5CZXA

Crystal structure of notch3 nrr in complex with 20358 fab
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
227
Chain Sequence
CPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHVIGSVVMLEIDNRLCLQNDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Neurogenic locus notch homolog protein 3
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 227
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5czxA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5czxA01
2OO4A 5CZXA 4ZLPA 3ETOA 5CZVA 3L95X
chains in the Genus database with same CATH superfamily
2BJ7A 3PYGA 2ZM6F 4PYDA 1HNWJ 1EP4B 1VDHA 2BABA 2OEKA 1FRIA 4D4GA 4QIFA 3CGIA 1A7GE 3D3CJ 1WC6A 1UWBA 1PJ5A 2HHHJ 4NOZA 3W7BA 3QO9B 2KXFA 1RADB 1WEXA 1XNQF 3G2XA 3TVYA 5H9EJ 2W8KA 4C7QA 4RZRA 4D3HA 4WFNQ 4ODJA 2JHEA 1TMMA 1K0VA 3MFIA 2Z57B 4DR1C 1IBCB 4JI3C 1S1XA 4LRAA 3B7WA 3E3XA 6FD1A 1S6QA 2W7AA 2FZCB 4AL7A 3CW9A 2OD4A 1BHNA 3V81B 2FY8A 3TUJC 3VAIA 2G13A 3G6ES 2R8KA 4EBEA 4QU7A 3U1NA 2ZH9A 2UXBC 4NLVA 1R43A 3UWTA 2MQNA 1EKSA 1RTJA 4YR3A 3P8BB 1S5ZA 2F8HA 1EHWA 2KU7A 2MKIA 2BRKA 2DGOA 2FLNA 4F4XA 3G6XA 3DLGB 4Q2MA 2XMUA 2OJ3A 4ANCA 3TANA 1X4BA 2HNYB 3I6PA 2GFFA 1L3UA 5B08A 2W2OP 4USKA 4N7TA 2XM3A 4LF2A 5AE1A 2AQ4A 1KLNA 3A9VA 2LMIA 4LREA 4UQGA 4PCQA 4F8RA 2D3UA 4L74A 2Q3PA 2UV8G 4NYZA 3EGNA 2GMLA 1UEVA 2VOOA 1YVFA 2ZBQA 4WTOB 1R8BA 2W1BA 3QWPA 5DETA 2V4JB 3AJ2A 1Y0HA 5EGYA 1GH8A 3OBIA 1ZTWA 1R8HA 4OI0A 2R42A 4O3RA 3G8QA 4ZVTB 3KLHA 3MMJA 4JI0C 1FXDA 4YEAA 1JLFA 2DNRA 4EO8A 1I94C 4OJ3A 1SJQA 3PRDA 1WC3A 4IFVB 4K4UA 3LUYA 5CZXA 1SL1A 4RUHA 1M1GA 1SUQB 3G8SA 5KFGA 4LRCA 4MK7A 3MHYA 2FZGB 3P5TL 4NMLA 1RTDB 4U5YD 4A4JA 3KDOA 4PZVA 4I6YA 4NMXA 3TWZA 3QJLA 3IAS9 4WFBQ 2UUCC 1PIEA 4HHUA 1PCAA 3DLEB 4E2FB 3GTYX 1UJ4A 4ED1A 3T1YF 1X5SA 3BDEA 2N7CA 1QVFR 3G9CA 3TVKA 2APOA 3FBEA 2YNIB 2GVDA 5DM6Q 2V8VA 2B56A 1WACA 3IM9A 4X4PA 1FK9A 5A0YA 1HMVA 4F2SA 1VBKA 5C7PA 4DV6C 2CU6A 2G1DA 2OPSB 3OD2A 2E8CA 4NA2A 2VB6A 3H90A 5FLXU 2VU5A 4JYAF 4IQXA 3I5CA 2VASA 4LF1A 4F7VA 2PI4A 3ISNC 3UX3A 3EVOA 3P4UB 1SQFA 2QO3A 1LEOA 5LMUC 4OI6A 4TY9A 1TAUA 4B3SF 2Q6CA 4DS4A 3W3SA 4ZLPA 2CIMA 3B4MA 4MK8A 1G7CB 4B02A 3U7JA 4ED7A 2RQCA 2F3JA 5FDLB 3FRZA 1J5EC 2ASJA 1Q7YT 1H2TZ 3R2DJ 1WCJA 3CNQP 3FMBA 2OD6A 4J9VA 1VR6A 3C6TA 4X4QA 3AD8C 4TVAB 4CTAA 3I82A 2VONA 2R7QA 1ZZNA 4NE9C 3FGVA 5F8LA 1QVGR 1N6QA 4FXWA 1EARA 5BSWA 2V9WA 2M8DB 3BREA 2R9LA 3J7A1 1NK9A 1N56A 3UDVA 1Y3JA 3R5JB 3BM7A 2I38A 4ZPCA 4CO0A 3VTIA 3CQ2A 2RHSB 5KFMA 4X66C 3BPDA 1U09A 2DHHA 3M2VA 3N4WA 1D9FA 3AOAA 1VQKS 2C2KB 2W4PA 1TL1B 4RW8B 1B7YB 1WF0A 3JTNA 4GS5A 4NPOA 2BM0A 2LQ9A 3GR0A 1MW7A 5GMEA 3MUMP 5IFMA 1HI8A 4NI2B 5DGBA 1JJ2R 2J9CA 2QA4S 2C2OB 1SJ1A 5AXKA 3V6DB 2YKAA 2PDAA 4D56A 1KQSR 2AU0A 4Y2MA 1N2FA 3MM9A 3DDIA 4M8LA 3N79A 3FEZA 2JWNA 4D57A 1K1QA 5BYSA 5CYQB 4LR9A 5ETOA 1P27B 2MMAB 4IG3B 1TELA 2KH9A 1AUDA 2XLKA 3ETCA 1WDDA 4LVOP 4QYZJ 4EATA 3HHKA 1RTIA 2JVRA 4GKJJ 2E7GA 2FVQA 1ZPWX 3A3PB 1IJEB 1QUVA 2XMVA 4OI2A 3DNCA 2HFOA 3EUNA 3PV8A 3T6JA 1B0PA 2VA3A 4AQYC 3HSZA 1SQEA 4F0KA 3LGNA 1NDKA 1SV5B 3VAKA 2ZJQQ 3EGWB 2IMWP 2N3LA 4C9DA 1IUJA 1TKXA 1UW9A 1H74A 2RRNA 5HVFA 2LDIA 1R6YA 4DL6A 3M8PB 1VK3A 3H0PA 2FVRA 3AF5A 2Q79A 2MDAA 4KH0B 5HLFA 4AD6A 1QAXA 1TR0A 2HVDA 3DGPB 2BMBA 4LF9J 1HNXC 5KFCA 3TAQA 2XLJA 2HZCA 4OV6A 2R7TA 2H4YB 2D74B 3X3UA 4U7UD 2UUBF 4JI2C 4LFCF 2CVEA 1FDNA 4JP8A 1MN7A 3J7YI 2CFXA 5LMNF 1LWFA 5GAEI 2OKQA 3CXCR 4URQU 2E9RX 4LF7C 2V4QA 3S1TA 3AXKA 1NDLA 1QWIA 3VAFA 2W9BB 3H25A 1GXUA 4ELVA 4PPZA 3G82B 3QFHA 1YBAA 1VRQC 1VQMS 1FT8A 4B3TJ 3K0JA 3QJPA 4LBPA 1FI4A 1Q79A 2AJ4A 2QL9B 3ZTQA 4UY8T 2NCLA 2F65A 1IKVA 2QVXX 2YKPA 4PUHA 1HFEL 1YSJA 3M6WA 1FERA 3NNHA 3DFEA 4NXNJ 4PG5A 3MI7X 2C2EA 3IWNC 1U6BA 2E8FA 4JI6C 4LIRA 3GV7B 4FUTA 4OZ3A 3S82A 1XERA 2OFGX 4RBTA 4ICLB 4K0KC 1AA1B 4DV2J 3K6RA 2MKJA 4DCUA 3C15B 4LFAC 1WKLA 1PO6A 2DH8A 4DWIA 4KC5A 3QFWA 4X65F 4NLRA 3TA1A 4KHPF 3KK2B 3TAMA 1S7HA 4FN5A 1QM4A 1ZA1B 3LP2B 3H8YA 2IJNA 5DDPC 2OEMA 3OTOJ 3RZAA 1WOPA 3M1VB 2CADA 1WOOA 1H98A 2QSWA 2QLXA 1B0TA 2JC1A 5KFOA 3BGLA 1IR2A 2VQEC 4ZN1A 2B9YA 4DUYC 2VJVA 3MCNA 2WSFC 2VG6A 4LR7A 3D5MA 2Y1JA 4JI4C 1H7XA 3SQGA 5J2PB 1KHVA 2CQ2A 4F3QA 4JI1J 4NYOA 3OTDA 3AODA 4PR6A 4V19X 1Q53A 4YUDA 3HT0A 3N28A 2QRRA 5GTDA 3QWUA 2WW8A 2FHKA 4KGVB 2PSZA 3E01B 1RYRA 1SH3A 2DBBA 4WIIA 2FLLA 4HKQA 3R1LA 3NPDA 3OXGA 4X4OA 3CJ3A 1REVA 2R8JA 2LLZA 3A3NB 2N7YA 4CLLA 2ZVSA 1XK8A 3GILA 1ZOTA 1BE4A 2VZ9A 2YY3A 5LSOA 2DYJA 4YB7A 2ZDPA 3EICA 2FLOA 2HHVA 1IJFB 4YOEA 4Q8EA 4WP8A 2UUTA 4OZ2A 2C2MB 1G2EA 1RHMB 3MR3A 3GWCA 4O4GA 4GVLA 3ZXWA 4ZVRB 1VQLS 2J6SA 5KFYA 1P9QC 3BGOP 2AGQA 2QC3A 3ENVA 2WVDA 1XMOJ 3HHNB 2NCKL 1O93A 3S6EA 1XRBA 2YX4A 3NGTA 3TNVA 3FFIA 3FKBA 4N47A 2ZBPA 4LMZA 5KFFA 4F4AA 1ULRA 3BH7B 4KV8B 3IEUA 5HVGA 3E7XA 3PM9A 3VGTA 5K20B 3PFEA 5IC6B 3VNSA 1D9DA 2E5JA 1VQSA 4E8UA 2ZD1B 5F8HA 1JXLA 3F73A 4ERDA 3M2UA 4J9LA 4NX9A 4XDCA 4F2RA 2YNHA 4OI1A 2CQ0A 1Z2LA 3BV8A 4DDFA 2Y3YA 3BJYA 3NNCA 3A9UA 5E7QA 1V3ZA 4CO1A 1GFWB 3AF6A 1OYDA 4OYBA 3KUHA 5MLCV 1F9HA 2LYVA 4DR5F 2ZFHA 3OUYB 4OZNA 4DR3J 4L73A 3BQ1A 1WSRA 3ZC4A 5KEIA 3IS9B 4OI4A 1KC8T 3QMQA 4R1LA 5K85A 3A8IA 5FD1A 2CNLB 3THTA 2I5JB 3GPAA 4IH7A 2RF2B 3M8YA 5ITHA 3L7PA 3THPA 5EN1A 2EBGA 1XNRC 1KVIA 2RH3A 2R7UA 4C8ZA 2JMPA 3ZNJ1 4DR1F 2VFVA 1RT5B 5KG2A 2DVIA 1YITS 2XWYA 1WC1A 3FEYB 4DCSA 1YDLA 4PYAA 2XYGB 4CI0B 4Y2IA 4C48A 3RG6A 5KFEA 5HK4A 2BYCA 1PG4A 3UNYA 1RT6B 2Y1IA 4CQ1A 2Z4PA 2IYIA 3NG8A 2H48B 1M1HA 3UN2A 3H4BA 4GKKF 5IT4A 1N36C 1UWBB 1B0VA 2QFJA 5JVHQ 3GYXB 2UXBF 2XI3A 1VQOS 2E7XA 4CRJA 1IBKC 3NGSA 2ZHAA 3KK1A 4DV1C 4PAAA 2WVEA 2V2VA 2HEKA 4MYTA 3NCRA 2RIJA 1ELOA 2PT7G 5KT6A 3OHBA 2GHVC 5D0RA 3CVKA 3ITHA 5KG3A 5CYJA 3MR7A 1O6XA 2D41A 1VQ9S 2Z51A 5HL7Q 3IAM9 5U47A 1NMEB 2HHHF 1NJZA 4QR2A 3M30B 4J9QA 4CNYA 1RWKB 1CQMA 3Q22A 3J81Y 5A76A 4PQUB 4DV3F 4LF8J 4I2QA 4M94A 6AT1B 4IG0A 2QL7B 2EC0A 5FJ4A 2PA3A 1ACMB 1YRTA 2HFNA 3G96A 3DRPA 4ECUA 3QT5A 1WKJA 4DJBA 3DI6B 1R8PA 4DG9A 3CDUA 2AGOA 2AGPA 4K5SA 2EFOA 1V5VA 4P10A 1EX8A 5E0OA 2WB4A 1LK5A 1IXKA 2B6AB 1SJ3P 2EK1A 1RZMA 2BOAA 1PSDA 2HQ3A 1Y3KA 3K89A 3WIUA 4JI0F 1CC7A 2U2FA 4LF4C 1TKZA 1IBMJ 3TZYA 1GMWD 2EKYA 1VLYA 3KLIB 2HHUA 1DY3A 2IC3A 2ZBCA 4FF4A 4ES2A 4FS2A 3FCVA 3KG1A 4ZPVR 3EYZA 4G1QB 3R6LB 3GSDA 2CQCA 1JLGB 1YZ6A 2H9ZA 3EM1A 2UUCF 4DFMA 2GMJA 2QMUB 4TPSB 1NSQA 1TAQA 3ETOA 4OHXA 4RW6B 5DO2A 2FPHX 4TLRA 3KKFA 2VG7A 5T8SA 5DLGA 4UOGA 1MSWD 3W62A 4RLQA 2AZ1A 1JLFB 2W4CA 3UR0A 4N77A 1T9VA 5T41A 3VZIA 5C5JA 1ZAXA 5KFRA 5D15A 3NKYA 3BQ0A 2L41A 4DV6F 3LUSA 3KJVB 2E7VA 1UVKA 2RUSA 4JI7C 4HTJA 4EYHB 2B5JB 1K47A 3D66A 2HK3A 3UDCA 1ZPVA 1D9AA 1C2PA 3MWBA 4RX6A 2SXLA 3AOBA 4RNFA 5LMUF 1X5PA 4UT4A 4LF6J 1PU1A 4GC6A 4JB8B 1KKHA 1AFJA 3MAAB 1HNIB 4Q0BA 1X4GA 5HROB 1NYEA 1Q0NA 5A0YB 4J9PA 1CJKB 1FDDA 4DV0J 2GQQA 1RHKB 3BF4A 2FQQB 3KJQB 3ILLA 4JI5C 3DRSA 2B4UA 2AYEA 4ZDNA 3A4TA 4M5LA 2H5JB 4R0MA 4DUTA 1YIJS 3FZBA 5K8FA 4KHRA 1RI7A 3CB4A 1NDCA 3QT8A 1TVRA 2LKZA 1FXLA 3OW2R 2Z2MA 1RU2A 4X66F 3CULA 1HNWC 3FVYA 4KGXB 1TUWA 4DLGA 1DJ0A 2VV5A 4DV4F 1UW4A 2AJ1A 2WSCC 3MMCA 4OHVA 3BSNA 2KDNA 1YQHA 2HGMA 3D9BA 3C6TB 3HSDA 1HR0J 1FRJA 4CWBA 4H54A 3PYEA 2LQ5A 4GVBB 1FRXA 3DYAA 3ZZRA 2HFVA 3PVXA 2KG0A 1OYEA 5G0RA 3KHHA 5DV9A 4UTGA 5A6PA 2BW7A 2YBVA 3MECA 2NSBA 3D3BJ 2HQCA 4EBCA 5J2NB 3OR2B 2CJXB 4OYIA 4RW9B 3IBFB 2JEJA 4EEYA 4B3OA 3LOUA 3T5HA 3M8SA 2YWWA 2JC0A 1VC6A 2D69A 3W8PA 2FJWA 4ZCIA 3SV4A 2CPYA 3LTOA 2VSQA 3R5DA 3A1YG 5B0FA 2BJDA 2DIVA 4F50A 3TYTA 1RT2B 4Q2LA 3OQ2A 3QIPA 2QFIA 1U1PA 3R9WA 1S4FA 3T9NA 1EETB 2MKCA 5DQGA 3MM9B 4UUXA 5J1NA 4ZJQA 4QWCA 3QYYA 3V4MA 1RLDA 3CF5Q 2NSCA 3CCMS 3PRVA 1LCIA 3QQCD 2K7JA 1WDTA 2HVHA 4QIVA 3DC2A 1CS4B 3MMAA 1TP7A 1QLNA 3CEDA 4HEA9 3IR5B 3OL7A 4WK3A 2RMLA 1UVIA 4A8WA 3PJ9A 2XY6A 1KLMA 3CQ3A 1S0NA 1OSCA 1U49A 4KPYA 4I9GA 5J2MB 2P9EA 2DGTA 2HFSA 4NLDA 4ZLJA 2HNZB 3NI2A 4GKJF 1IM6A 1RB0A 1LW2B 2IMOA 5EWGA 5AJ3J 5D8HB 1KOOA 4LF7F 2D27A 3B8HA 2VC1A 5HQMA 2R8HA 3RB0A 1HQEB 2DR8A 5C2GA 1WEYA 4FKYA 4M5IA 4ECVA 5HI7A 4P52A 4CDIA 4USTA 2W7OA 2KFYA 4I7FB 4EBDA 1GNKA 4LUBA 2MLXA 2OUGA 4RLFA 2X1GA 5KFIA 4YQWA 1RWMB 3BKUA 1UVJA 4DQQA 3I0RB 1FJ7A 1WG1A 3UO0A 4CO4A 4WZMA 1SKRA 2EC2A 2F4VJ 2AMCB 2DPIA 1P1TA 2CG8A 1HLWA 2FJEB 3RAQA 1T0TV 3QNWB 1HBUA 1VBXA 1HBMA 4LSZB 4TU8A 4B3MF 1IKXB 5K8NA 4UQTA 2XS2A 3HM9A 2CDRB 3NOGA 2DCLA 3UX2A 3AOCA 3LP0B 3IWLA 1U24A 5KFLA 3BGRA 4LFAF 3GFZA 2BR0A 3IO1A 4J9UE 2ZH3A 2RS2A 4K4YA 2BDPA 2BJEA 1KOHA 2GGPA 2Q1LA 4DSLA 1MMNA 4DUZJ 5CABA 5DQIA 1X9WA 1RAIB 1OMSA 2HZAA 1HNVB 1MROB 3T9ZA 3POTA 1I1GA 4NXMC 3SDEA 2IHR1 5K8OA 1C1BB 2J8AA 2VL1A 2VQEF 4B3TF 4DUYF 1Y5LB 4JI4F 1NZAA 1OQ6A 1FX4A 2I6WA 2MYFA 1H6KX 4QWAA 1B3TA 3LGHA 4NXNF 5GAGU 4G37A 1C4AA 3KXDA 3LGMA 3CC4S 1T05B 1X4HA 3FBBA 3MR2A 2XNQA 3N0VA 3BSOA 1VQ7S 1J5OA 2EG2A 5DG8A 3HHLD 4DV2F 2QW0X 2C3YA 2HMIB 2MEWA 1RAEB 3RB6A 4URSA 5K9FA 2QL8A 4MTNA 2EFQA 2ZWPA 1OWXA 3Q8PB 3EX7B 1VQYA 5BURA 1SH0A 4JV1A 1R3NA 4ECYA 2BKPA 4HDHA 1IKYA 3US5A 1BMQB 2EFPA 5BSMA 1QAJA 1ZM4A 4WP3A 2J0QD 3A25A 1PBAA 4DSFA 2QLWA 3MAHA 2CQ1A 3K8WA 4YN3B 2UUAJ 3N9UC 1WJ9A 2YQ0A 2P2CB 3KLGB 1LV5A 1BQNA 1T9XA 4WU2A 2JVOA 4WE1A 1NPRA 3L09A 3LF0A 3R44A 4JI1F 1S6PA 1JIHA 5HANA 3TZWA 1X0PA 3C66A 5CCMA 1XEZA 2FC8A 3D0HE 1GPMA 4C3LA 3MCOA 4ECRA 1H3DA 2EFNA 2MHNA 4ELTA 3J7YU 2P02A 2DPJA 4X64J 1U02A 1VJWA 3KHRA 4F3OA 5KTQA 4I4BA 3CJTA 2YKMA 2KM8C 1Q82T 4UOHA 3TUIC 2ASDA 1WHYA 2GQ2A 4CIOA 3D68A 3SCIE 2CJ9A 2R2SA 4PEOA 2E0GA 2MY7A 4IFYB 4J9NA 2R3VA 2BANA 2AHOB 1RBLA 4LF9C 2G2OA 4FDFA 2OP5A 1LXJA 5KG4A 2JEFA 5D77A 1UKKA 1CQNA 2MQOA 2RT3A 2CXCA 4DFJA 4DMZA 3HKZD 2AYBA 3UDLA 1CPZA 4HT7A 3OSPA 1RU1A 2C3PA 1HI1A 2GZOA 2AYAA 3CJ2A 1QE1A 4AXIA 1R0CB 3D1HA 1LXNA 1D1UA 1I6JA 2Z2LA 2KVQE 4WKYA 4OZLA 3DOKA 1DTTA 2OPQB 2Q6BA 2WONB 4ALZA 2GIFA 3I0SA 4K5RA 1M90T 5HJYA 4DV1F 4EZ9A 1S1WA 5ETQA 1C0UB 3MFHA 1IBLJ 4FNIA 2HQIA 3U1LA 1TL3A 3NWRA 4DR4C 2HNDA 4KPCA 2ZH5A 1Y5NB 1VLAA 2DD8S 2MJUA 3K5PA 4EYIB 1KVJA 5I42B 3W2VA 3R9XA 2V50A 1V3SA 4OX9F 2V2KA 3ZZ0A 3CPWR 3W5ZA 3WC2A 3UVJB 4J91A 5D0EA 4CT8A 1HWJA 2RNEA 3DOLB 1U26A 3GLJA 4H4KC 1MMDA 1FVSA 1S57A 4UY85 4PPDA 3I9ZA 3MM6B 5DRKA 2KM8B 3S7RA 1YJWS 1B70B 1FO1A 3KLFB 4ID5B 2ZHBA 3DLLQ 1RAGB 2BW2A 1UVLA 4ZVFA 3IP0A 3VAGA 3J7AN 4G1PA 5L9NA 1HYSB 1M5SA 3QJJA 1R0AB 5L1IA 2RD5C 3HULA 1JKHB 4LF4F 4CLPA 3UN5A 2LECA 1R89A 5CD4H 1RSCA 3JSBA 3RBZA 2XTJP 4Z2XA 1NK6A 2V68A 2ADBA 3TUPA 1M5HA 2HVZA 2DTJA 3HVWA 1AUSL 2ZBRA 1RHQB 4RR5A 2C1EB 4ILRA 1HBOA 1H0HB 1NJWA 3M9MB 1UZDA 1WF2A 1QAYA 2NYIA 2KDOA 2F1FA 5IM0B 2XSJB 2BQ3A 2NZ4A 2YWCA 5EWEA 2HBRB 3VHQA 4P7TA 1RISA 3TAPA 2DO4A 1EJ7L 3AFGA 5JXSA 3FQKA 1HD1A 2I0XA 4KO0B 4JI7F 1XMOC 3MPWA 3SEOA 2N82B 2BOPA 1U2RA 2IM2A 1FFGB 3FUYA 2RU3A 1IBMF 3QBCA 4FF3A 5ETVA 3PNIA 2GVZA 5IZHA 3AH6A 5DG7A 4F4KA 2CPXA 4ILLA 3IG1B 2QA4G 3RGIA 1SB6A 2D3ZA 4RBVA 2KYZA 2NXUA 3EGVA 1YJ9S 2A6OA 2QEXS 2V34A 4DX8H 1QAIA 5JVGQ 5H1SV 3M8RA 3WQPA 3DGVA 3JSRA 4C11B 2R7SA 2POKA 2JX2A 5I3UB 3BSCA 1MLAA 2B8QA 3HCXA 1R27B 2HIYA 4ZVOB 4DSKA 2CXEA 3O2IA 1JLQA 3BYPA 3DN9A 3NAIA 1RCOB 2DISA 4I69A 2L48A 2B51A 3DM2A 2YNGA 3H5XA 2W2MP 2FJAB 1HNZJ 3SQOP 3HKWA 2ATLA 2D9OA 1L3VA 3K5NA 3M4XA 1BD6A 5CHCB 3PHEA 3WZ0A 5I3PA 3OVBA 2CNNB 3PRBA 2G4BA 3I4HX 2BJ8A 3GCWP 4DL4A 4PWDB 4DV0F 3HFZB 3O2EA 3L9ZA 1EQMA 3CDAA 3CT9A 1VS3A 3UCGA 4K4VA 1UMJA 4PRFA 3MMCB 5FLXY 4DHVA 1NBEB 3SSQA 1FFSB 2DY1A 2GW8A 4NASA 3IMQJ 2AYGA 5HSPA 1XRAA 4P9SA 1KQGB 4J9SA 4DV5C 1HBNB 6FDRA 3C46A 4JYAJ 4CP5A 5ETNA 5IT9U 3KLEB 3HHLA 1VGYA 3AY0A 3Q2SC 5BUSA 3OJUA 1XTZA 4R0JA 2KT3A 1TK0A 2VBXA 4B3SJ 2NLWA 2B0GA 4WPAA 1LW0A 4RO0A 2VQFC 2ZITA 5A8RB 3IXQA 4RJVA 2EG1A 3BO2A 1KEKA 2CPJA 2J5AA 5GVQA 1WHWA 2QA2A 1YK9A 2WRMA 1F60B 2PMHA 2QVYX 2AYMA 4W4MA 4O44A 1GX5A 1C0TA 3T1HF 4RU2A 2HWTA 1F5CA 3DLKB 3FMWA 2HGLA 3WBZA 2W24A 4GC7A 1YTYA 3NYQA 3NBPB 2OPRA 4QW9A 4DR6J 3GIJA 2FIUA 1VQ5S 1HIYA 5KYTA 3PBKA 3Q8UA 1HWIA 1O51A 4LT6A 2NREA 1S1UA 1SXLA 1FRKA 3M9NB 3W9JA 1ZYQA 2YKQA 3VCDA 5JJBA 1HI0P 4OHZA 2QMWA 1U45A 2QYCA 3T19A 5M2PA 1YGYA 4JM1A 3W5YA 4RVNA 2ZWOA 3SMZA 2C42A 4AUKA 4FNHA 4RNHA 3NGDA 5F41A 3CD6S 1WF3A 3H2UB 5BYQA 1NSAA 4EMDA 1AFIA 4FXDA 2HZVA 5IWAC 1RT7A 3IBWA 3KG4A 3R8YA 1Z2ZA 5GAHI 1T9WA 1QY7A 1NO8A 3UD5A 2ATCB 1ZB8A 2IVMA 1CEZA 2MKYA 3UW1A 4X62C 3OPKA 5IS2A 3LH2S 1Q8BA 3MTJA 4RUAA 5M2UA 2XULA 3Q8RB 4LFBC 5DZ7A 5H9EK 4CLYA 4Y2AA 2NPFA 3DXBA 3C16A 3M2RA 1TQLA 2DH7A 5ETKA 2E44A 2CKWA 2HHPA 2QSFA 1N5VA 2WOMB 4PXCA 3TJ9A 4MYUA 2MZSA 4U8VA 4PXBA 3QAUA 5T7LA 1RWXB 2XNRA 4DG8A 4NXMF 2HHWA 1P4EC 3BS9A 4IOCQ 1IVZA 3C6UB 2XO7A 2R2UA 4EGLA 5AT1B 2MM9A 3QPIA 2D7SA 2J76E 2UV8A 1JJ4A 4QOTA 4ZPAA 2E7WA 1M6XC 4LFCJ 2AJ0A 5EWFA 1XR6A 1LNQA 4P2XA 1AB8A 3GFXA 3CD0A 1JQGA 4P71A 1F0XA 2BJ9A 2P6SA 5DDOC 3P49B 4ZP6A 3GP9A 1MNEA 3CDEA 4LRBA 3FBFA 5IV4A 3ILIA 4LR8A 2RILA 2ZC3A 1X5TA 1V3RA 4RW7A 2NPIA 1N32J 2XEXA 3FJ2A 2CZVC 2EXUA 2VDIA 2VG5B 1MU2A 4LVNP 4C97A 4A8QA 4TKTA 4TY8A 1UETA 2YPYA 2VFTA 4FVMA 5K14A 4DUZF 2JSXA 2V6AA 3CJSA 2OIHA 5A8WB 2VPWB 2AEJA 4LRDA 3KFWX 4FPRA 4J9RA 3HHEA 1SC4B 2JEIA 2LQ8A 4FVCA 2PI5A 3RTVA 2HJGA 2RU9A 2AJ2A 3OSNA 5KFZA 3MZIA 3KUEA 1OJ4A 4OLPA 4OYCA 2WTFA 3ZZYA 2RVJA 3KHGA 2KZMA 4C8OA 3EPGA 3MDFA 3EZUA 1GMVA 4AYBD 4X65J 2P8IA 3MD3A 4KHPJ 1AZSB 1RY2A 2IRUA 3GZ7A 3PG9A 2Y27A 1ZH5A 3WC0A 5JUMA 4G3IA 2CNOB 4ZIVA 2ROEA 3WDOA 2G1HA 2R7WA 1BQNB 2XC9A 4DFKA 4DSJA 1G3OA 4W92B 3TEGA 2VPZB 2QJ3A 1RT4A 1TUGB 4JUZA 4IZ6A 1DLOA 2M3DA 3RJMB 3LP1A 1SBRA 3H4DA 2MPUA 2VKRA 3IRXA 2DR6A 5C24A 1OY8A 4LSLB 2BACA 2MMYA 3UD4P 4YHHC 2GIRA 5A8KB 2QL5B 2FDNA 3HVTA 3Q24A 5J1EB 4Y2CA 3RRGA 5HBMB 2A18A 2X7IA 3CJEA 7FD1A 1U0HA 4DQRA 3MEGB 1TKDA 2B9WA 1NU4A 1S9GA 1LQLA 4OQJA 3VR1A 2HFUA 3OL8A 1T3NA 5H9FK 4K7QA 2F8MA 2F9JA 3A8KA 1T9TA 2ZVIA 4TLQA 4X64F 2B9EA 1YRXA 4C0BA 1N33C 1SI9A 3DMJA 4PG4A 5CXTA 1O5JA 1Y9OA 1DQAA 3CCLS 1NEEA 1LK7A 4PZPA 1B4SA 1NZ8A 5LXYA 2VBYA 2LDYA 2RE1A 1T3OA 2AW0A 3BKTA 5D78A 4KT0C 4LF5J 5KYVA 2VF3A 2F4VC 3VV2B 4KH1B 2Z8QA 1DTQB 2JZ5A 1BWEA 2W9CA 3SO4A 3GR1A 2V2QA 3V4IB 3PW0A 1LWCA 4DR4F 4OXIA 3DKDA 2UU9J 1XR5A 3PDNA 4HI1A 2R2TA 1CULB 1H7WA 4WFZA 3MEEB 3CJKB 2A0FB 2ZUGA 4I68A 2IM3A 4R8UA 2EBEA 1RWVB 2E8EA 4ZCMA 3DXSX 2MQ8A 4B3RF 3QGPA 4PQAA 5RUBA 2FGOA 1Q8LA 4NLXA 2PEHA 4DR5J 2W2QP 4M5KA 1NCLA 2GJ2A 3A12A 1A0OB 3UI3A 1L5UA 4I2PB 7AT1B 3H5SA 1TL3B 4C3KA 4RUCA 3WX4A 1RJJA 1NKEA 3AB4B 3PJWA 1XHJA 2HNDB 4OZ0A 2E1CA 5LSLA 3A8JA 4J37A 3PR5B 1U6FA 5F0WA 3T3FA 1WF1A 2WVBA 4K4SA 3M32A 1CJVB 2WD9A 1FKPA 2C2ZB 3GJQB 4L72B 3KTQA 1DQ8A 2KJVA 1Q5YA 1TL5A 1C1CB 1CJTB 4DQIA 3U1MA 2YWHA 3KDNA 3H98A 3QIDA 1RBAA 1I51B 4DR1J 2XS7A 4JI3J 2MHEA 3MM8A 2K1RB 4CYUA 2DGUA 2DHMA 2K8GA 3VGSA 2KG1A 3CCWA 2E5LC 2E5GA 2FHMA 4JOUA 1Y10A 5AE3A 4P2MA 3GJSB 1S1VA 3QGHA 1T95A 5H9UA 4HR2A 2OFHX 3I5AA 1K44A 4HI2A 1R0BG 3HP6A 4F02A 4USWA 1FDBA 2UXBJ 1NPPA 2YQ1A 1MKYA 3RG2A 2ZH7A 4ETXA 2QX0A 1LWEB 2M5OA 1T03A 5HATA 1PILA 2KJWA 2HHXA 2MQMA 1J27A 3I56S 2D3OR 4MIAA 2KO1A 5A2QY 1JMTA 3HFKA 3UZ0A 1F9FA 1VQ8S 2Y8WA 3AAWB 1JLCB 3W2WB 4DG1B 2F9DA 2PN6A 1M5VC 4NLUA 4RW4A 1RA7A 1OY6A 2ZZTA 1S0MA 3Q89A 2D1QA 4DV3J 1JLAB 2D9PA 4E98A 4J7CA 4MH8A 1VBZA 4L76A 5SUHA 4NZ6A 4DCPB 4GXRA 1YLXA 1VJQA 3CJ8A 1PA4A 1IQZA 1FWKA 2G2ZA 2YWBA 1RTHB 4H4MA 2ERRA 2CPZA 5K8MA 2HRYA 3RBEA 4ED4A 4L3NA 3QSYB 2OPPA 2FVSA 2EWHA 2GCFA 4NCGA 2CQHA 4M5DB 5MAOA 1LQ9A 4ZP9A 3ISND 2BVZA 3DDNA 1GAOA 1N34F 2JOQA 4JI0J 4FPIA 1YHQS 2DO0A 4QYRA 2YKNB 2GVZB 3NCQA 3MMBA 1I94J 3PXGa 4DU7A 4U7UK 4JV0A 1S97A 1YJTA 2DNLA 2HBZB 2NXJA 4RVOA 1O8BA 4Z37A 3K57A 3ZTPA 1V26A 3F41A 3NL0A 3NNAA 1KR4A 2W01A 5KG6A 4G6VB 2Y0BB 4JV5C 4Q45A 4IDKB 2ZH4A 2UUCJ 2HHQA 4QQBA 3PIOQ 2RJZA 2VBZA 3B4DA 3JYTA 3CWJA 2N4CA 1NHKL 3MUTP 5A1IA 4IOBA 2IYGA 4ED6A 1RE1B 3P45B 5CA5A 1FRLA 3ADAC 1CJUB 1G4CA 1AT1B 4A8XA 1JLQB 1X60A 2J0SD 3M9OB 1DFDA 2GX8A 2HAIA 1N5YA 2MXYA 1PYSB 1MWZA 4DV6J 1LKZA 1VQPS 4DR7F 2DIUA 1N5TA 1IKWB 4WS9A 3PR4A 3IWXA 3OL9A 5CQGA 1Q1KA 1DQ9A 1HQ2A 3MEDA 1VQ6S 3OFGA 4RM3A 2QA1A 1BA3A 5LMUJ 2EKNA 3W61A 1TH5A 3DU6A 1EP4A 2BH1X 4RUBA 4PG7A 1MMLA 2VQFF 3SYZA 2BZ2A 4KAIA 1RUSA 1J5EJ 2EFGA 5KFWA 1HNZF 2DNGA 4ZCLA 3C14A 2QZ8A 2KYXA 3S01A 1VMBA 1EZZB 1HWUA 3QO9A 3UR3C 2AJQA 2IBOA 2C2RA 3CUNA 4IR1A 4HL9A 2OPLA 3JAMU 3J81U 4IO9Q 3A3OB 1O9TA 2E1PA 2HIQA 5CYMB 3D0GE 2Z2YB 3NGRA 3BO3A 4D3GA 1X9SA 1W25A 2AP6A 2CJBA 4X66J 2ZM6C 2DEIA 4FF2A 5IXUA 4N76A 4L3KA 3CCES 2B9XA 5HP1B 4PUOB 2LEAA 1JWWA 3FK4A 3V81A 1NJIT 3ZZPA 4ZHRB 4DV4J 1T11A 1L3SA 2E5HA 4DS5A 1HQUB 1XNQC 2MB0B 2RDJA 3NMRA 3D54A 1CBKA 4Z7YA 2XSFA 1ZETA 3N6NA 2H65B 3PX4A 2WVCA 3TJAA 4UF4A 2DKOB 2PMWA 3K2YA 4K4ZA 1TL7B 1VRUB 3PACA 3KK3B 3GG0A 4F4YA 3W9IA 3DLGA 1M5OC 2O3DA 1O92A 1UEUA 3GIRA 1NLKL 4YB1P 1YX2A 1L3KA 3MCMA 1W2BR 3JTPA 3RW7A 2LXIA 2HNYA 4LBHA 2O5DA 3KWMA 2M8HA 5AXNA 3CW8X 3Q2TC 1JNRB 2IIHA 4EK2A 1U1LA 2KFZA 5E3PA 1TU0B 4LFBF 5F8MA 4KY3A 3H2TA 1PJ7A 2F5GA 4FS1A 1TV6B 3GIKA 3CCRS 1S72S 1FJGC 3CW2C 4DR6F 1KVKA 3E7WA 4EFAC 4OJ1A 1RLCL 2KVIA 2CJAA 2V4JA 5LT5A 2IRYA 5ETTA 2MGZB 3N2QA 1RT7B 3NP5A 4IQMA 4X4UA 3VGUA 4WWSA 2KI2A 1GMUA 4MFBB 1WEZA 3G86A 2OO4A 1HWLA 2ASYA 1GT8A 1FLOA 4IFVA 1FRHA 1HNXJ 1JNZB 2R7XA 1XMQC 1JXVA 3VZHA 2ROPA 2NYHA 4O4RA 4H4OA 4ANDA 4NLYA 4P75A 4NLQA 2YNFB 4QWEA 1KN6A 2J0XA 2FTRA 3GYGA 4FBUA 2CQ4A 1UFWA 2ZH8A 3IEVA 4OYXA 4ZS6A 4GMKA 3DLEA 4KTQA 3PCOB 2X3GA 3OXLA 1U2CA 2VUGA 3AQPA 4LF7J 3RU0A 3E2EA 2YNIA 4MKAA 1N52B 2LXUA 4G1IA 3OJSA 5LJ5Y 3FSIA 3PX0A 1S1TB 3GPCA 2L9NA 4KKOB 3OFHA 5C25B 4DV7C 1TMJA 3PEHA 2YH1A 4QJVA 1NHVA 3PKMA 3LANA 3D7SB 2HWHA 2LU2A 1OPZA 2ZKTA 2DNKA 2OPSA 1PG3A 4YY3C 3DRRB 4X4RA 2WBRA 2HRTA 2HYIB 1RAOA 3O3LA 5F8GA 3MM7B 3T1YC 4JI6J 4DOZA 3MD1A 3TZZA 4ED2A 3Q8VA 3FSXA 1MD9A 5ETRA 4DL7A 1NM2A 1U47A 4KB7A 4B3MJ 3PIPQ 2ZH1A 5DJBA 3R7BB 5FDLA 1R8CA 4K0KJ 1S9EB 1MU2B 4DF8A 2QGFB 2C3UA 1T5DX 1JLEB 4LFAJ 3IPLA 2JL9A 3QLHB 2M0GB 4O3SA 4ZPWR 3H59A 4JYAC 4MIBA 5GADU 1QUPA 2G2YA 1VIXA 1D8YA 1FESA 1FVQA 2LVWA 4RMNA 1UTAA 1N32F 1JLBB 2KKHA 3IM8A 4B3SC 2V9KA 2H51B 3RAXA 3AJ1A 3UCZP 2FD2A 2Z30B 1TL1A 4RW8A 2VQEJ 4DUYJ 3JSMB 4M95A 1QTNB 4JI4J 2Z58B 2MJNA 4WXOA 2DGSA 2DGQA 4L7IA 2GJIA 4YDDB 4ED3A 3DOMB 4NI2A 5D4OA 4OJHA 3V6DA 4YHHF 1FEHA 2CQDA 1HPZB 3IBCB 1PKUA 2MZTA 1APSA 3D2WA 3I08A 1QTMA 5CYQA 1N54B 4J9OA 5J2QA 2V2ZA 4IG3A 1U1NA 2OTLS 4CLZA 1C4CA 2GHWA 3GCXP 3NS6A 3CQ1A 4RU9A 1DLOB 2RKIB 1FKOB 3E51A 5KFTA 4C8KA 2J9DE 5B0DA 1N33F 4LSNB 4X4SA 5GMDA 3VVUA 1TKTB 1SV5A 2DH9A 5HN0A 3DCAA 2Q66A 3K8VA 1YZ7A 3TR3A 3W60A 1K73T 3I31A 2HGNA 1FHTA 4AL5A 1U0HB 1EB0A 5BSUA 3MR6A 4ECSA 3M8PA 3FCWA 3CJQA 4DQSA 2CQIA 4HACB 5KFQA 1RYSA 4OI3A 1U4BA 1FF2A 3DGPA 4RNOA 5D3GB 1CLFA 1X5OA 2AF6A 2C28A 1WG4A 4ZVQB 3CIMA 4KQZA 2VZEA 1VQ4S 4KR0B 2AX1A 4F04B 3MM5B 1USPB 5IQ6A 2P20A 1RT1A 1NH7A 1TZ0A 4WFAQ 2K2PA 5ETSA 2G0JA 3N6MA 4PWUA 2GQCA 4RKUC 1LWCB 5F8NA 4QWBA 1Y7PA 1U1OA 3LAXA 1RA6A 2W9BA 1GQEA 4F4WA 3G82A 4BDPA 1PGZA 1KTVA 2UUBC 4RNNA 4LF5F 2ZOGA 1HHSA 3ETMA 5HO4A 1U2FA 4N8OA 5LMNC 2L3MA 2LP4A 5ETMA 4JI8F 4DXLA 4LE5A 2XMAA 2UUWA 2UU9F 4FYVB 1KS2A 1D8ZA 3FDSA 3SV3A 3R5CA 4ICLA 2E5LF 4ISBA 4R25A 3TP2A 4U7CA 3KMSA 4RNMA 2MTLA 1N36J 3SCKE 3R5BA 2BE7D 2VOPA 4UOFA 3BPSP 2BX6A 1SQGA 3T6BA 3R1HA 1IB8A 2HSEB 3DHWC 5FLXD 1BQMB 2NXEA 1MWQA 4DV1J 1W7WA 4IH5A 4XTTA 1XRCA 2V7BA 1ZAWA 4J9KA 1ITPA 2XR1A 3BN4A 2DNYA 1VFJA 3LP2A 2B7CB 1EGAA 2W2PP 3RRKA 4DR2C 1S6OA 3M1VA 1WHVA 2BKNA 4KFBA 3PZPA 2HK2A 4B9TA 4A8FA 1BQXA 1SVDA 4A47A 4Q8FA 1F3VA 3EDRB 3R97A 4OX9J 2VFSA 5J2PA 3PW4A 3KYLA 3K5LA 3JQJA 3LNVA 4JI3F 2AJFE 4KHPC 4Y2KA 1I5OB 2CQGA 4K59A 5HMYA 3HJVA 2UXCC 2J6UA 1UFKA 2BQUA 2ZOFA 1RWUA 4AFFA 4WXWA 4NWBA 1VHIA 2DRAA 2B4VA 2VFRA 3GYNA 1IQTA 2JLEA 4LF4J 4M63A 3ZZTA 2V8HA 3BB5A 1RWWB 1S49A 3Q83A 1UPMB 3F56A 1S1XB 4C4WA 3L4BC 4X84A 2MY8A 5T8TA 5KOXA 2HG4A 1FTCA 3CTRA 1S6QB 1HKAA 3W63A 1E6YA 3Q8YA 2WAQD 3AD7C 5KFDA 1GTHA 4JV5F 2XYHB 2FVCA 1MDFA 4NCGB 3P3DA 2P9GA 4RWWA 1G6BA 4C8NA 4W98A 1T7PA 2DRBA 3ISZA 1DARA 4AE5A 5BR8C 1U8WA 2HVEA 1RTJB 3RAMA 4KV8A 2DCUB 2CQPA 3PTWA 2W9AA 1UPPA 1MXBA 4DBQA 2ZD1A 1KQKA 5CZVA 3GFYA 2XMTA 1Q86T 2B3TB 4TXSA 4CM2A 2D3O1 4JI7J 1YG0A 2MQQA 1GXTA 1LOUA 1S10A 3AB2B 3GMGA 1HW8A 2HHSA 1I94F 1YBUA 3HXMA 4OYWA 3GB0A 2LCWA 4K4XA 4QIGA 4F0HA 2M7SA 4Q43A 2UXDC 5D0HA 3D1OA 2ASLA 3IS9A 4U95A 2XGQA 1PJ6A 4CLFA 1H72C 3K17A 4E0DA 1KHWA 2RQMA 1NKBA 1Y00A 3N54B 4O3OA 4ZPBA 3D1QA 2RF2A 1L3TA 2NUUG 4ECTA 2PT0A 3KLHB 4F3MA 5E3AA 3R6GB 3I96A 4ZVEA 5CH7B 1RT5A 4DR5C 4NDNA 1RP5A 3QT7A 3O8WA 3TARA 4V19J 2VH7A 2JH3A 1P8GA 4PXEA 2LA4A 2BJ3A 4LQ9A 4N41A 3P5BP 3KJFB 1RT6A 4YS2A 3C14B 1GX6A 4DCVA 4CCHA 3HI9A 3M6XA 1YWXA 2Y9HA 3Q23A 2X1FA 4BLGA 3SXLA 3VQTA 1SL2A 2OPLB 3UPFA 1ZS6A 5K5MA 2NXCA 2I2YA 2PMZD 2WP0C 4CH7A 3OLBA 1VQNS 3C8YA 2GVDB 2ZH2A 1J5EF 4BSZA 5KFKA 3MAQA 2MLZA 1FK9B 3AHPA 1HMVB 3LNOA 2ZJPQ 4NLGA 1WD6A 3SZ2A 1D09B 3M30A 2GNKA 2LU1A 2W7PA 3D28A 4PQUA 2MKKA 4GKKC 4XO0A 5IT9Y 4Q5VA 2FJBB 2P2QA 1Y5IB 4O23A 3NOCA 3M05A 2Y8YA 3AQOA 1U25A 1URNA 1OO0B 2YTCA 3DI6A 2EFVA 1NK4A 1D0EA 2WB1D 4BCAA 2MQPA 3IC1A 1FJGF 3DRYA 5KG0A 2A1BA 1XS3A 2B6AA 4V1Ak 1ZM3A 4G65A 5E3CA 2E1MC 3LO3A 4XIUA 3RBXA 2E29A 2HHHC 2DRDA 4CTAB 1Q5VA 4DV3C 1V5IB 2W8LA 3BBBA 1N6QB 5KFUA 2P9CA 2GO9A 4ETZA 1U6ZA 3KLIA 3FBCA 3ZO7A 1F9EB 3IMLA 1ROFA 2ADCA 2XWXA 3T1HJ 5HMWA 2XGPA 5KT5A 1XMQF 2XY7A 1I3OB 2V63A 1SH2A 2D7VA 1NAQA 4G1QA 3L3CA 3M2VB 3DHXA 2JNJA 3W64A 1JLGA 5AE2A 1QD1A 4DEZA 1X4FA 5A19A 4ZOSA 4RW6A 3DDKA 3PX6A 1IWAA 3W65A 4HPVA 2HW3A 4AQYF 1JX4A 3AA8A 3KUGA 2ACYA 3Q8QB 4OZJA 1N0UA 2M2BA 2XO6A 1VCTA 1X31C 4DV7F 2RUGA 4Y6IA 4USVA 1VC5A 1SKUB 2CYYA 3CO0P 2VKZG 3KJVA 1GTEA 4H4OB 4YY3F 3BYRA 3V2UC 2B5JA 3CC2S 2DITA 2QE5A 4HHHA 3BN7A 2AD9A 1RTIB 4NA3A 3SI8A 4EWTA 4NEZA 2V67A 4MK9A 3L7UA 1HNXF 1Q78A 2K3KA 1RT3A 1N5QA 3JQKA 2K06A 2YWGA 4WU3A 3MAAA 2F40A 4DX5A 1NJYA 1HNIA 4WFYA 3H5YA 5HROA 1RHJB 2DGVA 4FBTA 4DX7A 4JI2F 1CJKA 3ZNUA 2XCAA 1OY9A 1PG5B 1TKXB 4CM0A 3HHDA 2IAJA 2UVVA 4ES3A 2DJWA 4NLSA 4D4IA 2MSSA 2AKWB 4KHMA 2YWEA 2UVWA 5HLFB 5A6WA 3QRQA 4NXMJ 1UFLA 2O01C 2XB2D 2MZRA 5L1JA 1REGX 5H9FJ 5A1GA 2KT5A 2OSQA 3NMAA 2J7UA 2FGCA 3DLPX 5E3RA 3QAEA 2IJRA 3W8GA 2QG9B 2IPOB 4KGZB 2VODA 1LWFB 2HAFA 4GVBA 3LQVA 2KXNB 1EQ0A 3K58A 3TR5A 4JI6F 1NK5A 2BXJA 5G4DA 2F63A 4C3MA 5J2NA 2ZEJA 3OR2A 4YFUA 4RW9A 2ZE2A 5F8IA 4CT9A 2GV1A 4ECZA 4K0KF 2PC6A 3FSYA 3LPYA 4ANEA 1Y4ZB 2PFFB 3R5AA 2CWKA 2RHQB 3NLCA 2HRUA 1HA1A 2KZZA 4DV4C 5F0UA 1X4CA 4ZP7A 2JFDA 3FZ2A 1IKVB 5CAAA 1RT2A 2X3DA 4KIAA 1S4EA 2WBMA 3MTKA 3EPIA 3E8OA 1EETA 2XG8A 4DPOA 1X8DA 4J5OA 4P7VA 2DR9A 2P2FA 2CJKA 5THWA 3CJRA 1SPBP 4ZJLA 2MSTA 5GAGI 5J2QB 4TU9A 1HHQA 5A2QD 4ZLLA 3GG1A 3H2VE 1CS4A 1A9NB 1A6LA 4ILMA 4KYZA 3NS5A 5E7OB 1XQIA 4WCEQ 4IRDA 3FCCA 2ROGA 2KZ0A 3TAMB 1RGVA 2DXEA 3CD5A 4I6WA 2BQRA 3H42A 3RYLA 8RUCA 1CC8A 1RBOB 3UE2A 1RWNB 4CLSA 4O0IA 2CPIA 3M8QA 4PABA 4CLTA 1NK8A 5J2MA 1TK5A 2PFDA 2I9SA 1X4EA 3JSYA 2HNZA 3JQMA 2VG6B 1IM4A 5KFHA 4NLOA 4A8KA 3TDEA 2A10A 3SQGB 1KWMA 4I9FA 1LW2A 2AIRB 3I55S 2Y0SD 1FA0A 3CC7S 4CLWA 1UA0A 1SIZA 2CAJA 4HVZA 5AXMA 3QATA 3FRYA 2PEBA 2FLPA 2VDHA 2NUHA 1YJVA 1U1RA 3I87A 1HQEA 1UJ5A 3ZTRA 3HLUA 4PKDB 4I7FA 1REVB 2XHCA 2P5VA 5LOQA 4AL6A 4DSIA 3A4IA 4M5HA 4N8NA 4DL5A 3I0RA 1BXNA 3C3LA 2MLYA 3OXFA 2CRLA 5E33A 1X7VA 1RT1B 4GKJC 2W4DA 2ALZA 4DQPA 2DYAA 5J1PA 5L38A 3CCJS 4B9UA 4F26A 4O4GB 2HBYB 5GAEU 3TQEA 3PYFA 1IKXA 3GIMA 1RXOB 2IY5B 4WFXA 1RG9A 5I4MA 3SSRA 3CO9A 3ENAA 4ZCKA 5F9NA 3LAMA 3LP0A 3ZZUA 3GQCA 1VRTA 1P1LA 4NA1A 5LL6d 3FFIB 4ES1A 1TK8A 1N0VC 3B6BA 4EU0A 2CQBA 1VOMA 1KSPA 2WCXA 2GC8A 4XPCA 1NB7A 2HS0A 1HNVA 1MROA 3EMTA 1UEKA 3GIIA 1ZAVA 1WH9A 3J80Y 3HK2A 2J9EA 4DR4J 4PXDA 3BZQA 4DR2F 4RL1A 1WHXA 4IYQA 4B3MC 1WORA 2F4FA 1C1BA 3M2UB 2DB1A 2VHGA 3HFVA 4O3NA 3B82A 1LWXA 3GJRB 2CY1A 3OFFA 1W26A 3W9HA 4K50A 5BSVA 2YNHB 4ED0A 2DPLA 4HLBA 2VPYB 1XNRF 2RRBA 2FB0A 4B3RJ 4NLPA 1CVJA 3D6FB 1U48A 4RWXA 4WIQA 4IR7A 2PO4A 1T05A 3J7Z5 2J0WA 3UDEA 3L8CA 4DX6A 2UXCF 4HT5A 3G87A 5B0BA 1S0OA 2HMIA 2HS3A 4BC7A 2HQGA 4P2FA 4B9NA 4R5PA 1N36F 3NWGA 4KFBB 4C0OC 4P73A 4B3TC 3HJFA 2EPIA 1U0SA 1PYOB 4DPUA 1IBKF 3PESA 5L8RC 2N4DA 2KHCA 2VD3A 4TYBA 2B4PA 4B08A 2LEBA 4ZVSB 4DLEA 2FHJD 2HBQB 1Q8IA 1ICEB 4NXNC 4DPYA 2QLBB 1U7LA 3KOAA 2OMOA 4FTFA 2WHOA 5KAKA 3S8SA 4K4TA 2D1SA 3PEJA 3CJ0A 3IFEA 5DDQC 2OAUA 4MJKA 1WTFA 3EVWA 3KLGA 4U96A 4DV2C 4A48A 1Z4UA 1H2UX 2QV6A 2DXFA 2ASBA 3T5JA 5KG1A 2V4RA 2PN2A 2ZBIA 1ZM2A 3QSIA 3CMAS 5BR8F 4NYPA 3KK1B 1M0SA 1M5KC 1F5AA 4R1MA 3TJ8A 2WK4A 4GO7X 3RR8A 4OZ1A 2DY9A 1SIWB 3ITHB 4QCLA 3P6YC 1S48A 4CZCA 3OTOC 1DBDA 4QIEA 1E6YB 1AYEA 2XQCA 3K7RA 4FYYB 1YJNS 3EZOA 1IR1A 1AW0A 2O66A 1JK9B 3EERA 2C2NA 3FNNA 2QLFB 4K2XA 1TFYA 4I2QB 1E6VA 1S7IA 4JI1C 1JXEA 4IG0B 2HVIA 4OYPA 5CD4A 3DRPB 4IFYA 4P74A 2BA9A 2YH0A 3OTCA 1QJHA 5JRHA 1N48A 4RPFA 1XC9A 3V6HA 2UXDF 1AXQA 4ED5A 1B64A 2M5HA 1Q4RA 2GS8A 3TA0A 1NB2A 4XDDA 5BUQA 3ZTSA 2C2DA 2OLWA 2HURA 4IOAQ 4OLOA 5DLFA 3QGIA 3T1AA 1TKZB 2A6MA 2CZ4A 1N34J 2E66A 1WC0A 5F3ZA 3T5LA 1FE4A 2IC3B 5D0GA 4O3PA 3BSAA 4PG8A 3KXWA 4CH1A 3KMQA 2BE2A 3THVA 1FDAA 2R2RA 2OPQA 3IGVA 2OI2A 4KJIA 2WONA 3H20A 4KTVA 3R2CJ 2IBKA 1C0UA 3RW6A 2QMXA 2VG7B 2CG4A 1SKSA 4LJMA 1WWHA 2B8PA 1SC6A 1NSPA 2IVFB 4N5SA 1KFSA 1O0PA 4O3QA 4I56A 4I6AA 1TUVA 2DK2A 3QRRA 5I42A 1MDBA 4JI5F 4BS2A 4ZVHA 4KBIA 4WP9A 4DSEA 4DR7J 3UVJA 5B7WA 4QIWD 3U02A 1T9UA 2X1BA 4DV5J 2YXLA 3JB9k 5HQLA 3DOLA 3IR6B 3DRXA 1WKKA 1S59A 2KXHA 4P6QA 4MMOA 4DR3C 3MM6A 1HNWF 2IRXA 3KG0A 3KLFA 4ID5A 3ZZOA 5DQHA 3MCSA 4Q0BB 2VQFJ 3MPVA 5EHHA 2GHPA 4EO6A 4Z7CA 5AXLA 5A2QU 1S9FA 1FJEB 2CPHA 1HYSA 1FX2A 1R0AA 4ITSA 3DRSB 3JAMY 4IRKA 4FYDA 4ECQA 4QR0A 1JKHA 4OX9C 1M5PC 3OV7A 1VBYA 1KDNA 5LXRA 1V60A 1TTHB 2K7KA 3ELHA 2V8GA 2RDIA 1TVRB 3PY8A 5EUHA 1RACB 5HMXA 3BDPA 4B9VA 2Z0GA 1YI2S 3ULHA 3VQSA 2RRAA 4DPXA 3FEXB 1FD8A 1KKGA 2XMJA 5D4PA 3A13A 3LW5C 4WZQA 3DYAB 4NZ7A 4NL5A 4K0BA 5IM0A 2NZCA 1OS5A 5G0RB 3G4SS 2XSJA 3MECB 4M1KA 3VAHA 3NEKA 4HDGA 2HQDA 2XS5A 4B3OB 5KFBA 2OBVA 1UWAA 4A8MP 1F2GA 3GE9A 2Z2ZA 4KO0A 3TUFA 4ER8A 1FRMA 4A46A 3I5BA 3MPDA 1S12A 2EGTA 1OSDA 4MIWA 5IWAJ 4LF8C 4U67Q 2OELA 4X62J 2KN4A 3SIPB 4M5NA 3QIPB 4B17A 4OZ5A 2MCQA 3IG1A 1X4DA 4LFBJ 1FKAF 1BLUA 3MEKA 4KTTA 1T9YA 2JRSA 2RQ4A 3IRWP 2YPZA 4H4KA 1OQ3A 2OH2A 2VA2A 2E9ZA 3NY0A 1ZTTA 3SSSA 2DR5A 3MMAB 4C11A 3H7HB 4DPTA 1RCXB 1IBMC 5KFNA 5I3UA 1PC5A 4L6V3 2KFNA 1OIAA 4C2MA 2IDEA 1RT3B 2NR0A 5BSTA 2DNZA 1NDPA 1KLMB 1Q8KA 3LALA 1DAXA 1FNOA 1ZZFA 3EXCX 1AMUA 3U27A 3G6YA 3NYRA 1U1MA 9ATCB 2EK6A 2C3MA 3RUBL 2VBWA 1EIYB 4C0HA 3OL6A 4HH1A 4M5JA 2IAJB 1XMBA 3UNGC 2HLUA 3A26A 2CZ9A 3NGUA 3LGXA 4U6PA 1AROP 4EI2A 4ZVPB 2H5IB 3HF5A 1RHUB 4TN2A 3O44A 5HAOA 3RR7A 3IGNA 5KFJA 1XIQA 3FCHA 4WK1A 4WYWA 4PWDA 4DU8A 3ENWA 1XBWA 4PWWA 1WSVA 3GKUA 3MOJB 2F8EX 2XY5A 1RK8A 2DT9A 2H1YA 2FC9A 3K5MA 4IR9A 1HD0A 4C8LA 4L4QA 5DS7A 3CE8A 5E2QA 5KFVA 1UWDA 1HBNA 1RABB 3O5TB 3KLEA 4LF6C 2AV5A 1HBUB 4G36A 1HBMB 4PG6A 8ATCB 2ZE2B 1RQ0A 1UKUA 1DURA 2XLIA 1O90A 3M8ZA 4DV0C 3J81j 2FHJA 5A8RA 1XN9A 2V94A 4IO1A 3BGRB 2A2DA 3C19A 3I07A 2JJ4D 2GGPB 2XHWA 2DGWA 4OHWA 4WTYA 3M8WA 3VGVA 1SC1B 4Y00A 1FD2A 3EE3A 1B99A 4S0MA 3V6KA 3W66A 2Y1RI 2BUNA 3POTB 2EEYA 3DLKA 2PD1A 1X4AA 3SDEB 4FP9A 2AZ3A 2FY1A 3Q0AA 1K0RA 1PAEX 1KONA 3NBPA 1R8AA 1R31A 1IR0A 1YJRA 1S79A 4OYZA 4DN0A 4OX8A 1HL6A 2WVFA 2Q43A 2MKSA 2D1TA 4U8YA 1HR0C 3GU0A 3R7SB 3DLHA 1M1KT 2QT7A 1H73A 4OX6A 1FCAA 1TL4A 3T5KA 2XI2A 2YX1A 3T1HC 2P2MA 2CQ3A 4YHHJ 1ZBTA 2LEPA 2R4FA 1J5OB 1JJCB 4ZITA 3MUVP 4WV3A 3MPUB 3L7OA 3R9LA 3M8QB 2WSEC 5F9LA 2V8DA 2MZJA 1NK0A 4NCBA 4ECWA 4Y34A 3EDQB 1GEHA 4F4ZA 3CCTA 1QDUB 1IKYB 3HVAA 3OR1A 2CPEA 4QR1A 1X9MA 5C42A 2HLTA 2ZDOA 1N33J 4P72A 4QPXA 4DPWA 4ZJOA 2VIHA 4DF4A 1VK8A 3TQIA 3R5GA 3N5BA 4ID8A 3TOQA 1HARA 1XWLA 3TX8A 4WE1B 5IQQA 2JDJA 1VC0A 2GJFA 3EWGA 1S6PB 2WOMA 4ZVGA 4O0NA 5F3TA 4NCAA 5KG7A 1U1KA 2JNVA 1NKCA 3MPYA 4QW8A 3PW2A 3UEBA 5HVHA 1YBTA 4ENOA 4LF9F 3CCVS 2NS1B 4TYAA 1KNZA 2FJXA 5LJ3Y 2G0IA 3R7NB 3C6UA 4F67A 2BV3A 2LA6A 1ULTA 4PUGA 4WBFA 2R7RA 4NLWA 1G1XA 3M6VA 2YKMB 3TA2A 3V5RA 1KRPA 5DM7Q 3ENQA 1PYTA 1VRTB 2NQPA 3FCEA 4KGMA 1FWPA 5DG9A 2VFUA 2COLA 4OV1A 4CLUA 1NHUA 1YJUA 2BANB 2N3OA 1N4LA 2KL8A 4CO3A 1RAJA 2DEJA 2D1CA 2VG5A 2CJQA 1L2FA 2BEFA 5HJXA 1N88A 1R7IA 3AJDA 1T5HX 3K5OA 3WIVA 3H40A 1WELA 2XZWA 2B7BB 4M5MA 4DZ6A 4UW2A 2V69A 3M7VA 5IT0A 5A8WA 2PGCA 1QE1B 1RAHB 3EGZA 2CJYB 2KZFA 4JI8J 2EI5A 2L9WA 3DLBA 2W2NP 5HQ8A 4NEYA 3DOKB 5E3QA 5DZ6A 4ZMMA 2E5LJ 4R5PB 1DTTB 2PA8D 2D28C 3I0SB 4K8RA 1RDRA 3GFHA 5E5NA 4IUFA 1S1WB 4Q44A 1K8AT 1P6TA 4DUZC 5L1LA 2HQFA 5IC4B 5IT9D 1AZSA 3ET6A 4U9RA 4QYZK 4C8YA 3RRHA 3OTOF 1BC6A 3JTOA 4RBUA 1WTBA 1KQFB 3R3TA 3W2VB 2HS4A 1WOSA 2YVSA 4LRFA 4OIXA 4MAKA 3KLVA 4USUA 1VISA 1GMWA 1P4EA 4IH6A 3LWMA 2CNKB 5L39A 3KHLA 1U1QA 2FJDB 3BH6B 4IRCA 5HMZA 4LSLA 5A8KA 2AEMA 1M6XA 4F25A 5B0AA 3PW7A 5J1EA 2Y1LB 3C5EA 1MXAA 2AEFA 5HBMA 4FYWB 2BKOA 4Y65A 2ZZNA 2FZKB 1FNXH 4L2ZA 4BC9A 4N56A 5B0GA 3MEGA 3D0IE 3TQ1A 3GSIA 2DNQA 3BGFA 3BO4A 3IN5A 2DNPA 4ZN3A 2M52A 2DNNA 3VWSA 1E6VB 1VI7A 3G6VA 2X1AA 5IFIA 3BR9A 1BWVA 1MXCA 3VNRA 2C3OA 2K3IA 1J2VA 1PC4A 2RS8A 1VYAA 4CO2A 2OMLA 2UUAC 1RAFB 1MWYA 2FYXA 4BWMA 4F36A 1PBUA 1YRUA 2B43A 4CLKA 8AT1B 4MKVA 1XMOF 4GO5X 1WUUA 3I9V9 3LAKA 1HBOB 1NJXA 4JV5J 4C8MA 1BY9A 2CDQA 4FF1A 4ZA1A 3BGUA 1NXIA 4Y0FA 4C98A 1KD1T 2YX7A 2QTWA 2ZNZA 1DTQA 1ZM9A 3V4IA 3LA0A 1VLOA 3V6JA 2VICA 3G7SA 2BRLA 4KE5A 3HZGA 4EZ6A 4JBCA 4X64C 5SZTA 1WI8A 4ZPTR 2R8GA 2DXDA 1CULA 3CJKA 3MEEA 2BE2B 3CMQA 3HHLC 4YB5A 2A3JA 3OTEA 1V25A 5D4LA 1T94A 1UZHA 5KT7A 3UFCX 1EAYC 4ZIWA 2R8IA 5GMKa 3X1LB 3NAHA 4B9MA 4DR3F 5JMNA 3Q8SB 1ML8A 2FUG9 4I2PA 2BM1A 5KFAA 1KBRA 1W2IA 3D6HB 4OX7A 2G9OA 2OTJS 1SJ4P 1S6UA 2ZKUA 1NSKL 4ZVUB 1CJVA 1BUXA 1S77D 4AXJA 3TX0A 2QN6B 3BBCA 2CPDA 1K9MT 5KFSA 3TO8A 1C1CA 3DLJA 1CJTA 3KJNB 4B3RC 2MQLA 1SC3B 1CSJA 4DL0C 2UVRA 3W1YC 3RBDA 2K1RA 4BBYA 4WJBA 3EZ5A 2ZM6J 1FEEA 2ZC4A 1QSYA 3DM2B 3UD3P 2YNGB 3RV2A 3NRBA 3PO4A 4DI6A 2OGUA 4TQRA 2DNOA 4ZLNA 1Q7LB 2XCPA 3TEHB 2FHOB 4LIWA 2CWXA 4QU6A 4OYOA 1GXLA 4DV5F 2MKHA 4KGKA 1XNQJ 5BXIA 4OHYA 2P2BA 3MXHP 2IVYA 3C2PA 2IJFA 4ED8A 4HHJA 1UAWA 4QBUA 1DZ5A 1IBLC 5EDWA 1LWEA 4FUQA 3MGJA 1VHFA 3HDSA 4ZJZA 2H3EB 4DL2A 1QSLA 1URRA 2ZNYA 3HSGA 3RB3A 2BBEA 3GONA 4MT1A 4GXQA 2L9DA 1QSSA 2J7WA 2ZUAA 1JLCA 3W2WA 2HKEA 4DG1A 1D3WA 3OLAA 1HHTP 4LF8F 1YJ7A 1WI6A 3ZZZA 2V0NA 2X51A 1LFPA 1JLAA 2YWFA 4MKBA 2E9TA 1RWPB 5L9XA 5KOWA 2DHGA 3I32A 1Q81T 3HHLB 3OTBA 3UOWA 4QPTA 1JOSA 1JB0C 1RTHA 2I8EA 1SCJB 3F44A 1LW0B 4I64A 1FJGJ 5C2CA 2BJ1A 5LM7E 5DDRC 3BBFA 4M5DA 4QWDA 3CSKA 4MKYA 3EXYA 3G71S 2J8SA 4F0MA 3SCLE 4NLTA 2YKNA 4O44B 1C0TB 2QIFA 2W25A 3CDBA 2KRRA 4ZK7M 5D6GA 1XMQJ 2VPXB 4RLEA 3CJ4A 2CPFA 4OJGA 2OPRB 4I1TA 4ECXA 1NH8A 2R7OA 1X0FA 5ETLA 3CCZA 2CUYA 5IWAF 1MG7A 4IDKA 5T14A 1VIOA 1P7LA 1S1UB 3TW0A 2ATWA 2AWZA 1VEHA 4X62F 3QZ8A 5LSRA 2E5IA 2G0CA 3IR7B 3NCPA 1NY8A 5EX0A 4ATNA 2AT1B 4NOHA 2HWIA 4NZ0A 1N34C 5ETPA 3VF0B 3CCQS 1CJUA 3QRPA 4ZP8A 4AQYJ 3NGKA 1NRKA 4CO5A 4KRWA 4DCTA 2M88A 4DV7J 2U1AA 3DHVA 4ZPDA 2OEJA 1IKWA 3IA0A 4YY3J 3PO5A 2DR7A 3K59A 1WC5A 4LF6F 3F0NA 2LQBA 2V5HG 4JV2A 4HYKA 4YR2A 3T1YJ 4USMA 1UVNA 5KT2A 1WNEA 5B09A 2QYGA 3BR8A 4NRTA 4OYMA 2E1AA 3M6UA 4A8YA 2LQJA 3JS9A 2DNHA 2ZJRQ 1SUQA 2BE9B 4URGA 4HH0A 2IM0A 2OSRA 3C16B 3J80D 3VAJA 3N5FA 9RUBA 4OYAA 1RTDA 4JI2J 3M2RB 3MR5A 3ILOA 4ZKAA 4DR7C 4DCOB 2HFZA 4CNZA 3D67A 1RAAB 4XAKA 2ACMA 3OHAA 1UL3A 2RAQA 3UQSA 2ZZMA 2DHAA 1F6TA 2E1RA 5T7LB 4X4VA 2H5EA 5CYMA 3HZEA 4TNOA 1K1SA 3SFUA 4J90A 4PHTA 3WX8A 1KTQA 2B4OA 3PW5A 1EKRA 1BGXT 2XYPB 1CG2A 3HD1A 1Q95G 5HP1A 4PUOA 3PHTA 4I0WA 2MZ1A 4FKXA 1HNZC 4ZHRA 1HR0F 4DFPA 2UP1A 3OT9A 3J7ZT 1HQUA 3TZXA 2DNMA 4WF9Q 3CJ5A 4FXVA 4BWJA 4DL3A 3H2LA 2JLGA 4DZDA 3BEGB 3GV5B 1FE0A 2NXNA 4RW7B 1SJRA 1TL7A 1VRUA 3KK3A 4I67A 1SJFA 1WG5A 3HMJG 5F8JA 4UZBA 2I1RA 2ALYB 2J9DA 2V8PA 4YMEA 1T02A 4TY8B 5GADI 2DHXA 3PROC 3LPEA 5K14B 4TQSA 1V9OA 4USIA 2FVPA 3CCSS 4M5GA 1RKIA 2DGXA 4YP3A 1S76D 4R0EA 2IDLA 1TV6A 3ZTOA 1XJWB 1NNDA 4YR0A 2XZTB 5L1KA 2O1PA 3N01A 1FNMA 3TI0A 2MGZA 4B9SA 4MH4A 2XBPA 4XK8C 3TRGA 1DRZA 4MFBA 3GJTB 1DHMA 2Y4OA 3OR1B 3QZ7A 4WYLA 3VVTA 5C42B 2JLFA 5GAHU 4UOCA 2UZAA 4WKRA 2J7KA 1RHRB 2PROA 2OHDA 3SCJE 3BQ2A 3MF5A 3PFOA 3B54A 1SL0A 4DR6C 5KT3A 2YNFA 1RTZA 2KB2A 1H38A 1F2HA 3D6MB 5KFPA 5AJ3F 2IA0A 1RT4B 2YQ3A 3T41A 2VJUA 3KNGA 5KFXA 2JEGA 1K0TA 3LP1B 2HHTA 3IRXB 5C24B 7FDRA 3CMES 1JJHA 2Z56B 1FWLA 3HSJA 4W90B 4OFZA 3WHIA 1U8SA 3HVTB 1S1TA 3PKYA 4KKOA 5C25A 2IM1A 4X4NA 4NRUA 2PIIA 1S9GB 2GO8A 2UUBJ 2EW9A 1KFDA 2YKOA 3DRRA 2F4VF 2QLJB 5LMNJ 3OVSA 3CDWA 2VC0A 1RWOB 3L95X 1QM9A 1XR7A 3MM7A 4USHA 3AA9A 2CA9A 1Q16B 3DMJB 3LWLA 1S9EA 2IFXA 1UVMA 1JLEA 2M9KA 4FYXB 2YWKA 4UUWA 2M4MA 2H54B 3ILJA 3QLHA 4RM2A 1YKWA 3H5UA 4J9MA 5IOLA 4L75A 4A8OA 3EQ6A 2GMHA 2F7VA 1TFWA 2W9CB 3N6LA 4AT1B 4KSEB 1F5BA 1SKWA 1JLBA 3W5XA 3D4JA 2GIQA 4DCJB 4TU7A 3FQLA 1NUEA 4DR2J 5LCIA 1ZB9A 3CIZA 2L08A 2RB7A 2WW4A 3EJMA 4R8UB 2J6TA 3JSMA 2AX0A 2C22A 3HVRA 4LFCC 4UZCA 2MZQA 5E41A 4Q7AA 2KT2A 3NXZA 3KNAA 4K2JA 1XNRJ 2RDDA 3DOMA 5B0EA 3JAMD 4LQ3A 3J81D 1T8EA 2DHSA 2M70A 1IN0A 2XZDB 3CD7A 1HPZA 1NPKA 5IV3A 4K4WA 3ET6B 3CCUS 3O1LA 1S99A 4Y28C 1UJ6A 2UXCJ 1N32C 3HX9A 1IWGA 3QT6A 3RB4A 5BJRA 3ICLA 3M32B 1FKPB 4HTIA 1FJCA 1OPIA 3C15A 2FJVA 4CH0S 2RQKA 1IBKJ 3OVAA 4FZVA 1UCNA 2XMMA 3OFEA 2RKIA 1FKOA 3KK2A 4LSNA 3P96A 4USJC 3UN3A 3HD2A 3MM8B 2UUAF 3NS7B 1Y11A 1TKTA 4CYUB 1P9YA 1WC4A 4GRSA 2ILZA 2KRBA 1HH2P 2RSQA 2WZ1A 1FUGA 1S1VB 3PYDA 4LBIA 3QGGA 3O6QA 3DU5A 4C6AA 2ZHOA 1MN9A 3MOZA 3PJXA 3VALA 4OL8A 4HACA 1NK7A 5BR8J 1ZA2B 4X65C 4XX2A 1T03B 2GAHC 3GV8B 2ONFA 5D3GA 3E01A 2ABYA 5DGAA 3DAYA 5ADZA 5BSRA 4EUVA 1FXRA 2QVZX 3B78A 4YB6A 2YCBA 5B0CA 3MM5A 4RW4B 2GA7A 2ZH6A 1USPA 1HWKA 3HPOA 2BJOA 4A8SA 5KT4A 2P2JA 2ZOMA 4Y3CA 2LFVA 2GAGC 3G8TA 1F1BB 1N5SA 3JXOA 4MTPA 3ONQA 5K8PA 4PROC 2UXDJ 4H4MB 3D6TB 4B9LA 1UP1A 1LFWA 5BYRA 3J80U 3AD9C 2OPPB 3VAMA 1FFWB 2UVUA 2IA6A 5M2RA 4YDXA 3R27A 2XMKA 2PE8A 2Y4NA 1RKJA 4QZVB 1N8RT 5EX3A 3SBMA 3MMBB 3UCUP 1Z1ZA 3AXMA 4IKAA 5KG5A 5D4NA 1R6VA 3FC9A 2O67A 1KP6A 3HT3A 3I4PA 3A8EA 2P6TA 1B7FA 4OMFG 4BHQA 1GK8A 3BKFA 4ELUA 1H2VZ 3JYTB 4LF5C 1BQMA 2H4WB 3TVZA 1IBLF 4P2SA 3EVMA 3OUYA 3ZFVA 3VNQA 2KHDA 5I3QA 2XMWA 2KTQA 3Q86A 3MURP 2ILYA 4JI8C 2UU9C 5CCLA 2LXFA 1F3FA 1V6HA 1S0VA 2A2CA 2EVZA 4X4TA 1N5YB 3AT1B 4JI5J 1FTRA 5L46A 4X2BA 5FIIA 3TUZC 2R7VA 2D1RA 3HO1A 4GKKJ 2CVIA 2I5JA 3SFGA 1PAUB 1UA1A 2JFKA 3MEDB 4DN9A 1HW9A 4XPEA 4PUIA 2M5YA 2HPUA
chains in the Genus database with same CATH topology
2VA2A 2E9ZA 2ZM6F 1N32F 1JLBB 1ZTTA 1EP4B 2KKHA 3TUIC 3SSSA 2DR5A 2BABA 3MMAB 2ASDA 4B3SC 2V9KA 1WHYA 2GQ2A 4CIOA 4C11A 1FRIA 3SCIE 3RAXA 4D4GA 2CJ9A 2R2SA 3AJ1A 4QIFA 5KFNA 5I3UA 1IBMC 1PC5A 2E0GA 3UCZP 3CGIA 4L6V3 2MY7A 2FD2A 1A7GE 4IFYB 1OIAA 2KFNA 1TL1A 4RW8A 4C2MA 1UWBA 4J9NA 2BANA 3JSMB 4NOZA 4M95A 3W7BA 1RT3B 3QO9B 2NR0A 2DNZA 2KXFA 1XNQF 1WEXA 5BSTA 4LF9C 1KLMB 2MJNA 3TVYA 5H9EJ 3LALA 1DAXA 4WXOA 4C7QA 2W8KA 1FNOA 1ZZFA 2DGSA 2OP5A 4RZRA 3EXCX 1AMUA 2DGQA 3U27A 4D3HA 3G6YA 3NYRA 2GJIA 4WFNQ 4YDDB 1U1MA 4L7IA 4ODJA 1LXJA 5KG4A 4ED3A 2JEFA 2JHEA 2EK6A 2C3MA 1K0VA 3MFIA 2VBWA 5D4OA 5D77A 1UKKA 1CQNA 4C0HA 3OL6A 4OJHA 2MQOA 4DR1C 4HH1A 3V6DA 2RT3A 4YHHF 1FEHA 4JI3C 2CQDA 1HPZB 2CXCA 1S1XA 2MZTA 4DFJA 1APSA 2IAJB 3B7WA 3E3XA 1XMBA 3D2WA 3UNGC 4DMZA 6FD1A 3I08A 3HKZD 2HLUA 2AYBA 3UDLA 1CPZA 4HT7A 1S6QA 2W7AA 1QTMA 3OSPA 5CYQA 4AL7A 3CW9A 1N54B 3LGXA 4U6PA 2C3PA 4DV4F 1HI1A 4J9OA 5J2QA 2AYAA 1AROP 2OD4A 3V81B 3CJ2A 1QE1A 4AXIA 3HF5A 4IG3A 1U1NA 2OTLS 3TUJC 4TN2A 3VAIA 3D1HA 3O44A 1C4CA 1LXNA 2G13A 3G6ES 2GHWA 1I6JA 4EBEA 1D1UA 2R8KA 4QU7A 3RR7A 3U1NA 2Z2LA 3IGNA 4WKYA 2ZH9A 5KFJA 4OZLA 2UXBC 3FCHA 3NS6A 4WK1A 4WYWA 4NLVA 4PWDA 1R43A 4RU9A 3DOKA 3ENWA 1DLOB 1XBWA 3UWTA 1DTTA 2RKIB 2MQNA 1FKOB 3E51A 1RTJA 4YR3A 2OPQB 2Q6BA 5KFTA 4C8KA 3GKUA 3MOJB 2J9DE 5B0DA 1N33F 2F8EX 2XY5A 4LSNB 2F8HA 2WONB 1RK8A 4ALZA 2DT9A 4DR3C 2KU7A 3I0SA 4X4SA 2MKIA 2FC9A 2BRKA 4K5RA 1TKTB 2DGOA 3K5MA 4IR9A 1SV5A 2DH9A 5HN0A 1HD0A 4DV1F 1M90T 4EZ9A 3DCAA 4C8LA 4L4QA 1S1WA 5DS7A 2Q66A 3K8VA 1C0UB 3CE8A 5E2QA 5KFVA 4F4XA 1HBNA 3G6XA 2FLNA 3DLGB 4Q2MA 2XMUA 1K73T 3I31A 3O5TB 3MFHA 3KLEA 2HGNA 1FHTA 2OJ3A 4AL5A 3TANA 4LF6C 4FNIA 2AV5A 5BSUA 2HQIA 1X4BA 2HNYB 3MR6A 3U1LA 1HBUB 3I6PA 4G36A 1HBMB 2GFFA 1L3UA 1TL3A 4ECSA 5B08A 4PG6A 3M8PA 4DR4C 5AE1A 2HNDA 4DQSA 2ZE2B 2CQIA 2ZH5A 2AQ4A 1Y5NB 1RQ0A 1VLAA 1UKUA 1KLNA 2MJUA 1DURA 2DD8S 2LMIA 3A9VA 2XLIA 4UQGA 3K5PA 4EYIB 1O90A 5KFQA 1KVJA 4PCQA 5I42B 1RYSA 4DV0C 3W2VA 4F8RA 4OI3A 1U4BA 3R9XA 2FHJA 5A8RA 1FF2A 1XN9A 2V94A 4IO1A 3BGRB 1V3SA 2A2DA 2D3UA 4OX9F 2Q3PA 3DGPA 2UV8G 4RNOA 5D3GB 4NYZA 2V2KA 1CLFA 3ZZ0A 1X5OA 3CPWR 3I07A 3WC2A 2AF6A 2C28A 2JJ4D 3EGNA 2GMLA 1WG4A 2GGPB 2XHWA 2DGWA 4OHWA 4WTYA 4CT8A 1UEVA 1HWJA 2RNEA 3CIMA 2VOOA 4Y00A 1YVFA 1FD2A 1U26A 3DOLB 4H4KC 1MMDA 1FVSA 4KQZA 3V6KA 1R8BA 4UY85 4PPDA 2Y1RI 3QWPA 2VZEA 3I9ZA 1VQ4S 5DETA 2V4JB 4KR0B 3MM6B 2BUNA 3AJ2A 3POTB 1Y0HA 5DRKA 3DLKA 2AX1A 2KM8B 2PD1A 1X4AA 5EGYA 3SDEB 1GH8A 3MM5B 3S7RA 1YJWS 4FP9A 3OBIA 3KLFB 1FO1A 1ZTWA 4ID5B 1R8HA 2ZHBA 3DLLQ 4OI0A 4O3RA 2BW2A 5IQ6A 1USPB 2P20A 1RT1A 3G8QA 2FY1A 1UVLA 4ZVFA 1NH7A 3Q0AA 1TZ0A 4WFAQ 3KLHA 1K0RA 3MMJA 1KONA 2K2PA 1FXDA 3NBPA 4YEAA 3VAGA 4JI0C 1R8AA 1R31A 1JLFA 1IR0A 1YJRA 4G1PA 2DNRA 3N6MA 4EO8A 1S79A 4DN0A 4PWUA 1I94C 4OJ3A 4OX8A 5L9NA 1HYSB 1HL6A 1M5SA 1SJQA 2GQCA 1R0AB 3QJJA 4RKUC 1LWCB 2Q43A 3PRDA 2MKSA 2D1TA 5F8NA 4IFVB 5L1IA 2RD5C 4K4UA 3LUYA 1HR0C 5CZXA 1JKHB 4QWBA 1SL1A 4LF4F 1Y7PA 3DLHA 1U1OA 3LAXA 4RUHA 1RA6A 2W9BA 1GQEA 4F4WA 1SUQB 3G8SA 2LECA 1R89A 5KFGA 5CD4H 1M1KT 2QT7A 4MK7A 3MHYA 4OX6A 3JSBA 3P5TL 4NMLA 4BDPA 1RTDB 4U5YD 1FCAA 4Z2XA 1TL4A 4A4JA 3T5KA 1PGZA 1KTVA 2XI2A 1NK6A 4I6YA 2YX1A 3T1HC 3QJLA 2P2MA 3IAS9 4WFBQ 2ADBA 4RNNA 2CQ3A 2UUBC 2UUCC 1ZBTA 4LF5F 2LEPA 1M5HA 2ZOGA 2R4FA 1J5OB 1HHSA 2HVZA 2DTJA 5HO4A 3MUVP 1U2FA 3HVWA 4N8OA 4WV3A 5LMNC 3DLEB 1UJ4A 3L7OA 4ED1A 3T1YF 2L3MA 3M8QB 1X5SA 4ILRA 1HBOA 2WSEC 5F9LA 3BDEA 4JI8F 2V8DA 2MZJA 1NK0A 2N7CA 4ECWA 4NCBA 4LE5A 1H0HB 2UUWA 4Y34A 1QVFR 3TVKA 3G9CA 2APOA 2UU9F 2YNIB 1KS2A 5DM6Q 1D8ZA 1NJWA 2V8VA 4F4ZA 3M9MB 3FDSA 3SV3A 1WF2A 1WACA 2B56A 3CCTA 3R5CA 1QAYA 2NYIA 4X4PA 2KDOA 4ICLA 2HHHF 1IKYB 1FK9A 2E5LF 4ISBA 3HVAA 2F1FA 4R25A 1HMVA 5A0YA 3TP2A 5IM0B 4U7CA 4F2SA 3KMSA 3OR1A 4RNMA 2XSJB 2CPEA 2BQ3A 4QR1A 1X9MA 3SCKE 3R5BA 2NZ4A 4DV6C 2G1DA 2YWCA 5EWEA 5C42A 2HLTA 2ZDOA 2VOPA 4P7TA 1RISA 4QPXA 3TAPA 2OPSB 2E8CA 4NA2A 2VB6A 4DF4A 3T6BA 3R1HA 4JYAF 2DO4A 5JXSA 3DHWC 1VK8A 4IQXA 3FQKA 1BQMB 3I5CA 5FLXD 2VASA 1HD1A 3TQIA 2PI4A 3ISNC 2I0XA 4IH5A 3N5BA 4ID8A 2QO3A 3TOQA 4KO0B 1HARA 1XWLA 1XRCA 1ZAWA 2V7BA 4JI7F 1XMOC 3TX8A 4WE1B 4J9KA 3MPWA 5LMUC 3SEOA 4OI6A 5IQQA 2XR1A 2N82B 4TY9A 2BOPA 3BN4A 1TAUA 1U2RA 4B3SF 2IM2A 2Q6CA 2JDJA 4DS4A 2DNYA 1VC0A 4ZLPA 1S6PB 1VFJA 3W3SA 2WOMA 2B7CB 3LP2A 4ZVGA 2CIMA 1EGAA 3B4MA 4MK8A 3RRKA 5F3TA 2RU3A 1G7CB 4NCAA 1IBMF 4B02A 4FF3A 3U7JA 5KG7A 4ED7A 2RQCA 4DR2C 2F3JA 1S6OA 3FRZA 3PNIA 3M1VA 5FDLB 2ASJA 1U1KA 1J5EC 1NKCA 1WHVA 1Q7YT 3MPYA 4QW8A 1H2TZ 5IZHA 3AH6A 5DG7A 4KFBA 4F4KA 3PW2A 3PZPA 3FMBA 4B9TA 2OD6A 4A8FA 2CPXA 4LF9F 3CCVS 4ILLA 1BQXA 2NS1B 3IG1B 3C6TA 4A47A 4X4QA 2QA4G 4Q8FA 4TYAA 4CTAA 1KNZA 3I82A 2VFSA 2FJXA 5J2PA 3PW4A 1SB6A 2VONA 5LJ3Y 2D3ZA 3C6UA 2R7QA 1ZZNA 3KYLA 4F67A 2BV3A 4RBVA 2LA6A 3K5LA 3FGVA 3LNVA 5F8LA 1ULTA 2KYZA 2NXUA 1QVGR 1N6QA 1YJ9S 2R7RA 4FXWA 4JI3F 5BSWA 2QEXS 2V9WA 4NLWA 3BREA 3M6VA 2M8DB 2YKMB 4DX8H 1G1XA 2R9LA 3TA2A 3V5RA 1NK9A 3J7A1 1QAIA 5JVGQ 2AJFE 4KHPC 1KRPA 1N56A 5H1SV 3M8RA 1Y3JA 3BM7A 4Y2KA 5DM7Q 3ENQA 2I38A 4ZPCA 4CO0A 3VTIA 2CQGA 1VRTB 4K59A 5HMYA 5KFMA 2NQPA 2UXCC 4X66C 3FCEA 4KGMA 2J6UA 3JSRA 4C11B 2R7SA 1U09A 2POKA 5DG9A 2JX2A 3M2VA 3N4WA 5I3UB 3BSCA 1D9FA 1VQKS 2BQUA 2ZOFA 1RWUA 4AFFA 2VFUA 2W4PA 1TL1B 2COLA 4RW8B 4OV1A 4WXWA 1NHUA 1R27B 4NWBA 1YJUA 2BANB 4DSKA 2N3OA 1WF0A 3JTNA 1JLQA 3O2IA 1N4LA 2DRAA 4NPOA 3DN9A 2BM0A 2LQ9A 2B4VA 3NAIA 4GS5A 2VFRA 3GR0A 4CO3A 2DISA 1MW7A 4I69A 1RAJA 3MUMP 2L48A 3GYNA 1IQTA 2B51A 2JLEA 3DM2A 4M63A 2D1CA 3ZZTA 2YNGA 5IFMA 3H5XA 1HI8A 2FJAB 2V8HA 5DGBA 2VG5A 1JJ2R 2CJQA 2J9CA 1L2FA 2QA4S 3BB5A 1SJ1A 5AXKA 3V6DB 1N88A 1R7IA 1S49A 2YKAA 2PDAA 1T5HX 3F56A 1S1XB 3K5OA 1KQSR 4D56A 3HKWA 2AU0A 3H40A 4C4WA 4Y2MA 2ATLA 1N2FA 3MM9A 4X84A 4M8LA 3N79A 2XZWA 1WELA 2D9OA 3FEZA 2JWNA 2MY8A 1L3VA 1K1QA 2B7BB 5KOXA 3K5NA 5T8TA 4D57A 2HG4A 1FTCA 5BYSA 3CTRA 1S6QB 3M4XA 1BD6A 4UW2A 1E6YA 5CHCB 2WAQD 5CYQB 3PHEA 3WZ0A 5KFDA 5IT0A 5I3PA 3OVBA 5A8WA 1GTHA 1P27B 4JV5F 2PGCA 3PRBA 1QE1B 4IG3B 2G4BA 3I4HX 2FVCA