA 3GJ4A 1XMVA 4E5UA 2OE2A 5HE8A 3A36A 4UNRA 1LS6A 3AB3A 2ZU0C 3WNCA 4EKDA 4PZYA 3JVVA 3F3YA 4C30A 3EX7C 2J3EA 2ZRPA 2FMXA 2WHXA 2HJGA 4IFBA 2RGNC 4DV0C 1XNRC 3PEWA 5DISB 3AKEA 1FJGC 2XX3A 2OT3B 4P4SA 1VG9B 1B0UA 1E9EA 2FFAA 4PAQA 1WB9A 721PA 4IOJA 1EWQA 3BAFA 3VHLB 1L4YA 1YZGA 3QE0A 4IOKA 1UJ2A 2ASBA 2E5LC 1UKKA 3H4MA 3W6PA 4BFVA 3SN6A 1F2TA 4M1OA 3I4LA 4DUGD 1NVWQ 3CZQA 3RRZA 4KSBA 4W7SA 1OFUX 1LW7A 1XCGB 3FDIA 2AKYA 3R7WA 2R8RA 2IK8A 2BWJA 4B3BA 2ZRMA 1IQPA 4LJ9A 2O5VA 2JATA 1M74A 1Z08A 3I1FA 4A2QA 4DHEA 3H2YA 2IHYA 3LA6A 4G5GA 2W83A 3HYRA 4PSKA 4L15A 5BXQC 1RC8A 3U44A 2EGTA 2DCUA 1T5LA 1MABB 2GCNA 3HU2A 2ZR7A 3KTAB 4G5RA 5EP1A 5IWAC 4OI2A 3U3RA 4AY2A 3IKJA 3LLMA 1KJYA 4IEIA 5DE3A 2G3YA 5CK5A 4NYMQ 4ZO4A 4BLOA 1RRGA 5KPJA 4B75A 4C2UA 4LF7C 1YRBA 2GKSA 3IPYA 3TAUA 2ZANA 5CLQA 1KAGA 1Q22A 3FKSA 4TYWA 2ZQ5A 4URVR 2PT7A 4O2LA 2VHUA 4MGKR 2R6DA 5FBWB 4GSYA 3VX4A 5JSZA 2EYUA 1PVOA 4CIDA 1N5KA 1COWA 4HAXA 3DL0A 5EXXA 4DR2C 1N6LA 4AKGA 3ETLA 4NXNC 2BDTA 4B3MC 1UADA 2BCGY 2OHFA 1A82A 3P26A 4JL5A 4BZQA 4HDQB 1P2VA 3EXAA 4JVNA 5GJBA 2XSZD 3ZZUA 3I8SA 3BH7A 3DM5A 2G77B 1DARA 1KY2A 2CLSA 4OQMA 4EUNA 5FBRB 4D4KA 2GAOA 3U44B 2J7PA 2QM8A 1Z28A 2W00A 1IY0A 3GJ0A 3S1AB 2IUSA 3EASA 3CBQA 5BN4A 3T1YC 4M1SA 3MUFA 2QU8A 2ZVQX 4N1AA 3ZLJA 2XB2A 1KI7A 1G3IA 2VSFA 2IUUA 3TLXA 1ZCAA 2ZRFA 3W90A 1N5IA 2ZE7A 4GP6A 1JOSA 2HYIC 4LY6A 1E4VA 1N34C 1QF9A 3DPUA 5JJKA 3NBXX 2PEZA 2ZRBA 3OIWA 3GEEA 2BJOA 4XJXA 3SR0A 3KUDA 4RJLA 4CW7A 1P3JA 1DAEA 2CXXA 4AURA 5K8TA 2QGZA 1XNJA 2QI9C 3P4XA 2BMFA 5DHAA 4LF5C 3TSWA 4ZDIA 4DR3C 2DFNA 2QMOA 2P6NA 4QGAA 4JVLA 2KBEA 3I07A 1ZJ6A 3FPAA 4ZPXA 3MSXA 2F9LA 4LJ7A 5F3WB 3PXGA 4UXJA 1QVRA 1NVVR 2RMKA 4DIEA 4JI8C 3NWJA 3ZH9B 3OFND 4HDCA 5DO9A 4MYCA 1KMQA 1FX0B 4WIAA 2V4ZA 4OK3A 2RGXA 2CL0X 1E0KA 2ZJ5A 3K9HA 3QVVA 3EZFA 3GFOA 4EFLA 2BV3A 4PC3A 1XEXA 5KSZA 1WBBA 2IA5A 4A2PA 4BFZA 2UUBC 3I5XA 2V1XA 2ZJYA 1XU4A 4JT2A 1AS0A 1JI0A 1XP8A 4CEHA 3QXSA 3B8HA 5FL3A 5HZHA 1Y3AA 2IF0A 2W6JA 1M6NA 1X6VA 2ZVPX 2UXCC 3GMTA 2AN9A 4B76A 4Q1DA 3QNUA 2W2XA 4RD0A 2DBYA 3GCGA 3H86A 4JV5C 1EESA 2WJJA 1OB5A 3OESA 2BKUA 2DWOA 2JLZA 3AVTA 4TTPA 2CVHA 3MRSA 4KITB 2BVNA 2A7QA 5CLLA 4RD4A 2ZSDA 1OIXA 4A8JC 4K81B 1YR6A 4LI0A 1B23P 2VHQA 1T8TA 3C14C 3C41J 1U0LA 4QJ3A 2QEQA 2EWWA 4QBGB 2IXGA 3DOFA 4NONA 5FBVB 5G40A 2WJVA 2D62A 3PR1A 1BYUA 2QE7A 3LH5A 2VHJA 4HUQB 4L16A 2QL6A 3BH6A 2GXQA 2ZAOA 3CX8A 4JYAC 4QHTA 4NHOA 2C9OA 1IJEA 3PUYA 1KI4A 3NC0C 1K5GA 4OK6A 5E7MA 5KDLA 3EIQA 1AQYA 1II0A 1E2FA 3GLHE 4MDFA 5BW8A 1R6BX 1ZU5A 4TYNA 4DSOA 4MRSA 4U7DA 4F38A 1U90A 1MRNA 1Z63A 4GOKA 4Q21A 1E2LA 4MRNA 1G7SA 3HU1A 4NCKA 1AQUA 5ELXA 3ND8A 1S8FA 3GLIA 1U9IC 1UKZA 3GJXC 3ADCA 1NN0A 3O8RA 4DV6C 2QBYA 1JAHA 1T0JB 2YHSA 4ZI3A 4ZIRB 4ZCIA 1UKYA 3HDTA 4GRAA 3KQLA 4JYBA 2FNAA 4DCTA 4LHXA 1P75A 1NF3A 4LYJA 4IXMA 4BRUA 4F4JA 4A0RA 1YQTA 3U7HB 1YZTA 1RVDA 1YZQA 4MUBA 3WYAA 4PO1A 1VYUA 1XEFA 3ZZ0A 1R0ZA 2I1VB 3OIVA 1F3OA 3PEVA 3KFXA 3HU3A 1OXUA 4JLAA 1P61B 3PUVA 1U8ZA 2JEOA 3OFNA 2V1UA 2P6RA 3MG9A 2YWFA 4HB2A 3LXRA 1EK0A 2AD1A 3BBPA 2VH5R 3DKVA 4LFAC 4IDPA 1OSNA 5EJEA 1E9DA 1SXJA 2C8VA 4QGHA 2ZJ8A 2EW1A 3GJ7A 1IBLC 4BPBA 2GZDA 2PCLA 1XTSA 1AS2A 4OHWA 2IS6A 3B5JA 1S3GA 1FTSA 4LF4C 2UZ3A 5C1BA 1LF5A 1XFAA 2OZEA 2VP4A 1XPUA 1UKVY 3QF4B 4PO8A 2WJGA 4KCGA 3W5IA 3GFPA 4HB4A 1DE0A 5L3SA 1RJ9A 4LC0A 4X8OA 3A58B 1DVRA 2BMDA 1Q1EA 1LV7A 1TPZA 1UM8A 2GWHA 2V7QA 3L0PA 4ACAA 1RKBA 5GJWC 3GLFE 4GP7A 2IYVA 4S2EA 3IIKA 5DI3B 2RB4A 5CYPA 4QGFA 3X1ZA 1KDOA 1ZBDA 1P73A 4MITA 4R2HA 4TL9A 5F9FA 4XSGA 4Q18A 1S4QA 4IFEA 2ATVA 3VR3A 3WRYC 4DC9A 4Z54A 3ZVMA 1ZNXA 5L3VA 4H1VA 2O8CA 1XJQA 2CK3A 4HI0E 4NE2A 2ZSFA 2BBWA 2VA8A 3NBYC 4PHHA 5TXGA 4IXNA 4Q01A 4D0LB 3GPLA 4LFCC 3IPXA 3Q85A 3A6PC 4U5XA 2BBSA 3UKDA 1FQKA 4DLYA 1D2NA 1PJRA 2RCNA 3MGCA 3U6BA 3CRRA 5IK2D 3UATA 1BMFD 3EAQA 1X86B 4TQ9A 3D8BA 4LYHA 2A5GA 2FSIA 3UK6A 5EZ5A 2OAP1 3QVUA 5EP2A 3E1SA 5DNYB 2OM2A 1YZKA 4NXMC 1KO1A 1OIVA 1Z0JA 3NTUA 3AVQA 5H68A 2IYLD 3EPJA 1H8HA 3DMNA 1E9AA 2JJ1A 2GJ9A 3N2EA 4YMTA 2PZGA 1W4RA 3AGPA 4IDOA 1CTQA 3W9YA 1XMQC 2F1JA 1N6KA 3AKYA 2DYKA 4KHZA 4Q9JA 4EPWA 2QZ4A 2ECKA 3VKHA 2HHHC 3DVLA 1IN5A 4FXPA 621PA 4JLJA 5HPYB 2DHRA 3OIUA 4MGIR 4B3XA 4YMUA 2EWVA 4WA7A 4EFMA 5GVRA 3LRPA 2HJVA 4PSVA 4JKIA 2ODEA 5TARA 3TW8B 2E8CA 1FNMA 1Z0AA 4JI2C 3OE7D 4MQBA 1CF4A 4C0QC 2B7BA 4GZMA 3CIOA 3VR5A 3AUXA 4BFUA 1AGPA 5LPNA 4DB4A 2G0TA 3KJGA 2RGAA 4Q4JA 3LAWA 2WAXA 4W5JA 1N5LA 3FMFA 2KSQA 4MH4A 1J8YF 3QKTA 2OBMA 3QPUA 1A2BA 3R20A 2A9KA 3NDPA 4HAVA 3P20A 3CRVA 2ERYA 2HF8A 521PA 1TADA 4NDZA 5JZVA 1VMAA 3RWMB 1LVGA 1HE8B 2H5EA 1T6NA 1JPJA 1Z0KA 1NIJA 1XD8A 1CR0A 2VHTA 4DDUA 2O0JA 4NCJA 5EP4A
chains in the Genus database with same CATH superfamily
4UTNA 3GJ5A 1P62B 1N0IA 1T2DA 4DV1B 1LUAA 4RQUA 5H7XA 5JJLA 4BQPA 2IOHA 2I8LA 2C4TA 3KT8A 1Y5NA 1U1FA 3DFMA 1L5NA 1M8PA 4R0VA 5IW8A 4ND5A 3RS4A 2A57A 2V6GA 4DV2B 1A7JA 2FFHA 3ZBQA 1R4ZA 3KV3O 3H75A 4GGOA 1V16B 3REQB 2EJCA 3IUNA 3K8YA 2PAFA 3DAFA 4QJIA 2MINB 1L7EA 1JI3A 2B61A 1GPYA 4O5OA 3Q8KA 3LOQA 2FUCA 3G02A 4O2RA 1GNRA 2GEUA 4CM7A 5IRCD 2QJFA 1IRIA 1V45E 1X1RA 3IP6A 3KSBC 4R3NA 1ODCA 4ABTA 2PSEA 1ISRA 3JARA 3ZK9A 3AL0C 1OTYA 1SIBE 2GM9A 4BIIA 2PSFA 3I12A 3NW9A 1K97A 1FDIA 3VSEA 4TVSA 4JGGA 1M1YB 1EVQA 3OHSX 1DUSA 4OA8A 1A9ZA 3PIIA 3I8XA 3STTA 3OWHA 1NRWA 5BSUA 5MN4A 3S82A 1IHUA 1Q7TA 1YJXA 1THZA 5BPFA 2OUIA 2IYNA 1RI1A 3GGJA 4KACA 4J29A 4OXYA 1SXJC 5A1JA 1YSCA 3O3NB 1D6NA 3GLTA 2WIGA 1W59A 1QH8B 2WIAA 1EHCA 2Q0XA 4PUHA 2ZJOA 2HSJA 3QSGA 5LDHA 3BB3A 1QOPB 3NOQA 4EJMA 4QUAA 1ST3A 2A30A 2CFCA 3HP7A 3OT5A 2VPWA 4UBKA 4CKZA 2VTKA 1AU9A 3HCCA 2XCOA 1VKHA 3MJEA 4KUGA 1U1IA 3F3SA 1I4EB 5DI9A 4K0KB 2PJDA 4YAFA 1Q0PA 4F21A 2EVWX 2OVFA 1TAHA 2MWMA 1ILEA 1JDUA 1R15A 4HYYA 5AKXA 4JU9A 5EIBD 3DYBA 4OOFA 1ZFNA 3ETJA 2P9QA 3OZ7A 5PNTA 2PS3A 5AE2A 4RZUA 1QQAA 3JTEA 3TZCA 3F71A 5LN1A 1BQ4A 2C2OA 4FCVA 4QSHA 1LDNA 4IDEA 1JFLA 3UUEA 1GOTA 4AFNA 1ZG3A 2Z83A 1N0VC 3WP1B 1S3IA 3GXBA 3CXUA 4KR9A 2IW3A 1GSHA 1CJCA 1N8KA 2J85A 4V0SA 4YJGA 2ZR0A 3JVUA 2FUG1 4XXHA 3DNFA 4MOWA 1F60A 1YQUA 1ISMA 1Q21A 2DHEA 2HO5A 2F43B 2O8FB 1FPMA 1W5SA 4N3NA 3WMEA 1FMLA 1SXJD 4XGIA 3OOYA 2UYYA 1A5SB 1AUQA 3W34A 5LQAA 5LLDA 1XG5A 5HA5A 1LBHA 3A05A 3P32A 2D5LA 2H00A 1BQ3A 2SKEA 1WDWB 2X5KO 1ETHA 1NE2A 1W1WA 3QWHA 5NLLA 1IM5A 2AFHA 2HB6A 2R751 4KE7A 4QDTA 1QG6A 3ADOA 4RQAA 4DJJA 4GR9A 2RG1A 4DMRA 1E2GA 4UZFA 1BD4A 1P2BA 1KQ3A 3Q98A 2OXEA 1ABFA 4Z49A 5LWHA 1O89A 1EWRA 3IPCA 3U7QB 3H7AA 1XJCA 2OCPA 3DOUA 3W5JA 4CT0A 1UC4B 3S29A 2FN3A 3W0LB 4ZI7B 5J3JA 4PYNA 2JCXA 3BSYA 5HM8A 2PTHA 5IDYA 5IEJA 1G38A 4G9EA 3W4JA 1G0OA 1CY1A 2R7NA 3HN7A 4OHUA 1B8PA 1CG6A 2NVOA 5JLJA 5GADl 1YKFA 2VP6A 4E88A 4RV4A 3PWSA 2J7PD 2RIRA 3QLVA 2JD2A 2GHIA 3T7TA 5IVHA 4NXMB 2Y1XA 4KWHA 3CZRA 5AHKA 3UT5B 5E0KB 3IB3A 3ZDXB 3FM9A 1XRMA 2YJGA 3DQPA 4X71A 1E1QA 5P21A 3UGTA 1I3KA 2C2YA 4BKUA 4EBBA 4F1WA 4N48A 1VP9A 3O8OA 4TT3D 1PS0A 4HY3A 3THOA 1K86A 1UAAA 1SULA 3S2FA 2XQFA 2ZB4A 3INRA 1UCFA 1WMDA 2QYHA 3AY7A 1N2JA 4GL4A 4D5GA 2YJTD 5T7BA 1EXWA 1P72A 3OIGA 4DCMA 1GA6A 3IH5A 2H18A 2WC1A 2YWRA 1DO8A 1UT5A 4I4CA 2XJ4A 1UFOA 4Q3NA 5CP8A 2WD7A 1QE0A 3GT4A 3VNBA 1SRRA 1ZNWA 5M04A 2P3QA 4GRIA 1KP2A 2IGBA 2LNDA 3GYGA 4TKUA 4DBLE 3I6QA 4FKMA 2CHUA 1Z9BA 2OCDA 3DHWC 3L1JA 2FSSA 4HGRA 3NBMA 4DARA 2ZBDA 1ODSA 1M7BA 3NG1A 1PA4A 1GPDG 4RPGA 4KR6A 1SC6A 4Q6BA 1QVVA 2IHVA 5DM2A 4HX9A 4EYEA 1NTOA 1P0MA 2P30A 2QM3A 2OPHA 4B6SA 2CVZA 3D4OA 3BQMB 5FJJA 3ZQ6A 3UOGA 1RBZA 4NBSA 5DBIA 3NWEA 2FRVA 3OZIA 3DOHA 1MJGM 3L1UA 3ORSA 3VVMA 1BFKA 3GFTA 3E3LA 2XXAA 1JECA 3QX8A 4BMDA 1XTJA 3VR5H 3LDAA 1I2CA 1P0CA 2NVUA 3HHPA 3I58A 1CUWA 1Y1LA 1N9GB 2WBLC 3I9FA 1MB4A 2IS4A 3DDSA 4I8XA 4NG5A 5LBTA 4CV3A 4EHJA 1AZTA 2QZZA 1EJ2A 4LZNA 4RZSA 4YASA 5FP0A 2Z9DA 2DPMA 2QQEA 5E9WA 1ZISA 4PAMA 2WICA 1Y6GA 5UKDA 3SYRA 3L8ZA 1TKBA 5IX8A 3EGCA 3ZVNA 1YFZA 2JJ2A 1QIMA 4WOCA 3HN6A 3U3XA 2W37A 2DE0X 3K53A 3H4TA 1YK0A 2JFOA 2PWAA 4BX8A 4EG0A 3HUTA 2XUJA 3LW7A 1LDMA 2ZCVA 1QBGA 4X62B 1B2LA 1W87A 3JVDA 3NWPA 4WRRA 2ONCA 1CYDA 5DBOA 5GONB 3WRVA 3U5TA 1AHPA 2AW5A 2XF8A 1UOEA 4E5DA 1TPYA 3RK1A 4QUDA 3Q3VA 5FKJA 3QFHA 4ZU3A 4GMKA 4YROA 2GPSA 4A1FA 4QFBA 3PXAA 2JKZA 4JP5A 2XOKD 2G1JA 4IRMA 2BFWA 4GI2A 5IMBA 5IT9D 2XE4A 2FETA 3B2EA 4KQWA 3WFJA 2JLXA 2RBEA 4G5XA 2LV8A 1A7UA 3P9IA 2GVNA 3O4RA 3CLTD 1YO6A 4B2YA 1D2EA 2P67A 1IAQA 1I3CA 1N5MA 3QVGA 2G72A 3PDHA 4HLUC 1Y3CE 4NPCA 4CYMA 2P7IA 3ND6A 3QOWA 3OE5A 4RV9A 2ZP1A 5HYVA 1O9GA 2UZ0A 2V98A 1NJ5A 4BX2A 4HN2A 1PWZA 2GZ2A 2NYVA 2CJWA 2X4DA 1OFHA 3LQYA 2AMLA 1P45A 4G4SO 5JDIA 3AHIA 2HJRA 5EMMA 1UBHS 2JFBA 5IC4A 2H8GA 1HL3A 2FEWB 4P7JA 4EB0A 1KEPA 4HWOA 3CEAA 821PA 3U4HA 4YPVA 5TGZA 5L6LB 2I7XA 4S2UA 5EE1A 2QN8A 3V4LA 5LXTA 2MINA 4J1NA 2HMVA 2ZAMA 1JA1A 4ZA2A 3UXYA 4RA9A 2CZCA 3TIIA 3KUCA 2FU5C 3A2KA 5AT1A 4RSGA 2WDZA 2UAGA 1WKVA 2C2MA 3FSGA 4D43A 2PZEA 2Y1WA 4KN6A 4YA6A 3RUPA 5JU6A 3Q3HA 1Q0RA 4FCTA 3QX7A 4FB4A 3NAZA 1SUBA 5JZMA 1XNHA 4OUDA 1KVQA 4TV9B 4X94A 1U65A 3NO4A 4KYTA 4XTRA 5FLEX 4XVCA 2I0FA 4PYLA 2O3SA 4ZMSA 1XEWX 3IO3A 1C7FA 5IK2A 2VH2A 4QIHA 1N77A 1E2EA 1Z36A 4ZGGA 2PA0A 1E9SA 1M2GA 4JV5B 3BHMA 2PT7G 1FC0A 3DOEA 1BGVA 4ZYTA 1GR0A 1II9A 3T1YB 4NFSA 2XGGA 3FETA 1N0HA 4AW9A 1RXVA 3L05A 1MKYA 2Q9CA 3DV0A 1ZM3A 2B8TA 2IY8A 3DL2A 3I5AA 3UK2A 3AUKA 4PRZA 4WXRA 3CUUA 2ZFUA 2H2FA 1EHYA 5EI5A 1ZKDA 3IPRA 3RUCA 4XASA 3E1GA 2REQA 5LQSA 4WXEA 1BFUA 1D0SA 2JI6A 3ROPA 3RSLA 3AEXA 3TDEA 4CTOA 4XM2A 4LX0A 4AQ7A 1RYNA 3R9IA 3N07A 5C31A 2GLTA 2YZ2A 4ND4A 4TYMA 2D00A 2YY5A 1QG4A 1J42A 2Z98A 1WBJB 3BD7A 5THQA 4CIXA 1EVEA 4MKGA 1P2SA 4M1MA 5JVDA 4C2TA 1TEZA 5DBFA 4IIJF 1OYVA 4HLDA 2HCBA 1KGDA 4DY6A 2I54A 3ZE1B 1U6KA 2HWYA 4Q9IA 1IHYA 1QANA 1KK0A 1U2GC 1V8ZA 2JFPA 4Y2HA 5IN5A 5K8IA 4P58A 1FUYB 1WMSA 1YE8A 4AJHA 1SUEA 3CUYA 4NJOA 1LLQA 4D5EA 2QT0A 4GR4A 5I7VA 3ORHA 5LYYA 4W5HA 1JH8A 4OB8A 3L0ZA 1DKRA 3AHDA 3KL2A 3ZHRA 3KTFA 2D5IA 3ZCVA 4TWZA 1Z6XA 2FR8A 4O1HA 4AKSA 3HFRA 5ALVA 2YNMD 3FWPA 4OQZA 3LAXA 5LXTF 2VK8A 1BEEA 1N32C 2ZWOA 1C3XA 1V9LA 2IUEA 1XPOA 1M2EA 1U0JA 3QY0A 1UMBA 2I29A 2I67A 2MSWA 4ZD6A 3S8EA 3LUKA 1Y8QB 1N32B 1M6XA 1UXHA 4I55A 3BB4A 4X7MA 2GT1A 5DW0A 2Q7DA 2F1HA 4HDMB 4KHPB 3CVJA 4DZTA 5CB0A 2HXSA 1KOGA 1T13A 1AKEA 2VBIA 3LZCA 5AW2A 3HU5A 4PZEA 1J24A 1EFPB 3H9QA 3NP7A 1IBLB 3ANTA 3RVBA 1C9EA 1X77A 3IQFA 1R8QA 4HLNA 4Y98A 3K5PA 2Y71A 4O25A 3GQBA 3PYMA 1XZLA 4FOLA 3EAGA 3O82A 2X8LA 1ZVMA 3G5AA 3R24A 3P45A 3F74A 4IIGA 3TTTA 1O87A 1GARA 1XNGA 2CMHA 5BV8A 4D97A 3QYJA 1FF9A 4DQKA 1RCUA 4UTVA 1GUYA 1AMOA 2IL1A 1SWVA 2FW6A 2B25A 4REQA 2OV4A 1ZWLA 1T8UA 3EH2A 4KXQA 4PYJA 4F3TA 2AYZA 4AAYA 3D2AA 4LGMA 3VUFA 1E3EA 4BC9A 1CZOA 4BZWA 2QWXA 4DPLA 2IH4A 1QZXA 2DBVO 1NASA 2QYSA 3AEQA 1QPZA 5SYAA 1W0CA 1TVCA 2NSLA 3S7ZA 3VBCA 2EEPA 4RPKA 3GH1A 4Y0VA 5ALRA 5JMOA 4DDHA 3LUJA 1KMHB 5AKJA 4D8TA 2H6EA 4OHMA 5FBLB 1NFQA 2B92A 3JV7A 1T5OA 3BXHA 1ZI8A 2V0CA 2IYSA 2X3FA 4WH0A 4M9UA 2OYRA 2N3ZA 3LX5A 4FN4A 4IDCA 1YJAA 1TM3E 3F78A 4PCLA 3ZWAA 3LUFA 2R60A 4Q00A 2V5AA 1GFSA 4YIKA 4HVLA 3AIOA 2A88A 4JN6B 3V1YA 5C34B 1KQPA 4DA8A 1TZKA 1U2RA 1G64A 2E1RA 1Q15A 1XP5A 2GXSA 3MMSA 4O4IF 5BT9A 1UL1X 3JAMD 1IM2A 4CF7A 2AUMA 2B9EA 3QKUA 1S6YA 1DKLA 1XZFA 3ZN2A 4D6PA 4ZI7F 3FROA 1YV9A 3KVOA 3BTVA 1FW8A 2CBZA 1T6XA 2K2WA 3C6KA 5DGHA 5JAOA 1TW2A 1MW8X 4EB6A 1RSZA 1EIWA 1PZEA 2DAPA 3HB7A 1N2SA 4BB0A 5CIYA 1X3LA 3M5WA 4J07A 4CMKA 1N1DA 1RAHA 2LBPA 2Q5QA 3RLFA 1XHJA 2BGMA 4BMNA 4YUWA 4OLBA 1WA5A 3DULA 1W5AA 1GDDA 3MTDA 3RS7A 1GZHB 1GCUA 4DV2C 4DTIA 2HHJA 5FA6A 2JLRA 2FXIA 1KOLA 5BVHB 4G26A 3DDWA 2B0CA 3A6GA 4PHGA 2ZPTX 1AX9A 1MFZA 3FYSA 3H5LA 1F9EA 2XCIA 4TV8A 1IN6A 3QQPA 3LCCA 4KPGA 3HKCB 4PZ9A 1Z6AA 2C4HA 1XDGA 1M5UA 2XUHA 4V02A 3Q2IA 2Q7OE 1W4BA 4LXTA 3WGVA 3ETGA 4ZMBA 2WWIA 2PX5A 1NYQA 2CXSA 2EF1A 1H05A 2WOJA 2BFCA 3R5XA 3SZ3A 2HIAA 4R83A 1XZMA 1VYHA 2P9ZA 3CEJA 2EKLA 2QGNA 3CISA 3THYA 5AXAA 3T4EA 1TECE 2GJKA 4XGKA 2PD4A 4B32A 3KQQA 4I1VA 4AS3A 2PX2A 3W7AA 2CMFA 4CUZA 3D8NA 3L0SA 5IANA 2WQ6A 1NR5A 5J2UF 2PSDA 4UEJA 5SZJA 2E4XA 3QFRA 3BE8A 2HBRA 1RMYA 5A6SA 1CW2B 1T3SA 2FTKE 3VH4A 1S3SA 4OHZA 4GQBA 5L3SB 3GLHA 1SNYA 2B8WA 2YWGA 3NKFA 1TA9A 3CO0S 2Z2KA 3B51X 5E9JA 1GN8A 2Q2OA 1OW3B 1NR7A 1GYQA 1V43A 1N7JA 4HVAA 2XB4A 1O3YA 1LPNA 5AJTA 5BN5B 1DKMA 3VTFA 1UOPA 3KXLA 4RHFA 5DTJA 3D6UA 4J76A 4B3HA 4OHXA 3UHOA 3DBIA 1CJUC 1LCIA 1S2DA 4MYDA 3SI7A 2YMMA 4C14A 4AI6A 1KF0A 4BAGA 4DLAA 4YRGA 3NNDA 4OPMA 2DULA 2ZS7A 3HDVA 3FSJX 4PLHA 5J4HA 3MD0A 5FYQA 3UB3A 3H9UA 4BS9A 4RDXA 2FG6C 3KJIA 5I7UA 2VZ0A 5KVQA 5CURA 1ZC4A 4V1CI 2PWPA 3H2GA 1DIGA 1YIAA 3ELDA 3UUGA 3W05A 3Q8LA 4U2BA 4RTMA 3CYFA 4KMMA 1M6XC 4QQFA 2P2FA 3VUEA 1UBGA 3SIWA 4L2IB 3H84A 3KR1A 4J0EA 1XXHB 1P7LA 1KP9A 3EA0A 3QVJA 4YJ2F 3ZJ4A 4RTLA 1P6QA 4TYQA 5K3CA 3U1BA 2KI5A 4ZOLA 3JQFC 3DOJA 3JQBA 3TRDA 4EMSA 3EC1A 5ICCA 4HDRB 2DKOA 3IVGA 3GHHA 4CU5A 3C3WA 3BKXA 1EFUA 1G98A 2BTOA 2Z1DA 2W2LD 3K09C 3OWOA 4MLCA 5FA8A 3J81A 4WLVA 1Z4OA 4N9WA 1WB4A 4WADA 5IYZF 4B1FA 4JI0B 3AESB 2FX2A 2O05A 3KB2A 1PL0A 1HYEA 3H1FA 4N8SA 1QK4A 1PKEA 2RFLA 1U28C 3DL4A 3G8CA 4P2BA 1P39A 4QXAA 5FOXA 1NI3A 3DHVA 3KSUA 5EUCA 1X7XA 5FFFA 4JAVC 5GVSA 4UHJA 5D6NA 2J4DA 1C30B 1JMYA 1R37A 3FHOA 4NPAA 3TO5A 3GRKA 3UPDA 4LOLA 4P32A 2P5SA 3B3AA 1JTEA 4S24A 4UVEA 4P0QB 2NUAA 2EKDA 4FFLA 3FPCA 4B3DA 2Y4NA 5K3OA 1WTAA 2Q27A 3MWJA 2O5EA 4XUEA 1I7NA 3EIFA 3GLGB 1E7SA 3VSCA 2WPDD 3OQJA 4F3NA 4FYPA 5FOSA 2OV2A 1OI4A 1SQ6A 4MH0R 5A04A 1T2AA 3TUJC 5B55A 4HJRA 5E3HA 1GPMA 5T8KC 4NU0A 5KYKA 2FPKA 3BMXA 3RC9A 4MV6A 2OLKA 2D7JA 1IEQA 1I2MA 1RT9A 1SU7A 2NVBA 3OFSA 2EX1A 2QHXA 4IXWA 4KDRA 3SEZA 3GFFA 2X5JO 4KO8A 5L8VA 2IHZA 1RRPA 3K9QO 3TIFA 1DX6A 3ZWVA 4EF6A 5GQSA 2PXAA 5JI2E 4RJ2A 4Y6SA 1G7TA 4I6JA 4R8SA 4JT8A 4YECA 5H82A 2X3UA 4FMCB 3ESRA 2ZI7A 4OJNA 4H4DA 1S4MA 5K8UA 2YS6A 5AVOA 1JMVA 1TZMA 1YK1A 4G8DA 4OQNA 3C7TA 2Y2UA 3OQIA 2NZ8A 1OXXK 2ISSD 4UU0A 1YR1A 2OM6A 2AX4A 5I5EA 4FDVA 5FWAA 1R4MB 3OX2A 4I5DA 4QDJA 5CBKA 1FUEA 1AK1A 3TF5A 2V7BA 5EHNA 1LBQA 5CCDA 3WQHA 1XB2A 1YRWA 2HBYA 2NUBA 3AM4A 3RS0A 1CVLA 2H52A 3RYCB 2YJ6A 4DIDA 2PRJA 2QNRA 3F3MA 3R3ZA 3PE6A 3QG1A 4L4RA 4ZQFA 4JI7C 5A05A 3T1QA 4EGCB 1GP2A 1O6ZA 2PUJA 3FFBA 3PXUA 4DIFA 3UAWA 2FQQA 4HQRA 4NABA 4OQLA 2OG1A 1G21B 2Q3HA 4UAGA 3ROGA 1Z6ZA 2EHJA 4L76A 4E2YA 4ZVPA 3ZGOA 2OGZA 1O0SA 1TQ4A 1L9XA 4QEDA 3CH6A 2G88A 3A1VA 4DIKA 4HB3A 1M7GA 1GCGA 3X44A 3HCDA 3IBGA 2GD6A 4IQ0A 4MW7A 3DWGA 4JSRA 3SC3A 1C9NA 2GA9A 5FCDA 2YHUA 1SXJB 4BKRA 2LIVA 3VYRB 1SKYE 4JLOA 3W4IA 4BGUA 1EB8A 1XS3A 2JA2A 4HNVA 4M0CA 4RD2A 4QZVA 2EFYA 2V4MA 2W0SA 2WYVA 1ML8A 3JWIA 4PRLA 4H6XA 2R1VB 1DTWB 1JDPA 1USVA 1VSBA 3NWBA 3AY3A 4JQSA 5FOUA 4LHVA 2D7DA 1J22A 3RR2A 1QHIA 2VA9A 3R7WB 4D9CA 1O0BA 1UZAA 2QJOA 3FDZB 1XZPA 3WQBA 3AETB 1R8JA 4K3VA 4A8JB 3CFYA 3EAFA 3O4GA 4QBFA 2VL7A 5CX1A 3STWA 4I50B 1X38A 4QTTB 5AD1A 4AMVA 1G6OA 1PS9A 1RJEA 2O2SA 2GSWA 2VNKA 3EEOA 2OO5C 9ATCA 1YNOA 3MJFA 3C3XA 4CEIB 6AT1A 4WKGA 3LPDA 4BVBA 5A7FA 1U2SA 1ULZA 5AJVB 3V4ZA 4ZTZB 2IIPA 3IT3A 1L8XA 5HRUA 3N58A 5JCOA 2PXXA 2RHBA 1TT5B 3FTQA 1I1QB 1A2QA 2F64A 4NOMA 1DO2A 4TROA 1O8CA 1Z7WA 2ZRLA 4RVUA 1G20E 1DIAA 3KHUA 4MO2A 4B43A 4DV1C 3CEPB 4DT1B 2JIPA 3GEGA 1VDMA 5BSVA 1LWOA 4N3AA 3T9BA 1CE8B 3W6NA 3F73A 1EM8A 1MXFA 3DO8A 3PXCX 4LRUA 5IJ0B 1DNPA 1FK8A 4ZRNA 2R6JA 3KB6A 3FDJA 1BHO1 1QHYA 2JEYA 3PCXA 3PQCA 5H80A 2YDXA 4ZV7A 2XTAA 4G5SA 1RPTA 2OWEA 3CUSA 3IIMA 1VL8A 3PQ4A 1XK6A 4LXXA 3RI3A 3UY4A 5GIOE 1ZIPA 2YJ5A 5KAMA 1IN1A 4KDFA 2ZB7A 5TR9A 5A6VA 4FYJA 4A0HA 3X1MA 2YN0A 4P83A 3JQ6A 4CCSA 2FSVA 2RGDA 7ADHA 2WNSA 1Q20A 1ZN2A 4N03A 3R8FA 4ED9A 2P9HA 3N3BC 4F8YA 2GCOB 2Z1NA 2Q3CA 4RU1A 2JHGA 3HYSA 1NKSA 3P97A 1FUIA 1YR7A 1JIQA 5EMHA 3TLAA 4AK9A 1RBQA 5DYWA 4HNAB 1DG3A 1F9AA 1WY5A 2XCUA 1AKUA 3L18A 3KJEA 3N3AC 3SCZA 3A9SA 1PG2A 1RS0A 3LQ2A 4XEHA 4YP1A 3T3IA 4JI2B 2P4HX 1NYRA 1QQ5A 3JQ8B 2P2BA 3QNMA 1CX9B 3BXPA 3PTAA 3OFJA 1VIDA 3V8VA 5LP6B 1CIVA 4FMBB 3NQ41 4TGLA 1R8SA 2VDJA 4CDRA 4L5AA 3B82A 1JXMA 1KZHA 1BX1A 2PJZA 3E18A 3DHNA 2ZYHA 4RWEA 4G37A 2HWUA 3TOSA 4CL3A 3QA3E 2Z3VA 3FTPA 4CKWB 2QQGA 1O94A 1QO9A 2DBRA 3F47A 4J75A 1PR2A 1KEEB 4R1TA 3LBIA 3UOAB 7MDHA 4KR7A 4DR7C 1C0PA 1OZFA 3OZTA 4M6WA 1Y33E 2Q28A 4RY2A 3PLRA 4W8GA 3RIHA 4ER5A 4YUAA 2EQBA 2IYUA 4K7JA 3DAHA 5LZ5A 2CV2A 2WLTA 3QVOA 2FVXA 4KXMA 3DV9A 5AR1A 3DP7A 3ZV3A 3SU8A 4NJMA 1DAIA 4DKXA 1YRAA 5AK5A 2YIDA 4TS1A 5B1EA 3GPBA 4E2ZA 5LCIA 2AF4C 2B69A 3V3TA 1TEVA 4IGFA 1SWWA 4GO1A 2Z6AA 1DJNA 5BWLA 2FZVA 3RV2A 1T4DA 1ZH6A 4DV6B 1E60A 5AW1A 1H65A 4NQRA 2JFYA 2D1TA 4QDOA 4CPDA 2ASEA 1QFXA 4E6PA 4A10A 1EFPA 2P69A 2X19A 2RSLA 3ML1A 3RAGA 3W8DA 4Z51A 2C07A 2ZYWX 1FFHA 5EL0A 1TMYA 3TCNA 2EU8A 1PJZA 3KOUA 4YRZA 4LF8C 1G8HA 2BFBA 2QTZA 3D8RA 5J43A 4HGOA 4JOBA 2JNWA 1X7XB 4ZHQA 5B6PA 3O0DA 2G67A 1L5SA 1IFXA 1SBNE 4KXWA 1L5MA 4G4GA 1M2FA 3REFA 1RXCA 3H1TA 4HPJB 2WAYA 4J49A 4ZQBA 3EDMA 3EDQA 2YTZA 3RKRA 1CFZA 1ECFA 1RXUA 1EFVB 2BKAA 3Q2KA 4LMBA 4O8CA 2LIPA 4UTXA 3F6CA 4WASA 1K92A 1MV5A 2ECPA 5CT5A 5DLQC 3QEOA 3U9LA 5BWCA 5JSYA 7REQA 4L72A 5LQNA 2CVFA 4WK6A 3SIRA 1SCUB 1OU4A 5A9RA 1R4AA 2IHUA 3ZQUA 1FB5A 5B58C 1QF6A 3AMVA 1A9OA 1DKPA 4DC1A 4Q9HA 3R5TA 4C29A 3FE2A 4YLYA 2LXNA 3HJNA 3AI1A 2O57A 2QRKA 2RGBA 3K70B 2GJ4A 3M6XA 3ONVA 4U7HA 5LBIA 3WL6A 3K70C 4ZCTA 4ESVA 1UT6A 5B7NA 3A7DA 4N8DA 1VKJA 1ZSVA 2BZ1A 2H1RA 2Y9PB 4PS0A 4WBSA 4EPXA 2WINI 4J0HA 1QRTA 4WSOA 1I4TD 3X1YA 5D7BA 4GBMA 2AFIE 3BS4A 2J0SA 4N18A 1AKRA 2MYNA 1W5TA 2WTNA 1FNBA 1NWCA 3EQ6A 1DAPA 1EDEA 3WIVA 3R0VA 2H1CA 1ZW6A 1TCAA 4CR7A 1TA0A 3AZOA 3HDGA 4ZO8A 1PJ3A 4GXQA 2XCLA 3PUKA 1XTTA 5L4NA 1LXCA 3IE2A 2Y0PA 4V2UA 5CH8A 4YWJA 4EJSC 4ESHA 2JI4A 3TLZA 4IDNA 3UEBA 2C5EA 2J3QA 2PNFA 5DEOA 4ZC1A 5TPWA 1RQGA 3D6VA 4V0KA 3ZGXA 5IZ4A 3T0GA 1SVSA 1UKEA 4INAA 3FTNA 4L4XA 4QQNA 4AZ3A 3PEYA 1I9GA 3NEYA 2Y3IA 2CWWA 1QDLB 2I78A 1J20A 3W6ZA 1Y9AA 2B20A 2C9BA 3LIPA 4RABA 4KU4A 1B43A 1XTPA 2M6RA 4HDNB 4MVJI 4Y2SA 4EW6A 1TU3A 3K5WA 2JBAB 2P91A 1LJUA 2GPNA 1PR1A 3AHJA 1FVHA 3ECCA 1KTIA 3ZJ5A 2EDCA 3JAKB 3IFSA 1YVDA 4DANA 3P96A 3DNMA 4H77A 3HJTA 4RAQA 5FHRA 3L9XA 2BF4A 4LJ5A 4MB6A 3IPAA 4IINA 4Z0PA 3TSOA 5JYCA 5K6RA 3PRHA 5KTTA 3TXYA 1F8XA 5KHLB 4P93A 4F85A 1X1AA 2BEUA 2GN4A 3E22B 1XOIA 1E9VA 3QE2A 3LC0A 4GKAA 4KGVA 3AILA 4MB2A 1CF9A 5FULA 3V80A 1M7HA 5B37A 1IOLA 5JNRA 4KXVA 4OYCA 2VN8A 2H2IA 1XMOC 2WF9A 1OMOA 1TFRA 3LDFA 4UMDA 1GGKA 1OR8A 2CLDX 2O8VA 3BZUA 5I8ZA 3SS8A 3SZMA 1TTTA 2GBIA 2HCRA 4B6OA 4P5DA 1WAMA 2RH4A 4D4JA 4BGDA 4IGKA 2I7CA 1U5BA 5K8LA 4C7JA 1GUFA 1SCKA 3EJ6A 4OHFA 1H1LB 1NDUA 1DIOB 1HLFA 1NOKA 3AR8A 3OOEA 1G3MA 4FFMA 3MK31 1OH8A 2GHQA 4RK0A 1NKTA 2O1WA 3FTEA 5IKXA 4CLDA 1S5PA 2BPOA 2FPMA 4KRGA 1DT5A 1RFGE 3WYDA 1H1LA 1OXVA 4R84A 3TLKA 2QD2A 2NUPB 3T3EA 3K1YA 1QGUB 4R2MA 1JTFA 3STHA 9LDTA 4KR2A 1QGZA 1SHTX 4EG8A 2ZIZA 3I30X 1CRWG 2RH5A 3JPWA 3Q7EA 1MC1A 3EXEA 2E1PA 3V7NA 4C43A 1PX2A 4MW4A 2ZU6A 2F1KA 3EFOB 3IP3A 3CLTC 4XB1A 3PNLA 2FPOA 4IICA 2R4QA 4DT1A 3VHXA 3AI3A 2IP4A 2N42A 3PNPA 1W46A 4NWIA 2WTAA 4YK7A 3G0HA 5HS6A 3DF7A 1C30A 3EISA 4DAEA 4KR0A 4H7DA 2OMKA 3OTOC 1C3LA 1FUKA 1GNQA 3L8GA 3VR4H 3HMQA 4PBSA 3F8WA 3O8CA 4CR6A 3ZHVA 2CKMA 4RKFA 3KKOA 3C8MA 3ROZA 5SZHB 3WRYA 4CM8A 1NVXQ 1N2XA 1BNCA 1EAYA 3L40A 1TW3A 4OMUA 5AVRA 2NO5A 1K2WA 3IELA 4XWKA 2AS0A 4CCYB 1XHLA 2NO4A 3QXJA 4ZDWA 1GHTA 4RD6A 4B8ZA 1W85A 5EJIA 2ZI5A 2R00C 3IAHA 3B13B 4LZAA 1HQYE 3C1AA 1LC0A 3KS9A 5IH3A 3TSCA 1J5EC 5IVIA 3CZMA 4L8GA 1VI2A 5HMMA 3LU1A 1EFDN 1Z5ZA 2PBZA 3SHOA 1SUPA 1ZH0A 4ZKDA 3DAPA 5HKKD 3CLSD 3T1HB 4YMLA 1O6BA 1NXWA 4NS1A 4D4HA 3RTBA 4TTVA 4B81A 3A9VA 1H93A 2VF4X 3S6JA 2QPOA 3JS5A 2Q1UA 5IMSA 3Q3GE 3HMKA 3VJMA 5E2IA 5ESRA 5KIAA 2A3RA 3WK6A 2I8AA 2ADMA 4ZYZA 1O7JA 4Y1RB 1NI4B 2WY2D 1L5WA 1SK9A 2MYPA 1AKYA 2REOA 3AEZA 2X6RA 4Y2XA 5BYJA 5KJ6A 2ZR9A 3RLIA 2C7VA 5CVDA 3ZNOA 1KVUA 4DIOA 5CEEA 1F1JA 2W2OA 1PVVA 3LF1A 1M34A 4KWTA 1E2HA 3LO5A 2ZYTX 5HG0A 2ZT7A 2Y1DA 1U0TA 5B2ZA 2ZBQA 3DLCA 2G1AA 3TQFA 3ZDQA 4GX1A 1QV6A 2QDXA 2OOKA 2PUTA 4HGQA 1OIWA 3Q87B 4CM4B 4D4LA 2WM8A 2O9JA 3CB2A 1UXIA 1ZXLA 3DYIA 3HJCA 3OP1A 2QXTA 2ZTMA 2PMDA 1S2GA 4D0NA 1JYFA 4K6KA 3SK0A 1EFCA 2QVCA 1U7ZA 4PBRA 3W5BA 4JJ7A 3OEED 2R6GA 3KKQA 3UX3A 1G3RA 1UAYA 3VR6A 1FL9A 1HDIA 2DG2A 5DZSA 3DCJA 3GLIE 2Y68A 5E6SA 2DPLA 1FOEB 4NZ9A 2GN1A 4V2IA 3ZK7A 3L8DA 4O2BF 3GEPA 1Z5WA 2R7AA 4BMOB 1N6PA 4LXUA 2CFOA 3DZDA 3IX7A 4M0LA 3MBIA 4MKZA 1DC4A 2HA6A 4B3SC 3CINA 5CG2A 3U56A 1X87A 5KJEA 1VB3A 2VJQA 2R1VA 2VUTA 4ZT7A 3CWQA 1N4DA 2OXCA 2ZR8A 1OBHA 5BT8A 5EZQA 3CEMA 3CT6A 5EYPB 1FMTA 4JBYA 1CUVA 4O4HF 1U3GA 1V9SA 4J16C 4LSMA 3RYFA 3BWMA 1USPB 4OH1A 1Z4LA 5A3JA 3AVUA 3T12A 1TVEA 1HH4A 3UWKA 1H69A 4OQXA 3JAWA 5A4KA 1NZDA 5JALA 1Y4AE 2J9FB 5J4YA 4QUBA 3AVYA 3KT0A 3C5CA 4WQMA 1ZMXA 4PYQA 2FPWA 3ZUGA 5T4HA 4AP6A 4YREA 4ZN6A 3AUUA 2GF0A 4F45A 5EZ6B 1JEYA 4BO4A 2HF2A 2HA0A 1FDWA 4U6QA 5NULA 4UNQA 2NTYC 1SGWA 2WU3A 1G60A 3QMMA 1AUOA 4IUCS 5DB4A 2IHJA 5JZBA 3J81k 2AQIA 2WNIA 1N2ZA 3GV0A 3ONFA 1PNQA 3WIBA 4MV1A 3MINB 4U1RA 4EFDA 2B98A 5I51A 4LRXA 1ZMOA 4QXRA 1MR3F 4PRKA 3PHCA 3L3BA 3RRYA 5HS4A 1TQDA 2BL4A 1E58A 3SBEA 3T0FA 2QKYA 1K08A 2CDCA 3C7DB 4P4SB 2B36A 3FIUA 1VPLA 5JRHA 2QUHA 2FSPA 2PGXA 2WF8A 3B1VA 2X7HA 3SNKA 4EEXA 3K2EA 5F33A 1G2PA 5JS6A 2PRKA 1DC7A 1MVLA 2O0LA 3A28A 3AH8A 3IOCA 3GT7A 3NYWA 4XVQA 121PA 4AO8A 5HRCA 3PX7A 1UEJA 4HLQB 2ADOA 1RMTA 3DUFB 1JHQA 3K32A 3MLEA 1US8B 1OKKA 3C8UA 1U2ZA 5AJZA 3UJAA 3DM9B 1NVKA 4LPSA 3QGMA 2QV7A 4WEOA 1WCJA 1LDEA 1IVSA 1ADYA 1TVKA 4JYZA 3QVXA 1HO3A 2AUNA 4B7AA 4TMXA 3ZWMA 4LWQA 4J0IA 4U2DA 1X70A<