2PN2A

Crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
137
structure length
137
Chain Sequence
LYFQGMTTSKVTYQGDLRTSAIHLQSNNEIITDAPVDNQGKGEAFSPTDLLATSLASCMLTIIGIKARDMEIDIAGTTAEVTKVMAADPRRVSEVHIAITFNQELDDKTQKIFYNTALTCPVAKSIHPDIFQKVIIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_263861.1) from Psychrobacter arcticus 273-4 at 2.15 A resolution
rcsb
source organism Psychrobacter arcticus
molecule tags Signaling protein
total genus 32
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2pn2A00
1ZB8A 1N32C 1LQLA 2E5LC 4B3TC 3R9WA 4MTNA 2UUAC 4JI1C 4X62C 4DUYC 4JI2C 4DCSA 2E8CA 4DR6C 4LFBC 1WF3A 4DCTA 4DV4C 1N33C 2CY1A 3LUSA 4DR3C 1HNXC 5BR8C 4DV2C 1I94C 2UXCC 4MH4A 3J80D 1J5EC 1XNQC 4X66C 4DV0C 1FJGC 5A2QD 2UXDC 1USPA 1IBLC 2VQEC 2HHHC 1N34C 4JI6C 1L2FA 1EGAA 1QWIA 4DR7C 2UUCC 2ASBA 4JYAC 4LFCC 2XR1A 2EGTA 4YY3C 3JAMD 5LMUC 3T1YC 4JI7C 1K0RA 2E7GA 1UKKA 2E8EA 1MKYA 2YCBA 1N36C 4B3SC 5FLXD 2PT7G 2HJGA 5IWAC 4LF9C 1KKGA 3J81D 3IEUA 4DUZC 4LFAC 2D7VA 4JI0C 3CJEA 4X65C 2UUBC 4GKKC 2PN2A 1HNZC 4LF6C 4DR2C 4BSZA 4LF5C 4NXNC 4B3MC 2CXCA 4DV1C 4JV5C 3T1HC 1HH2P 1WH9A 3GKUA 3R9XA 4KHPC 4DR5C 3I07A 1XMQC 5LMNC 4LF4C 4AQYC 2E8FA 4DCUA 1HNWC 1IBKC 3EERA 4XX2A 1IBMC 4JI3C 4DV5C 4DV3C 4LF8C 1N2FA 2DYJA 4DR4C 1JOSA 4JI5C 2ATWA 4NXMC 4B3RC 1VLAA 2UU9C 4DR1C 1XNRC 2BJOA 2JMPA 1XMOC 3AF5A 4YHHC 3OTOC 4K0KC 2UXBC 4JI4C 2KZFA 1ML8A 3AF6A 2VQFC 4DV7C 4GKJC 3IEVA 2QL8A 4DCVA 4X64C 4JI8C 4OX9C 2F4VC 1HR0C 2OPLA 1ZB9A 2ONFA 2OPLB 1PA4A 4LF7C 4NOZA 1NYEA 4DV6C 1USPB 2ZM6C 5IT9D
chains in the Genus database with same CATH superfamily
4HPVA 2E5LC 3R9WA 4I9GA 2UUAC 2D1RA 5H9UA 4X62C 3A26A 1WF3A 1GPMA 3DHVA 1M6XA 1N33C 4OYCA 1HNXC 5BR8C 1I94C 4MH4A 4X66C 3VNSA 5A2QD 2UXDC 1IBLC 2PROA 2VQEC 2HHHC 5BSUA 5BSVA 2DPLA 1RG9A 3PBKA 4G36A 4EATA 4GXQA 3UX3A 1P4EA 3I08A 1O90A 4JYAC 1UWDA 2EGTA 5BSTA 3T1YC 2P20A 3TQIA 3AY0A 5IFIA 3N2QA 2CU6A 2HJGA 2D1QA 1VEHA 3ETOA 1KKGA 4RMNA 2Y4NA 5K8FA 4R1LA 2WP0C 5BUSA 1MD9A 5A1IA 4BSZA 4B3MC 1TH5A 5A1GA 2YWCA 3GKUA 1WH9A 4L7IA 4DR5C 4AQYC 1IBKC 3EERA 4D4IA 4FUTA 2QVXX 4LF8C 1N2FA 2Y27A 1PG4A 3O2EA 3VNQA 4DR4C 4DG8A 4DR1C 2BJOA 2JMPA 1BA3A 1PG3A 3CQ3A 2QW0X 4DV7C 3UOWA 4LE5A 4DCVA 2F4VC 2V7BA 1HR0C 1ZB9A 5AE2A 3NI2A 4LF7C 4PHTA 2ZM6C 1AMUA 3CW9A 1N32C 4B3TC 4MTNA 2BH1X 4PROC 1PU1A 5K85A 4JI2C 4PUIA 2E8CA 4DR6C 4LFBC 4D56A 2QVZX 4DR3C 2Z51A 3GPCA 3LAXA 4FTFA 2UXCC 1MDBA 2VSQA 3J80D 4JI6C 1L2FA 1EGAA 4BC9A 5KEIA 4DR7C 3DLPX 3TR3A 4YY3C 3JAMD 2ZZNA 1YJ7A 3NPDA 3C5EA 3DAYA 5FLXD 2PT7G 1FLOA 1V26A 3GR0A 4LFAC 2D7VA 2DHMA 3CJEA 4BCAA 2PN2A 3UEBA 3K6RA 1HNZC 4LF6C 4LF5C 2YWBA 2YX1A 2OO4A 4KHPC 2ZZMA 4RLQA 4XX2A 4OXIA 4DV3C 3A9UA 2DYJA 4ZLPA 4NXMC 3VNRA 3ETCA 1VLAA 2UU9C 5BSRA 3RG2A 5DV9A 4ZJZA 3LNVA 2KZ0A 3KXWA 3AF5A 1XRAA 2P2FA 1IB8A 2E0GA 4RM2A 5AE3A 3G7SA 1ML8A 5CZXA 3AF6A 5T8TA 1XHJA 4D4GA 2OPLB 1PA4A 4NOZA 3H2TA 2D1SA 3GR1A 1ZB8A 5BSMA 5BURA 2P2MA 4RM3A 4JM1A 1LQLA 4TPSB 5AE1A 2D28C 2NCLA 4DCTA 4DV4C 4K0BA 2CY1A 3LUSA 4DV2C 2P2BA 4IZ6A 4WS9A 1XNQC 4DV0C 1FJGC 3E7WA 4NDNA 4ISBA 4D57A 4PUGA 2M5HA 1QM4A 2UUCC 2WD9A 2ASBA 2M5OA 2XR1A 4KTVA 4JI7C 1K0RA 1MKYA 4B3SC 3TDEA 3IMLA 3R44A 3B7WA 5IWAC 2P2QA 1O9TA 4LF9C 3L8CA 5KYVA 3J81D 3IEUA 1P7LA 3CQ2A 3UZ0A 4JI0C 4X65C 4GKKC 3E7XA 2CXCA 4DV1C 3R9XA 4DG9A 4BC7A 3EQ6A 5LMNC 4LF4C 2E8FA 2OBVA 4JI3C 1XS3A 3SO4A 1JOSA 2ATWA 3PESA 2KDNA 4YHHC 1MXBA 2JNVA 4K0KC 2UXBC 4JI4C 4BBYA 3IEVA 2QL8A 4X64C 4JI8C 1XRBA 4OX9C 5KYTA 3A4IA 3LNOA 4I9FA 4DV6C 1M6XC 5IT9D 2P02A 5LCIA 2VZEA 3S82A 3LGXA 3NYQA 4JI1C 4DUYC 3CQ1A 5JRHA 4RVNA 4DCSA 1WCJA 3A9VA 1MXAA 1P4EC 2MCQA 4WV3A 5E7QA 1O93A 3PROC 1J5EC 2QVYX 1USPA 4IR7A 4ODJA 3FCCA 1N34C 5BUQA 1QWIA 3N54B 3NYRA 4LFCC 1T5DX 4L4QA 3RV2A 2D1TA 5LMUC 4PUHA 1LCIA 2E7GA 1UKKA 2E8EA 2YCBA 4G1IA 1N36C 2P2JA 2Y4OA 1V60A 4L2ZA 1NY8A 4DUZC 4R1MA 5CZVA 3IPLA 1RY2A 3TUFA 2UUBC 4GXRA 4GS5A 4DR2C 3FCEA 4NXNC 4R0MA 2AYAA 1O92A 4JV5C 3T1HC 1HH2P 5T8SA 3I07A 5GTDA 1XMQC 1HNWC 4DCUA 1IBMC 4G37A 4DV5C 1MXCA 5ADZA 4RLFA 1MDFA 4JI5C 2D27A 4B3RC 5A19A 4U5YD 3A25A 1XNRC 3L95X 4PZPA 1XMOC 4FUQA 4RVOA 3OTOC 2KZFA 2VQFC 5BSWA 4KTTA 1FUGA 4GKJC 2MM9A 2MMAB 3UX2A 3CW8X 2OPLA 2ONFA 1T5HX 1NYEA 1XRCA 1ULTA 1USPB 1V25A
chains in the Genus database with same CATH topology
4HPVA 2E5LC 3R9WA 4I9GA 2UUAC 2D1RA 5H9UA 4X62C 1WF3A 1GPMA 3DHVA 1N33C 4OYCA 1HNXC 5BR8C 1I94C 4MH4A 4X66C 3VNSA 5A2QD 2UXDC 1IBLC 2PROA 2VQEC 2HHHC 5BSUA 5BSVA 2DPLA 1RG9A 3PBKA 4G36A 4EATA 4GXQA 3I08A 1O90A 4JYAC 2EGTA 5BSTA 3T1YC 2P20A 3TQIA 5IFIA 3N2QA 2HJGA 2D1QA 3ETOA 1KKGA 4RMNA 2Y4NA 5K8FA 4R1LA 2WP0C 5BUSA 1MD9A 5A1IA 4BSZA 4B3MC 5A1GA 2YWCA 3GKUA 1WH9A 4L7IA 4DR5C 4AQYC 1IBKC 3EERA 4D4IA 4FUTA 2QVXX 4LF8C 1N2FA 2Y27A 1PG4A 3VNQA 4DR4C 4DG8A 4DR1C 2BJOA 2JMPA 1BA3A 1PG3A 2QW0X 4DV7C 3UOWA 4LE5A 4DCVA 2F4VC 2V7BA 1HR0C 1ZB9A 5AE2A 3NI2A 4LF7C 4PHTA 2ZM6C 1AMUA 3CW9A 1N32C 4B3TC 4MTNA 2BH1X 4PROC 5K85A 4JI2C 2E8CA 4DR6C 4LFBC 4D56A 2QVZX 4DR3C 3GPCA 3LAXA 4FTFA 2UXCC 1MDBA 2VSQA 3J80D 4JI6C 1L2FA 1EGAA 4BC9A 5KEIA 4DR7C 3DLPX 4YY3C 3JAMD 1YJ7A 3NPDA 3C5EA 3DAYA 5FLXD 2PT7G 1V26A 3GR0A 4LFAC 2D7VA 3CJEA 4BCAA 2PN2A 1HNZC 4LF6C 4LF5C 2YWBA 4KHPC 2OO4A 4RLQA 4XX2A 4OXIA 4DV3C 3A9UA 2DYJA 4ZLPA 4NXMC 3VNRA 3ETCA 1VLAA 2UU9C 5BSRA 3RG2A 5DV9A 4ZJZA 3LNVA 3KXWA 3AF5A 1XRAA 2P2FA 2E0GA 4RM2A 5AE3A 3G7SA 1ML8A 5CZXA 3AF6A 5T8TA 4D4GA 2OPLB 1PA4A 4NOZA 3H2TA 2D1SA 3GR1A 1ZB8A 5BSMA 5BURA 2P2MA 4RM3A 4JM1A 1LQLA 4TPSB 5AE1A 2D28C 4DCTA 4DV4C 4K0BA 2CY1A 3LUSA 4DV2C 2P2BA 4IZ6A 4WS9A 1XNQC 4DV0C 1FJGC 3E7WA 4NDNA 4ISBA 4D57A 1QM4A 2UUCC 2WD9A 2ASBA 2XR1A 4KTVA 4JI7C 1K0RA 1MKYA 4B3SC 3TDEA 3IMLA 3R44A 3B7WA 5IWAC 2P2QA 1O9TA 4LF9C 3L8CA 5KYVA 3J81D 3IEUA 1P7LA 3UZ0A 4JI0C 4X65C 4GKKC 3E7XA 2CXCA 4DV1C 3R9XA 4DG9A 4BC7A 3EQ6A 5LMNC 4LF4C 2E8FA 2OBVA 4JI3C 3SO4A 1JOSA 2ATWA 3PESA 4YHHC 1MXBA 4K0KC 2UXBC 4JI4C 4BBYA 3IEVA 2QL8A 4X64C 4JI8C 1XRBA 4OX9C 5KYTA 3A4IA 4I9FA 4DV6C 5IT9D 2P02A 2VZEA 3S82A 3LGXA 3NYQA 4JI1C 4DUYC 5JRHA 4RVNA 4DCSA 3A9VA 1MXAA 4WV3A 5E7QA 1O93A 3PROC 1J5EC 2QVYX 1USPA 4IR7A 4ODJA 3FCCA 1N34C 5BUQA 1QWIA 3N54B 3NYRA 4LFCC 1T5DX 4L4QA 3RV2A 2D1TA 5LMUC 1LCIA 2E7GA 1UKKA 2E8EA 2YCBA 4G1IA 1N36C 2P2JA 2Y4OA 4L2ZA 4DUZC 4R1MA 5CZVA 3IPLA 1RY2A 3TUFA 2UUBC 4GXRA 4GS5A 4DR2C 3FCEA 4NXNC 4R0MA 2AYAA 1O92A 4JV5C 3T1HC 1HH2P 5T8SA 3I07A 5GTDA 1XMQC 1HNWC 4DCUA 1IBMC 4G37A 4DV5C 1MXCA 5ADZA 4RLFA 1MDFA 4JI5C 2D27A 4B3RC 5A19A 4U5YD 1XNRC 3L95X 4PZPA 1XMOC 4FUQA 4RVOA 3OTOC 2KZFA 2VQFC 5BSWA 4KTTA 1FUGA 4GKJC 3CW8X 2OPLA 2ONFA 1T5HX 1NYEA 1XRCA 1ULTA 1USPB 1V25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB8 A;  1N32 C;  1LQL A;  2E5L C;  4B3T C;  3R9W A;  4MTN A;  2UUA C;  4JI1 C;  4X62 C;  4DUY C;  4JI2 C;  4DCS A;  2E8C A;  4DR6 C;  4LFB C;  1WF3 A;  4DCT A;  4DV4 C;  1N33 C;  2CY1 A;  3LUS A;  4DR3 C;  1HNX C;  5BR8 C;  4DV2 C;  1I94 C;  2UXC C;  4MH4 A;  3J80 D;  1J5E C;  1XNQ C;  4X66 C;  4DV0 C;  1FJG C;  5A2Q D;  2UXD C;  1USP A;  1IBL C;  2VQE C;  2HHH C;  1N34 C;  4JI6 C;  1L2F A;  1EGA A;  1QWI A;  4DR7 C;  2UUC C;  2ASB A;  4JYA C;  4LFC C;  2XR1 A;  2EGT A;  4YY3 C;  3JAM D;  5LMU C;  3T1Y C;  4JI7 C;  1K0R A;  2E7G A;  1UKK A;  2E8E A;  1MKY A;  2YCB A;  1N36 C;  4B3S C;  5FLX D;  2PT7 G;  2HJG A;  5IWA C;  4LF9 C;  1KKG A;  3J81 D;  3IEU A;  4DUZ C;  4LFA C;  2D7V A;  4JI0 C;  3CJE A;  4X65 C;  2UUB C;  4GKK C;  2PN2 A;  1HNZ C;  4LF6 C;  4DR2 C;  4BSZ A;  4LF5 C;  4NXN C;  4B3M C;  2CXC A;  4DV1 C;  4JV5 C;  3T1H C;  1HH2 P;  1WH9 A;  3GKU A;  3R9X A;  4KHP C;  4DR5 C;  3I07 A;  1XMQ C;  5LMN C;  4LF4 C;  4AQY C;  2E8F A;  4DCU A;  1HNW C;  1IBK C;  3EER A;  4XX2 A;  1IBM C;  4JI3 C;  4DV5 C;  4DV3 C;  4LF8 C;  1N2F A;  2DYJ A;  4DR4 C;  1JOS A;  4JI5 C;  2ATW A;  4NXM C;  4B3R C;  1VLA A;  2UU9 C;  4DR1 C;  1XNR C;  2BJO A;  2JMP A;  1XMO C;  3AF5 A;  4YHH C;  3OTO C;  4K0K C;  2UXB C;  4JI4 C;  2KZF A;  1ML8 A;  3AF6 A;  2VQF C;  4DV7 C;  4GKJ C;  3IEV A;  2QL8 A;  4DCV A;  4X64 C;  4JI8 C;  4OX9 C;  2F4V C;  1HR0 C;  2OPL A;  1ZB9 A;  2ONF A;  2OPL B;  1PA4 A;  4LF7 C;  4NOZ A;  1NYE A;  4DV6 C;  1USP B;  2ZM6 C;  5IT9 D; 
#chains in the Genus database with same CATH topology
 4HPV A;  2E5L C;  3R9W A;  4I9G A;  2UUA C;  2D1R A;  5H9U A;  4X62 C;  3A26 A;  1WF3 A;  1GPM A;  3DHV A;  1M6X A;  1N33 C;  4OYC A;  1HNX C;  5BR8 C;  1I94 C;  4MH4 A;  4X66 C;  3VNS A;  5A2Q D;  2UXD C;  1IBL C;  2PRO A;  2VQE C;  2HHH C;  5BSU A;  5BSV A;  2DPL A;  1RG9 A;  3PBK A;  4G36 A;  4EAT A;  4GXQ A;  3UX3 A;  1P4E A;  3I08 A;  1O90 A;  4JYA C;  1UWD A;  2EGT A;  5BST A;  3T1Y C;  2P20 A;  3TQI A;  3AY0 A;  5IFI A;  3N2Q A;  2CU6 A;  2HJG A;  2D1Q A;  1VEH A;  3ETO A;  1KKG A;  4RMN A;  2Y4N A;  5K8F A;  4R1L A;  2WP0 C;  5BUS A;  1MD9 A;  5A1I A;  4BSZ A;  4B3M C;  1TH5 A;  5A1G A;  2YWC A;  3GKU A;  1WH9 A;  4L7I A;  4DR5 C;  4AQY C;  1IBK C;  3EER A;  4D4I A;  4FUT A;  2QVX X;  4LF8 C;  1N2F A;  2Y27 A;  1PG4 A;  3O2E A;  3VNQ A;  4DR4 C;  4DG8 A;  4DR1 C;  2BJO A;  2JMP A;  1BA3 A;  1PG3 A;  3CQ3 A;  2QW0 X;  4DV7 C;  3UOW A;  4LE5 A;  4DCV A;  2F4V C;  2V7B A;  1HR0 C;  1ZB9 A;  5AE2 A;  3NI2 A;  4LF7 C;  4PHT A;  2ZM6 C;  1AMU A;  3CW9 A;  1N32 C;  4B3T C;  4MTN A;  2BH1 X;  4PRO C;  1PU1 A;  5K85 A;  4JI2 C;  4PUI A;  2E8C A;  4DR6 C;  4LFB C;  4D56 A;  2QVZ X;  4DR3 C;  2Z51 A;  3GPC A;  3LAX A;  4FTF A;  2UXC C;  1MDB A;  2VSQ A;  3J80 D;  4JI6 C;  1L2F A;  1EGA A;  4BC9 A;  5KEI A;  4DR7 C;  3DLP X;  3TR3 A;  4YY3 C;  3JAM D;  2ZZN A;  1YJ7 A;  3NPD A;  3C5E A;  3DAY A;  5FLX D;  2PT7 G;  1FLO A;  1V26 A;  3GR0 A;  4LFA C;  2D7V A;  2DHM A;  3CJE A;  4BCA A;  2PN2 A;  3UEB A;  3K6R A;  1HNZ C;  4LF6 C;  4LF5 C;  2YWB A;  2YX1 A;  2OO4 A;  4KHP C;  2ZZM A;  4RLQ A;  4XX2 A;  4OXI A;  4DV3 C;  3A9U A;  2DYJ A;  4ZLP A;  4NXM C;  3VNR A;  3ETC A;  1VLA A;  2UU9 C;  5BSR A;  3RG2 A;  5DV9 A;  4ZJZ A;  3LNV A;  2KZ0 A;  3KXW A;  3AF5 A;  1XRA A;  2P2F A;  1IB8 A;  2E0G A;  4RM2 A;  5AE3 A;  3G7S A;  1ML8 A;  5CZX A;  3AF6 A;  5T8T A;  1XHJ A;  4D4G A;  2OPL B;  1PA4 A;  4NOZ A;  3H2T A;  2D1S A;  3GR1 A;  1ZB8 A;  5BSM A;  5BUR A;  2P2M A;  4RM3 A;  4JM1 A;  1LQL A;  4TPS B;  5AE1 A;  2D28 C;  2NCL A;  4DCT A;  4DV4 C;  4K0B A;  2CY1 A;  3LUS A;  4DV2 C;  2P2B A;  4IZ6 A;  4WS9 A;  1XNQ C;  4DV0 C;  1FJG C;  3E7W A;  4NDN A;  4ISB A;  4D57 A;  4PUG A;  2M5H A;  1QM4 A;  2UUC C;  2WD9 A;  2ASB A;  2M5O A;  2XR1 A;  4KTV A;  4JI7 C;  1K0R A;  1MKY A;  4B3S C;  3TDE A;  3IML A;  3R44 A;  3B7W A;  5IWA C;  2P2Q A;  1O9T A;  4LF9 C;  3L8C A;  5KYV A;  3J81 D;  3IEU A;  1P7L A;  3CQ2 A;  3UZ0 A;  4JI0 C;  4X65 C;  4GKK C;  3E7X A;  2CXC A;  4DV1 C;  3R9X A;  4DG9 A;  4BC7 A;  3EQ6 A;  5LMN C;  4LF4 C;  2E8F A;  2OBV A;  4JI3 C;  1XS3 A;  3SO4 A;  1JOS A;  2ATW A;  3PES A;  2KDN A;  4YHH C;  1MXB A;  2JNV A;  4K0K C;  2UXB C;  4JI4 C;  4BBY A;  3IEV A;  2QL8 A;  4X64 C;  4JI8 C;  1XRB A;  4OX9 C;  5KYT A;  3A4I A;  3LNO A;  4I9F A;  4DV6 C;  1M6X C;  5IT9 D;  2P02 A;  5LCI A;  2VZE A;  3S82 A;  3LGX A;  3NYQ A;  4JI1 C;  4DUY C;  3CQ1 A;  5JRH A;  4RVN A;  4DCS A;  1WCJ A;  3A9V A;  1MXA A;  1P4E C;  2MCQ A;  4WV3 A;  5E7Q A;  1O93 A;  3PRO C;  1J5E C;  2QVY X;  1USP A;  4IR7 A;  4ODJ A;  3FCC A;  1N34 C;  5BUQ A;  1QWI A;  3N54 B;  3NYR A;  4LFC C;  1T5D X;  4L4Q A;  3RV2 A;  2D1T A;  5LMU C;  4PUH A;  1LCI A;  2E7G A;  1UKK A;  2E8E A;  2YCB A;  4G1I A;  1N36 C;  2P2J A;  2Y4O A;  1V60 A;  4L2Z A;  1NY8 A;  4DUZ C;  4R1M A;  5CZV A;  3IPL A;  1RY2 A;  3TUF A;  2UUB C;  4GXR A;  4GS5 A;  4DR2 C;  3FCE A;  4NXN C;  4R0M A;  2AYA A;  1O92 A;  4JV5 C;  3T1H C;  1HH2 P;  5T8S A;  3I07 A;  5GTD A;  1XMQ C;  1HNW C;  4DCU A;  1IBM C;  4G37 A;  4DV5 C;  1MXC A;  5ADZ A;  4RLF A;  1MDF A;  4JI5 C;  2D27 A;  4B3R C;  5A19 A;  4U5Y D;  3A25 A;  1XNR C;  3L95 X;  4PZP A;  1XMO C;  4FUQ A;  4RVO A;  3OTO C;  2KZF A;  2VQF C;  5BSW A;  4KTT A;  1FUG A;  4GKJ C;  2MM9 A;  2MMA B;  3UX2 A;  3CW8 X;  2OPL A;  2ONF A;  1T5H X;  1NYE A;  1XRC A;  1ULT A;  1USP B;  1V25 A; 
#chains in the Genus database with same CATH homology
 4HPV A;  2E5L C;  3R9W A;  4I9G A;  2UUA C;  2D1R A;  5H9U A;  4X62 C;  1WF3 A;  1GPM A;  3DHV A;  1N33 C;  4OYC A;  1HNX C;  5BR8 C;  1I94 C;  4MH4 A;  4X66 C;  3VNS A;  5A2Q D;  2UXD C;  1IBL C;  2PRO A;  2VQE C;  2HHH C;  5BSU A;  5BSV A;  2DPL A;  1RG9 A;  3PBK A;  4G36 A;  4EAT A;  4GXQ A;  3I08 A;  1O90 A;  4JYA C;  2EGT A;  5BST A;  3T1Y C;  2P20 A;  3TQI A;  5IFI A;  3N2Q A;  2HJG A;  2D1Q A;  3ETO A;  1KKG A;  4RMN A;  2Y4N A;  5K8F A;  4R1L A;  2WP0 C;  5BUS A;  1MD9 A;  5A1I A;  4BSZ A;  4B3M C;  5A1G A;  2YWC A;  3GKU A;  1WH9 A;  4L7I A;  4DR5 C;  4AQY C;  1IBK C;  3EER A;  4D4I A;  4FUT A;  2QVX X;  4LF8 C;  1N2F A;  2Y27 A;  1PG4 A;  3VNQ A;  4DR4 C;  4DG8 A;  4DR1 C;  2BJO A;  2JMP A;  1BA3 A;  1PG3 A;  2QW0 X;  4DV7 C;  3UOW A;  4LE5 A;  4DCV A;  2F4V C;  2V7B A;  1HR0 C;  1ZB9 A;  5AE2 A;  3NI2 A;  4LF7 C;  4PHT A;  2ZM6 C;  1AMU A;  3CW9 A;  1N32 C;  4B3T C;  4MTN A;  2BH1 X;  4PRO C;  5K85 A;  4JI2 C;  2E8C A;  4DR6 C;  4LFB C;  4D56 A;  2QVZ X;  4DR3 C;  3GPC A;  3LAX A;  4FTF A;  2UXC C;  1MDB A;  2VSQ A;  3J80 D;  4JI6 C;  1L2F A;  1EGA A;  4BC9 A;  5KEI A;  4DR7 C;  3DLP X;  4YY3 C;  3JAM D;  1YJ7 A;  3NPD A;  3C5E A;  3DAY A;  5FLX D;  2PT7 G;  1V26 A;  3GR0 A;  4LFA C;  2D7V A;  3CJE A;  4BCA A;  2PN2 A;  1HNZ C;  4LF6 C;  4LF5 C;  2YWB A;  4KHP C;  2OO4 A;  4RLQ A;  4XX2 A;  4OXI A;  4DV3 C;  3A9U A;  2DYJ A;  4ZLP A;  4NXM C;  3VNR A;  3ETC A;  1VLA A;  2UU9 C;  5BSR A;  3RG2 A;  5DV9 A;  4ZJZ A;  3LNV A;  3KXW A;  3AF5 A;  1XRA A;  2P2F A;  2E0G A;  4RM2 A;  5AE3 A;  3G7S A;  1ML8 A;  5CZX A;  3AF6 A;  5T8T A;  4D4G A;  2OPL B;  1PA4 A;  4NOZ A;  3H2T A;  2D1S A;  3GR1 A;  1ZB8 A;  5BSM A;  5BUR A;  2P2M A;  4RM3 A;  4JM1 A;  1LQL A;  4TPS B;  5AE1 A;  2D28 C;  4DCT A;  4DV4 C;  4K0B A;  2CY1 A;  3LUS A;  4DV2 C;  2P2B A;  4IZ6 A;  4WS9 A;  1XNQ C;  4DV0 C;  1FJG C;  3E7W A;  4NDN A;  4ISB A;  4D57 A;  1QM4 A;  2UUC C;  2WD9 A;  2ASB A;  2XR1 A;  4KTV A;  4JI7 C;  1K0R A;  1MKY A;  4B3S C;  3TDE A;  3IML A;  3R44 A;  3B7W A;  5IWA C;  2P2Q A;  1O9T A;  4LF9 C;  3L8C A;  5KYV A;  3J81 D;  3IEU A;  1P7L A;  3UZ0 A;  4JI0 C;  4X65 C;  4GKK C;  3E7X A;  2CXC A;  4DV1 C;  3R9X A;  4DG9 A;  4BC7 A;  3EQ6 A;  5LMN C;  4LF4 C;  2E8F A;  2OBV A;  4JI3 C;  3SO4 A;  1JOS A;  2ATW A;  3PES A;  4YHH C;  1MXB A;  4K0K C;  2UXB C;  4JI4 C;  4BBY A;  3IEV A;  2QL8 A;  4X64 C;  4JI8 C;  1XRB A;  4OX9 C;  5KYT A;  3A4I A;  4I9F A;  4DV6 C;  5IT9 D;  2P02 A;  2VZE A;  3S82 A;  3LGX A;  3NYQ A;  4JI1 C;  4DUY C;  5JRH A;  4RVN A;  4DCS A;  3A9V A;  1MXA A;  4WV3 A;  5E7Q A;  1O93 A;  3PRO C;  1J5E C;  2QVY X;  1USP A;  4IR7 A;  4ODJ A;  3FCC A;  1N34 C;  5BUQ A;  1QWI A;  3N54 B;  3NYR A;  4LFC C;  1T5D X;  4L4Q A;  3RV2 A;  2D1T A;  5LMU C;  1LCI A;  2E7G A;  1UKK A;  2E8E A;  2YCB A;  4G1I A;  1N36 C;  2P2J A;  2Y4O A;  4L2Z A;  4DUZ C;  4R1M A;  5CZV A;  3IPL A;  1RY2 A;  3TUF A;  2UUB C;  4GXR A;  4GS5 A;  4DR2 C;  3FCE A;  4NXN C;  4R0M A;  2AYA A;  1O92 A;  4JV5 C;  3T1H C;  1HH2 P;  5T8S A;  3I07 A;  5GTD A;  1XMQ C;  1HNW C;  4DCU A;  1IBM C;  4G37 A;  4DV5 C;  1MXC A;  5ADZ A;  4RLF A;  1MDF A;  4JI5 C;  2D27 A;  4B3R C;  5A19 A;  4U5Y D;  1XNR C;  3L95 X;  4PZP A;  1XMO C;  4FUQ A;  4RVO A;  3OTO C;  2KZF A;  2VQF C;  5BSW A;  4KTT A;  1FUG A;  4GKJ C;  3CW8 X;  2OPL A;  2ONF A;  1T5H X;  1NYE A;  1XRC A;  1ULT A;  1USP B;  1V25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...