3R9XA

Crystal structure of era in complex with mggdpnp, nucleotides 1506-1542 of 16s ribosomal rna, and ksga
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Era GTPase recognizes the GAUCACCUCC sequence and binds helix 45 near the 3' end of 16S rRNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/transferase/rna
molecule keywords GTPase Era
total genus 102
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3r9xA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r9xA01
2ZS7A 3DHWC 4B3TC 3T35A 3KUDA 1KDOA 3VQTA 1S8FA 2RGEA 1JECA 3OE7A 4X8HA 2PT5A 3AKCA 1R8SA 3WRXC 4NH0A 3KQNA 4FMDB 4AKEA 1NRJB 2QL8A 4EDHA 2Z4RA 3SJZA 1SVWA 4DV2C 5LMNC 2IHBA 2ZJ8A 4KBFA 4L16A 5DYIA 2G83A 3PXGA 1G1MA 4LF6C 4FI3C 2IWRA 2H7VA 3MAAC 1FX0B 1KMHB 2FPLA 4OHXA 2LCFA 4ILEA 5LMUC 4M9SA 3UATA 1Q20A 3SJAA 2ZM6C 3ZDQA 4KLNA 4QGHA 4DC9A 3DOEA 1P5ZB 1AKYA 1KI6A 2DB3A 4HI0E 2EW1A 3I5XA 3VHLB 1USPB 3KB2A 3C14C 2AD1A 4JBYA 4NZYA 4B2IA 1KI3A 2VP2A 4TLEA 2QE7D 1EESA 3EARA 4OI2A 3GLGE 4PSVA 1WQ1R 2FWRA 3B9PA 4JVNA 5F3WB 2W6JD 2IYLD 4DDVA 2IEYA 4YMVA 2OPLA 2QTHA 1Z28A 4CEJB 1GIAA 3L0SA 1NLZA 4Y0AA 4BFYA 3K09A 2GCOA 3WNCA 4GOXA 3QF4B 4JMPA 1OYWA 1RYHA 2GZDA 4BQSA 4QHTA 1RVDA 1N25A 1IQPA 1ZUNB 4PC3A 2VA8A 3A36A 1S96A 1E9EA 3KKMA 3VU9A 2B8TA 1IBLC 5AUOB 5IT5A 4Q9IA 4NONA 2X2EA 3QI2A 2H17A 1GG2A 4LCBA 1RIFA 4WW0A 4WOPA 3QEJA 5FTLA 4RJLA 3EX7C 1U99A 4US1R 4YHHC 4TTRA 4EFLA 2ZU6A 4LBWA 4WAUA 3ZGXA 4DR4C 2PCLA 4NU0A 4Q4JA 2G9NA 5IHPA 1SKYB 4LX0A 2R62A 3UANA 5JHHB 4URZR 4ZIRB 2OCYC 1XEWX 2GK6A 4DSOA 3IBGA 1XF9A 1T0HB 1XEXA 2JIZD 1YR8A 1GRQA 5J5CA 4AC9A 2NGRA 3SR0A 4M1WA 2FSHA 1TQ4A 2ZSFA 3TKLA 2Z4SA 1XXHB 1N6NA 2QPTA 3S1AA 1CTQA 1XTIA 1IBRA 4C4PA 1DG3A 4OJKA 1PLKA 1NMZA 3AKEA 1DPFA 4GP6A 3O8RA 2ERYA 3CRQA 1DAGA 4JYCA 1OFTA 4LJ9A 4D0LB 4ZKEA 3EPKA 3H0KA 2QRNA 1XTSA 4PPGA 3R9WA 2IYUA 2A2ZA 4RD0A 3T1VA 3KDSE 1G21E 3QKSB 3T15A 4GOJA 4MH4A 5FOWA 3REGA 1US8A 4BFUA 4O2RA 1DAMA 4W5WA 1EX7A 4QC2A 4U02A 1K5DA 3VHXA 4BLTA 5KYKA 2P6RA 3EW9A 1HNXC 2JGNA 3PUWA 2SHKA 2F43A 3B78A 4NYMQ 4KVGA 2C9YA 4IFEA 2J0UA 4NTZA 4JBWA 2HLDD 1L8QA 1E2HA 1N0WA 5AUQA 3U61B 1GTVA 1UKVY 2XJ4A 5LPNA 4WXPA 4IOMA 1ZAKA 4MRNA 3THOA 1Z0AA 2WZQA 1U98A 2WHXA 1UF9A 4Y0VA 3D6TB 3T1QA 5FOVA 2XXAA 3AM1A 4KHPC 3TR5A 2VH5R 2ATWA 1U81A 3PJRA 1NJFA 2GEUA 1HEIA 2WSSA 3FTQA 1MRSA 3IEUA 3FFAA 2V4ZA 3EZ7A 3HR8A 3QBTA 4CT5A 1YZLA 3CB4A 2OCAA 3AP1A 4IDNA 1XZQA 3N70A 2VLIA 2BCJQ 2JEOA 2JASA 2DWPA 4HUTA 1WP9A 1J90A 1E69A 1N2FA 4TT3A 1RKBA 5GVSA 1G20E 4MTNA 1CJVC 1U9IC 1HE8B 3AUYA 1MV5A 4YMWA 4LFAC 3BIFA 4PQYA 2CMKA 4LV5B 5JLJA 3KQLA 3FMFA 4XD7A 2IF0A 2IW3A 4M4SA 4DSTA 4KODA 2KWIA 5ELXA 1ZC4A 1ZM3A 3FYHA 4JJZA 4XVRA 1PUIA 3DM9B 1S1CA 1XCMA 3PEVA 3PV0A 4D0GA 1A4RA 2AXNA 2FNAA 4GMDA 4AYTA 3D3QA 4BLSA 2GETA 2HCBA 2GCPA 4Q1BA 3IQXA 1J7KA 1FMJA 2P3SA 5CB6A 3U7FB 3NC0C 221PA 5DYGA 1P9WA 3R9IA 4I4LA 3BORA 3MGCA 3E70C 3TRFA 3B5JA 2QGZA 3EERA 3SHFA 2VBCA 3RRMA 4I1OA 3BD9A 2AL7A 3NBZC 4URWR 3ZVMA 2P67A 4PAOA 1RYFA 4MUBA 2JA1A 1DBSA 1KI8A 2F1IA 3REFA 4A0GA 2G1JA 4ZIRA 1GM5A 5KSPA 2W2XA 4IXMA 1QVAA 4DZZA 4RZ2A 1RC8A 1E1QA 1GL7A 2OXCA 5FTMA 4EJSC 8OHMA 2GCOB 1OHHD 3NDBB 3ICEA 3CNLA 2AR7A 1F3OA 4PHTA 3SDZA 4QJ5A 4AY2A 4DSUA 2Z5FA 4B34A 2W2TA 3ZZUA 4DIEA 3Q7QA 4DRZA 1SVMA 2ONFA 4MYUA 2ZI3A 3HR7A 2VHTA 1WA5A 4EPYA 4TYYA 5AJWA 1XMVA 1JI0A 4JVMA 3SYLA 3TH5A 3SEAA 3U3MA 4EIWA 5J4KA 4LRWA 5F9HA 1C1YA 1JB1A 2CLDX 1XNJA 1NVWQ 4Q9HA 1VG0B 1R0XA 4JI3C 4IDPA 5AUPB 4YY3C 4F38A 1Z22A 2J0QA 2NZJA 2HYIC 4DLWA 3LBHA 2VP4A 3WMEA 3GLGB 4RZ3A 4PPNA 3TR0A 1SZPA 3VKHA 2ANCA 4C0AC 1W1WA 5A5GA 2Z43A 2XTNA 4KAXA 1VPLA 3TVTA 5KNBA 1EK0A 4JI7C 2CJWB 3AEZA 2GXSA 4B73A 1IN4A 1G8YA 2FSFA 2DPXA 5J4HA 5LD2B 2OEPA 3FKSA 4P31A 4B32A 2BBSA 3B1WA 2XEXA 3NVAA 1LQLA 3NWJA 4V0ME 3GJ6A 2A5GA 3L0IB 2EWVA 3KTAA 4Q4AA 4M1YA 5HCIA 3M4YA 1RZ3A 4RKEA 2CHVA 1F2TB 3EWAA 5DHAA 4XSHA 2C04A 2F55A 4M53A 1CP2A 5K8TA 4PC2A 2EYUA 2X77A 3B82A 2DFTA 3K1JA 4EKDA 4C2TA 2W6IA 2HT1A 2HF8A 4OX9C 5B2ZA 2WJJA 2PX3A 2YWEA 5G3ZA 3A1TA 5H68A 3RS5A 1M7BA 3RS7A 3KL4A 1OXUA 1TX4B 4JYBA 4DDTA 4ZI3A 4M8NE 2PLRA 1VCOA 3O8CA 2Q9CA 4PZYA 2YHSA 2ANBA 5JHGB 1SHZA 3I5YA 1T8TA 1KJYA 3RABA 4D82A 2DY1A 5P21A 4FMDF 2OG2A 2AKYA 2WAYA 1G64A 1KZGB 1ODFA 2B7BA 3B1ZA 4MGIR 1P4SA 3N2IA 4LHZA 2IUUA 3ZH9B 1CS4C 4IRUB 2F43B 1SXJA 3SI7A 3TVDA 2QMUA 3CRRA 3B8HA 1U9IA 3L0OA 4QJ4A 2OT3B 3U3KA 3AF0A 4X65C 2WWFA 3SFVA 1NYEA 4BFZA 2PZGA 4D80A 2OO7A 1JPJA 4PO8A 5LB4A 3SOPA 5C46F 1QBKC 4NCKA 4GZLA 1OKKD 3GKUA 1E2KA 2HLDA 2OXRA 2ZU0C 3GEIA 4LHWA 1P2TA 1G291 1KSHA 3FVQA 4RFSB 5FL3A 3VX4A 3K0FA 3U44A 3ZD6A 2IA5A 1E2LA 1NP6A 1TEXA 3Q3JB 721PA 3IIKA 2QN6A 4TYQA 3DOFA 4S35A 5FI1B 4NYIQ 3UMFA 4YXWD 3GLFB 1W4AA 2O5VA 3E1SA 1PLLA 3NHBA 4GOKA 1GZSA 4M9ZA 3QE0A 1KJWA 1FL9A 6Q21A 3K53A 1OXSC 4IJMA 3A8TA 4DR3C 1W36B 1UBFA 1SXJE 2D74A 1MO5A 1HQCA 2QP3A 3Q5EA 4IHQA 1VTKA 3PUYA 1QDEA 4ZDJA 4LHXA 4RD4A 3CLVA 3UG6A 1W4CA 1YU9A 4CEHA 5C1BA 5HR5A 5EJEA 3IDQA 4PQFA 1CR4A 4QNRA 2C5LA 4DBLC 3CWZA 4HAWA 4DLZA 5JECA 2ZE8A 5M04A 4DHEA 3GJ8A 4DJTA 3IILA 1N6PA 1XMOC 4NYJR 4V0KA 421PA 1HQYE 4F91B 4P4SA 3FHCB 2PZFA 4KI0A 3V9PA 3ADDA 2CHGA 4G0NA 2O8BA 3VFDA 4NPHA 4CZ2A 4L15A 1RRGA 4V0MA 2XOKA 1BO6A 1YRAA 2REXB 4EUNA 2OZEA 2W83A 2YOGA 4JJKA 1S2MA 5EP4A 5IF9A 3C41J 1XNQC 3A4NA 4MKHA 3SYKA 4C0QC 1CRPA 1DADA 3M0EA 3LO5A 2XR1A 2ZRJA 1COWD 1NN3A 5FOXA 1HT2E 3C16C 4BECA 3LW8A 2DR3A 4LY6A 4KSBA 5AWFC 3SHWA 2Q3HA 3IGFA 3CR8A 1PZNA 1NVVQ 2W0SA 3A4LA 5DI3A 4AIIA 1GWNA 2HXYA 4NXMC 1TUIA 2NO6A 3GJXC 1ZB8A 4XX2A 1G16A 3Q7PA 4MKFA 1Q12A 3C7KA 3DL0A 4TMWA 1AZTA 1KAGA 4HLCA 4GL2A 4M1OA 1MOZA 2ZRPA 3KUCA 5E7MA 2ZUCA 4BZQA 1D5CA 1BMFA 4TTPA 5CM9C 4JT4A 2WJIA 4A2PA 4QGAA 3X1XA 3KB1A 3W90A 1KI9A 1XX6A 4Q9KA 4BASA 1QHXA 4BEBA 1KK1A 1S1MA 4QBHA 1YZTA 4XTCS 3SN6A 3UWKA 4LGMA 1BKDR 5C18A 4DV7C 1QG4A 2VYFA 2QP9X 3A1VA 3FMIA 5G41A 5TARA 4Q1DA 2GNOA 1G19A 2X8AA 5DISB 5E7JA 1VG8A 2C96A 1XFAA 2JJ1A 1J8YF 1PLJA 3NH6A 4D81A 1E2EA 2D2FA 4DLYA 3K0SA 5BW8A 3CX7A 3GJ3A 3MJHA 1FP6A 4KLZA 4CGZA 3JVUA 4GSYA 1JJ7A 1T3HA 4R98A 4BE7B 3DZDA 1XTQA 2QMEA 1QZXA 3C5CA 2IK8A 2PCJA 4JL8A 1KK2A 4AKIA 2YWHA 4KVAA 3RSOA 4A92A 2O8CA 3IO5A 1RPZA 1CJUC 2WJGA 2GESA 3T5DA 1Z2AA 2JLYA 2CBZA 2NO7A 4CRWB 2AN9A 1YZKA 4BFTA 4X64C 1SVLA 3CPEA 4TTQA 2XTZA 2RGXA 4LYHA 4E07A 4JI1C 2V6JA 2WVJA 3J80D 2YYZA 2IL1A 3QQ5A 4NHOA 3SQXA 3W9YA 2PT7G 1Z0DA 3FPAA 1M74A 1ZD8A 1U2RA 4KITB 4HLUC 1E99A 1NIJA 2MMGA 2NZ8A 1F6BA 4XVQA 4XVUA 1T6NA 1RRCA 2ZM5A 4F7WA 1M8PA 1Z63A 2I1VB 4Z1MD 5L3SA 2R6GA 3Q85A 4TSFA 2BEJA 2FFBA 3EXAA 5KNCA 1II8A 1ZM2A 4Q4HA 3B7GA 4P0TA 4Q4LA 1NN5A 5DLQC 3UIEA 4HYYA 4IDOA 4DEXA 4QHYA 1E2GA 1QHGA 2VSXA 4M21A 5H8WA 4DV6C 2D62A 1JOSA 4GPTA 1VHLA 3AVOA 3SJCA 1JR3E 2QAGB 3I72A 1MABB 2ZSAA 5EZ5A 3U7EB 1GVNB 3V00A 2C03A 5TMPA 1JPNA 4DR5C 3HU1A 4NL4H 5LDDC 3GLFA 4KFSA 4Q9JA 1DO2A 2IYRA 3PUVA 3QXCA 4LF9C 5L3RA 1WB9A 5IRCD 1NN1A 4L9WA 2PX0A 3K0FB 2UXCC 1KJZA 3NHAA 4A0RA 2XAUA 4JLOA 5BYKA 4EFMA 3CPHA 1I4TD 2VO1A 2ASBA 2ORWA 1OXTA 3QXJA 3SBEA 5FBVB 4OQNA 4RD6A 2VL7A 4CVNA 2F3RA 1Z6YA 4CEIB 1J8MF 3HYRA 3AQ4A 5JZVA 2ZUDA 2JJ2A 3TSZA 1TF5A 3X1DA 3GLFE 2RB4A 4OHVA 1K0RA 2ZE6A 4TL7A 1IXZA 4JV5C 2E7GA 3PEWA 5FLXD 3KKPA 5D3MA 1Q44A 3GPLA 2OBLA 821PA 1OIVA 4IKEA 2GZHA 4P3YA 5B58C 2ZRNA 4M1KA 1DTSA 1TU4A 4Q5IA 1Q1BA 2V6IA 2WAXA 4PAMA 5AJZA 3K0AB 1D8TA 4Q1FA 1N0UA 1N5LA 1C9KA 5FUXA 2IXFA 4KHZA 5DSZA 4JLDA 4OJQA 1Z6XA 1OV4A 3LXRA 1IN6A 1TNDA 1ZMXA 2JDID 1NY6A 2VHQA 1T91A 2CCGA 4LJ7A 2JDIA 1YZQA 1CJTC 1DARA 3WYGA 5FH9A 2UVQA 3OAAA 3L8ZA 1P60A 2G6BA 4C7OB 4QL3A 4KXFB 2OSBA 4UNRA 2ZJ5A 3PFIA 4V03A 1KGDA 2CLSA 3AVVA 2CNWD 1E0KA 1XD9A 4HAXA 2J1LA 4DV5C 4C3ZA 3W5IA 1XZPA 5AK0A 2UKDA 4QM6A 2IS2A 2PL3A 2QBYB 3T61A 2QT1A 4P32A 1KNXA 4QM7A 1W0JD 1TUEA 1EG7A 4KU4A 3VKWA 4DV3C 3S1AB 1TQ2A 2ZITA 1F2UB 1U0HC 3H1TA 4HSEA 4IOJA 1GNQA 3GLHE 4C0JA 3TUZC 1XXHE 1W5SA 1D2EA 2OFWA 5F9FA 3AP3A 2O8BB 3QKTA 2HF9A 4EQ6B 4GNKA 3AVXA 4X8LA 2ATVA 3GJ5A 5BR8C 4QRHA 4TLDA 1Z07A 3NXSA 4NCJA 2KBFA 5FPTA 2IYXA 4B3XA 1XJ0A 1NMYA 2BCGY 2IXEA 4DR6C 4RY2A 3MRSA 3KKNA 5KUTA 1AGRA 4HLUA 3AVTA 1G5RA 2NO1A 3E5HA 4X8MA 5JWOA 2R8RA 1G8GA 4C0LA 1KDTA 3J81k 1G8FA 5FPSA 4ZDKA 3LX5A 3THWB 2YZ2A 3AVWA 1L4UA 1G3RA 1FQKA 3LV8A 2KB0A 1ZD1A 4KFTA 3ZZ0A 1GSIA 4ARZB 4OHYA 4N1AA 3KQHA 1XCGB 4R71A 3P4YA 5CDFA 4K46A 3T1TA 3QBVA 2W00A 3WMGA 1R5OA 2WIBA 3FDIA 1XXHA 3F5FA 1CJKC 1IOZA 2ZYWX 4HAZA 1ETUA 4W7SA 4A8JC 2BV3A 2V7QA 4LSGA 2V9PA 5J40A 4BFWA 4KJZA 2FMXA 3IHWA 1M7GA 3VTKA 4PSKA 2P6UA 4AKHA 3RVBA 1IN7A 4PZLA 2OILA 1W46A 1W4BA 5DE3A 4JI5C 4H1UA 4G1UC 1HA3A 4YLGA 3A1UA 3RWOA 4ZCMA 3U60B 2ZI6A 4LFCC 2QUZA 2ZSDA 5FL7D 1H8HD 1AQYA 4JS0A 1B0UA 2Q21A 4TN1A 5EP3A 3RC8A 3PEUA 3QEOA 3NBYC 1OHHA 4Q4HB 2JJ1D 4ACAA 5KSZA 4AI6A 1G7RA 1R6BX 1HH4A 2VPPA 2A5JA 5BN4A 1QG2A 4NDZA 1GRNA 3CWQA 1G6HA 1OIXA 4DB2A 1JALA 1KTVA 2FA9A 3LVRE 4UKDA 5TB5A 3L82B 4TT3D 3U6BA 3O47A 2DBYA 2X2FA 2VHJA 4PC1A 5TDHA 3GD7A 3X1YA 2O52A 5IK2A 5CB8A 1QRAA 3QSYA 1R0WA 5E7IA 1P72A 1GP2A 1JR3A 2VSOA 3NG1A 1M7HA 2QENA 1KHTA 3AP2A 2QNRA 5BYJA 3EA0A 3EPLA 1FP7A 2AKAB 5TY0A 1P73A 3UMRA 1YR6A 1I4DD 4RFVA 4IOLA 1CRQA 5E3HA 5EQTA 4CIDA 1NBME 4DUZC 2ONKA 3OZXA 2WWIA 4JSYA 1DVRA 3EA5A 3HDTA 1GITA 2YVUA 2GVZC 1FTNA 4LJYA 3F8TA 4JT2A 2FN4A 2ZRGA 4RFSA 3AVPA 4U00A 1N6KA 5FOSA 4TYNA 4TYWA 3CW2A 2G77B 3QXXA 2TMKA 3CKLA 1UADA 2H5EA 1WRBA 5HKKD 2OLJA 1ZP6A 1WDTA 2V55B 3K9NA 2QU8A 4LZZA 4Q9LA 4WVFA 4G5GA 1E2QA 2ONJA 2HHHC 2GZAA 3VR3A 1SVIA 1Z0JA 1DAHA 4DXAA 1AK2A 3NH9A 1XPUA 1KI4A 2A3RA 2UZIR 3B9QA 2N1BA 2WMOB 1EWRA 2CNWA 1E32A 3B1VA 2R44A 3H86A 3MG9A 1ZU4A 1XU4A 1HUQA 3ECCA 1NLFA 1OIWA 3WYAA 4C0SA 1GRRA 3B13B 5JJLA 4D26A 1Q57A 4LV8B 2ORVA 4FW9A 4EPTA 3ZVNA 4WA7A 1WMSA 1R0YA 3THXA 3RYTC 4MRRA 4K0KC 4RD3A 5CDFE 2ZYTX 3ADKA 3N2EA 4LHVA 4B44A 1FPMA 1XNRC 4Q7MB 4GBMA 2ZS8A 1G7CA 1U8ZA 1QHSA 2J41A 4B6EA 4B3SC 1Z0FA 1EGAA 1UBCA 3DMDA 3RC3A 4O0MA 2C98A 1ZU5A 1GNPA 4Q18A 2J59A 3K09C 3CRVA 3P4XA 1E2FA 5HPYB 4J0QA 2AHOA 2ZQ5A 3OAAD 3RDPA 4FWTA 2R6FA 3PCRB 4BLQA 3MUFA 4GRAA 1NVUQ 2WV9A 2ZVQX 3GJ0A 1YZUA 5FBQB 4DR7C 4UXIA 3RWMB 3VAAA 2ZSEA 3BJIC 2G1KA 2IYVA 1G5TA 4QFMA 1ML8A 2XITA 4AURA 3ZD7A 2PH1A 2ZRDA 1KY3A 5CJ2A 4PAQA 2GJSA 2J0SA 4LV6A 3I62A 4TL9A 1L2FA 4B3DA 5LD2C 2R6AA 1U90A 2BJWA 1W2GA 2VP6A 1CF4A 1GILA 2JIZA 2YWGA 2VQSA 4JKYA 1XP8A 5DNYB 2IF2A 1E2JA 2AXPA 2V7QD 3BH0A 3CJEA 4LPKA 2FDCA 1UDXA 1NJGA 2C9OA 5EE0A 2P0EA 1A1VA 1X6VA 1OXXK 4A2QA 2ZJAA 3BH6A 1T8UA 2NG1A 4QG7A 3GLIA 1F48A 3D7MA 1XTJA 1Q1EA 2RGCA 3WP1B 1H8HA 3FFBA 5CLLA 2A5FA 1NBMD 5KNDA 2WKPA 3LA6A 3QPVA 1XMQC 1QHYA 1WCV1 1XTRA 4ARZA 1OLOA 3HU2A 2K5UA 3TBKA 1XD2B 2OFOA 4MDFA 1HYQA 2I1QA 3X1ZA 1ZYUA 1A7JA 1RRPA 1G7SA 1AA9A 3KXLA 4D6PA 2AD5A 4PPQA 2W6JA 4JYAC 1RJ9A 1EFCA 1P7CA 2BMEA 4ON9A 4ZCIA 2C8VA 1U0LA 2GJ9A 3VR2A 1N2CE 4JLJA 5IK2D 4NCHA 4NOZA 1SGWA 2AWOA 4YMUA 1AS3A 1T0JB 1UKEA 3QG1A 4LJ6A 4N0EA 3VR4A 3WBJA 2CL6X 5K8UA 2BMDA 3GFPA 1OH7A 4KV9A 1XWIA 2CK3A 4FWIB 4Q03A 2IWHA 2AFIE 4MYHA 4B3CA 1X1RA 1X3SA 3LW7A 5B30A 2CCJA 3HYTA 1SULA 4S2EA 2BM1A 1Z6TA 1VHTA 1UJ2A 3AKDA 1CR1A 1N5JA 1VYTA 3BFKA 2BEKA 4O2LA 4RCYA 4WZAE 5EXSA 1E3MA 1R7RA 2QEQA 3KQUA 2E5LC 2F3TA 3ZS9A 1E4YA 4IEIA 4AD8A 4JLAA 2MSDB 5GVRA 2WM9B 1NG1A 1K5GA 1DG1G 1G3UA 2EWWA 5CYOA 3EPJA 3I8SA 2XX3A 2Z6VA 1DAFA 1E4VA 2BHRA 3W8NA 3LY5A 3W3AA 1NY5A 2P5TB 1IXSB 2QSYA 4PHFA 3ZQ6A 1T5LA 4GKJC 4B48A 4URXR 2F1HA 3BFXA 4P33A 2CE7A 4HLQB 5FI0B 2JLQA 1JQJC 3NEYA 1HTWA 1KI1A 2GKSA 4IVRA 4OKSA 5BXQC 1AZSC 3KQKA 3EZFA 4C7OA 5FUYA 1U8AA 2F9LA 2QRZA 2RHMA 4FMCF 2QM7A 4OQXA 4PPFA 3UWOA 4DLVA 4Q7KA 5K8LA 4PFSA 2QE7A 2QAGA 4FXPA 1LY1A 1S9HA 2QM8A 3AUXA 4LYAA 2HUPA 4PHHA 4B71A 4FMBB 4ITRC 1W5TA 2ODEA 3G82C 2OE2A 4HB3A 1NKSA 4WIAA 2VHUA 1CR2A 5SZJA 3CH5A 2J7PD 1BS1A 2IT1A 3EPHA 1II8B 1WXQA 4M2LA 4A0HA 4DLUA 2H1LA 3QJYA 1XEFA 5A0FA 3U5ZB 1E2MA 1YHNA 4G3XA 3OEED 3PITA 4HATA 4URVR 1EWQA 3UMSA 2CDNA 3QOFA 4FIDA 1W4RA 3BERA 4DV1C 1AN0A 1ZRHA 3D8BA 1XMSA 1M6NA 1BMFD 1KKGA 4I1SA 2D06A 4UQOA 1N5IA 1UEJA 2FOLA 2CLCX 1NF3A 1LF5A 3WHLA 2D3WA 4U5XA 3PQCA 3T1YC 2YC2C 5FBRB 2Z0MA 4KBGA 2O8EB 1PV4A 1VCNA 4Q00A 2RAPA 3LH5A 4FN5A 1SVSA 5SZHB 3QKRA 4US2R 5EZ6B 1AS2A 2BOVA 1DS6A 1JAIA 2YOFA 4CEJA 3AVUA 1IJEA 2YCBA 2WSSD 4A6PA 4ZKDA 3R7WA 2AFHE 4HZUB 4LHYA 4M0LA 2O8EA 5KDLA 2ODBA 3BBPA 5JMTA 4B6FA 4B75A 1ZNWA 4ASUD 4KFRA 2IYTA 4OK6A 1VIAA 4DCNA 4NCNA 4DSNA 4RKFA 3L2OB 2XOKD 3P32A 3AV0B 3HPRA 1CXZA 2YC4C 3RS3A 1W36D 3TSOA 5GJVC 1EFRD 1BYUA 4TLCA 5G40A 3TIFA 2FSIA 1YZGA 3LWNA 3FGNA 4RD2A 3RAPR 2OHFA 1KMHA 1TU3A 1AS0A 1TADA 2L0XA 2R6DA 4QBFA 3OIYA 3UXMA 2A78A 4TMZA 3IBYA 4OHWA 2R2AA 3LXXA 4JVLA 4Z51A 2IS6A 5HE9A 1W7AA 2B92A 1N6IA 5EUMA 3ZVLA 4D4MA 3O8BA 3I1FA 3WYFA 1CIPA 1NSFA 4F4JA 2YINC 2MMCA 1E2DA 2ODNA 2PJZA 3OFNA 4EPVA 3TQCA 1J99A 1R8QA 2HDNB 4ESHA 3CM0A 1OB2A 4WZ6A 1D2NA 2CY1A 1P2UA 4GI7A 1E94E 4LUCA 2J45A 2J5XA 1S9DA 1GNRA 4LBYA 1JEEA 2ZYVX 2D7VA 1OXVA 2ZI4A 3EWSA 4DCTA 1ZIPA 4Z1MA 3CF6R 2VQEC 1G3QA 1NVVR 2VP9A 1PA4A 1VKJA 1JJVA 5FOUA 1IHUA 2GXQA 4PC7A 3ADBA 4UJ3A 5DH9A 4EAQA 1E9AA 2HEIA 3WBKA 2RGGA 2ZSBA 1V43A 2DWOA 3K9LA 1KKLA 1W0JA 2E9SA 2B7CA 4POAA 4QJ3A 4QOSA 4HB2A 4B3GA 1P9RA 1CULC 1DOAA 3MWKA 3ZLJA 4AK9A 1TF2A 5BN5A 4PR0A 4R9UC 1Y3AA 1JAHA 4BLPA 2UXDC 4OBEA 4PHGA 3M6AA 3QVUA 3T5GA 2D7CA 2VHCA 1LFDB 1BIFA 4XWOA 1FMLA 3R9XA 3G0HA 3AGQA 3DM5A 2GF0A 5LBIA 3TQFA 4IXNA 1OH8A 3A6PC 1R2QA 2O8DB 4L9SA 2DYJA 2J0UB 1I4LD 3Q5DA 1JR6A 5KSYA 4JI8C 3R20A 2P6NA 2FSGA 2IEZA 4B2PA 4B43A 2IX3A 1MO6A 1ONBA 1TTTA 1UKYA 2Y8EA 3G5UA 2REBA 2WKRA 4JLKA 1OSNA 2JLZA 2CL0X 5BN3A 2WJHA 3LD9A 5JRJA 5EXTA 4II7A 2QT0A 4DEYA 4A15A 3KJHA 2OFXA 1IBMC 5CM8B 3NKVA 1X1SA 5J47A 2GXAA 2GCNA 4X66C 3EC1A 3IO3A 3AKYA 3WNBA 2ZR0A 4A4DA 2OBNA 1OT3A 2XNDD 3LQQA 5CJPA 1SQ5A 4MDEA 2VEDA 1N6LA 4DUGD 1LF0A 3U4QB 1DAEA 3QG5A 2V1UA 3GLHA 1A2BA 2ZAMA 2IYWA 4ESVA 1FFHA 4LPSA 1ZM7A 4NCIA 1VLAA 4OK5A 4XWAA 1CR0A 1CEEA 2ZJBA 2IC5A 2JMPA 5JBQA 3MWYW 2GA8A 1R5NA 2ZVPX 4KYIB 2CE2X 4MKGA 2PJRA 1G5PA 5EP2A 1R5BA 3WXMA 3K8YA 4A6XA 5AR1A 2Q6TA 2XB2A 3MCAA 1N36C 1BH2A 1S4QA 1VCMA 2BJVA 4MYCA 2PEZA 3WRYC 3SFZA 3FB4A 4FD2A 3KKOA 4RZUA 4HUQB 4BLRA 4TMVA 4MH0R 3H4MA 3THXB 2QZ4A 3CRMA 2ZEJA 3OHMA 4RZXA 5DHFA 1F60A 1LW7A 3KX2A 3DKPA 5FTJA 1CKEA 2ZI9A 1E79A 3MWJA 1G18A 4W5JA 3UG7A 5CITA 5EUQB 4LF8C 3GLHB 3U7HB 2H16A 3OEEA 4B3BA 4K81B 5DN6D 4LWZA 4DDUA 3RS4A 3PUXA 2V1XA 5EXXA 5CIWA 3P1JA 1SKYE 1FNNA 1R0ZA 1ZUHA 3KJIA 4DDWA 3RSLA 1JXMA 1GL6A 2ZRHA 3TUIC 1FUKA 3EG5A 4HB4A 3TAUA 3KJGA 2YNMA 3GLIE 3RRZA 1LS1A 4D4JA 3W5JA 2GAAA 5L3QA 1Z0IA 4RVCA 1E9FA 2ZS9A 4BEJA 5AUNB 1XCPA 1Z5ZA 4NKRA 5A4JA 2ZJOA 5FR2A 1Q1ZA 2FX3A 2J46A 2N46A 3TW8B 1Q3HA 3SNHA 1D9XA 3EASA 1M1YE 4LC1A 1Z3IX 2PLFA 2ZE7A 4BLOA 2H18A 4KFUA 5JSZB 4X8OA 3ZQJA 2NPFA 1KSGA 5JCPA 5HCNA 5IT9D 3RS2A 2DFNA 4TL8A 3TE6A 1KK0A 1NL3A 2CCKA 2D7DA 2C99A 1OFUX 2UUBC 3AF1A 4EPRA 1DAKA 3ASYA 1O87A 4GZMA 3BFVA 2BIFA 3KFXA 2BM0A 4YDHB 2WJVA 2A5YB 3TJZA 1S0UA 2QTFA 5CYPA 4BGDA 3EZ9A 3GP8A 2Q9AA 5D3MB 3HPQA 3JVVA 4OQLA 5FUWA 4E03A 1F2TA 3R8FA 1II0A 1SXJD 4UXHA 1ESNA 2DWQA 3FKQA 4C2UA 4ZI2A 5FBLB 1ZNYA 3CZPA 4LF4C 1L4YA 3DZ8A 1EFHA 5L3QB 3U6KA 1YZNA 2FH5B 2G3YA 3Q9LA 1E9CA 4LJAA 2WKQA 3SQWA 1QHIA 2FEMA 1R10A 1KAOA 1BYIA 1NKTA 4H1VA 3CF2A 2F4VC 2FEOA 1KSJA 1J70A 1UKZA 3VNUA 1XEXB 3B1XA 4LYJA 5JRZA 2WWYA 1W48A 1NIPA 3OIVA 3ONWA 2CJWA 2KJQA 4W5HA 2QROA 3T12A 3VNVA 2GBLA 3QXHA 2EFGA 4JLPA 4FMCB 4M1MA 4C0KA 3BWDD 4OK3A 4R2HA 5KDOA 4E09A 3ND9A 4JVSB 4FCWA 4XSGA 1ZNZA 2NTYC 4F4CA 2A5DA 4Q1AA 3K70D 1NI3A 2DFLA 1A2KC 2QP4A 2ZPTX 5L8VA 1GOTA 3QY0A 3RRYA 4DKXA 1TL7C 1W0KD 2BC9A 5BWMA 5SZKB 1KOFA 2VTKA 3PG5A 4QNMA 1KZ7B 4Q7LA 5JWRA 4AKGA 3PIRA 2ORIA 4DV4C 3WNDA 4OQFA 4V0LA 1CLUA 1XD8A 2CK3D 3ZZTA 1ESMA 3K0CC 3QXSA 5HKKA 4YQFA 3I3SR 1E9BA 1P61B 1LS6A 2F7SA 2RGAA 5FBWB 5CIQA 2XNSA 1XPOA 2XGJA 2QTVB 4NMMA 1HURA 3RHFA 4D2IA 2CVFA 5GADl 2OV2A 3U3OA 4PTLA 2LKCA 2ZR7A 3IIJA 4ZDIA 1OJLA 2ZR9A 1N6RA 2J0VA 5KO2A 121PA 2HYDA 4JI4C 5TV2A 3CONA 3P20A 1J2JA 2AX4A 4DT1A 1AQUA 3CX6A 2E8EA 1KI7A 3LBIA 2P65A 4JL5A 1KKMA 1COWA 1LB1B 4JLMA 3QKRB 1KNQA 3C5HA 5C4GB 2BBOA 5L3SB 5FPYA 3ADCA 1E79D 1FTSA 4IW3B 1SVOA 2PEYA 1ZCBA 5DGXA 4JI0C 1OH5A 2ZIAA 2FE4A 1G3IA 5FFMA 3RS0A 3LLMA 3OFND 3FHOA 2GVDC 2HV8A 4RCZA 1PVOA 4NP6A 1NLYA 4C0HA 4G5SA 2QAJA 3U2QA 3VX3A 3FE2A 2J3EA 3LBNA 2IYYA 5CLQA 4GMXA 4QKQA 1IONA 2ERXA 2OLKA 1Q1QA 4URYR 2XNDA 4F92B 4PX9A 4OI0A 3K9GA 4F93B 3CX8A 2R6CA 3OTOC 3N5CA 2ZYUX 3QKUA 4TZ6A 3A1SA 3JZMA 3ZVRA 2JLXA 2Q0HA 1QHHA 4B3MC 3T06B 1G8PA 4D4KA 3KJEA 2OCPA 1ELOA 4U7DA 3EIEA 1HE1C 3QIAA 4JBXA 3DKVA 4M22A 4Q1EA 2ZJYA 621PA 5H1YA 2WIAA 1KO5A 1W0KA 3LDAA 4TL6A 1ZW6A 3MMPA 2Q9BA 4JZKA 2VQFC 2UUCC 3UK6A 2ZRFA 2GF9A 2FGJA 4HAYA 1M2OB 1KK3A 2R9VA 4XTRA 1JXOA 1FZQA 3E2IA 1FUUA 1Z2CA 2XTMA 3UKDA 4QGGA 1KDRA 3VR6A 5E4FA 1UKKA 3GFTA 5JCZA 4UJ5A 3AF6A 2XZOA 4PO1A 2WWWA 3K0AA 3K0EA 1Z06A 5EE1A 3WP0A 5JS8A 1IAQA 4BFXA 4BUJA 5JEDA 4DVGA 2W58A 1KO7A 1NNEA 1ANKA 1MR3F 1GL9B 5KOYA 4ASUA 4PZZA 4GFDA 4BRUA 2HXSA 2QQEA 4O25A 3NDPA 2ZAOA 4TQAA 3PVSA 5JJKA 3BGWA 1TEVA 2QORA 5GJCA 4EFNA 5GJBA 3GLIB 4TZ0A 2WOOA 2LWIA 1D2MA 3U7GA 3SYNA 1MH1A 1KDPA 5DIFA 3BB1A 4Q19A 2HJGA 4NXNC 5IDVA 2ZUBA 1WBBA 4CEHB 1P62B 4Q66C 4TQUS 3QVVA 3PEYA 2ZXUA 1SKQA 2IYQA 1GKYA 2JCSA 1VIYA 3W3ZB 4LYFA 1E98A 4A1FA 3TAHA 4BRWA 3BK7A 2FF7A 2NQ2C 1EX6A 2WJYA 2ZTSA 4TQ9A 1M34E 3W34A 1OB5A 1ZIOA 2A30A 5J4YA 4I99A 3LRPA 4OQMA 1IN8A 2J87A 3BAFA 4TMXA 1W44A 5JJIA 2GXUA 2OBMA 4MGYR 5AJVB 2WTUA 2O8FB 2WMNB 1PUJA 2E8CA 4JI2C 1H8ED 4EPXA 4DCSA 3A1WA 2RGDA 4HLDA 5D3QA 1HH2P 3W6PA 3X1WA 2BMFA 3DMNA 1WF3A 1I2MA 2D4HA 5BQ5A 3TUJC 3NTUA 2O0HA 1USPA 2OPLB 3L8YA 1KSFX 2OAP1 3ICQB 3OEHA 1HV8A 4M9XA 4C9BA 1EFTA 3OEHD 3T1HC 4LC0A 4MKIA 2FFAA 2ZRAA 4Q4JB 4XWKA 2O8CB 2GJAA 2CL7X 3BOSA 2AK2A 4NYIR 3TW4A 4G5RA 3IPYA 2HJVA 1WBDA 3GMTA 1E0SA 4BFSA 4QGFA 1JEDA 3NEJA 4MYTA 2PN2A 3K70C 1SXJB 4A9AA 3HWSA 3BB4A 4Q21A 3CR7A 3MSXA 4PSAA 5FTKA 3WMFA 4DLTA 2ZRLA 2WWHA 1VYVA 1Z08A 1KO4A 1V5WA 2GAOA 5EE5B 1XJQA 2I3BA 3LLUA 2H92A 2R65A 3I8XA 1CU1A 2YWFA 4PANA 4HDCA 1A82A 1E2IA 2RGBA 3WY9A 2CXXA 1JNYA 3LUSA 3U4QA 2J7PA 5A2QD 1KI2A 2KBEA 3HP1A 5EXPA 4PQRA 4FCTA 3LX8A 4LJ5A 3OIWA 2KE5A 2GEDA 2IUSA 4UNNA 1T3LA 3AVYA 2Z83A 4HAUA 4I1VA 5AJXA 3SZRA 3AF5A 2WPDA 1SXJC 1LVGA 1Q21A 4OHZA 2G0NA 3P27A 1OFIA 3LVQE 1DE0A 4LJ8A 4A8JA 1E2NA 2REOA 4A0FA 1FW6A 1YVDA 1RW4A 5FPKA 3RRNA 3QF7A 2QPAA 4MQBA 3W6OA 4K8OA 1P3JA 2V8OA 2A7QA 3BS4A 1E96A 2ZJZA 2B8WA 1E9DA 1FX0A 1X86B 4WBSA 4GDFA 2E87A 2EFDB 2H57A 2ZE5A 2ZREA 1X8JA 4HB0A 4L4UA 4DIDA 2QPOA 3CNNA 2JLVA 3L0PA 4QHSA 2KZFA 4QXAA 4N0DA 1NG9A 3WHKA 1F5NA 1ZCAA 2FZ4A 3PR1A 1EFUA 5JFGA 1SVKA 3GQBA 4KCGA 1SHKA 1E0JA 1GAJA 1YR9A 5B57C 4Q1CA 3U3RA 5B64A 3LFUA 4KSCA 5DI3B 4O3MA 4NBSA 2AWNA 1T9HA 4P4TA 3I07A 1HNWC 4Q02A 2WBLC 3AH8A 3CNOA 1OKKA 2IYSA 3EZ6A 1TAGA 3KXKA 3FOZA 5KPJA 1WH9A 2ZRKA 2RGNA 3AGPA 3KXIA 2RCNA 3NC1C 5TVKA 2Q3MA 1KMQA 1W2HA 4ACBA 2YV5A 2VRWA 2BVNA 3QPUA 2XJ9A 2ZI7A 4N3NA 5EE9A 1G41A 2IS1A 3L43A 2EQBA 3R8CA 4M9QA 1DEKA 1IY1A 2BBWA 2GBLC 2VSFA 3W8RA 1XD2A 1CJMA 2B6HA 3OE7D 3TNFA 2FPKA 2FFHA 1D6JA 2IUTA 4KO8A 3EAQA 1GKUB 4LBVA 4EJSA 1N33C 2WWXA 1KO8A 1XBTA 1OE0A 2QMHA 4UNSA 2NPIA 2V3CC 1G4UR 2LKDA 4IDQA 5G53C 3R7WB 2VF8A 1Z6AA 2F9MA 3BRWD 2F6RA 3IQWA 1IY0A 4D4LA 4LDJA 3TSWA 2IXGA 3THYA 4A82A 2PT7A 3IUYA 1GUAA 2C78A 5ANRB 1U0JA 2EFEB 1G4AE 3I61A 3B2EA 2EGTA 1ZD9A 5G3YA 1DAIA 1VECA 1JBKA 3C4JA 2RH5A 1VYUA 4DV0C 1ZM4A 5J4LA 3TGPA 1NBMA 4MRSA 5KHOC 2W6ID 1Z47A 3I73A 2E8FA 2FFQA 4NYJQ 3BB3A 5FPHA 5FUVA 3VU9B 4EQ6A 4Q7JB 4BZPA 4ABYA 2J9RA 4GT1A 4DLXA 1N0VC 1YRBA 4UNPA 4CT4B 3CUEF 2GRJA 1IY2A 2YKGA 1UBGA 1IBKC 4Q48A 1Q22A 2OCBA 3LNCA 1NVXQ 4TYPA 3O8DA 3T1OA 4YMSA 1XMIA 4R7ZA 5HE8A 5JS7A 5KU1A 5CK4A 5JWHA 3AF3A 1ZM9A 3BE4A 3BH7A 2CXCA 2DYKA 2GJKA 1P75A 1L2TA 3QPWA 3MFYA 5SZIA 4BPBA 3THWA 4NYMR 2FJUA 2EFHB 3DO6A 3MD0A 2WPDD 2CEAA 4DR2C 2FGKA 2FU5C 2C9CA 5JI3E 1KY2A 2JLSA 2MSEB 5DN6A 3IIMA 5JI2E 1E2PA 1UM8A 2F1JA 4A8JB 2XB4A 5KTYA 3AB3A 1JR3D 3TK1A 2X19A 4DR1C 1H8EA 1TQ6A 1X8LA 2W0MA 4OI1A 2O0JA 1GDDA 4IOKA 1PJRA 1VCIA 3MWLA 4TSFD 4JLNA 3SE0A 1E6CA 1EXMA 2RHDA 1P2VA 1B23P 2PMKA 4WXRA 1F2UA 3AF4A 3IPXA 1RFLA 1P9NA 4XIGS 1Q3TA 1W49A 2BBTA 1XRJA 5F2EA 3QNUA 1Z83A 4M1TA 2QQ0A 5GJWC 4OYHA 3VMFA 3W6NA 3VKGA 3H84A 4DB4A 4PXAA 1OPXA 1E9RA 2D2EA 2J7KA 1S3GA 3D31A 4MGZR 1I2DA 3GLGA 4ZPXA 2JLWA 4WZBE 3CO5A 4Z54A 1YJ5A 5FOTA 2H8KA 1G9XA 1XB2A 1XDBA 2RKOA 2WWGA 3DVLA 1P2SA 5JEEA 2GK7A 5K8IA 3QUSA 4ZCLA 3UPUA 1XPRA 2KSQA 2ODWA 4AYXA 4I81A 2BKUA 2QI9C 3EIHA 3FWYA 3KFVA 1LNZA 3KTAB 1ZVQA 4Q4AB 4XD7D 4CEIA 2EU8A 4JLVA 2XXAB 1GKIA 4G5OA 1UPTA 1GFIA 3FMOB 3IKJA 4IVQA 4YMTA 1AJEA 1QHHB 2AK3A 3ETLA 2YJTD 4TWZA 3IEVA 2RMKA 2NO0A 4B2LA 1BOFA 1QVRA 2PZEA 3BC1A 4B47A 4BZXA 4URUR 3GCGA 3ZJYA 4QBGB 4B33A 2V54A 4JSTA 4JKIA 1X8KA 3AVQA 3C15C 2QY9A 1NMXA 2RGNC 2XSZD 3VR5A 3ZYCA 2XSZA 3I32A 1G17A 1UEIA 1XJCA 4P4SB 5C4MA 3CIOA 3SS8A 3HJNA 2ATXA 3FKSD 2FPMA 4BSZA 3NBXX 1I94C 1OF1A 5KDDA 1E1RA 2WSMA 3F0TA 3TMKA 2YOHA 1QWIA 2BDTA 3OESA 1E1RD 3MJRA 3QKSA 2IYZA 3LAWA 4GP7A 4DWJA 1W36C 5F98A 4AYWA 3X2SA 4YXWA 1RE0A 2VP5A 3GJ7A 1ZJ6A 1MKYA 3GJ4A 3RANA 3I92A 2FZLA 4XOIA 2VP0A 2MSCB 4KYUA 2NOAA 1YR7A 4C0BA 4D25A 4ZO4A 3THYB 1MT0A 4Z8XA 3FMPB 1FJGC 4DLSA 1T3SA 1U8YA 1FQJA 2CHQA 4ZDWA 5H70A 1E0AA 3A58B 2GEVA 2QL6A 2DCUA 4EJSB 4LOAA 3RLFA 4CDGA 3RNLA 1O3YA 2UU9C 1TPZA 2IHYA 4BFVA 1H65A 1J5EC 2IBMA 2OUKA 3HU3A 1UBEA 2OAQ1 4ERNA 4IDHA 1OW3B 4HZUA 1MO4A 2EFCB 3P26A 4MITA 1YE8A 2ZRMA 2O8FA 3T34A 2ZJ2A 1MO3A 2BKEA 3EC2A 4IFBA 3MLEA 4MRPA 4DCVA 3JZAA 3NIBA 5FL7A 5J4VA 1KI6B 1U94A 3DDCA 4PC6A 5C2JB 1N3BA 4C30A 1LV7A 2ZRBA 4UXJA 1Z6GA 4MRVA 3J81D 5DI9A 3AF2A 1TQDA 2W2VA 1JQLB 1A5TA 2GJ8A 2ZROA 3CH4B 3NBFA 5LB2A 1D9ZA 4Q47A 4DUGA 2JLRA 2PMDA 1AKEA 1Z8FA 2QA5A 3DEFA 4W9MC 4B35A 2C2HA 1KIMA 4LJ4A 2Q3FA 4A36A 2CVHA 3K0CA 1II9A 5JSZA 1LTQA 4TMKA 1S3SA 2NO9A 3ASZA 2PBRA 2BMJA 2NIPA 3H2YA 4US0R 4E22A 4I1UA 4V02A 3C8UA 3SC3A 1VG9B 4D0NA 1KYIA 4HDQB 4LK2A 4R2IA 2ASEA 4HZIA 3V4RA 5TXGA 2ECKA 3CZQA 4OL0A 5E95A 1R4AA 4IVPA 4MGKR 3PENA 2VIIA 5L3VA 4XJXA 3KKQA 1P6XA 4X62C 4EPWA 4ZV4A 2QMOA 1ZC3A 3GEHA 2P5SA 2X1VA 3SJBA 1XMJA 4AQYC 4F4IA 2IS4A 3SU8A 4NE2A 4LF7C 3VR1A 2JJ8A 3EIQA 4DUYC 5EE3A 3V4FA 2XZLA 1QHNA 4DCUA 2F1RA 3EZ2A 3GEEA 2UXBC 1TMKA 4YDSA 1DO0A 4JL6A 4P4UA 1NN0A 3OIUA 3K70B 4Q01A 1YKSA 2JATA 1MRNA 2QGNA 4TLBA 2NMVA 1G6OA 1DELA 2GDJA 1YQTA 1G3MA 1IXRC 4JIMA 1K8RA 3B6EA 3M1IA 1EFRA 1OFHA 4JLBA 3B60A 1N6HA 2GWHA 2FV8A 2HCJB 2VF7A 3LQRA 4A2WA 5HZHA 5FTNA 2JLUA 2GTPA 2KI5A 5EP1A 4HUQA 4B3FX 4OI4A 3JAMD 1OYYA 1T4GA 1UFQA 1E9SA 4CF7A 1UDWA 2UUAC 4CW7A 4HEJA 4G5QA 1US8B 5IWAC 1ZUIA 2C95A 3KZ1E 2FG5A 3QENA 1L7VC 4Z8YA 4TMTA 1VDZA 3OF5A 3ZIAD 4UNQA 4E5UA 3B85A 1IJFA 2JJ2D 1VG1A 4QBIA 4B3RC 1G7TA 1NSTA 4YONB 1WE2A 2DFKB 1RJ9B 3F3YA 4AG6A 1HY3A 4IEEA 2OESA 2G0TA 5KPDA 4RSGA 3ND8A 4L8GA 4PO9A 5FR1A 521PA 3DPUA 1T5IA 4DT1B 3CRW1 1KO1A 5AJYA 3TLXA 5KSOA 4MA4A 2JAQA 2GHIA 1N32C 2QG6A 3QF4A 1N5KA 1ZBDA 5HZKA 4LI0A 2I4IA 1CBUA 1UAAA 2XZPA 4LBZA 3Q72A 4B74A 1AIPA 2ZRCA 1MABA 1TF7A 2A9KA 1ZINA 2E1RA 2DHRA 4GKKC 1E1QD 3BXZA 1N34C 1FNMA 4M1SA 5HTKA 3U44B 1AM4D 1N6OA 1VMAA 2P2LA 5DO9A 5UKDA 4HDOB 4TLAA 2QAGC 4H9GA 3FHTA 3B1YA 1XTKA 4AG5A 4B76A 4AWXA 4LFBC 1QF9A 2WOJA 1HNZC 2G88A 2UZ3A 4YC7A 1Z29A 3SBDA 1Q0UA 3I4LA 1W47A 4LF5C 4FINA 1Z0KA 5CK5A 2BJOA 3CPJB 2BWJA 1HT1E 2N42A 1AGPA 2GILA 1FOEB 3IHLA 3U3JA 2WICA 1G8HA 3A37A 4CYMA 4G01B 1K6MA 3ZIAA 4DLRA 4V0NA 4RD1A 1XEWY 4JI6C 2O8DA 3PUZA 2ZI5A 1HR0C 2QSZA 1Y63A 4HAVA 2EYQA 2C77A 4V0OA 1OH6A 2QBYA 1IM2A 2O0KA 1ZB9A 3GFOA 2HT6A 3K9HA 2ZANA 1RRFA 4BWYA 4XH9B 1IN5A 1ZNXA 4FCVA 2ZRIA 3A4MA 3ZS8A 1C4OA 2B21A 2EVWX 2OM2A 2ZETA 4MUAA 3CF0A 4L5BA 3CBQA 3Q8XB
chains in the Genus database with same CATH superfamily
1YL5A 4B3TC 2ZFUA 1YQQA 2ZZKA 3KUDA 2JFFA 3JD2A 4XPIA 5P8WA 5LKAA 3BD7A 4FFSA 2YR0A 1QAMA 4F0JA 1V11A 3JSAA 3LYHA 1IJBA 1S8FA 4DA6A 4P5DA 4DSAA 3RT1A 4HNTA 5EPUA 5ARDA 5E6UB 3FNRA 3AKCA 4JZYA 4C7MA 4MUXA 1GPLA 3P9NA 3KQNA 5DTQA 1SUSA 4ZQEA 1BG6A 3GJQA 5DHUA 5K0ZA 5KJCA 2FW7A 3NWBA 2QL8A 4MUMA 3HN2A 2R96A 2Z4RA 4BQRA 4ZYXA 2P78A 1PHRA 1V6CA 1WL8A 3D81A 3DJYA 1TUBA 5JY6A 5AXCA 3UT5A 1ULZA 3ZLTA 2IHBA 2R1VA 1P0MA 4QAJA 2RDMA 3LO8A 3PHHA 5LL6P 3PXGA 3K2BA 1G1MA 1VKNA 3N0RA 5FPQA 4DZTA 2AIRA 3CXUA 5T8KC 2IWRA 3LRTA 2O2SA 5FP0A 4FYIA 1FYXA 2LCFA 1AA6A 1M2OA 3CLUD 2VOEA 4C29A 5BQOA 3UATA 4IWXA 1RQXA 1V1RB 3A04A 3SJAA 4BNVA 4XYMA 5HJ5A 2O3JA 4KLNA 4QGHA 4DC9A 1CZHA 5F5NA 3AJEA 3QRWA 4F5EA 5K0FA 5AP9A 1PSZA 2VTVA 1AKYA 2YMQA 4HI0E 1Y9JA 1Z17A 4X65B 1IUOA 4QOJA 5E2IA 3KB2A 2AD1A 4NZYA 4FDTA 2ADOA 3C3DA 1WKBA 1HE5A 5FAXA 4BNMA 4TM8A 1PI3A 3N2GA 3WA7A 1MA3A 3EARA 1KJQA 3ADOA 3D8TA 5EHIA 4CF5A 3PDIA 2GZRA 1WQ1R 2PSHA 3OCZA 4JVNA 4F9FA 2GA9A 4DR2B 4GECA 2W6JD 5HRAA 5F3WB 5IM4A 2CDCA 4U3JA 4YMVA 3MPUA 2XOEA 1U3UA 3FOBA 1XL0A 1RLJA 2X22A 4FT4A 1L3CA 4M9RA 3QF4B 4JMPA 1RYHA 3WTCA 5AESA 5HF8A 3CO0S 1LPBB 1C7EA 4KPUA 2A58A 3K8OE 1EXWA 5DNEA 2RE8A 2C83A 4PC3A 1DG9A 4G8CA 3WQHA 3ZCUA 2Z5GA 4IQ0A 3HKBB 1S96A 2HLNA 4DTCA 5J2UA 3NPAA 1E9EA 1EU1A 4CKCB 3O2SB 3ZDRA 2WSLA 4RGVA 4OP2A 5CA0A 2HSJA 5C80A 4BNWA 5IT5A 5CH8A 4DV3B 4O4JF 2Q2QA 2RHHA 1GG2A 3D4PA 5ICCA 2XMBA 1RU3A 4WW0A 3JQFA 3QEJA 4H35A 3HDJA 5FTLA 2I91A 3I52A 3V4ZA 3BDAA 4UHDA 1QIFA 3L7JA 1ZFNA 1VBKA 1U02A 2GDZA 4R01A 3BFPA 3ZY6A 4BJ3A 3PKJA 1TI7A 2F4NA 1ODIA 4D5GA 3ZGLA 4LBWA 3MAJA 3ZGXA 5JAUA 4DR4C 3H9JA 2JVIA 5IHPA 3L1VA 1GT6A 3C70A 3ZTTA 2R62A 3PIIA 3SR4A 3UANA 4GBED 2YW9A 3CVOA 3SSMA 2OCYC 1UOPA 1XEWX 3EEYA 5FD8A 1A9PA 3QOXA 3IBGA 3RRXA 3S2SA 1M83A 1XF9A 2IYAA 3KDAA 4ANFA 4AX8A 1XEXA 2QMQA 1USGA 1YR8A 2O3SA 1MTOA 1LX6A 1E3IA 1M6YA 4M0KA 2NGRA 4PLYA 5DTIA 2A3NA 2FSHA 1HKUA 1SKUA 2OVBA 4ND8A 3L49A 2QPTA 1VSUA 5B3JA 3S1AA 1CTQA 5D2CA 5KX5F 1V47A 1DG3A 3E8XA 3HV0A 1UDAA 4JBLA 1E20A 5H3CA 3RVDA 3DFUA 1NXOA 3NBMA 3LX6A 3VSAA 3I05A 3MGBA 1Z4JA 3O3NB 4HXEB 1OFTA 3F8SA 4D0LB 5DHPA 2DAPA 3HWX1 3ON5A 3O2QB 4HV4A 1TK9A 2A2ZA 2IYUA 1K89A 4RD0A 4P3OA 3ZYCA 2IU3A 5JE8A 1GR1A 2QRLA 3ZHCA 3IP1A 4LSMA 1DAMA 1EX7A 1N9ZA 4ALJA 4Q9AA 1IFXA 3OY2A 3ESCA 4NVRA 4RV4A 2VHZA 5KYKA 1NURA 1HRKA 2SHKA 4UQPA 4L2ZA 3D6HA 2F43A 3TQRA 2F8MA 5ISMA 3B78A 4NYMQ 3RADC 3A6JA 3JQFC 4BO4A 3NV9A 4IFEA 3VZBA 3HVKA 4Z5XA 2QUHA 1M5RA 1YS6A 5EZYA 2J08A 1T1EA 2PUEA 4JLWA 1N0WA 3GR0A 3PXEA 2WTMA 5DEIA 1P4RA 1QKJA 3C4VA 3DE6X 5FA6A 1K66A 3LCJA 5F73A 4I50A 3OUUA 5AKIA 5JAMA 3WTBA 1H2HA 1HZZC 3THOA 5LPNA 2WZQA 5C8XA 3RYCB 2BHSA 2WHXA 2COKA 1BCRB 3D6TB 4LDPA 4B45A 1JLLB 2YHBA 3PUIA 3AM1A 2VH5R 1KP3A 1U81A 3PJRA 1H05A 2FX2A 4O4LB 3CZ9A 4OOEA 1HEIA 4J2TA 5HS6A 5BMVA 3IEUA 5BMVB 3N2YA 5ALLA 3PPIA 5TGZA 4NSNA 5E38A 5SYMA 1DJOA 3W4JA 3FWKA 1ISHA 3T4UA 3X2EA 1XVUA 2BCJQ 2VLIA 1EVKA 3FTEA 1WSBA 4B5LA 4DNPA 3IE0A 1TU0A 4WY8A 5EKSA 4OMCA 1EBFA 3PQ5A 1RKBA 5GVSA 4BNJA 5U4XA 1CJVC 4HQKA 1OC4A 3RHZA 4YMWA 5PGMA 4M7WA 4LFAC 1M34A 1WOYA 2H00A 5JLJA 5KJ1A 3T3OA 4Y18A 1EK2A 3GGOA 3IX7A 5BT8A 5DWDA 3G5LA 2JBWA 4ZWNA 2IW3A 4KODA 1BVUA 3CQ1A 1ZC4A 5AIAA 2VSQA 4UU0A 3I9NA 5BR7A 3U1VA 1IB0A 3EVBA 5DM4A 1R0CA 4QUAA 4XVRA 5K0SA 3DM9B 1ACLA 1WG8A 1E4EB 1QLWA 3CE6A 3PEVA 4D0GA 1B8VA 1J20A 3TJMA 1A4RA 4E12A 5BVGB 2GETA 2HCBA 1JBEA 1OUMA 4NNOA 1YS4A 4QAQA 5KTSA 1PYOA 1BS2A 5IBCA 2FJPA 3IQXA 4FMPA 1J7KA 1Z0SA 3OZGA 5C0OE 1X1QA 3TSAA 4BIIA 4GVLA 3U1TA 2J9GA 4FDLA 1E89A 3T94A 2ZBUA 2WJPA 1LQTA 1TM2A 1FLDA 3E70C 1CQPA 3NHPA 3U81A 3B52X 1AB5A 4H7PA 3RRMA 4FB5A 4XRRA 1ZD3A 3ZVMA 2P67A 3W2EA 4D4GA 2YNMD 3A9VA 2FF5A 3ITNA 3TL6A 1WEKA 3PLAE 1JG1A 1SIOA 2OKCA 3CGWA 2ILTA 3G23A 4XFDA 5FQOA 3ZDCA 4IH4A 4WZBB 1JQKA 1KI8A 2XA1A 2I76A 4LF4B 5AE2A 5IBPA 4KQXA 5JS6A 1ZJWA 3MSCA 5KSPA 2P75A 4CHGA 2YYAA 3H5RA 3G2MA 2VZ8A 2MSNA 3FZYA 3QOYA 5JYCA 1P1HA 2D5IA 3B48A 2XB9A 5HIJA 1DKUA 1F2DA 4CODB 1RCTE 1K7FB 3ZWYA 3CNLA 3D54D 1LJ8A 2AR7A 3KEMA 2WHQA 3PQ4A 4ZP1A 3SDZA 2YHIB 3ZLBA 6LDHA 3R24A 2OO4A 1PKEA 3PRYA 4DSUA 1NVDA 2A84A 3DBHA 4U2EA 5AKHA 4HYQA 4X20B 4WNAA 1E3JA 3D8NA 3C5EA 2BTQA 5I8WA 2IH2A 1WA5A 1TAQA 3TH5A 4R1UA 5B1HA 2IDZA 4EIWA 3EH2A 5F9HA 4WDRA 4Q9HA 5LLTA 4IDPA 3HKBA 4RVSA 2G76A 4YY3C 4B17A 1UMCB 4UC0A 10MHA 1XRNA 4PNPA 3ASUA 2XNHA 4PPNA 4UTXA 3T5MA 3CHYA 4C0AC 3I04A 2Z43A 1XHJA 2XTNA 4L0MA 4QOEA 5CXQA 3TVTA 4DJAA 1GU7A 1DUIA 5HUHA 4JI6B 1L4MA 5AVOA 2GXSA 4BZZA 1JEYA 4UM7A 1XU9A 2XT6A 1MOPA 5J4HA 1FYVA 3ZE0B 3OZ7A 4E6EA 1KHHA 5AW1A 5BO5A 3EAFA 3NVAA 1KXJA 3BCUA 1RXIA 3OP1A 1YZYA 2EOAA 4M0PA 3TQSA 3WQRA 5AVVA 4NBTA 3IPRA 2A0FA 1B8PA 3TZHA 5KBYA 5BNFA 4EABA 5HVNA 4YV1A 2JIDA 4FCCA 4D43A 1CLEA 3ROXA 1SBIA 3F8WA 3OEWA 1VSBA 3OM0A 2BM8A 3FNIA 1T9KA 5J2TF 3FPHA 2AZDA 4EZIA 1WDKA 2HBQA 3NDIA 1F2TB 3HJBA 3OWHA 5DHAA 2C04A 1Z9BA 4I9NA 1SPBS 4UE3S 4Z9AA 5K8TA 2F55A 1YJBA 1H85A 2X77A 4PC2A 3VZPA 2AVDA 4B4UA 1TTPB 4PCLA 3MNFA 3SD7A 2C4WA 4H3SA 5B2ZA 1A9YA 4ZJPA 5G3ZA 5ADHA 3T52A 4FPXA 3NBKA 4P0PB 4CKEB 3NW9A 3OQHA 1P2BA 5JXGA 4NQZA 3FCUB 3Q8WA 3KL4A 1JLKA 5EESA 3ZW7A 4EG0A 2IW1A 1I9GA 4RV9A 4DDTA 1H4QA 4M8NE 4K03A 2MCFA 4ENTA 2REQA 3CYFA 3O8CA 4DBLE 3L7NA 3R76A 4J03A 3FHJA 3WL7A 4B7ZA 3I5YA 3SSOA 4KWTA 4NE7A 4BE9A 3NLLA 5I4CA 1T8TA 1H3FA 3EBOA 3GDGA 5TQ0A 2DY1A 4JI8B 3SIXA 3CTMA 2QG4A 3H1BA 2OG2A 5DP2A 5AYVA 1KZGB 3NEAA 5KQRA 2QTRA 5BN5B 1IZZA 2F43B 3SI7A 3W3AH 4K9RA 2AJLI 1KU6A 1P74A 2QMUA 1AK1A 2BGTA 1J0DA 1GPDG 2ZSKA 2A59A 1QFSA 3G68A 3OQPA 3Q87B 2C29D 3X2FA 2OT3B 4L4XA 4RF4A 1VRVA 2C9ZA 3WQQA 5KKNB 4X65C 3S2ZA 2WAAA 2WWFA 1ULTA 5H81A 1FDUA 4BFZA 2PZGA 4B09A 2HFKA 2OO7A 1OREA 2OAEA 4PAGA 4PO8A 2IV3A 3SOPA 1IDN1 1LI5A 3K1AA 2E21A 2HLDA 4GZLA 2ZU0C 2WE8A 4MQUA 4LHWA 4RFSB 1KSHA 3AIMA 3FVQA 3Q3IA 2P30A 4M83A 5FL3A 3ZD6A 2IA5A 3FPSA 3NQ41 3OURA 3GUHA 3R7DA 1OWMA 3X1DA 1NP6A 1TYZA 1TEXA 4UHJA 1SQ0A 4NZ9A 4QICA 4F85A 1WQ3A 1XGKA 3DOFA 1E8NA 1X1AA 4NYIQ 4BV2A 1W4AA 4FT2A 4MV7A 1I1NA 1QMPA 1AX9A 4M89A 3NHBA 4M9ZA 1GUBA 3QE0A 2UZ1B 1XLTC 2JVKA 2X42A 1LPAB 4FFWA 1HSOA 3DL2A 2HBYA 3V7WA 3PJDA 4JI4B 4UDYX 1PF7E 1UBFA 4UULA 1SXJE 1I13A 4IX9A 5TQJA 1MO5A 3JV7A 1UMDA 2QP3A 2J07A 1Y5NA 1GQFA 4F8JA 1B7GO 1QAOA 1F17A 5C1BA 5HR5A 1L5LA 3EUWA 3PZRA 2J5RA 3F5MA 5I5EA 3BJZA 2XCIA 2ZT6A 1QE5A 2C5LA 3IAAA 3LPMA 4WZAB 2V7BA 2A8YA 2XQKA 2ZGVA 3EXG1 1NF9A 3UZUA 2HCRA 5M04A 2QD4A 3D3NA 3HFGA 3DT6A 1WY5A 1E4EA 3DAOA 3IILA 4II2A 4S24A 4NYJR 4Z2YA 2EFYA 4PZDA 1ZIDA 4R51A 3ZIDA 4BX3A 1G6KA 5IFIA 4LVCA 3C3AA 1IEXA 3KEFA 1J09A 2IXTA 2HM7A 2F90A 4CIXA 4G0NA 1KQPA 1O92A 3R77A 4HQRA 3UKJA 2ZWPA 3VFDA 5KYNA 2O8BA 4G1CA 4L15A 4WKGA 3RUFA 5K8JB 1HNNA 2HY7A 3LUJA 3UGQA 3RAEC 4X44A 5IWCA 4DJFC 4FIZA 1TMOA 5ALTA 2AC4A 1T3ZA 2YOGA 1S2MA 2ZBRA 3I3OA 3C41J 4GKBA 3UXHA 5IF9A 4L5IA 2KMLA 4PG8A 3UHOA 4Z0NA 4YFVA 1O7JA 3COJA 3CNEA 2ZRJA 1YOVB 3ZE2B 5K0JA 4ND5A 1NN3A 2J9FB 5FOXA 1JJFA 2H1SA 3DB2A 3OMXA 2UUOA 2M6KA 3AUTA 3CN7A 1XDDA 2DKFA 5G1PA 4KSBA 3PDIB 4FJ2A 2NQTA 3IGFA 3TZCA 5I9LA 3K16A 3ZDFA 4YXFA 3WG9A 4NXMC 3FB1A 3LMKA 4DCCA 1WUJS 3FWPA 2JVJA 2C7GA 4IR7A 4CF3A 2W6QA 4ZOLB 5K7SA 2R8BA 3WYDA 3OZDA 4MPRA 4YRCA 1KAGA 1DJQA 4DMGA 4M1OA 1PK8A 2YVKA 4UCWA 1PJCA 1P7VA 1XRQA 4RESA 2J5QA 4QDXA 1APBA 4TTPA 4ZQGA 2Z2ZA 4YUAA 5IDXA 1PZHA 5CVDA 2WJIA 3DLHA 3H5TA 2IHNA 1KI9A 1ZRSA 3CLSD 5BPFA 3N3AC 1XX6A 2XYRA 2BFBB 3HZHA 4BASA 2JC3A 1NATA 4HWTA 4BEBA 1YZTA 1RI3A 3SN6A 1DLJA 3TQHA 4KB5A 3TX2A 3KALA 5K3OA 3UZ0A 2VXOA 3B1JA 1BKDR 4LGMA 2GM9A 4NMXB 4ERXA 2P1RA 3O90A 3VYWA 2PSJA 4RJTA 3HBJA 5DNCA 1VJRA 3DG9A 2GNOA 1RLUA 3OLCX 4EUSA 2CLMB 2W2PA 1T5DX 1XE3A 3H9GA 4DZRA 1LX7A 3L40A 4GIBA 1E77A 1HRDA 1E2EA 2XQVA 4HC4A 3OZEA 4MQLA 3VNAA 5EEGA 3K0SA 1EP9A 3CX7A 2MIIA 4QLBA 3LNOA 2VBIA 3FSEA 3CJRA 2FPGA 4BE7B 1F6DA 1U7UA 2H51A 3HRIA 2V6GA 3DZDA 1XTQA 4M37A 2QMEA 3FWZA 3PUKA 4RM2A 3OCUA 2HWWA 4JL8A 4IQGA 4YRLA 3RVJA 3N87A 4EVIA 2VYCA 4BO6A 1KERA 2NXJA 2FB9A 4JGBA 4R9NA 4OMDA 4A92A 3A05A 1CJUC 2CFCA 2WJGA 4X3PA 3MERA 5I4IA 1MW8X 2HU5A 4W8GA 4LF8B 2CBZA 4ZA2A 4H15A 5A03A 1I10A 1NHGA 1NW6A 1SWWA 1PGJA 2P7HA 3KAPA 1HF3A 3CPEA 3MWFA 4KWIA 4IWNA 4F3KA 2XGSA 2QU7A 2XTZA 3OF3A 2ODAA 4LYHA 4E07A 2WWTA 4Z4CA 4BKMA 4N54A 1FUEA 4S1TA 5KYTA 1Z0UA 5CFZA 3UJ6A 5L7TA 2IBTA 3SQXA 2INGX 4D44A 3CSDA 1M74A 2PGAA 3VH2A 3Q8KA 1E99A 3P2OA 1L8LA 3IEXA 1QX3A 3OO0A 3UJBA 5C4IA 1JA0A 2D1QA 3VO8A 2ZM5A 1CUCA 3IAM6 5LQMA 2IITA 3C24A 3R7AA 1J25A 3G8BA 1LDYA 2R6GA 1GGHA 4QVGA 3DE1X 3UF0A 4RK1A 3W05A 2FFBA 3D3KA 4W7HA 5DHSA 2EZUA 3OT4A 5K0LA 3U4HA 5KNCA 5J2UB 2YWBA 3WK4A 2P8JA 2XA2A 3RYHA 3VC2A 2MSLA 4H77A 3HFSA 3TFWA 1Z2NX 5DLQC 1M2VA 4KXVA 1JX6A 1TYBE 4RAQA 3EGEA 2ZULA 1SK8A 4JX9A 4DV6C 1HEUA 4PUGA 4FYHA 2QWXA 3KZVA 3D7RA 2FKAA 5CT8A 3SJCA 1JR3E 2BONA 3I72A 4JDPA 3U7EB 3BHJA 4V3BA 2XCQA 1VJ1A 2BKXA 4INOA 1VP3A 2WZCA 3HU1A 4NL4H 1JMYA 3WNQA 4G5FA 2I6SA 3UV3A 5CFMA 5LDDC 5C52B 3CB2A 4EB8A 5GV8A 2E0IA 4XJSA 3EQ7A 3RGGA 5IRCD 2OUIA 5D1NA 1NN1A 4L9WA 3K0FB 2DVMA 3NHAA 5EIFA 4PN3A 3EB9A 4OIMA 3ECAA 3WFZA 4D9IA 3TNDA 2GNAA 3Q1LA 4OLAA 5AHXA 4AQ7A 1CIVA 4MWTA 5ALYA 3E1GA 4XDGA 3CZ5A 2FPWA 4WY2A 4L72A 2GSDA 2WTBA 2XE8A 3JRWA 4CVNA 1R27A 3K1ZA 5EI5A 5J63A 2GSWA 3STUA 3M4XA 2P2DA 4YRKA 3STHA 5JU6A 4CEIB 3GUZA 3TXAA 1Y7TA 3AQ4A 3VZRA 2BJHA 4W8OA 4NBVA 1N33B 4B40A 5J9FA 4U0JA 3H5LA 3EFOA 3HYNA 3PGA1 1JLRA 3LUHA 3LY8A 1X42A 4II3A 4JV5C 1F4PA 4TL7A 3PEWA 5FLXD 1BWPA 4JJ4A 4S12A 3SX4A 2FR8C 4J4TA 4RSMA 2YWRA 3UB3A 3VX4A 3KYIB 821PA 1OTYA 2ZRNA 4M1KA 3NNSA 4KTVE 1QK3A 1TU4A 4NPAA 4UBMA 4XWGA 1VBNA 1M2NA 1O94D 1D8TA 3AUJB 4Q1FA 1D4OA 1SO8A 4H31A 2VJOA 2XGOA 1PWZA 1XELA 2E4UA 2ZIEA 3KUXA 5FUXA 3OY7A 4EB0A 4KHZA 3UPTA 1OZFA 2YXBA 1V11B 5F21A 3OZFA 3LK6A 3TOCA 1BHJA 1E6UA 1EWKA 1NY6A 2M1XA 1T91A 5L45A 1YR1A 2GAIA 3FYTA 3EGCA 1DARA 5HZGA 1LRJA 2EIXA 1NUUA 4B1FA 5EIHA 4RVFA 4KXFB 2OSBA 4X60A 1O6ZA 3G3EA 4QXQA 1VHWA 2CEKA 3C6ZA 3PNPA 2VDWA 4JP8A 4IMIB 5B1EA 1ZW1A 1XD9A 1NQVA 4PSCA 3VKUA 3ZXUB 4B6QA 4PUIA 2YJ6A 2QTAA 3GVIA 5AK0A 3OCJA 1DOZA 4CDRA 2DETA 5KTTA 1H2WA 1YI8A 4QQNA 2PL3A 1NRWA 1SNYA 4O4IB 3K0BA 4Z4HA 4HMOA 4QM7A 4Z4IA 2FKNA 1W0JD 2JZNA 4CM4B 3VKWA 3BICA 1FMTA 1TVCA 2EKPA 3S1AB 4EK9A 1QDUA 4Z4QA 3GI1A 1T9GR 3VKFA 4EMSA 3AT1A 4ALKA 1GNQA 2Q1TA 4IJQA 4C0JA 3K6SA 1WZUA 2SCUA 3OPNA 1D2EA 4IDEA 4YQEA 3H1AA 4JH0A 2OBBA 3LAXA 4S1WA 4CQMD 1BDHA 3TNYA 3AVXA 3IUEA 1JYEA 4XARA 4E5NA 2ATVA 4J0JA 3NGMA 3RARA 4GYKA 4TLDA 2VDPB 1JIIA 2V96A 1IHXA 5FPTA 2F59A 2L18A 3FCSB 3ONVA 2BLNA 1Q0LA 4E21A 3ZJTA 3IEPA 4DR6C 3KKNA 5KUTA 3AVTA 1K06A 1G5RA 2NO1A 4X8MA 5JWOA 1G8GA 1KDTA 2HRQA 5CNMA 4G0UA 2ZYIA 4YRDA 5FPSA 4JKOA 2KX7A 3LX5A 2O2XA 4LF6B 3NFRA 5H5JA 2OZLB 2ZKIA 3IAS1 1FQKA 3HEMA 1Y8RB 1V8ZA 4INZA 4Q3EA 2LCIA 1XUOA 4KFTA 4ZOLA 4DDHA 4KACA 4XWWA 1QOZA 3DMTC 4JODA 3L04A 4N1AA 4P7FA 3KQHA 4CMCA 3P4YA 1K8QA 2EEZA 3WZLA 2PPVA 3QBVA 2PE5A 4KRFA 3WMGA 1N57A 1V3QE 4K9QA 4WBNF 5DSTA 3UTDA 2WIBA 4RTOA 2Q8PA 3F5FA 3CUVA 2HDOA 3KHTA 4WESB 1OR8A 1U3DA 4D45A 4UU7A 1BFKA 4BO5A 4NH4A 4KJZA 4RHUA 3T7SA 1SCNE 3AI2A 3SLKA 5H16A 5E3IA 3FZQA 4PSKA 3AEQA 2B20A 3TW6A 4Z0TA 2FOIA 2BISA 1U8FO 1L4GA 1TVMA 1W4BA 1YIOA 2OILA 2QS9A 3RVBA 4Z7NB 5HYVA 1EP1B 2QRQA 4M99A 3ROMA 4CM8B 2WINI 4ZCMA 4Y30A 4L8WB 4ENSA 2XUKA 4KE6A 3WLRA 3EVZA 3ID6C 3HUFA 1H8HD 1PHPA 2OD2A 3DVSX 1GCGA 3MFQA 2Q21A 4JS0A 2XAAA 5DM0A 5LXTB 3GFBA 3QEOA 4UTNA 2IX3A 1G7RA 3T3MB 2PFKA 2NZWA 4V38A 1HH4A 2VPPA 2WVGA 3N58A 4LFBB 1HE3A 1GA6A 1QG2A 4NDZA 1DQPA 1GRNA 1K7YA 3E3MA 3SQOA 2DBQA 3CWQA 3O03A 2MHCA 3FGZA 5CPBA 2V03A 3D3WB 3LVRE 4WZAA 2IOHA 1H4VB 3I04M 2P91A 2C57A 4PV7A 4UUMA 3O47A 2X2FA 2R0QC 1NOJA 1T8RA 5TDHA 5FX2A 2CWWA 1QRAA 1HO3A 3QSYA 1VL5A 1MGPA 4MWEA 1CUHA 5E0OA 3PHIA 4RGBA 4LYDA 3ZQKA 3GRCA 2QENA 2QNRA 3Q3CA 4KRYA 2ZTHA 3B53X 1ICEA 3LHIA 4HFJA 1FP7A 1YU6A 4FGWA 1BE0A 2E4ZA 3N86A 5TY0A 3TBFA 3L4JA 2P69A 1WCIA 4WASA 3LS2A 4KW7A 2CMHA 2QTNA 2OCDA 1U65A 3BFJA 3IA7A 3CVYA 4JJFA 4CIDA 1H3NA 2ZTMA 5KVAA 2FDXA 4MIEA 1UQTA 4ALMA 4X6YA 2E0GA 1DVRA 3EA5A 2ZBDA 4MLDA 4O8CA 3TLGB 4LJYA 3EIXA 3ML1A 3CINA 4ROTA 3AINA 2FN4A 4YAWA 4GMGA 3FOFC 4Z0HO 4RFSA 2L69A 5KHLB 4U00A 1N6KA 2DUUA 5FOSA 5TPZD 4BNNA 4N76A 4TYWA 2ZUTA 4MQEA 2JNVA 3CKLA 3GQBB 1OILA 1UADA 5HZMA 1GG5A 1E66A 3NX4A 1DOHA 1ZP6A 1WDTA 4LZZA 8GPBA 4L85A 1KFCB 4Q9LA 5DXAA 1QIHA 1DCMA 3LTNC 3VV3A 1AK2A 4CDMA 2I99A 1SQFA 1XRMA 5TEWA 5KC8A 3KYBA 5AO9A 4YRZA 2IXBA 2I7XA 3B9QA 5IH3A 2ZIZA 3UAVA 1EWRA 4AKSA 3CEHA 1AUVA 2A35A 2QRVA 4KQKA 4AS2A 4BWGA 4ENUA 4KE7A 2MYPA 3GRZA 5BUCA 5IW8A 2QB5A 2HTFA 2O4CA 1Z62A 3D4IA 1YI0A 4KQEA 4DADA 1XU4A 3A1DA 3PWSA 4TS9A 1O58A 5A3RA 4Y2TA 4U7JA 3JZDA 3KOWA 1YGYA 1NV8A 2B8NA 3S27A 5HM6A 4RD3A 2PIAA 3KZKA 1C1DA 3ADKA 3G5AA 2OHJA 5DBEX 1DFHA 4ME6A 1ZG3A 1RI5A 4QQFA 3ZHRA 3RHTA 3GYGA 1XNHA 5EJ7A 2CXNA 3HGMA 4Q7MB 4BLUA 3QUCA 2X6TA 1GGJA 4KGDA 4TRJA 5DLDA 4RPJA 3WLIA 4B6EA 1QHSA 1SIBE 1XDGA 2J41A 2Z8ZA 3HZOA 3ED1A 5AVZA 2VZ9A 4GKVA 1W75A 4B3SC 1BFDA 1UBCA 3RC3A 4U2KA 3TN7A 5U1PA 4O0MA 3VZDA 4XB2A 3W78A 2PWYA 5HIAA 3K09C 1E9VA 4PR3A 4WXYB 3CRVA 4MUFA 1E2FA 4CU2A 3PCRB 1BS9A 5TC4A 1YULA 2PXHA 1AKVA 3ASVA 4GO1A 2EDCA 2BGWA 4EW1A 3E7DA 1VE1A 5FBQB 4EECA 3FOWA 4DR7C 1RWBA 3I83A 2O2CA 1RAHA 1UK9A 3OLVA 1ZICA 3B6IA 5TRTA 2ZSEA 3JWHA 2XUDA 4TV9A 4AY5A 2ZK7A 1LK7A 3QLEA 4JUFA 1ML8A 3VR5H 3ZU6A 1MD9A 1Z18A 4AURA 1W34A 2PH1A 1ULSA 1VSTA 4L50A 3EGOA 4OP3A 1PWHA 3TNLA 2J3LA 4PAQA 2GJSA 2YDXA 5FNVF 3V7FA 1DNPA 2PRZA 2V8BA 5IANA 2BGGA 1NC1A 1W30A 2VP6A 3DR5A 3K73O 1M6HA 4DF3A 2JIZA 1PT5A 1RCUA 2VQSA 4FR0A 1NQWA 2Y71A 1XP8A 1RBZA 4JKYA 4WNYA 4CBVA 5AW4A 3DAGA 4MYRA 1NJSA 3DT8A 1NJGA 1M33A 2P0EA 2ZYDA 3L93A 1PW7A 4KXXA 4TKUA 5CD9A 4LY0A 1P18A 3M6UA 3BH6A 4D3SA 3GLIA 4JXKA 3D7MA 1XTJA 3WP1B 2RGCA 4Y6SA 1M10A 3DE4X 5EWJA 1F12A 1Y9EA 1Z6PA 1G66A 2A5FA 3IQEA 1QGUA 4BO3A 1NVAA 2B2XA 3GP3A 4MWCA 3HU2A 4IDGA 4CL0A 3CZAA 1K0FA 1PGOA 2J3MA 5JAOA 2AFIB 3K94A 2I1QA 1ZYUA 1XKXA 1R8XA 4FNAA 4E5SA 2VF4X 4HL6A 2X8LA 3HXTA 2H3HA 2JAHA 1GZ6A 1QXSA 1H2XA 1VRWA 1IUKA 4ZYLA 6ABPA 4JYAC 4K9LA 4AJ2A 4B3SB 2GK3A 3G8AA 4HP8A 1Q6ZA 3CUTA 1ST3A 2FW9A 2GJ9A 4UHEA 4JLJA 5SICE 4NOZA 2I87A 2AWOA 4YMUA 4BBYA 4NDNA 1JT9A 1F4VA 1UKEA 3EMBA 3FCOA 4YREA 5IX8A 2NZUG 1QP0A 3KLPX 1SOVA 1RYNA 5JRHA 3GZNB 3GRAA 3QKWA 1NXPA 1RWWA 4KV9A 1XWIA 1FVXA 4QPZA 4WNIA 4CTKA 3ZWKA 3CX3A 4K6GA 3EOZA 5AXBA 2BI7A 4J1TC 4Y8VA 5FULA 1F1BA 3BG5A 3LW7A 5TSDA 1PV1A 2CCJA 1C7FA 2BM1A 3L4BA 3RIGA 1CR1A 2J4CA 3BFKA 2BEKA 5C1IA 5EXSA 4WCDA 1R7RA 3R3JA 1E3LA 1RP7A 2W6PA 4AD8A 1IQRA 1XTTA 2EJBA 1C7ZA 2MSDB 5GVRA 4DR4B 2IUFA 3BXGA 1F0YA 3IJ5A 2YIVX 5DRYA 2V4MA 4NWIA 2XX3A 1RKXA 1RC1A 1POXA 2BMAA 2DRIA 1NXSA 5LOVF 1XNQB 4XWTA 3O26A 3ZQ6A 3WGJA 3WVNA 4WNCA 1JUDA 4LMBA 4D3FA 5LU9A 1OLUB 4GKJC 2F1HA 4OGFA 5GAJA 4E2FA 4RTPA 4KUHA 4R1TA 3GBPA 1H2AS 3W5UA 4MDYA 2FXIA 5TPWA 1C1HA 4Y2HA 1M0WA 1G2IA 2Z2XA 2QOEA 4CQNA 3K6RA 3EZFA 1UJ4A 4Y1GA 2IEGA 5FUYA 1QV6A 2C0PA 2RHMA 2W4QA 4RTNA 1UMBB 2QE7A 5IT4A 2QM8A 4PHHA 3BRCA 4Z9BA 3RVMA 1NU8A 4MR7B 4LHSA 4HB3A 5DX1A 3ORRA 5KYYA 2BAGA 4P81A 5AW6A 1YB5A 3EMDA 1UBUS 4FNOA 4ZQBA 2Q41A 5IJ0A 1TT5B 4FLEA 3EPHA 4DCGA 1II8B 3Q41A 2J67A 4ZHQA 3HXOA 3ZW9A 4JFAA 3A3OA 4XM1A 2EBWA 3CSSA 5A0FA 1H0KA 4R7GA 4G3XA 4F11A 1OYOA 1CR6A 2BH9A 4G97A 2XUOA 1X7ZA 4F2GA 4MMZB 4QJBA 1I7SB 3H1PA 2CDNA 1CUXA 2IE0A 2CXRA 3D8BA 1DAOA 1JKIA 3FYUC 1KKGA 4G36A 2CNBA 4MK4A 2W4MA 4WLEA 5DF1A 5T3YA 2FOLA 2OOSA 4ZC8A 1YI1A 4U5XA 3HN7A 5LUBA 2O8EB 1IG0A 1L8AA 3LH5A 3A2MA 3B1KA 4DYHA 5SZHB 4US2R 3P2KA 3IXLA 3FWHA 4CEJA 4Y3UA 5BUQA 1X14A 1ZI6A 1FS6A 2E2WA 2ISSD 2Z9BA 1FFBA 4LXUA 1X7WB 1J8VA 3CV3A 3L0DA 2HPAA 2E82A 2ODPA 1MAVA 2B1QA 1T13A 1C3JA 2FZVA 4B6FA 2PRSA 1DPGA 2PAFA 1LD3A 2WF7A 4L76A 1ZKDA 4TLLB 4OK6A 1FTWA 3NBAA 5JNSA 3RUIA 1G8MA 1K08A 4TRRA 3DV0A 4X6LA 2C42A 3OJLA 4QT4A 1SK9A 1NQXA 1SD2A 3K92A 4TLCA 3TIFA 1R9NA 1RE1A 1CEYA 1YZGA 3LP5A 3NTRA 2FLWA 2Y2UA 1TM4E 2CLFB 4RD2A 3I8OA 4GM0A 1KMHA 1TU3A 5A7GA 5IAEA 3C7AA 2PUAA 5MDHA 2Z56A 1JDPA 3OT1B 4RYLA 3OIYA 3MELA 4TMZA 4I2VA 3UXMA 2GD0A 2IS6A 2R2AA 4V1CB 2QJOA 5HE9A 2ZWIA 4UNIA 1MIOB 4RE5A 1N6IA 5EERA 3WYFA 1Y8AA 2FK7A 4F4JA 4AP6A 4YYZA 2QF7A 4YRFA 1GZUA 1OXBB 2FEPA 2XCUA 1ORVA 2KYRA 1R8QA 4GSKA 1SVUA 2G9RA 2HK6A 2JLXA 1OB2A 2PGIA 1D2NA 4GI7A 3FNQA 3K32A 4AF7A 1E94E 2SECE 1QTIA 1LVUA 4BATA 5ALVA 3UMVA 2J5XA 2CF6A 2V9CA 3WLKX 1EUCB 2D1RA 1GNRA 4BZWA 1QCZA 3WMWA 1OXVA 2DJIA 1WNTA 2ZB2A 4CG2A 1O9GA 1EVLA 2A92A 3Q12A 1VLHA 3EWSA 1ZS9A 4UBIA 1ZIPA 4Z1MA 4EO9A 3MCVA 1G3QA 4FE3A 2QE6A 5KZMB 1ADCA 3P0RA 4TV8B 5HMLA 1XF1A 5TGDA 3BQNB 3D6UA 1IHUA 4QOFA 4IZ6A 3W5DA 3ADBA 4WKNA 4DANA 1ZX1A 4H0FA 2ECOA 1BKYA 2ACKA 5AVJA 1Q19A 1WXGA 2NSDA 1V0JA 3BT7A 2X9QA 4OB6A 1KKLA 4QJ3A 3X0DA 1GRCA 2B7CA 4JEUA 4L02A 4QOSA 2ODQA 1P9RA 4YMIA 3ZLJA 2OYCA<