5CZXA

Crystal structure of notch3 nrr in complex with 20358 fab
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
227
Chain Sequence
CPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHVIGSVVMLEIDNRLCLQNDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurogenic locus notch homolog protein 3
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 61
structure length 227
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5czxA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5czxA01
3ETOA 4ZLPA 2OO4A 5CZXA 5CZVA 3L95X
chains in the Genus database with same CATH superfamily
3DHXA 2VBZA 3AXMA 1R0CB 1LWXA 1RAFB 1Y7PA 4DR6C 4TVAB 1VYAA 3DLKB 4C3KA 3ZTPA 1FE0A 3KUGA 4LFCF 1UVIA 4GC7A 4WP8A 4YS2A 2LFVA 4HKQA 2DYAA 1DARA 2CWKA 2ZVIA 1AZSB 2JLGA 5F8HA 3JTOA 2DBBA 1WI6A 4ILMA 4LF1A 4GVBB 1WH9A 3W8PA 1VRTA 3KG4A 4F0MA 4DL5A 5BSTA 4MTNA 1H3DA 3CCRS 1JLBB 2OEMA 2GAHC 2J7WA 1ZOTA 1PO6A 3CD5A 2O66A 3CC4S 1KONA 4CTAA 1JKHB 5HVHA 4L76A 5KYVA 4DV4F 1NPRA 1U02A 1EGAA 3A8IA 4HACA 3RB0A 1PBAA 2YNGA 1NSAA 3IP0A 4Q2LA 3PACA 4WPAA 2CZVC 4WFBQ 5LSOA 1BWVA 2QYCA 4X62F 4ECZA 1LQ9A 4ERDA 1VC5A 3ZZZA 2GQQA 5K20B 3IO1A 3R3TA 1T9YA 4O3NA 1KOOA 3K2YA 4O0IA 4FYVB 1T9TA 1UVKA 4OI1A 2YWBA 5AJ3F 3V6DA 3EGZA 2V50A 1DLOB 3CJ0A 2BJ8A 2IRYA 4OYAA 4G65A 1EX8A 3D6HB 4ANCA 3D1QA 4ECQA 4G36A 5JVHQ 2RKIB 4F4YA 4USTA 1HL6A 3CC7S 4WCEQ 1U6FA 4B3TJ 4O23A 5D78A 3QSIA 2UUCC 2J9EA 4F8RA 2R8JA 2CXCA 4F2SA 3T6BA 1XMQJ 3TDEA 3H5XA 4CI0B 1RYSA 2WZ1A 3MM8B 2JEGA 2L9NA 4OZJA 1N36F 4ZVQB 2OFGX 3M32B 1I3OB 3R27A 4NL5A 5HMXA 1REVB 2HHXA 2DIUA 1KVJA 1RZMA 2C3OA 2Z57B 1DTTB 4M5HA 4RUCA 2U2FA 2VFSA 4C0BA 2X3GA 3UD5A 5K8FA 4TN2A 3PYEA 3NGSA 5A8RB 4D56A 4NOHA 1WDDA 2ADCA 3HVTA 4PYDA 2MZSA 4I68A 4NEYA 4PG8A 4QIFA 3HO1A 4ZOSA 4DPXA 1VS3A 3Q2TC 1X4AA 3UVJB 1SKUB 1SV5A 3MMCA 4ENOA 3W2VA 4J9VA 1QM4A 1YZ6A 3JAMU 5KAKA 4LRDA 1XNRJ 4JI7J 1L3SA 2ZNZA 3IM8A 1N34F 1IR2A 3FUYA 1U0HB 1K1SA 1NCLA 3W9IA 2MGZB 3MPUB 3M8PB 4NLQA 5A2QY 2VC1A 4B9SA 5KFAA 3V6JA 1RQ0A 4UOGA 2VKRA 1G2EA 5KFUA 4NOZA 2FHJA 4F0KA 3GPCA 2P8IA 1MXCA 1TUGB 3QZ8A 4XDCA 3TR5A 1EZZB 5CCLA 2NQPA 1MWZA 2UU9C 5AT1B 3CPWR 3N79A 1JLGA 5A0YA 2BJ9A 3J81j 2VSQA 2RH3A 5H1SV 4GXRA 3FKBA 4ZMMA 2FUG9 1YZ7A 1UA0A 2HHHF 1NU4A 4A48A 1A6LA 2LQ9A 3ZO7A 3FCCA 2VG5B 4JI1J 3MMBB 3EJMA 3VWSA 3IR7B 1MMNA 2ATLA 4DFKA 1M90T 1S0OA 3U1NA 2FJVA 2GIFA 1IBKF 5T7LA 3ZZPA 2J6TA 4UOFA 3DRXA 2CNNB 5H9FJ 1J27A 4Z2XA 3TRGA 3KLGB 4YMEA 3B7WA 5IT0A 2LXIA 2KT5A 2DGWA 1CJVA 3ADAC 4DX6A 4DR3C 1KQKA 4ZCIA 1S72S 1USPB 3BGRB 2ZBPA 1QVFR 1VQ9S 3TANA 3SSRA 1KLMB 3NWRA 3CCMS 3KUHA 4QW9A 1TR0A 1T3OA 2DR9A 3B54A 1GTEA 3OUYA 3WX4A 2DXDA 2H65B 2DNMA 1RA6A 1WF0A 3SXLA 4XTTA 2D74B 4NZ0A 4DR2C 1RTHA 3W5XA 1TH5A 3MECB 1E6YA 4DUYC 3ZZTA 3LP1B 2RHSB 2VV5A 3OL8A 4GXQA 4M8LA 2HBQB 2LMIA 2FIUA 1KTQA 2DITA 3OSNA 2CWXA 4RW7A 2J0WA 4Y2KA 3NNHA 2UXDC 2AYGA 2GHPA 2OP5A 3Q23A 5KT5A 4DFJA 4C11A 3UEBA 4ZPBA 1O9TA 2Z51A 2L9DA 3UI3A 2LQBA 2GC8A 3PIOQ 2D7SA 3L3CA 2CPJA 3A3NB 2DCLA 4N77A 2MQNA 4QR2A 3VVUA 3M05A 4DUZJ 2V2KA 2J9DA 1XN9A 4NA1A 1VEHA 2YY3A 4R25A 2KTQA 1S9GA 5CYQA 1IBLC 3H20A 1IN0A 1FRHA 3JQMA 3U1MA 3BKFA 4DN9A 2FD2A 4WYWA 2CA9A 4LF6F 2F3JA 3E01B 4DR1C 3T6JA 2C2ZB 4NXMF 3F0NA 3P8BB 1NJYA 2PMZD 3GIKA 2YKMB 2EFGA 3IS9A 4HR2A 2YNGB 1HR0J 1I94C 3IGVA 4C8KA 2DGVA 1K44A 4QCLA 4GKKC 3FMBA 2EW9A 4TU8A 1UA1A 3GE9A 4OYZA 1ZZFA 3FJ2A 1D9DA 1TVRB 4F2RA 4JYAF 1QE1B 2PIIA 5B0BA 4IKAA 2F4VJ 1HNVB 3ZTOA 4USUA 1SJRA 5LCIA 4FYDA 3V6DB 2X1BA 2EGTA 1SIZA 2N3LA 4I0WA 2VA3A 2F65A 3ENAA 3CO0P 4A8SA 1N32J 3NMAA 5MAOA 3UD3P 1K73T 1PSDA 2QLBB 2O3DA 3HZEA 1RAOA 2DISA 4QOTA 4FVMA 4YR3A 5IT9U 4GO5X 3MTJA 5U47A 5LMUC 3W9JA 4RW4A 2AJ0A 4LMZA 2HAIA 4RLFA 5L1LA 2QYGA 2YKPA 3E7WA 1YLXA 2BH1X 3DGVA 3UNGC 3EERA 2J8SA 4DR5C 5C42A 3G82A 4X64C 1GH8A 4RW8A 2AP6A 2QV6A 3AOCA 5J2MA 1F1BB 5L1KA 3CJRA 5HO4A 4K4YA 1S6PB 3PIPQ 4DFMA 2Y1RI 2DNKA 3DOKB 5LMNJ 4LF4C 3G4SS 1V5VA 4UQTA 3C5EA 3D54A 5A2QU 1RTZA 2L41A 4Y2CA 2O1PA 1FJGC 1NH7A 2M7SA 4HPVA 3GFHA 3LQVA 2MKYA 4V19J 3Q2SC 4ZPVR 1JLFA 3U27A 2HGLA 4QZVB 2YX7A 1XMQF 3A9UA 3ZZUA 2QA4G 3LGHA 3L7UA 4KYZA 4OJ3A 4BLGA 3LP0A 3VAHA 2A2DA 1T05B 3NGUA 3BO3A 4DBQA 3PM9A 1UAWA 2NREA 4I7FA 4JB8B 1BLUA 4N8NA 5DLFA 4JI3F 1UMJA 1RBLA 3K17A 2HHVA 3VNRA 2VF3A 1MG7A 1QSLA 4P7VA 3M8SA 2ZFHA 3HHLD 2VPWB 4DR4C 2Z58B 3PZPA 2BBEA 4C8MA 4DV5F 1RWNB 2WD9A 1IKXA 4DV2J 2GS8A 2EC2A 2SXLA 3NL0A 2ZOGA 4D4GA 5K9FA 2UZAA 4H4KC 1PAUB 4CLYA 2UVRA 5E5NA 2MZTA 3RRGA 1XNRF 4JI7F 1U2FA 3NS6A 4ZJLA 1OYEA 5SUHA 5BR8C 2OPPB 1WG4A 1E6VA 4KKOA 3GONA 3QSYB 1T9WA 5K8OA 2GGPA 4I6WA 3UX3A 2F8HA 3E2EA 3MOZA 1TV6A 2UP1A 2EK6A 4JV1A 3T3FA 2DHSA 1HBOA 5MLCV 2DH8A 1P1TA 2DD8S 5D4PA 2MMYA 2NCKL 3EGVA 2XULA 5A8KA 1Q0NA 2IJRA 2YX4A 2E1MC 1FNOA 3CWJA 4LVOP 1CQNA 2NUHA 4IDKB 2M3DA 3LNOA 2J0SD 2VFRA 3VGTA 5SZTA 1SQGA 3CTRA 3D9BA 1DY3A 4X4PA 1VHFA 4BSZA 2PN2A 4TLQA 3D1HA 4Y0FA 1R8CA 4KAIA 1V3ZA 2CG8A 4NI2B 3E51A 2YKNB 1TKZA 4WXWA 1HI8A 2FHJD 3DRYA 2KVIA 3NS5A 1I5OB 4IH5A 1PG3A 4QYZK 4ID5A 2RF2A 1RTIA 2E5LC 2IBKA 3CCWA 3CNQP 4CLFA 4F3MA 2IJNA 3C14A 3GCWP 1Q4RA 1TKDA 4OZ3A 2VQEJ 4CO3A 1XS3A 2ZD1B 4OHVA 1WCJA 3VGVA 3KJVB 4LF7J 4CWBA 4LSNB 4J9LA 4KSEB 1E6YB 2IC3A 1DRZA 2ONFA 2EBEA 3CO9A 3JYTB 3KXWA 5KG4A 1F3VA 3ZTQA 3CD7A 4L4QA 3T19A 4I64A 1RDRA 2HIQA 1S79A 3BGFA 1KP6A 1P27B 4X4RA 2XWXA 1HNIB 2J0XA 5K14A 1GXTA 4QWBA 4TQRA 2IM0A 4Y00A 1VBKA 1M5VC 4ZIVA 2E7WA 4DF8A 1U48A 2AF6A 2OO4A 3H0PA 2JJ4D 2ABYA 4B3SC 1RISA 2JLEA 3QT6A 2V0NA 2ZH4A 4PZVA 4ZLJA 4AUKA 2B4UA 2QL7B 1WSRA 4J9PA 4OJGA 2QLFB 1K0TA 2FLLA 1RT1A 3SMZA 4ZJOA 2XO6A 1F6TA 3PCOB 3TAMA 3W60A 3MAQA 3FGVA 5KT2A 5DG9A 3CD6S 1KQGB 2QFJA 1UVLA 5ETTA 5F8JA 3KG1A 3W1YC 4G37A 2VQFC 1F0XA 1IR0A 4IUFA 4TU7A 2KL8A 1VQ6S 2Q6BA 4NLYA 4M63A 4OZ2A 2CXEA 4OYPA 1TKXB 4QYRA 1N48A 1S48A 3W64A 1HNZJ 1RCOB 1D9FA 1AFJA 3LGMA 3K58A 2CNOB 2ZZMA 3EMTA 4YR0A 3VAJA 3IG1B 4DSFA 4F4KA 1KS2A 2C2KB 1SKRA 4ZVEA 1YIJS 3NCRA 3Q8RB 2JLFA 3GG1A 2WVDA 2HPUA 5I42A 1HH2P 2OI2A 3H8YA 1HR0F 2QTWA 4IFYB 2UUAJ 4H54A 3WC2A 4AQYJ 5H9UA 2H51B 4DX8H 3I32A 3DYAA 1SBRA 4RU9A 3KTQA 1RT6B 2JHEA 2P2QA 2R7XA 2R2SA 2R7VA 2F5GA 4DV7J 4JI5C 4RW9B 5B0AA 3PW4A 1NK0A 2HYIB 1MDFA 1T9XA 4ZLPA 2DNGA 3IAM9 1UTAA 1D3WA 1H2UX 1UFLA 4CT8A 2CQ3A 4O4GA 2VJVA 2FY8A 3F44A 1QUVA 1RAJA 2CQDA 3SYZA 2UUCF 2A0FB 1JJCB 1IUJA 1FKPA 3DOMB 2XMTA 3TI0A 1LKZA 4P6QA 3NGTA 2WONA 2YX1A 1W7WA 1TL4A 2KM8C 3SQGA 3PROC 1HPZA 2PEBA 2JH3A 4OX6A 2AJFE 1HI1A 2KT2A 1HIYA 3AT1B 1X0FA 4QW8A 4JI6J 1N0VC 3KLIA 4ZPTR 3VNQA 2FJEB 3VQTA 2N7YA 3D6FB 2IIHA 2KI2A 2YWKA 2HS4A 3MM7B 3PEJA 2FPHX 4LFBF 1R8BA 2HFZA 4ZK7M 2VBWA 1N4LA 3PYGA 3CMAS 3HXMA 1WC6A 2QFIA 1C1BA 3G6YA 3C6UA 2EFOA 1S1TB 1PGZA 3GR1A 1FJCA 1NSPA 5DRKA 4LIWA 1S59A 3PV8A 1S6QB 4CLKA 1NHKL 3T5LA 5H9EJ 5F3TA 4F4ZA 1RT3B 1TMJA 2QLWA 4X84A 1JXVA 4F3OA 4QR0A 5JXSA 4P52A 1MROB 4U6PA 1F2GA 4RUHA 3UCGA 1M5SA 2O01C 3EGNA 3B4MA 3NI2A 2F9JA 4B9NA 1RBAA 1RTJA 2VBYA 1ITPA 1HHTP 4DX7A 3MR2A 2OPLB 4DX5A 2QG9B 3LOUA 4JBCA 1MXBA 1NDKA 5J1NA 2RAQA 1N33C 1VJWA 1FNMA 2GGPB 5THWA 4K0BA 2FLNA 4D57A 1WC4A 5HMZA 2XZTB 2OSRA 1TL1A 4USMA 2OHDA 2ZHAA 1U1NA 1KRPA 2UUWA 3OR2A 2N82B 1T95A 2G2ZA 3G71S 4IRKA 3I31A 3NXZA 1FCAA 3HP6A 3CJ8A 5KFKA 4B9VA 2ASBA 2DH9A 2BM0A 1B7YB 2JVRA 2J0QD 5F41A 5KT3A 4NLOA 4U7UD 4DV1J 5A19A 2P6SA 3UQSA 4ES3A 5LJ5Y 2OKQA 1JLQB 4IO1A 3CXCR 4IQMA 4OHZA 1V9OA 1RSCA 1UKKA 1RTIB 4RNFA 1BGXT 3BBCA 3K0JA 5E3PA 2BANA 4QIGA 5CZVA 2GFFA 2B7BB 5KG5A 2GO8A 1VBZA 1AB8A 1FWLA 4LF8J 2VL1A 5HN0A 4C98A 2R42A 3MEEA 2DR5A 1Q81T 1AXQA 2WSEC 2CAJA 4QIEA 1YJNS 3W8GA 5IT9D 1JOSA 1GQEA 2ZKTA 2GMJA 4CYUB 4HT7A 4MIBA 4LRAA 1HQUA 3M30A 1EJ7L 3WIVA 3G9CA 3P4UB 2B9XA 2OPRB 2ACYA 2YPYA 3TJAA 4JI0C 4FYYB 5F9NA 4DPOA 4Q7AA 1U8WA 3M2RA 3PYFA 3IBWA 3SIPB 2KXNB 2XC9A 3IEVA 4DR2F 1TL7B 1H7XA 3FFIA 4G1PA 4FZVA 4DUYF 5HJXA 2ASDA 5ETLA 4DPUA 2NPFA 4CO2A 5FIIA 3LP2B 4OX8A 2VQEF 3ULHA 4FTFA 1T5HX 3RU0A 2UXCC 4ED6A 1S12A 4ID8A 1L3KA 2DNQA 2UUBC 2JMPA 2E5HA 1WOOA 3DOLA 1S5ZA 1D09B 1VQMS 3RB3A 1S1XB 5DGBA 1MLAA 1LW0A 2W9BA 3PHEA 4A47A 5GADI 3PRDA 2FDNA 4FUTA 2QVXX 2EVZA 5KFEA 4D4IA 4LRBA 1CG2A 3PW5A 3TNVA 1RT5B 2NXUA 1DFDA 3P96A 2O5DA 2ALYB 3HFVA 4DR1F 1NMEB 1HBMB 1ZM2A 3NGDA 1NH8A 1OSCA 4AE5A 3D0HE 3R7BB 4B9UA 3LUSA 1NPKA 3TZYA 5A1GA 2P20A 3QZ7A 2NXJA 3TARA 5CHCB 1TK5A 2IM1A 1YSJA 2YWFA 2HWTA 1M5HA 4I2QA 3WBZA 1UVJA 2BR0A 4OLOA 4AL7A 4EATA 4ZIWA 5IXUA 4F36A 2R7QA 4N47A 2Y4NA 3EUNA 3G6ES 1KSPA 2ZH6A 2P5VA 1DQ9A 1Z2ZA 4OX9C 4DR6J 2X1AA 2HFOA 3SV3A 2ZOFA 3QRQA 2AGPA 3THPA 2D1QA 2D9PA 3OL6A 4K0KJ 4DI6A 3UDVA 3D3CJ 5J2QA 3IWLA 5KFVA 2GNKA 2XMMA 2BKPA 4ECSA 4IG0A 1Q8IA 1OY9A 1QVGR 1M5KC 1WOPA 1S1UB 2CJYB 1CULA 4KHPC 1KTVA 3W65A 4YY3F 2HQFA 4MK9A 1FKPB 4HHJA 3OLAA 3TAQA 2K1RA 3MFHA 8AT1B 4ZVHA 3BKTA 1Q8BA 1S4EA 4ZCMA 2UUAF 3UO0A 1RWUA 1C0UA 5HLFB 3W2WB 1N6QA 1V6HA 5DETA 1CQMA 1P9YA 2UXBC 1HBNA 1NHVA 1PBUA 1UJ4A 5H9FK 4R8UA 2MKIA 1JQGA 3VGSA 2KZZA 2QA1A 3EE3A 1LK5A 1HNXF 5I3PA 3POTA 1RT7B 3J81U 1FJGF 1J5EC 1LFPA 3P3DA 1RWOB 3CE8A 1FVSA 3ITHB 5LXRA 1SJFA 2DXFA 4YHHC 2E5GA 4Q45A 3R5GA 4RBUA 2R7UA 3CDUA 4PUOA 2ZE2B 5DJBA 3DLJA 3FZBA 3BKUA 2BKOA 2EEYA 4ETZA 1B4SA 1IXKA 3TUFA 4NXNC 4EI2A 2OSQA 2CKWA 2WRMA 4USHA 3ISNC 4GO7X 4OYMA 2GV1A 1Q5VA 4C97A 1Y3KA 1JLEA 3M2UA 4R0EA 3TP2A 3CDWA 1MD9A 2E9TA 3T41A 3GQCA 1W2IA 4USJC 2BUNA 4FBTA 3UDCA 1FEEA 2DPJA 2AKWB 3I5BA 4S0MA 4NPOA 4PG6A 3VZIA 5I3QA 2UVUA 3TX0A 5DDPC 3FMWA 2P02A 4DQPA 3DLEA 2QL5B 5KFPA 2RIJA 2CZ9A 3R6LB 2DGOA 3MM5A 3KUEA 1TKTA 1JB0C 3I56S 1RT2A 1FKOA 4FXDA 5BUSA 5C2GA 3RGIA 3SCIE 2ROPA 2V8HA 2EI5A 2QEXS 2YWGA 2MSTA 1ZAWA 1D8YA 1V25A 3KLFA 1B70B 1RE1B 3HHLB 1XNQC 1HWJA 3M1VA 4DPYA 1S97A 5GMEA 2GIRA 5BR8F 4LE5A 2EG1A 3Q8VA 3H5YA 1X4EA 5IWAC 5KOXA 5FLXU 3GV5B 5G0RB 4Q5VA 2A2CA 2YNIB 2PE8A 4C3LA 4DL3A 2HWIA 4IH6A 5K8NA 2ZHOA 3CCVS 3AODA 3O8WA 2OPQA 3I55S 1TQLA 3UNYA 1ZPVA 5DDRC 3UCZP 4X65J 2LQJA 4ZPDA 4DQQA 1T03B 1K0VA 4EWTA 4J9SA 1VQPS 1GAOA 1YJ7A 5G4DA 2B4PA 5F8MA 2FVRA 1BQNA 4NZ6A 2Y8YA 3IPLA 2EFNA 1WHXA 2KZFA 1GMUA 3J7Z5 1WC3A 2YKQA 2EG2A 4U9RA 1YBTA 3DAYA 5KYTA 4KHMA 4P10A 1SC3B 4ZVOB 5HAOA 5CH7B 1YI2S 2XYGB 4O3RA 3CW2C 4L74A 2H5JB 3RBDA 5IFIA 1K1QA 4U7UK 2DEJA 2C2RA 1MWYA 3BQ0A 1HQUB 1HKAA 4C9DA 3OXFA 4ZVTB 2G4BA 4MIAA 3DLGB 1R0BG 4IOCQ 2AX0A 1RCXB 6FD1A 4DR7J 4B3RJ 4PRFA 3IA0A 4F02A 1KKHA 3NGRA 4QR1A 4LFCC 8RUCA 3N2QA 2E0GA 4M5DB 4LQ3A 1IKVB 3MPYA 1HBUA 4FNIA 2AMCB 1N2FA 3W62A 4RM2A 1S9EB 4WFNQ 4LF8F 4Y6IA 4N76A 2J76E 3S7RA 1X7VA 2FZKB 5D0HA 4URQU 1ZS6A 5F0UA 3CCSS 4U96A 1K9MT 3AJ2A 1H74A 4NCAA 4FUQA 3QJJA 3G8SA 2W9BB 2OD6A 3I9V9 3ENVA 1HI0P 1N5YA 1HNWC 3KJQB 2V7BA 4FVCA 1PYTA 4DV4C 2A6MA 3D7SB 4IO9Q 4Q8FA 2XO7A 4MKAA 1NJWA 3SSQA 2NCLA 4C0OC 4X62C 2KFYA 4UTGA 4LUBA 2J7UA 4RPFA 1I51B 3IRXB 2BQUA 1LWFB 4P2MA 1AROP 2HVIA 3HF5A 4ATNA 3IFEA 4ES1A 3KLEA 3JQKA 1QLNA 4WV3A 2VQFF 4DJBA 1YKWA 3BSAA 3N5BA 2ZJQQ 1QAIA 4I2QB 2KG0A 4FF2A 1XC9A 3PJXA 4R5PB 3A13A 2PSZA 3LWLA 2P9CA 3AF5A 4DSKA 3V4IB 2XMUA 3WIUA 4A4JA 4J9KA 3OFEA 1BA3A 4FS2A 2XCPA 3EDRB 4ISBA 3AB2B 3QWPA 5CCMA 1Q53A 4ECTA 5AXMA 1NSQA 3DMJA 2XLJA 2FJDB 2UXDJ 2HBZB 3GIMA 4I9GA 4MKBA 3QIPB 2MY8A 4O3QA 3F73A 3M9OB 1OPIA 3M2VA 2IAJA 3TR3A 2E1CA 4Q44A 2OTJS 5J2NA 3KK3A 4DOZA 3CCUS 3BO2A 1KKGA 3MEDA 1Y10A 2AV5A 3JXOA 3R6GB 5C24A 3MEGA 2Z30B 2F40A 2FC8A 4IH7A 2QZ8A 4WFYA 3KK1A 2HK3A 5A8WB 2HNDB 3I82A 2XMJA 1KQFB 3M6XA 3GKUA 1WKKA 4DWIA 2RD5C 1NXIA 3TJ8A 4R8UB 4GKKJ 1TTHB 5IV4A 3W3SA 3Q8QB 4F25A 4WIIA 2OBVA 4P2XA 5JUMA 2GVDB 3B8HA 4WBFA 2HJGA 3R5AA 4I6YA 3VAMA 2WOMA 2BJ1A 4QPTA 1N34C 2OH2A 2R4FA 2E5JA 1GXLA 2LXFA 4OYIA 2D28C 4HYKA 4ECUA 1S7IA 2WBMA 4DV3C 4OYOA 1HYSA 4M5NA 1VQ7S 4KQZA 2Y0BB 2ZJPQ 2BKNA 2PEHA 3KLHA 2J6UA 2BABA 3QFWA 1JLEB 1U24A 4B3OA 1FNXH 3CB4A 3AB4B 3VF0B 2BQRA 2W2MP 2L9WA 4I4BA 5LMUJ 2BE7D 3BS9A 3TQEA 1C0TB 1Y5IB 5J1EA 2CJBA 3G8QA 2OPSB 3PVXA 2E9RX 4TY8A 3OTDA 3KWMA 5DQGA 2L3MA 5KT7A 4KFBB 1TKTB 3SSSA 2C3YA 4JUZA 5LJ3Y 5D6GA 4FF4A 3N0VA 4ILLA 5C2CA 4HTJA 3MPVA 5DQIA 2XY5A 2HRUA 1TFWA 2A18A 4H4MA 1M6XA 2FC9A 3C6TB 3MFIA 1S6UA 1AT1B 3JSMA 2ZHBA 4LF4J 4NA3A 1FX4A 1JLCA 4NRUA 2DYJA 2YBVA 1N33F 1ACMB 4DQRA 3QATA 1IBKC 5HBMB 1FWPA 2FJBB 1KQSR 3BGOP 1ZETA 5E3CA 2HZCA 1X4BA 3TUPA 1UL3A 2F7VA 3BEGB 5E0OA 1S7HA 2G2OA 2HQCA 4KV8A 1EHWA 1HQEA 2F1FA 1RTDA 4EBDA 4OZ0A 3M6WA 1Q78A 4K4TA 5E33A 4C8OA 3BSOA 4PEOA 4ZP9A 3JSYA 2BACA 2ZUGA 3PESA 1KHVA 3EZ5A 2UVVA 3OR1B 1TZ0A 3CMQA 3FBCA 4P7TA 3AJ1A 5CZXA 2CQBA 3GILA 1LW2A 5C7PA 3NBPA 2HIYA 4CM2A 3DRSA 2XZDB 2DNNA 2B51A 3X1LB 1YTYA 2MLZA 3EXCX 1RHKB 1FDAA 4LRCA 2E1RA 3ZFVA 4HTIA 3IGNA 2J7KA 3FCWA 1FK9A 2FTRA 2R2RA 1JJ2R 4DG9A 1EETA 4XPEA 1J5OB 2DJWA 1FWKA 3UWTA 3AQOA 4DHVA 3IRWP 5D4NA 4ZLLA 5EX0A 4ZHRB 3FCEA 2FVCA 1S4FA 4PPZA 2V2ZA 4PWDA 2ATCB 1ZTTA 4UF4A 3H59A 2B6AB 1DHMA 3HVWA 2G1HA 4GRSA 2DVIA 4JI0F 5IM0A 2N3OA 1X4CA 1RHUB 4J90A 4WE1B 5CXTA 4X4UA 3MWBA 4DU7A 3DLKA 2JOQA 3LANA 4PKDB 4FPIA 2C22A 3QIDA 3OVBA 4WFXA 1TK0A 2MTLA 2P6TA 3VAFA 1X5TA 2CRLA 4LF6C 5A76A 4JI2C 3R9XA 3A4IA 4PQAA 4Q2MA 4RU2A 3R8YA 2UXCF 2YPZA 1AZSA 4FYWB 4RUAA 4DR7F 3J81D 1OY6A 2XTJP 3THVA 3GIJA 4OI0A 3CCES 3ZZYA 1BC6A 4GVBA 1WF3A 1FKAF 5IS2A 4YB6A 5J2PB 1JLBA 3HHLC 3VVTA 2ATWA 4ELUA 3QRPA 4URGA 1KD1T 2E5LJ 3CW8X 1SJQA 5JRHA 3TUJC 1JKHA 2LU1A 2DGTA 2IVYA 2GIQA 1BY9A 1B0TA 5DV9A 2JC1A 3TAPA 3SCKE 1JXLA 4WP9A 3HHEA 4GKJJ 4Y3CA 3QNWB 3V6KA 3IBCB 4UY85 3CDAA 1H2VZ 3LF0A 1N56A 5HQLA 2D1CA 2VG7B 4HHUA 4PXEA 5LM7E 1NYEA 4WXOA 1L2FA 2QLXA 4UW2A 2MZ1A 1NO8A 4USVA 3DMJB 2CJXB 5ETOA 4CO5A 2EPIA 4LBPA 2VIHA 2HFVA 2YTCA 1DLOA 1B0PA 3W9HA 1SQFA 1TUWA 3QT7A 4JI4J 3O44A 5KFDA 5KG0A 2RKIA 1WORA 4DFPA 3HSGA 1EIYB 3QJLA 1FRMA 4MIWA 1NSKL 3KXDA 4ZA1A 2ROGA 4KIAA 4DL6A 4KHPF 1F9EB 2HZAA 1HWIA 3BN4A 2RILA 3M32A 2DHXA 3TQ1A 1REVA 1GNKA 2I38A 4JM1A 2DY9A 1XMQC 2KKHA 4RNMA 3GB0A 1VMBA 1RABB 4LBIA 2ERRA 2V2QA 5HL7Q 2DK2A 2KRRA 5A8RA 4C4WA 4Y65A 1ULTA 1P1LA 2UXBF 2WW4A 1NDCA 3OTOJ 1RKIA 5AXLA 4RZRA 4OI3A 2Z2YB 4PCQA 3UVJA 3ZZ0A 1XR6A 3M6UA 1JXEA 3UW1A 4F04B 2X51A 3IWXA 2MZJA 3ET6B 2HGNA 1TU0B 2CADA 2ZBQA 2R9LA 4KH0B 4OYWA 5E41A 1MKYA 1FESA 4ED4A 3A3OB 2XMAA 1LXJA 3FSYA 1FJEB 1FF2A 2PROA 1U0HA 2RS2A 3KHHA 2XY6A 2MGZA 2XNRA 4JI5J 3M8PA 1XNRC 1ML8A 2R7SA 4NXNF 4JI7C 3DN9A 2V4RA 3EZOA 3PRVA 5HMWA 1UZDA 3H25A 5CD4H 3ONQA 3A12A 1H6KX 4TLRA 3R2CJ 4IG3B 4NEZA 3JAMY 3K6RA 1OPZA 4RVOA 1VLAA 4FKYA 2OD4A 1VC0A 4AT1B 5LXYA 4K2JA 2J9DE 2LQ8A 3AD8C 4BC7A 1WHWA 4UT4A 1DURA 2IM3A 2I5JB 3T1YJ 5KFTA 4N8OA 1OIAA 3NEKA 3BN7A 2D69A 2VB6A 2CQHA 2PDAA 5IFMA 1FXRA 1HQEB 1FFGB 2VG5A 3I5AA 3MMBA 1VJQA 3CJKB 2JEFA 2HLUA 1RXOB 4C7QA 3K8WA 2XSJB 1APSA 2DHHA 2I0XA 2QMUB 4N7TA 2KZMA 2BJ7A 4ED8A 4OLPA 2LEBA 4JV0A 3HPOA 5C25B 1KFSA 2CPIA 4LSLB 3GLJA 5HANA 2XM3A 3KLGA 4J9OA 5CD4A 3HVAA 4FDFA 2KN4A 2R7TA 2BW2A 1MW7A 2L08A 2BJDA 1DZ5A 5BUQA 1VRQC 3SI8A 4K7QA 1USPA 3BGRA 3WX8A 2FHKA 1EETB 2AJ2A 2GJIA 3BB5A 9RUBA 4JV5J 2IPOB 3QWUA 2NZCA 2LEPA 1Q7LB 2RVJA 3PYDA 2RNEA 2CNKB 3R1HA 4OV1A 4RX6A 4YB5A 5B0EA 4XDDA 3VAKA 4HI2A 2KVQE 2IDLA 4P75A 3O2IA 4M5MA 4KB7A 4G1IA 3QGHA 2XS7A 1UZHA 2NS1B 1S6OA 3LP1A 4NLGA 3DCAA 4ZLNA 1VK8A 1RAAB 2AT1B 4EZ6A 3KK2B 4LF5J 2LDIA 5DM6Q 4USIA 3ZXWA 2W4DA 4P73A 1IKYB 5B7WA 1Y3JA 2QVZX 5A6PA 2HLTA 4ZVFA 5D0RA 4LF9J 3HLUA 5KFHA 2QT7A 2ZKUA 4ALZA 1CLFA 2PA8D 2OIHA 2NR0A 1ZAVA 2GHVC 3W5ZA 1F3FA 5J1PA 2ACMA 3ETCA 4LR9A 3GYNA 2F8MA 5KFFA 1FVQA 4F26A 1MN9A 1VISA 4ED3A 2G0IA 1GMWA 1TP7A 1S0MA 2HRYA 2DNHA 2EFQA 2KJWA 3CJ4A 2JFDA 4K2XA 3E01A 4ZJZA 1HNWF 3CJQA 3K89A 2GO9A 4DUZC 1OQ3A 2YKMA 3LPEA 1R6YA 3LAMA 3DGPB 2G1DA 1F5CA 3PW2A 1UJ6A 4U8VA 1KFDA 3T1HJ 2XEXA 4KPCA 3CDEA 4DSLA 3J80D 1WC1A 3CEDA 2Y3YA 2M8HA 1TVRA 1IBCB 2G0CA 1QTMA 1RWKB 3J7ZT 2CVIA 2VBXA 4NYZA 1HR0C 1QE1A 5B08A 4YP3A 1HNVA 2ADBA 3MR7A 4WKRA 3C3LA 3NYQA 3VAIA 3EVOA 3ZZRA 2Y27A 2ZUAA 1BD6A 1JIHA 3TZXA 3PNIA 4EEYA 1JJHA 1FLOA 3AFGA 1ZZNA 3LGNA 2V63A 2N4CA 1VIXA 4DPTA 3C16B 4K5RA 4WTOB 2HHTA 1YHQS 4CLPA 4BS2A 5CYMB 1RGVA 5DDOC 4GKJF 4Y2MA 2EKYA 2ZM6J 1EB0A 4M95A 3MUMP 3CC2S 3NNAA 3GV7B 3PX6A 1P4EC 4B9LA 4CLZA 3NG8A 1YDLA 1UWDA 4QJVA 1QD1A 5E3QA 2CQ0A 4QBUA 3FSXA 3RRKA 1SQEA 4G6VB 4I1TA 3G86A 1UJ5A 3HSZA 4HHHA 2D3UA 5EWFA 1RJJA 2MM9A 1S6PA 4TU9A 3CCJS 5D8HB 4AYBD 3ZZOA 4DMZA 2LVWA 3K5MA 2GCFA 4WU2A 3DOKA 2R7RA 4LFBC 3G87A 4JI4F 1FUGA 4ED5A 1OJ4A 4PHTA 1N0UA 2JC0A 2P9GA 5JVGQ 5IT9Y 4V19X 1FRIA 4NCBA 1IWGA 3Q8SB 3KMSA 1DQAA 3MAAA 2BJ3A 2GVZB 2VDIA 5LMNC 2YWWA 3EICA 4WKYA 1XMOJ 1FD8A 1UFWA 2HSEB 5LT5A 3QAEA 1T05A 1U1OA 3R9LA 3OTEA 2RQKA 1DTQB 2P2JA 2AYBA 1S1WB 3QGIA 1O51A 1X5SA 4XIUA 4ZPWR 2BRKA 4DV3F 4ZN3A 5D77A 2JWNA 2H48B 2Y0SD 2ALZA 4ZDNA 5E7QA 1D9AA 4CLSA 2PI4A 2MQQA 4I2PB 5KFIA 4W4MA 2QVYX 1FHTA 3D6MB 3OFHA 3OTOF 4OMFG 1MSWD 2HBYB 2WB4A 5KFBA 2YVSA 1IB8A 2H54B 2CPXA 4C8YA 4K4SA 5HATA 1JNRB 2FZCB 4J5OA 5B0GA 2GMHA 3N54B 3IMLA 1LQLA 1VCTA 4NYOA 3S1TA 5EWGA 1CJKB 1IJEB 4UUWA 2LU2A 2OPPA 3UD4P 1SUQB 3R7NB 3FC9A 3MZIA 2WW8A 2GAGC 5GAHU 4C2MA 1XQIA 2MQOA 3LW5C 2IRXA 3LNVA 5L38A 3QJPA 5KG6A 3ZC4A 1S0NA 3H40A 2QL9B 3EM1A 2MCQA 1LWEB 4EUVA 3LAXA 4IDKA 1M5PC 4YHHJ 5D4LA 3BPSP 4L2ZA 2BE2B 5BSWA 4NE9C 1VRUB 4NI2A 3Q8PB 3R7SB 3T1YF 2JSXA 2YKNA 3VZHA 2WVFA 4U8YA 1VQKS 1BXNA 1NK7A 5IC4B 2COLA 3OVAA 2ASYA 2I2YA 3N6MA 4CDIA 4B3MJ 1KWMA 2GZOA 3DDNA 4OHWA 3W7BA 2CVEA 3FRZA 4OZLA 4DSIA 5T8TA 4ECVA 2C2OB 2XHWA 2IBOA 2R8HA 1O0PA 2ZD1A 2NYHA 4PROC 3KJVA 2WSFC 2DHMA 2JX2A 5IT4A 4LSNA 3K59A 2VHGA 3JYTA 1KOHA 4ES2A 2VQEC 2KM8B 1KR4A 1CPZA 3V81B 2WHOA 1XNQJ 2VZ9A 4P2FA 3W61A 1FFSB 2XCAA 1HNIA 4A8OA 3H2LA 3PX4A 4WIQA 4M5KA 1GT8A 4JV5F 1ZM9A 1XERA 3FK4A 1A0OB 1LXNA 2HNZB 3DXSX 2CJAA 2H9ZA 1O5JA 3QT5A 2Y9HA 3DDIA 2PI5A 5HP1B 1R0AB 2XYPB 1WDTA 1SL2A 3FBEA 4CT9A 2C1EB 2CDRB 1T94A 5KFGA 2IDEA 1IWAA 5AXKA 1RY2A 1T02A 4B9MA 5ETMA 2KDNA 4JI2F 3LWMA 5D15A 1XBWA 3LO3A 1V5IB 4LF5F 4DLGA 3MOJB 4MKYA 5BYQA 1WEXA 2P2BA 3L4BC 3MCOA 3ISZA 1CJTB 4NASA 1NUEA 3RYLA 2OELA 1SPBP 9ATCB 2M2BA 1YGYA 2V94A 2QW0X 3TW0A 3NKYA 3SEOA 4DV0J 1EQMA 5IZHA 2X3DA 4KGXB 4USKA 4M5GA 3VR1A 1TKXA 4E2FB 2IY5B 5ADZA 3VQSA 4TYAA 2VG6B 4RW6B 5LOQA 5HVFA 2MKCA 4P72A 1N5VA 3JSRA 2MPUA 4LFCJ 4RWWA 3IG1A 3O3LA 2DPIA 1R89A 3ENQA 4WJBA 1X0PA 3D0GE 2FQQB 1IKWB 1UWAA 4P9SA 3CIZA 1HNZC 4IFYA 5DO2A 4YY3C 3P5TL 3T1HF 3DM2B 2CQPA 3C15B 2HRTA 3PHTA 2IJFA 1RT6A 1SH2A 2K7KA 3VCDA 2WVCA 1Q86T 1O8BA 4I6AA 1Y4ZB 3TYTA 2Z56B 4RW9A 2NZ4A 3K8VA 2ZDPA 1GMWD 2UUAC 4KJIA 5K8PA 1A7GE 2QIFA 2KT3A 2WVEA 1WACA 2HMIB 4DV4J 5GAEU 2ROEA 2D7VA 2RUGA 4CO4A 3DOMA 3ILJA 1TELA 2AEFA 4OYXA 2NSBA 1XHJA 4QWCA 1HNXC 2QSFA 2HVEA 2GQ2A 5AE3A 2DRBA 4B3TF 3V2UC 4YOEA 3MAAB 1R8HA 1JNZB 3A3PB 2AGQA 3MXHP 4ZP8A 3RW7A 4ZVSB 2A1BA 1HQ2A 5AJ3J 3MM7A 2BJEA 2D3O1 4LIRA 4IR1A 4OL8A 5KG3A 2YQ1A 4JI6C 2MKSA 1WD6A 2EKNA 2I1RA 2QJ3A 5E3RA 5DGAA 3AQPA 4X66J 3SQOP 2W2PP 2HW3A 5BYRA 2W8KA 8ATCB 1Y5NB 1S1TA 2B9EA 5KFOA 1QDUB 4UY8T 2B8PA 5GADU 4YB7A 1S6QA 3PRBA 1MMDA 3UR0A 1N36J 3DRRB 1S57A 2J8AA 1ZBTA 3J7A1 4MT1A 1DQ8A 5L46A 1RT3A 1WF2A 5HJYA 2MY7A 2Z0GA 2PMWA 3NAHA 5KT4A 4WYLA 3C19A 1UW9A 5GTDA 2ZH8A 4J7CA 1MROA 4LFAJ 4ZJQA 2V68A 2GX8A 1YG0A 2IYGA 5HQMA 3OJUA 3QO9B 1F9FA 2LECA 4URSA 4UZCA 4WZQA 2OPLA 1NJXA 1NAQA 3QLHB 3MI7X 3G7SA 1TK8A 2XZWA 3BR8A 1HW8A 2DNZA 3L7PA 3P5BP 3GZ7A 1HD0A 5FJ4A 1DJ0A 1YRUA 1WTBA 4DV6J 1YITS 4DU8A 3TUIC 1TMMA 4QU6A 4GMKA 2Q66A 5FDLA 6FDRA 1N34J 4CZCA 1HHSA 3N6NA 3K5NA 3DLLQ 1U4BA 3JQJA 1HMVB 3R5CA 2QX0A 5B0FA 4YR2A 3EVMA 2GHWA 2LEAA 3HKWA 1FXDA 2DGSA 3H7HB 1JLQA 4JI1F 1M1HA 3HT3A 2GJ2A 4LSZB 3WDOA 4DV1C 1Y9OA 3A25A 3HK2A 1MU2A 3A9VA 3DDKA 1YJRA 5KTQA 2RQMA 2AYMA 4ICLB 3TA2A 2V5HG 2XMWA 2HFSA 3R9WA 2V8GA 1FDBA 1VK3A 4KGZB 4FN5A 2HHHJ 5KOWA 3L95X 2AX1A 4CYUA 2AJ1A 1RP5A 1OS5A 4P2SA 5CQGA 1TL3B 4A8YA 2OPRA 4LF8C 4NA2A 1RLDA 3BH7B 3OVSA 2C3UA 1R6VA 5KFRA 4B3MF 3L7OA 2JNJA 2HWHA 2VFUA 1HARA 4CO1A 1TL7A 4O3OA 2CJKA 2HNYB 3MMAB 3GJTB 3KHGA 3BYRA 2F9DA 2CPEA 4CCHA 4FXVA 2VONA 2LCWA 3LP2A 4C0HA 2IMOA 4PAAA 2LA4A 1R7IA 3QYYA 1BQMB 2X1GA 5K85A 3VV2B 1RU2A 1MMLA 4EO6A 3EYZA 3A8JA 4J9MA 1I1GA 3FEYB 1PJ5A 1XRBA 3HHNB 2D3OR 2Y1LB 1PYSB 2C28A 4IR9A 2Q79A 2M0GB 3CSKA 1S1XA 4EK2A 5LSRA 2IYIA 1SC6A 3AD9C 3BBBA 3BSCA 1ZH5A 2MQLA 1PYOB 2OFHX 2Y1IA 4PR6A 4ED7A 2ASLA 1CBKA 1RT5A 1XIQA 3ETOA 2QSWA 3H90A 4DPWA 5K8MA 1HBMA 1TL5A 3M8QB 3GWCA 2CQIA 2XQCA 4B02A 3TVKA 1X8DA 4DUZF 4O4RA 3UN5A 1KLNA 4E0DA 3SBMA 3EGWB 2UUTA 4ZS6A 2JRSA 3N4WA 3BQ2A 3PW0A 1H0HB 1PG5B 3GMGA 5KG2A 2AYAA 2VA2A 2V4JB 4CO0A 2HQDA 3MM9B 1WEZA 1AFIA 3M6VA 3G8TA 4B08A 3M9MB 4O44B 2OMOA 4PYAA 4PXBA 1FDDA 1UETA 4IR7A 5M2PA 3I07A 3KG0A 2ZH1A 1ZB8A 1SL0A 4DUTA 4KTQA 5JJBA 1MXAA 2JFKA 3OW2R 2RDJA 4RNNA 4L6V3 4ZVRB 1HFEL 3RR8A 2DY1A 2F4VF 1EKRA 2RU3A 2A10A 1VQOS 1BE4A 5CYJA 2YNHA 4F4WA 2DKOB 4NXMJ 4EO8A 4DCUA 1S1UA 3DRPB 4BDPA 1VOMA 2DB1A 3C8YA 4K0KC 4FXWA 3D67A 4PQUB 3ISND 1X9MA 4LQ9A 2PFDA 4JI8J 4WS9A 4KO0A 1N32F 1KC8T 2B4VA 3CJTA 4L72B 3A8KA 5HLFA 1NJIT 4JYAJ 3W2WA 3KFWX 3PDNA 4MFBB 5M2RA 2OUGA 4X4VA 1S76D 3THTA 1IBMJ 2C2NA 3HFKA 4KGKA 4BWJA 1X5PA 1WC0A 2APOA 2CQ2A 2JDJA 2PT7G 2CPDA 5E2QA 1RT7A 1Q79A 4QIVA 3LA0A 3DXBA 1Y11A 2MQPA 4MYUA 4L75A 4J9NA 2DR6A 4USWA 3ITHA 1ZYQA 2MYFA 3BBFA 3H5SA 4DS4A 2RB7A 2MJUA 5ETKA 5LMNF 3TEHB 2BDPA 2HHSA 1H98A 5KFMA 2ZE2A 1VFJA 1N5QA 3S8SA 4TQSA 2PN6A 2YH1A 1S77D 4H4OB 4G1QA 2CDQA 4NLDA 1H72C 3UX2A 1UWBB 3NLCA 1S49A 3GV8B 1YVFA 3GYXB 2KHDA 3H2UB 4CRJA 1XMBA 3EXYA 4LRFA 4WTYA 1YRTA 3DU5A 1LCIA 1X4HA 1JLAB 3J81Y 2QGFB 2MHNA 3KDNA 3B82A 4TPSB 4O3SA 1CJUB 3GFXA 1NDLA 3I6PA 4X66F 3OSPA 1YJVA 2OEKA 4K4XA 3RAMA 1UEUA 1XTZA 3UDLA 2B7CB 2FHOB 3EDQB 2HQGA 3T5KA 3HHLA 2QMWA 1LOUA 4RJVA 4DCPB 1V26A 3BREA 5FDLB 5KFSA 4DV2F 1NPPA 4RUBA 4DL7A 2KJVA 2PA3A 1N52B 4Y2IA 1EQ0A 2MDAA 5G0RA 4LFAF 3ZNUA 4RLEA 1SIWB 3PKYA 2YNIA 1M1KT 4JI3J 2MB0B 5GMKa 1YJWS 2EFPA 3T9ZA 3NOCA 4N5SA 2R3VA 2DCUB 2VFVA 3Q86A 1S1VB 3EQ6A 1T03A 2WB1D 4DV5J 1U1LA 2YQ0A 2B5JB 1CS4B 1EARA 1MU2B 2DHAA 4MMOA 4DV6F 2XS2A 5ETNA 1Q95G 2NSCA 5KFLA 2FJAB 1HHQA 5ETQA 3A4TA 4X65C 2CJ9A 5FLXY 4DCOB 2B4OA 2W9CB 1EP4B 4FYXB 3CF5Q 4X4OA 2R8IA 3I0RB 1VIOA 3WC0A 2XR1A 2AWZA 3PR5B 5I3UB 3SZ2A 1VQNS 2Q43A 4V1Ak 4K50A 3DLGA 1ZA1B 2AZ3A 2N4DA 3RB4A 2VKZG 2G9OA 2L48A 3KLVA 2AEJA 1VQYA 1G3OA 1T11A 4PXDA 3AJDA 3PW7A 1RT4A 2X1FA 5D3GA 4X4NA 1NHUA 2XHCA 1YBAA 3Q89A 5AXNA 5IOLA 4DQSA 3OT9A 3NNCA 1CC8A 4M5DA 1IKVA 3KOAA 2CUYA 1O6XA 1S9EA 4DLEA 4DR7C 4B3RC 2HS0A 4XAKA 4LF7F 1T7PA 1WI8A 2ZWPA 4G3IA 2IA0A 2E44A 2DR7A 2H5EA 1X9WA 4J9QA 3CJEA 3V6HA 4DG1B 1RHJB 4HI1A 3QRRA 3RW6A 7AT1B 3HFZB 2YNFB 1NM2A 2BYCA 1MNEA 4UZBA 4X4SA 2IVFB 1Z1ZA 5L9XA 4Y2AA 4KC5A 1VBYA 3NYRA 2CQGA 4CH0S 2DRAA 4J9UE 1C1CB 1WUUA 3OL7A 4Q0BB 5L39A 3IRXA 1ZM4A 1LWFA 1U45A 4DS5A 3DU6A 2BRLA 2Y4OA 3KNAA 1OO0B 3T5HA 2FB0A 2Z4PA 1Y0HA 2JL9A 2PT0A 4KPYA 5F9LA 3HD2A 3AF6A 2DNPA 4EYHB 1U1MA 4R5PA 1UFKA 1WC5A 1JJ4A 3V4IA 2ASJA 4FKXA 4ODJA 2BMBA 5GAGI 3MF5A 3N9UC 2E66A 2Q1LA 2RUSA 4OYBA 2BX6A 1WOSA 4YEAA 4KH1B 5IV3A 4X4TA 3NRBA 2YNHB 3QIPA 5HROB 2CG4A 1HNZF 2R8GA 4DG8A 1YJUA 2BZ2A 4U5YD 3QPIA 3VAGA 4KTVA 1NLKL 3EX7B 1S99A 3HVRA 4ITSA 3HJFA 4KO0B 5BSUA 5ETVA 1JX4A 3BGLA 2E8CA 1S0VA 3TWZA 2FLOA 4AQYF 1U47A 1UPPA 5A8WA 2HNDA 4DEZA 4LBHA 1B64A 1VRTB 3NS7B 4HL9A 5ETSA 4DV7F 2AJQA 3LH2S 1M6XC 2D9OA 4ZCLA 4CLLA 2V34A 1ZPWX 1B0VA 2V6AA 4CTAB 3W5YA 3BSNA 2HZVA 4UOHA 4EYIB 2GVDA 3AHPA 4HACB 1F9HA 3M4XA 1FJ7A 2U1AA 2ZC3A 2M5OA 4JI8F 5L1JA 2AW0A 4A8FA 3H5UA 2RDIA 4K4VA 2XGQA 3CT9A 2BW7A 4G1QB 1D0EA 5ETPA 1RUSA 4JI6F 3BPDA 1M5OC 2MHEA 4AXIA 1IBMF 2W25A 3OD2A 1SL1A 2YKAA 3OXLA 1FA0A 2I8EA 2B0GA 2H4YB 2UUCJ 1C2PA 2B43A 4C6AA 4CNZA 3GSDA 4U7CA 2E7VA 1Q16B 1C0TA 2W2QP 2RQ4A 2IMWP 3IM9A 2OPSA 4KGVB 2DGXA 4LR8A 4KFBA 1T0TV 1CC7A 1ELOA 2C3MA 4BCAA 3KKFA 2AGOA 1SC1B 1VGYA 3AA8A 3IN5A 3DLPX 3R97A 4QQBA 4ED2A 4KTTA 5A6WA 2HVHA 2VH7A 3GJSB 3C6TA 2M52A 2Q3PA 2W7OA 3DKDA 1VQ8S 4HDHA 4LFBJ 1RWWB 1RAHB 2JEJA 3J80Y 2BE9B 3L09A 3M8RA 2GJFA 5HBMA 1UEVA 1SB6A 1PCAA 2NXEA 1VR6A 3O6QA 2NYIA 1FEHA 1RYRA 2RRBA 1D1UA 2ZITA 3GFYA 1RG9A 1BHNA 1PA4A 3HVTB 2C2DA 1RWMB 4WP3A 3GIRA 2DO0A 1LEOA 4N56A 1SV5B 3MMCB 3W2VB 1RADB 3OR1A 3FZ2A 3CMES 3UN2A 2FJXA 2NXNA 1VQ5S 2AEMA 3PJWA 4UUXA 5RUBA 2Z8QA 4F7VA 2DNLA 5JMNA 3BO4A 3C46A 4RKUC 2HBRB 3D66A 4DV1F 2UU9J 1GTHA 2HHQA 2KXFA 3OHAA 1V3SA 3MPDA 2UV8G 1N8RT 1QWIA 4DCJB 1P4EA 3O1LA 3BDPA 1J5OA 4ETXA 1QJHA 2D1RA 4RBVA 2ZWOA 2AZ1A 3NCQA 3O5TB 1SXLA 1RT4B 5D3GB 1FRLA 2PGCA 3CJ3A 4ELTA 4ZHRA 1O92A 2KFNA 3D0IE 1FTRA 4MK8A 2YWHA 1SJ1A 4FS1A 1SKWA 4RM3A 1QTNB 1PG4A 1GPMA 2XGPA 1JLGB 5A0YB 4ECWA 3PY8A 2B6AA 2YWCA 2OTLS 1WSVA 3HDSA 3TUZC 2ZDOA 3UE2A 3RUBL 4WE1A 3I08A 4KRWA 3BH6B 1UKUA 1W26A 3JSBA 1NZ8A 5DG8A 1PU1A 3OTCA 4O3PA 3AD7C 1RKJA 2ILZA 2G0JA 1SI9A 2EC0A 4AL5A 2CY1A 2KYXA 3VTIA 2DO4A 1ICEB 2CPFA 3UZ0A 4DR3J 3IAS9 5T7LB 1VLOA 2LP4A 3FBBA 5AE1A 3B4DA 2XG8A 2YH0A 3D3BJ 3I4PA 3H4DA 5J2PA 2VFTA 2NXCA 2XNQA 1VQ4S 2K7JA 1CJVB 1R31A 2LKZA 2AYEA 2G13A 1R3NA 4ECXA 3I87A 1PJ6A 1Z4UA 2M5YA 1AUSL 1Q1KA 3LGXA 4DR2J 4D3HA 3FRYA 1NKCA 4XO0A 4DUYJ 1IR1A 1G4CA 5GMDA 3TQIA 4IRCA 2VG7A 3FQLA 2EFVA 3OUYB 2Q6CA 2DHGA 1L3VA 4L3KA 1UVNA 4GKJC 1RTHB 3IR5B 2I9SA 4OZ1A 2AQ4A 5DZ6A 2WP0C 3OXGA 3FEZA 1B3TA 2HQ3A 2CU6A 1WEYA 4OV6A 1KEKA 4OHYA 3J7YU 4RW7B 4AL6A 4C8LA 2C42A 4B17A 1WELA 1IBLJ 4ER8A 4R1LA 4C11B 2MQ8A 2Y8WA 3TJ9A 4DR1J 4JI4C 2AIRB 3IR6B 1X5OA 1VQLS 4DR6F 3OTBA 1S9GB 2YKOA 2YCBA 1RU1A 3CD0A 5CYQB 1I94J 4K0KF 5KEIA 3PX0A 3UR3C 2XSFA 3FCVA 2FVSA 2XI3A 4CNYA 2KDOA 1UW4A 2QC3A 2C2MB 3IS9B 1BUXA 1KN6A 4ZVUB 3JAMD 2QE5A 3L9ZA 5KFYA 2V9WA 4M5IA 3DI6A 3N5FA 3CGIA 2WBRA 3HX9A 1AUDA 3KMQA 2VOOA 4A46A 1NB2A 4P74A 2XS5A 4K59A 1RK8A 2NPIA 1RAEB 3GP9A 3GPAA 3UOWA 5LSLA 2RT3A 3ET6A 3OTOC 3CCZA 5KFNA 4FBUA 4ED0A 3TVZA 5B09A 4NLTA 1L5UA 1A9NB 3J80U 4YY3J 4Z7CA 3QGPA 3IMQJ 5GAHI 3HSDA 1WF1A 1T3NA 3MGJA 3MHYA 1RHRB 1PC4A 2ZBRA 3BV8A 3M8YA 2MEWA 4PPDA 4DR5J 2AHOB 1GK8A 3SCLE 3RG2A 4X64J 1RB0A 1U09A 1VI7A 2V8PA 3FDSA 4PABA 1RACB 4RW4B 3MCNA 3UDEA 4PUGA 4IG3A 5DZ7A 5CAAA 4KGMA 3VNSA 4K4UA 5C42B 5IQQA 3RRHA 3Q8YA 3QT8A 3G82B 4MYTA 4L3NA 3PO4A 4RW8B 1U1QA 1WNEA 1HNXJ 5J2MB 3I96A 4NRTA 3LUYA 1Q8LA 1FJGJ 4IYQA 2J6SA 2I5JA 4A8XA 1NDPA 4QU7A 1CEZA 1TUVA 3TA1A 2DNRA 1AA1B 3CVKA 3CJKA 5F8IA 2V4QA 4NLRA 1RAGB 2XSJA 4NLWA 3OV7A 3H2TA 2QA2A 3T1YC 2VD3A 5BXIA 3JTNA 1JLFB 4NYPA 2WTFA 4DL2A 3HHKA 3PEHA 1R8AA 1P9QC 4WK1A 3P45B 3MPWA 1PAEX 3LP0B 1N88A 5C25A 2Z2MA 4LSLA 2K06A 2YWEA 2OEJA 1SC4B 1JK9B 2ZH3A 2RDDA 4PWWA 3DLHA 5F3ZA 2M9KA 1HLWA 4DR4J 5T41A 1XRAA 2AU0A 1RA7A 4I7FB 5E7OB 3JB9k 4DSJA 2IA6A 5KFWA 1SJ4P 4P71A 2LLZA 1FO1A 1QAJA 5BJRA 1RWXB 1C4AA 3I0SA 3GR0A 1UP1A 4OJ1A 1NEEA 3E7XA 3RZAA 7FDRA 4GS5A 3OQ2A 1ZB9A 5F8GA 3C66A 4X65F 1U26A 3VALA 4OI6A 1OSDA 1FTCA 1IKXB 1QUPA 3V5RA 2MSSA 2IFXA 5BR8J 5D0EA 2BOAA 2EBGA 3GG0A 2M8DB 5C5JA 3G96A 4JV5C 1GMVA 4CLWA 2OAUA 3CDBA 1Z2LA 1F5BA 3FVYA 3HMJG 2W7AA 3MM6A 1RWPB 2FVQA 1N5TA 2OGUA 4YDDB 1K8AT 3KK2A 1E6VB 3ILOA 4KKOB 3ENWA 1RI7A 3ILLA 1IKYA 1AMUA 3CCTA 5HK4A 4NLPA 2UU9F 1TV6B 1TAUA 1OY8A 2MMAB 3DC2A 4OYCA 2E1PA 1HBOB 1X4FA 4HVZA 4LF5C 1IJFB 3FQKA 4B3RF 1VDHA 5KT6A 2DPLA 3T5JA 1P6TA 3VGUA 5A8KB 3BZQA 7FD1A 3ZTSA 1V60A 1VC6A 4WK3A 2V8DA 4LF9C 5IC6B 4EMDA 3RAXA 4NLVA 4NWBA 4OJHA 3FBFA 3OPKA 3R5BA 1REGX 1TKZB 2V67A 1RHMB 1MWQA 3DGPA 1NRKA 3MDFA 4ID5B 2RF2B 1U2CA 1UVMA 1FRKA 4XK8C 4HLBA 2R7OA 4H4KA 1HW9A 5GVQA 1X31C 5EN1A 1U1RA 2VODA 3C14B 2HHUA 2IVMA 1KVKA 1Y5LB 2DGUA 3W63A 4ZVGA 4DR3F 5BSVA 2VASA 3GJRB 4N41A 2D1TA 3T1HC 5GAEI 4TNOA 2D3ZA 3P49B 2IC3B 2HEKA 2CIMA 4DCTA 1B99A 1RBOB 3CCQS 4NZ7A 4OXIA 4B3SJ 2XB2D 3AAWB 3WQPA 3C16A 2QN6B 2IM2A 5K14B 5T14A 4NLXA 5CYMA 1Q5YA 1F5AA 4NLUA 2WCXA 1GEHA 2MZRA 2M5HA 1FT8A 1SVDA 3AH6A 4JV2A 3E8OA 1FX2A 4Y28C 5I4MA 3UPFA 2KU7A 4YFUA 2DRDA 2M4MA 5A2QD 4B3TC 4IOBA 4QIWD 2OJ3A 2ZM6C 2DNOA 3PBKA 3FNNA 2VQFJ 2UXDF 2EXUA 3UFCX 1RT1B 1WWHA 1QM9A 5F8NA 3TAMB 3U1LA 2VDHA 2ZH7A 1M0SA 3DI6B 2KG1A 4X2BA 3JTPA 1NK4A 3LAKA 4R0JA 1G7CB 1PKUA 2VICA 1IBLF 1AW0A 1EKSA 4ECRA 5B0DA 3NY0A 1N5SA 2BV3A 2GVZA 2BXJA 3D6TB 1O93A 3UCUP 4DDFA 4ILRA 2W2NP 1I94F 2QMXA 1DTQA 1OWXA 3K5OA 4I9FA 4PG5A 4GKKF 1S1WA 3RJMB 3OBIA 3A1YG 1VLYA 3PO5A 4PWUA 1X4GA 5LL6d 1XMOC 3KJFB 4M1KA 1P8GA 2QLJB 4QPXA 5I42B 4XX2A 4ANDA 2KB2A 4I2PA 3R2DJ 2JNVA 1X9SA 3EWGA 3QMQA 3DYAB 4IQXA 5L8RC 4KE5A 5T8SA 2XYHB 5DDQC 2HAFA 2ZNYA 3IEUA 1WKLA 4GC6A 3PFEA 3O2EA 2KXHA 2XMVA 2GA7A 5B0CA 3HD1A 3NMRA 4ZP7A 2CZ4A 1CJKA 2GW8A 2MXYA 2E7XA 4O4GB 2ZBIA 2GQCA 4M94A 2F4FA 1SUQA 4X4QA 2HVZA 5LMUF 1JWWA 3N6LA 5IQ6A 4PZPA 2FVPA 1XEZA 2XLKA 2WONB 5DLGA 3SQGB 5CA5A 2W1BA 1HPZB 4DR5F 4AXJA 3F56A 4DL4A 2MKHA 4X64F 4FF3A 3WHIA 2E7GA 3HJVA 4O0NA 5EHHA 1T9VA 4ZITA 3PKMA 4LT6A 4C8ZA 3DFEA 3KLIB 4NDNA 1LWEA 3K5PA 4JI1C 4UOCA 2MKJA 4BHQA 1QAYA 2RU9A 4U67Q 4KT0C 2QL8A 2X7IA 2MLYA 3Q0AA 4LF4F 4OI4A 2CQCA 2BE2A 3R1LA 1NK6A 3CUNA 2XMKA 1VRUA 2VJUA 4F4XA 2NUUG 5A1IA 1XR7A 3R44A 4CP5A 3AY0A 1C1BB 3C6UB 3I0SB 3MCMA 1OYDA 4XPCA 5EGYA 2MJNA 2P2MA 2CQ4A 1BMQB 3RBXA 3I4HX 2P9EA 2XY7A 1LWCA 4NMXA 1IM6A 1GX6A 1X60A 3EPGA 1U8SA 1T5DX 4K4WA 3KHLA 1N33J 5ITHA 2AJ4A 4B3MC 3MD1A 1HWLA 3PTWA 1V3RA 2DNYA 2HFNA 1NKBA 3GU0A 1WJ9A 3MM6B 1RTJB 3M7VA 3BYPA 4DR4F 2UV8A 3V81A 2V8VA 3BQ1A 1R8PA 1U7LA 1D8ZA 3X3UA 4OX7A 3KHRA 1W25A 1TL1B 3US5A 1YX2A 2H4WB 4RVNA 1LFWA 2HNZA 3FSIA 3OR2B 3NCPA 2PD1A 2XWYA 3KYLA 2RJZA 5BSMA 3OLBA 4OIXA 1ZAXA 3D4JA 3TOQA 1QAXA 5HP1A 1ROFA 1R0AA 4TXSA 1URRA 1OQ6A 2AD9A 1J2VA 2E29A 3PXGa 1GFWB 3ICLA 3G6XA 2J9CA 2R7WA 4OHXA 2ILYA 3CQ2A 2BM1A 2HG4A 4CM0A 4OI2A 3S01A 3SDEA 2N7CA 1CJTA 2P2CB 1UEKA 3DLBA 2RMLA 3MMJA 1GX5A 4E8UA 2ZOMA 4ZPAA 1F2HA 4ANEA 2BANB 4E98A 2XI2A 3K5LA 2RQCA 3GYGA 4K8RA 4FPRA 2R8KA 2Z2ZA 2VG6A 4RW6A 2CYYA 2CJQA 4JI0J 2D27A 3MEEB 3SFUA 1FI4A 4EZ9A 1IQZA 3H98A 1BWEA 4DV0C 2FGCA 1S9FA 2HQIA 1RAIB 2E5LF 3UN3A 3CJSA 2VPYB 3M30B 2F4VC 2DXEA 4Z7YA 3TZZA 2W01A 1IKWA 2FJWA 2W8LA 2UXCJ 1YK9A 3M2RB 4DCSA 3CCLS 1NY8A 1WHVA 3MR5A 2ZJRQ 3DM2A 3C15A 2LQ5A 2UUBJ 4NCGA 3FFIB 3I5CA 3DHVA 3TVYA 2VU5A 3OFFA 4IOAQ 3ZNJ1 1N32C 4EBCA 1U2RA 1XR5A 2XLIA 4OZ5A 2R2UA 4CIOA 2HMIA 4D3GA 4CH1A 5ETRA 4M5LA 4IZ6A 3DOLB 3CULA 4R0MA 2OMLA 4FNHA 1U0SA 4HH0A 4B3SF 4EU0A 1LW0B 1FXLA 2UVWA 2B9YA 2I6WA 1IM4A 2E8FA 4LR7A 5M2UA 2VPZB 4J9RA 1C4CA 1ZA2B 2KFZA 2O67A 2XBPA 4WFAQ 1FFWB 2B8QA 1OMSA 2LA6A 6AT1B 1NZAA 2YQ3A 4I67A 1FRJA 1R27B 3Q22A 4ZN1A 3CIMA 4CLTA 1NNDA 1B7FA 4DCVA 4RL1A 2DR8A 4OX9J 1N54B 1TAQA 2Y1JA 1Q8KA 2KYZA 3RV2A 1K0RA 5EWEA 2HHWA 3KDOA 5HVGA 1S10A 3E3XA 3IXQA 2HURA 3HT0A 4KHPJ 2W2OP 3DRRA 3U02A 1GXUA 2DH7A 4X66C 4PXCA 1KHWA 3MUVP 2M88A 2RE1A 4HEA9 5J2QB 5KG7A 3ILIA 2JZ5A 2C3PA 4PUIA 4IG0B 5K5MA 4NX9A 1QY7A 2A3JA 3QGGA 4U95A 1CULB 3ETMA 2CFXA 1N36C 2KZ0A 3QO9A 3I9ZA 1DAXA 2E9ZA 4DV2C 1T9UA 3IC1A 3QLHA 4DL0C 2QO3A 2UXBJ 5KFQA 2K1RB 4MH8A 1YBUA 4UQGA 1FRXA 2QA4S 4LFAC 3V4MA 4JI5F 3DNCA 5F0WA 2W9AA 1FERA 4LJMA 1C0UB 4LREA 1FD2A 1N6QB 2ZH5A 2MQMA 3VHQA 3B6BA 1J5EJ 3BJYA 4YDXA 1HBNB 3KNGA 4W90B 3PJ9A 3HM9A 4ZKAA 3NAIA 5L9NA 2H1YA 4F3QA 2DEIA 4ZCKA 4C8NA 2FGOA 4DV6C 3HSJA 4TYBA 3POTB 5DQHA 2K3IA 3D28A 1HMVA 3MURP 1URNA 4NXNJ 2VC0A 3Q8UA 4BC9A 3JS9A 2A6OA 4TKTA 4EBEA 3D2WA 2MKKA 2VOPA 3OFGA 5KFXA 4F0HA 2BVZA 3LALA 4PUOB 5F8LA 2P2FA 1G6BA 1BQXA 4OQJA 5KG1A 2FY1A 3BGUA 1LWCB 3AOAA 4YUDA 2VUGA 2K8GA 2BJOA 3A26A 3A8EA 4ICLA 2J5AA 3M2UB 4PG7A 2LDYA 4EFAC 2RSQA 2E1AA 3N01A 4RNHA 4CQ1A 3ZTRA 3IWNC 4R1MA 2EK1A 3NPDA 5DM7Q 4DSEA 2F8EX 1ZTWA 1RHQB 3DLEB 3GTYX 1KNZA 3RAQA 1TL3A 3MM5B 3RG6A 2PC6A 4LF7C 1RT2B 1WG1A 1FKOB 2V69A 5IWAJ 2ZH2A 4W98A 2HKEA 2HHHC 4ZVPB 3TO8A 3NP5A 4DQIA 4ZP6A 4EGLA 3M8ZA 4WF9Q 4YN3B 4KBIA 3KLFB 1ZM3A 5D0GA 2HNYA 3MMAA 3T9NA 3M1VB 1HD1A 1UCNA 4RMNA 4RR5A 1BQMA 2LYVA 4I56A 4WZMA 2ZC4A 2ZZTA 1HA1A 2W24A 1X4DA 4TY9A 3CJ2A 4C48A 3IBFB 3LTOA 4CH7A 3HI9A 2CPHA 3G2XA 5AE2A 3J7AN 4J37A 1SH3A 4C3MA 2HHPA 2OPQB 3CQ1A 3SDEB 1Q82T 2W4CA 2KRBA 2MZQA 2ZEJA 3QQCD 2CPYA 4OFZA 2D1SA 2NLWA 4QWAA 3CQ3A 3S82A 2R2TA 4LF2A 3BM7A 4MJKA 1BQNB 4QWDA 4MTPA 1AYEA 4LF9F 2CQ1A 5CABA 2CNLB 2WAQD 2WVBA 4YQWA 3M8QA 2ZH9A 1U25A 1DBDA 2JVOA 2FYXA 4RO0A 2DGQA 3HZGA 4F67A 4L73A 4AD6A 1IVZA 1U49A 2V4JA 3KJNB 1U6ZA 3MM9A 5KFCA 3SO4A 1F60B 2C2EA 5HSPA 3BF4A 4JOUA 2IRUA 4J91A 3D1OA 4K5SA 4O44A 4A8QA 4FP9A 1NJZA 4AFFA 2JEIA 3H42A 1VHIA 5BYSA 1W2BR 2WK4A 4NCGB 1Q7YT 4ECYA 2D41A 3GFZA 3SFGA 2W7PA 4PUHA 4BBYA 4BWMA 3MR6A 3RB6A 1PIEA 1HBUB 3NWGA 1M1GA 3ELHA 4IFVA 1QSYA 4Z37A 4AQYC 4MAKA 2BA9A 1NB7A 1HNWJ 1LV5A 3W66A 3DRPA 4F4AA 2MLXA 3D5MA 3RBEA 4A8WA 4B9TA 4DV7C 4MK7A 4DXLA 2B56A 4DZ6A 4PQUA 4LVNP 4ZPCA 4X62J 3MR3A 2H3EB 1N5YB 4NXMC 1U1PA 3RR7A 1NKEA 1YJ9S 3GSIA 4NLSA 4FF1A 5DS7A 4MFBA 4WWSA 4ED1A 1MDBA 2ZM6F 1XJWB 1VQSA 1KVIA 2UUBF 1UPMB 3U7JA 2KHCA 1WHYA 4JI8C 2Z2LA 2ZVSA 4KHRA 4F50A 4MH4A 2H5IB 2RRNA 1U1KA 4JYAC 1SJ3P 3QAUA 4KY3A 1H73A 3S6EA 5HI7A 3KLEB 4JP8A 2DTJA 3CW9A 1IBMC 4WFZA 4GVLA 5BSRA 4A8MP 2OLWA 4NMLA 4QYZJ 5L1IA 2E8EA 3DHWC 5EX3A 1IQTA 3RTVA 5H9EK 2E5IA 1NK8A 3MCSA 4H4OA 1PILA 1YWXA 2BEFA 2KH9A 1T8EA 4A8KA 1UWBA 2ZZNA 4K4ZA 2HGMA 2BQ3A 2HVDA 1I6JA 2DT9A 2HS3A 5EUHA 4OZNA 1XMOF 2DIVA 5BURA 3RBZA 3R5DA 3EPIA 3FCHA 1JLAA 3SCJE 2EWHA 3M2VB 1KBRA 1CSJA 2IAJB 3AXKA 2CPZA 1CJUA 2W4PA 1CVJA 4OX9F 5E3AA 2POKA 5J2NB 3KK3B 1KDNA 1H2TZ 4DN0A 2RHQB 3HULA 3MEDB 5FLXD 1EAYC 1K47A 3D68A 5C24B 1NBEB 3MEGB 3TZWA 2FZGB 3BR9A 3QBCA 3KK1B 3MM8A 3TX8A 1VBXA 3WZ0A 2B3TB 2G2YA 5GAGU 3K57A 1YQHA 1H38A 2VZEA 1RLCL 1QSSA 3HKZD 1SCJB 1LNQA 1XRCA 3H4BA 1DTTA 3PG9A 4HH1A 4DV3J 1L3UA 1FDNA 1YJTA 4YB1P 1H7WA 3L8CA 1JMTA 2WOMB 4DZDA 5KFZA 3OL9A 4PG4A 1S1VA 2PO4A 2V9KA 3GIIA 2YXLA 4JI3C 1HYSB 2B5JA 1CS4A 2WSCC 3CJ5A 1TFYA 5D4OA 3F41A 3KLHB 3GCXP 1J5EF 2M70A 5HMYA 1SH0A 1WKJA 4DV5C 1XWLA 4B3OB 4YHHF 2W9CA 1EP4A 2RS8A 3MD3A 2FLPA 4Q8EA 3N28A 4Y34A 2V2VA 4RNOA 3I0RA 3AA9A 5J1EB 4I69A 3HHDA 3GJQB 2HFUA 4TY8B 2K2PA 3HCXA 5I3UA 3K7RA 3NOGA 3LPYA 1L3TA 1RWVB 1PJ7A 4RBTA 1P7LA 1IBKJ 1XK8A 4H4MB 3OJSA 4W92B 3G6VA 3P6YC 1NK9A 3JSMB 1Y00A 3PR4A 1JLCB 4KR0B 4ELVA 5FD1A 2GMLA 1WG5A 5KFJA 3T1AA 1PC5A 3EVWA 1U6BA 1ULRA 4QWEA 1FE4A 2KO1A 3H2VE 1NK5A 4M5JA 3B78A 4KV8B 4MKVA 4RWXA 3MAHA 1RTDB 4DG1A 1XNQF 3AOBA 2F63A 2VPXB 1R43A 3M9NB 1MN7A 2PMHA 3M8WA 2YNFA 4IRDA 3PFOA 2PFFB 3FEXB 3MEKA 5EDWA 2HK2A 5IWAF 2FHMA 4HDGA 4DF4A 2LXUA 5HQ8A 3NGKA 3C2PA 3Q83A 1LW2B 3NBPB 3SV4A 1YRXA 3DRSB 4CLUA 1C1CA 4HT5A 3TA0A 4L7IA 1HWUA 4Q0BA 1G1XA 3J7YI 3OHBA 3R5JB 2BOPA 3MUTP 3QFHA 5DG7A 1SKSA 1FK9B 3Q24A 2IHR1 1WTFA 2B9WA 4WU3A 1KLMA 3BDEA 2ZBCA 3TEGA 4Q43A 1O90A 2QRRA 4DV0F 4PWDB 1HWKA 1LK7A 3MTKA 4RLQA 4IFVB 4LF6J 3MECA 2K3KA 5HROA 3EZUA 2RRAA 4JI2J 5IM0B
chains in the Genus database with same CATH topology
4GO7X 2GV1A 3DHXA 2VBZA 3NKYA 4C97A 1Y3KA 1JLEA 1Y7PA 3M2UA 3CVKA 3CJKA 4R0EA 3SEOA 3TP2A 4DR6C 3CDWA 5F8IA 1MD9A 2E9TA 2V4QA 3GQCA 1W2IA 3DLKB 4NLRA 5IZHA 4C3KA 2XSJA 4NLWA 4USJC 1FE0A 3OV7A 3H2TA 2BUNA 2QA2A 4LFCF 2VD3A 3T1YC 4FBTA 3JTNA 4GC7A 1UVIA 3VR1A 1TKXA 1JLFB 4NYPA 3UDCA 5ADZA 1FEEA 2WTFA 3VQSA 4DL2A 3HHKA 4TYAA 2DPJA 2VG6B 4RW6B 3I5BA 4NPOA 4HKQA 4PG6A 3PEHA 1R8AA 3VZIA 5I3QA 2UVUA 5DDPC 1DARA 3FMWA 2P02A 4DQPA 3DLEA 5KFPA 1P9QC 2MKCA 4WK1A 2RIJA 2JLGA 1N5VA 3MPWA 5F8HA 3JTOA 3LP0B 2DGOA 1N88A 3MM5A 2DBBA 5C25A 1TKTA 3JSRA 2Z2MA 4LSLA 1WI6A 2MPUA 2YWEA 4RWWA 1JB0C 4ILMA 3IG1A 3I56S 1RT2A 3O3LA 1FKOA 2DPIA 1JK9B 1R89A 2ZH3A 4FXDA 3ENQA 4WJBA 5BUSA 1WH9A 3DLHA 5F3ZA 1X0PA 3D0GE 3SCIE 2ROPA 1VRTA 2V8HA 3KG4A 4DL5A 2EI5A 1IKWB 2M9KA 2QEXS 5BSTA 2YWGA 2MSTA 3CIZA 1ZAWA 5T41A 1D8YA 2AU0A 1RA7A 4I7FB 1XRAA 1HNZC 1V25A 4MTNA 1H3DA 5E7OB 3KLFA 3CCRS 3HHLB 3JB9k 1JLBB 4IFYA 4DSJA 5DO2A 2IA6A 5KFWA 1XNQC 1HWJA 2J7WA 3M1VA 1ZOTA 1SJ4P 1PO6A 4YY3C 3CD5A 2LLZA 2O66A 3P5TL 3T1HF 1S97A 1FO1A 1QAJA 3CC4S 2GIRA 1KONA 2CQPA 3DM2B 4CTAA 1JKHB 5BJRA 5BR8F 4LE5A 2EG1A 2IJFA 1C4AA 3I0SA 3GR0A 1RT6A 1UP1A 4OJ1A 1NEEA 3E7XA 5KYVA 3RZAA 1SH2A 2K7KA 1X4EA 7FDRA 3H5YA 4DV4F 5KOXA 3VCDA 4GS5A 5IWAC 3OQ2A 1EGAA 1Q86T 1O8BA 3GV5B 5F8GA 1ZB9A 5G0RB 3C66A 4I6AA 4Q5VA 3RB0A 1Y4ZB 3TYTA 4X65F 2A2CA 1U26A 2YNGA 4RW9A 2YNIB 2PE8A 3K8VA 2NZ4A 3VALA 2ZDPA 4Q2LA 4OI6A 1OSDA 3PACA 4C3LA 4DL3A 4KJIA 2UUAC 1FTCA 2CZVC 1IKXB 2HWIA 1QUPA 4IH6A 2ZHOA 3V5RA 5K8NA 5K8PA 4WFBQ 2MSSA 2IFXA 5LSOA 1A7GE 2QYCA 4X62F 2QIFA 3CCVS 4ECZA 1LQ9A 2KT3A 2HMIB 1WACA 2EBGA 3GG0A 4ERDA 1VC5A 2M8DB 5C5JA 3O8WA 2OPQA 3I55S 1TQLA 3ZZZA 3G96A 5GAEU 1ZPVA 4JV5C 2ROEA 5DDRC 3UCZP 2LQJA 4ZPDA 4DQQA 2OAUA 3CDBA 1T03B 2D7VA 2RUGA 4CO4A 4EWTA 1K0VA 4J9SA 2GQQA 1Z2LA 1GAOA 3DOMA 1VQPS 1F5BA 3FVYA 5G4DA 3IO1A 3R3TA 1YJ7A 2B4PA 4O3NA 3HMJG 1KOOA 2W7AA 3MM6A 5F8MA 3K2YA 2FVRA 1BQNA 2FVQA 2NSBA 1N5TA 4YDDB 1K8AT 4NZ6A 4O0IA 3IPLA 2EFNA 1UVKA 1WHXA 2KZFA 4OI1A 4QWCA 3KK2A 2YWBA 1E6VB 1HNXC 5AJ3F 3V6DA 3EGZA 2QSFA 4KKOB 2GQ2A 1RI7A 3ENWA 3J7Z5 1IKYA 5AE3A 1AMUA 2YKQA 2EG2A 4U9RA 3CCTA 1DLOB 2DRBA 3DAYA 4B3TF 4NLPA 3CJ0A 2UU9F 5KYTA 2IRYA 4KHMA 3V2UC 1TV6B 1TAUA 4YOEA 5CH7B 1YI2S 1R8HA 3DC2A 4O3RA 3D1QA 1JNZB 4ECQA 4OYCA 3RBDA 2AGQA 1HBOB 4ZP8A 3MXHP 4G36A 5JVHQ 3RW7A 2RKIB 2A1BA 4F4YA 1X4FA 4HVZA 3MM7A 1HL6A 2BJEA 5IFIA 3CC7S 4LF5C 1K1QA 4U7UK 1IJFB 3FQKA 4WCEQ 4B3RF 1U6FA 5KT6A 2DPLA 4LIRA 2C2RA 3T5JA 1MWYA 1P6TA 5A8KB 4O23A 3BQ0A 1HQUB 5D78A 4IR1A 2J9EA 3BZQA 4F8RA 4OL8A 2UUCC 7FD1A 2R8JA 5KG3A 2CXCA 4F2SA 4C9DA 3T6BA 4JI6C 3OXFA 3TDEA 1VC6A 2G4BA 2MKSA 4MIAA 3DLGB 3H5XA 4WK3A 1WD6A 4CI0B 1RYSA 3MM8B 2I1RA 4IOCQ 5E3RA 5DGAA 2AX0A 2JEGA 2L9NA 2V8DA 4LF9C 3AQPA 4OZJA 1N36F 3RAXA 2HW3A 2OFGX 4NLVA 4NWBA 6FD1A 5BYRA 3M32B 3IA0A 4PRFA 4F02A 4OJHA 3OPKA 2W8KA 4QR1A 1Y5NB 1S1TA 3R5BA 4LFCC 5KFOA 3R27A 3N2QA 4NL5A 5HMXA 1REVB 2HHXA 4UY8T 2E0GA 1TKZB 2DIUA 5GADU 1KVJA 4YB7A 1S6QA 4M5DB 4LQ3A 2C3OA 1IKVB 3MPYA 1DTTB 3DGPA 1HBUA 1NRKA 3MDFA 4FNIA 3PRBA 1MMDA 3UR0A 3DRRB 4RUCA 2U2FA 2J8AA 1N2FA 2VFSA 1ZBTA 3J7A1 4RM2A 1S9EB 4ID5B 1DQ8A 4WFNQ 1RT3A 1WF2A 4C0BA 2X3GA 2RF2B 5K8FA 4TN2A 2MY7A 4LF8F 1UVMA 1FRKA 4XK8C 2Z0GA 4Y6IA 4HLBA 2R7OA 4H4KA 5A8RB 4N76A 3NAHA 5KT4A 4WYLA 2J76E 4D56A 4NOHA 1HW9A 5GTDA 3S7RA 2ADCA 5GVQA 2ZH8A 3HVTA 1U1RA 5EN1A 2VODA 1MROA 2HHUA 2MZSA 1X7VA 2IVMA 2GX8A 1Y5LB 2DGUA 4I68A 1YG0A 2IYGA 4URQU 5F0UA 4PG8A 4QIFA 3CCSS 3HO1A 4ZOSA 4ZVGA 1K9MT 4DR3F 3AJ2A 1VS3A 3Q2TC 1X4AA 4NCAA 3OJUA 4FUQA 3QJJA 3QO9B 5BSVA 1F9FA 2LECA 2VASA 3G8SA 4URSA 2W9BB 1SV5A 3MMCA 4N41A 2D1TA 2OD6A 3I9V9 3W2VA 3T1HC 4WZQA 3ENVA 2OPLA 1NJXA 1HI0P 5GAEI 1NAQA 3QLHB 2D3ZA 4TNOA 3MI7X 1N5YA 1QM4A 3P49B 3G7SA 1HNWC 2V7BA 2IC3B 5KAKA 4FVCA 2XZWA 1TK8A 4DV4C 3BR8A 1HW8A 2CIMA 2DNZA 3L7PA 4IO9Q 4DCTA 4Q8FA 1L3SA 2XO7A 3GZ7A 2ZNZA 3CCQS 4NZ7A 1HD0A 4MKAA 1NJWA 4OXIA 5FJ4A 1N34F 2XB2D 1DJ0A 1YRUA 3AAWB 1WTBA 3SSQA 4C0OC 4X62C 2KFYA 1YITS 2IM2A 1K1SA 5K14B 4LUBA 5T14A 3TUIC 4NLXA 2J7UA 5CYMA 4QU6A 4GMKA 2MGZB 1F5AA 3IRXB 1LWFB 2BQUA 3M8PB 4NLUA 5FDLA 2Q66A 4NLQA 2WCXA 6FDRA 5A2QY 2VC1A 4B9SA 1AROP 2MZRA 2HVIA 5KFAA 1FT8A 3V6JA 3HF5A 4ATNA 3IFEA 1RQ0A 4ES1A 4CZCA 3KLEA 1HHSA 3AH6A 1QLNA 4WV3A 2VKRA 2VQFF 4DJBA 1G2EA 5KFUA 4NOZA 3BSAA 3N6NA 3K5NA 2FHJA 3GPCA 4JV2A 3DLLQ 3N5BA 2ZJQQ 1U4BA 1MXCA 1QAIA 3QZ8A 3E8OA 5I4MA 4I2QB 4Y28C 4XDCA 3UPFA 2KU7A 3TR5A 4YFUA 2KG0A 1HMVB 2M4MA 3R5CA 5CCLA 4FF2A 2NQPA 5A2QD 1XC9A 3PJXA 1MWZA 4B3TC 4IOBA 5B0FA 4YR2A 4R5PB 2UU9C 4QIWD 2GHWA 2OJ3A 2ZM6C 2DNOA 2LEAA 3CPWR 3PBKA 2PSZA 3HKWA 3LWLA 3FNNA 2P9CA 2UXDF 3N79A 3AF5A 4DSKA 3V4IB 1FXDA 3UFCX 2XMUA 1JLGA 5A0YA 2DGSA 2VSQA 2RH3A 1JLQA 4A4JA 1RT1B 5H1SV 4J9KA 3OFEA 1WWHA 4FS2A 2XCPA 4JI1F 1BA3A 4GXRA 3HT3A 2GJ2A 1QM9A 5F8NA 3TAMB 4ZMMA 3WDOA 4ISBA 3AB2B 3QWPA 3U1LA 5CCMA 4DV1C 1Q53A 1Y9OA 2FUG9 2ZH7A 4ECTA 3HK2A 5AXMA 1M0SA 3DI6B 2KG1A 1MU2A 3DMJA 3DDKA 2XLJA 3A9VA 1UA0A 2HHHF 3JTPA 2FJDB 1NU4A 1NK4A 4X2BA 1YJRA 3GIMA 4I9GA 4A48A 4MKBA 1A6LA 5KTQA 3LAKA 3QIPB 4R0JA 2RQMA 1G7CB 2LQ9A 1IBLF 2AYMA 4ICLB 3TA2A 3FCCA 2VG5B 2MY8A 4O3QA 3F73A 3M9OB 1AW0A 1OPIA 3MMBB 3VWSA 4ECRA 3M2VA 2V5HG 5B0DA 1N5SA 3IR7B 1MMNA 2ATLA 4DFKA 1M90T 2XMWA 2IAJA 2BV3A 2BXJA 3R9WA 2V8GA 1FDBA 1VK3A 1S0OA 2E1CA 3U1NA 4Q44A 4FN5A 5KOWA 2OTJS 3L95X 5J2NA 2AX1A 3KK3A 4DOZA 1O93A 2FJVA 3CCUS 3BO2A 1KKGA 3UCUP 4DDFA 1IBKF 4ILRA 2AJ1A 3MEDA 5T7LA 1RP5A 1OS5A 2QMXA 2AV5A 4P2SA 5CQGA 1I94F 3ZZPA 1DTQA 2J6TA 1OWXA 3K5OA 1TL3B 3DRXA 4I9FA 5C24A 4PG5A 4GKKF 4A8YA 2OPRA 3MEGA 4LF8C 1S1WA 2F40A 2FC8A 4IH7A 4NA2A 5H9FJ 2QZ8A 4WFYA 3KK1A 4Z2XA 3OBIA 3TRGA 3A1YG 3OVSA 3KLGB 5A8WB 2HNDB 3I82A 4YMEA 1VLYA 5IT0A 3B7WA 2C3UA 3PO5A 5KFRA 4PWUA 1X4GA 2XMJA 1KQFB 5LL6d 3M6XA 4B3MF 1XMOC 4M1KA 3GKUA 2LXIA 3L7OA 1P8GA 2HWHA 2VFUA 2KT5A 4QPXA 4DWIA 2DGWA 5I42B 4XX2A 2RD5C 1HARA 4CO1A 2KB2A 4O3OA 2CJKA 4DR3C 4I2PA 2HNYB 3MMAB 4R8UB 3KHGA 1KQKA 2F9DA 2CPEA 4CCHA 4FXVA 1X9SA 2VONA 3QMQA 3DYAB 2LCWA 3LP2A 4C0HA 4IQXA 2IMOA 5L8RC 2LA4A 1R7IA 4ZCIA 4KE5A 1S72S