5CZXA

Crystal structure of notch3 nrr in complex with 20358 fab
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
227
Chain Sequence
CPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHVIGSVVMLEIDNRLCLQNDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Neurogenic locus notch homolog protein 3
total genus 61
structure length 227
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5czxA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5czxA01
5CZVA 3ETOA 4ZLPA 2OO4A 5CZXA 3L95X
chains in the Genus database with same CATH superfamily
4B3MJ 4LSNB 1NSKL 2YWCA 5IQ6A 1JLQB 2FD2A 4Q43A 5DETA 2ASYA 2B9WA 2RKIB 4C3MA 2ZHAA 4M5DB 3K59A 2WBMA 3UO0A 4B3TC 4TXSA 1HWUA 2JLGA 4JI2J 4JV5F 4OZNA 1CS4B 1XMQF 1N34J 3IXQA 1FERA 3VF0B 1F5CA 4Y2CA 4UF4A 2UU9C 3TZWA 1YRTA 5CZXA 3SQOP 1D1UA 1Y5IB 4FPRA 1F6TA 4K7QA 3JTOA 1C4AA 1OY8A 3T9NA 2CFXA 4LF8C 1EETB 2DITA 4D57A 2BJ7A 5HVGA 2RD5C 4RPFA 1S10A 5BR8C 5IOLA 1UTAA 2MZRA 2HHQA 2D1RA 3PW5A 3UDCA 5J2MB 2ZHOA 1H74A 2AHOB 3M30A 3TR5A 4DU7A 2OPPB 3CJ2A 3CXCR 1UWBA 3M1VA 3UPFA 2DHXA 2BR0A 4DR4J 2D28C 5H9UA 4OI3A 4DUYJ 3BPSP 2DGXA 1CBKA 4KB7A 3DLJA 3EM1A 2QC3A 5HMYA 3OTOJ 3CE8A 9ATCB 3H90A 1B4SA 1X31C 3IGNA 4A48A 1MXBA 1S6PB 1KQSR 4ES2A 1GNKA 2HWTA 2OGUA 3RJMB 2QEXS 1ZM2A 2HQDA 4JI6F 2JHEA 1S12A 4YR0A 4IOAQ 1RTIA 1O9TA 1F1BB 1VJWA 2E7XA 4OIXA 3TNVA 3LNOA 3AJ1A 4UOFA 2VJVA 4IH5A 3PTWA 4OZ3A 1IVZA 4AL6A 4ECTA 2IM0A 3QGHA 3MM8B 1H2UX 3QT6A 4IKAA 1VC0A 1YJVA 4EZ9A 2DR5A 4N76A 4NA3A 4YHHF 3D7SB 4QYZJ 1S1VB 1UPMB 2JFDA 3BKTA 3GYXB 2CPXA 1CG2A 1U0SA 4ED6A 2KN4A 3DLHA 3PACA 3QGIA 4XIUA 4IRCA 1Y3JA 2B0GA 4WK3A 1WSRA 3WC2A 2N3OA 4HLBA 3AH6A 4NA1A 2N4CA 2C2ZB 4ZHRB 2BANA 2HSEB 3M9NB 3G8SA 1KVJA 4H4KA 3RU0A 1A6LA 4ILMA 4ZVOB 1FKPA 3M32B 4ZPDA 4F0HA 4U8YA 4ED8A 4X2BA 5KFNA 4OHZA 4HDGA 4NLYA 1S0MA 3CNQP 4DR7J 4CTAB 3V81A 3ILOA 3L7OA 4DR2F 2DPLA 3S8SA 4E98A 3MWBA 4IH7A 3OXFA 1HWIA 2XSJB 4ZLLA 2HG4A 3I32A 1NDPA 3BYPA 3CCTA 1DAXA 2XEXA 1Q4RA 3GFXA 4BC9A 4RW6B 1KLMB 4I6AA 1R8HA 3CVKA 1RKJA 3OTOC 2IRYA 1O6XA 5DV9A 2WVCA 1N5YB 1HNXJ 5KFZA 2BJ8A 5HANA 2FZKB 3M2RA 2RQCA 3PJWA 2W2OP 2F8MA 4O3PA 2BMBA 4MT1A 4CM2A 2X51A 4DCOB 2QO3A 2LEBA 4G3IA 2GHPA 2AYBA 5KT3A 2G13A 2QLBB 1MROB 5H9FJ 4X4TA 3Q8SB 5KYVA 2VBYA 3FUYA 1NSPA 5D4NA 3CJTA 2PN6A 4CIOA 2W2QP 5KFAA 4ZMMA 1Q8IA 4XPEA 4PZPA 1N5SA 4KGXB 5CD4H 2PEBA 1N56A 1K1SA 4N41A 1KQGB 3PR4A 3HVTB 1TU0B 4U8VA 2AD9A 4LF5F 1A7GE 3UN5A 3ZZUA 2AJFE 2QSFA 4F4AA 2ZH6A 3TARA 1B3TA 1RJJA 4ID5A 4DR1J 1KN6A 1WTBA 4X4RA 3N2QA 1RZMA 1NK9A 4Y2KA 5BJRA 3NCRA 1XR6A 2EFOA 1RTJB 2OAUA 3AB2B 4MTPA 2ZM6F 4KTQA 4YN3B 3WQPA 3FMWA 4FP9A 3E2EA 5AXMA 3RB0A 1RT6A 5GADU 3EICA 3NNHA 1Q16B 2HHHJ 2CQIA 3LW5C 1Y4ZB 1UAWA 2ROGA 2KFZA 1IKYB 4I9GA 2BKPA 2UUBF 2KT2A 1HA1A 4JI2F 4A8OA 2RDDA 3MMJA 4WU2A 5U47A 2YKNB 2UUTA 5J2PA 3UCZP 3FEYB 5T14A 1GAOA 4KR0B 3D3BJ 1GTEA 4P2FA 2LQBA 2ZD1B 4PG8A 1JLCB 1R27B 3BSAA 2VPWB 2D1QA 4ED2A 1JXVA 2DYJA 5B0DA 2GMHA 2HS3A 2YXLA 3IBFB 4FYVB 5FLXU 2C22A 4PUHA 4WYLA 2HS4A 5J2PB 1FJGF 3SO4A 1S1UB 2Q79A 2XMTA 4GKKJ 4KO0A 3JTPA 3MTKA 5SUHA 1V5IB 1LFWA 3TI0A 1XIQA 1QD1A 4Z37A 1E6VB 2MPUA 3UX2A 3G4SS 3AT1B 2KM8B 1EQ0A 2VBWA 3UD3P 2QTWA 4QPXA 3HZEA 3OLAA 2ASDA 1RSCA 2LP4A 3K17A 4CZCA 4AQYC 1N34C 4P7TA 4QYRA 4O3NA 4JV5C 1NDLA 3ISND 2E7VA 2MQMA 3QZ7A 4B9VA 3VCDA 2QSWA 3GFYA 5B0FA 1UVLA 2QGFB 3I96A 2JC0A 3CTRA 3DOLA 2WOMA 4S0MA 3HVTA 3N28A 4XAKA 3C16B 2FLLA 1KVIA 1UKKA 5A1GA 5C42B 2O5DA 1VLOA 4X4SA 5A1IA 2EPIA 2R9LA 1QTMA 1MKYA 3CEDA 5K9FA 1SQFA 1R0CB 1Y11A 1Y5LB 4RBTA 5KFPA 5FLXD 5KFLA 4LF8J 1ZAVA 2AP6A 2V2QA 4WFAQ 3D1OA 3G87A 3K8WA 2R7UA 2HK2A 2CDRB 5HROB 4C8NA 4K0KJ 1XHJA 2OBVA 1VDHA 2P2QA 4G37A 1IBKC 4ED7A 2POKA 2ASLA 2IMWP 3CJ8A 3T6JA 2FHJD 1TL1B 5KFEA 2C2OB 4CO5A 1IBLJ 4QCLA 2BABA 2GW8A 2H5EA 1R43A 2DNRA 2B9XA 2PMHA 2PT0A 3NWRA 2W8LA 2HAIA 2RS2A 2UUAJ 1UW4A 4TY8A 4R0JA 3CCLS 7FDRA 3LGHA 3W63A 1IKXA 3CJRA 1CPZA 1NPKA 5BSWA 3DN9A 1D8YA 2DD8S 3JQJA 1YBAA 1M1GA 4UW2A 2RILA 4J9MA 1P7LA 3VNRA 1YKWA 3BBBA 4QIEA 2VV5A 3ENVA 2DNLA 4DG1B 4EFAC 4DV2F 2VG5A 3AFGA 3W9IA 1RWOB 4UZBA 2K3KA 1NBEB 4PQAA 3MD3A 3OV7A 2EI5A 3GSIA 1WF1A 2W2MP 2YQ0A 3L09A 3HDSA 3R3TA 2HFUA 1WOSA 4ZVGA 1RI7A 4AFFA 2ZH8A 4WS9A 2JLFA 1TKXA 1D09B 5EX3A 1XNQF 4A8MP 1GT8A 4OX7A 1OQ3A 5LL6d 1RA6A 2XNQA 4NYPA 3W5YA 5CAAA 3PV8A 3Q8RB 5GMEA 3HFKA 4DQQA 2V7BA 3SCLE 3GCXP 3RBXA 2B56A 4DCPB 4EU0A 1TL3B 2VPZB 5MLCV 4X62J 3HVRA 3Q0AA 5KFQA 3VAGA 2I0XA 4RUBA 3A9UA 1HNXC 2JVOA 1LWEB 1S6OA 3QWUA 5CYMA 3PIOQ 5JVGQ 4JI3F 2BQRA 4IG0A 2G0JA 3VZHA 4F4XA 2DRBA 1D9FA 4RMNA 2OPRB 5LXRA 1BQMA 1HQ2A 1KONA 1TQLA 3AQOA 4MYUA 5EGYA 1QSYA 4W92B 3DRYA 4LFAF 3A3NB 4I0WA 1S0VA 4KH1B 3EE3A 1UCNA 2AGPA 2VFRA 2WTFA 4OZ1A 1KNZA 4JI8F 2DB1A 4JI1C 3I0SB 3I82A 2DNHA 4L73A 4WFXA 2GX8A 1YIJS 4RNNA 3JSMB 1XEZA 3MEDB 2V4RA 2P20A 4GXQA 5A2QD 1NU4A 1FE0A 2ZZTA 5G0RA 4OYMA 5IV3A 2Z4PA 2L9NA 5FLXY 1GH8A 4B17A 4MK7A 4AYBD 4QR1A 4FNIA 2FPHX 2CAJA 4RZRA 4C98A 5HAOA 1T7PA 1GMVA 1VIXA 1CS4A 3KUEA 2Q66A 1ELOA 3IMLA 1NDKA 2D41A 4RNOA 1K73T 1FK9B 2U2FA 2LLZA 3LALA 4LRAA 2D9PA 2BRKA 3GZ7A 3HHLD 4QW9A 1NY8A 3DLBA 2LMIA 4MH4A 1RBLA 4EEYA 1S1XA 1IM4A 3DCAA 3OT9A 2XZDB 5I42A 1VQ5S 2M5YA 2VIHA 2HHTA 3BQ1A 2D7SA 1TL7A 1RAFB 2G2YA 4QBUA 3MAAA 3MFHA 2VL1A 2RU3A 3VNSA 4A8QA 1QVGR 4PUGA 1LKZA 4NXNC 2CPFA 2ZBCA 4PWUA 3KHHA 3DRPB 1MMDA 2JNVA 1Y7PA 1BHNA 3BN7A 4C7QA 1H38A 2QIFA 3AOCA 3ZZOA 3M8QB 2GVZA 5B0GA 4JV0A 4H4OA 5LSLA 2DGUA 2RB7A 5A2QU 3L8CA 4K4UA 1HPZA 2OPQB 1CJTB 1MU2A 2DCLA 1S77D 3NGRA 3OTDA 3WBZA 1U0HB 3C14B 4HR2A 3KNAA 1QE1A 4DV2C 4DR6C 3IEVA 4IG0B 1B0PA 1SB6A 1WNEA 3M7VA 3U1MA 4HEA9 4LQ3A 1WG4A 2OKQA 3MM5A 5CYJA 1CSJA 2W7OA 4ECSA 1GMUA 2MSTA 3M4XA 4YB5A 3KLHB 1HQUA 2EFGA 1WF2A 2LQJA 1XWLA 1RAOA 2CPEA 2RSQA 4IYQA 1HI8A 5FDLB 3TA1A 3MURP 2EC0A 1LW0B 3DC2A 2EXUA 1WC3A 1FE4A 4NA2A 3ZC4A 2EKYA 1R0AB 2DGWA 3G2XA 4ZJLA 1A9NB 4OX9J 3BEGB 3DMJB 5KOXA 4FXDA 3K5PA 5H9FK 1H72C 4LFBC 3LP1A 4J9OA 2V9WA 3GG0A 4CRJA 2HVEA 2I5JB 2QLFB 3DLEA 3L7PA 3D1HA 3TEGA 1K0TA 2MB0B 4GKJJ 2BE2A 2GNKA 4I7FA 1SL0A 3FEZA 1VRTA 3VAHA 1YI2S 2PD1A 4NXMF 3AAWB 1UJ5A 3QFWA 5HLFA 1KWMA 2XMWA 3FBCA 3B4DA 4MKVA 4OI6A 4R5PA 2UXDC 4WIIA 3DDIA 1D0EA 1UL3A 2B4OA 3VWSA 5F8IA 2PT7G 3LWLA 1PYSB 2AEJA 2WSFC 5BYQA 3H2VE 4F26A 1OPIA 2FC8A 2M8HA 3HULA 3K58A 1RT7A 1VMBA 2WOMB 3MI7X 3FGVA 5A6PA 5HMWA 2RMLA 2L9DA 4GMKA 3B7WA 4P71A 2D1SA 4FYWB 1X9MA 2E9ZA 1QM9A 2RUGA 4RW9B 5E0OA 2W1BA 5A0YB 5KG7A 2IA0A 1I1GA 3KMSA 3KMQA 2M52A 4O23A 4PCQA 3GFHA 2OFHX 4RL1A 3R9LA 2KXNB 2YQ1A 3VTIA 5EHHA 1SKUB 5K85A 2VB6A 4U6PA 3R1HA 4JI4F 4B3RJ 2V4QA 1T9UA 1UA0A 5GAEI 1HHQA 4Q8FA 3R7BB 4ITSA 2BQ3A 1EKRA 4DWIA 3NGSA 5ETKA 1J5EJ 5F0WA 4OYCA 4ZLPA 2A6OA 1BQNA 2DJWA 2F7VA 4I2PB 2EFPA 2C3MA 2HHSA 1RB0A 2NPFA 4LFAJ 4NWBA 1XMOJ 1S57A 4DFJA 2BKNA 3DHVA 3QIDA 4F2RA 3DM2A 3P96A 4KV8A 1I6JA 1UWDA 1EX8A 1PJ5A 2CPIA 3R5AA 4DSJA 1FNMA 2J0WA 2LA4A 4K59A 2J76E 4K2JA 4RBUA 5KT4A 3GLJA 3J81j 1L3SA 2EFNA 2P9GA 3UNYA 3F73A 2VQEJ 2PI4A 2LQ9A 4ECWA 4B3SF 1KFDA 3UQSA 2R42A 1T5HX 3V6JA 3CQ3A 4NCBA 3KYLA 2E7GA 3THTA 4YUDA 3CJQA 5E3RA 5HBMA 2BM1A 5LMUF 1HNVB 1TV6A 4N7TA 5JUMA 4H4MB 4MTNA 2AMCB 2MY8A 4ZVEA 1QSLA 2CQDA 3JSBA 3GB0A 4TLRA 4KO0B 1N88A 2VBZA 3CDWA 5C24A 2C3YA 1XTZA 2QA4S 2NZCA 3KLFA 4GC7A 3KXWA 3GYNA 5BSRA 3J7AN 1UVIA 2GV1A 3M2UA 3RAMA 2ZH2A 1I5OB 4DV1J 3SQGA 3IA0A 4JV2A 3POTB 3H59A 3SDEB 4KGZB 4X64J 2V67A 5E33A 4YQWA 4PXEA 1J5OB 3T5LA 1CULA 1LQ9A 2CQ3A 1RAJA 2YNFB 5B0AA 3T1YF 1VQ4S 2OLWA 4USKA 4DR7C 2HK3A 5GAHU 2XGQA 2CADA 2E1CA 2QMUB 1YJWS 4HACB 2J6SA 1T11A 3GIRA 2OEMA 2F8HA 5DQIA 4DPOA 2EGTA 1D8ZA 1TUGB 5IT4A 2P9CA 5D8HB 2ZUAA 1D9AA 1FDAA 2BOAA 1SV5B 2WSEC 2CQCA 4OZLA 1JOSA 4NLXA 3CJKB 3T6BA 2L3MA 2FJWA 2FVCA 2W01A 5A8KA 3RV2A 2AYAA 2GCFA 4C3KA 2E0GA 3VQTA 4F2SA 3RRHA 2VD3A 4GVBA 4IDKA 2EBGA 2PA3A 2ZOFA 4M5IA 1XS3A 4TY9A 4MKAA 2N7YA 3PZPA 2GAGC 1ZETA 1UJ4A 2C3PA 2VFVA 4DR2C 4DV2J 4DR6J 2KDOA 3MPYA 2CWKA 3ETMA 5IC4B 5HROA 4NCGB 1M5OC 3MCNA 1KFSA 2ZZNA 1KSPA 5ETLA 4WXWA 1SV5A 4PG4A 1ZTTA 1OMSA 3O5TB 4J9RA 2BX6A 4DX6A 1U25A 4OX9C 4OJGA 1VQ6S 2N7CA 3BO4A 5B0CA 3VZIA 1VLYA 2OMOA 2JVRA 4P72A 1U2RA 4QZVB 3ZFVA 3ICLA 4ECXA 4PZVA 5HO4A 2L41A 3C8YA 1YJRA 3N79A 4OX9F 3T5JA 5J2NA 4DQIA 2B5JB 4O3QA 4XO0A 1HHSA 1TFYA 1BQMB 1RHMB 2Y3YA 4RR5A 5L9XA 1QSSA 4X66J 1UVKA 2CA9A 3SDEA 1CJVA 6FDRA 3TQEA 3QRPA 1PU1A 1X4AA 2E1PA 5M2RA 5IWAJ 4DQPA 1SIZA 4RM3A 1REGX 5ADZA 1C2PA 5K20B 3CQ2A 2F4VJ 2DISA 3GV7B 1U26A 1XMOF 3IWNC 3LGMA 1UEVA 2ILZA 1JJ4A 1U8SA 3I9V9 3OFGA 1WDTA 4AXJA 5H1SV 4KKOB 4IH6A 3WC0A 4IUFA 1ZAXA 2XS7A 3I56S 1TKXB 1HR0C 2IDEA 1MNEA 2KL8A 4C9DA 4JM1A 3HZGA 4HTJA 3I5BA 1RLCL 5HQLA 4FVMA 1M5PC 4KGMA 1FRJA 3HKZD 4RUCA 1RAHB 2DNGA 3LP0A 1Z2LA 3FCWA 4TQRA 3VAJA 1FDNA 5D3GB 3OL8A 3NG8A 1QAJA 2GJFA 3M9MB 2KXHA 4GVBB 4IDKB 4WP3A 1T3OA 1SJ3P 1FX2A 3IPLA 4WXOA 1S49A 2MKCA 2OMLA 1RHJB 2ZH1A 4DL4A 5DGBA 4JI3J 2F4VF 2CWXA 2AU0A 3NCPA 2D3UA 4B08A 2R7VA 3EDRB 1S1WA 4LQ9A 3VAKA 4NCAA 5B0EA 2ZHBA 3LANA 3BN4A 3U1LA 4FTFA 1SJRA 3T5HA 5T8SA 4C0OC 2V8HA 3PYEA 4F0MA 4B3TF 1N48A 2DGVA 1YRXA 4C11B 3I0RA 5HJYA 2BBEA 1NJWA 2P2MA 2R3VA 4HACA 2CG4A 2VQEF 2J6UA 3GIMA 5A8RB 4YFUA 1U1KA 3A26A 3FJ2A 5AXLA 5ETNA 3RUBL 4DDFA 2ZKUA 2QLXA 1SPBP 4DOZA 4L75A 1WOPA 2B9EA 3MFIA 1U2FA 2UUWA 4M94A 5D0RA 1SKSA 2CUYA 4DL6A 1FD2A 1QTNB 3ITHA 4TU7A 4MH8A 1EARA 4FF1A 4JI3C 2V8PA 4K5RA 4NYOA 1P9QC 2C2DA 4I2QA 1RT2A 2W2NP 4NLSA 4CO2A 5F8LA 3CWJA 5KFHA 4Q5VA 4IR1A 5IT9U 1WHYA 3WX8A 1LWXA 3U7JA 5RUBA 1VQ8S 2BJ3A 2AW0A 2AEMA 3PX4A 2B8PA 2DKOB 5KFDA 1DQAA 1HI1A 2F40A 3MAQA 3KLEA 4DG9A 1AMUA 2BZ2A 1Z4UA 2W7AA 1RT5B 4LSZB 3DGPB 2J9EA 3V6DA 2QL8A 4IR7A 1N4LA 3LP1B 3R8YA 5JRHA 4NLRA 4QR0A 3DRRB 4KFBA 4OMFG 4M1KA 1S99A 2Z58B 4WBFA 2CNLB 5J1NA 3WIUA 3PW4A 2PGCA 2HS0A 1L5UA 3SCKE 4JI0C 4WKRA 3VGUA 1P1LA 2C2KB 2DH8A 4PWDA 2G4BA 3H7HB 1HBMA 1HNIB 2VQFC 2I8EA 4M8LA 3H5XA 1USPB 2VG6B 1XMOC 2DNZA 2LQ5A 1U49A 4NI2B 3AA9A 2AGQA 3W66A 4NXMC 2RRNA 2OELA 1XN9A 4ANEA 2D9OA 3GYGA 4LR9A 1RHUB 3R6GB 3GE9A 4F0KA 1FLOA 1FVSA 1WHXA 5KOWA 1WC4A 4ZVSB 2ZOGA 3JYTA 4EBCA 1HNWJ 4OZJA 3D6TB 3DRSA 3KK1A 4J9QA 4LF7C 1KKHA 4ED3A 3N5BA 2V50A 3W61A 1FJ7A 2PFDA 3CIMA 3TA2A 2JDJA 1RT3A 2RRBA 2YVSA 1XNRC 1WC6A 2E44A 4O44B 4R25A 1KEKA 3CC2S 3OW2R 3W3SA 1MSWD 2LEPA 1RAGB 2GAHC 1V3SA 2FHKA 3DRPA 2MHNA 1TELA 4OYBA 3IP0A 3R7SB 1N5TA 4BWMA 1FVQA 3D28A 3OR1B 4J90A 2CPDA 4IFVB 4M5JA 4J9KA 1KC8T 4LVOP 3K5OA 3MPUB 1IKWA 4FXWA 4FZVA 3SMZA 3SSQA 4NXMJ 4ILLA 2M5OA 1R8BA 3RG2A 3TEHB 1WC0A 2Z56B 3PDNA 2IJRA 1N32F 2D3O1 3R2DJ 5KFXA 1HNWF 2QYGA 4DMZA 4LF5C 1V3RA 2J0XA 4RNHA 1P4EC 2F65A 2RVJA 3EUNA 2ZDPA 2E5IA 4JI5C 3H40A 2WP0C 1XRCA 4L72B 1JJCB 1TK5A 5KT5A 2GZOA 2KVIA 3R5CA 4ZVTB 3IS9B 4ZCKA 4ECUA 1WELA 4PPZA 4K4WA 2XS2A 4HKQA 2G0CA 3MF5A 3P45B 2G1HA 4X65J 2UZAA 3MCSA 3NGTA 1LK7A 4QWCA 1LWCB 1B99A 2COLA 1VLAA 4ELTA 1IBCB 1HBMB 3G6XA 4NLWA 1TMMA 2AJ0A 1QAIA 1N0VC 1NJXA 1S0NA 1RCOB 3ILJA 2Q1LA 4EYHB 2NQPA 4V19J 2KRRA 2M7SA 1X5SA 1JMTA 2UUCC 3A13A 3BYRA 3HHLC 3BSCA 2DBBA 2IYIA 3M6XA 3OD2A 3CMAS 1C1BB 2I38A 3O8WA 3OBIA 4CO4A 1RAEB 5EX0A 3AB4B 2Z2YB 3OXGA 3QYYA 1FRLA 3M8YA 3TVZA 3BGLA 4W4MA 5DG7A 1CJKA 1M6XA 1JJHA 3DHWC 4USWA 4L4QA 4YDXA 2IYGA 3JAMD 2N3LA 4ZN3A 4DG8A 3DLGB 5KEIA 4LFBF 1HMVB 5CA5A 4AXIA 4Z7CA 3KLEB 1HPZB 2LU1A 5BSMA 2GQCA 2RNEA 1NCLA 3DM2B 1N0UA 3LTOA 5J2NB 2HFSA 3AJ2A 2GS8A 4DPWA 5AE3A 4X65F 3BSOA 1H2TZ 1T02A 2QMWA 4TYAA 4OJ3A 2X1AA 2RE1A 2YNGB 3G71S 1RWNB 2I6WA 1UVJA 3BM7A 3LP2A 1JIHA 3PHTA 3E7XA 1LXNA 1REVB 4OFZA 4ECYA 2KRBA 1S76D 1O0PA 4OI1A 2ZH4A 2AJQA 5IT9Y 2WSCC 5KG0A 3MM6A 2ZE2B 4HI1A 2CRLA 3CD5A 4KY3A 4ILRA 4O4GB 3ZZTA 4BLGA 1N6QB 4LFBJ 1WWHA 3AF6A 1NYEA 3K0JA 2AX0A 4RKUC 4LJMA 3KK3A 1W2IA 4ZP6A 4FN5A 4B9LA 2ZJQQ 4ZS6A 1VI7A 2OPRA 5BR8J 2D1TA 2OTLS 3OHBA 3R9WA 3UDVA 4U7UK 3RTVA 1FJGJ 2GIRA 4CM0A 1JLBB 3LAKA 3D0HE 4C97A 4YMEA 2FVQA 5E7QA 4JI6C 1NPRA 1MLAA 1VBYA 3ELHA 3MECB 4RVNA 1EJ7L 4JI8C 4N77A 3UR3C 2MJUA 2HNYB 2HVZA 4LSLB 5BYSA 1KLNA 1F5AA 2A2CA 3PFOA 3UFCX 5GAHI 4U5YD 2LECA 2UUAC 4HH0A 3VGVA 4NZ6A 2OEJA 4CYUA 4O44A 3TO8A 2OJ3A 4XDDA 3TA0A 4O4RA 1TL1A 4ANDA 3CULA 3KK3B 4EMDA 4DX7A 3ZO7A 4DV5J 1HW9A 1WTFA 2MXYA 1S7HA 5ETQA 2D27A 4RUAA 1DQ9A 1QY7A 4HT7A 3EPIA 3AODA 3D54A 2BACA 3K2YA 2XZWA 1F9FA 4ZITA 4PG5A 2UVRA 2EG2A 1YSJA 3HVWA 3GJQB 1YX2A 3OL7A 3VAIA 1V60A 3OFHA 2HGMA 4KT0C 1XC9A 2DRDA 3KDNA 1RWKB 1WEZA 4EBDA 2DGQA 4KJIA 2F8EX 2UXDF 1RAIB 3W9HA 1FHTA 1DY3A 3Q8VA 2X7IA 2XQCA 1HARA 2CZ4A 1N36C 1KHWA 4FDFA 3JS9A 4X62C 1VFJA 1IBLF 5LOQA 4CP5A 1VBXA 2RF2A 4JI0J 4KTTA 4ZJOA 4ECRA 1LWFB 2NXUA 3MMAA 4ECVA 1S1TA 1MDBA 1R6VA 2DHHA 1XNQJ 5GMDA 2CJQA 2Z0GA 1V25A 3MCOA 2CY1A 2N82B 4LF7J 2I2YA 2ASBA 1VBKA 3PY8A 1DARA 2DH9A 2B5JA 2OPQA 2IVYA 2LDIA 1NH8A 4USJC 3UDEA 2GIFA 1U48A 5KG1A 2MLZA 4IZ6A 4LR7A 1FJCA 4WKYA 1FRHA 4KYZA 2R2UA 4J9PA 2J9DE 4RW8B 4WCEQ 3G82A 1HNXF 2Y0SD 1NZAA 3A1YG 4QYZK 2DEJA 4YHHJ 2DPJA 4DSKA 1TVRA 2VH7A 2EK6A 5E2QA 1S9EA 2DH7A 2VONA 4Q0BA 2DRAA 1T9YA 2RHSB 4CLKA 3EPGA 4RO0A 2EWHA 3T3FA 2JEIA 4K4SA 1VEHA 3C3LA 1DBDA 2DHAA 3GJRB 4Q44A 4LF6J 2KFYA 2IAJB 3KJFB 2XO7A 4ZIVA 1M1KT 3IR5B 1S59A 3BR8A 3A8IA 5C2CA 5K8PA 3PRDA 2VZEA 5HMZA 1I3OB 2C42A 2FHOB 3JQMA 4XPCA 2DNKA 3KG0A 3M8PA 5E3CA 1X4HA 2VBXA 2MKHA 3MOZA 3QT7A 3N0VA 4R8UB 2Y8WA 3OVSA 3CCVS 4LF9J 4R5PB 4P73A 3MEDA 2MKSA 2B4UA 2EBEA 1U1LA 2HZAA 3AY0A 3TUJC 5IXUA 3Q2SC 1S1UA 2V4JB 4ZN1A 4I64A 1NRKA 4A8WA 2GMJA 3OSPA 4IQXA 1O51A 3DI6A 4D3HA 2PA8D 5KG3A 2K7JA 4ID5B 4QWEA 2LDYA 3OTOF 2EG1A 1M0SA 1NMEB 4Y2MA 4ER8A 3I4HX 5CH7B 5LT5A 2PC6A 3IBCB 4DL3A 3OR2B 1DJ0A 2YKMB 2NUUG 3B4MA 3DYAB 3GIIA 4DV4F 1CJKB 4KH0B 3VVUA 1ZYQA 3CD0A 1IXKA 3NNAA 1CQMA 4KSEB 3MXHP 1ULTA 4OV1A 1HYSB 1ZM9A 3NCQA 1HR0J 3ZTRA 5C25A 2GGPA 1WKKA 1YRUA 1S5ZA 3CO9A 3D6FB 4JOUA 2JFKA 2E5HA 4J9NA 4DLEA 5CXTA 1S9GB 3FEXB 4JI2C 3O3LA 5DQGA 4L74A 1JKHB 2PROA 5F8MA 1M1HA 4DR1F 2C28A 2WB4A 4J9UE 2CQBA 2QZ8A 4NLUA 3FCHA 3FFIB 2R4FA 2K1RA 3NRBA 2IDLA 2MZJA 3C15A 3GCWP 5L1IA 4GKKC 5C25B 2XY6A 1HYSA 4X66C 1HNZJ 4USMA 5T41A 2XMJA 2QA2A 1EIYB 2XS5A 4DCTA 1RISA 1RT5A 1MU2B 4ICLB 2UVVA 4O3OA 2XNRA 4MIWA 5HMXA 1KKGA 4LFCC 3DLPX 1XRBA 3HSZA 3B78A 1RLDA 5I4MA 2ZBIA 5IV4A 4HHHA 2XULA 5KAKA 3T1YJ 1PCAA 4JV5J 1W26A 2N4DA 1N32C 5H9EJ 2MZTA 2A6MA 2ZWOA 3FKBA 3J7ZT 4DV7F 2CPJA 5LMNJ 1JWWA 1S48A 1IBMC 2YNHA 3BO3A 4G1QA 1SKWA 4OHXA 1Q81T 3W65A 3GWCA 3O2IA 4PR6A 4DJBA 4CLLA 2OIHA 3P49B 1M6XC 3R9XA 2W9AA 1UMJA 2QVZX 1FJGC 1MN9A 3EGVA 4OZ2A 3M2RB 5AJ3F 2IBOA 3HJVA 4JI7F 3PO4A 4HHUA 4DFMA 1HNZF 2OUGA 3ZTSA 4PEOA 3MM9B 3OHAA 2GVDA 2MLXA 3FCVA 4CLFA 5AXKA 2YWKA 2BE9B 3ZZRA 1VIOA 3CGIA 4G1PA 2OSQA 1SCJB 4EGLA 1FRMA 4RNFA 3LA0A 1JXEA 2HFZA 3J7Z5 2W4PA 1S9EB 1KHVA 2YKOA 4MJKA 4P7VA 1XJWB 2CG8A 1YVFA 3W60A 4BCAA 1VK8A 2YNHB 4WJBA 1EAYC 3K5NA 4DQSA 1HI0P 2OTJS 3DRXA 1SJFA 1Q78A 1FKPB 3DDKA 4PXBA 5HLFB 2HWIA 1T03B 3CW2C 1WCJA 4LBHA 2KZZA 2ACYA 5F8HA 2FIUA 1IBKJ 1CC7A 4ODJA 5HSPA 3RR8A 4AE5A 4DPTA 4XX2A 3TDEA 2EFQA 4QPTA 1Q79A 3M8RA 4JI4J 4B3RF 4PHTA 2JH3A 2HPUA 3DOMA 2XMAA 3HO1A 2V9KA 4NRUA 4ATNA 4LFAC 1GXLA 4DV3F 5CYMB 3HD1A 3SFUA 3TW0A 1U1NA 1R0AA 2CQ2A 3A3OB 2CKWA 1R0BG 1WJ9A 2MQ8A 3CDBA 3KLFB 1RU2A 3UEBA 1LW0A 2AJ2A 3IGVA 5K14B 3SCIE 5ETSA 5E3AA 1QDUB 2DGOA 5KFOA 1HBUA 2YWWA 5DG9A 1IKVB 1AW0A 4CO0A 5G4DA 1UWAA 1FTRA 1TP7A 1SH3A 4NLQA 1NEEA 1BMQB 4KQZA 5AE1A 5K8MA 2VG7B 1RCXB 4DZDA 2OI2A 1YZ7A 3IBWA 1VQ9S 4KPCA 2ZH5A 4EK2A 2IY5B 2DHSA 3C5EA 5FD1A 2VDHA 1XQIA 1AUDA 4WE1A 3EERA 4LF6C 1QE1B 2X3DA 3LH2S 4YOEA 3H2UB 2XC9A 1U0HA 3C14A 3M30B 2CJAA 4NOHA 1BUXA 3NY0A 3VQSA 4DR5J 5J2MA 1HBOA 1PAUB 1J5EF 1RDRA 2XYGB 2YBVA 4DR6F 2IM1A 3MGJA 2JC1A 5LJ5Y 2LCWA 4JYAJ 4X4OA 1SXLA 1T9TA 1YJTA 1LW2A 1X0FA 3C6TA 4OZ5A 3KHLA 3MM7B 3WDOA 5I3PA 2J0QD 2P2BA 1IKWB 2HNYA 4LSLA 3ETCA 2DXFA 1IKXB 3HSDA 4F4WA 1TL7B 1V9OA 1HIYA 2P02A 5CD4A 4YB1P 4G36A 3SZ2A 3K7RA 1XBWA 2L48A 3EDQB 1OSCA 2YWGA 2UUBJ 4DV7C 1J2VA 5I42B 3NS5A 2GO9A 2CNNB 2O1PA 3GJTB 3BQ2A 4B9MA 1S97A 2BDPA 1R8CA 5D4LA 3HHNB 3PJ9A 3PYGA 4DUYF 3LO3A 3OLBA 3HHLB 4U95A 2AYMA 3MMCB 2MQNA 2HHHC 4FUQA 2DIVA 5LMNF 2FUG9 3D1QA 4ZVHA 8AT1B 3PW7A 1N6QA 4LRDA 4FKXA 4Z2XA 5A76A 2FGOA 4FF2A 1B7FA 1ITPA 2CQ4A 1U6FA 4G1QB 1DHMA 3L7UA 3CT9A 4LF1A 4D4GA 2DVIA 2WONA 5HQMA 1B70B 4K8RA 3HT3A 4DR1C 3Q83A 3J80U 4U7CA 4NLTA 4RW7B 1AYEA 5HATA 1F2GA 2R7WA 3DOKA 3BGRA 4A47A 4DFKA 3UX3A 2VFTA 5K5MA 1BD6A 5IZHA 1Q7YT 5BURA 4NE9C 1H2VZ 2CJYB 2H5IB 4D4IA 4F4KA 5HQ8A 3EX7B 4HT5A 3G6YA 1NJYA 3EVOA 4TU9A 4UQGA 2RKIA 3W8GA 4DN0A 4RW6A 3JB9k 3H42A 3M2UB 1VC6A 1Q86T 1WI6A 3H0PA 1FCAA 1Q5YA 3KJVA 5IM0B 1VQ7S 1DRZA 2QLJB 4LFCJ 1N36F 1FESA 4Y34A 1Y0HA 5MAOA 2RQMA 3FZ2A 5KFKA 4UOHA 1WF0A 3BGRB 2MCQA 2J7WA 4I6WA 1UVNA 2CJKA 1CLFA 3NMAA 4LF8F 4DR2J 5HL7Q 3IM9A 2QVXX 4OX8A 1FWPA 1T9XA 3GTYX 2MMAB 4IRKA 1WOOA 3FQKA 3RBEA 2WCXA 3I55S 3D0IE 3BGFA 3M2VA 4CCHA 3TZZA 2CJ9A 1WD6A 2W9CB 1R7IA 3ULHA 3DLKA 4LR8A 1RTHA 1OS5A 4F04B 3H5UA 4N56A 2APOA 3C6UA 5E3QA 2VFSA 1JNRB 1TZ0A 1QVFR 2D1CA 3T41A 2P6SA 3NOCA 3PBKA 1L3UA 3TUZC 2MQPA 2KT3A 1RTIB 3E8OA 3BGOP 4DLGA 1SJ1A 2DNMA 1TK0A 2RRAA 2JX2A 4HL9A 4DSLA 4USHA 3OTEA 3O6QA 5KFSA 1WUUA 4UTGA 3MAAB 3G6ES 2ROPA 5IQQA 3RGIA 4DUTA 5JMNA 4NLGA 4DV0J 1RHQB 1TKZB 2JJ4D 4YY3J 3BGUA 3Q8YA 2NYIA 1AROP 2A10A 3AOBA 3PYFA 4CLWA 4ZK7M 5GMKa 4R0MA 4YS2A 1KTVA 1SIWB 2NS1B 3V2UC 5A8WA 4DEZA 3PXGa 4NYZA 3JYTB 2AGOA 1W2BR 3QJJA 2E1AA 2O3DA 4WV3A 1BWVA 1XMBA 2ZE2A 4R1MA 1T9WA 3N6LA 1OQ6A 2VOPA 3UVJB 2XY5A 1AZSB 4F4ZA 4IOBA 4DV4J 2DXDA 2ZBQA 4C8OA 2CQGA 3SIPB 2J8AA 3SCJE 3J81Y 1Q53A 2WD9A 1RWVB 2MQOA 1T9VA 4OV6A 2EFVA 4WWSA 3ZZYA 2E5LC 2JNJA 4P2XA 3QLHB 2NYHA 1U1QA 3H20A 4O0IA 5EDWA 1NKCA 3U02A 3ZTQA 1T3NA 4JYAF 1C0UB 3S82A 3TANA 1N5YA 3DLGA 2ZOMA 2HRUA 3QNWB 3CC4S 2AJ1A 3F0NA 2FJVA 1BQXA 1NAQA 2DY9A 4KAIA 4DU8A 2KT5A 3LNVA 2YY3A 1Q82T 1EGAA 2WRMA 1R3NA 2FC9A 1OPZA 1SUQA 2EKNA 3R7NB 1JK9B 4CLTA 2DK2A 5BR8F 5EWEA 1VQNS 4M5LA 4PG6A 3W2WA 1EP4A 3S6EA 2D3ZA 1DTQB 1MWQA 1SH2A 4P10A 1F3VA 3TAPA 3EZUA 5DM7Q 3DKDA 4M5HA 3IO1A 4CO3A 1L2FA 5DDRC 1MW7A 3R6LB 2Q43A 1LWCA 2GGPB 4HI2A 4I67A 1S7IA 4ZHRA 1MDFA 3IRXA 2H4YB 2VKZG 5F3ZA 1G3OA 1IR1A 4ENOA 1LQLA 3M6WA 4A8YA 3ENAA 2FYXA 1YJ9S 1H7WA 2W9BB 1AFIA 3MPWA 3N6NA 4TKTA 3JXOA 2H9ZA 3R2CJ 3HT0A 2MGZB 3KJNB 3C15B 3X1LB 4K4TA 1SQEA 5A8RA 1QLNA 4WIQA 2ZC3A 4PG7A 4MMOA 1FDDA 5KG6A 1TK8A 4QWAA 3W64A 2HVDA 4RJVA 1PA4A 2IC3B 3I5CA 2KTQA 3KJQB 1PO6A 2MKYA 3KLGB 4WP9A 3Q24A 2E8FA 1X4CA 2OHDA 3KLIA 4MFBB 4BWJA 1TKDA 2KM8C 4HPVA 3HCXA 1GTHA 2VOOA 1RUSA 4NDNA 3NNCA 3GKUA 1SBRA 2GHVC 3PJXA 3RB3A 1D9DA 2YPZA 3B54A 2BE2B 3CCRS 2GHWA 1OYDA 4V1Ak 1RT3B 1V6HA 3CJSA 5ITHA 2IAJA 3QIPA 1EQMA 5DJBA 3B6BA 2WK4A 2YWHA 1LNQA 3K57A 3LP0B 1RACB 5D3GA 3DRSB 2HJGA 1VRQC 4O4GA 3HVAA 4ZVQB 2FLPA 3L95X 1QWIA 2HHPA 2HQGA 2D3OR 4X4QA 2HMIB 3CJ0A 4M63A 3S7RA 4LIRA 4AUKA 2NREA 5EN1A 2I9SA 5F8GA 1G4CA 3CCQS 4IRDA 5CZVA 1HNVA 4ES3A 3SXLA 1X4GA 2NUHA 4KHPF 4CH0S 2C2RA 4N5SA 1YJUA 4Z7YA 4PWDB 3PW0A 4MKYA 4ZJZA 3ZNUA 2X1BA 3JQKA 4M5DA 4CQ1A 2FY8A 4P9SA 3BSNA 3KXDA 2HBRB 4K4VA 3OVAA 3FDSA 4HHJA 2B4VA 4LFCF 1SJ4P 2LQ8A 2FJBB 2LU2A 4YDDB 1TMJA 2YKMA 3DYAA 1HBNB 4ZLNA 5CCLA 1KS2A 1T94A 4EYIB 1TUWA 1Z2ZA 4DL2A 2FZCB 2UUAF 4M5MA 4ELUA 2E1RA 1M90T 4YY3F 4LF5J 5BUQA 5GTDA 1TKTB 2KG1A 3BKUA 2Y27A 1T05B 3OPKA 2UXDJ 3LOUA 3E01B 2P2JA 3ET6B 2ZBRA 5LXYA 1TTHB 4DV0C 3OFFA 1X4DA 5T7LA 3Q86A 1LEOA 3C2PA 1JLAB 5KT7A 3TUFA 2GVDB 1NK6A 4NZ0A 1R8AA 1KR4A 4RWXA 1Z1ZA 3TYTA 3HM9A 1URRA 3BPDA 5KFUA 1BXNA 3V4IA 1LWFA 2XY7A 2HHHF 3I08A 1IWGA 4ZKAA 3BBFA 3R5BA 4LF7F 2YWFA 4CYUB 3M05A 1IBLC 2B7CB 3RZAA 3EVMA 4B9SA 4X62F 4DPXA 4NRTA 4C11A 4HTIA 2AT1B 3MDFA 3LGXA 1UVMA 4OHWA 3QRQA 2RH3A 4O0NA 3TOQA 5FJ4A 3CW9A 1ULRA 2PSZA 3L9ZA 4KHPC 3GMGA 2AYGA 1DTTB 2J9CA 2IBKA 4LF9F 2V69A 3MM7A 1XR5A 2HHVA 3D67A 1LW2B 2R8IA 3I0SA 4HDHA 1PGZA 2OP5A 4FYXB 5FIIA 2MGZA 4DS5A 2CYYA 3AXKA 1RTZA 5DDOC 5GVQA 3PVXA 2OPPA 3UDLA 1VQOS 3BH7B 1RG9A 4I69A 1T95A 2BH1X 2H65B 3QGGA 5B08A 1HR0F 5KT2A 5KFRA 4AD6A 4FS2A 3CCMS 3CPWR 4M5NA 4DUZJ 3FBBA 3L3CA 3Q8PB 2WW4A 1NSAA 1FNXH 1P9YA 4KBIA 3MECA 1JJ2R 1SI9A 4DR4C 4Y2IA 1HNIA 3TJAA 1QUVA 3P5BP 4DX5A 4GS5A 1HMVA 1Y3KA 4PABA 1FFSB 2BVZA 2VPXB 3DOLB 3O44A 5B09A 1K8AT 3BDPA 1UJ6A 4M5GA 3ZTPA 4ZDNA 1HH2P 2CU6A 2RQ4A 1OSDA 1DFDA 4DV1C 2FHMA 2XBPA 2YWEA 4ZVUB 3GPAA 5AJ3J 1KOHA 2YWBA 5L1KA 4DR3J 4RU9A 1U6ZA 3UZ0A 2ZM6C 1MWZA 5E3PA 2NXJA 3LPEA 4DR5C 3MM6B 5DG8A 1C0UA 4OYPA 2A2DA 2DNYA 3W2VA 2R2RA 4WTYA 2DEIA 3FK4A 4B3SJ 1AFJA 4B3RC 2O67A 1KRPA 3LP2B 3JSRA 3QLHA 4C48A 4EUVA 5KFWA 4WF9Q 1RADB 2BJDA 2K06A 2Y1LB 2V94A 2KO1A 3M32A 4MIAA 5LM7E 2NSBA 3HFVA 1VRUB 3DGVA 1U47A 5L39A 1ZPVA 1EP4B 3FSYA 3US5A 3KUHA 1V5VA 3G8TA 4ZPWR 1ACMB 1KD1T 1B0TA 4UY85 1JLBA 3P5TL 4KGVB 5AE2A 2HGNA 3KUGA 4XDCA 2W7PA 4G6VB 4KPYA 4X4VA 1JLFB 4DCUA 1L3KA 3MMCA 2VODA 3HHLA 1NK7A 2JOQA 3O1LA 3QQCD 4UZCA 5DRKA 3WX4A 4X64F 1S9FA 4IO1A 2LVWA 3VVTA 5HN0A 1IJFB 2DO0A 5EWGA 3D66A 1YJNS 3HHDA 5L38A 1IKYA 2E5GA 3JSYA 2KH9A 3QPIA 2ZDOA 3TJ9A 3ISZA 5KG2A 2VHGA 1VBZA 2XG8A 1S6QB 3MHYA 2DHMA 1F0XA 1XRAA 4RBVA 2MSSA 2YQ3A 1RY2A 2ILYA 2UV8G 5K8NA 1XNRJ 2IPOB 5D78A 4JI0F 4V19X 3MCMA 1F9EB 3PRBA 4I7FB 4DR7F 2C3OA 1FTCA 1ZB8A 3A8JA 3G96A 3CQ1A 1U1RA 3ILIA 2BW2A 3EWGA 4P74A 1IN0A 1OJ4A 1CJUB 1KP6A 1UWBB 2V2ZA 1FO1A 3M1VB 4DX8H 4TQSA 4P52A 1JXLA 2E5LF 4O3SA 5F8NA 2CJBA 3CD6S 2ONFA 3B8HA 4B9UA 3NAIA 2AV5A 3VALA 3D4JA 2C2MB 5IWAC 1C4CA 5L8RC 4C6AA 4KE5A 2E7WA 2QRRA 5FDLA 2K1RB 3Q8QB 2YKPA 2XCPA 4MIBA 1KDNA 5LMUC 4F02A 1HQUB 3TX0A 1YDLA 3C46A 5KFGA 1IBMJ 3BDEA 3EVWA 5K8FA 3C66A 3LPYA 2KFNA 1RKIA 4B3TJ 4X65C 1NLKL 1R31A 2KI2A 2LEAA 2NSCA 3R5JB 3H5YA 3UR0A 1J5EC 4E2FB 3CO0P 1N2FA 2QX0A 3OJUA 3UNGC 2XLKA 1ZBTA 1JLFA 1SL2A 3ZZ0A 1CJTA 5KFFA 1DQ8A 4F67A 1X8DA 2NCLA 2H4WB 4K2XA 3R1LA 4MK8A 2HQIA 4DG1A 4WPAA 3KG4A 2Z8QA 2XGPA 4A8FA 4QQBA 5DM6Q 4RW4A 2CZVC 3SBMA 2AKWB 1P6TA 2JRSA 2V8GA 5D0EA 2ASJA 2HBQB 1FRIA 5DDQC 2FVRA 4DS4A 1WEYA 1NO8A 2FLOA 2BANB 1DTQA 2KZFA 1JQGA 3I87A 3MUVP 4LRCA 1SC6A 5IC6B 2CVEA 1TAQA 2LFVA 3W2VB 2FLNA 4FKYA 3Q22A 1VQLS 4ZP8A 3MUTP 4LF4F 4DUZC 4QWBA 2B8QA 4A8XA 1GMWD 2B7BB 4UUXA 4C8LA 2BJ1A 4JI5F 4X4UA 2MZSA 2DNOA 2QN6B 3DU6A 1NK0A 3CB4A 5F8JA 4ES1A 5THWA 4EO6A 4I4BA 3H4DA 4HYKA 4PROC 4I6YA 1H7XA 2AJ4A 2MQLA 5I3UA 2GQQA 4UQTA 3A8EA 2MZ1A 2ZBPA 4DHVA 4DI6A 1RT2B 3JSMA 4DV6J 3BO2A 3TAQA 1SKRA 2K7KA 4B9NA 1B64A 1O90A 2CXCA 3HJFA 2KG0A 2GA7A 4DCSA 2HQFA 3AXMA 3GJSB 5DS7A 2Y9HA 9RUBA 5SZTA 5A19A 5BUSA 1YTYA 3O2EA 2J6TA 1OY6A 1WEXA 1HWKA 4DPUA 4IO9Q 1H6KX 2VFUA 1X5PA 2OPLA 5J2QA 2XR1A 5LMNC 3FC9A 1VJQA 2GMLA 4I9FA 2FGCA 5F9LA 4P2SA 1K1QA 1WG1A 4KFBB 5DZ7A 2RT3A 4DF8A 4DUYC 2MTLA 2W24A 2HZVA 3QT5A 2WW8A 2V63A 2VG7A 1DTTA 4NMXA 4NLPA 2RF2B 4X4PA 4KKOA 3P3DA 4JI1J 2MEWA 3NBPB 3T1AA 4ZCIA 4H4MA 4DQRA 1U8WA 2Y0BB 2B9YA 4QOTA 4Q45A 2BV3A 2DYAA 2AIRB 4DR3C 1BE4A 3P6YC 4NLDA 3BJYA 3CCES 3M8ZA 5HP1A 2HRYA 1N5VA 1VHIA 1F60B 2B43A 1RWMB 2HURA 2KHDA 2Z30B 3F44A 3I6PA 3IAS9 3LGNA 3SSRA 3UVJA 4TYBA 3SYZA 4J7CA 4OYAA 3VGTA 4C3LA 1OWXA 1NJIT 1EB0A 3KFWX 3V4IB 3RR7A 1ZH5A 4JI4C 3GR1A 2VQFJ 5B0BA 3AD9C 3MR2A 2Z57B 5DZ6A 1YZ6A 2DY1A 3LF0A 1O8BA 4MK9A 4OI4A 4CNYA 4OL8A 1FXLA 2VA2A 3QWPA 4LF6F 3EGWB 1AXQA 3IWLA 2QMXA 1RWWB 4U67Q 2GC8A 2FDNA 1P27B 2HZCA 2FY1A 3OR1A 2RIJA 3PNIA 2BUNA 3D6HB 2GIQA 2Z2LA 2P2FA 2ZWPA 1VOMA 4ZVRB 5KTQA 4IR9A 3K6RA 4K0KC 1LFPA 4PXCA 1RTJA 1Y9OA 4X64C 1BY9A 2AYEA 4LT6A 2UXBF 5JXSA 3OUYA 2HEKA 3C6UB 3HD2A 1WACA 1UEKA 1WI8A 2MMYA 1AUSL 1YG0A 3WZ0A 4CLZA 2ZM6J 3PX0A 1WHVA 1WC1A 3NGKA 2VPYB 4OYOA 2RDIA 5T7LB 2X3GA 1T0TV 3WHIA 3R97A 4FBUA 1OYEA 5K8OA 1EKSA 5G0RB 3W5ZA 2ZJRQ 3CW8X 4JUZA 3GU0A 1NXIA 1VRTB 1PG4A 1H0HB 2NLWA 1U1OA 4JI5J 4RU2A 4DSIA 5GAGI 3N9UC 1LCIA 4H4KC 1U1MA 2F4VC 2F1FA 2XI3A 3S01A 3KHRA 1DURA 1RBAA 3T9ZA 2ZNYA 1SC3B 3A3PB 2MLYA 1X9WA 2F63A 1KQFB 3UD4P 2W8KA 3H25A 3MMAB 2HFOA 4CLSA 2DNNA 2DNPA 4J37A 2MY7A 5C24B 4GKJC 3AA8A 2IVFB 5HI7A 3HHKA 5C5JA 2UUCJ 2F4FA 1TV6B 1JLGB 2R8JA 2YNIA 4N47A 3MEEB 3J7YI 2VC1A 2V34A 2WZ1A 1ZZNA 2KB2A 3CIZA 4OHVA 1V26A 2Z51A 3J80Y 5ETMA 2CXEA 1QUPA 3FVYA 4UUWA 3TUIC 2HHXA 3N4WA 3GV8B 1HKAA 2M0GB 3UCGA 4KHMA 1KQKA 7FD1A 2X1GA 1IWAA 3IS9A 4BC7A 2O66A 3KNGA 3HK2A 3T1YC 2YX7A 2H1YA 1Y5NB 2H54B 1P1TA 4EO8A 1GX6A 2CPYA 2DR8A 3J7YU 1LV5A 1JLCA 1SC1B 5D4PA 3KHGA 3EQ6A 2YCBA 2Y1RI 2X1FA 3UOWA 4QJVA 1FKOB 4LIWA 1JNZB 1VYAA 5B7WA 2XTJP 3HMJG 4PUIA 2XO6A 1ML8A 1RE1B 2HLTA 5A8KB 2ZKTA 4Q2LA 2A1BA 2MQQA 5IT9D 2OD4A 5BYRA 4ETZA 1NKEA 3T1HC 3H2LA 2XMVA 1OY9A 1O92A 2IJFA 2PN2A 4CLYA 4USIA 4R8UA 3PKMA 1RXOB 3UWTA 3W2WB 1H73A 3MR5A 2VF3A 3FQLA 4MAKA 3B82A 3MR3A 1DZ5A 1RWXB 2V2KA 5KYTA 1GXTA 4TY8B 3W8PA 4C8ZA 1K0RA 1O93A 1GX5A 3D5MA 3NWGA 4CWBA 2ERRA 1I51B 1XNRF 5KFJA 2XM3A 4PUOA 3OXLA 5H9EK 4N8OA 2VQEC 2C2NA 1CULB 1GXUA 2W4CA 3D9BA 3FNNA 3HHEA 3I5AA 4B02A 1Q8LA 1SL1A 1N36J 1U09A 3FZBA 3DNCA 2F3JA 1U4BA 2H3EB 3SQGB 3KTQA 1KTQA 3FMBA 4USTA 5A2QY 1VGYA 3NEKA 1UZHA 1X4FA 3BREA 3MR7A 1RTDB 1Q5VA 2QYCA 4C8MA 3UI3A 3HPOA 2AQ4A 2JEFA 3D6MB 2UXCF 3UW1A 4PKDB 4ANCA 2R2SA 2J8SA 4YP3A 3ZTOA 2YH1A 2ROEA 3TZYA 2HHWA 3DLLQ 3OTCA 3EGZA 3ONQA 4EZ6A 1PC4A 4CH7A 5A8WB 5BXIA 5F9NA 1FWKA 2XWYA 4RW9A 5A0YA 1CJVB 4I1TA 1S1TB 1JB0C 1G1XA 4ZVFA 5E5NA 1HWLA 1PJ7A 4CLPA 2P2CB 2DPIA 4MKBA 1U1PA 2AEFA 3VV2B 3QMQA 1VQMS 3E01A 2KDNA 2PIIA 2O01C 1PG5B 1J27A 2HVHA 1YHQS 2HKEA 4OXIA 3NLCA 2ADCA 3GPCA 1YK9A 2HGLA 4PXDA 4RW8A 3QRRA 2ZH9A 1LOUA 1X60A 1AT1B 1K47A 3OJSA 2DT9A 3A12A 3TR3A 2GO8A 3M8SA 3SI8A 4Y6IA 1S1VA 4TN2A 2RU9A 1Q1KA 4DCVA 4C8YA 5L1LA 1FXDA 1IB8A 1MXCA 2HNDB 3ZNJ1 5EUHA 4JI8J 4OZ0A 2HRTA 3N5FA 3NI2A 1F2HA 2B51A 1IBKF 1WSVA 1PILA 1RHKB 3UN3A 2J7UA 3VNQA 3I0RB 2KVQE 3PX6A 1WDDA 4Y65A 1NB2A 3TP2A 2QV6A 4F25A 1T8EA 1S6PA 4TU8A 2XCAA 1HQEA 1BC6A 4X4NA 4ZOSA 2NZ4A 3BH6B 1RT6B 3IAM9 3CF5Q 3Q8UA 3T1HF 4MYTA 4ZPAA 1U2CA 4XTTA 3D68A 5IWAF 3TAMB 1FKAF 1QM4A 1BLUA 2QVYX 3TVYA 3HSJA 3HSGA 2XYHB 3N6MA 3QSYB 5D0GA 2WB1D 5DO2A 3NGDA 2MDAA 1R8PA 2I5JA 4ZLJA 4FF4A 1PBAA 3MUMP 2M2BA 4TPSB 2F9DA 4CI0B 4G65A 2Y1JA 3POTA 3WIVA 2CNKB 2YX4A 3M8QA 4EWTA 1BWEA 3DOKB 3THPA 1MXAA 4F4YA 3C19A 2DIUA 2XMMA 4O3RA 3CD7A 3NXZA 1DLOA 2NXEA 3K89A 4R1LA 4Q7AA 1HL6A 1S6QA 2UXCC 5E41A 3CCUS 4FXVA 3NYRA 2VA3A 4OQJA 5ETOA 5I3UB 3TUPA 1S9GA 1M5VC 3A8KA 2M9KA 5L46A 3MR6A 1S1XB 3RB4A 1UFKA 1VS3A 4YR2A 3CC7S 2GJIA 1APSA 4J5OA 1IR0A 2XHCA 1N54B 4OJHA 4ED0A 2JSXA 2JWNA 3FCCA 2W4DA 3HKWA 3NAHA 2HNZB 4DV6F 4UOCA 1K44A 3PW2A 1LWEA 2HHUA 4I68A 4CO1A 5DLGA 3UCUP 5HVFA 1KOOA 3V6KA 2CDQA 1OO0B 3E51A 1PYOB 1X5OA 1BGXT 1RYSA 4X84A 2IA6A 1TVRB 3QFHA 4QIWD 4URQU 3G82B 4I2PA 3PEHA 4GO5X 4DXLA 2MKKA 1NJZA 2WHOA 3C6TB 2UVWA 4JI1F 4I2QB 2H51B 4QR2A 4D3GA 1YLXA 5M2UA 6FD1A 2F5GA 1ZB9A 3GIJA 4AL7A 2JEGA 4F3OA 2JMPA 3TQIA 5ETRA 2DTJA 4NL5A 3SEOA 3ZZPA 4DN9A 8ATCB 2HWHA 4FNHA 2GJ2A 5AXNA 5CYQA 4LRFA 4DV1F 5KFVA 4YEAA 3GFZA 3NGUA 1SQGA 3W7BA 2BQUA 4NOZA 3IN5A 2R7QA 1UW9A 2WVBA 3PYDA 4PWWA 2QLWA 4A4JA 2R8HA 1YQHA 3PG9A 4EATA 2UXBC 1G6BA 4LREA 4A8SA 2AZ1A 5KFCA 5GAGU 1FA0A 1TKZA 1AA1B 1UETA 2QJ3A 5DGAA 4B3OA 4RM2A 1FEEA 4ZP9A 1UZDA 1AB8A 3R27A 4IFVA 3QBCA 4J9LA 1DLOB 4F7VA 1W7WA 3BR9A 3MEGB 3G6VA 2E5LJ 3OVBA 1F5BA 3SFGA 1IM6A 3ILLA 4PYAA 1AZSA 3D3CJ 5A6WA 4F50A 4K50A 2D7VA 5HJXA 2ZJPQ 2PEHA 3VR1A 1ZTWA 2CQ1A 4URSA 1N32J 4AQYJ 2DGTA 2MHEA 5D77A 4ZCLA 2PI5A 4OYXA 3P8BB 1HFEL 4EBEA 3BBCA 3DLEB 3DOMB 3OSNA 2BJOA 2RJZA 3UN2A 4A46A 4ZJQA 2P6TA 4AQYF 3KK1B 3VGSA 1X4EA 4OI0A 1IR2A 3KK2A 2UXBJ 2EC2A 4NLVA 4ZPTR 1M5KC 3DHXA 1S4EA 1M5HA 3BB5A 2XLIA 4L3KA 4WU3A 5C2GA 1NK5A 2QL9B 5IFMA 3L4BC 4KRWA 4KHPJ 2DO4A 5HP1B 2C2EA 2DNQA 2IC3A 1NPPA 4J91A 2HBYB 1HBUB 3GR0A 4WFYA 4GC6A 3D0GE 5K14A 4C2MA 4KIAA 2UU9J 3A4TA 3LQVA 3EYZA 2QA4G 4ED5A 3J7A1 2QE5A 2V8DA 2R8KA 1KLMA 2E29A 3NYQA 2B6AB 1RT1A 3JAMY 4LSNA 1MMLA 4DR5F 1HLWA 2M70A 2L08A 1VK3A 2A0FB 1N8RT 1HHTP 2MYFA 4IG3A 3GILA 2JEJA 2QA1A 2UUBC 3HXMA 2DCUB 2BRLA 3F56A 1REVA 3M2VB 3NKYA 4ZVPB 3OL6A 3DFEA 2E9TA 1TL5A 1IQTA 4NI2A 3OL9A 2AX1A 4TVAB 1WC5A 2JLEA 2XSFA 2M3DA 5ETPA 2RDJA 2KZ0A 1FDBA 3H4BA 2IFXA 3QAUA 2E8EA 4K0KF 2QW0X 2EEYA 3E3XA 3QO9B 4CNZA 1BQNB 2IRXA 1VQYA 3EZOA 1K9MT 4NLOA 3G7SA 2ZUGA 5KT6A 2Q3PA 2YKAA 4GO7X 1MWYA 1RGVA 3OQ2A 4LF4J 1S0OA 3FRZA 3QT8A 4BHQA 3CJEA 4WZMA 5DLFA 5J1EA 3KJVB 3CJ3A 1XNQC 4ZCMA 4CH1A 4P75A 1YJ7A 1RT1B 3BZQA 3PKYA 1FJEB 5HK4A 1XMQJ 1N34F 1FK9A 1NH7A 2AZ3A 2BA9A 2PMWA 3IEUA 3FFIA 3Q2TC 2K8GA 4DUZF 4DV7J 4LF4C 1C0TA 3IR7B 1E6VA 1TUVA 2ZH3A 1SH0A 1PIEA 1UKUA 3IM8A 3LAMA 3CMQA 3BQ0A 1NHVA 2OFGX 1Q8BA 2BKOA 2CIMA 2DGSA 3DXSX 4FPIA 2HFVA 5D4OA 5LMUJ 4ECZA 1O5JA 2YNGA 3IMQJ 3IG1B 4QIGA 4DR3F 1BA3A 2V5HG 4A8KA 1HWJA 4UT4A 1YWXA 2CNOB 3KWMA 3AJDA 3ZXWA 2FJEB 2CZ9A 4DL0C 4I56A 5C42A 1A0OB 2BM0A 3W5XA 3OR2A 1NNDA 3TRGA 4CDIA 1HD0A 1X0PA 1YBTA 2K3IA 3OUYB 4J9SA 3T5KA 2YPYA 1C1CA 1Q0NA 1CEZA 2K2PA 4QIVA 4K4ZA 1GPMA 3FCEA 2KJWA 1RK8A 3TAMA 2R2TA 2ACMA 3RB6A 1WG5A 2WVEA 2VDIA 3HFZB 3MD1A 4RUHA 3G9CA 3IG1A 3K5MA 4DSEA 3TJ8A 4ELVA 3KLGA 2NXCA 2XMUA 2Q6BA 3MEGA 4EI2A 3U27A 3ZZZA 3ETOA 1FNOA 2BJEA 1IKVA 4JP8A 1GK8A 1X4BA 2QL5B 3CJ5A 3M8PB 1T03A 5KFBA 1XK8A 1RWUA 2GQ2A 5HBMB 2QG9B 1FRKA 3FRYA 2FQQB 2VASA 4E8UA 3ENWA 1JX4A 2KZMA 2ALZA 3QGPA 5KG4A 2UP1A 4L76A 2DXEA 1RTHB 2RAQA 3TVKA 3NS6A 1FXRA 5J1EB 5BSTA 2A3JA 4ZPBA 4WE1B 4C8KA 3I07A 3N54B 2KXFA 2EK1A 3RW7A 3W62A 4PAAA 5CCMA 3GIKA 4USUA 2V2VA 4LF2A 3KKFA 1VQPS 3LUSA 4RLFA 3Q23A 2HW3A 3DXBA 4LMZA 2YKNA 4NEZA 2H48B 4K4YA 1TFWA 4Q0BB 2BXJA 2E66A 3TX8A 5IT0A 3E7WA 4W90B 3EZ5A 3RRKA 3V6HA 2FVPA 1S6UA 3G86A 2XWXA 5CHCB 4IQMA 5KG5A 2Y4NA 4ZPVR 2J7KA 3BKFA 3EXYA 5DDPC 4LBPA 4BBYA 1UA1A 3PROC 4HH1A 4IG3B 5IM0A 4TNOA 3PO5A 1UP1A 1GFWB 5JVHQ 1FT8A 4Q8EA 1HNZC 1Q95G 4GKJF 3PR5B 2ZC4A 2SXLA 3MM9A 2ALYB 1R6YA 2HAFA 1QJHA 3DGPA 3V6DB 2YKQA 2BYCA 3EGNA 2MKIA 5M2PA 1UEUA 1VHFA 1FF2A 1GMWA 2KYZA 4GVLA 4TLQA 5J1PA 4F3QA 1CQNA 3S1TA 1Q7LB 1RAAB 2E1MC 2OPSA 5KFTA 3V5RA 3AQPA 3GV5B 1RTDA 4RLEA 1V3ZA 4H54A 1FEHA 1RQ0A 1FWLA 4B9TA 2BJ9A 2WONB 2VG6A 2IM2A 2UU9F 2HBZB 5C7PA 4JV1A 1MD9A 1TH5A 4ISBA 3OTBA 2U1AA 1MROA 3ITHB 1FUGA 1YGYA 1TR0A 1NKBA 1RBOB 3A4IA 4OYIA 2W2PP 5AT1B 2ZVSA 5T8TA 2R7TA 1C0TB 5KFYA 2NR0A 3T1HJ 4C0BA 4KTVA 2P9EA 4X66F 4DF4A 3H8YA 3MMBA 4KC5A 1TL4A 2HQ3A 1VQKS 4ZA1A 4PUOB 3A9VA 2ZFHA 3FSIA 3JAMU 1UFLA 1ZM3A 2VZ9A 2M88A 1ZZFA 1N33J 1NHKL 5D15A 3CJKA 3H98A 2Y4OA 1LXJA 3KLIB 1UFWA 4MFBA 5F41A 1I94F 2MKJA 2RQKA 2HVIA 1CC8A 3KLHA 1NK8A 2E5JA 3D2WA 1K0VA 3RYLA 2P5VA 2R7OA 2QFIA 3ISNC 4WFNQ 4NPOA 2YTCA 2JL9A 4DV4C 1HBOB 1JLQA 3HLUA 4QU7A 3CCWA 2HNDA 3OFEA 4L3NA 5CYQB 1VR6A 1U7LA 2C1EB 3A25A 4ICLA 4LE5A 1ZS6A 1NM2A 2ATLA 1JLAA 2LXIA 3MOJB 2M5HA 4CT8A 2V68A 3MM8A 2G0IA 3CUNA 1R89A 3JTNA 3R5GA 4KV8B 3DI6B 4DCJB 4WTOB 2WAQD 2VG5B 2ABYA 3GONA 2GVZB 4JYAC 3AHPA 2MZQA 3IWXA 2YNIB 4LF9C 2KJVA 2XYPB 4NEYA 3X3UA 2M8DB 2J5AA 1X7VA 3NBPA 5F0UA 1CVJA 3MZIA 1Y00A 4NX9A 2HIQA 2WVDA 4YB6A 1KVKA 3KG1A 1SUQB 1UPPA 2DR6A 1HBNA 1D3WA 2LA6A 3PRVA 4OX6A 4F36A 3CDAA 3NMRA 1IJEB 3N01A 2HLUA 3RG6A 3LAXA 2IM3A 1FX4A 1VQSA 5IS2A 4C0HA 1VCTA 2V6AA 5L9NA 4NXNJ 1C1BA 1FD8A 2EW9A 4UOGA 4USVA 3P4UB 1HD1A 1ZM4A 2R7RA 4BSZA 2IHR1 4JBCA 1VISA 3HF5A 4LRBA 4B3SC 2UVUA 4M95A 1RT4A 4RW7A 4DV6C 4RWWA 2EVZA 2Z2ZA 3ET6A 4F3MA 3R44A 2OEKA 4M5KA 4JI6J 3CCZA 2PE8A 2PFFB 4WFBQ 2CQPA 4RLQA 2WVFA 1WHWA 1WORA 3M6UA 4RNMA 2HYIB 4FF3A 4PQUB 1H3DA 4OYZA 2W25A 2OPSB 1N52B 1ZAWA 1KBRA 2DR9A 5BSUA 3HI9A 1RT4B 2MM9A 2HIYA 2CVIA 4E0DA 2ZNZA 3G8QA 5IFIA 4P6QA 1RP5A 1F3FA 4DPYA 2VICA 3MEKA 1ROFA 3NS7B 3U1NA 5CABA 4DFPA 3RAQA 1RU1A 3LUYA 1RT7B 3TZXA 3EMTA 3VAMA 4DV5F 5LJ3Y 2Y1IA 4D56A 2L9WA 5KFIA 1T5DX 4ALZA 1JLEA 3MTJA 6AT1B 4ZPCA 1QAXA 1WKLA 1MN7A 3PHEA 4IFYA 4P2MA 4ETXA 1X9SA 1EHWA 3QO9A 3PESA 4XK8C 4DZ6A 1OIAA 3CJ4A 3NP5A 4QIFA 2V8VA 3F41A 5EWFA 3VAFA 1T05A 1TKTA 4RW4B 3QJLA 2FB0A 2VKRA 4OJ1A 2FTRA 1H98A 1XERA 1U45A 4FBTA 1FKOA 3AOAA 3PCOB 4DL5A 2HMIA 2ZZMA 1TAUA 2J9DA 3QZ8A 3I31A 4NCGA 4DBQA 2B3TB 1LK5A 4LBIA 1J5OA 1ZA2B 3NL0A 2CQ0A 2W9BA 2FJAB 2W9CA 1EZZB 1W25A 3DU5A 2FJDB 2Y8YA 5I3QA 3PEJA 2R7XA 4FYYB 1RYRA 4H4OB 1X5TA 2BOPA 1NK4A 2V0NA 2FJXA 1NUEA 3EJMA 2VC0A 3GP9A 4B3MC 2PDAA 2MJNA 4Y00A 3AD8C 3R5DA 5ETVA 5HVHA 4OHYA 2IRUA 3W9JA 3DDNA 1PJ6A 3CDUA 3BV8A 4U96A 4AT1B 3MPVA 4DV3J 4FS1A 2VU5A 2BEFA 4CT9A 4QWDA 3KLVA 2HFNA 1F9HA 1N33C 1E6YB 1ZOTA 4YY3C 3KK2B 1FI4A 3DRRA 1I94J 1U02A 4U9RA 5GADI 2A18A 4F8RA 1SVDA 2GFFA 2RUSA 1N33F 3DAYA 2R8GA 2OPLB 1U6BA 1L3VA 2G2ZA 2ATCB 2G2OA 2VUGA 1B7YB 1MMNA 2V4JA 5LSRA 2AF6A 1QAYA 2XI2A 2PMZD 4RX6A 2QFJA 2R7SA 1M5SA 4DR4F 3SV3A 1HW8A 2KU7A 2P8IA 4L6V3 2FZGB 4IOCQ 2BW7A 4B3MF 4ZIWA 1YITS 3CMES 1FRXA 2OO4A 1S72S 4NXNF 2CPHA 5L1JA 4DV5C 2BE7D 2LKZA 2Q6CA 2CPZA 1ICEB 4LUBA 4OLPA 4WP8A 5KFMA 2B4PA 1GEHA 4N8NA 1L3TA 3FBEA 3CDEA 3K8VA 1NDCA 2CQHA 2LXFA 3VHQA 3RBDA 3RAXA 4K4XA 1SC4B 1YBUA 2IVMA 1NZ8A 2KHCA 3PFEA 2XHWA 2KYXA 5CQGA 4QW8A 2RS8A 8RUCA 4ED1A 2UUCF 2XSJA 3ADAC 1WF3A 3H2TA 2ZEJA 4FUTA 4RVOA 1TL3A 2IIHA 2FVSA 1RABB 2M4MA 3QJPA 4CTAA 1IQZA 2UV8A 3IRXB 4Q2MA 4JB8B 5JJBA 4ID8A 1ZA1B 4GXRA 2NXNA 1P8GA 4K0BA 2ZITA 3AF5A 4BS2A 1PAEX 1XMQC 4KHRA 2CJXB 1P4EA 3CSKA 3SSSA 2G1DA 5D0HA 2DHGA 4LVNP 1NSQA 5ETTA 2G9OA 3DLKB 2XLJA 1HNWC 4J9VA 4OI2A 4Y0FA 2HNZA 2YH0A 3SV4A 1ZPWX 2AWZA 2ZD1A 4GKKF 4YHHC 3QSIA 2B6AA 2DR7A 2ATWA 4U7UD 1PYTA 4DV0F 4R0EA 2VSQA 4Y3CA 1WH9A 1Q8KA 4JI7J 1S79A 3AD7C 3FSXA 2XB2D 3IFEA 1JKHA 4PPDA 3IR6B 4Y28C 5E7OB 3FBFA 3MEEA 7AT1B 3GSDA 1JLGA 2OD6A 4CLUA 3M9OB 1NHUA 3UE2A 1PG3A 3M8WA 2UXCJ 1S1WB 5DQHA 3MM5B 1NB7A 4HVZA 1U24A 2FHJA 1PC5A 2E9RX 3MPDA 3Q89A 1URNA 2LYVA 5F3TA 3KDOA 4FYDA 3TQ1A 3KOAA 3NOGA 4NASA 3QAEA 2Z2MA 1C1CB 1PKUA 3CCSS 3MMBB 3MAHA 4K5SA 1CJUA 2NPIA 3HX9A 4W98A 1G7CB 1MG7A 2F9JA 3QIPB 3CCJS 2VJUA 5J2QB 4YR3A 1VC5A 1WKJA 2KKHA 2XMKA 1RWPB 3DMJA 2QT7A 4L2ZA 4JI7C 1RA7A 2ZVIA 2XZTB 1E6YA 2D69A 2NCKL 2IMOA 4NMLA 1N5QA 2J0SD 1RHRB 3THVA 1GQEA 3RW6A 3ENQA 4ERDA 2E8CA 3J80D 3GG1A 3UD5A 3BS9A 4YB7A 2VQFF 1EETA 4IFYB 1PBUA 1HQEB 1IBMF 4URGA 3HP6A 4PYDA 4B3OB 3IRWP 3I4PA 1IUJA 3K5LA 4OYWA 2D74B 5D6GA 4ED4A 2ZH7A 4DSFA 3RRGA 3PIPQ 2RHQB 3V4MA 4BDPA 4QU6A 4ECQA 5LCIA 3M6VA 4WYWA 4WZQA 3QATA 3NPDA 2C3UA 3T19A 3W1YC 2HQCA 3PM9A 4UY8T 1SJQA 5LSOA 3EXCX 4C4WA 2LXUA 3IC1A 2JZ5A 4G1IA 1PSDA 1XR7A 3TWZA 3GQCA 2OH2A 4GRSA 3V81B 4PQUA 2ADBA 1FFGB 1VRUA 5BSVA 4Y2AA 1FFWB 1B0VA 3LWMA 1I94C 2YX1A 1S4FA 4OLOA 1USPA 2PO4A 3J81D 4FVCA 4WFZA 2I1RA 4PRFA 1G2EA 4NZ7A 3J81U 4KGKA 2WBRA 4DV3C 3H5SA 4ZP7A 4WK1A 3C16A 1JLEB 5GAEU 2H5JB 4AL5A 3BF4A 3I9ZA 2YNFA 4DL7A 2QL7B 2OSRA 4L7IA 2IJNA 1Y10A 3RBZA
chains in the Genus database with same CATH topology
4LSNB 2YWCA 5IQ6A 1JLQB 2FD2A 4Q43A 5DETA 2ASYA 2B9WA 2RKIB 4C3MA 2ZHAA 4M5DB 3K59A 2WBMA 4B3TC 4TXSA 1HWUA 2JLGA 4JV5F 4OZNA 1XMQF 3IXQA 1FERA 3VF0B 1F5CA 4Y2CA 2UU9C 1YRTA 5CZXA 1D1UA 1Y5IB 4FPRA 3JTOA 1C4AA 3T9NA 2CFXA 4LF8C 1EETB 2DITA 4D57A 2RD5C 1S10A 5BR8C 2MZRA 2HHQA 2D1RA 3PW5A 3UDCA 5J2MB 2ZHOA 3TR5A 1T7PA 3M30A 4FF2A 4DV5C 2OPPB 3CJ2A 3CXCR 1UWBA 3M1VA 3UPFA 2DHXA 2BR0A 5H9UA 4OI3A 2DGXA 4KB7A 3DLJA 5HMYA 3CE8A 1MXBA 4A48A 3IGNA 1S6PB 1KQSR 4ES2A 1GNKA 2HWTA 1N32F 2QEXS 1ZM2A 4JI6F 2JHEA 4YR0A 4IOAQ 1RTIA 3TNVA 1VJWA 2E7XA 4OIXA 3AJ1A 4IH5A 4AL6A 4ECTA 2IM0A 3QGHA 3MM8B 1H2UX 1VC0A 4IKAA 4N76A 1YJVA 2DR5A 4NA3A 4YHHF 4QYZJ 1S1VB 4ED6A 2JFDA 3GYXB 3I08A 2CPXA 1CG2A 1JWWA 2KN4A 3DLHA 3PACA 3QGIA 4XIUA 4IRCA 1Y3JA 2B0GA 4WK3A 3WC2A 2N3OA 4HLBA 3AH6A 4NA1A 2N4CA 4ZHRB 1KVJA 2BANA 3M9NB 3G8SA 4H4KA 3RU0A 1A6LA 4ILMA 1FKPA 3M32B 4ZPDA 4ED8A 4X2BA 5KFNA 4OHZA 4HDGA 4NLYA 1S0MA 4CTAB 3V81A 3L7OA 4DR2F 2DPLA 3S8SA 4E98A 3MWBA 4IH7A 3OXFA 1HWIA 2XSJB 2HG4A 3I32A 3CCTA 1DAXA 2XEXA 1Q4RA 3GFXA 4BC9A 4RW6B 1KLMB 4I6AA 1R8HA 3CVKA 1RKJA 3OTOC 2IRYA 5DV9A 1N5YB 5KFZA 3M2RA 2RQCA 3PJWA 4O3PA 2F8MA 2AGPA 1N48A 1KNZA 4G3IA 2X51A 2QO3A 2LEBA 2GHPA 2AYBA 5KT3A 2G13A 3Q8SB 1MROB 5H9FJ 4X4TA 5KYVA 2VBYA 5D4NA 4CIOA 2PN6A 5KFAA 4ZMMA 4XPEA 1Q8IA 4PZPA 1N5SA 5CD4H 1N56A 1K1SA 4N41A 1KQGB 3PR4A 3HVTB 2AD9A 4LF5F 1A7GE 3ZZUA 2ZH6A 2QSFA 2AJFE 3TARA 1RJJA 4ID5A 1KN6A 1WTBA 4X4RA 3N2QA 1NK9A 4Y2KA 5BJRA 3NCRA 1XR6A 2EFOA 1RTJB 2OAUA 3AB2B 4MTPA 2ZM6F 4KTQA 3FMWA 4FP9A 5AXMA 3RB0A 1RT6A 5GADU 3NNHA 1Q16B 2CQIA 3LW5C 1Y4ZB 1UAWA 2ROGA 2KFZA 1IKYB 4I9GA 2UUBF 2KT2A 1HA1A 4JI2F 4A8OA 3MMJA 4WU2A 5U47A 2YKNB 2UUTA 5J2PA 3UCZP 3FEYB 5T14A 1GAOA 4KR0B 1GTEA 2LQBA 2ZD1B 4PG8A 1JLCB 1R27B 3BSAA 2VPWB 2D1QA 4ED2A 2DYJA 5B0DA 2GMHA 2HS3A 2C22A 5BURA 4WYLA 2HS4A 5J2PB 1FJGF 3SO4A 1S1UB 2Q79A 2XMTA 4KO0A 3JTPA 3MTKA 5SUHA 1LFWA 3TI0A 4Z37A 1E6VB 2MPUA 3G4SS 2KM8B 2VBWA 3UD3P 4QPXA 2ASDA 3HZEA 3OLAA 1N34C 4CZCA 4AQYC 4P7TA 4QYRA 4O3NA 4JV5C 3ISND 3QZ7A 2MQMA 4B9VA 3VCDA 2QSWA 3GFYA 5B0FA 1UVLA 3I96A 2JC0A 3CTRA 3DOLA 2WOMA 3HVTA 3N28A 4XAKA 1KVIA 2FLLA 1UKKA 5A1GA 5C42B 2O5DA 4X4SA 5A1IA 2EPIA 2R9LA 1QTMA 1MKYA 3CEDA 5K9FA 1Y5LB 5KFPA 4RBTA 5FLXD 5KFLA 1ZAVA 2AP6A 4WFAQ 3D1OA 3K8WA 2R7UA 5HROB 4C8NA 2OBVA 2P2QA 4G37A 1IBKC 4ED7A 2POKA 2ASLA 2IMWP 3T6JA 2FHJD 1TL1B 5KFEA 4CO5A 4QCLA 2BABA 2GW8A 1R43A 2DNRA 2H5EA 2B9XA 2PMHA 2PT0A 2W8LA 2RS2A 2HAIA 1UW4A 4TY8A 4R0JA 3CCLS 7FDRA 1CPZA 1IKXA 5BSWA 3DN9A 2DD8S 1YBAA 4UW2A 2RILA 4J9MA 1P7LA 3VNRA 4QIEA 2VV5A 3ENVA 2DNLA 4DG1B 4EFAC 4DV2F 2VG5A 4DR6F 2K3KA 4PQAA 3MD3A 3OV7A 2EI5A 1WF1A 3L09A 3R3TA 3HDSA 4ZVGA 4AFFA 2ZH8A 1RI7A 4WS9A 2JLFA 1TKXA 1XNQF 5EX3A 4A8MP 1GT8A 4OX7A 1OQ3A 5LL6d 1RA6A 2XNQA 4NYPA 3PV8A 1L2FA 4DQQA 3HFKA 2V7BA 3SCLE 5MLCV 2B56A 4EU0A 3HVRA 1TL3B 2VPZB 3VAGA 3Q0AA 2I0XA 3A9UA 1HNXC 2JVOA 1LWEB 1S6OA 3QWUA 5CYMA 3PIOQ 5JVGQ 4JI3F 2BQRA 4IG0A 3VZHA 4F4XA 2DRBA 1D9FA 4RMNA 2OPRB 5LXRA 1BQMA 3AQOA 1KONA 1TQLA 4MYUA 5EGYA 1QSYA 4W92B 3DRYA 4LFAF 4I0WA 1S0VA 2VFRA 2WTFA 4OZ1A 4JI8F 2DB1A 4JI1C 3I0SB 3I82A 2DNHA 4WFXA 1YIJS 2GX8A 4RNNA 3JSMB 1XEZA 3MEDB 2V4RA 2P20A 4GXQA 5A2QD 1NU4A 1FE0A 5G0RA 5FLXY 4JI8C 1GH8A 2Z4PA 2L9NA 4B17A 4MK7A 4AYBD 4QR1A 4FNIA 2FPHX 4RZRA 4C98A 1VIXA 2Q66A 3IMLA 1ELOA 2D41A 4RNOA 1K73T 1FK9B 2U2FA 2LLZA 3LALA 2D9PA 2BRKA 3GZ7A 3HHLD 4QW9A 3DLBA 2LMIA 4MH4A 4EEYA 1S1XA 1IM4A 3DCAA 5I42A 1VQ5S 2M5YA 2HHTA 3BQ1A 2D7SA 3MFHA 4QBUA 2VL1A 2RU3A 3VNSA 4A8QA 1QVGR 1LKZA 4NXNC 2CPFA 2ZBCA 4PWUA 3KHHA 3DRPB 1MMDA 1Y7PA 3BN7A 4C7QA 1H38A 2QIFA 3ZZOA 3M8QB 4JV0A 5B0GA 5LSLA 4H4OA 3E7WA 2DGUA 2RB7A 3L8CA 4K4UA 1HPZA 2OPQB 1MU2A 2DCLA 1S77D 3WBZA 3OTDA 3KNAA 1QE1A 4DV2C 4DR6C 3IEVA 4IG0B 1B0PA 1SB6A 1WNEA 3U1MA 4HEA9 4LQ3A 1WG4A 2OKQA 3MM5A 5CYJA 1CSJA 2W7OA 4ECSA 2MSTA 3M4XA 4YB5A 3KLHB 1HQUA 2EFGA 1WF2A 2LQJA 1XWLA 2CPEA 2RSQA 4IYQA 3TA1A 1HI8A 5FDLB 3MURP 2EC0A 1LW0B 3DC2A 1FE4A 4NA2A 3ZC4A 2EKYA 1R0AB 2DGWA 3BEGB 3DMJB 5KOXA 4FXDA 3K5PA 4LFBC 3LP1A 4J9OA 2V9WA 3GG0A 2I5JB 3DLEA 3L7PA 3D1HA 1K0TA 2MB0B 2BE2A 2GNKA 4I7FA 1SL0A 3FEZA 1VRTA 3VAHA 1YI2S 2PD1A 4NXMF 3AAWB 1UJ5A 5HLFA 1T03A 2XMWA 2UXDC 3B4DA 4OI6A 4R5PA 4WIIA 1D0EA 1UL3A 2B4OA 3VWSA 5F8IA 2PT7G 3LWLA 5BYQA 5BSRA 2WSFC 4F26A 3H2VE 1OPIA 2FC8A 2M8HA 3K58A 1RT7A 1VMBA 2WOMB 3MI7X 3FGVA 5A6PA 5HMWA 2RMLA 2L9DA 4GMKA 3B7WA 2D1SA 1X9MA 2E9ZA 1QM9A 2RUGA 4RW9B 5E0OA 5A0YB 5KG7A 3KMQA 2IA0A 1I1GA 3KMSA 2M52A 4O23A 4PCQA 3GFHA 2OFHX 2KXNB 3VTIA 5EHHA 5K85A 2VB6A 4U6PA 4JI4F 2V4QA 1UA0A 5GAEI 4Q8FA 4ITSA 2BQ3A 4DWIA 5F0WA 4OYCA 4ZLPA 2HHSA 1BQNA 2DJWA 2F7VA 4I2PB 2EFPA 2C3MA 2NPFA 4NWBA 3DHVA 4DFJA 3QIDA 4F2RA 3DM2A 3P96A 4KV8A 1I6JA 2CPIA 3R5AA 4DSJA 1FNMA 2J0WA 2LA4A 4K59A 2J76E 4RBUA 5KT4A 1L3SA 2EFNA 2P9GA 2PI4A 3F73A 2LQ9A 4ECWA 4B3SF 1KFDA 3UQSA 1T5HX 3V6JA 4NCBA 3KYLA 2E7GA 3THTA 4YUDA 5E3RA 5HBMA 2BM1A 5LMUF 1HNVB 1TV6A 5JUMA 4H4MB 4MTNA 2MY8A 4ZVEA 1QSLA 2CQDA 3JSBA 3GB0A 4TLRA 4KO0B 1N88A 2VBZA 3CDWA 5C24A 2C3YA 1XTZA 2QA4S 3KLFA 4GC7A 2E8FA 3KXWA 3GYNA 1UVIA 2GV1A 3M2UA 3RAMA 2ZH2A 3SQGA 3IA0A 3POTB 3H59A 3SDEB 5E33A 4YQWA 4PXEA 1J5OB 3T5LA 1LQ9A 2CQ3A 1RAJA 2YNFB 5B0AA 3T1YF 1VQ4S 2OLWA 4DR7C 5GAHU 2XGQA 2E1CA 2J6SA 2F8HA 5DQIA 4DPOA 2EGTA 1D8ZA 5IT4A 2P9CA 5D8HB 1D9AA 1FDAA 1JOSA 1SV5B 2WSEC 2CQCA 4OZLA 4NLXA 3CJKB 3T6BA 2L3MA 2FJWA 2FVCA 5A8KA 3RV2A 2AYAA 2GCFA 4C3KA 2E0GA 3VQTA 4F2SA 3RRHA 2VD3A 4IDKA 2EBGA 2PA3A 2ZOFA 4TY9A 4MKAA 2N7YA 3PZPA 1ZETA 1UJ4A 2C3PA 2VFVA 4DR2C 2KDOA 3MPYA 1M5OC 5HROA 4NCGB 2ZZNA 1KFSA 1KSPA 4WXWA 1SV5A 4PG4A 1ZTTA 3O5TB 4J9RA 1U25A 4OX9C 4OJGA 1VQ6S 2N7CA 3BO4A 5B0CA 3VZIA 1VLYA 2OMOA 2JVRA 3ZFVA 1U2RA 4QZVB 4ECXA 3ICLA 1NJXA 5HO4A 3T5JA 2L41A 3C8YA 1YJRA 3N79A 4OX9F 5J2NA 4DQIA 2B5JB 4O3QA 4XO0A 1HHSA 1TFYA 1BQMB 5L9XA 1QSSA 1UVKA 3SDEA 6FDRA 1X4AA 5M2RA 4DQPA 1SIZA 4RM3A 5ADZA 1C2PA 2DISA 3GV7B 1U26A 1XMOF 3IWNC 3LGMA 1UEVA 2ILZA 1JJ4A 1U8SA 3I9V9 3OFGA 4AXJA 5H1SV 4KKOB 4IH6A 3WC0A 4IUFA 1ZAXA 2XS7A 3I56S 1TKXB 1HR0C 1MNEA 4C9DA 4JM1A 3HZGA 4HTJA