3R9XA

Crystal structure of era in complex with mggdpnp, nucleotides 1506-1542 of 16s ribosomal rna, and ksga
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transferase/rna
molecule keywords GTPase Era
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 102
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3r9xA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9xA01
1W4RA 1IN5A 5KNBA 3A1UA 3T5GA 1II9A 2IYZA 2ZETA 2WJHA 1T5IA 4UJ5A 1HA3A 4JLAA 4CT5A 2ANBA 3DO6A 821PA 4X62C 4UNQA 5JBQA 4IVPA 1CEEA 2G0NA 3WRYC 1BS1A 1XWIA 2ZROA 4KFUA 1HNZC 1T5LA 4TT3D 3AVQA 3QKRA 2OV2A 4IEIA 3U3OA 2FV8A 2OLKA 1T3LA 1VKJA 1N0VC 2O8EB 4MTNA 3C8UA 3RWOA 4IFEA 5IRCD 3CBQA 3I3SR 2PH1A 4URWR 3SZRA 1EFUA 1Q20A 2HXYA 2QY9A 4C0BA 2J3EA 3LAWA 4BFSA 1MRNA 1SXJC 2ODWA 2QTHA 4Q19A 4BZXA 1ZUNB 3K0FB 3EASA 3MAAC 4XJXA 2VP9A 4LJAA 5C2JB 1T8TA 1GKIA 3MFYA 1JPNA 4LFCC 3PEVA 3DM9B 4KITB 5KUTA 1W4AA 3NKVA 4N3NA 1I2MA 5HKKD 2ZM6C 2IWRA 4M0LA 2CCGA 2OXCA 1T9HA 4DBLC 3BC1A 2CY1A 3EZ2A 3IQWA 1GITA 5CYOA 4IFBA 2F1RA 1UKYA 3SEAA 5DN6A 2QN6A 1E2DA 1BKDR 2BV3A 3IEVA 2ZI6A 4R7ZA 2JIZA 1QHXA 2ZANA 4JSTA 5FTLA 1KY3A 2Z83A 3B8HA 3ZH9B 4B74A 5JJKA 3D8BA 1FFHA 3GEEA 4LJ6A 4PO1A 1P5ZB 1W0JA 1Z08A 4B71A 5FR1A 3PVSA 3TR5A 1G7RA 2WKPA 3L8ZA 2UUBC 4B75A 4O3MA 1CJKC 3AGQA 1MO4A 4TQ9A 4ERNA 1CJVC 1WE2A 4MRNA 1TNDA 1WF3A 5FUVA 3BFKA 1NI3A 4F4JA 4DT1B 1PA4A 2BBTA 5SZKB 3GLHB 5JFGA 3BH7A 1Z2AA 2JEOA 3AF1A 4I1UA 3QPVA 4QRHA 4B47A 2V3CC 5JLJA 5LB4A 4JLNA 1JR6A 1GSIA 2QL6A 4G1UC 4DV1C 5KDDA 1YQTA 2OAP1 5LD2C 3KDSE 3KUDA 4MKFA 4YLGA 4PPQA 2O8BB 1E9RA 5L3VA 4JVNA 3TJZA 3LH5A 1E9FA 2MSCB 3K70C 4Q9KA 4IXMA 1VYUA 3ND9A 5E7JA 3R8FA 5J4HA 3C5HA 1KMHB 3R9IA 1G4UR 5CK5A 1U8AA 2R65A 3VR3A 1K0RA 1C4OA 4IDPA 1AIPA 2J41A 5L3QB 1VG1A 4HUTA 4ZI2A 3SOPA 4LJYA 3U7EB 3ADDA 4NXNC 4GOKA 2C9YA 4NCJA 1NP6A 4U02A 3VR2A 4RD1A 5L3SA 4B32A 2C9OA 2VP4A 1TQ4A 2C96A 2J45A 3NEYA 3ASZA 4Z1MA 2QORA 1JPJA 3KKMA 4HLQB 2XNDA 4A2QA 5KNDA 2QMUA 1BMFD 1JJ7A 1SVIA 2O8FA 2F7SA 2C98A 3BERA 4LJ4A 4AQYC 4U00A 4A0RA 2ORWA 5EE5B 2W6JD 3S1AA 4KAXA 5AWFC 2ZE6A 1CJUC 1P4SA 2ZSDA 4DLYA 3EIHA 1SXJB 3CZPA 1Z63A 1TL7C 4LJ9A 3CF0A 4KLZA 4FI3C 3AF5A 3VKHA 4PX9A 4Q7JB 1ZBDA 4L16A 2FFQA 4DVGA 4Q5IA 1WH9A 1YJ5A 2BKEA 1KDPA 1MABA 3O8BA 1GM5A 4MYTA 5J47A 5FL7A 2HHHC 5DI3B 1XB2A 1JECA 3A1TA 4M9ZA 4AKIA 4NCIA 2EVWX 2O5VA 2BC9A 2GJ9A 4DIDA 3V4FA 1X6VA 1S2MA 2GNOA 4LDJA 1OXVA 2BBWA 3KB1A 1J7KA 5FPSA 2OILA 4Q1DA 5JWRA 4PQFA 1OSNA 3DDCA 1KNXA 2FZLA 4WW0A 4H1UA 3N70A 3EC2A 2H5EA 1UBFA 3T12A 3VU9A 5JWOA 3KQLA 2Q9CA 2CL6X 1H8ED 5H70A 2G77B 4Z8XA 3NC1C 2IHBA 2GTPA 2ZYTX 1Q21A 2V6JA 2ZRBA 4JJKA 4QBIA 4TLDA 3UANA 2HYDA 4DSUA 5JRZA 3EERA 1QHHA 3DKVA 4TMTA 4YQFA 1XMSA 1NN3A 5FOWA 3JZMA 4LF6C 2HDNB 4HUQB 5LB2A 1L2FA 1QRAA 2RHDA 3D6TB 5C1BA 3QF7A 4PAOA 3UATA 2F3RA 1JNYA 2J0VA 5A0FA 2ANCA 3ADKA 4A8JC 1QF9A 2Q3HA 4AKGA 1HT2E 1DAFA 2QUZA 2QU8A 2FF7A 5FUXA 1RRGA 4N1AA 2FMXA 2WPDA 2WJYA 4BLQA 4B48A 1A2BA 1G8PA 1M8PA 2QP4A 2A5YB 1E2LA 2NO9A 3LVQE 3K70B 4I1SA 4NDZA 5K8UA 1E2PA 5SZJA 2BVNA 3CRMA 3GJXC 4I99A 1TF5A 2XOKD 3LW8A 4CDGA 3KTAA 4A6XA 4RY2A 5CIQA 3U3JA 1Y63A 1IAQA 3VR5A 5JCZA 1Z2CA 3LLMA 1X1SA 3BE4A 3W6NA 1S9HA 3U44A 4QHYA 1IBMC 1XJCA 1U94A 2ZE7A 1U2RA 3CX8A 1JR3D 3AVYA 5KYKA 3SC3A 4JI8C 1XU4A 4YHHC 4JI6C 2C03A 3HPRA 1R0XA 2FSFA 4EPYA 2JCSA 1XEXA 4LBZA 1S8FA 2C04A 4PSVA 5ELXA 4FMCF 1VCIA 1XJQA 3NBYC 2ATXA 2PEZA 4S35A 2ASEA 4TYQA 1GL6A 4BLOA 2V6IA 3EAQA 4HATA 2GVZC 2UUAC 2ODEA 1I94C 1XTSA 5JZVA 1VG0B 2XGJA 3FKSA 3BXZA 4ASUA 4YY3C 2Z4RA 3WY9A 4C0LA 3ICQB 3FKQA 1N6OA 2BEJA 2ZR9A 3H84A 4G5GA 4E07A 3F8TA 1VDZA 1E2KA 1EFRD 5JEEA 1GNRA 4GDFA 2IUTA 5L3SB 3CNNA 4LV5B 1XMOC 4BZPA 4E09A 4NONA 4XVRA 3BGWA 1E79D 2RHMA 1D5CA 1FP6A 3OZXA 5FPHA 3TRFA 5FPYA 1KI6A 2VBCA 2G9NA 4YMWA 4EFNA 3GEIA 4X65C 1XD8A 2P3SA 4MYCA 4OI2A 4X64C 2O8FB 1COWD 4LOAA 1L4YA 2F6RA 4DUZC 1BOFA 4RD3A 1MOZA 1G8YA 3GJ5A 4GP6A 2EW1A 3NH9A 3VX3A 2Q9AA 3ZDQA 1J8MF 2ZVQX 3PR1A 4OI1A 4M1KA 3H4MA 4LSGA 3LV8A 2UZIR 5DISB 3I32A 1XD2A 4WIAA 2WOOA 2ZI3A 1IM2A 3NHBA 3AVOA 2E87A 2HUPA 1F3OA 3CRQA 1IOZA 2RGDA 4TQAA 1HQCA 4TT3A 4KODA 5FUYA 2CE7A 2ZE8A 2DYKA 1R0ZA 4IOKA 5AJVB 3FFBA 1YE8A 1NL3A 1Z0DA 4OHYA 1C9KA 4R2IA 1PUJA 4RVCA 4A8JB 2ZAOA 2JJ2D 2VTKA 1W0KA 4EAQA 2VHQA 1OJLA 2RKOA 1CP2A 2ZSEA 2Z5FA 2AKYA 4LK2A 4QG7A 2UUCC 5J4KA 4Q1CA 2XTMA 4LBVA 3NIBA 4OHZA 4NHOA 3UG7A 2W0MA 2VHCA 1SKQA 4X8OA 2IYRA 2HXSA 3ZZUA 4LF7C 1EESA 2N1BA 3THWB 1QHHB 3ZJYA 1NBME 3FWYA 1HR0C 4IRUB 3KKPA 1GP2A 5FL3A 3U6BA 1DTSA 3CB4A 3NG1A 2H18A 4ZPXA 1XPRA 1H8HA 4LGMA 1KDRA 3K0AA 4V0KA 4OYHA 4ZCLA 3SBDA 2ZUCA 4DLSA 4DXAA 4M1OA 2WHXA 4P0TA 3G0HA 4PQRA 2BCGY 4OK6A 2Q6TA 1UDXA 1W1WA 4PC7A 4PO8A 4FD2A 1VIAA 2IYYA 1OFUX 4DHEA 4JI7C 2ZJ5A 1T4GA 1KI4A 2IF0A 3I92A 4M8NE 4Q1AA 2XB4A 5D3MB 2CJWA 5EP2A 2JLXA 3PUXA 3QEOA 3GLIB 3WMFA 1KK2A 3TUJC 4LJ5A 1MR3F 1WBDA 3EIEA 1E9BA 1NLZA 3WHKA 3TUZC 4L5BA 4Y0VA 1WP9A 3GKUA 4HZUA 4JJZA 2IXGA 3ZZ0A 1TEXA 2J46A 5GADl 2V1UA 1H65A 2YC4C 1RJ9B 2PMKA 1E4VA 1RE0A 4Q4JA 4LZZA 3AP2A 3U44B 2BMJA 2N42A 4P4SA 1ZM4A 4C9BA 2ZE5A 4ITRC 4RJLA 4CF7A 1VECA 4LFBC 2FEMA 3I73A 4CZ2A 2AFHE 4KFTA 3NXSA 4YDSA 2ZQ5A 5BQ5A 5K8TA 2F1IA 2IXEA 3FHCB 4PHHA 4LF8C 5KSZA 4DV4C 1QBKC 5EXSA 5J5CA 2OPLA 2CLSA 3RRNA 2JIZD 2PT7G 1N6KA 1TQ6A 4KBGA 4E03A 2JLZA 3D31A 3ONWA 5CB6A 4LHWA 3E2IA 2G3YA 3VHLB 3KJEA 1RYHA 3FHOA 1W0JD 1LY1A 1SVOA 2YVUA 3MWKA 4FCTA 2E5LC 4LWZA 4JYAC 4NTZA 4V02A 3A4NA 4QGHA 4IOJA 2QAGA 1NVVR 4ACAA 1N6HA 2FPLA 3ASYA 2JLYA 5B2ZA 4M1YA 4MKIA 3C5CA 4C0SA 4KXFB 1KHTA 1OW3B 5GVSA 1G5PA 2ZU6A 3KQHA 2X77A 3L0PA 1KI6B 2X19A 1G41A 5CJPA 4URUR 2XTZA 4BPBA 2IXFA 1G8FA 4B3XA 4MQBA 3RC3A 1M34E 2JLQA 1YR7A 3F5FA 3ZVNA 1OFTA 1XXHB 4C0QC 3MLEA 3O8CA 3PITA 4RD2A 5DYIA 3QXHA 3QI2A 5HCIA 4W5WA 3CPJB 3R8CA 5CITA 2O0HA 1OE0A 3E5HA 5KDOA 2AR7A 1II8A 3V9PA 1DELA 4IW3B 2P5SA 3P26A 4Q4AA 4CRWB 3CRW1 5FH9A 4DUGA 3TW4A 1JOSA 4DLZA 4KSBA 4TYYA 2I1QA 2PZEA 2WWFA 4JVLA 3AKYA 4Q9IA 2J0UA 5FTKA 4D4KA 3QBTA 1KJZA 4QGAA 2FEOA 3FOZA 2GKSA 4A0FA 1KDOA 3IGFA 3B5JA 2XNDD 4WBSA 4EPXA 1P2VA 2TMKA 1G19A 3BH6A 4WAUA 2H17A 1KI8A 2O8CB 4W9MC 4ZI3A 2CXCA 5DO9A 1AJEA 1NMYA 3AUXA 1KK0A 3LBNA 1P9WA 3LW7A 4BLTA 2XEXA 4EIWA 5TARA 1P9NA 4R71A 4UKDA 1KIMA 1Z6GA 1GAJA 1XCGB 1W44A 2NTYC 1VCOA 4ZKDA 4BFYA 3MWYW 1GNQA 3Q9LA 2E1RA 5AUNB 5C46F 1ZM3A 2RGBA 4HB4A 5G3YA 3ECCA 3KXKA 2CEAA 1B0UA 1NMZA 1VYVA 3GLGE 4QM7A 2GVDC 1A1VA 3MJHA 2ZI9A 3BAFA 2D4HA 3SFZA 2DBYA 3A37A 2EFHB 4Q4HB 3BK7A 4A0GA 4XTRA 5FL7D 3DKPA 4FCVA 2QENA 2WJJA 2ZYUX 3LUSA 2H8KA 4DUYC 4OHVA 4C0JA 2ZXUA 2AK3A 2JDIA 3LFUA 3QPWA 3HU3A 1Q3TA 5CYPA 3J80D 2WOJA 2ZVPX 3J81k 2VHJA 2XOKA 2J59A 2XJ9A 3GFTA 2F1HA 3KFVA 5ANRB 3FFAA 3W8RA 2UU9C 4BWYA 1T8UA 4PXAA 1CJMA 1UM8A 2W0SA 2EU8A 3A1WA 1MRSA 1LQLA 4NYIR 3T1QA 4CEHA 3RAPR 3LNCA 5AUQA 1K5DA 1ESMA 4URZR 4GKKC 3G5UA 3LA6A 1US8A 4HZUB 4M4SA 1G1MA 4B76A 2ERYA 4Q1FA 3BIFA 4GFDA 2C95A 3W5IA 4P3YA 3KL4A 2ZSAA 2RGNA 1ZUIA 2IS2A 1KO1A 5CIWA 3U6KA 2ASBA 1N2FA 3X1YA 5C4GB 3AKEA 3I72A 4C7OB 5FPTA 3KKQA 4GT1A 3B1ZA 1AS2A 3VAAA 3BD9A 4LYHA 3V00A 5JJIA 2JASA 1FTNA 2ONFA 5SZHB 3C7KA 1OH8A 3IQXA 4WXPA 4CIDA 4AI6A 1CULC 1I4LD 5FLXD 3OHMA 1T0HB 4KCGA 4TSFA 5FOSA 4NBSA 2GWHA 2OXRA 3K8YA 4TL9A 1J99A 5DHAA 3PEYA 1Z22A 4QBFA 1TUIA 3I8XA 3B1XA 2WPDD 1JQJC 1GL9B 4JMPA 2GRJA 3TH5A 4HB0A 1N6RA 5L8VA 3EC1A 1WA5A 1AS0A 3ZGXA 2ZYWX 1XNRC 4IHQA 4OQXA 4OK3A 1RC8A 1GWNA 3GQBA 2J7PA 5JJLA 5JWHA 1X1RA 2Q0HA 2QAGB 3PJRA 4R2HA 1CRQA 4HLCA 1U98A 3SR0A 1N5IA 2GJAA 3GLFB 4XWKA 2OAQ1 3VKGA 5EE1A 4BLSA 2SHKA 5DI9A 3VR6A 3AVPA 4GOJA 2NO1A 4YONB 4QHTA 1AK2A 4EPVA 4DDTA 1CF4A 3W3ZB 1TQ2A 2BBSA 4B2PA 3DMNA 3EZ6A 2QL8A 3K09A 5BN3A 1UADA 2YWFA 3LVRE 5DE3A 1CR2A 4LPSA 4F91B 5KTYA 5B64A 4KVGA 5JSZB 1G5TA 3IIJA 4DRZA 3B6EA 3M1IA 4MA4A 5KSPA 1A4RA 4ARZA 1UKVY 4UQOA 3GJ7A 3EX7C 2NO7A 5EZ5A 3TE6A 4HDCA 3QQ5A 2NZJA 1TTTA 2GZDA 3Q72A 1N3BA 4HB3A 1II8B 2BKUA 3FKSD 3N2IA 1Q3HA 4DB4A 2RGCA 1G20E 3Q8XB 1NKTA 3QEJA 3PIRA 4CW7A 2XR1A 2G88A 1LS1A 2DWOA 4KYIB 1G9XA 3FMOB 3PUZA 4GZLA 1W49A 4DDUA 4EKDA 1ELOA 4UNNA 2CHGA 4CYMA 3I5YA 4ILEA 1RIFA 4YMVA 2KSQA 1NSFA 1P75A 2GCOB 3KQUA 3QE0A 2JLWA 1NN5A 1E99A 5H8WA 1UKKA 1KNQA 3T1HC 1LF0A 2G1KA 3AB3A 2FSHA 4JL8A 3LWNA 2XXAB 4JI4C 1LB1B 3HJNA 3UIEA 1LVGA 1R4AA 1VLAA 1JB1A 2YV5A 1N32C 2ZUBA 3LRPA 3R7WB 1NRJB 1U0HC 4UNSA 4HAXA 1DVRA 3QXJA 1N34C 1NVUQ 4B3GA 4TWZA 3K0CA 3I5XA 2KI5A 4ZO4A 4YMSA 2D2EA 4CEIB 3SQWA 1NG9A 4FMCB 1IBLC 2FSIA 2NOAA 4EFMA 3PUVA 2IYVA 4LV8B 3I4LA 3DPUA 2CE2X 3AKDA 1E6CA 2KBFA 2GJ8A 4EJSA 1XTIA 3QY0A 4F4IA 1T0JB 4PHGA 2ZS8A 5EE3A 1XFAA 4A82A 4V0NA 3QBVA 1GVNB 2IX3A 1MO5A 4OJQA 1W0KD 3RABA 3ZVMA 1XZPA 2C9CA 1ZM2A 1R8SA 4JL5A 2OFXA 1N36C 3MJRA 2QZ4A 3KJHA 1FX0B 1IJFA 3BORA 2ZAMA 4LJ8A 2J0SA 2YWGA 1OPXA 1NYEA 2F55A 5EXTA 2AN9A 1KSFX 2QGNA 2RGXA 2XSZA 2QE7A 1FW6A 3JZAA 1KAGA 3IKJA 2O8DA 4LCBA 4HB2A 1SVSA 5UKDA 3KQNA 4LF4C 4CT4B 4BFTA 2DB3A 2GF9A 5SZIA 4L9WA 5F98A 1H8HD 1DAKA 2YOFA 1KTVA 1RFLA 1AM4D 2FJUA 3WNDA 1DADA 2HCJB 1M7HA 5IT9D 1CLUA 2FGKA 3LQRA 1IXZA 3GLHE 1HEIA 3MD0A 2QMEA 2D3WA 3PFIA 3SYLA 1IN6A 3AM1A 2PJRA 2BCJQ 3X1ZA 1U90A 5IK2A 2D74A 1II0A 2HJGA 2C5LA 3A58B 4POAA 4Q66C 1FPMA 4B44A 1VIYA 1CR0A 3QF4B 4II7A 1FUUA 4TMXA 1DG3A 2VLIA 4ESVA 2G0TA 2RMKA 2BMEA 3KB2A 3T61A 2MMGA 1F60A 2FN4A 3SJAA 3NDBB 1DEKA 3T34A 1JBKA 4D81A 4U5XA 2WV9A 4MYHA 1KSGA 3F3YA 4Q03A 1G7SA 2EFEB 1ZM7A 4JZKA 5CM8B 3RS0A 1E2EA 1YZTA 1P2TA 2P65A 1WBBA 3M6AA 2BWJA 3KUCA 3LXXA 4URXR 3GJ6A 3CIOA 3EPHA 3T35A 4R98A 3WNCA 5KSYA 4F93B 1Z5ZA 1JQLB 1MT0A 1OV4A 3WBKA 5EE9A 1MV5A 5TY0A 2UKDA 4YC7A 2W83A 3KXLA 4AYWA 3OTOC 4PZZA 5EP3A 2YYZA 4Q47A 5E7IA 5FBVB 4L8GA 3RS4A 1PV4A 4ZIRA 2PL3A 2PMDA 3TSWA 1W36D 1FJGC 3EA5A 3SN6A 4FN5A 4C4PA 2JJ8A 2VYFA 3CWQA 1VHLA 5FI1B 1AZSC 2W2XA 4DV3C 4OJKA 1FOEB 2PCLA 1SXJE 2DR3A 3HYRA 1OH6A 1XZQA 4M1SA 3B85A 4NOZA 1KY2A 2Q21A 2BEKA 3FE2A 4TLCA 3DZ8A 1UKZA 4W5JA 1AZTA 3NVAA 1ZU5A 3QKTA 4MRSA 3EPLA 1FMJA 5IHPA 2RGEA 1E2HA 3RSOA 1JALA 3F0TA 4V0MA 1Q1EA 1X8LA 2DY1A 5G41A 2CMKA 3WYAA 2WJVA 4B3TC 1EGAA 3ZS9A 4PZLA 2DHRA 1P62B 3WBJA 2JLRA 1TMKA 5EQTA 4OHXA 1BIFA 2PLRA 2QQ0A 1NVXQ 2RCNA 1P7CA 4IXNA 1E2MA 4GRAA 3VKWA 3SQXA 5EUQB 1QDEA 4PPGA 1G3IA 4DUGD 2CL0X 1P72A 1J5EC 1SGWA 4G0NA 5EJEA 1SVMA 3ZVRA 3RDPA 3QKRB 1TU4A 1Z06A 2ZRGA 3ZIAA 4NYMR 1ZIOA 5AR1A 2CK3A 3CZQA 2PBRA 4B6FA 1G3MA 4OHWA 1X3SA 2IC5A 1XDBA 3OIVA 3QOFA 1WXQA 2PX0A 2GXUA 2QP9X 4GMXA 2FH5B 5HE8A 4H1VA 1O3YA 4JLOA 3GMTA 3U5ZB 4D4LA 1P2UA 3OEEA 1N5JA 4FXPA 2IYTA 3ETLA 1JI0A 3IIMA 5F2EA 5KPDA 3VFDA 5HCNA 2R6GA 5M04A 4B6EA 2WICA 4I1VA 4TLAA 2IEYA 5A5GA 1W2GA 3ZVLA 1SKYB 1KKMA 2O8DB 5CJ2A 4AG6A 1OH7A 3CF2A 4F7WA 1QVAA 1G18A 5HPYB 4QNMA 5P21A 2GXSA 2IUUA 1KI3A 4MUBA 2ZIAA 4Q7MB 3ZS8A 2JLUA 3CRRA 3LQQA 2AKAB 2DFKB 4AIIA 2JDID 2CCKA 4QNRA 2FPKA 2Z6VA 4TZ0A 3AF3A 3NC0C 1DO0A 2ZRLA 4XD7D 3CKLA 4AYXA 3DZDA 4B43A 1YR8A 1XTRA 3H2YA 2F43A 2GA8A 3KKOA 3NDPA 5BYJA 3GJ0A 1Z8FA 3AGPA 1KK3A 4LHXA 4KFSA 4M9XA 2ZITA 2C99A 1HH2P 3GFOA 2NG1A 3L2OB 1M6NA 4FIDA 4QC2A 5JHGB 2AWNA 1ZB8A 2BBOA 2IK8A 1W5SA 2P67A 1RW4A 1ZINA 3THXA 1OFHA 2BM0A 2AD5A 4WOPA 1UFQA 5DYGA 2R62A 2GEUA 3CPEA 3MRSA 4TL6A 4Y0AA 2ZM5A 5FTNA 1E0SA 4DR6C 3T1TA 4TYWA 4KBFA 1XNJA 1D9ZA 1E94E 1USPA 1OIXA 4OI4A 4C2UA 3IPXA 4TSFD 2FWRA 5D3QA 4JI1C 1ZNXA 3IHLA 3I62A 3L0IB 4HYYA 1A7JA 5K8LA 4O2RA 2J87A 1ZB9A 4TMWA 5CDFA 5JRJA 1AGRA 1D9XA 3W3AA 4B3CA 4TZ6A 4S2EA 4PC2A 3QVUA 4OQNA 3HDTA 4IDQA 3SDZA 4UJ3A 1R5BA 1P2SA 3CNOA 4XSGA 2J7PD 3B1YA 1G291 1XCPA 3B9PA 4X8HA 2ZRPA 2UXBC 4BEJA 2Q9BA 1S4QA 2CXXA 1A82A 2FNAA 3EIQA 5AJZA 3WXMA 3Q7QA 2GJKA 4BFWA 2IS6A 4HLDA 1E3MA 4FINA 4BQSA 5E3HA 5C4MA 2GILA 3I1FA 4MGKR 2QI9C 4QJ4A 2CHQA 4B73A 3S1AB 2A5FA 2WIBA 2QSZA 2IS4A 1E0JA 3N2EA 2QMOA 3AP1A 4KFRA 2X8AA 3NWJA 2KZFA 2OM2A 5EP4A 4C0KA 1XTQA 3TAUA 4Q21A 1IXRC 5BW8A 4TMKA 2GK6A 3T15A 4AWXA 2ZI7A 1N25A 3FMIA 2WM9B 1MABB 1KZGB 4PANA 2P6UA 1NN1A 3R20A 1UKEA 3MSXA 5TVKA 1EX7A 1PUIA 2IYUA 4DV2C 4IVQA 4WZ6A 1SVWA 3ZLJA 3JVVA 3FGNA 3O8DA 4RCZA 2ONJA 2V9PA 2ZTSA 2GBLA 3B82A 2VL7A 2HCBA 3OIWA 4KU4A 4D0LB 2XZOA 4LHYA 1ZD9A 5F9FA 3KJGA 1J2JA 2WKQA 5BN5A 4W7SA 1YZUA 5DGXA 2NO6A 3TW8B 3SHFA 4DSOA 2HT1A 4N0DA 1ZNZA 3DOEA 3VU9B 2CCJA 2F3TA 3TBKA 1YR6A 1SVKA 2WSMA 4JVMA 4MKHA 1NJGA 1QHSA 2H92A 1P73A 3WRXC 3LX5A 1RYFA 4C0HA 1XBTA 1G64A 4X66C 4D0GA 2GESA 1NSTA 5AJXA 4O2LA 4DSNA 1G3UA 3BFXA 4A36A 1XMJA 4Q01A 4PQYA 4LV6A 1IJEA 2OCAA 3BH0A 4TMZA 3GLIE 3K9NA 4PC1A 2ORVA 4LF9C 3IEUA 1S96A 1F2UA 3SHWA 3RS3A 1TU3A 4DSTA 1VPLA 2EQBA 2GF0A 2OZEA 4QXAA 2F4VC 5FBWB 4D26A 1BO6A 5IT5A 3THYA 1TUEA 3MCAA 4EQ6A 1TPZA 4PHTA 2C2HA 1R5NA 2LKDA 3CH5A 4HLUA 2OHFA 3A1SA 1Z0JA 3C4JA 1ZCBA 3CWZA 4IDOA 1OB5A 3LXRA 1DOAA 3GD7A 4HAVA 3KTAB 3UKDA 3OESA 2BJWA 5KU1A 1CXZA 2OUKA 4E22A 2IYQA 3GLGA 4Q7LA 4G5RA 2H1LA 3BRWD 4QJ5A 4WZAE 1E1QA 1IN7A 4G5SA 5B30A 3U60B 1KI2A 2XZPA 4XWOA 3Q3JB 1FNNA 2VH5R 3PG5A 4JLVA 2B6HA 2XSZD 1XEXB 4X8LA 1ZCAA 2QE7D 1RKBA 3O47A 4GMDA 1AA9A 1OXXK 4EDHA 4V03A 1EX6A 2IT1A 2JJ1A 3A4LA 5FI0B 1R0YA 4JLDA 3WP1B 4IJMA 2QTVB 4TL7A 4ZCMA 1XD9A 3KKNA 1KK1A 3SFVA 5FPKA 3P4XA 2KB0A 4QJ3A 2QBYA 1Z28A 3CF6R 4HSEA 4Z51A 1SULA 4M1TA 5IK2D 2BOVA 2DWQA 4NKRA 1G16A 3ADBA 3EPKA 4PHFA 2AWOA 3CPHA 4KHZA 1K5GA 4LC1A 1CTQA 1XXHE 2I3BA 5KDLA 3GJ3A 3EW9A 1B23P 3QG1A 1CRPA 1R5OA 2ZRFA 4DZZA 1IY1A 2A5DA 2Z0MA 2ZJBA 1KI7A 1Q22A 5EXPA 2A3RA 4YMUA 2WMNB 2P6RA 1KKGA 1D6JA 3AEZA 5E4FA 2LCFA 2WSSA 4GNKA 1RPZA 3CX6A 1FQJA 4PAMA 4BECA 1N0UA 4BSZA 5CM9C 2E8FA 1G17A 4EPTA 1L4UA 3NBXX 1XD2B 3RWMB 2QAGC 3LBHA 4DDVA 3CUEF 1DAEA 2VQFC 1XNQC 2OFWA 4TMVA 4GKJC 4EUNA 3DEFA 2R8RA 1A5TA 3RSLA 2W00A 4XVUA 4BRWA 2GEDA 3WHLA 3K9LA 1GKUB 1Z6YA 4RKFA 1TQDA 4CVNA 3OIYA 5FFMA 5DSZA 1L7VC 521PA 2GJSA 3MMPA 1N5LA 3RS2A 3WMEA 5EE0A 1NLFA 2REOA 4BLRA 4AYTA 1YHNA 1C1YA 2CVHA 1YZGA 3BWDD 2JAQA 5DLQC 3AVTA 4AC9A 4DLXA 4DR5C 1IBKC 3OFNA 4AKHA 1TF7A 1N6LA 4RZXA 4AY2A 5JHHB 3W8NA 1G3RA 1AQYA 1KO4A 3QSYA 3I07A 2R2AA 3WYFA 4US0R 2UXDC 5DHFA 2AFIE 4LHZA 1U9IA 2IW3A 3K0AB 5JS8A 2BJOA 1OH5A 4B2IA 3QG5A 2P6NA 1F2UB 4JI5C 2QT1A 4ZCIA 2XNSA 2YCBA 2CNWA 3IO5A 2H16A 2QRNA 1CBUA 1KO5A 2OCYC 3T1YC 1E4YA 1R0WA 2ZEJA 4QOSA 4XD7A 4YMTA 2CJWB 3EZ7A 5C18A 4ON9A 1D8TA 3ZIAD 4Q48A 1R2QA 2CK3D 4L15A 4PAQA 2RH5A 4NYJR 4DV5C 5JCPA 1GUAA 2ORIA 2WWXA 2PCJA 4P4TA 1ZC4A 2O0KA 3IILA 4XIGS 4F4CA 3CJEA 2ZRMA 4Q02A 3AVVA 1IQPA 3SJBA 2O8EA 4JYCA 3L43A 2FFAA 4Q4JB 3U3KA 5GJWC 4Q9JA 3OEED 4A1FA 1QVRA 2PX3A 4RFVA 4YDHB 2XZLA 1UBEA 4P4SB 1DAHA 3TVTA 4J0QA 2KJQA 1KKLA 4AKEA 3OEHA 5DH9A 1GDDA 1HH4A 2X2EA 3QIAA 3T1OA 4KHPC 2ZRAA 4PO9A 1HY3A 1NVWQ 1PZNA 3D3QA 3OAAD 3W6OA 4DV0C 1JJVA 5FTJA 1F2TA 4JI3C 1NF3A 4JBYA 4LY6A 4IDNA 2OPLB 3SI7A 5G3ZA 2C78A 1E9AA 2ZJAA 4OQMA 3DOFA 1X86B 3GLFE 1KI9A 3FMFA 1IN4A 4V0LA 3TIFA 2VRWA 1UPTA 2EGTA 3TMKA 3QKUA 1KJYA 1VMAA 4RFSA 4AURA 5J4LA 3HYTA 1W36B 4QBHA 1GKYA 2REBA 2RGNC 5K8IA 3EA0A 3IBGA 2IS1A 4JI0C 5AK0A 1NY5A 1IXSB 2XAUA 4C2TA 3C41J 4KI0A 1NBMD 1S1CA 1AKEA 2GDJA 4I1OA 2FFHA 5JEDA 4EPWA 2WWHA 2P2LA 2B8WA 4MRRA 5HTKA 3EWAA 1OIWA 2ZSFA 1WMSA 5JI2E 4FWIB 4B3SC 4ESHA 1E2NA 1UF9A 2V1XA 5DIFA 3B78A 4BEBA 4KV9A 2OBLA 3PENA 3FPAA 4B3BA 2BIFA 2AHOA 2P0EA 1PJRA 2V55B 2IYWA 3VNUA 1E2JA 1G21E 1OYWA 1OB2A 1YZLA 2WWIA 4PFSA 2VF7A 4YXWD 3FDIA 5CLQA 1EFHA 1RZ3A 5FBLB 1NN0A 5F3WB 2O8BA 1V43A 3QKSA 4Q00A 4PSKA 1U0JA 4E5UA 5FUWA 4Q4AB 4RKEA 2HLDA 4FMDF 4I4LA 4B35A 4RD4A 1P9RA 1GNPA 2GK7A 4DLWA 1KOFA 2L0XA 1NVVQ 5KPJA 4US2R 1KMHA 4RD6A 1DO2A 1XCMA 2ATVA 4TYPA 2VSFA 4US1R 1Z6XA 2J0UB 3N5CA 4JS0A 4M9QA 4NE2A 3PQCA 5G53C 4P32A 3C15C 2IWHA 4MUAA 2EYQA 3K09C 3B1WA 2FOLA 4JLMA 5L3QA 3W9YA 1T6NA 2D7CA 3IHWA 1NMXA 2VQEC 2J0QA 4JLKA 3K0EA 1KI1A 3TNFA 2ZS9A 1ONBA 3ICEA 2ZJ2A 1HT1E 4G5QA 4LHVA 3U7GA 4GI7A 5LMUC 2ZYVX 1WB9A 3IUYA 2QRZA 3LD9A 2QM8A 5CLLA 3X1DA 4RCYA 4PSAA 1Z0IA 5A2QD 2VP5A 2ZJZA 2Q3MA 2PN2A 1ZUHA 1QHNA 2VSXA 2GAOA 5AJYA 1K6MA 3AVXA 1NIPA 2OCPA 2G83A 1HE8B 2WAYA 3CNLA 3RRZA 3AVWA 4ZV4A 3NTUA 1KZ7B 1SXJA 4HAZA 4TTRA 4OBEA 3OE7A 1ZAKA 221PA 2RGAA 3L0OA 3I8SA 1U99A 4DLUA 4Z8YA 1ZD8A 4DR7C 2JA1A 4BZQA 3ZYCA 2J5XA 3SYNA 1HNWC 2I1VB 4P33A 1JR3E 1SVLA 1N33C 1EK0A 1R7RA 1WQ1R 2IYSA 1KJWA 3GEHA 4XSHA 2PT7A 3RYTC 3FVQA 4M9SA 1MO3A 5DI3A 1J90A 2MMCA 4DIEA 5B57C 4CEHB 4PR0A 4K8OA 5LBIA 1CKEA 3U7HB 1US8B 1XMQC 1NLYA 2ZJOA 2G1JA 2JATA 3K0CC 4TTQA 1Q1QA 4XOIA 3AQ4A 4CGZA 1OYYA 3B13B 1QZXA 3TGPA 2YOHA 1G8HA 1OXSC 2UXCC 4KO8A 4HAUA 4BGDA 2AXNA 5KHOC 5FTMA 1JXOA 5IWAC 3UK6A 5KO2A 3UWOA 4EJSC 2A7QA 2ZRHA 4TN1A 2HEIA 4LRWA 1F5NA 1QG2A 1VCMA 4WVFA 1F2TB 1TF2A 1OXUA 1HUQA 2P5TB 3AP3A 4PC3A 2HJVA 1F48A 4UXIA 4BFVA 4HUQA 2R9VA 4GP7A 3QXSA 2R6CA 4A9AA 3UMSA 2NPFA 1XP8A 4NYIQ 4NCHA 4NYJQ 1E2GA 2YNMA 3A8TA 4RFSB 2W6ID 4P31A 2CDNA 1XTJA 3LBIA 4MDFA 1Z83A 3TAHA 1N5KA 2XJ4A 4ZDIA 3SYKA 4QFMA 1XMVA 1ANKA 2IA5A 4P4UA 3JAMD 2EWVA 2W2TA 2CHVA 4JV5C 2XTNA 3EARA 4XVQA 1ZW6A 1E1QD 4IOLA 2C77A 1DAGA 3GJ8A 1Z0FA 3U3MA 3B9QA 1IHUA 2OSBA 3EZ9A 4M22A 4D6PA 2R6AA 5TMPA 1Z6AA 4M1WA 4IEEA 1HYQA 3U61B 3KX2A 4OX9C 3PXGA 1BH2A 3RC8A 3RLFA 4ARZB 5J4YA 621PA 2QM7A 4WZBE 2IBMA 3FMPB 3W34A 2JJ1D 1MH1A 3SBEA 1G8GA 2DYJA 1R6BX 2VP6A 3CLVA 1IY2A 5EZ6B 1GRQA 2WWGA 2ZRIA 1XEWX 4IOMA 2ZR7A 4M21A 2GHIA 3QKSB 1SHKA 1NG1A 3PUYA 5TB5A 3VR1A 1S9DA 4LFAC 3TKLA 3E70C 2ZR0A 1HURA 1QHGA 2A2ZA 3EXAA 3VR4A 1LF5A 1S1MA 2NMVA 3GJ4A 1JAIA 3T5DA 4DCUA 1GG2A 2N46A 4KVAA 2XITA 2H57A 3P1JA 2CLCX 4PTLA 1HNXC 2A5JA 2Q3FA 2R6DA 3UMRA 2NPIA 2BM1A 2GEVA 3BB3A 2VEDA 3C16C 5LDDC 5BN4A 4B3RC 4C0AC 4TLBA 1ZYUA 3AH8A 4GBMA 2OEPA 2WBLC 2ZPTX 3WP0A 1LV7A 2ONKA 5BWMA 1RRFA 1OF1A 4GOXA 3CW2A 2OLJA 3WMGA 2JMPA 1E2FA 2DCUA 3LX8A 2WSSD 1IBRA 2QMHA 3RVBA 3CM0A 1G6OA 2X2FA 1MKYA 1IN8A 1G6HA 1VG8A 2AK2A 1Q1BA 3Q5DA 4MITA 3TR0A 4G5OA 4HEJA 2NIPA 1ZMXA 2QNRA 3SNHA 4FMBB 3SU8A 4OI0A 4DDWA 4DLVA 3WNBA 1U0LA 4DR4C 4TLEA 3QXCA 3D7MA 4BUJA 1OIVA 1PVOA 1ML8A 1X8JA 2FSGA 2VHTA 4JKIA 6Q21A 4B3FX 3LY5A 1CIPA 2D7DA 4IVRA 3PEUA 2C8VA 4EJSB 1KAOA 3QENA 4O0MA 3UMFA 2AX4A 4RZUA 4B34A 3UPUA 5GJVC 3G82C 3A4MA 5A4JA 1XMIA 3U4QA 1KO8A 1SKYE 2LWIA 2QQEA 5G40A 1O87A 2OG2A 3HU1A 3NEJA 4NCKA 2Z4SA 4A8JA 4EPRA 3OFND 4DV7C 1N6NA 1UBCA 1OHHA 1R10A 4DR1C 3NBZC 4QM6A 2EYUA 4AD8A 4BFZA 3BBPA 1YZNA 2QTFA 3HU2A 1ODFA 3DVLA 3OAAA 1VG9B 3P27A 2O0JA 2V7QA 3HWSA 1RRCA 5KNCA 2NO0A 1BYUA 1OKKA 2D7VA 1NNEA 2CBZA 2ZJ8A 3CH4B 3THWA 4LC0A 3OIUA 3MWJA 5H68A 4DC9A 2HYIC 1ZNYA 3FHTA 4Q4LA 1YU9A 3DM5A 4DLTA 3M0EA 2KWIA 2CLDX 2CNWD 3K53A 4G01B 1T3SA 4G3XA 2PJZA 3SE0A 1E0AA 4OK5A 3T1VA 3TSZA 2ZUDA 1ZC3A 2ZSBA 1Q57A 3MG9A 5EXXA 3K9HA 2GZAA 1CR4A 1DG1G 2B8TA 2HV8A 1TEVA 1NBMA 4MGZR 1M7GA 3RHFA 1FTSA 1XEFA 1W2HA 2DFNA 4B2LA 1XEWY 5D3MA 5CB8A 3AV0B 4DR2C 1I2DA 2ODBA 4A2PA 3H1TA 3CX7A 4PC6A 3GLIA 1EG7A 2ZS7A 1CU1A 3TSOA 1GL7A 3ZQJA 3EZFA 1FUKA 2FX3A 1XPUA 3QVVA 4K81B 5B58C 1IY0A 3ZQ6A 4BASA 3TUIC 4YXWA 1EFTA 1RJ9A 3OEHD 1UEJA 3KQKA 3K0SA 2W58A 1PLKA 4HAYA 3KXIA 4B33A 2ZJYA 2WJIA 4D25A 1DAMA 1K8RA 4MGYR 1TAGA 4ZIRB 4RZ2A 5AUOB 1DE0A 4XWAA 3Q85A 1X8KA 5FOVA 1A2KC 3O8RA 1UAAA 1XJ0A 2KE5A 5HR5A 3V4RA 1FP7A 4V0ME 2PLFA 2FE4A 3VQTA 4W5HA 2VIIA 4HDQB 5CK4A 4D4JA 2YC2C 4JI2C 5KOYA 1YR9A 1ZJ6A 1M74A 4UXJA 2VP0A 2ZI5A 3IO3A 2ATWA 4DKXA 4A4DA 4X8MA 3HP1A 2VF8A 1AQUA 2WKRA 2VHUA 2R6FA 2FFBA 2ZRCA 2WZQA 2LKCA 3R9WA 5JECA 2E9SA 1W46A 2QG6A 3MGCA 1DBSA 1U81A 2WWWA 1E9EA 1UJ2A 2R44A 3MWLA 4OQFA 4UNPA 1ZU4A 4HZIA 1ESNA 4UNRA 1YVDA 2BJVA 4FW9A 1XXHA 2QSYA 4D80A 2B92A 1RRPA 2HLDD 1VTKA 1U8ZA 2ERXA 2UVQA 3H0KA 2EFCB 1ZM9A 3B60A 4M2LA 3SJCA 1CJTC 4PZYA 2F9LA 3BB4A 4NZYA 1G7TA 2ZU0C 1VCNA 1EWRA 4EFLA 5FBRB 2PEYA 5HZKA 5LPNA 1KGDA 4ACBA 5LD2B 1FQKA 5GJBA 4LPKA 3L82B 4WA7A 2DFLA 1XRJA 3REGA 5FR2A 2B7BA 2J7KA 2QROA 1EXMA 4QGGA 3U4QB 3ZZTA 1R8QA 3E1SA 4V0OA 1HE1C 2QPOA 3TQFA 1S3GA 4RSGA 1W47A 1L2TA 2O8CA 2GBLC 3CRVA 3EG5A 1D2MA 1QG4A 3NHAA 4DCVA 1E1RD 1T91A 3BB1A 3FTQA 4DR3C 2ZREA 3REFA 3DHWC 5HKKA 1E2IA 3LO5A 1VHTA 4NH0A 2V8OA 1OFIA 2XX3A 1SXJD 2QT0A 4NYMQ 3OE7D 2I4IA 1IONA 1E9SA 2YJTD 3AUYA 2VA8A 4ZKEA 2W6IA 1PLJA 1T3HA 1P61B 3PCRB 1Q0UA 2J1LA 4FMDB 2E8CA 4R9UC 1QWIA 4B3MC 4Q4HA 1LS6A 1NY6A 1Z0KA 1J70A 1S0UA 2IEZA 3VX4A 3BJIC 4D82A 1UBGA 4BRUA 2F43B 1QHYA 2V4ZA 4XTCS 3K1JA 4FCWA 3SS8A 2VP2A 4JLJA 2WAXA 1GRRA 1RVDA 1CR1A 1TADA 2B7CA 2VQSA 4NCNA 4DWJA 1I4TD 5FBQB 3THXB 1KDTA 1W7AA 1GOTA 2EFDB 2JGNA 3TLXA 2QA5A 1VYTA 1AKYA 4B3DA 3HR7A 4QKQA 1L8QA 3AKCA 3RS7A 4D4MA 2OCBA 2WVJA 4A2WA 2AL7A 1XX6A 4UXHA 3GPLA 1D2NA 5AUPB 4HAWA 5CDFE 3KJIA 4LYJA 4MDEA 1USPB 4HLUC 4DB2A 4JKYA 5F9HA 3QUSA 4I81A 4K46A 3RRMA 5IDVA 4BLPA 4BFUA 2QEQA 3AF0A 2OFOA 4A15A 1N6IA 4C7OA 5FOTA 4TL8A 4JBWA 2IYLD 3PUWA 2IUSA 4DJTA 3X1WA 4L9SA 3VTKA 3R9XA 3X2SA 3KFXA 1KO7A 1N6PA 2BMFA 2YWEA 5DNYB 3IDQA 4C3ZA 4GSYA 4JSYA 4MH0R 5DN6D 4M53A 1OT3A 4LBYA 4NMMA 2FA9A 2ZRNA 1J8YF 2EFGA 3Q7PA 1Z07A 3B7GA 5TXGA 3J81D 2ZRJA 2ODNA 3K70D 1Z47A 1OXTA 1NKSA 2FGJA 2PZGA 5JS7A 1FNMA 8OHMA 2J9RA 4Q7KA 4CEJA 4DCSA 1W5TA 3QJYA 3WYGA 4AK9A 3GCGA 3GLFA 1FL9A 2OT3B 2EWWA 4LX0A 1BMFA 2CVFA 1G3QA 1W36C 4GPTA 4QGFA 2KBEA 4N0EA 3EPJA 2GCPA 4OKSA 2OBMA 1CS4C 2IYXA 2W6JA 2VPPA 5EP1A 4BFXA 3CO5A 4TYNA 4TQUS 4GZMA 2DWPA 3AF4A 2IF2A 1EWQA 5JSZA 4ZDKA 1D2EA 1LTQA 4ZDWA 2BDTA 1KMQA 4DCTA 1JAHA 2QPTA 3MUFA 1Z3IX 1Q12A 4JVSB 3ND8A 421PA 5HE9A 2A30A 3P4YA 2OE2A 1E9DA 5LMNC 4D0NA 1JXMA 1GRNA 4HDOB 4C30A 5FOXA 1E9CA 4MRVA 1DAIA 3AVUA 1E32A 1E69A 3CR8A 3A6PC 3CR7A 3UG6A 1LNZA 1NJFA 1FZQA 3TQCA 3VNVA 5IF9A 4Z1MD 1LFDB 2A78A 1LW7A 2QP3A 4NU0A 3P20A 4URYR 1V5WA 4KJZA 4O25A 2GCOA 1NIJA 1H8EA 1YRBA 2ECKA 2F9MA 2GAAA 5JMTA 1ZD1A 2YZ2A 5GJCA 4A0HA 2PT5A 4Q1EA 4KLNA 1Q44A 4MYUA 1KSHA 1G4AE 5FOUA 5E7MA 3HR8A 1EFCA 2XXAA 2NQ2C 1AS3A 4TTPA 3U3RA 4OL0A 1HQYE 2JLSA 1GIAA 2FG5A 4Q18A 2WIAA 2UZ3A 1YKSA 2X1VA 3R7WA 2FU5C 4IDHA 4JBXA 4BE7B 2YHSA 3ADCA 5GVRA 3THYB 4EQ6B 3NBFA 2RGGA 2RB4A 3U2QA 1MO6A 4JL6A 4AG5A 4Q1BA 4CEIA 1ZNWA 4JLBA 3H86A 1P3JA 4LUCA 1YZKA 2VSOA 1ZVQA 3KZ1E 1W4CA 2MSDB 2QAJA 4LF5C 3Q5EA 3RNLA 2D2FA 1Q1ZA 2OESA 4DLRA 3GLGB 1P6XA 2D62A 1SZPA 4Q9HA 4A6PA 3IBYA 2V54A 3DL0A 1U9IC 1U8YA 4PPNA 5JI3E 2YOGA 4NPHA 1OHHD 2CL7X 2Z43A 3JVUA 3K0FA 2IL1A 121PA 4GL2A 4JIMA 1SQ5A 1Z6TA 2H7VA 2ZRKA 3W90A 4LYAA 4A92A 4JLPA 4FWTA 1AGPA 1FX0A 5TDHA 2V7QD 1JR3A 1HTWA 1GILA 2ZI4A 5L3RA 5J40A 1F6BA 1OKKD 3K9GA 2WWYA 3UWKA 4U7DA 1ZIPA 1WCV1 4ABYA 4DEXA 3GFPA 4XH9B 3LLUA 3QXXA 2A9KA 1XPOA 1WDTA 3AF2A 1GFIA 3C14C 3U7FB 3RRYA 4F92B 2HF9A 1XF9A 3P32A 2E7GA 2QBYB 4DEYA 1YZQA 3PV0A 1N2CE 2IHYA 4Q9LA 1QHIA 2QGZA 4D2IA 1JEEA 4DCNA 4NXMC 2XB2A 1E0KA 3RANA 2GETA 2GCNA 3X1XA 1Y3AA 1E96A 1N0WA 2GXAA 2OBNA 2WJGA 1ZP6A 2HF8A 1TX4B 3TVDA 1JEDA 2D06A 4HI0E 4XX2A 2FPMA 1EFRA 2AD1A 2JLVA 4MGIR 1I4DD 1M7BA 2BMDA 3VMFA 1W48A 4Z54A 3THOA 2ZRDA 4H9GA 4MH4A 2MSEB 3QF4A 4DT1A 5BR8C 3GLHA 1G5RA 1WRBA 2AXPA 2HT6A 2K5UA 2B21A 3L0SA 3UXMA 721PA 5J4VA 1E2QA 2E8EA 1AN0A 1E79A 4NL4H 2WTUA 4CEJB 4URVR 4RD0A 4DV6C 1PLLA 2BHRA 3LDAA 1HV8A 1COWA 1M1YE 3DMDA 1BYIA 1GZSA 5EUMA 3EWSA 4QL3A 5BYKA 3L8YA 2Y8EA 3B2EA 3VHXA 3W5JA 5KSOA 3IIKA 4LJ7A 3W6PA 1FMLA 4JT2A 2FDCA 1DPFA 3A1VA 5HZHA 2WMOB 2YINC 3AF6A 1DARA 1M2OB 2QPAA 1KSJA 4LBWA 4K0KC 3PEWA 3FB4A 1Z29A 3IPYA 3QNUA 1G7CA 4NP6A 4L4UA 1S3SA 1GTVA 1E98A 4M1MA 4QHSA 3BOSA 5TV2A 1Z0AA 1DS6A 4QBGB 2RAPA 2G6BA 3NH6A 4MRPA 1ZRHA 4ASUD 3A36A 3TK1A 3RS5A 1OLOA 4MKGA 2REXB 2W2VA 1KYIA 3BS4A 2A5GA 1YRAA 3HPQA 4KYUA 2JJ2A 3T06B 3SJZA 2O52A 4JYBA 2VO1A 5E95A 4F38A 5AJWA 4IKEA 2FZ4A 2PZFA 2DPXA 1P60A 3OF5A 2GXQA 1ETUA 3QPUA 1UDWA 4LYFA 1E1RA 4OQLA 2F1JA 4ZDJA 3FYHA 1UEIA 5BXQC 5H1YA 3CONA 4PPFA 3I61A 4JT4A 4RZ3A 3ZD7A 3ZD6A 1SHZA 4WXRA 2OO7A 3B1VA 3M4YA 4KSCA 2GZHA 2YWHA 2NGRA 4LI0A 3GP8A 3BFVA 1XTKA 1W4BA 2DFTA 2NZ8A 2YKGA
chains in the Genus database with same CATH superfamily
4NFYA 1ZD5A 1II9A 2IYZA 2ZETA 4XFJA 1HA3A 1Z2OX 2G17A 1E5DA 2R85A 4X62C 3KQWA 4JC0A 4HGOA 1XTTA 1J6UA 5JBQA 2G09A 1A5ZA 1CEEA 1DBQA 2WUDA 1FUIA 1OYOA 3PFWO 1XJWA 4PROC 3R6GA 5EHIA 3UC9A 5HW0A 4Z4IA 2FCRA 1XWIA 5AW3A 3BL6A 2BEUA 2HL6A 1T5LA 3QKRA 2OLKA 3ENQA 1U3DA 5CB4B 4MTNA 2CXPA 3C8UA 4REQB 13PKA 1M1UA 1XCLA 2WIKA 1O8BA 1D09A 3GWZA 3QVGB 3RWOA 1TZBA 1FY2A 5ICSA 2PGLA 2R11A 2PH1A 2DH5A 3EMVA 1EFUA 1YMVA 3SZRA 2J3EA 1T5TA 2HRCA 4C88A 1YCDA 1ST3A 2EWMA 2EQ5A 3E48A 4RACA 1EK6A 1XZJA 2VP9A 3HJAA 5C2JB 5KVSA 1L4KA 4I08A 1VPDA 1JPNA 2JGRA 2DT5A 3EJWA 3PEVA 4CQLA 1AY0A 4WNYA 5B7PA 7MDHA 5K03A 2PPVA 2ZFUA 1MENA 1NFRA 3RIHA 1I2MA 4F7DA 5HKKD 2ZM6C 5EJ9A 2GA9A 2CCGA 3BIXA 3DHEA 4NOLA 3L4KA 4U6SA 2Q2NA 1R12A 1VLJA 4L50A 3U9TA 1FDOA 2PX2A 4CKXA 1FXWF 3PFCA 1GITA 2XYPA 2W4MA 1HYEA 1HE4A 1YBFA 5LXTF 1Z13A 3SEAA 4O4LB 5DN6A 2YV2A 2FN7A 2BV3A 3AG5A 3IFSA 4ER7A 4G8DA 2X8JB 1B6SA 2JIZA 4PVDA 4BX9A 3A10A 5FTLA 1QRRA 3EZXA 2BMAA 1M2EA 1Y9JA 1G6KA 3FDFA 4FQ7A 4HNGA 4M88A 3WYDA 2FSSA 1T9DA 1RQGA 1XRPA 1XT6A 1ACMA 1GU7A 2I80A 3F8WA 3GEEA 3L93A 4LJ6A 3ZH9B 1Z08A 3N5KA 1GPJA 4FMPA 1NV8A 1RI4A 5FR1A 3PVSA 3TR5A 3IP1A 1EFPA 2DLDA 3L8ZA 3T7AA 3L0BA 3ZZMA 2HA0A 3L1UA 1CJKC 2UYOA 1VL2A 2B3TA 2QSUA 4TQ9A 3FI9A 4ERNA 4LXQA 4MRNA 3GT7A 5LZ5A 3B3AA 5JSFA 2Y1OA 3BFKA 5FWAA 3AYZB 4F4JA 1R6VA 2BBTA 3RFTA 2QR3A 1Z2AA 4XYMA 1VMIA 4QRHA 4GKVA 2X41A 3VAZA 5JLJA 2G7ZA 4DYDA 4E0BA 4OFZA 2YJNA 2ZW9A 3L8DA 1SHJA 4JR0A 3MGKA 4F86A 9ABPA 5K0ZA 1IJKA 1H2ZA 2Q99A 3KU4A 4G1UC 5JSKA 2Z6QA 2OAP1 1I30A 3L6CA 3KUDA 4MKFA 5LYJA 2JFPA 3ED1A 3LPLA 2HU5A 1J2YA 3AKZA 3HXMA 4DMFA 1D4ZA 3N3AC 1UZUA 2MDTA 3G23A 3J7TA 5F12A 1WSBA 1S2GA 3WG9A 1CFJA 3PGLA 5CDGA 1YB1A 1YS4A 3BXHA 3L79A 3WLIA 2R8PA 1KMHB 5JJCA 3FM9A 2YZKA 1KOLA 3OJFA 3T4UA 4ZGGA 3QFFA 3FIUA 3VR3A 5DNAA 2ACEA 2CYCA 1AIPA 2NADA 4HAOA 4C7JA 2EG9A 5F76A 3LZ6A 3QX7A 4HUTA 3FTNA 3A32A 3REQA 4RGQA 4MPDA 1P18A 5K4GA 3VR2A 2YW2A 4RD1A 4ZV9A 4B32A 2OCIA 3FCAA 5BSRA 1TQ4A 2C96A 2J45A 5T3YA 5T8KC 1FMFA 3ASZA 4W1RA 2RHHA 5LIPA 1YCGA 3GAMA 4HLQB 3RBAA 5BMVA 1FDUA 3FJYA 4BGEA 2A1TS 4RIEA 2R4UA 4RNCA 2EARA 2JFUA 4GEGA 1UP4A 1O0CA 1IBLB 1JJ7A 3D5EA 3FCUB 4K3VA 2F7SA 3WLKX 4OHKA 3C4QA 2QUKA 3PNBA 4AQYC 3NU1A 2WAMA 3TKYA 3FN4A 2H2HA 3W9UA 5EE5B 4FN4A 4D8WA 3G5MA 5BV1A 3IKTA 5EG5A 4E70A 2QN8A 3GVCA 5AHRA 5JDCA 3C3EA 3QELB 5HK9A 4AJOA 1RWBA 2FP4B 3CZPA 1TL7C 3JQAA 4LJ9A 4F6RA 1R9JA 2CDCA 4PX9A 2COUA 3LT4A 3LT2A 4OYYA 1KPIA 4Y6GB 2A0XA 4DVGA 4Q5IA 3SC2B 1DQPA 3WV4A 2BKEA 2Y1WA 3ILXA 1WQ3A 4TTVA 5LQRA 1MABA 1A9XA 1V1RA 4MYTA 3NYWA 4YACA 2YFKA 3PCTA 1ZOIA 3KR1A 4PLWA 1XB2A 3R3ZA 4E4YA 1F2VA 3A1TA 4CJXA 4NCIA 5LKRA 3G9ZA 1SXGA 1X6VA 1DG9A 2GD0A 2GNOA 2JH9A 3FFTA 4IPTA 4LDJA 3IAS1 4NFSA 3RBZA 3KB1A 1U2ZA 3LUDA 4ESOA 5J2TB 2P2DA 3M6WA 3GT0A 1FBTA 4RV5A 2AYYA 3K9CA 2EJBA 2FZLA 2HN9A 4N9QA 2ZLBA 2H5EA 2CXOA 1KQFA 2P90A 5JWOA 4GQAA 3I52A 3KQLA 5H70A 1H8ED 2WVHA 1PFQA 1YMQA 2DFDA 3BJZA 4Z8XA 1PKEA 3ZZ1A 2ZYTX 4JJKA 4WADA 2UUBB 1IRIA 2HYDA 5JRZA 3HCBA 2IP2A 1QHHA 5LA6F 1KYTA 3H5TA 3RF6A 2WA1A 1AUVA 2GN0A 4JJ8A 4YQFA 3AZPA 3JZMA 2YIDA 3RYCB 1SIWA 3H87A 5EIBD 2CLFB 2HDNB 4MR8B 1V8PA 5LB2A 1L2FA 2I76A 3IOMA 5K0TA 5C1BA 4G56A 2LDBA 1JNYA 1DWUA 3P2KA 4MS1B 4N01A 5FADA 5C5DA 1L7QA 1MG5A 3PJDA 1Y82A 1QONA 2K2WA 2Q3HA 1Z8DA 2EEPA 3IDOA 3PJGA 2QU8A 4HEQA 1CY4A 2KLBA 4N1AA 5HTOA 5F21A 1OX5A 1P45A 3HRIA 1YJXA 3DOJA 2PN1A 2D3TA 4DCMA 1D1SA 4B48A 1C0EA 4HGPA 4RK6A 4EUKA 2LR0A 5AIAA 3VDRA 2QP4A 3NP9A 3IBTA 4WI1A 5E6RA 4CE6A 4EYGA 1LFAA 2BCEA 4OATA 5CBPB 2YV3A 5K8UA 1E2PA 4BQFA 3OPXA 2EGUA 4CMBA 2VZ8A 4RVGA 1BVHA 3A0UA 2BVNA 3CRMA 1D2GA 3EPRA 1E3DA 3SQDA 4CDGA 4EB3A 4G5YA 2IPAB 3AMVA 3KJXA 1ZW1A 3KTAA 4J0GA 4M8IA 3SR3A 3HC7A 4YO7A 1IAQA 3VR5A 1H23A 1QP7A 4P4LA 1Z2CA 2F2TA 3UV7A 5ES4B 3D7KA 3VNSA 3U44A 3DCYA 1AVTA 2C3YA 3X3HA 4FC6A 4DLPA 1U94A 4TRJA 1KDVA 3ZG6A 1JR3D 3C43A 5K0GA 3E3NA 2FY8A 5KYKA 4JI8C 3AVYA 4EPYA 4YHHC 1GGFA 1I6WA 1R0XA 2FSFA 3F6SA 1JJFA 3HL4A 3HPRA 3L7YA 1XEXA 3KQQA 1UBJS 3H1AA 4LBZA 3G68A 4GGMX 2C04A 5D3KA 4OF4A 3JQGA 4LJKA 1DRKA 1XJQA 4UPVA 4DV3B 1VMEA 1ICEA 2CZCA 2C3PA 2PEZA 3H5RA 3HUEA 4JUAA 4BVHA 2BF7A 2RH8A 3KCQA 3ZR4B 1YOVB 2VXBA 1MC5A 3KDAA 4BLOA 5E2BA 3OJ0A 1OBFO 1L1RA 1GZHB 2ODEA 3C45A 5JZVA 4ASUA 2ACKA 4FS3A 5EMNA 4B40A 4C0LA 1PWXA 4E07A 3A3NA 1NXTA 4PM4A 3Q0IA 5C34B 1EFRD 2QW1A 3E5MA 3KV3O 4C05A 1MQAA 4DDMA 4ZMRA 3RS8A 2GPBA 4OXNA 3EGOA 5ESWA 4DANA 4MV6A 1I3LA 3CNNA 4RX1A 4CUZA 1E5XA 4HR7A 1RVV1 3TPFA 5ALIA 1BMDA 4FYKA 1D5CA 4AY3A 1KI6A 2VBCA 4QDZA 4EFNA 4BLUA 2PRKA 4UMFA 2P3SA 4G4GA 2G07A 4NULA 1QJCA 1WOYA 4KDRA 2B4TO 1COWD 2SKEA 1EX1A 3IP3A 5EHGA 3W2EA 1CZKA 2JJMA 4NICA 3W0LB 4L74A 5BR7A 1CSEE 1G8YA 4GP6A 1R4NA 4FILA 1NPDA 3OFSA 3ZDQA 1JQ3A 2ZVQX 4DAOA 4XFDA 1DWPA 1TTPB 5BSKA 4ALKA 3MRXA 4KQXA 5JANA 3HO1A 2W2KA 2W5UA 1PRYA 3OOJA 4OBXA 2CLIB 2XUPA 1NX6A 1Z17A 2XIQA 3H4MA 3JAWA 1H9BA 3IPLA 1RU3A 3LV8A 5DISB 3I32A 1KHHA 1V0JA 3JPWA 3ZCRA 1LNSA 2BFBB 2WM3A 2EDCA 2X8LA 3I05A 1HDZA 1C5KA 3WRXA 5JYBA 3VRHA 5BV2P 1DTWB 5KVQA 2HUPA 1KAMA 2VCEA 2PYIA 1F3OA 2V7GA 3CRQA 1JEOA 3Q7TA 5J59A 4C4XA 3GRFA 1DIAA 1JEYA 2VK2A 1C3EA 2DYKA 2O2IA 5AJVB 2AG1A 3I9V6 1NL3A 1Z7WA 4KDCA 4UAGA 4ZU3A 4F3NA 1C9KA 5BV7A 4BIMA 3DUWA 2C8LA 3EY4A 1O0SA 3UTDA 4H18A 3SO4A 4QU8A 5LCIA 5DKFA 1WNFA 2VHQA 3FPFA 4MYDA 1OJLA 2RKOA 3RUIA 1DWQA 3QNWA 3PVCA 3FUTA 2AKYA 4QG7A 2UUCC 5J4KA 3C5EA 4BN5A 4EG5A 5JAIA 4LBVA 2BFPA 2CZQA 2F1OA 3O92A 3TBHA 1BJKA 3D3WB 1PTJA 1N78A 3MC1A 3DEJA 4X8OA 1UBMS 2ABWA 2CFIA 2HXSA 3UMCA 4WBNB 3LGAA 2HSDA 3PR2B 4ZQIA 5J1SB 1ZH2A 4C01A 2WYVA 4F1KA 1GP2A 1SVNA 2QOEA 1DTSA 1OILA 3KV1A 2YW9A 3SS7X 4L2IA 2QTAA 4Q12A 5D00A 3D1VA 2QG4A 1IBMB 3HMQA 1IHYA 2BD0A 1URPA 5IUNC 1NZDA 4DLSA 2WD8A 2WHXA 1HFKA 2V5AA 4HDAA 4P0TA 4K9NA 4JI6B 1X1AA 4PO8A 2FPIA 1RQPA 2A9QA 2LIVA 4EB6B 5IT9A 4FD2A 4R84A 3AEQB 3P9NA 5AKEA 5A03A 2IYYA 3IALA 3VOTA 3I4CA 1XDGA 3I92A 5H4HA 5TGTA 5AI9A 4GECA 2GOYA 2PZBA 1SY7A 4KE7A 5D86A 1DB3A 3ZW9A 3L05A 1B41A 2RAFA 1L5WA 2D1TA 1GNTA 2AQKA 2D1FA 4XGNA 4QXPA 2JIQA 5CNKA 3HJBA 4Y0VA 4WNIA 4MPPA 2CJXA 2FUG6 1I94B 3A9VA 4ZT3A 2AMYA 5AOVA 1GJRA 3EEFA 4D4GA 1A9TA 2W2MA 1RJ9B 2YC4C 5ALLA 3J81A 3EVBA 2ZXEA 4RF3A 4ATNA 2XBMA 2O7VA 4HG2A 5GADl 4HH4A 2FEWB 2NVUA 3USES 1SBYA 1F0NA 3HNOA 2B2XA 1ZM4A 1JHDA 3L1KA 3OIGA 1OUMA 1QQ7A 1TFRA 2ZE5A 4CF7A 1U9JA 3I73A 4D9KA 3THSA 1EP1B 3G2OA 3NXSA 4RSHA 4YDSA 4BRZA 2ZQYA 3CE6A 2PX8A 1Z0SA 3FHCB 4LF8C 4WZAB 1JFSA 1TUBB 1QBKC 4C4SA 2Q6LA 1CR6A 2WFAA 5J5CA 2E0GA 4WY5A 4JYZA 1KJ9A 3MF4A 3RC2A 3DL2A 1TQ6A 5KTSA 1KMMA 4KBGA 5IC6A 2YRWA 3D31A 5JG7A 2Y66A 3W7VA 3VHLB 3WSVA 4ISCA 2VUHB 3KJEA 5IT4A 1JG3A 3JWHA 4GNRA 2H51A 1W0JD 3N2YA 1SVOA 2YVUA 4R2LA 3UJ3X 2E5LC 4UUBA 4EECA 2GBCA 2BE7A 5I7WA 3RTAA 1SU4A 4L7VA 4NTZA 4V02A 3GR1A 3P19A 1XG5A 2QAGA 4FEGA 4IOJA 2VDMB 3A6KA 1MHPA 1M8GA 1NVVR 1N6HA 3IVGA 4HYEA 3U7QA 3ASYA 4Z86A 5B2ZA 4M1YA 3C5CA 4MK4A 4YT5A 1IK4A 2IYPA 2PGJA 3FUXA 4JJ6A 5DEIA 2V96A 1B00A 1LZKA 1FLNA 3OM1A 1IZ9A 1AQIA 1U1CA 2ZU6A 4FLFA 1C1XB 2YVQA 3HJHA 4TV8A 4XDZA 2X19A 4I50A 3PQEA 1ZMOA 1NATA 1PDOA 2DQSA 3VO2A 3DAYA 3LMKA 2ZSUA 3RC3A 3ZVNA 1Y1PA 2JLQA 4BBJA 3HTXA 2FR8A 1JG4A 3IYLW 3MLEA 1NXVA 3O8CA 2V7WA 5AVRA 4ETMA 1YE3A 3AUAA 3USZA 2HRDA 2YHBA 1T0PA 2K7ZA 3FJOA 4ML3A 3BGSA 1MQ8B 3DC7A 1CNFA 4O1HA 4XE5A 5CITA 1MA3A 2O0HA 3CUWA 3R8XA 1JP7A 4RHEA 3V9PA 5FPPA 2WYWA 1PZXA 3IAHA 2ASVA 4CRWB 2I6XA 3OEYA 1JOSA 4H1TA 4KSBA 5AKYA 5G0TA 5EQJB 3ZWNA 2GYYA 4TYYA 3PLAE 2WWFA 3T3HA 1AUPA 3COZA 3AKYA 4E4TA 5L6MB 1JUDA 3L92A 4D4KA 3AWIA 1RPNA 2VZLA 2BI4A 3LF2A 1KJZA 3V33A 4L85A 1BN7A 2HZBA 1SK8A 4HOYA 1ZXXA 1KMNA 4UCXA 4A0FA 1KDOA 3OT1A 3DBRA 1I3NA 3IGFA 3P0EA 4AJ4A 1L7NA 5AVVA 2AZTA 2DBVO 1Y80A 3S27A 1NUPA 2PRYA 3ETHA 5C35A 3EUEA 1ZN7A 2H17A 4HPVA 3FROA 1KI8A 2HQSA 2NWQA 1NMYA 3R76A 2FUCA 4TS4A 5CIYA 2OM6A 2Z5VA 5HQ3A 1AJEA 1BWRA 5FEMA 5TARA 1P9NA 2B3DA 3WLAA 3TPZA 3PTAA 1KIMA 1KVUA 1P0CA 1MXAA 3ANSA 1XCGB 2NTYC 3A4TA 1ND6A 1TKBA 3MWYW 3UPTA 3DZFA 2VDJA 3H6KA 1DJLA 3CLRD 2VAVA 1IY8A 5C46F 3TJMA 3WNQA 2FX5A 4FHEA 4V39A 4YDQA 4KC0A 1LA2A 3ITEA 3R23A 4BNDB 3GLGE 1ZK1A 2XCOA 3H97A 2GVDC 3NTLA 4JT8A 5EJFA 5TPWB 3I6MA 4UUPA 3CEPB 5FYDA 3RI3A 3SFZA 5K6RA 2JEYA 2QX9A 3IEKA 2J31A 1C7IA 1HZZA 3A37A 4J0CA 1W19A 3LXUX 5FOTA 3BK7A 1OTYA 5HSGA 4LGCA 5FL7D 3CLUC 1Y3CE 4A0GA 2WJJA 5B3LA 1TW3A 4LFBB 1R00A 4B87A 4LXGA 2BHLA 4AMZA 1I7PA 1QIEA 4HO1X 1B76A 2YXNA 3J81k 4FU0A 2WOJA 3MTJA 1SCJA 4KOAA 4QZVA 5ANRB 4AG3A 3PFNA 2DGDA 2ISCA 2AGVA 2UU9C 3D7SA 3U1VA 2O0MA 1AD2A 2W0SA 4P7KA 3PXXA 3F1LA 2JHCA 1TYAE 1YBMA 2FE1A 4C7KA 2M2IA 4YRTA 1GYQA 5ALEA 1ESMA 2WZDA 1I2AA 2XB8A 2CBGA 3ELDA 3G5UA 4CL8A 4E21A 1G1MA 2ERYA 1IATA 5LMZA 5ALXA 2NSLA 1P29A 4Q1VA 2XRYA 2C95A 5KOHA 2P79A 3G2KA 4QLAA 4JX8A 1OBHA 1R74A 3THRA 2IS2A 2P7HA 3I53A 3VTZA 3W6UA 1KO1A 4H77A 1XKQA 3H19A 3IC5A 4BOYA 3X1YA 3AKEA 3I72A 1I51A 4UD6A 2Q4TA 2QTGA 3B1ZA 1AS2A 4JBGA 3IXLA 5TQ2B 2HIAA 2XF2A 3BD9A 4LYHA 1S89A 1FP2A 3IQXA 2EKLA 1U3GA 1CULC 1I4LD 5FLXD 2ZIEA 4JEUA 4TSFA 3SY8A 5D84A 4E1VA 5JJ5A 3DE5X 4CM3A 4XPIA 3K8YA 5F3DA 5FA6A 3KAJA 1B73A 1Z22A 2TYSB 2XD9A 1TUIA 1IM5A 1ZAYA 1U0FA 5AKXA 3TZ6A 1E3TA 4I8IA 4R3WA 3A4IA 3LA8A 2GRJA 3V1TC 2Q7OE 5L8VA 1WA5A 3DMHA 1ML4A 3FBTA 4OQXA 2ZUTA 1TVKA 2XA9A 1GWNA 1EJ0A 2J7PA 2Q1TA 4LE0A 2GD6A 1YUMA 3H75A 4JJ7A 3ZY2A 3DE0X 5DHSA 2OD2A 1A8IA 2GR9A 2Q0HA 4PPYA 4QVKA 4E5DA 3PJRA 3I6YA 4BXOB 1N5IA 1WW2A 1UBKS 2GJAA 2L18A 2PDAA 5T8TA 5DM70 2SHKA 3RJMA 4UEQA 2AZDA 3LSTA 3GP5A 4YONB 3OFKA 4QHTA 1PBTA 3W3ZB 1SM4A 3PCXA 4K8RB 5GINE 1PS8A 3EIFA 3ZE6A 1BHJA 2QL8A 1IHOA 1PEAA 2Q1SA 3I9V1 4EKYA 1UADA 1CUGA 3LVRE 5DE3A 4XYLA 4JXZA 5KTYA 2XWSA 1SZJG 1M66A 2G5PA 4BNXA 2QXUA 4KGVA 1UKVY 3A6EA 3GJ7A 4UQOA 3VM6A 5AM5A 5LA6B 2P9BA 4BWGA 5T8SA 4HDCA 4Z3DA 3ZIDA 1GG5A 2OP0A 2X0FA 3T0FA 4EUHA 1XZMA 1EFAA 3Q72A 1E18A 3SE7A 4HB3A 4RIGA 3VVBA 3Q8XB 1SU6A 2O3TA 4HYTA 1G21B 4KLAA 2Q5EA 1O6ZA 5ECYA 3PIRA 3NHPA 5IARA 2G88A 3VPAA 5DHUA 2BFCB 5D87A 2DWOA 4H1WA 1NGSA 4MWZA 4C4RA 4QUGA 1GFZA 2GN1A 4RK5A 4YFYA 4R3UC 5E8RA 1C4XA 5EWMA 3ZU4A 1H5NA 1TZMA 4CBVA 1QS0B 4CYMA 1E1DA 1GQQA 3VHRA 4ILEA 1RIFA 2OAGA 3G88A 1VIVA 1C9MA 2KSQA 4OB7A 3RIMA 1OX6A 2AR9A 5JD5A 4LXTA 2VAXA 4YWJA 3L7KA 4EQZA 3QE0A 3TQRA 1Y0BA 3PFGA 3GC6A 4W6QA 1E99A 4DUYB 4O5AA 1TTQB 4I5DA 4FD3A 5ALHA 3DE6X 3VKHA 3K20A 3L8FA 3RU9A 4XYBA 1V35A 2WP0A 1S2NA 3AERA 5D01A 4MINA 3SZOA 3TSCA 3HB0A 1LVGA 3RUDA 2IVFA 3S2FA 3PJFA 4GZ5A 2YV5A 1ZD3A 1NRJB 2AE1A 4UNSA 3RBVA 1DVRA 4KGZA 1JGTA 2EATA 4HS4A 2OWDA 1R6XA 4FDLA 4JGIA 4TWZA 4B3GA 3D6AA 1I33A 4JB2A 4N3GA 5ARCA 5H4GA 3C8HA 5FLKA 2GN4A 4TZTA 3K4HA 1U9ZA 3BILA 2N47A 4G1VA 2FSIA 2O19A 4BRWA 4YP9A 1M76A 1ZHFA 2GBFA 2J9YB 4LV8B 3VOBA 4BX8A 1QG6A 2GPNA 1XFDA 2GPWA 2DR0A 3AKDA 4S1PA 4RKYA 4E6EA 5C37A 2GJ8A 3D1JA 4YRDA 3RIEA 4EJSA 3QY0A 1K7YA 3OMXA 4R6XA 1Q7RA 3QBVA 1WBJB 1QKIA 5KAPA 3UB4A 5IH7A 4N76A 2FWIA 1U5BA 2Q6VA 4OJQA 4GI1A 4MZXA 3ZVMA 1XZPA 3H11B 1XRNA 3HBLA 4FDTA 2BFEB 4ISBA 1ZM2A 3Q8LA 4EY7A 2OFXA 5CVEA 5DGIA 4PGFA 5B3KA 4W5TA 1T36B 2QZ4A 1FX0B 3DFKA 4U2EA 2ZAMA 4LJ8A 5I48A 3IVAA 4BJ1A 2CJPA 2IKSA 1OBOA 1NYEA 5DK6A 1YFKA 2IGTA 2XSZA 3SC6A 3ABOB 4AZTA 4J3FA 3QTTA 2QE7A 4OXIA 1IU9A 3OTGA 1F38A 3JZAA 3SC2A 3AR6A 4JI0B 2WF5A 4LCBA 4E13A 4I5GA 1SVSA 2QTNA 4LF4C 2R86A 3DYVA 2NUPB 3WIBA 2OOSA 4RENA 3E53A 4A6EA 1M6XC 2YOFA 2SCUA 4EB8A 5JNWA 1J97A 2FJUA 5JDIA 4KQGA 4CF3A 5KWSA 4UU8A 5AI5A 5T4BA 4AY4A 5JADA 1DKNA 1JF8A 5DX1A 1CLUA 4JL8A 5T4FA 1IXZA 2VJAA 3GLHE 2QMEA 2WUGA 3PFIA 4U7HA 2WC1A 3AM1A 5EYPA 4OLBA 2NP7A 3EIUA 4WXMA 2PJRA 1MEEA 1ESCA 1U90A 3FPSA 1FUYB 4Y2JA 4Z0TA 5DBEX 1SCQA 3CLTD 1II0A 5CFZA 4POAA 4RK1A 4LHEA 4Y6OA 1P5JA 2ZIZA 1FUUA 4RQTA 1T8WA 4R31A 1DG3A 4U7WA 2VLIA 4LE1A 1KAHA 1BWSA 2IHZA 4BYGA 4K2AA 4S1VA 2RMKA 1F8GA 1DJQA 1KERA 1Z5OA 4B17A 2BMEA 4HDMA 2CLLB 2NYVA 3KB2A 2F64A 4K2HA 4FB4A 2PZJA 3C6QA 4PRZA 4KMMA 3STXA 3ZDYB 5BQ3A 1IXYA 2ODQA 3NDBB 5IJWA 3LJKA 3IP9A 4V0QA 4UU0A 3T34A 5BSHA 3BZWA 1EUYA 4D81A 1KYWA 3AETB 4IMPA 1EWKA 1UDRA 2B1IA 4R2XA 1KSGA 2PS9A 3F3YA 1F20A 1G7SA 4N41A 1X7YB 1K06A 1LWOA 5CM8B 3MBOA 5I9BA 3UHJA 4KQ6A 3M6AA 2QRLA 2BFWA 2BWJA 3PQ3A 3V8RA 1X1DA 3WWPA 4AJHA 4QGSA 3NPAA 2DFVA 3CIOA 2IP1A 3FLAA 3EPHA 1O8CA 4R1SA 3JSXA 1CUDA 5KYTA 2GD2A 2FF5A 3U9SA 3WBKA 4F93B 3ANTA 2P0YA 3F9IA 1MV5A 1Z75A 2UKDA 2B0JA 5BSWA 1OTHA 2W83A 3KXLA 3PX2A 4N3BA 1GVHA 1E66A 3BWMA 5EEHA 2IOHA 3DLIA 2HFJA 2LCIA 3ONDA 2IPNA 4Q47A 3TFOA 3EFBA 4ZIRA 2IZ6A 4EARA 1JTFA 1WAMA 2GBPA 3AK4A 2PMDA 4UBIA 2R1UA 5H0IA 3TSWA 3GF4A 4JT9A 3NW9A 3V4OA 3LHKA 4FN5A 1TC2A 4F6LA 1FNDA 2W2XA 2CKMA 2IYOA 2Z51A 4MO9A 1GCIA 1OMOA 1OROA 3ULKA 4JJAA 2RC6A 2Q21A 4TLCA 4W5JA 5BYBA 1BKYA 2ZCVA 1OLUA 2WHYA 3QKTA 5K6AC 5C7LO 5IHPA 4DW8A 2V7PA 5CDYA 1CZUA 1M1XB 2YZGA 3PYMA 2EP8A 4V0MA 3T52A 1X8LA 3L46A 3TL6A 3WYAA 2Y93A 1Q7TA 4MIYA 1NLMA 4MUGA 3WKAA 3ZS9A 1DO8A 2AXEA 3OP1A 2M98A 2DHRA 1VHJA 5IULC 5JSQA 2FPGA 2WT9A 3UN1A 4X41A 3WBJA 1VLHA 2H2GA 3I01A 4GMHA 5EQTA 3E22A 4BKUA 1NVXQ 4HNVA 5C31A 4JSRA 1FP1D 2CFOA 3DTTA 3JD4A 3OCUA 3R3YA 1G9TA 3JWPA 3L7BA 1EU1A 1LJ8A 4W4TA 1G3IA 4ZU1X 1R66A 1P72A 1J5EC 1T9AA 2DUMA 2IIVA 3C87A 1FS4A 4FTWA 4G0NA 2BEUB 4KN9S 4AJEA 3RG8A 1GA4A 3S8EA 3QKRB 4F72A 3K31A 4MLZA 3HY4A 2G9ZA 2R97A 1JPVA 2V45A 5EIWA 4H15A 2XZTA 3P2IA 4JC8A 1Z5WA 3CZQA 2DUNA 2VT2A 3HJCA 1KF0A 2V7XA 4B3HA 1BEEA 2IC5A 1XDBA 4UBKA 2ORYA 4DWVA 2H6EA 1U2GC 2HWKA 4GMXA 3QRWA 2FH5B 1MX1A 2AJTA 2AUNA 3GMTA 3U5ZB 2C4NA 1XV5A 1T5DX 3I6ZA 3OEEA 4GOMD 4CQLB 2IYTA 1MB4A 3HI4A 3IIMA 3O9ZA 3LUFA 5AKJA 3GRVA 1G2PA 2PU7A 3JCZA 4F3RA 3SJ7A 3TTUA 5D7BA 2WFLB 5B1IA 2PGIA 3PYLA 1F06A 3RROA 6YASA 1NRIA 1NW3A 2I8AA 1P0MA 2O8DB 4HNRA 3O3CA 5D51S 1FTWA 1VBNA 1DSSG 5G1OA 1G18A 5SYAA 5HPYB 3EQ7A 5LMCA 3I09A 4G9BA 2VJOA 3FG9A 2HM7A 4HFJA 2GXSA 5P21A 3EGDA 2IUUA 3PDCA 3ZK8A 1M6EX 1KI3A 4S1TA 1YS2X 1Q0RA 4TXLA 1P91A 1JMVA 1U04A 5AT1A 3ZS8A 1ZN8A 3HNRA 4YJHB 2EL9A 3BHMA 1GUFA 1H6AA 4L95C 2DFKB 3M1AA 4QNRA 4BNNA 2WHPA 1EFPB 4ICIA 1DO0A 1UWDA 3CKLA 6CHYA 5K09A 2DU8A 4P86A 1I24A 1XCOA 2ZBVA 3A1FA 4B43A 2IITA 2UZ4A 1JJAA 3NDPA 3TQSA 1Z8FA 4EG3A 2COKA 2FLWA 5GAJA 3IVXA 1Q7BA 3AGPA 3DCJA 4E32A 4M9XA 2C94A 2FMHA 2ZITA 4B4DA 1HH2P 1FMTA 3KSBC 1P80A 4QC2A 1QC5A 2DPLA 1TZKA 3HFSA 3PPVA 5AMXA 2AWNA 3VYUB 1SRQA 4C20A 2W8BB 2BMWA 2CMHA 3THXA 1ZINA 1CB0A 1FJGB 1YK1A 2BM0A 3U56A 4EG7A 2NUAA 2E21A 1KARA 2AC2A 5LYJB 1UFQA 5DYGA 3PGKA 3CPEA 4BHTA 2ZM5A 3AFNA 4TL6A 1M8KA 3I9KA 5K3BA 4HXGA 4I6EA 4TYWA 2LD4A 2BE9A 1PGOA 4KBFA 5F23A 1XNJA 4PYNA 1MIOB 1QLWA 1E20A 3DQPA 1ZH6A 3S82A 1A7AA 2QTVA 3IPXA 4XX1A 3DZHA 2C5SA 1CVRA 2HO5A 2IE0A 2X5JO 4X3PA 4ZOLF 1KIFA 1DC6A 3IHLA 3QPCA 1FYDA 1JEJA 1G0NA 2J87A 1ZB9A 3TMYA 4MWTA 5E6SA 3UB2A 4MV0A 3D3NA 3REQB 1ZI9A 3Q98A 3T4XA 4CR6A 1VQ1A 4PG4A 3TLMA 3B3FA 4EHLA 3AHCA 1RQ7A 3F6YA 3SDZA 2EIHA 4IDQA 3UCXA 5HF6A 3CZ4A 1GDTA 4AKSA 1OXMA 1R5BA 1P2SA 2DJ5A 2OCKA 2VWQA 4JITA 4HSGA 3B1YA 4KO2S 1B8UA 1XCPA 2AYAA 2HK6A 3MWEA 2B30A 4DQLA 5J47A 2Q9BA 1TVCA 3C5WP 3NHUA 2JD0A 4I46A 1UBLS 5AJZA 3WKCA 2GJKA 2V6BA 3FSGA 4KV7A 2WY2D 4RTRA 4MGKR 4QJ4A 1O6CA 1WEHA 2MYUA 3I6QA 4WUVA 3B6ZA 4XCXA 3SP1A 5LCXA 5K3CA 4RSRA 3L6RA 2JBAB 3DMTA 3NKLA 2QMOA 1P9OA 2WAAA 1EFVA 4DM4A 4KFRA 1E58A 4AXBA 2OM2A 1DXOA 3JQAB 3PWZA 3IQEA 4C0KA 3O26A 1K88A 4F6RB 5HQJA 4Q21A 1JEQB 2C1XA 2N75A 4OP3A 4HQRA 1OZ0A 4EG0A 4XVCA 4R8LA 1N25A 3FMIA 3RK0A 2WM9B 1MABB 2RFLA 1KZGB 3IURA 1V1RB 3KHKA 2P6UA 4BNJA 1NN1A 3VVLA 4EI9A 2BTQA 4OLHA 2H59A 2IYUA 2H48A 4Q16A 1ISMA 4WZ6A 5E38A 3JVVA 6LDHA 3IMFA 5K0EA 1FJXA 5T6MA 2ZTSA 5IH3A 2GBLA 2BFMA 2VJQA 3SR4A 4NWIA 3LC7O 4D0LB 2O1SA 3IQHX 5TT0A 3KALA 2VSYA 4IHAA 1MCZA 4KEAA 3DYBA 1J2JA 1PJQA 2WKQA 3BHNA 3LF1A 3WICA 1D1TA 1PT9A 1XHEA 3DXYA 2BFDA 3C8DA 3IR7A 3BQ9A 1VEHA 4D3ZA 3ZI7A 1GFSA 1N7JA 1BQEA 3D2BA 3EG9A 3RASA 2HPZA 4G86A 1ARZA 1FFDA 1USKA 1PSZA 2PIDA 1A5BB 4JVMA 3MXTA 4EYKA 1AZLA 3IUMA 3UB3A 1Z7GA 3VH4A 2GLXA 1RYFA 2B35A 1Q14A 2FI1A 2XDQB 4CF5A 5CLHA 1V48A 3C7AA 2HSEA 2OCXA 4DSNA 1FSSA 1IHPA 4JXKA 3A31A 3VR0A 1NQOA 2KS6A 1U3VA 2QRVA 4ILKA 3K92A 1X9HA 2FZCA 1T4BA 1USWA 3SXPA 1MHTA 2V6MA 4XVHA 1K7EB 1QXSA 3AHHA 4PC1A 1U1FA 2ORVA 4D9IA 2H2WA 1YV9A 4C76A 1YDFA 3LKVA 4CTOA 4FBLA 1PZHA 3RS3A 5LZ9A 1FSGA 3I2KA 1IOLA 1RAAA 1JHRA 1E64A 1BXGA 1VLQA 2RHRA 2OZEA 4W8HA 2IELA 2JAOA 4AIRA 4D26A 4KAJA 5E6RB 2PNFA 5C80A 2R66A 1A7UA 1Z7BA 2PZKA 4WCFC 2CNLA 5C52B 1Z0JA 3C4JA 4NU6A 2EF1A 3CWZA 4XIYA 5M7EA 1NP7A 1JHQA 2D0OB 4OJNA 3SKXA 3T9BA 4ZJPA 1F51E 5KINB 3KTAB 5BNIA 3OESA 2BJWA 2F8MA 3PWSA 4L0CA 2ZBQA 4BO6A 5JH7A 3GLGA 1VLVA 1Z4QA 2G28A 1LW6E 5CT5A 2QJWA 3U60B 3CXUA 3LVFO 5CCEA 2PKRA 1EK5A 2Q28A 3Q3JB 4E30A 3PG5A 2VH5R 1GNSA 2B37A 4GPD1 4TVKA 1AKTA 4X1YA 4G23A 1H3NA 1XEXB 1ML3A 2AF4C 4KH1A 4PBRA 1RKBA 3MMSA 2V6FA 1WG8A 3C1TA 1OXXK 1IEVA 1RRKA