5CZXA

Crystal structure of notch3 nrr in complex with 20358 fab
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
227
Chain Sequence
CPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHVIGSVVMLEIDNRLCLQNDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Neurogenic locus notch homolog protein 3
total genus 61
structure length 227
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5czxA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5czxA01
3L95X 4ZLPA 5CZVA 3ETOA 2OO4A 5CZXA
chains in the Genus database with same CATH superfamily
3UR3C 3PJXA 1KS2A 2GAHC 3NAIA 2ZHAA 4EZ9A 2FJXA 3IEUA 3GJQB 2V68A 4C8KA 4JI4F 3QIPB 4NXMF 3AJ1A 3MAQA 2B8QA 1EGAA 1RACB 2F9DA 3PIPQ 3QO9B 5K8NA 4OZ1A 3MOJB 1KONA 4C8ZA 2LXFA 3TEHB 2M5OA 3N6MA 3UX3A 1LW2A 4UUWA 3BB5A 3H4BA 2E8FA 2KJWA 1YKWA 1C1CA 1RISA 3W61A 4DG1A 3IN5A 2GMLA 3E8OA 4DL5A 2XM3A 2KFNA 5KT2A 4DFPA 3BKTA 4A8YA 2C3YA 1QUVA 4NZ7A 3AJ2A 3KUEA 4UTGA 3VCDA 3SO4A 1JMTA 2DHAA 3TANA 2V67A 5CA5A 3JS9A 3D28A 1AA1B 2W4CA 2YWCA 3R5DA 4X4OA 2P2BA 2CG8A 5HP1A 1FTCA 3N6LA 2FGCA 4NZ0A 2FVRA 4FUQA 1Y00A 1KTVA 2YNHA 2DEIA 2UUWA 1WACA 3H40A 2B9XA 3MEEB 4U7CA 2MKIA 4HH0A 3KTQA 2KZZA 5L8RC 3LNOA 4HT5A 3TJ9A 3MPVA 1W2BR 2UV8G 2KVQE 1Y7PA 4FXWA 4LBPA 4NLWA 3KFWX 1Q8BA 3NNCA 3GKUA 3RV2A 5C7PA 1CSJA 1XWLA 1RAAB 2OKQA 3IA0A 2ZBIA 1QSYA 2CPFA 2LQBA 4QR2A 1ITPA 1RG9A 5K5MA 1CVJA 3M2UB 2KG0A 4OI2A 4NLXA 4KTQA 4LFCF 2D41A 2CA9A 4NCAA 2P6SA 4QIVA 4Y00A 1U2CA 2PMHA 1GMUA 3IC1A 3OXFA 5CD4H 1NLKL 1HHQA 1RBLA 1RT3A 3UDEA 4DS5A 4N7TA 2N3OA 1F9EB 4DR5J 2NLWA 1G4CA 4I2PA 3MD3A 3IBWA 1U25A 4JBCA 1PA4A 1GTEA 4RW8B 1O9TA 3GJRB 1XS3A 3G8QA 4B08A 4K4YA 3QGPA 2YWEA 1SUQA 1JK9B 5KFIA 2ZOMA 3PYFA 3TR5A 3CCQS 1HNXJ 4FBTA 3MR6A 3PW4A 2JC1A 4LMZA 1HHTP 2V4RA 4X66C 3CGIA 1IR0A 1TUGB 4OZ0A 4NWBA 4GKJJ 2DISA 1RAFB 4RL1A 4OX9F 1YJRA 1NJYA 1XJWB 3CULA 1WI8A 4CTAB 5EWFA 1U6FA 2GVZB 1JLGA 2UUTA 4USIA 4UQGA 3FSYA 3NP5A 5HLFA 2UUCF 1OJ4A 5BUQA 1X4GA 3HULA 2DH8A 1X5TA 5DM7Q 5T8SA 4RBVA 1FK9B 1LK5A 4LF8J 2X7IA 3A1YG 1TZ0A 3NS6A 5HVFA 4B9NA 1QUPA 1JXEA 3CCES 4USWA 2F4VC 1OYDA 2GMJA 4K7QA 3MOZA 4DPYA 1UWDA 2G9OA 2HWIA 2GVZA 3BJYA 1XMQF 3R9WA 1I94J 3O1LA 4O4GB 2RKIB 1XR6A 3IMLA 2CNKB 4Z7CA 4ECUA 5D77A 3OHBA 6AT1B 3RAQA 1WHYA 5KG0A 2LEBA 3AB4B 3GPAA 1HW8A 4Y2AA 1FRHA 5EWEA 4DV2F 1JJHA 2KHDA 2VPZB 2FDNA 4HT7A 2UUBJ 3KHHA 3M8YA 4D56A 5LMNC 1ELOA 5B0GA 3MMAA 5E7QA 1UETA 3KNAA 1QE1A 4BBYA 3LF0A 3Q0AA 3K5OA 4ZHRA 1VQ9S 1F60B 2NSBA 3JXOA 2XI2A 4HH1A 1LQLA 5KFRA 3KG1A 1FRXA 1YK9A 1ZBTA 1QLNA 1UPPA 4DUYF 2ALYB 2ZITA 5C42B 4P2SA 5KOWA 2XQCA 1APSA 2ZJRQ 3BSCA 4ODJA 1NUEA 3KK3A 2CQPA 1PO6A 2FJVA 1WEZA 2WK4A 5FD1A 4XO0A 2N3LA 2OEMA 2PFFB 3HHEA 4DR1C 2CU6A 1D9FA 4ZPBA 3PRBA 4J7CA 2PDAA 2D1RA 3GLJA 5DZ6A 1VMBA 2RU9A 1U1KA 1IBMF 4IYQA 1NPPA 3F56A 3FQLA 4FPIA 4Y34A 1NHUA 2BZ2A 4RW9B 4P6QA 3FBEA 3FC9A 1YQHA 2OLWA 4TQSA 3DLKB 4DV0J 2CPDA 3ZXWA 2VOOA 3G86A 3CPWR 4X84A 3PX4A 3VWSA 2F4VF 3EGWB 1BY9A 1YG0A 3SSRA 3B7WA 3UNYA 1V3SA 1YWXA 3NRBA 3NLCA 4WK3A 5B09A 2G2YA 3T1YC 2C28A 3Q8QB 4EK2A 4JI0J 5IV3A 3BF4A 2VODA 2QYGA 4ZVFA 2YKNB 5KFTA 4C0HA 4DUYC 1N34C 3TR3A 3HZEA 4PZPA 1NO8A 2RJZA 3BKUA 3QFWA 1SL0A 2DO0A 2K06A 5KFAA 2QA4G 1L3VA 3G6ES 4KPYA 1N48A 2JEIA 2V7BA 1N36C 4XK8C 2I5JB 2MY7A 1VQSA 4JI8J 2BQUA 1JLBB 3Q8VA 3MR2A 4DV7F 3VV2B 1V60A 1WF1A 3CC7S 1OQ3A 2Z56B 2Q79A 4DR6F 4X4SA 3HHLB 3M32B 5I3PA 1RT7B 3TP2A 4HKQA 4ZPCA 2QMWA 1QD1A 5EWGA 3AHPA 4LRFA 1XMBA 2MGZA 2JWNA 3GIMA 2G2OA 5DRKA 3SSSA 1UP1A 2AP6A 2B7BB 3DC2A 4JI4J 3KJVA 4FF2A 2HFVA 2VH7A 3PYGA 3TAMB 1SC4B 3BBCA 2Z51A 5IM0A 3PBKA 1Q8IA 4DU7A 1IJFB 4A8MP 5J2NA 1TP7A 1HFEL 5F8HA 3G7SA 2Q3PA 2V8VA 5HQ8A 3HJVA 1G7CB 5IFMA 3M32A 1AB8A 1FDBA 2OPRB 5KFZA 3J7ZT 3GFYA 3R6GB 5I3UB 3TVYA 3KLFA 3PYEA 1O51A 2C22A 2A3JA 1VRTB 3CJ4A 3LO3A 4L3KA 2UUAC 2R7RA 2BM1A 1W7WA 3JQJA 2CJQA 2I5JA 1ZM2A 4FVCA 2YQ3A 2CFXA 4P2MA 4AQYF 1VC0A 1IBKF 4WS9A 4Y28C 4IH6A 2XSJB 4MIAA 5CCMA 1R0AB 1OQ6A 1VQKS 1NHKL 1UWBA 1RHMB 4QIWD 2K7JA 3RBZA 2W9BA 2R7WA 4K4XA 2CPXA 5KFLA 3DLGA 2J0QD 1XRBA 2U2FA 4EYHB 2RKIA 3EWGA 4TNOA 4GC7A 2E8EA 5FJ4A 2FHMA 4FYDA 2KJVA 4I2QA 5HMYA 2MDAA 3D6FB 2JL9A 3QT6A 4H4KC 1UW9A 3C14B 3R5CA 5AT1B 5KFJA 1YJNS 2E9TA 2HIQA 1BA3A 1HBOA 4DF4A 2DHSA 2OD4A 1NK0A 2Y9HA 2JMPA 1F9HA 3BH6B 3OT9A 3WX8A 2HSEB 1LQ9A 2LU1A 4IH5A 3PFEA 5DLFA 2ATLA 2DR7A 1TL4A 5K20B 2WB4A 1SKSA 2HRYA 2ZNYA 3TZZA 3RBDA 2E5LJ 4FYYB 4JI1C 3GONA 1RE1B 2CJBA 1R8PA 2DTJA 5C42A 1JXLA 2W2OP 1T7PA 1Y5NB 4X62C 2AKWB 2CQHA 4YB7A 3TWZA 1TKXA 2QSWA 4I64A 2UV8A 4DQPA 2PMWA 4ID8A 4P72A 2IBOA 5A0YA 2IAJA 4C97A 1ZZNA 3RB6A 2IA6A 5HMXA 1K1QA 5A8RB 1FD2A 2UXBF 5L1IA 2P2MA 1ZTWA 4MT1A 2KB2A 1QE1B 3L09A 2VONA 1WC6A 2QA2A 2V5HG 3CW8X 3MM8B 3CMES 2V69A 2IM2A 1RHRB 2QRRA 1HNWF 2AYAA 4QR0A 3A9VA 4K0KJ 1N33F 5JMNA 4YR3A 3QZ8A 3M30A 4MAKA 5A0YB 2AEMA 4ECSA 3RB3A 4I68A 4DCSA 3M2RB 3AQOA 3H8YA 3P6YC 1RAHB 1XR5A 1SQGA 2DXEA 2OHDA 2EFPA 4AXJA 2PC6A 5DDPC 3K59A 5M2PA 5L1KA 1JX4A 1SV5B 3U02A 3H7HB 3D54A 3PXGa 1HBUA 4QIEA 2JOQA 3A3NB 3DGPB 1UAWA 2BJ3A 2YNHB 1M5PC 2RD5C 3D9BA 2Y3YA 1ZPWX 3MM6A 4BHQA 4YY3J 4ZP7A 1LFPA 1Q7YT 4FF3A 3GZ7A 5HP1B 1SKRA 4CT8A 4L76A 2RQMA 1RCOB 2FB0A 2XMUA 3LGMA 3QPIA 4LJMA 4CTAA 4ZLPA 3QJLA 1RY2A 3OFEA 4PHTA 3ULHA 2F40A 3K2YA 1BMQB 3DLGB 1U45A 4USMA 2BE2B 2FZGB 2EFNA 2YWWA 1UWBB 3H20A 2D7VA 1R0AA 1SJ4P 1RLCL 1SXLA 1J5EJ 4NCBA 2XR1A 2B7CB 3HHDA 2LXIA 2G13A 4X4NA 2H48B 4K5RA 5AE3A 4GXQA 1S57A 2ZUAA 2HAFA 4AL6A 3R5AA 3B82A 3QO9A 1D8ZA 5E0OA 4AD6A 3MDFA 5GAHU 3L3CA 1OIAA 3OLAA 3CC2S 2R9LA 2X1GA 1F0XA 3PW0A 3K8VA 4DUYJ 4LR7A 4ED0A 1EB0A 2ZJPQ 3GR0A 2HVDA 2RHSB 4M5IA 3LP0B 4ITSA 1BLUA 3QNWB 4UOHA 4C3MA 5MAOA 2VHGA 2UVWA 4OYZA 3MGJA 2L08A 5BSTA 2GHWA 2CADA 3RW7A 8RUCA 2VFTA 4OI6A 3B4MA 4XPEA 1RA6A 4C8MA 1BE4A 4EGLA 4LRAA 1F2GA 4RLFA 4Q44A 4LFBF 4GKKJ 3KJNB 3ZTQA 4IQMA 4DV2J 3NGUA 1DTTB 2ZOFA 3BQ2A 2E1CA 2QL9B 5LXYA 4K0KC 4O3QA 1QVGR 5DDQC 3S8SA 5F41A 3MEEA 1NSAA 1N52B 1EETB 1QDUB 2AX0A 3DOLA 4A8OA 3OJSA 5J2MA 3T19A 1RT7A 3HHLA 2G2ZA 3T9NA 1VK8A 2HFZA 1L3TA 2VZEA 1T11A 1AYEA 1TV6A 2M9KA 3CQ1A 4IR7A 1Z2LA 2AMCB 2HRUA 3AD7C 3A3OB 2OD6A 2QLXA 2RE1A 4ANEA 1EAYC 4PUGA 1RLDA 2MKSA 3L7OA 1LWFB 3NWRA 2DH9A 1X4AA 3PZPA 4DFKA 2F63A 1REGX 1C2PA 3SCKE 3TO8A 1I3OB 4RUCA 1C1CB 3BBBA 4DG1B 2E7GA 1JXVA 1N88A 4DZDA 2JC0A 2GQCA 2X1BA 3UW1A 4ZCIA 5KFKA 5DDRC 2F1FA 4ZLNA 2WD9A 5A1GA 4ED7A 2QA1A 4R5PB 1SQFA 5F8IA 4WFAQ 4B3OA 2MKYA 2DGTA 4HHUA 4C7QA 3P5BP 4J9QA 2AJ2A 3RTVA 2OPLA 1WTBA 4RX6A 3CJ0A 2OPQA 2I8EA 1RB0A 2E0GA 2Z8QA 2Z0GA 5IWAC 1WDDA 2JHEA 4JI7C 2IJFA 2VBXA 4DMZA 3L8CA 3PRDA 4RO0A 3UO0A 1FVQA 2RIJA 2HHHJ 1A9NB 4ISBA 1NDCA 4TYBA 5KT5A 1NCLA 2RUSA 3B78A 1KLNA 1RAGB 3QBCA 4X4QA 1WUUA 3IG1A 3QGGA 1P8GA 4HACA 3CJKB 4KTVA 1M1GA 4NCGA 2P9GA 3MM9B 3GV7B 3OVBA 4R25A 2GA7A 2CZVC 2EG1A 2L9DA 1RZMA 3IR7B 2EBGA 3QLHB 2HQDA 4O44B 1X9WA 4P74A 5U47A 2Q66A 1D9DA 4KRWA 1N54B 3UDLA 3LW5C 1FHTA 3HF5A 4EO6A 4UQTA 2XZDB 4DR7C 3W66A 4F25A 4IRKA 3R5BA 3EVOA 2MLXA 1MWZA 1X4BA 3E51A 4IDKB 2Z2LA 7FDRA 2OIHA 1UJ4A 3FFIA 4L74A 2HYIB 4PWWA 2EK1A 2PD1A 3IBCB 2ZKUA 3LPYA 2ZM6F 4N56A 1IKXA 5B0DA 1PJ6A 2YNGB 1FX2A 5ETTA 4CT9A 1YRXA 4R1LA 5G4DA 3BDPA 3PR5B 4YR2A 1EARA 1TU0B 4DV5C 2JNVA 2HW3A 3J80D 1RXOB 3PW5A 3L7UA 2OUGA 2ZH5A 5KG5A 2C2EA 1Q5YA 1S72S 2WOMA 2XCAA 3ILOA 4X4TA 4AT1B 5KFSA 1MU2A 1RT2B 4KGMA 1VC5A 2DR9A 1LEOA 4CH0S 2DB1A 4OIXA 2KVIA 2QL5B 3MCMA 4JYAJ 4OHVA 4OV1A 4ZN1A 5AE2A 5GAEI 5AXNA 3PHTA 3FNNA 2VDHA 4A8FA 3OV7A 1JJCB 3ILIA 4OZLA 3SQGA 4X65C 3RB4A 1R7IA 2E29A 3DRPB 2C1EB 2LECA 1WH9A 2AWZA 2FD2A 4F7VA 4A47A 2D74B 1FUGA 3MZIA 3Q8SB 3AF6A 1VDHA 2CPJA 3I9ZA 1NKEA 3GSDA 5D78A 1GAOA 2IM1A 5AXKA 2O3DA 1N0UA 4M63A 2GIRA 5I42B 1IVZA 1NDLA 1UEVA 1URRA 3J81U 1R3NA 1GTHA 3T5JA 4JI6C 3DRRA 5DLGA 2VPYB 1O5JA 4V19J 4F4AA 3V81A 4DU8A 4I2PB 1BWEA 5T8TA 3B54A 3O6QA 4NOHA 4JM1A 4EI2A 3CCVS 2JFDA 2NXCA 3MFIA 5F0UA 2JSXA 2V4JB 3NBPB 5K14B 1SH3A 2VC1A 3M2UA 4ES2A 3W65A 4OZNA 5DGAA 2KRRA 3AXKA 1B0VA 2HVZA 3KJQB 7AT1B 4IO1A 4CNYA 2CKWA 3DXSX 1H38A 1MSWD 4CLZA 4RNNA 4PUOA 2QW0X 1SKUB 4PZVA 2W9CB 3TUPA 2ZC4A 3IAM9 1EZZB 1Q0NA 1T0TV 1VJQA 3P3DA 4TQRA 1MD9A 4GKJC 4RW4B 3VAHA 4LREA 5LM7E 4LFCJ 3CD5A 1VOMA 1Q95G 1Z1ZA 2R7QA 2V34A 2WBMA 2UU9F 3B4DA 3RRHA 5HMWA 1ICEB 1RU1A 3LUYA 2WB1D 2XY5A 4ZS6A 2XMAA 1RTZA 1LXNA 2EPIA 1TL3B 2B4PA 4IG3B 2ZH6A 1N56A 1HNIB 3D0HE 1W2IA 4F36A 4ER8A 4KTTA 4X64J 3RAMA 3TQ1A 1XMQJ 2Q43A 1MG7A 4RW4A 4LFAF 4QPTA 4JI0F 1FJCA 2W9CA 1GXTA 4B02A 1FKPA 3BGLA 5HO4A 5HJXA 2VG7A 3JQMA 2D1CA 4G1IA 5SUHA 4ZPWR 2KI2A 4URGA 2F9JA 3E01A 1RT4B 2EXUA 4OJGA 3K8WA 1XERA 3G6VA 5KFYA 1SJ3P 1KQGB 1T5HX 4JI7J 2E5GA 1TL1B 2HMIB 1WC3A 1FE0A 1TL5A 2YPYA 4DCOB 5F3ZA 2DRBA 1JLEB 4K4SA 2QO3A 3HVTA 4P52A 3KK2A 1IM6A 4YY3C 5GVQA 3HLUA 1AFIA 3HD2A 4J9RA 3QQCD 1YI2S 3QIPA 2GMHA 2NXJA 2YNIB 4PG4A 4UF4A 1MW7A 3LWLA 3MEGA 1U8WA 3HHLC 2BJEA 3QT8A 2M0GB 3BKFA 3R5GA 1X8DA 4KE5A 5ETLA 1O8BA 1KR4A 2MZSA 3TNVA 3W8PA 5JJBA 2W9AA 5I42A 3PO4A 3GTYX 1S1TA 4LBHA 4DR2F 2UVRA 1F5BA 2ZH9A 5G0RB 1AXQA 1HMVB 2MKCA 3ETMA 3UE2A 3UWTA 4JI3F 2OI2A 2D27A 3TUIC 3C16A 2CJKA 3A8EA 4LF4J 2ZD1B 4ED8A 4K59A 3SBMA 3DRPA 3BV8A 3PVXA 3C3LA 1V26A 2HBZB 2NSCA 2C42A 3D6HB 1FDNA 3VVUA 5ETVA 2MQ8A 3HZGA 2P02A 3ZZUA 1HBNA 2LQ5A 1M5HA 3Q24A 4B3TF 3A4IA 4DV6J 3NGKA 2FC9A 3NAHA 2M8HA 4PG7A 1T05A 1S76D 2HZCA 4X64C 4LF9C 1R6VA 1S9GB 2GO8A 2NUHA 2U1AA 3BR8A 4RPFA 4CM2A 3OTEA 3EX7B 4X4UA 2AIRB 5B7WA 3K5PA 4TVAB 3R3TA 1TUVA 2ASJA 3T1HF 4N8OA 2VG5A 3IXQA 5CYQB 3I4PA 5B0EA 3TAPA 3FFIB 4Y6IA 4YB6A 1HKAA 4DZ6A 2ZDPA 4NLYA 2ZH2A 1PC5A 5LJ3Y 3T1YJ 1YHQS 1GH8A 5F9LA 2RRAA 1SQEA 2BKOA 4QIGA 1RA7A 3OD2A 4PXEA 4ELTA 1JLQB 1S1WA 2EWHA 4DV1J 1WEYA 5AE1A 2HNZA 4K2XA 4PXBA 2FVQA 4NYZA 3C46A 4JYAF 3MEKA 4O3OA 3N2QA 1YJWS 4ZP8A 3UCUP 3CE8A 4Q0BA 4CZCA 1HQ2A 2V8DA 3FBBA 2CAJA 2JLFA 2OEKA 3CJRA 3QSIA 4OX7A 4U8YA 1FJGJ 4ZJZA 3ZZPA 4C8NA 2IRXA 3BN7A 1HR0F 4JV5C 2D7SA 4EO8A 5HL7Q 1BQMA 1D0EA 3T1HC 2E7WA 3E2EA 3DLPX 4HEA9 1V25A 2N4CA 4QWBA 2P20A 5B08A 5CD4A 3GG0A 3JSMA 1S6PA 2MZJA 1RHKB 5CQGA 5BYRA 1QM9A 3E7WA 1DQAA 2W2PP 2Z57B 3FQKA 2UUAJ 4C8LA 2OPQB 2IMWP 2CXEA 1JWWA 4U5YD 2J0WA 4F4ZA 2OPLB 3ZZZA 1S0OA 4B3TC 2CRLA 3WDOA 2KFZA 4B3OB 2SXLA 4I6AA 2D3O1 1QAYA 2HIYA 1R8CA 2UXCF 2ZWOA 4O3PA 4YUDA 3E7XA 2LMIA 5H9UA 1RTHB 2DRDA 2HS4A 4FPRA 3HHLD 4W90B 2YKMB 3A25A 3V4IB 4FF1A 5C24A 2FHKA 4NLGA 2H4WB 5C25A 5DQHA 3T9ZA 2RQCA 3GV5B 4DL4A 3NXZA 4KHRA 3CD7A 1H2UX 1FE4A 3W60A 1S9GA 1X5OA 2CPYA 3ONQA 1C0TB 2KHCA 4PXDA 2AGPA 1KD1T 3W7BA 4LF7J 2VL1A 1RU2A 1XRCA 2CWKA 1PYTA 2J8AA 3GG1A 1NZ8A 1P1TA 2O01C 3F44A 5ADZA 1BUXA 1S1UB 4DV3J 2WZ1A 1IUJA 1YZ6A 2HFNA 3KJFB 4IUFA 1UVJA 2DK2A 3LGNA 1FA0A 2MSSA 5B0CA 2IYIA 3M6XA 2HRTA 4X62J 3Q8UA 3KK1A 1KNZA 3QGHA 2OFHX 3TDEA 4OYIA 3PIOQ 1F1BB 2B56A 5D3GB 1HR0C 4LF4C 4DV1C 3BZQA 3TARA 4C2MA 1SVDA 2HGLA 1MNEA 1SH0A 3CJ8A 4WZMA 4DG9A 5DGBA 1HMVA 4JI7F 2B4UA 4C8YA 5KG6A 2VASA 1TK5A 4JI0C 4ZMMA 3DM2B 2W01A 3ZNUA 2NZ4A 2DJWA 2VB6A 2KT5A 3GYXB 2QT7A 3LP0A 4OJ1A 2XEXA 5FDLA 3KYLA 2R8HA 2VQEF 2EGTA 1YX2A 3ET6B 1PYOB 3EUNA 4FXVA 1VCTA 1PAUB 5KFVA 2AYGA 4F4XA 4C9DA 2LQ9A 3O8WA 3UCZP 2XG8A 3KDOA 4DR4J 1UA0A 3THTA 3BSNA 2BJ9A 4EUVA 4ED5A 3LP2A 1NBEB 1E6YB 4TU7A 4ECQA 1TL1A 1S49A 5KFEA 1ROFA 3QMQA 2VFUA 4G1QB 4KO0B 2RF2B 3ZTRA 5GAHI 2L41A 4PYAA 2LDIA 4J9OA 2R2SA 1VQMS 2BE2A 2GJ2A 3E01B 2R8KA 4NA3A 4DFJA 2VA2A 3RBXA 1S10A 4TN2A 1ZB9A 1NJIT 3IEVA 3UNGC 2VG6B 2ONFA 1WNEA 2DIVA 4NPOA 3KLHB 1T03A 4C3KA 3OFGA 4PQUB 2NQPA 3A4TA 3WC0A 1U2RA 3IM9A 4NLSA 2FZKB 1U1LA 1KVKA 2APOA 5IWAF 1S0VA 1RWVB 5KYTA 1CEZA 1MROA 2CXCA 5A8WA 4DQSA 2MKHA 2CZ4A 2AW0A 3LH2S 2GHPA 3TZWA 4DR5F 4DV6F 4PPZA 2H3EB 2FHJA 2AT1B 3MHYA 3P96A 1ZM3A 4F0KA 4JI1F 3F41A 1WTFA 2ALZA 1NK4A 2OPSA 3M2RA 1QTNB 5D4NA 5THWA 2I6WA 1M5KC 4UT4A 4DQQA 1OY8A 3QFHA 4JOUA 3ZZTA 3EXYA 3MMBA 3KNGA 3M30B 4TYAA 4ED6A 2KO1A 5J1EB 1NKBA 1MMDA 3PV8A 2KT2A 1KVJA 4C4WA 1RTDA 3CMQA 2V2KA 3KLIB 1DHMA 4JV0A 1ZS6A 4NI2B 5EUHA 1VQ8S 3DLLQ 1DFDA 1U02A 2VPWB 4DV3C 2HKEA 1RWMB 4TKTA 4WZQA 2IAJB 2GV1A 1RWKB 1YBTA 3DYAA 1XNQF 1RT5A 5KFOA 3IGVA 4YDDB 2NXEA 2W7AA 4U96A 4LSNA 4EZ6A 3MFHA 3H98A 4WP3A 5HATA 1L3KA 3HPOA 1DZ5A 3K0JA 3LOUA 2VSQA 2MJUA 5H9FJ 2ZM6C 2Z2MA 3D0GE 1FVSA 2NYHA 4ZVEA 3S1TA 4YN3B 3SFUA 4YB1P 4WKRA 5A8KA 2BQRA 3FCWA 4ECYA 1LNQA 2RB7A 2BM0A 3SQGB 2XS5A 2F8EX 3EGNA 4YEAA 1VIXA 3VVTA 4CLYA 4TY8A 4JI3C 3W2VA 5GTDA 5K9FA 1WI6A 3ENVA 3MECA 1C0UB 1HD1A 4JI5C 4ATNA 4DQIA 4LQ9A 2YVSA 1ZPVA 2X3GA 3VF0B 1REVA 5IXUA 3RG6A 2DNZA 3EDQB 2EBEA 5D4LA 4CLKA 4HTIA 2WSFC 2Y0SD 1NKCA 3GJTB 4CLTA 2ERRA 1CQMA 3CB4A 3IR6B 2DITA 3MCNA 2UVUA 2QVXX 4RR5A 4YQWA 3EMTA 1WF2A 1EX8A 4ZVOB 2V6AA 3NEKA 2Y0BB 3PHEA 3VHQA 3KG0A 4DG8A 3I0RA 3A13A 2BJ8A 3MEDB 1AFJA 2V63A 2XGQA 3PDNA 3NYRA 4HDGA 1LWCB 2AJFE 2ILZA 2QGFB 3AQPA 1X5SA 1GX5A 3BBFA 2XY6A 2FZCB 3WQPA 1M90T 1S1XA 2A6MA 3PEHA 4DQRA 2OMLA 2WCXA 2HS3A 4ZVPB 3NGTA 1F3FA 4WFXA 1WF3A 1XR7A 2GHVC 4HR2A 4YR0A 4UW2A 4LIWA 2DNOA 2VOPA 2WSCC 3BYRA 2OPRA 4HLBA 4OFZA 3FGVA 1Q78A 5DM6Q 3DI6A 4X62F 2VKRA 4FNIA 4HACB 3CJKA 1HBMB 1JKHB 3MCOA 2W7PA 4UY85 5IT9Y 2EFOA 4DR2J 2YBVA 1WC5A 2XY7A 3M8SA 3KXDA 4IOBA 2KU7A 1DLOB 3RB0A 3AT1B 2PEHA 3CJSA 1CULA 3DMJA 4OHZA 2ZZMA 1F2HA 2XYPB 3R5JB 3THPA 2F8HA 1FEEA 4FN5A 3J80Y 4PCQA 3MR3A 1XMOJ 1NM2A 4MKAA 4R8UA 1VC6A 2DH7A 4M5KA 4I9GA 3D1QA 4DF8A 2DKOB 3HVRA 5JVHQ 2KM8C 2DR5A 2I38A 1P4EC 1V6HA 3G8SA 1YJVA 2VA3A 3PJWA 1HI1A 5E5NA 1RCXB 1JLBA 1RAOA 2DCLA 2GGPA 3GIRA 4FZVA 3DHVA 2WVCA 4R5PA 1JLCB 2QLWA 1S6QA 4KGXB 2CQIA 2Z2YB 5BR8F 5EDWA 2BR0A 3W3SA 2DRAA 2ROPA 1B7FA 4IFYA 5JRHA 4C6AA 4OYXA 2DYAA 2UUBC 1TQLA 2PEBA 4MK8A 3GU0A 2LA6A 5IQQA 3OL9A 4DX5A 3CCWA 2AEJA 5EX3A 1ZYQA 4KH1B 1LWFA 3IS9B 3IP0A 2K8GA 4USTA 4ICLB 2UUAF 4BDPA 2FY8A 3KKFA 1UKUA 2XMJA 2VU5A 4HHHA 2KTQA 1TR0A 5H1SV 5A76A 2YWBA 4RNHA 3UX2A 2MPUA 3BGFA 1S7HA 3DOLB 1EETA 2RVJA 3Q2TC 2MQPA 3JB9k 1RI7A 3OXGA 1UVNA 2J0XA 1N6QB 2M5HA 2AU0A 1M6XC 4NX9A 3C6TA 3F73A 3PRVA 3T5LA 3RRGA 4RLQA 3RJMB 4XAKA 1A0OB 1S1VB 5FLXD 1KKGA 3OPKA 4LE5A 3S6EA 1WC4A 2AJ1A 2O5DA 3OL8A 2DGWA 4RMNA 4CDIA 3LANA 1JLCA 3G71S 4RZRA 2VJVA 2G1HA 4LVOP 4OLPA 1KQKA 3TUJC 4NLDA 3R9LA 2LKZA 2CQGA 4NLUA 1F9FA 4ID5A 2CQBA 3CIZA 5IFIA 1ZAVA 4O23A 1S6OA 4TU8A 2NUUG 2OMOA 2DR8A 1UMJA 2JVRA 1IBLJ 2YH1A 3HHKA 1S7IA 5D6GA 3FEYB 2KT3A 2QV6A 2XHWA 2KDOA 2F4VJ 1TKZA 1TAQA 4U95A 1GXLA 2W2QP 3DDIA 4CO4A 4ILMA 3PFOA 3QWUA 1JKHA 2QTWA 1L3UA 2YH0A 5ETQA 2DHMA 5A6PA 4K0BA 4FDFA 3ISNC 2ZHBA 1EQ0A 5KG3A 2K3IA 3JQKA 2ADCA 1WG1A 2C3UA 2XZTB 4ZPDA 4F26A 2KM8B 1FJEB 3R7BB 3BEGB 1ZM9A 2DGVA 1XC9A 2R4FA 4JI1J 3QJJA 2HHVA 4K4WA 3DOMB 2H54B 5KFGA 2LVWA 4IZ6A 2AZ1A 4CM0A 2BJ7A 3I87A 4P2FA 1SV5A 5KT4A 3GIKA 2QIFA 2B3TB 2MQMA 3TA0A 1IB8A 5HLFB 2V9WA 4N41A 1RHUB 3BGOP 3D0IE 1AUDA 2IHR1 4R0JA 4HHJA 3CUNA 1U7LA 3W5ZA 4USKA 4FF4A 4CCHA 3Q22A 1EP4A 2HK2A 3R8YA 4KR0B 1RBAA 1U1OA 4KHPF 1KFDA 2WP0C 1H2TZ 3AOBA 3KHLA 5LMNF 3G2XA 2MHEA 1UPMB 1Y10A 5E7OB 1H3DA 5DETA 3KLGA 1D3WA 3IPLA 2LFVA 2W8LA 2HHQA 1FFWB 2B9YA 2WRMA 2QX0A 2QFIA 3M6VA 4P7TA 4IQXA 3SZ2A 1WC0A 2EFGA 4TY8B 2UXDC 1CJVB 3X3UA 4XIUA 3I96A 4DCJB 2DBBA 2GW8A 3JTNA 1ZAXA 2XC9A 4L7IA 2MTLA 3I5CA 4WU3A 3VAFA 3UEBA 1QWIA 3BN4A 4A8SA 3BQ1A 4PG5A 2RRBA 4AL5A 3NOCA 1YTYA 2BACA 2NXNA 2JZ5A 2HHWA 1IKVA 1E6VB 4B9TA 1WOSA 3RU0A 2B4VA 4QYZK 1USPB 1VFJA 1RT5B 3LTOA 1X60A 4OX6A 4ANCA 4PABA 2J9DA 2DO4A 4ED1A 4TPSB 3ZTSA 1NDPA 2G0IA 1NH7A 4D3GA 4EEYA 2O67A 3J7A1 1OSDA 3OFHA 1RT6A 4WYWA 4LF9J 1SB6A 2LDYA 3P45B 3VGVA 1RTDB 2MM9A 5H9FK 5BJRA 3KLVA 2JX2A 1VLOA 3MTKA 4JI4C 1X4HA 3QAUA 1T9XA 2JLGA 2C2NA 1NK9A 1I51B 3MXHP 3V5RA 4ECRA 4QQBA 5KFNA 2EK6A 4H54A 4FKYA 1MDFA 2OPSB 4J9KA 2LCWA 3CJQA 4CO2A 4HPVA 3IWNC 1MXCA 3LP1B 2XLIA 4X66F 1VRQC 1PIEA 4ALZA 1X9MA 1PJ7A 4DSKA 2A18A 2FJWA 5BSRA 3R27A 1D9AA 3UPFA 1P27B 1Y0HA 1RUSA 3J80U 4F4WA 1JB0C 5KFPA 2IDLA 3D5MA 1RT1B 4WK1A 4CLFA 1CS4A 5KG4A 2RQ4A 3DHWC 1HNZF 2H5IB 2YPZA 3NGRA 2UXDF 3VZIA 1ACMB 1S5ZA 4NA1A 2MCQA 2V2QA 1P9QC 4PROC 2KG1A 4DBQA 1HR0J 1Y5IB 2G4BA 3P4UB 4FXDA 3VNSA 3M8PA 1IM4A 4N8NA 4OHXA 1Q8KA 5HANA 3ZO7A 3ZZ0A 4BS2A 1F3VA 2ADBA 1U1QA 1FJGF 1Y9OA 2VG6A 1UFLA 2FLOA 1AROP 1IKWA 3NS7B 4LF2A 1KQFB 1L2FA 5KAKA 3S7RA 2CJYB 3LUSA 4OHWA 3RR7A 3P49B 3PESA 3HVAA 1R27B 3SV3A 1QTMA 1Y11A 2DY1A 2RF2A 3D6TB 1KHVA 1X31C 2EC2A 1T95A 4RU9A 2Y1RI 2GQQA 3J7YU 4B9MA 4K4VA 1EKRA 1Y5LB 3OBIA 3HVWA 1FF2A 2HQCA 4GC6A 4OLOA 2WVFA 2A6OA 1UA1A 3PKMA 3QRRA 3DNCA 4B9VA 4IRDA 3KUHA 3NPDA 2ZEJA 1KEKA 2RHQB 3NOGA 2L48A 3POTA 1IXKA 1TVRB 2FYXA 1RTIA 2J9CA 3HKZD 3UD3P 5L9XA 1RP5A 3LALA 4B17A 4DN9A 2FGOA 2J0SD 3HFZB 5HQLA 2XMMA 1VLYA 1XBWA 4OHYA 2OSRA 3Q8RB 3TRGA 2UXBC 2VD3A 2DNLA 3A8KA 3CJ5A 3P8BB 1A7GE 3I4HX 4B3TJ 2H1YA 5HBMA 1ULRA 4QYRA 2YKQA 1AZSA 3ELHA 4LF5J 2BABA 2UXBJ 3EDRB 2YKNA 5F8JA 2VPXB 4I0WA 4WXOA 3ZZOA 1I5OB 3GQCA 2CJXB 4JI5F 3DLBA 1PKUA 1BWVA 3C15B 2MKJA 1WHVA 1HYSA 2AJ4A 3DLEA 2EG2A 4IH7A 5BSWA 4F50A 3T1HJ 3D68A 5IC4B 2CNLB 2XSFA 2KYZA 5KFUA 2J76E 1NSPA 1NPRA 1WORA 2J7WA 2CY1A 1CJTB 1FT8A 3BSOA 2JVOA 1SI9A 1RYSA 1VBKA 3DRSB 1FXLA 2H51B 3IMQJ 2VUGA 2YX4A 3B6BA 2YWGA 5D15A 5HAOA 4DSJA 4XX2A 4YP3A 2WW4A 5KOXA 2I0XA 1RTHA 1H2VZ 3M2VA 1DQ9A 4QR1A 3KK3B 3SI8A 1FXRA 3EPIA 2D9PA 3V4MA 1TK8A 2F5GA 3TJ8A 2CQ0A 2H65B 4OZJA 1KVIA 1P6TA 1RADB 4R1MA 3K17A 1M5SA 1EKSA 3TQEA 1HWKA 1FDDA 3IBFB 1D8YA 2HNYB 4LF6J 4C0OC 4QCLA 4I7FA 4LSZB 4O3NA 1SJRA 4AQYC 3JSRA 3GP9A 2WVBA 4M8LA 5BUSA 1S12A 4LVNP 1AMUA 4HI1A 1K0RA 1XK8A 3DFEA 2MB0B 2OBVA 1J5EC 3B8HA 5KFDA 2LP4A 2MQNA 3AD8C 1DLOA 2XNRA 1HNXF 4WIIA 5BURA 1BD6A 4Q43A 4KC5A 2HVIA 4B3SC 1M0SA 2CJAA 4LF6C 2V4QA 2V94A 2AYBA 1FNOA 3NNHA 4OJHA 4O4GA 2DNMA 4TLQA 4W4MA 2GNKA 3H59A 2XMVA 2Z30B 2VC0A 2V9KA 3MAAB 3MM5B 3TW0A 4C98A 4ENOA 2CNNB 2ZH4A 4EYIB 2HNZB 3R1LA 3UN5A 3R2DJ 3BO2A 1WCJA 5A19A 2ZZTA 3OSNA 1NPKA 4J9LA 1DAXA 2IBKA 3VGTA 3BYPA 1KC8T 1QM4A 4EBEA 3SEOA 1KSPA 2DNNA 5LSRA 3CT9A 1VQ7S 3O5TB 4DCPB 4R0EA 2DNHA 4DSLA 5BR8C 2FQQB 2IRUA 4TY9A 4Y65A 3RYLA 2AZ3A 2B5JB 1HARA 3MMJA 1U1PA 4EBDA 2MLYA 4WFZA 5CXTA 5KFCA 2J6TA 2N7CA 4CO0A 4ZVUB 2E44A 8AT1B 2CVEA 3JTOA 2HBYB 2IRYA 4MFBB 5CYMB 4ZJLA 4TU9A 3VAMA 4A48A 5E2QA 2VQEC 2I9SA 1N34F 4JYAC 3QWPA 1HBNB 4GO7X 4AE5A 1GX6A 2HNDA 2CNOB 2IC3A 2J8SA 4DUZF 1TL7A 4IRCA 3I07A 3GR1A 1VRUB 2YX7A 1MXBA 4A8XA 4YHHJ 4RW6A 2ZH8A 1RT3B 2P2CB 5D0HA 3GJSB 2FJDB 3M8QB 2JNJA 1YJTA 2F7VA 1OY6A 2B6AA 2BYCA 3WBZA 2QVZX 3CMAS 5CZVA 1N36J 1K9MT 4WCEQ 3K6RA 4UOCA 4J9UE 4LF8C 2ZE2A 2HHPA 5CZXA 1S1TB 2Q6BA 1FESA 1TTHB 2EW9A 2NXUA 2YWKA 3E3XA 4NMLA 3GV8B 1U4BA 3M8ZA 3PG9A 1S77D 5GADI 1XMQC 2OPPA 4DR7J 3U7JA 4DV7J 3M7VA 5E3RA 1HNVA 3UFCX 3H25A 4DV5F 2DPJA 5HI7A 2WSEC 2R7VA 2ZM6J 2A0FB 4RBUA 4XDCA 3V2UC 4Y2CA 2C2DA 4FUTA 4NXMC 1LW0A 3ZZRA 1NB2A 2ASYA 3PKYA 4L75A 4JI6F 1LCIA 2M5YA 5K8FA 2GIFA 2VDIA 2HGNA 3MMBB 4ZP6A 2Y27A 3MTJA 1RAIB 2IDEA 5C2GA 2G0CA 1OPIA 4QJVA 4DL7A 3NL0A 2VG7B 1FKPB 3HCXA 2GS8A 3G82B 2WONB 2D28C 2M8DB 4DR2C 2KXHA 3EZOA 3H0PA 3ZFVA 3PX0A 3C6UB 4MKVA 3D1OA 2ZC3A 3IO1A 1TL3A 4FS1A 3DU5A 2MKKA 4DPXA 1SJQA 2LA4A 4RVNA 3AOAA 5IT9D 1V5VA 3V6DB 3UVJA 5RUBA 1PG4A 3ZTOA 4CP5A 3HSDA 2R2RA 4LFCC 3NGDA 1J2VA 4JV5F 1H98A 2HFOA 4DL6A 2Y8WA 2R7XA 4F04B 1LXJA 4KGZB 3L95X 4OV6A 4PUOB 1HPZB 1H0HB 2RDIA 5GAGU 5BYSA 4RU2A 3VQSA 3Q8PB 4S0MA 2YX1A 4JUZA 3SV4A 4G1QA 2AYMA 2ABYA 3GFXA 4C11A 2B6AB 1HLWA 1CJUB 1K47A 1FFSB 1CBKA 2QC3A 2QMXA 3A12A 1GXUA 3M8QA 3LP2B 3QIDA 3DCAA 3OJUA 4AL7A 2YCBA 4OYMA 4OX9C 4NXNF 3W8GA 1WC1A 2HQIA 2PIIA 2QLBB 3FSXA 5IOLA 4DPWA 2B4OA 5KFHA 3PR4A 3V81B 5A2QD 3DOKB 4ZIVA 1PJ5A 1DTQA 1OS5A 4KKOB 3GPCA 2DHHA 1RQ0A 2HPUA 3D3BJ 5FDLB 3QJPA 2UXCJ 3MUMP 3DM2A 1NK8A 4F8RA 3C8YA 2AHOB 5BSUA 1DARA 1GMWA 3EQ6A 1Q82T 1WSVA 4PWDB 4DUZJ 3FCVA 4USHA 5E3PA 1J27A 1QAIA 1HHSA 5IS2A 3I56S 2ZBPA 1B0PA 4M5LA 3KK1B 5J2PA 3DLHA 5D0RA 1JJ2R 5B0AA 1YVFA 1ZM4A 3CCLS 1GNKA 2XMKA 4ZPAA 2JEFA 3BGRB 4NXNC 3ETOA 4ZP9A 2HHHC 4HTJA 4QWAA 4PR6A 1WJ9A 2A1BA 2IM0A 2IYGA 3H2LA 2EI5A 3MM5A 4PG8A 3ENWA 3L4BC 2R7UA 1KTQA 1PILA 3MWBA 3Q8YA 1VHIA 5IZHA 1QY7A 2M3DA 4B9SA 2YNFA 3JAMY 2MQLA 2QLFB 4NLQA 2YNGA 1FWKA 3K57A 1IKXB 5HMZA 2OELA 5C25B 4I67A 4DV1F 1TAUA 1YRUA 1UVMA 1IKYA 2CQDA 2J7KA 5C24B 5LT5A 2LEAA 4DL2A 1TK0A 1MMNA 4UOGA 2IVYA 4KPCA 1P4EA 1DRZA 1J5OA 4Y2KA 3TAQA 4RNFA 4PWDA 4YOEA 3CJEA 1N5YA 1U0HA 1N8RT 1ZA2B 1H73A 4LF9F 4IR1A 2PN2A 4KGVB 3J7Z5 1HNZC 4JI8F 1GPMA 2AF6A 4ZVRB 4O44A 4F2RA 3QRPA 1VBYA 4GKKF 2W1BA 4A8QA 4Y3CA 4ERDA 5A6WA 3R1HA 1X0PA 2QFJA 2R8JA 1RTJB 3D3CJ 1B4SA 2XULA 3OUYA 1QAXA 2Z4PA 3IWXA 3VTIA 2PT7G 3VAJA 3AOCA 1W26A 4X65J 2WVDA 2ZBCA 1U1MA 3OR2B 3T6BA 4WTYA 4WV3A 2QMUB 3DAYA 1RDRA 3ITHA 3BO4A 1R0BG 2B43A 3K5LA 4LFBC 4LFAC 2DEJA 4N47A 3M1VA 2FHOB 2ZBRA 1TMJA 2BKNA 4DV0F 2L3MA 2HVHA 3W9IA 1EHWA 3QYYA 1HPZA 2YNFB 3K7RA 3MPUB 3TX0A 1HNZJ 5H9EJ 5F8NA 1VIOA 2FJEB 2XMTA 3CSKA 4Q2MA 4Y0FA 4IFVB 3EE3A 3UOWA 3SXLA 1C4AA 3P5TL 3MAHA 3HXMA 1YBUA 1NK6A 4B3SJ 2BRLA 3Q2SC 4J5OA 4WE1B 4QW8A 4ZIWA 1L3SA 1JLFB 1NHVA 1XEZA 2CDRB 2YY3A 3PY8A 2KFYA 2QE5A 4NYPA 3AODA 3GWCA 3TYTA 1URNA 2POKA 3CCZA 3CDAA 1IWAA 2XB2D 1XN9A 3C6UA 2H9ZA 4GKKC 3W2WB 5HBMB 2QYCA 1HNWC 4FS2A 4QIFA 1Z4UA 2WONA 4PKDB 3U1NA 4H4MA 4DX8H 4DFMA 3MUVP 2HVEA 5A1IA 2ATCB 5GMEA 1CJKB 4RKUC 1Y4ZB 4URSA 1R89A 4RNMA 1IQTA 2DNPA 3FMWA 4K4TA 1S48A 2NREA 2VF3A 4MH8A 3MPDA 2MLZA 5ETKA 3I0SA 2DGQA 2HS0A 2ZNZA 2XLKA 3OLBA 1LW0B 4Y2IA 2X1AA 4USVA 3RW6A 1U6BA 2M70A 2UU9C 5BXIA 1RWPB 2MZ1A 2R7TA 1Q79A 3ZTPA 2HWTA 2J6UA 3PO5A 1UEUA 2N7YA 4WP9A 1BQNB 2MQQA 4FKXA 3EICA 2I2YA 5D8HB 3AA9A 4OI3A 1TKTA 4DPOA 4MJKA 4DCVA 4UZBA 5KEIA 2FIUA 4ES1A 2R3VA 4QWDA 2B0GA 4OZ2A 5G0RA 4RUAA 4JI6J 2ZVIA 2CPEA 4DR3J 3OR1A 3A9UA 1YLXA 4NLRA 3AXMA 4URQU 3NWGA 2VQEJ 3W5XA 4OX9J 2ASBA 2Y8YA 1LK7A 5HQMA 2E1RA 1WWHA 2DR6A 3M8PB 2YNIA 5LMNJ 1IBLC 3UVJB 2MSTA 1P7LA 1VRUA 1F5CA 2JDJA 3RGIA 4DL0C 4M95A 4LR9A 2HNDB 1BGXT 1S79A 2HEKA 1CLFA 2FUG9 1SC3B 2CQCA 3AAWB 4DLGA 2P2JA 4CH1A 5AXMA 3H2VE 4AXIA 1ZA1B 3FCHA 2HGMA 2KN4A 1RHQB 4C0BA 4LF1A 4MH4A 5K8MA 4B3RJ 1EJ7L 5F0WA 1FKAF 4OYBA 5KFXA 4CIOA 2OH2A 2XWXA 1FO1A 1FRLA 1U26A 2R8IA 3TVZA 3JSYA 2XNQA 2VV5A 3C19A 2V8PA 3EZUA 3MM6B 4OYAA 4QWEA 1YIJS 2UVVA 1O93A 3DGPA 4RUHA 3KMSA 2NPFA 2R42A 1EQMA 1HBUB 4JI5J 1N32J 2Y1JA 3M4XA 1K73T 4NLTA 3CWJA 1RBOB 2WAQD 4LT6A 4NA2A 3AJDA 1Q4RA 2DXFA 3U1LA 1K8AT 3PW7A 3TA2A 1USPA 4J9SA 3S82A 1T05B 1BC6A 2X3DA 2W24A 3D4JA 2OSQA 1HQUB 3MM7B 4ECTA 4WWSA 2EKYA 2Y4OA 1RYRA 1NYEA 4RLEA 4DSFA 1NSQA 3CCJS 2UZAA 3MMCB 2EC0A 1IBKC 2HHTA 3HKWA 1YRTA 1HI8A 2GCFA 4RW6B 1WG5A 1HD0A 4ECVA 3EERA 1TL7B 1N36F 1S9EA 2IC3B 3AH6A 5T7LB 4ZK7M 1RTJA 5A8RA 3DRRB 2JLEA 2Y1LB 1KOHA 1X4CA 3CD0A 3H2UB 2NPIA 1TKXB 4OYWA 1SKWA 1XMOC 2Q1LA 1S6UA 1XNQC 4I6YA 3M05A 2RMLA 2AJ0A 4DL3A 2RS8A 4DX6A 4GVBB 2MJNA 3OW2R 2ASDA 3M2VB 2EKNA 5GAEU 2B5JA 3TQIA 1NMEB 1HA1A 4M5GA 1IKYB 1AT1B 1UFKA 4ZDNA 4G3IA 1B64A 3I9V9 1FXDA 2A10A 4NLPA 3HJFA 2HLUA 5LMUJ 2R2TA 2DCUB 2DHXA 1FRJA 1WOPA 2PA3A 3CJ3A 3N6NA 2FVPA 4KHPJ 1SC1B 1YBAA 2HWHA 3EGVA 3HM9A 1B70B 1HBOB 4Q8FA 1S59A 4ED3A 4OYCA 1MU2B 1KBRA 1RT2A 2CYYA 2OFGX 3MCSA 3AB2B 2WOMB 4ZVSB 4A46A 2XBPA 3NCRA 3PCOB 3GMGA 3PNIA 2VJUA 2C3MA 3MAAA 3M8RA 5HROB 4ZITA 1HYSB 1UVIA 1T9UA 1UJ5A 2P9CA 3TEGA 3VQTA 3FMBA 2QL7B 4LQ3A 3I08A 4ECXA 1F5AA 3D66A 4FP9A 1VQ4S 2W9BB 2JFKA 3EVWA 5J2PB 3PEJA 1U49A 1CQNA 5IT0A 4F4KA 5CYJA 4DXLA 3LGXA 3MF5A 5DZ7A 5K85A 1B0TA 2IFXA 1H6KX 4RWWA 1TKDA 4LSLB 1DJ0A 1XNQJ 3D6MB 1X5PA 3WIUA 2ZH1A 3KUGA 2VBWA 4X4RA 3N5BA 3RZAA 3CCUS 3RRKA 1ULTA 4RVOA 4DR4C 3A8JA 2WHOA 2XTJP 3MD1A 3HP6A 3QLHA 5I3UA 3FJ2A 4KV8A 4TLRA 2QG9B 3CXCR 4Z37A 5L38A 3UN2A 4GVLA 1DTQB 4KKOA 3UN3A 3MM9A 5I4MA 4NCGB 4Z7YA 3MR7A 1K44A 1LOUA 1N5TA 4F3MA 1ZAWA 3CNQP 3CEDA 1U2FA 3LWMA 3THVA 1MDBA 5CH7B 5IM0B 1IBKJ 1OSCA 2V0NA 4KYZA 4L2ZA 4IO9Q 4DJBA 4AQYJ 1H7XA 3PACA 5DJBA 3OTOF 3K5MA 1S1VA 4C11B 4H4KA 5L1JA 3FK4A 2ZBQA 3BH7B 2Q6CA 2V2VA 2VFSA 3CDUA 1QSSA 4LF6F 1KHWA 3TZYA 3DRSA 1OYEA 2XZWA 3C2PA 2MGZB 3NY0A 1G3OA 2P5VA 4F02A 1CJTA 4RNOA 4F4YA 1NJXA 1QSLA 1Q5VA 2ZOGA 4P71A 4GKJF 4L3NA 1FKOB 4BCAA 2CG4A 2RRNA 2V50A 3DLEB 4Y2MA 2QJ3A 1CC7A 2V8HA 2MEWA 1KP6A 2VFRA 3C15A 3U27A 2D3OR 5SZTA 1M5OC 1CS4B 3HMJG 3O2EA 1MLAA 1RT1A 4OI0A 3NGSA 3ZNJ1 3CCSS 3L9ZA 3OVSA 3JTPA 2JJ4D 1VQNS 3N54B 4F3QA 2OGUA 4IFYB 3HSJA 1C4CA 3CC4S 3MI7X 4DR6J 3I5BA 4JB8B 1X0FA 2PO4A 4ELVA 3C5EA 3FUYA 4ANDA 1H72C 1ZH5A 1TV6B 4KSEB 4ZCMA 1HWLA 3OSPA 4DR6C 2QN6B 4ZPTR 4DPTA 3T5HA 1GEHA 1FJ7A 1NB7A 4PUHA 3D1HA 4B3RC 2P2QA 2BANA 2W4DA 5ETOA 4BC7A 3GSIA 3VR1A 1PC4A 2BVZA 2MZRA 4R8UB 2B8PA 2BMBA 1PGZA 3NNAA 1U8SA 1VJWA 4F0MA 1HNVB 1UCNA 4CH7A 1RAEB 4ETZA 5MLCV 1DTTA 1FI4A 3OVAA 2OPPB 3R2CJ 2XI3A 2OEJA 2CQ2A 4BC9A 3KMQA 4EFAC 3GIJA 1JQGA 1T9TA 2HFUA 3ILLA 2E5JA 1KLMB 3IRXA 4OI4A 2DPLA 1RWNB 2ZE2B 1IKVB 2ZKTA 1VBZA 2ZWPA 3DI6B 3H5SA 1TH5A 2HBQB 3ENAA 1IKWB 3H5UA 2R8GA 3FDSA 2RU3A 4M5NA 1PG3A 1Q53A 3CW9A 3VALA 1SL2A 3G6XA 2FVSA 2K1RB 2ROEA 1FFGB 1YZ7A 3IR5B 3FSIA 1RKJA 1CJVA 4QPXA 3MMAB 1WELA 2WW8A 4RUBA 3VNRA 1Z2ZA 2CQ1A 5AJ3J 4JV2A 5KT3A 2L9WA 1FWLA 2VICA 1HWIA 1A6LA 2W4PA 4NL5A 1LWCA 2BXJA 2PROA 3CW2C 1DURA 1PAEX 4G65A 1HWUA 1WD6A 3WX4A 3WZ0A 4DR1F 2F4FA 1N5YB 3MEDA 3BDEA 3W1YC 2C2KB 3SYZA 4LF8F 2LLZA 2D1SA 3NMRA 4NXMJ 1R0CB 5CAAA 5K8PA 3MR5A 2E7XA 3LP1A 2HG4A 5KFMA 4USUA 1T8EA 1LKZA 3VZHA 3WIVA 3N0VA 2FC8A 1X4EA 5LL6d 5L39A 1U1RA 1Q81T 2E9ZA 5LJ5Y 3CQ2A 2BE9B 2D1TA 4CYUB 1REVB 2HZVA 1S4EA 4PRFA 4B3MF 2KZFA 2KRBA 3FEZA 3HHNB 1IWGA 3MURP 2P9EA 1FK9A 1KKHA 2D3UA 1N2FA 2NR0A 1NSKL 3G4SS 3SDEB 3PX6A 1RT6B 2PE8A 2K1RA 1FDAA 5J1NA 4I69A 4CO3A 2CPZA 4WYLA 2IPOB 4LRDA 2XO6A 3CJ2A 4E0DA 2AV5A 3CF5Q 5K8OA 1VQ5S 2E8CA 4PUIA 2PT0A 3AFGA 1IN0A 1E6VA 1MWQA 3QGIA 1FD8A 2VKZG 2GJIA 3N28A 4HL9A 1KLMA 3IRXB 3SIPB 4B9UA 2CZ9A 4IG0A 1H7WA 1BHNA 1SUQB 1TKZB 3C66A 2IJNA 4P7VA 1CG2A 1VISA 1BXNA 5D4PA 3LGHA 2BDPA 1D09B 2CPHA 3VGUA 3J81Y 5BYQA 2ZFHA 1UVLA 3G6YA 3FKBA 3MM8A 3BO3A 2BV3A 1HQEB 2FHJD 3DKDA 2OAUA 4ZCLA 4NASA 3SMZA 4ECZA 1Q86T 1R8AA 4I7FB 2WVEA 4CLLA 2M52A 2HNYA 2EFVA 2KXFA 3R7SB 4I6WA 3UD5A 4K2JA 5J1EA 5AJ3F 4DSEA 3V6JA 2COLA 1UJ6A 5H9EK 1U1NA 2LQ8A 4J9VA 4UOFA 2A2DA 1RK8A 3CDWA 3HD1A 3M6WA 3NCPA 1XIQA 4KB7A 5M2RA 3T6JA 4DDFA 1U09A 1EP4B 3CO0P 3VGSA 2VFVA 2YTCA 1UVKA 2MXYA 2X51A 1NK7A 2UXDJ 1GMVA 4JV5J 1QJHA 4IOAQ 3AA8A 4TXSA 1SH2A 4EATA 1NDKA 4U7UK 7FD1A 3OXLA 4ZPVR 2PI4A 1N33C 2DYJA 6FD1A 2AJQA 5IT4A 2P2FA 4U9RA 5T14A 2D1QA 4KGKA 3DOMA 4JI2F 2H4YB 2F3JA 2F8MA 2V2ZA 1PYSB 2CQ4A 2ZUGA 5KG7A 4DV4F 4WFNQ 1FKOA 1NZAA 1R43A 1TMMA 1UFWA 3C14A 5AXLA 5E41A 4EBCA 1JIHA 4DV7C 1FX4A 2J5AA 2BKPA 2QEXS 1XNRC 2BUNA 4WFYA 2AD9A 5FIIA 1I1GA 2IY5B 1FERA 3IS9A 4OI1A 3V6KA 3SQOP 1IQZA 2RS2A 4FYVB 2DGOA 2BW7A 3KDNA 3T41A 4V19X 2C3OA 2QA4S 2IA0A 1AZSB 5LSOA 1QAJA 2HHSA 4L4QA 2BA9A 1ZZFA 2BJOA 5DV9A 4RWXA 1E6YA 4HVZA 1MN9A 2BE7D 2P8IA 5E33A 1S6QB 5ETMA 3T1YF 3Q89A 1R8BA 4DUTA 3RR8A 4G36A 3LA0A 3G8TA 1PSDA 1FEHA 3MPWA 2YWHA 4PWUA 3CCMS 1Y3KA 4D57A 2RQKA 1UZDA 3TI0A 3ET6A 3OTDA 1SPBP 2G0JA 2DNYA 1TVRA 3H42A 4W98A 3POTB 4P10A 2XMWA 4KV8B 4BLGA 1KDNA 1VGYA 1GQEA 5L9NA 5J2QB 2MYFA 2W2MP 3KOAA 1S4FA 1KOOA 2LQJA 4P2XA 1RHJB 2W25A 2PA8D 3CCTA 4LSLA 4CI0B 3KLEA 5F8GA 4DHVA 3KJVB 3ETCA 5FLXU 5CHCB 4MTPA 4OYPA 2C2OB 4ZOSA 4KBIA 4AUKA 2QZ8A 1UW4A 1UWAA 2FJBB 3C6TB 4NLVA 1SJFA 1N6QA 4Q8EA 4U6PA 3H4DA 1LWXA 5LMUC 2J9EA 1T3OA 1IR2A 2DNRA 3ZC4A 5HROA 3UDCA 2MQOA 3RBEA 2OJ3A 3VAGA 2UUCC 2YKOA 4R0MA 1N5VA 4E8UA 1KQSR 1C0TA 2DIUA 4EU0A 4U67Q 4MKBA 2FVCA 4ICLA 4MMOA 3I55S 1NJWA 3BR9A 4PAAA 5GMDA 2FLPA 1I94C 1VK3A 2UU9J 4P73A 4DV2C 4B3RF 2B9WA 3Q86A 2RH3A 1WKJA 2YKAA 4DPUA 4XTTA 4OZ3A 3VAKA 4LF4F 1FNXH 1OMSA 3I31A 4H4OB 1DY3A 2O66A 2GGPB 1RWWB 1RWOB 2MMYA 5F9NA 1XNRJ 1IJEB 1VR6A 1DQ8A 2NS1B 3A8IA 3DLKA 4ZVHA 2GO9A 4BWJA 1V3RA 2YWFA 2B9EA 2ROGA 3O2IA 4RW9A 5E3QA 1B7YB 3BM7A 4GO5X 5GMKa 2UP1A 3SCIE 2ZZNA 1S9EB 2F65A 5T7LA 1I94F 4Q5VA 2VZ9A 1HQEA 2CIMA 4IR9A 1ZTTA 4DCTA 4G1PA 1WDTA 5D4OA 3UDVA 1MXAA 3PTWA 2MY8A 2UUBF 2VIHA 1C1BA 3MMCA 4CNZA 1CULB 3DMJB 1BQMB 3LQVA 5F8LA 5L1LA 1MKYA 4DV6C 3IGNA 1PBUA 3LPEA 4OX8A 1ZETA 4IG0B 4O0IA 4ZVGA 1MMLA 4ZCKA 2M88A 3OQ2A 5LMUF 1NJZA 5DG8A 1U48A 2OTJS 1HBMA 3LNVA 5J1PA 2OP5A 3EJMA 5LCIA 1XQIA 1O92A 2K7KA 4ZLLA 1NU4A 1TELA 4CWBA 5GAGI 5JXSA 1O6XA 3KXWA 2DGXA 2M4MA 3SDEA 4ZHRB 2UUCJ 1Q7LB 2MZQA 2ZHOA 4LFBJ 1UTAA 4M94A 1SIWB 2D9OA 4J91A 1S1XB 3BPSP 2E5LF 1N4LA 1IBMC 1S0MA 2ACMA 4KIAA 4CYUA 1TUWA 3D7SB 3KWMA 1YDLA 4XPCA 1LV5A 3KLGB 1KFSA 2CVIA 2VG5B 3ICLA 4F3OA 4WIQA 3DHXA 3UD4P 2XS2A 2JRSA 1NY8A 2Y4NA 4USJC 4UUXA 2ZH7A 4WJBA 3FRYA 3TX8A 3J7AN 3JYTA 5F8MA 4F67A 5ITHA 1S0NA 1MN7A 2BW2A 3JSBA 4L6V3 2J9DE 4P75A 4XDDA 3DRYA 5ETPA 3I5AA 3UI3A 5EGYA 2OTLS 2AEFA 2GC8A 3QATA 4FYXB 3J81D 5LXRA 1MROB 4M5JA 5IQ6A 2GJFA 2DGUA 3MECB 3RUBL 4KY3A 1HWJA 4K8RA 4NMXA 3W2VB 3SFGA 5BR8J 2E7VA 2E5IA 3K5NA 4N77A 2XCPA 3R7NB 3PW2A 3HK2A 1FJGC 3FBCA 2C2ZB 1JLGB 3WHIA 3FZBA 2ZD1A 4QBUA 4DV4C 2LEPA 3AY0A 3HFKA 4QWCA 3UZ0A 3OR1B 4X65F 5D0EA 4U7UD 2RDJA 1KRPA 4K50A 4AYBD 4D4IA 2DD8S 4KFBB 3TA1A 3T1AA 4NXNJ 5B0FA 1DBDA 1TKTB 4ZA1A 3OL7A 2I1RA 2XO7A 1SJ1A 5EN1A 3FCEA 2O1PA 2FTRA 2BH1X 2KZ0A 2PGCA 3M6UA 3MEGB 3TUZC 1G6BA 3HDSA 4HYKA 2KXNB 3OL6A 4OL8A 4NI2A 3LAMA 4DEZA 4QW9A 3BS9A 3KLIA 4OMFG 2C3PA 3IRWP 2ACYA 1ML8A 2BANB 4X66J 3N79A 4MTNA 1M5VC 3R44A 2GFFA 3I0SB 3HX9A 4ID5B 2BRKA 2Z58B 3A3PB 3ZZYA 2NZCA 1NK5A 1HI0P 2VQFC 1P9YA 3M9MB 4QOTA 2V8GA 5ETSA 2FY1A 5JVGQ 3GCXP 1RT4A 2IVMA 4GMKA 4Q7AA 1U47A 2GAGC 3NMAA 1K0TA 1RWXB 1PCAA 3CDEA 5IV4A 3DDKA 4F2SA 4DV0C 4CRJA 5KTQA 2UXCC 3CVKA 1VEHA 3FBFA 2BJ1A 2BQ3A 5D3GA 2BJDA 4I1TA 4X4VA 4NRTA 4ZVTB 3W2WA 2HLTA 1B3TA 2EVZA 3OTOC 1JJ4A 4DV4J 2ILYA 3Q83A 1R6YA 1VLAA 2VBZA 2C2RA 4RBTA 4W92B 1B99A 2CPIA 1S1UA 2AX1A 2RNEA 3LAXA 1NAQA 3GILA 3VAIA 4KAIA 1T9YA 2KYXA 1JLFA 1YITS 2HHXA 5KFQA 4FYWB 3CTRA 4WE1A 4ZKAA 4ELUA 1T94A 2G1DA 4DR4F 1GK8A 2LXUA 3NYQA 5KFWA 2HURA 3D67A 2RUGA 2RT3A 4FTFA 1NNDA 2DNKA 3OTOJ 3M9NB 3TZXA 2R7SA 1NXIA 4DN0A 5FLXY 3N5FA 5DG9A 3EZ5A 2NCLA 4QU7A 3CO9A 4UY8T 3IM8A 3GE9A 2B51A 3QZ7A 2V4JA 3NBPA 2H5JB 5K14A 1G1XA 3ITHB 4EMDA 1I6JA 3SSQA 2MMAB 1LW2B 4J37A 3UQSA 4KHPC 3KHRA 1S99A 2EFQA 3I32A 4FVMA 4NRUA 2Y1IA 1VQOS 1OY9A 5DQGA 3GCWP 4PG6A 4ZVQB 2R7OA 1YJ7A 4D3HA 3OUYB 2PSZA 2GVDA 2GZOA 4WPAA 2AQ4A 4MKYA 5LOQA 1WKKA 1JOSA 3OHAA 3GFHA 5T41A 1V3ZA 3EPGA 3TUFA 3H90A 4FNHA 1VQPS 1FLOA 2BBEA 2HZAA 4C8OA 2PN6A 3IWLA 3GYGA 3QT7A 4PEOA 4RW7A 5ETNA 3JSMB 3US5A 4DLEA 5J2QA 5KFFA 4BSZA 1CC8A 3GB0A 1Q1KA 1F6TA 3ENQA 2FLNA 1SCJB 3K58A 1J5OB 2ZVSA 2K2PA 1N34J 2N82B 1WEXA 4LRCA 4LUBA 5IC6B 5HJYA 1AW0A 4GS5A 5DG7A 4HI2A 4PQAA 2E1PA 2RAQA 1ZB8A 3RG2A 1Y3JA 1BQXA 2A2CA 3QT5A 1GT8A 1WSRA 4N5SA 4Q0BB 4C48A 1N0VC 4F0HA 3Q23A 1Q8LA 2E5HA 3G9CA 4RM2A 1TFYA 4YMEA 2DNQA 4KQZA 1U24A 2DPIA 3HO1A 1T02A 3MUTP 1GMWD 2FPHX 1LWEA 2W7OA 3HSGA 1S1WB 4X4PA 3EM1A 4OYOA 4Q45A 5BSVA 3DN9A 1YJ9S 4C3LA 5IWAJ 3GIIA 2HBRB 2LYVA 1RJJA 4DR1J 3A26A 4YHHC 1R31A 1VQYA 4J9MA 1G2EA 2YQ0A 5CYQA 6FDRA 1HW9A 1OPZA 3AF5A 3I0RB 3BPDA 4GVBA 2IJRA 4DX7A 4DWIA 2N4DA 3CJTA 1YJUA 3I82A 4NE9C 4BWMA 2X1FA 2FLLA 3QSYB 1LWEB 2ZDOA 1V9OA 1PBAA 3M8WA 3V6HA 4KH0B 1MWYA 2HFSA 4M5DB 5C2CA 4ES3A 2NCKL 2DT9A 3W64A 2BOPA 1C0UA 1U0SA 1RKIA 2AYEA 4QZVB 4ZJQA 2JEJA 4B3MC 1S6PB 1Q16B 3HSZA 4ZLJA 3CIMA 5EHHA 2J7UA 2RILA 1NRKA 2WBRA 4OZ5A 1VS3A 4O4RA 5A8KB 4OXIA 4RW8A 4M5HA 3FVYA 1FCAA 1X4DA 4WFBQ 1UEKA 1RWUA 2PMZD 4YHHF 3J81j 4A8WA 1HQUA 3MM7A 3DRXA 3BGUA 1WOOA 2HQFA 4LSNB 3DDNA 1YSJA 4RW7B 3KLFB 4L72B 4CO5A 3D2WA 2R2UA 3OTBA 4JI2J 4N76A 3DYAB 1N5SA 3IFEA 4NEZA 4CQ1A 4DOZA 1IBMJ 4K5SA 4ED2A 3PROC 2HQ3A 2HHHF 1QVFR 2GVDB 1O90A 3ISND 4DR3C 3R97A 2KH9A 3V6DA 2RSQA 1EIYB 1N5QA 4IKAA 1U6ZA 3M9OB 3BQ0A 9ATCB 1XHJA 1CPZA 1RAJA 3DXBA 3HVTB 5E3AA 4E2FB 4PXCA 1R8HA 4I4BA 3L7PA 2HMIA 2HJGA 3H2TA 3W9HA 4NZ6A 1IBCB 3O44A 3H5XA 4QYZJ 3W63A 4QU6A 4MYUA 4YB5A 4LF7F 1FTRA 5E3CA 4CLSA 2E5LC 3G82A 4JV1A 1RGVA 4J9PA 3NKYA 2D3ZA 3N4WA 2XGPA 2YQ1A 2CWXA 4WBFA 1XMOF 1VBXA 4DS4A 4L73A 2Z2ZA 3TJAA 1M1HA 2VQFJ 4DR3F 5HN0A 5A8WB 4UZCA 1NH8A 1WF0A 2CJ9A 3G96A 4O3SA 2YXLA 3CQ3A 4IG3A 3FCCA 1T9WA 3T3FA 2KDNA 5HVHA 4DCUA 4DUZC 3DU6A 5I3QA 2XWYA 4GRSA 2GX8A 3HT3A 2ASLA 3QRQA 4PQUA 1WHXA 3OFFA 3NS5A 3KLHA 1T03B 1OO0B 2ZJQQ 3U1MA 4K0KF 1N33J 2E9RX 1L5UA 2NYIA 4O3RA 5DS7A 3C16B 5DDOC 4DSIA 4ILLA 1N32C 1UL3A 5IT9U 5GADU 1S97A 3X1LB 2CDQA 3W62A 4GXRA 2DHGA 4LF7C 1RABB 4KO0A 5M2UA 3MPYA 1BQNA 2JH3A 1JLAB 2DXDA 3N9UC 4CLUA 9RUBA 3AD9C 4LBIA 4OJ3A 4B3MJ 4WU2A 5KT6A 4LF5C 2AGOA 2PFDA 3TOQA 2CUYA 1SBRA 4Q2LA 4O0NA 2IVFB 1X7VA 5D0GA 2JEGA 2CQ3A 3G87A 4LFAJ 1JLEA 3HT0A 4X64F 3HFVA 5B0BA 3KK2B 1VQ6S 4X2BA 1M6XA 4I56A 1JLAA 4ZJOA 3DGVA 5KG1A 5CABA 2E1AA 1T3NA 4NEYA 1H74A 5CYMA 4MFBA 2YKPA 3K89A 3PM9A 3T5KA 4HDHA 1CJKA 4KFBA 4CLWA 2W2NP 1YGYA 2L9NA 1GFWB 4B3SF 4DR7F 4H4MB 3OTCA 1TFWA 4U8VA 1UZHA 4P9SA 3W5YA 4KJIA 1AUSL 4AFFA 4D4GA 5HVGA 1NEEA 2D69A 3ISZA 5JUMA 3O3LA 1ZOTA 1HL6A 4DV5J 1J5EF 2ATWA 1FWPA 3FEXB 1HNIA 2KKHA 2GIQA 1VHFA 4M1KA 4YFUA 3GFZA 1WG4A 5HK4A 3SCLE 3ADAC 4ILRA 4KHMA 2M7SA 3H5YA 1VQLS 5KT7A 1HIYA 1FNMA 4LF5F 1UKKA 1X9SA 2HHUA 3EVMA 2DY9A 1SC6A 2XYGB 1IBLF 2HAIA 5BSMA 4JI8C 2BOAA 4WXWA 4M5MA 4IFVA 2XS7A 3KHGA 3R9XA 3JYTB 1W25A 3N01A 4YY3F 3JAMU 2XHCA 3CCRS 4ECWA 3FRZA 4MYTA 4RJVA 2J6SA 4DI6A 2FJAB 2XYHB 5C5JA 4JP8A 1KWMA 3W9JA 3M1VB 1WHWA 1SL1A 1N32F 3CD6S 3NCQA 3V4IA 1PG5B 2YKMA 8ATCB 2K3KA 2OO4A 3GYNA 2C2MB 4K4ZA 2VBYA 4LRBA 3OR2A 4YS2A 4MIBA 5F3TA 4K4UA 1VI7A 5KG2A 1JNZB 1FRMA 4LIRA 1T5DX 4DR5C 4B9LA 1V5IB 4G37A 3S01A 4J90A 4NLOA 5DO2A 4WTOB 5CCLA 1X4FA 4ETXA 3ILJA 5KFBA 3EGZA 3EYZA 3VNQA 2HQGA 3NG8A 4KT0C 1SIZA 1U0HB 4MIWA 4NYOA 1LFWA 3DLJA 3KG4A 2GQ2A 4E98A 5LSLA 2W8KA 1RSCA 4A8KA 2ZH3A 3PYDA 1C1BB 2EEYA 3FZ2A 3LAKA 5EX0A 4WKYA 4LR8A 1K0VA 4RM3A 4DV3F 1VYAA 3PJ9A 4PPDA 3SCJE 4JI2C 1FRIA 2E66A 2IM3A 4NDNA 3JAMD 4IOCQ 3F0NA 1XRAA 1PU1A 2IIHA 4M5DA 5KYVA 1P1LA 2XLJA 4I2QB 1HH2P 1JLQA 2QLJB 3BGRA 2RDDA 2QL8A 1OWXA 2HK3A 2MHNA 4H4OA 4PYDA 3RAXA 5A2QY 5ETRA 5DQIA 3BREA 4V1Ak 1HNXC 4CO1A 3UR0A 2XSJA 3IAS9 5HSPA 2VQFF 1S9FA 4FBUA 3R6LB 4IDKA 2BX6A 3HI9A 2H5EA 3BSAA 2DNGA 4I9FA 1JNRB 2M2BA 3TVKA 2DVIA 1VRTA 1XNRF 1D1UA 3NI2A 1WKLA 4YDXA 2KZMA 1K1SA 4WP8A 1RTIB 1O0PA 4G6VB 4ZN3A 2LU2A 2QSFA 3DOKA 1XTZA 4JI3J 2P6TA 2KL8A 5J2NB 2MZTA 3UCGA 2E1MC 3IG1B 4EWTA 5L46A 2BEFA 5J2MB 2WTFA 2AGQA 3WC2A 4CLPA 4NOZA 2IMOA 4ED4A 1M1KT 3TAMA 3CDBA 1T9VA 1CJUA 1KN6A 4MK9A 2PI5A 4OQJA 4WF9Q 1HNWJ 5A2QU 2QVYX 3KLEB 4A4JA 3I6PA 1FRKA 3EXCX 3J7YI 2DGSA 4J9NA 3QAEA 4Z2XA 1IR1A 4MK7A
chains in the Genus database with same CATH topology
3UR3C 3PJXA 1KS2A 2ZHAA 3NAIA 4EZ9A 3IEUA 2FJXA 4C8KA 4JI4F 3QIPB 4NXMF 3AJ1A 3MAQA 1EGAA 2F9DA 3PIPQ 3MOJB 3QO9B 5K8NA 4OZ1A 4C8ZA 1KONA 2LXFA 3N6MA 1LW2A 4UUWA 3BB5A 3H4BA 2E8FA 2KJWA 1C1CA 1RISA 4DG1A 4DL5A 3IN5A 2GMLA 3E8OA 2KFNA 5KT2A 4DFPA 4A8YA 2C3YA 1QUVA 4NZ7A 3AJ2A 3VCDA 1JMTA 2DHAA 3TANA 5CA5A 3D28A 2W4CA 2YWCA 3R5DA 4X4OA 2P2BA 5HP1A 1FTCA 3N6LA 2FGCA 4NZ0A 2FVRA 4FUQA 1Y00A 1KTVA 2YNHA 2UUWA 3KTQA 1WACA 3H40A 2B9XA 3MEEB 4U7CA 2MKIA 4HH0A 5L8RC 4HT5A 3MPVA 1W2BR 2UV8G 1Y7PA 4FXWA 4NLWA 3KFWX 1Q8BA 3NNCA 3GKUA 3RV2A 1CSJA 1XWLA 2OKQA 3IA0A 2ZBIA 1QSYA 2CPFA 2LQBA 4QR2A 1RG9A 5K5MA 1CVJA 3M2UB 2KG0A 4OI2A 4NLXA 4KTQA 4LFCF 2D41A 4NCAA 2P6SA 4QIVA 4Y00A 2PMHA 3IC1A 3OXFA 5CD4H 1KNZA 1RT3A 4DS5A 2N3OA 2NLWA 4I2PA 3MD3A 3IBWA 1U25A 4JBCA 1PA4A 1GTEA 1O9TA 3G8QA 4B08A 4K4YA 3QGPA 2YWEA 1SUQA 1JK9B 5KFIA 2ZOMA 3TR5A 3CCQS 4FBTA 4LE5A 3MR6A 3PW4A 2JC1A 4LMZA 1HHTP 2V4RA 4X66C 3CGIA 1IR0A 4OZ0A 2VSQA 4NWBA 2DISA 3CULA 4OX9F 1YJRA 1NJYA 1WI8A 4CTAB 5EWFA 1U6FA 2UUTA 1JLGA 4USIA 4UQGA 5HLFA 3FSYA 3NP5A 2UUCF 5BUQA 1X4GA 2DH8A 1X5TA 5DM7Q 5T8SA 4RBVA 1FK9B 1LK5A 3A1YG 1TZ0A 3NS6A 4B9NA 1QUPA 1JXEA 3CCES 2F4VC 2GMJA 3MOZA 3R9WA 2G9OA 2HWIA 3BJYA 1XMQF 3O1LA 4O4GB 2RKIB 1XR6A 3IMLA 4ECUA 5D77A 3OHBA 3RAQA 1WHYA 5KG0A 2LEBA 3AB4B 1HW8A 4Y2AA 1FRHA 5EWEA 4DV2F 1JJHA 2KHDA 2VPZB 2FDNA 4HT7A 4D56A 3KHHA 1ELOA 5B0GA 3MMAA 5E7QA 1UETA 3KNAA 1QE1A 4BBYA 3LF0A 3Q0AA 3K5OA 4ZHRA 1VQ9S 1F60B 2NSBA 2XI2A 4HH1A 1LQLA 5KFRA 3KG1A 1FRXA 1ZBTA 1QLNA 4DUYF 2ZITA 5C42B 4P2SA 5KOWA 1APSA 2ZJRQ 3BSCA 4ODJA 3KK3A 2CQPA 1PO6A 2FJVA 1WEZA 2WK4A 5FD1A 4XO0A 2N3LA 2PFFB 4DR1C 3HHEA 1D9FA 4ZPBA 3PRBA 2PDAA 2D1RA 1VMBA 2RU9A 1U1KA 1IBMF 4IYQA 3F56A 3FQLA 4Y34A 1NHUA 2BZ2A 4RW9B 4P6QA 1YQHA 2OLWA 4TQSA 3DLKB 2CPDA 2VOOA 3G86A 3CPWR 4X84A 3PX4A 3VWSA 3EGWB 1BY9A 1YG0A 3SSRA 3B7WA 1V3SA 1YWXA 3NRBA 3NLCA 4WK3A 5B09A 3T1YC 2C28A 3Q8QB 3BF4A 2VODA 4ZVFA 2YKNB 5KFTA 4C0HA 4DUYC 1N34C 3HZEA 4PZPA 1NO8A 2RJZA 1SL0A 2DO0A 5KFAA 2JEIA 2QA4G 1L3VA 3G6ES 4KPYA 1N48A 2V7BA 1N36C 4XK8C 2I5JB 2MY7A 1VQSA 2BQUA 1JLBB 3MR2A 4DV7F 1WF1A 3CC7S 1OQ3A 2Q79A 4DR6F 4X4SA 3HHLB 3M32B 5I3PA 1RT7B 3TP2A 4HKQA 4ZPCA 2QMWA 5EWGA 2MGZA 3AHPA 1XMBA 2JWNA 3GIMA 5DRKA 3SSSA 1UP1A 2AP6A 2B7BB 3DC2A 3KJVA 4FF2A 2VH7A 3TAMB 5IM0A 3PBKA 1Q8IA 1IJFB 4A8MP 5J2NA 1TP7A 1HFEL 5F8HA 3G7SA 2Q3PA 2V8VA 5HQ8A 1G7CB 5IFMA 3M32A 1FDBA 2OPRB 5KFZA 3J7ZT 3GFYA 5I3UB 3TVYA 1O51A 2C22A 2A3JA 1VRTB 3CJ4A 3LO3A 2UUAC 2R7RA 2BM1A 4DJBA 4AQYF 2CJQA 2I5JA 1ZM2A 4FVCA 2YQ3A 2CFXA 1VC0A 1IBKF 4WS9A 4Y28C 4IH6A 2XSJB 4MIAA 5CCMA 1R0AB 1OQ6A 1VQKS 2W9BA 1UWBA 4QIWD 4K4XA 2K7JA 3NYQA 2R7WA 2J0QD 2CPXA 5KFLA 3DLGA 1XRBA 2U2FA 4EYHB 2RKIA 4GC7A 4TNOA 2E8EA 5FJ4A 2FHMA 4FYDA 2KJVA 4I2QA 5HMYA 2MDAA 2JL9A 4H4KC 2E9TA 3R5CA 1YJNS 5KFJA 2HIQA 1BA3A 1HBOA 4DF4A 2DHSA 2OD4A 1NK0A 2JMPA 5DLFA 1LQ9A 2LU1A 4IH5A 3PFEA 2ATLA 2DR7A 1TL4A 2WB4A 1SKSA 2HRYA 2ZNYA 3RBDA 4JI1C 2CJBA 1R8PA 2DTJA 5C42A 1JXLA 1T7PA 4X62C 1Y5NB 2CQHA 4YB7A 4DQPA 1TKXA 2QSWA 4I64A 2UV8A 5A0YA 4ID8A 2IBOA 2IAJA 4C97A 1ZZNA 3RB6A 2IA6A 5HMXA 1K1QA 5A8RB 1FD2A 2UXBF 5L1IA 2P2MA 1ZTWA 5BR8C 2KB2A 1QE1B 3L09A 2VONA 2QA2A 2V5HG 3CW8X 3MM8B 3CMES 2IM2A 1HNWF 2QRRA 2AYAA 3A9VA 4QR0A 1N33F 4YR3A 3QZ8A 3M30A 4MAKA 5A0YB 4ECSA 3RB3A 4I68A 4DCSA 3M2RB 3AQOA 3H8YA 3P6YC 1XR5A 2EFPA 4AXJA 2PC6A 5DDPC 3K59A 5M2PA 5L1KA 1JX4A 1SV5B 3U02A 3D54A 3PXGa 1HBUA 4QIEA 2JOQA 1UAWA 2YNHB 1M5PC 2RD5C 3MM6A 4BHQA 1ZPWX 1Q7YT 4ZP7A 1LFPA 4FF3A 3GZ7A 5HP1B 1SKRA 4CT8A 2RQMA 2XMUA 2FB0A 4LJMA 3LGMA 3QPIA 4CTAA 4ZLPA 3QJLA 3OFEA 4PHTA 3ULHA 2F40A 3K2YA 3DLGB 1U45A 2BE2B 2EFNA 3H20A 1UWBB 2D7VA 1R0AA 1SJ4P 1SXLA 4NCBA 2XR1A 2B7CB 3HHDA 2LXIA 2G13A 4X4NA 4K5RA 5AE3A 4GXQA 1VBZA 3R5AA 3B82A 3QO9A 1D8ZA 5E0OA 5GAHU 3MDFA 3L3CA 3CC2S 1OIAA 3OLAA 2R9LA 2X1GA 1F0XA 3PW0A 3K8VA 4ED0A 2ZJPQ 3GR0A 4C3MA 3LP0B 4ITSA 1BLUA 5MAOA 2UVWA 3MGJA 2L08A 5BSTA 2GHWA 3RW7A 2VFTA 4OI6A 3B4MA 4XPEA 1RA6A 4C8MA 4EGLA 4RLFA 1F2GA 4Q44A 4LFBF 4IQMA 3BQ2A 1DTTB 2ZOFA 5LXYA 4O3QA 1QVGR 5DDQC 3S8SA 5F41A 3MEEA 5J2MA 1N52B 1EETB 2AX0A 4A8OA 3DOLA 3OJSA 3T19A 1RT7A 3HHLA 3T9NA 1VK8A 2HFZA 1L3TA 2VZEA 1TV6A 2M9KA 4IR7A 1Z2LA 2HRUA 2OD6A 2QLXA 2RE1A 3L7OA 2MKSA 1LWFB 2DH9A 1X4AA 3PZPA 4DFKA 3TO8A 1C2PA 3SCKE 4RUCA 1C1CB 4DG1B 2E7GA 5LMNC 1N88A 4ZCIA 5DDRC 2JC0A 2GQCA 2X1BA 3UW1A 5KFKA 2WD9A 3I07A 2F1FA 5A1GA 4ED7A 2QA1A 4R5PB 5F8IA 4WFAQ 4B3OA 2DGTA 4C7QA 3RTVA 4J9QA 2OPLA 1WTBA 4RX6A 3CJ0A 2OPQA 2I8EA 2E0GA 2Z8QA 2Z0GA 5IWAC 4JI7C 2JHEA 2IJFA 2VBXA 4DMZA 3L8CA 3PRDA 1FVQA 2RIJA 1A9NB 4ISBA 4TYBA 5KT5A 3B78A 1KLNA 4X4QA 3IG1A 3QGGA 1P8GA 3CJKB 4KTVA 4NCGA 2P9GA 3MM9B 3OVBA 4R25A 2GA7A 2CZVC 2EG1A 2L9DA 3IR7B 2EBGA 3QLHB 4O44B 1X9WA 5U47A 2Q66A 1FHTA 1D9DA 4KRWA 1N54B 3UDLA 3LW5C 3HF5A 4EO6A 4UQTA 4DR7C 4F25A 4IRKA 3R5BA 1MWZA 1X4BA 3E51A 4IDKB 2Z2LA 7FDRA 2OIHA 1UJ4A 3FFIA 2HYIB 2PD1A 2EK1A 3LPYA 2ZKUA 2ZM6F 4N56A 1IKXA 5B0DA 4R1LA 2YNGB 4CT9A 1YRXA 5G4DA 3BDPA 3PR5B 4YR2A 4DV5C 2HW3A 3J80D 3PW5A 2ZH5A 5KG5A 2C2EA 1S72S 2WOMA 2XCAA 5KFSA 1MU2A 1RT2B 4KGMA 1VC5A 2DR9A 4CH0S 2DB1A 4OIXA 2KVIA 4OHVA 4OV1A 5AE2A 5GAEI 5AXNA 4A8FA 3FNNA 4EATA 4X65C 3OV7A 4OZLA 3SQGA 3RB4A 1R7IA 2E29A 3DRPB 2LECA 1WH9A 2AWZA 2FD2A 4A47A 2D74B 1FUGA 3MZIA 3Q8SB 3AF6A 2CPJA 1NKEA 3I9ZA 3GSDA 5D78A 1GAOA 2IM1A 5AXKA 2O3DA 1N0UA 4M63A 2GIRA 5I42B 1UEVA 1URRA 1R3NA 1GTHA 3T5JA 4JI6C 3DRRA 5DLGA 2VPYB 1O5JA 4V19J 3V81A 4I2PB 1BWEA 5T8TA 3O6QA 4NOHA 4JM1A 3CCVS 2JFDA 3MFIA 5F0UA 2JSXA 2V4JB 3NBPB 5K14B 1SH3A 2VC1A 3M2UA 4ES2A 4OZNA 5DGAA 2KRRA 1B0VA 2HVZA 4IO1A 4CNYA 2CKWA 3DXSX 1H38A 1MSWD 2QW0X 4RNNA 4PUOA 2W9CB 2ZC4A 3IAM9 3P3DA 4TQRA 1MD9A 4GKJC 4RW4B 3VAHA 3CD5A 1VOMA 1Z1ZA 2R7QA 2WBMA 2UU9F 3B4DA 3RRHA 5HMWA 3LUYA 2XY5A 2WB1D 4ZS6A 4IG3B 1LXNA 2EPIA 1TL3B 2B4PA 2ZH6A 1N56A 1HNIB 3D0HE 1W2IA 4KTTA 4LFAF 3RAMA 3TQ1A 2Q43A 4RW4A 4QPTA 4JI0F 1FJCA 2W9CA 1GXTA 4B02A 1FKPA 3BGLA 5HO4A 2E1CA 2VG7A 4G1IA 2D1CA 1NJIT 5SUHA 4ZPWR 2KI2A 3G6VA 2F9JA 3E01A 1RT4B 1SJ3P 4OJGA 3K8WA 1XERA 1T5HX 5KFYA 1KQGB 2E5GA