5CZXA

Crystal structure of notch3 nrr in complex with 20358 fab
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
227
Chain Sequence
CPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHVIGSVVMLEIDNRLCLQNDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurogenic locus notch homolog protein 3
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 61
structure length 227
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5czxA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5czxA01
2OO4A 5CZXA 3L95X 4ZLPA 3ETOA 5CZVA
chains in the Genus database with same CATH superfamily
4WKYA 2ZKUA 1M6XA 2DXDA 1G1XA 3O6QA 3PBKA 1PGZA 2M5OA 4EZ9A 1F60B 3ZNJ1 3I6PA 3I5CA 2VDHA 2L9WA 2HVZA 4JI8J 6FD1A 3K2YA 3TI0A 1DQ8A 1Q78A 2BA9A 1C0UB 2OTJS 3MF5A 3CJ5A 1YZ7A 3VNSA 3UNYA 2BANA 4TKTA 3SCIE 2ROPA 2IJFA 1S1XB 3EZUA 5D3GB 3NGTA 1U0SA 4H4MA 4DV1J 1AW0A 3QJLA 2IAJB 4ICLB 1Q8KA 2CG4A 3Q22A 2GC8A 3MTJA 1WF2A 1UCNA 1V5VA 1LXNA 1HHTP 2IFXA 1LNQA 3MECB 2C22A 4RWWA 1RK8A 2FLNA 4KIAA 5E3QA 5EGYA 1H2UX 4LQ3A 1WG5A 4Y28C 5F9NA 2GMJA 3L09A 3HFZB 5DQHA 1JKHB 5DDQC 1KKHA 1T9TA 5C25B 3C15B 4ECQA 2DJWA 3TP2A 2HGNA 2C1EB 4JI0J 4I6AA 1DHMA 1HBOB 2IC3A 3ENWA 5LMUJ 4M95A 1V3RA 1SIWB 7FD1A 4USKA 5BR8C 2BOAA 5A0YA 1VQPS 3M05A 5LJ5Y 2JL9A 3HVRA 4PUOA 2AJ2A 2PT7G 3PVXA 1IR2A 1HR0F 1LWFB 1Y00A 5I42A 4Q8FA 2X1GA 4RUHA 1K1QA 2YNIA 3G7SA 3C8YA 3HT0A 4DL6A 3CDBA 3HDSA 3JSBA 3R5BA 2F4FA 4DR3C 3BBCA 3LUSA 2IY5B 2ASDA 1X4CA 1JB0C 2Z58B 5IQQA 4FVCA 1HQ2A 1NJZA 3CNQP 1F3FA 4F7VA 4Q0BA 2YH0A 1PC5A 3TA0A 4DR6C 1JLQB 1YX2A 4J9LA 4HT7A 3M9MB 2P2QA 2FJXA 1N88A 1O51A 2I6WA 2L9NA 3LGXA 4Z7YA 1RHMB 2HZAA 1TK5A 4QIWD 5HK4A 3QZ8A 3FBCA 2BJ1A 3UCZP 4AQYC 1J27A 3RUBL 3MM5A 4CLKA 1TFWA 4C11B 4KGKA 1Q86T 2J76E 2ASBA 1KONA 2QLWA 4RW4A 2CG8A 3T9ZA 2E7XA 3VCDA 4J9UE 1NSPA 2V69A 4EO6A 1HBNA 2HRTA 2UUTA 4DZ6A 3JAMY 1NZ8A 3QYYA 2MJUA 2F4VC 2G0CA 2M8DB 2C2KB 4LBPA 2P2MA 1N36C 4B3RJ 1NMEB 5AJ3J 4UQGA 4W92B 2BJ8A 5KFCA 2ILZA 3MCMA 2UVRA 1HBMB 2HNYB 2OPQB 2JLFA 1VLYA 4CM0A 4AYBD 4LF5J 2ILYA 2ZC4A 1BQNA 3QO9B 4CZCA 2IMWP 5KT4A 2JVOA 1C2PA 3KLFB 3B82A 2X1AA 3UCGA 5H9FJ 2DCUB 2BQ3A 2COLA 1S0MA 5BYSA 5KEIA 5GVQA 2UV8G 4TU9A 3CCVS 3V6KA 2R3VA 4OX6A 2NSBA 3WC0A 1JLEA 2WB1D 2CPJA 3S7RA 2MKIA 1FF2A 3GJSB 4ZDNA 4J9PA 3SSSA 4EBEA 4BLGA 1JNRB 4B9LA 5DZ7A 1W7WA 5IQ6A 2PIIA 2IPOB 2Q3PA 4RW7B 4I6WA 1YKWA 3PW0A 2EC2A 4MIWA 3SEOA 1SJ1A 4YHHF 2HBQB 3C6UA 3MR6A 2BM0A 3FGVA 2MMAB 2WD9A 2FDNA 2VC0A 5EX3A 4LF6C 1QUVA 3BO2A 3PY8A 1VBKA 4DR1C 2DNYA 4OYIA 4X62F 2K7KA 3FCCA 3AOBA 4NA2A 3BSAA 2DPIA 4R5PA 5L9XA 1N0UA 4GVLA 1QSSA 1FNMA 3BSNA 3DFEA 1NK8A 1RHUB 2YX1A 3MAHA 1OIAA 5L1JA 1VMBA 4WFBQ 4DUYF 2AYAA 3LNVA 3VV2B 2YY3A 3VNRA 1IR0A 4RNNA 3PYEA 5B0DA 2ATCB 3DOKB 1S76D 5FJ4A 2GHWA 1YLXA 2CVEA 1N8RT 4DI6A 1LK7A 5IWAF 2JC1A 2H65B 2WW4A 3A4TA 3I9ZA 4K7QA 4LRFA 3MGJA 1VIOA 5D78A 1N33C 4RU2A 1RCXB 2KJVA 4X65C 3T5HA 1P9QC 3N01A 4FYWB 2FB0A 3HK2A 2V34A 2A6OA 5KG4A 3EXYA 3FFIB 3BO3A 4LFAF 1TL5A 3AF5A 4FF3A 2W9AA 1WWHA 1JIHA 4DQQA 2Z2YB 1CULB 3MMBA 1HNXC 3KK3B 2QFJA 2XG8A 4E0DA 4KB7A 1RTIB 1HBUA 5KT7A 4KH0B 3NS7B 2DNOA 4X66C 5ETOA 1U0HB 2NXJA 4M5HA 4PG6A 3W7BA 1V26A 1FK9B 4DFKA 3U1MA 2MQPA 4WP3A 4M1KA 4V1Ak 2R2RA 4DLEA 2E5JA 4C8LA 3TX8A 2D27A 3OFHA 4DOZA 3ET6A 4I0WA 4WFAQ 5E3RA 4Y2MA 4WXOA 1BWEA 2XMTA 1N32F 5KFAA 4P72A 1L3SA 3LOUA 3A8JA 1HQEB 5EWEA 2ZVSA 4JI5J 1IBLC 1YQHA 5DG7A 4RJVA 3LH2S 5LCIA 3VTIA 5CYQB 3LANA 1SPBP 3M30A 2E8EA 1FRLA 1T03B 2MB0B 3SQGB 3SSRA 3PJWA 4JOUA 1U47A 3KK2B 1D0EA 2EBEA 1U1RA 1ZA1B 3SCJE 4DQRA 3KLHA 4A8QA 4QCLA 3IG1B 3KWMA 5ETNA 4LF2A 2ERRA 3G9CA 3DOLA 2N4CA 1N0VC 4HTIA 4K0KF 1Q79A 3FQKA 1SJ3P 2J8AA 2KFNA 2V2VA 4KV8B 3BSCA 2NZ4A 2BJEA 4PHTA 4OYCA 4DV5J 1AUSL 4L7IA 3LPYA 4QR0A 1NHUA 4B3TJ 2KDOA 5KOWA 2CNLB 1TQLA 3PV8A 3C2PA 1Q1KA 2AJ1A 3QRQA 1TTHB 2E1AA 2C2DA 3CQ2A 4ANEA 3HCXA 4ED5A 1FRJA 2YPZA 1S1XA 5D3GA 1XR7A 2E8CA 2XZDB 1U2RA 3AD9C 4ICLA 2LXIA 1DTQB 1VDHA 4WXWA 2GA7A 4B3SJ 1TMMA 2FVCA 1S1WB 5F3ZA 5A6WA 4DCTA 3VGSA 3MECA 4L2ZA 3DLJA 3NI2A 2HNDA 2YXLA 4K2XA 2K06A 4P75A 5E33A 2JX2A 2UU9J 1O90A 4WU2A 3ENVA 3NMRA 5BURA 1N5QA 5HQMA 3QJPA 2OGUA 1FLOA 4OHYA 1JKHA 2DR5A 3BGFA 5L1IA 1DZ5A 4JV2A 4ZVQB 2DIVA 2KZMA 2AJ0A 1N34C 3RAMA 1IN0A 3KG1A 3PX0A 2FHOB 4F4KA 1ZOTA 3GCXP 1JX4A 4HLBA 4YB5A 1M1KT 5F8JA 1BGXT 3QLHB 4WIIA 3BH7B 3GIJA 2X3GA 5F8MA 4F2SA 4PXDA 2OP5A 3KK1B 3N5BA 3SSQA 3O2IA 4Z37A 2D3ZA 2AEMA 2YWBA 3BB5A 2XS2A 2RT3A 1B70B 1GXLA 2B4VA 1X4HA 1VS3A 3G6VA 2VKZG 1LWFA 2JWNA 1RKJA 3T41A 4ZHRB 1REVA 2EK1A 2VQEJ 2PN2A 2EK6A 4XIUA 2YWFA 4B08A 3L9ZA 1IJEB 4AL5A 4DV0F 4CNYA 1J5EC 4OI0A 1TFYA 2G2ZA 1S9GB 1BC6A 1UVKA 4NRTA 1SC6A 1S79A 3TJ8A 2F9JA 2F8MA 2M7SA 2E5LF 3QGIA 3ZZPA 4KAIA 3PIPQ 3PRBA 1D3WA 3C16A 3TYTA 5KFIA 2OPRA 2QT7A 2LXUA 3C3LA 3NAHA 4C6AA 4AT1B 4F8RA 3N6MA 3RJMB 5C42B 4LIRA 4DV3F 2GAGC 2MPUA 2QL8A 4MKYA 2J9EA 5HQLA 2DISA 2AD9A 2VL1A 2FZGB 3TUIC 4DU8A 4Q44A 3T1HF 2NCLA 4I1TA 3OVSA 1Y10A 1S6UA 3QWPA 4LREA 1M90T 2RQ4A 1NAQA 1I94C 2JFDA 4M8LA 3CJQA 1YJRA 5AXNA 1X5TA 4C11A 4DPYA 4NXNJ 3AXMA 1VQOS 2K7JA 1T94A 5DDPC 3B7WA 4RLFA 4QR2A 2E9ZA 1UTAA 2MHEA 2VPWB 4EYHB 2DPJA 2ZBRA 3CIZA 2DD8S 5HJXA 2UXBJ 1MROA 4WP8A 3UO0A 1QAJA 1IQZA 3JSMA 2ZNYA 4NLRA 4O3SA 4R1MA 4O0NA 5AE2A 4DSFA 2LA4A 4OI6A 3UDVA 2O01C 1E6YB 3R5GA 1UJ6A 3UN3A 4RM2A 4U7CA 4B3MJ 1HBMA 2XR1A 4URQU 1HHSA 4FVMA 2OPQA 1HD1A 1U1LA 1VFJA 2LFVA 1Q81T 1RQ0A 3QO9A 4A8WA 2UXCC 4D4GA 3W3SA 3KLFA 1HI8A 4MK8A 3ZTPA 2LDYA 3AF6A 3MMCA 4DL3A 4O23A 3UDLA 1IBKC 4MIBA 4BC7A 3DI6A 3PFOA 1FDDA 3DXBA 3EJMA 3W2WB 2W1BA 2QSWA 1JQGA 1YSJA 3LF0A 4AL6A 1G2EA 1V60A 3EGZA 4MFBA 4ID5A 2CY1A 4ZPTR 2ZC3A 2E0GA 4PG8A 3EVWA 1HPZB 1RXOB 4RW7A 1FT8A 3HFVA 4JYAJ 3RV2A 4RW6B 3PO5A 3VAJA 4G3IA 4JV5C 1TVRA 4DUZJ 4NEZA 4USUA 4GRSA 3Q8VA 3QIPB 4KO0B 3MUVP 3DHXA 3THTA 1MDFA 3PACA 4K59A 1B4SA 1L5UA 5LXRA 5DDRC 2W7AA 4OV1A 4YB7A 4USHA 2GVDA 1UW9A 1VQ4S 1IUJA 4DG1B 3JS9A 2ZUGA 1EX8A 1FRKA 2QG9B 1MN7A 1S5ZA 4R0JA 4X4OA 2EKNA 3VZIA 1IBCB 1URRA 2I38A 2RUGA 1WC5A 3DOKA 3A3OB 1S1UB 4ED4A 1B3TA 4PQUB 1VQ7S 2HAFA 4FBUA 3FMBA 2B3TB 5E3CA 1WOPA 1VQ5S 3NYQA 4DV2F 1KLNA 4L73A 2OIHA 1V9OA 5RUBA 4KPYA 2Y3YA 4HHHA 1U6BA 1GNKA 3FFIA 4NYOA 3MEEB 4E98A 3IR6B 5DV9A 2VOPA 4GKKF 4CM2A 2QA4S 1FKOB 1NKEA 4UTGA 5KFNA 3I96A 3MUTP 1CULA 2A3JA 3I4HX 1KVJA 2C3OA 2PI5A 3C19A 1XWLA 1RTIA 1WACA 2XWXA 1FFWB 3GKUA 3W2VA 4NOZA 1U0HA 3HF5A 4FYYB 4JI6C 4G65A 1NSQA 3K8WA 1RT7B 2IYGA 4CRJA 3D1QA 4OV6A 3E01A 3OTOF 3TOQA 3H42A 1FK9A 4XAKA 1AYEA 1PKUA 2V8HA 2HIQA 3NS5A 3DYAB 3M2VB 1NSKL 3DDIA 1Z1ZA 3ISND 1M0SA 3IN5A 2CPYA 4DX7A 4RNFA 1XMBA 3EM1A 1CG2A 3BN7A 3RR8A 3MTKA 3ILJA 1GTHA 4HDGA 2DK2A 2NSCA 4ZCIA 2D1RA 1YIJS 5BR8J 5A8WB 2VU5A 3GFZA 5LOQA 2YBVA 3W61A 3J81j 2Y8YA 1OQ6A 1XQIA 2OD6A 2K1RB 4QPXA 4L4QA 1QM9A 1QWIA 5I3UB 3KK2A 1C1BB 2B9WA 2XMUA 3IG1A 3MPWA 3AXKA 4QWAA 2PD1A 3RW6A 1BXNA 1MMDA 4DR3J 4DF4A 2IM1A 4DL7A 3PXGa 4OYPA 3TQ1A 4X4TA 5C2GA 4Y34A 4O44A 1RTHA 2HFSA 4KV8A 2CZ4A 1KVKA 3J80D 3FZBA 5DQGA 1KNZA 2E7WA 1N54B 4DR6J 1URNA 3RBEA 3H5XA 1S10A 2HQ3A 2ZD1A 1FEHA 3GR0A 2FY8A 1F5AA 3OXFA 1SIZA 3CCWA 4FBTA 4LF4J 4LF7C 2K2PA 4ZA1A 5LMNC 1Z2ZA 1M1HA 2KHDA 4JI2F 5JMNA 2OPSB 2XS5A 2A18A 1EP4B 4F02A 4K4YA 4EWTA 1HNWF 1TUGB 2GO9A 3JTPA 1DTQA 4ECYA 2CQ2A 4JM1A 5K8FA 2ASYA 1NKCA 4AQYJ 4CLFA 1SKUB 2ALYB 1WEZA 1B0TA 3G6ES 2MQNA 3PIOQ 1SJRA 4CDIA 3F0NA 1VQKS 2WCXA 1VBYA 2HQFA 3TAMA 2FHJA 3MOJB 1CQMA 1PILA 2YQ0A 3OFEA 4ZCLA 1JLFA 2YNHB 3R5CA 3I55S 3LA0A 5JVGQ 4ZVFA 1T0TV 2F4VJ 1D9DA 4I6YA 2CPZA 2Y8WA 4FKYA 3GR1A 4B9MA 1N36J 2NXNA 1JJ2R 3VGUA 1PO6A 2VFTA 2YNFA 5KFGA 1S0NA 3NRBA 3KFWX 2G2YA 3CO0P 1VRQC 4DN0A 3HKZD 2M5YA 2MLXA 2BJ9A 3KK1A 1KP6A 3ZZRA 4DN9A 2R7WA 4UY85 1Y7PA 3T5LA 1GXUA 3NG8A 2D9PA 1SKRA 2P20A 3U7JA 2XZWA 2MZ1A 2HG4A 4UUWA 3BGUA 3GIRA 1ELOA 3KXDA 2H5IB 3CMQA 4ZHRA 5K8OA 4WKRA 4OZ3A 3R9XA 1FTCA 3GLJA 1FE0A 2HHHF 1RBAA 3MCNA 4KPCA 1S9GA 2KRBA 4LF6J 2P9GA 4R1LA 1L3KA 1FX4A 5ETQA 1ZM3A 4DR2J 1Y0HA 1YJWS 2YX4A 1SB6A 4KGMA 1EZZB 4Y3CA 3G6XA 4LVNP 4DR7F 2YNGA 2WBMA 2ZKTA 5KFPA 1RUSA 1VI7A 3M8ZA 3D67A 2MKCA 1BE4A 2UUAF 3PYFA 2XY7A 5FDLB 3K5LA 4G6VB 1BLUA 3M8YA 3OJSA 2DHHA 3HP6A 4DL5A 2MQOA 2DNGA 4B9TA 5A2QD 3BKTA 2AW0A 1KEKA 3IRXB 4ANDA 1TL4A 2QLJB 2GGPB 4DPWA 1SKSA 4EFAC 1S97A 1IKVB 4NLPA 1N33J 4W90B 4GC7A 3ZNUA 3KXWA 4X65J 4GKJC 1GTEA 3EZOA 2J6TA 3K89A 3GPAA 5C5JA 2KHCA 4ZP6A 1E6YA 2N7YA 1MWYA 3SQOP 3TA2A 4OZ2A 2MLYA 1K73T 4O3OA 1HNXJ 3DMJB 4CYUB 4N7TA 2AJ4A 1QUPA 3OSPA 2E1CA 4X66J 3MEGB 3DLGA 2IMOA 3TAPA 1K47A 4QR1A 2KG1A 2ZEJA 4QYZJ 2B43A 1RAEB 2KB2A 2DHGA 4PG7A 3W2WA 2G1DA 2ZBQA 3A12A 1VJWA 2RJZA 5CH7B 1WCJA 4M63A 4A8KA 3AB4B 2Y0BB 3BBFA 2KI2A 1HH2P 2HYIB 3OHBA 1XHJA 3CD7A 3TARA 3P5TL 1HPZA 4DR5F 1IBMC 1IBLJ 4MKVA 5DM7Q 4RW6A 3KJVB 3GE9A 4IO1A 2CQGA 5DGBA 1FJCA 1T5HX 5KFXA 1RAIB 3R27A 5KAKA 2OPPB 2W9CB 2YVSA 3QIPA 4KO0A 3PKYA 1R0CB 4BWJA 1RHKB 1X4FA 4I2PB 2VBWA 4IH7A 3LAXA 1C0TB 2WVDA 1XMOC 1UP1A 4M5MA 2UVUA 1FWKA 2DGXA 2YWCA 2QA1A 4YY3C 3B54A 1RTZA 1EETA 3GMGA 3K8VA 1Y4ZB 5F0UA 1T11A 3PJXA 5HL7Q 3LP0B 3PCOB 4BHQA 2CPHA 1TK8A 3UX2A 2CQCA 2FIUA 3H90A 2HNZB 4PQUA 5AXMA 5LSRA 2KH9A 3NNAA 3QAUA 2DR7A 3IAS9 1DTTB 1TL3B 3H98A 3R5JB 2VG5A 1HI0P 1TL1B 3JQJA 4I7FA 1KD1T 4ES1A 3GIMA 1MKYA 1Q5VA 3G6YA 1W2BR 4Q43A 4NLTA 4P10A 2R8GA 1X5SA 3WX4A 5ETPA 2I8EA 2V7BA 4J5OA 1FKOA 1UA1A 3HZGA 1FERA 2GFFA 4U8VA 2V4JB 1SH2A 2KM8B 1JLBB 3IR7B 2KKHA 3D3BJ 1TV6B 4ZN1A 3FCHA 5AXLA 4DV4F 2JH3A 2WSFC 1RT2B 2Q1LA 2RRNA 4DV6J 4CO1A 1RT7A 4KKOB 5KYVA 3FSYA 3TA1A 2VHGA 2OLWA 3AJ2A 3EE3A 1N34J 4DSLA 2UXDF 3KG4A 1S1TB 2JNJA 3MR2A 3M2VA 3GYGA 3O8WA 4FS2A 2KYXA 3P45B 1PA4A 2P9CA 3QMQA 4P7TA 1RT3B 3TVKA 2MZQA 2W8LA 2V5HG 2IVMA 3OR1A 5KG6A 4Y2AA 1RKIA 1UAWA 5A8WA 2HZVA 4RLEA 1FJGF 4G37A 2D3OR 3AHPA 2IRYA 4A46A 1P4EA 3AB2B 4LF9F 1JWWA 4KTVA 2ZOMA 2N82B 2B6AB 2XI2A 5ETKA 1VBXA 2KYZA 1R89A 4Y2IA 1FEEA 2D7VA 2HZCA 2Q43A 4YB6A 1OJ4A 3DRRB 4K0BA 2ZM6F 5H9EJ 4PROC 1NHKL 4TNOA 3V6HA 2W25A 1NJWA 3PX4A 1HW9A 1TKXA 1N52B 1FJEB 1Q8IA 1CJTB 3MPYA 4IG0B 5A2QY 3QNWB 3RB4A 2E8FA 4P7VA 4WWSA 3GV7B 4DSIA 2L3MA 2ZZTA 2ADCA 3UEBA 2L48A 3TJAA 3ZC4A 1NU4A 2XZTB 1PSDA 4TU7A 1UEVA 1RWOB 5KG2A 3W5ZA 3R3TA 5F3TA 3PZPA 5IT9U 3H2UB 5E2QA 4V19J 2CU6A 1R8CA 1VQLS 4KGZB 4ZCKA 2WVBA 4B9SA 4YOEA 3Q2TC 3OQ2A 3Q8QB 1EP4A 5EWGA 1CEZA 4WTOB 2MZTA 4CCHA 4WF9Q 2NUHA 3I08A 2FD2A 5K9FA 2BQUA 4LUBA 3TX0A 1I94J 3AD8C 2W9BB 2OTLS 4C9DA 1VHFA 2V68A 3K7RA 2CPXA 4RUAA 4ECWA 3M2RB 4ZP9A 1KFDA 2MCQA 2YNHA 2O66A 4Y00A 1FXDA 3FCWA 3M6XA 2DNHA 2LEAA 3HPOA 1NH8A 2ZE2B 4N8OA 4MTPA 1Y3KA 3SMZA 3IBCB 1RBLA 3E8OA 1O0PA 1ACMB 3W5XA 3NBPB 5F0WA 4LRDA 4OZJA 1N5SA 1WHVA 4CT9A 4NXNF 4J9NA 2QN6B 4KSEB 2Y4NA 5ITHA 4PWWA 2IJNA 1FE4A 2A2CA 2GV1A 2UXCJ 1WC0A 4JV0A 2KXHA 2BJOA 1FA0A 2J6UA 1M5SA 2GCFA 4KJIA 2J0SD 1IBKJ 2GX8A 3QT5A 3BYPA 5J2NB 4QIFA 2L41A 2KJWA 3J7AN 2EVZA 4JI3F 2V9WA 4RUBA 4F2RA 2MY7A 2X1FA 2OPLB 3KLGB 3SFGA 1SH3A 4MK9A 4Q5VA 1WI8A 3MZIA 4DSEA 3POTA 4ES3A 5HROB 5T7LB 3QPIA 1AA1B 3CJSA 2FZKB 1ZA2B 2MQLA 2BQRA 3NWGA 1WEYA 5DLFA 4NYPA 3NAIA 1XR6A 1SVDA 2F8EX 8RUCA 1RZMA 3J80U 4JV5J 3TUJC 3WHIA 1FXRA 2BRKA 4MK7A 5KFRA 1T02A 3EPIA 3LGHA 3FBBA 4YHHC 3ITHB 3D6MB 5K8PA 1HWKA 2RDIA 3V6DB 4XPEA 1USPB 2J0XA 2ZWOA 4EU0A 4X62C 1MXBA 3CJTA 3UR3C 4FXWA 3ULHA 5KT6A 2R7UA 2ZH1A 4F25A 5D4PA 3HI9A 3VVUA 2DNNA 4ECVA 3MI7X 4NWBA 5FDLA 3GZ7A 5IV4A 4ZITA 1SJFA 1T8EA 2DPLA 1FX2A 2KZZA 4DUYC 1CBKA 2VPYB 5B7WA 1YHQS 2EKYA 4O4GA 1V6HA 4M5NA 5B0EA 2YCBA 4YR0A 2GGPA 5IM0A 4CQ1A 4I67A 3U02A 1IKVA 1XC9A 3IC1A 2AYGA 1WKJA 3Q2SC 1UMJA 5FLXU 4LRCA 3QRRA 5IWAC 2R8HA 3J7ZT 4GXRA 1CC7A 1TUVA 3ZXWA 5DDOC 4ID8A 2NQPA 1JLCA 4WK3A 3T1YF 2MQ8A 4X64C 4LFCF 2YKNB 4LJMA 3GFHA 2FUG9 1QD1A 3SIPB 4DCVA 4B9UA 2BANB 3DMJA 3QFWA 4CYUA 4Y0FA 2DIUA 4H4MB 4JV1A 4LR9A 3MEGA 4LFAC 4DCOB 4JI6J 1XIQA 5E41A 3HO1A 3HHLD 4A47A 1TKZB 3A8KA 4GO5X 4UOGA 4JI1F 4F67A 1FNOA 4ECRA 4PEOA 4OHXA 1HNZF 3MM6A 3A25A 1F9FA 2UUCF 5HMZA 3CEDA 3G71S 3O3LA 4DQSA 1EAYC 3R97A 5CAAA 1WC4A 1X4EA 3UWTA 1VOMA 5D0HA 1A0OB 3KUHA 2ADBA 1IM6A 2B0GA 3KJVA 1N32C 1F0XA 2DGTA 4WYWA 2AV5A 2R2SA 2W9CA 1D8YA 3IRWP 2IC3B 4RR5A 3H20A 3P5BP 1GK8A 4HHJA 4OYWA 5EN1A 1C0TA 3MEDA 4IOBA 4JUZA 2KL8A 2QA4G 4U8YA 3MD1A 1X4DA 1WHYA 3PHEA 2Y1LB 3AA9A 2AIRB 4J9KA 5DRKA 2AT1B 1IB8A 1U1PA 2PEHA 5K8MA 4K0KC 5CYMB 4ZVUB 3CCJS 1T05B 3NCRA 3IBFB 4MKBA 2GVZA 2E66A 5J1EB 4KH1B 9RUBA 2J6SA 1UW4A 3G82A 1TL7A 3DLBA 4HL9A 2Z4PA 4LF7J 5LMNJ 4PUHA 5J2PB 1M5KC 1S4EA 4DV5C 4WK1A 4CWBA 4MYTA 2DTJA 2UP1A 3W65A 1R8AA 1X5PA 2D9OA 4RU9A 3S1TA 3Q24A 4IQXA 1KR4A 2V2KA 4DU7A 2H51B 3X1LB 1WKKA 1V25A 4MMOA 3CJKA 2H3EB 4K4TA 2HHPA 3ADAC 3AOAA 2V4JA 2KDNA 4PAAA 4J7CA 2BVZA 1YJUA 3VAHA 4LSZB 2HK3A 4C0OC 1RT2A 2JRSA 4ED8A 3IM9A 3FZ2A 4XPCA 4A8YA 3MM5B 4KY3A 4WBFA 4CNZA 4PABA 3OL6A 1E6VB 3CCQS 1T9UA 1S1TA 1H73A 3L3CA 3T9NA 1KVIA 3DGPB 1HBNB 4C3KA 1OS5A 4ZK7M 2OHDA 1VC6A 3VVTA 3RRKA 3G96A 1KDNA 2J7UA 2YKOA 3EXCX 4DFMA 2V67A 4TLRA 2CZVC 3LAKA 1O92A 1DY3A 2EG1A 3THVA 4DMZA 3PM9A 2B6AA 1TELA 5E7OB 2DH7A 3O44A 2R2TA 2ZH5A 2VD3A 3SI8A 3VR1A 2XYGB 2VC1A 2XEXA 3DRRA 3LGMA 3OVAA 3CULA 1SV5B 4YS2A 2XULA 3MWBA 4B3OB 2QFIA 3DLKA 4PZVA 2N3LA 2H54B 4R8UB 3QIDA 1CJTA 1X0FA 1RISA 4IG0A 1U4BA 5MLCV 2ZH4A 1JLEB 2KM8C 2ATLA 3KLVA 2NXUA 4ZP7A 3I32A 1P7LA 3ISNC 2Y4OA 3UX3A 1S6PB 4WFZA 7AT1B 5GAGI 1N56A 2GMLA 4ETZA 4XTTA 4OJ1A 4JI7F 1PCAA 1W2IA 3PO4A 4R0MA 1FDAA 2RDDA 2Z0GA 4RX6A 2E1RA 3M4XA 2Z2LA 2I0XA 1VRUB 5HN0A 2E5LC 1UWBB 1FRMA 4EI2A 4EZ6A 3HSJA 2OEJA 3TUZC 4DR1F 2MHNA 2GZOA 4QW9A 2IIHA 4ZS6A 1SC3B 4ED1A 2I9SA 2W9BA 3BGOP 3OTDA 3EUNA 5BUSA 1I5OB 2KT5A 2W7PA 1NDPA 3T1HC 1KHWA 2XLJA 2CNKB 4U95A 3VZHA 1FRHA 2CRLA 4QU6A 2CADA 3NGUA 3M2RA 1S9EB 3D3CJ 3QBCA 2AU0A 2ZBPA 1RT5A 4URSA 3T3FA 4GKJJ 2BR0A 3RBDA 3MM9B 2ZE2A 2XTJP 1RTDB 3DLHA 4IKAA 3NCPA 5LM7E 2M4MA 3NBPA 1Q8LA 4AD6A 2OFHX 1S12A 2BUNA 1VEHA 4Q2LA 2RE1A 5ETLA 2UXBC 2YWGA 4ECXA 4PXCA 4E2FB 3SDEB 4X4RA 5L46A 1B7FA 2D28C 2ZBIA 5D15A 3DCAA 1HNVA 2ZH7A 4F3QA 4X65F 1O5JA 2V8PA 4K2JA 5J2NA 2V63A 3A1YG 1EQ0A 2VZEA 5T41A 3NNCA 3MMBB 5J2QB 4ELUA 2VFUA 2B9EA 4X4PA 1GFWB 1F3VA 1YJTA 2OPLA 3KLGA 5KG0A 1TMJA 2RB7A 2VF3A 5T7LA 1IBMJ 4EK2A 2Y1JA 4N77A 4RKUC 2FVRA 3CO9A 1FRXA 3JYTA 2KVIA 3ET6B 5MAOA 3GSIA 3HM9A 2BMBA 1MNEA 3AOCA 2VIHA 4TY8B 3CUNA 4DPTA 1KFSA 2OBVA 3RAQA 3ITHA 2C28A 1IKYB 1JLAA 1WF1A 4K4WA 3BGRB 1XMOJ 4KBIA 2P5VA 2PMHA 3OL8A 3V6DA 2DNLA 2LP4A 1USPA 2MYFA 4YY3J 4DUZC 3R5DA 1HKAA 2B9XA 3D5MA 2PA8D 3E3XA 1XR5A 5JRHA 1VHIA 2DNQA 2DGUA 2UVWA 3DOLB 1WSRA 4NPOA 1ZM4A 3ETOA 4M5LA 2M8HA 1RAJA 2WONB 1X4GA 4DFPA 3L8CA 5K8NA 1TAUA 5KFEA 2G13A 2HFNA 2A1BA 1EHWA 3R6LB 4QYZK 3OHAA 1VLAA 2XCPA 1H98A 4O3NA 3FQLA 4MJKA 3VGTA 1U1QA 2HFVA 1RA6A 4ED7A 3NMAA 5M2PA 2AEFA 2ZJPQ 5I3PA 4K4XA 4ELVA 2FGOA 1S9FA 3D54A 3EERA 4DV2C 2YKNA 3R8YA 3HHLB 1S49A 2W01A 3NXZA 2ZVIA 1MWQA 3KLEA 2FC9A 1WHWA 1FWPA 2NR0A 4V19X 4MAKA 1YJNS 1FVSA 1RT4B 2AX0A 5B0AA 1SC4B 4EBDA 5GAEU 3QJJA 1JNZB 1O8BA 4F0HA 1TKZA 2M0GB 4CIOA 2XMVA 5HAOA 4OYZA 1PG5B 2JEGA 2HNDB 4ZPVR 4J9QA 3GU0A 3OTOC 4ILMA 3CIMA 2XWYA 3O5TB 3C14A 1UFKA 4PXEA 4F4WA 1D9FA 1S6OA 1UZHA 4NXMF 1ICEB 3UD5A 1W26A 3CDEA 2NPFA 1H7XA 1T3OA 2V4QA 4RMNA 3DLEA 3TJ9A 4F50A 3VAKA 2FHJD 5M2UA 1M6XC 4J37A 3DRYA 2DNMA 4IFYA 4PWUA 4NLXA 4P2SA 2BW2A 1WTFA 2HHUA 2G4BA 4Q2MA 2FY1A 2D7SA 1PC4A 4M5JA 1GEHA 3DU6A 3D2WA 1HWUA 4MH8A 2RF2A 2C2EA 3GPCA 1TAQA 3JXOA 4HT5A 5CXTA 2QVXX 2A10A 2CJAA 4UUXA 2AJFE 2DYAA 1PG3A 5CYMA 1REVB 1RJJA 3W9JA 4DL4A 1MU2B 4A48A 2WSEC 1PJ5A 2ALZA 2HHVA 4PYDA 4AL7A 1T05A 4LT6A 4PR6A 2CXEA 4TQSA 4K8RA 5EDWA 3OW2R 2F40A 5J1EA 1B64A 3QZ7A 3UCUP 4RLQA 1NH7A 3ZZ0A 1KQSR 1F2HA 3OSNA 5J2PA 4UOFA 2IRUA 3JQKA 5DGAA 1J5EF 2YKAA 1VQ8S 4DPXA 3M8WA 3FMWA 3EGNA 2ZZNA 3ELHA 4FYVB 3W63A 4ERDA 2I5JB 3C16B 2LEPA 2OPRB 4JI2C 3V4IB 3W8PA 4OFZA 4U9RA 4LF4C 2NS1B 1LQLA 2PFFB 4DR4F 5ADZA 1HNWC 1RHJB 4OI2A 3OR2A 3NL0A 2M2BA 3QGHA 3T6JA 1LOUA 1ZAWA 1S4FA 2BX6A 2XMKA 4ZKAA 2AP6A 2BE2B 2V9KA 3RTVA 3L7PA 4DJBA 3SCKE 2UUWA 4C8YA 1HHQA 1U6FA 1YJ7A 1DJ0A 5LT5A 2E7GA 2F63A 1E6VA 5H9EK 5JJBA 4IO9Q 1Z2LA 3SBMA 4KGVB 3DGPA 4ECZA 1MROB 1B0PA 5EUHA 2D1CA 2CQ0A 3JSMB 2Y1IA 2O3DA 3ZZZA 2RHSB 1RT6B 4DL2A 1EJ7L 3HKWA 2R7XA 2KN4A 5LSOA 5L39A 3N6NA 5JUMA 4F3OA 1JOSA 3CJEA 4NDNA 4LF8F 5F9LA 2B9YA 1R7IA 2VG6A 3OLAA 2B51A 2FJVA 3JSRA 4W98A 4J9MA 2CKWA 4HKQA 2G1HA 1NXIA 2EFNA 3MMCB 1SV5A 4LSLA 4B3OA 3DI6B 3GV8B 4IOAQ 4R8UA 4GXQA 2J0WA 1RCOB 4BSZA 1ZB9A 3KUGA 3M2UA 2HHHC 4MFBB 4ID5B 1Q82T 4HR2A 4I2QA 1S6PA 2R8JA 4FNIA 4YHHJ 2UUBF 2XMWA 2ZJRQ 2FTRA 2ZHAA 4NLSA 2RU3A 1XNQF 4YDXA 2J8SA 3D1OA 4LVOP 1UJ4A 4X62J 3OL7A 4FTFA 4J9VA 1LFWA 1VRUA 1NK0A 2XSJB 1TVRB 1UWBA 3D6TB 2LEBA 1F5CA 1KKGA 1T7PA 3DHWC 4P9SA 2QGFB 4DR2C 2APOA 3MM7A 3CD6S 2ZBCA 2RH3A 3I4PA 5BSUA 4DR7C 3FSIA 3IWNC 1AFIA 5EX0A 2IJRA 4DUYJ 4F4XA 2HQIA 4M5DB 1QM4A 4CLZA 2GVDB 2CZ9A 5A19A 2UUAC 4L3KA 1UFWA 1NLKL 1Q8BA 5I3QA 4AFFA 1LWEB 4G36A 1APSA 3H2LA 1S9EA 2C3PA 3RR7A 1RT1B 2MKSA 2BE9B 2P8IA 3I56S 2HS0A 1PYTA 1SKWA 4FXDA 5IWAJ 3MM9A 1UKKA 4CH0S 1ZM2A 4X64J 1RTDA 1OWXA 3TNVA 3U1LA 2DO0A 1OY9A 4NE9C 2AGOA 4NCGB 1NZAA 5GADU 4F36A 3LPEA 4CLLA 2XNRA 4ZP8A 2VBYA 4LFBF 2AHOB 2GHPA 3J81D 3SDEA 3HHNB 4QPTA 4ENOA 3OFGA 4KR0B 2KU7A 1QAYA 4LFAJ 2CWKA 3S6EA 4USJC 2DEJA 5GAHU 1VYAA 2IVYA 3BZQA 4PG4A 5E3AA 2MGZA 3MMAB 3GCWP 1B0VA 3MPUB 5J2QA 3P49B 1CQNA 2VA3A 3ICLA 4ES2A 4URGA 4ITSA 1HIYA 1F2GA 1RSCA 2NUUG 5SZTA 4H4KA 3W2VB 3OPKA 4ALZA 2MM9A 3UDEA 3W64A 5IC6B 5KFFA 5T8SA 2JFKA 1NYEA 3E01B 2HFOA 4DV7F 2RMLA 5KFZA 3THPA 4USWA 4D3GA 3TZXA 3SZ2A 1DARA 1GT8A 2DRAA 1N32J 3H4BA 2B5JB 3ZZTA 3HHDA 4F0MA 4D4IA 3WIVA 2CQ4A 1KOHA 2V2QA 3TANA 4DR5C 3CF5Q 3QSIA 3GYNA 3QFHA 3IP0A 1YI2S 4TY8A 2DR6A 3AAWB 3NGRA 4DHVA 2OFGX 1XRAA 2CNOB 1IKYA 2YTCA 3BGRA 4QIVA 2CJQA 3BN4A 1FRIA 1N5YA 4ZLLA 5FD1A 2GHVC 4KC5A 2W2PP 2BKOA 2YWKA 4CLPA 3G87A 1I51B 1LWCB 2X1BA 1UA0A 2W4DA 4K0KJ 3AT1B 1RHRB 3UN5A 2U2FA 4YEAA 2WONA 1DFDA 1XRBA 2V4RA 3MMJA 3BV8A 2C42A 4O44B 1RTHB 2AJQA 1IKXB 1M1GA 4I56A 2FLPA 1CSJA 5KFQA 1DAXA 2XBPA 2WB4A 3WIUA 1R31A 2GJIA 4GMKA 2ZD1B 1BUXA 1XMQF 2JEIA 2ZHBA 4WS9A 1H72C 3HHLA 1I3OB 3N28A 4O0IA 2U1AA 1HARA 5BSWA 2HHQA 3CJ2A 3TZYA 1KTQA 2LVWA 3H2VE 4KTQA 2R2UA 1RT4A 1AXQA 2Z8QA 5LMNF 4HDHA 4X2BA 4IYQA 4IFVB 2CPDA 2XM3A 1SCJB 3EDRB 1NEEA 1NPRA 3Q8UA 3V4MA 3I82A 4IUFA 3FJ2A 1QSYA 2DXFA 3FUYA 2N7CA 1LW0A 2LCWA 1SQGA 4DQIA 3P6YC 1GMVA 2AKWB 1NK9A 2WVFA 2RNEA 4YR3A 2R7VA 2CXCA 1U7LA 4YQWA 2ROEA 4DV4C 1KLMA 3TAMB 2GAHC 2IBKA 3DLLQ 2BEFA 1JLFB 2Q6CA 3BF4A 1QAIA 4DV6C 2C3UA 1H2VZ 4ILLA 4QWDA 3FBEA 2UXDC 1PG4A 5B08A 2FJDB 3Q8PB 2VASA 2YNFB 4FXVA 3JAMU 3HXMA 3TVZA 2CFXA 1RYRA 4MKAA 4DS4A 4EYIB 4M5KA 1Y5LB 4PPDA 5JXSA 1P27B 4UZBA 2E9TA 3AD7C 4DSJA 1RWNB 3EPGA 1NK5A 3A9VA 2XO7A 3CJ0A 1OY8A 1FJGC 1LCIA 5F8GA 3LP2B 2SXLA 2D69A 1WI6A 5KFUA 1WORA 2DH8A 4M5GA 4LF9C 2F5GA 3OTBA 4WJBA 4B9NA 3V81B 3GQCA 4ZLPA 1NHVA 1RY2A 1UVJA 1SC1B 3R9WA 2Y1RI 4HACB 4WFYA 2DY9A 2ZM6C 2ZH9A 3I07A 3A3NB 1WTBA 2VFSA 3JQMA 1MU2A 4JB8B 1KHVA 3C46A 4DV0J 3UPFA 3LO3A 3Q89A 4OJHA 1UJ5A 5A6PA 4NZ6A 1X4AA 1BQMA 2HIYA 3IS9B 3T19A 2E5LJ 5L1LA 1U6ZA 3R7BB 3CDWA 3BKFA 4DZDA 4ZLNA 1QDUB 4JP8A 4EUVA 2WOMA 1DLOB 5DETA 5GTDA 2HPUA 3TQIA 3KUEA 3BR8A 2I5JA 2WW8A 3J81Y 3PW7A 3IPLA 4F3MA 3OXLA 4DV3J 4N76A 3V4IA 2Q79A 2YNGB 3CXCR 4ZPBA 2G2OA 3CJ4A 1NK7A 4M94A 2CDQA 1K0RA 3CE8A 1H74A 2OMLA 1BD6A 4YN3B 3T1HJ 2H4WB 3V5RA 2XLIA 1HI1A 4RW8A 4OIXA 3CCMS 1XNRF 3KHGA 5DJBA 2BE2A 3R9LA 3M32A 2WRMA 2R9LA 5A76A 4A8FA 1YK9A 2DGQA 1M5PC 4DPUA 2XQCA 5DS7A 3OD2A 3QWUA 3F44A 2MDAA 5IT4A 3HHEA 2E5GA 3PW4A 4KT0C 1NM2A 5K85A 4ATNA 1RACB 1JXVA 4NYZA 2EFGA 2B7BB 5CZVA 3JB9k 4A8MP 1EQMA 3LQVA 5KOXA 1RT6A 3H59A 1RB0A 4A4JA 4O3PA 4ED6A 5HBMA 2HHWA 2Z51A 1R43A 3FCVA 4A8XA 1RADB 5LXYA 2KO1A 3W1YC 2YPYA 2FJAB 4FS1A 4AXJA 2W7OA 4ED2A 4N56A 2GQCA 1RWVB 4PZPA 1NRKA 4CH1A 3DLGB 3K17A 1H38A 4I4BA 1WSVA 4USIA 2RSQA 1AFJA 3RAXA 2LYVA 2Z30B 4JI3C 3M8RA 3PR5B 3QGPA 4XO0A 3LP1A 4LRBA 4P52A 3IMLA 4OZ1A 2OH2A 2JJ4D 5HLFA 3NPDA 2M70A 2D1QA 5CD4H 2G9OA 4PKDB 1VQ6S 1Y3JA 3R7NB 2FVPA 1PIEA 2VB6A 3BR9A 4ANCA 4WFXA 2Q6BA 1NK4A 2DRDA 1U8SA 3NEKA 3OFFA 2XSJA 4X84A 2BW7A 2LKZA 2YWWA 1MWZA 2FLLA 1FHTA 4WU3A 1EKSA 4ZPWR 1WDTA 2FJEB 1UEKA 1FXLA 3CGIA 4DDFA 4M5DA 1M5VC 1U09A 4NA1A 5ETTA 3GFYA 3G8SA 1HMVA 1EETB 1XRCA 4KHPF 4BCAA 1LWEA 3TZZA 3VNQA 1G3OA 2HWTA 4P2MA 4TLQA 3Q83A 4OX9F 1V5IB 1RT1A 2VDIA 5KFOA 3D7SB 3ZTSA 1UPMB 1U24A 3B8HA 4J9RA 2CA9A 2ATWA 2CPFA 4DV2J 3HSDA 2J7KA 2D3UA 1YTYA 2VG5B 4AUKA 1GMUA 3CVKA 2QMUB 4MH4A 4NCGA 1RU1A 4C7QA 3I5AA 4MT1A 2E7VA 4I7FB 5KG5A 3CCSS 2LLZA 5HANA 2KXNB 3T1YC 4U7UK 4LFCC 4CT8A 3BJYA 1KC8T 5B09A 4GKKJ 2HQGA 4J9OA 2AGPA 5C24A 3BM7A 3KHHA 4JI8F 4N8NA 1NJYA 3MMAA 4LIWA 2HS4A 2KZ0A 3PRDA 1YJ9S 3MM8A 2WBRA 3IR5B 1YRXA 2FGCA 2DVIA 3OTOJ 1RTJB 2HKEA 1VRTA 1VGYA 4JI1C 4XK8C 4ZVSB 5BSRA 1WH9A 2YH1A 4HTJA 4DV1F 3CQ1A 4ZJOA 2PFDA 1HNZC 2FC8A 1PYOB 2UUCC 1A7GE 2B5JA 3KHLA 4JI4C 5KFJA 2ZFHA 3OR1B 4Y2KA 1VBZA 3IBWA 2BE7D 3H25A 1LXJA 1YZ6A 3GIKA 4CO2A 5D8HB 1XK8A 2ZDOA 2RRAA 2QYCA 1U2CA 1H3DA 1LWCA 3LW5C 1S0OA 1IWAA 3N79A 5B0BA 4UQTA 4JI0F 3K5MA 4DPOA 3M9OB 2H48B 2N3OA 5LMUF 1RWMB 2MKKA 3LWLA 3QQCD 2MZRA 5HI7A 2VONA 2MQMA 3CB4A 3S82A 1TKXB 3PNIA 2PI4A 2R7OA 3N9UC 2BM1A 2YQ1A 3PRVA 3L7OA 1IKXA 5HQ8A 2BRLA 2VQFC 2NXCA 1S0VA 3HMJG 1R8HA 4K5SA 1SL0A 1CJUA 4A8SA 2GO8A 1Q53A 4PYAA 3JTOA 4C3LA 1R6VA 4OZ0A 2MLZA 1TK0A 2GQ2A 4JBCA 5BSMA 3PX6A 4JI2J 4CLUA 2HHSA 4ECUA 4UF4A 1IKWA 4IR1A 2X7IA 1C4CA 1HNWJ 3J81U 2HRUA 4DG8A 4L75A 2DR9A 4IFVA 4TU8A 4B02A 2QMWA 5BYRA 1UWDA 4C0HA 5DM6Q 2DKOB 2NYIA 4AE5A 3W60A 1N48A 1FD2A 1Q7LB 3SYZA 2R7QA 2BXJA 4NMXA 5L8RC 1HA1A 4DEZA 4CTAB 1HNIA 1UVNA 1LW2A 3B78A 2IDLA 4HH1A 1NPPA 3TUFA 2AEJA 2FVSA 3DC2A 2PC6A 3BDEA 3IWLA 1PU1A 1KWMA 1B99A 1RWPB 3NCQA 3FRZA 2W2QP 3KNAA 2VJVA 2OD4A 2XB2D 3RRHA 3G8QA 5CHCB 1WELA 1WOOA 3IGVA 2XMMA 4E8UA 4U67Q 1FKPB 2GJFA 3LP2A 5HVGA 3EGVA 4H54A 3V81A 4U7UD 1Z4UA 3HVTA 1RHQB 3M1VA 4DG9A 3HX9A 2QL7B 4B3RF 4TN2A 2J7WA 4HACA 5AT1B 5AJ3F 1RAAB 1WF0A 1VR6A 1W25A 2HHHJ 2C2RA 3CC2S 4MYUA 2I1RA 1EIYB 2RU9A 1NNDA 4IG3A 5CA5A 2FJBB 4LF5F 4D57A 3POTB 1SBRA 1SUQA 2XYHB 3FEXB 2KG0A 4R25A 4U6PA 2KFYA 1RU2A 3ENAA 1J2VA 2C2NA 2IDEA 1UVMA 5IS2A 3EZ5A 1RWWB 3IS9A 3ILLA 3M8PB 1VK3A 4WV3A 2R7SA 3CC4S 1CLFA 3V6JA 1FFSB 4ED3A 1DLOA 4JI7C 2K3IA 5A8KA 4DR7J 2EFOA 4DQPA 5GMEA 3L4BC 2EG2A 3A26A 2AWZA 3H5YA 2AYBA 2LA6A 4J90A 3GG0A 2R8KA 2HQDA 2UUAJ 3D6HB 5F8HA 4BBYA 1FDBA 4BDPA 2J5AA 1N4LA 4LRAA 4YP3A 3DNCA 2QLFB 3UFCX 2BOPA 2A0FB 1K0TA 3NGKA 3AA8A 5C7PA 3DRSB 4HYKA 2PDAA 5AXKA 2XGQA 3M6VA 1VQYA 5KT2A 1JJHA 4CO3A 4O4GB 2XHWA 4ZVEA 4QW8A 3DKDA 3I31A 4KQZA 4EMDA 5H9FK 1S99A 1VISA 5IM0B 3S8SA 3M8SA 3HD1A 3K57A 2G0IA 1U45A 2QE5A 1I1GA 1WHXA 3DRPA 1RWUA 3FKBA 2PT0A 1KQKA 1WC6A 1JLCB 4FPRA 2F9DA 4UY8T 5E3PA 4X64F 4OI4A 2AMCB 3US5A 4I69A 1JLGB 3QSYB 4C8NA 1NSAA 1U26A 5KFWA 2XLKA 2B8PA 5L38A 4KYZA 3TR3A 2CPEA 2FPHX 4RW9A 2XYPB 1V3SA 2Y0SD 1OPIA 1K44A 2CNNB 3UD4P 2MSSA 1UEUA 3RYLA 2KZFA 4ECSA 3HSGA 3C6TA 3MM6B 1ZZNA 3MPVA 4DR5J 1MLAA 4ZVTB 2NYHA 1NBEB 1J5OA 3UN2A 2J9CA 2CDRB 3OUYB 3RG2A 2HGLA 2JLGA 4C48A 3UDCA 2WHOA 5KG3A 5DQIA 1P9YA 1NDCA 2FVQA 2DYJA 2VICA 1S6QB 2FHMA 4J9SA 4F4AA 1KQGB 3K58A 3ZO7A 2LDIA 4IR9A 4L3NA 3DLPX 1YDLA 2ASJA 3M8QA 5KFVA 3V2UC 3FDSA 1Q4RA 1JMTA 2C2OB 4TQRA 1FI4A 3MEDB 1X0PA 1NK6A 2AQ4A 4JI5F 2HBZB 2B4UA 4L72B 2QSFA 2HHTA 2D41A 2XMAA 3DM2B 2K8GA 3KJFB 4QJVA 3B4DA 3R7SB 4DL0C 5KFHA 2ONFA 1IJFB 2B4OA 2JNVA 1QSLA 5GMKa 3BGLA 1WKLA 2GVZB 2IA6A 1G4CA 2GMHA 1TZ0A 2VPXB 3SCLE 3G82B 1TL7B 2QC3A 4C8OA 4USVA 1QTMA 2MKYA 3G86A 2VFVA 2CQPA 4OYOA 4LR7A 3DXSX 2HK2A 1MD9A 4DV5F 4Q7AA 5D0GA 1N6QB 4Q45A 1N2FA 3RBZA 4B3TF 1HL6A 3P8BB 3BREA 1C0UA 2X51A 4K5RA 1LEOA 1L3VA 1L3TA 3CJKB 5AE3A 5E5NA 4NLGA 3WQPA 4DV4J 3I0RB 3D0HE 3BQ1A 2P6TA 3HD2A 3SFUA 2PEBA 2FLOA 2NZCA 1RTJA 2IAJA 5G0RB 2JSXA 5HO4A 4GVBB 4M5IA 2RILA 1D09B 1RLDA 2LXFA 2IYIA 4XDDA 1K0VA 5IV3A 2UXDJ 4PXBA 1YVFA 3KJNB 4C2MA 4B3SF 2CQ3A 4UT4A 4NLDA 3EYZA 3Q8SB 4WE1B 2YX7A 5KFYA 4NXMC 4HPVA 1FWLA 5KTQA 3HHKA 3KMSA 1VQSA 1WNEA 4MIAA 3P3DA 1AZSB 3GWCA 3CSKA 5CYJA 5DLGA 1FJGJ 3NOGA 3FEYB 2UU9F 4HI2A 2PROA 3J7YI 4LF9J 4QZVB 1G6BA 5C25A 3T6BA 3TDEA 3C15A 1K1SA 2HEKA 4KE5A 4I64A 1MXAA 3TZWA 1Y5NB 1RA7A 2MKHA 2UZAA 1OY6A 3G4SS 1OO0B 2ZM6J 1HBOA 2W4CA 5A1IA 3ILOA 2K3KA 5D0RA 2V8DA 1FKAF 1UZDA 2CJKA 1HR0C 4OYBA 3VF0B 3EDQB 3BH6B 3DLKB 3M6UA 3BBBA 2VKRA 3QAEA 1YRTA 3MUMP 3FNNA 3DAYA 1VLOA 4IH6A 3TEHB 4OJGA 2BZ2A 3H2TA 2VZ9A 1PBUA 2HAIA 4ZVHA 1OYEA 2QZ8A 1QE1B 3MAAB 2VQEF 3KMQA 3B4MA 5T8TA 1FTRA 3NWRA 2HVDA 4QIGA 1IR1A 3K59A 1P6TA 4RBTA 3AJDA 4WZMA 3E7WA 3AQOA 4DCUA 1JLQA 1T95A 4KFBB 4DR4C 2P2FA 1T9XA 3PW5A 3I9V9 2WSCC 3HSZA 3TVYA 3GSDA 1P4EC 1H7WA 5F41A 3LUYA 2PO4A 2YWEA 2DGSA 4CTAA 3D4JA 3MAQA 1ZPVA 1UWAA 2FHKA 4C3MA 1ZBTA 1RT5B 1F5BA 1B7YB 4OX7A 3FVYA 5B0CA 3WBZA 1MG7A 2HBYB 2DCLA 4NLYA 3BSOA 2DHSA 2CQ1A 2F8HA 3NLCA 5THWA 4WCEQ 1L3UA 2E1PA 3KG0A 1GAOA 1UVLA 2BKPA 1HQUB 2XS7A 5KG7A 4USMA 3JTNA 3GFXA 2CIMA 1UETA 1N5TA 1RE1B 2MXYA 3Q86A 1XERA 1FKPA 4DUTA 4NEYA 2Z2ZA 2VJUA 1GMWA 3R6GB 2UXBF 3CW8X 1HNVB 3CW9A 3ZTQA 1RABB 1YITS 4LF8C 4OLOA 2B8QA 4GO7X 4JI3J 3PFEA 4KHRA 1AROP 4NZ7A 5IC4B 2HNYA 1YJVA 2HLUA 3W9HA 2JEFA 1OQ3A 1WD6A 4B3MF 2VPZB 2UVVA 4CO4A 1RAFB 4L76A 3GYXB 3TW0A 1BWVA 2W2OP 5BSVA 1IM4A 2X3DA 2J0QD 3OJUA 3MOZA 3JYTB 4LSNB 1NDKA 2CWXA 1D9AA 3M8PA 2V8VA 5KYTA 3VAFA 3KJQB 1WG1A 2UUBC 3JSYA 2JMPA 1XNQC 1CPZA 5F8IA 2OSRA 5L1KA 1JLAB 5E7QA 4L74A 1FJ7A 4L6V3 2QJ3A 1VQMS 3DRXA 3MD3A 1F1BB 4JYAF 1OSDA 3GJTB 1PJ6A 5AE1A 2OI2A 1VC0A 1NCLA 2XCAA 2QEXS 3EICA 3I0SB 3BQ0A 3NYRA 4DUZF 1LV5A 1SI9A 3GG1A 1FDNA 1ZAVA 3DRSA 4G1IA 3H5SA 1NJIT 1ZTTA 1HW8A 2QW0X 3TRGA 1P1LA 2VUGA 4C98A 1UL3A 5KFSA 2WVCA 2BACA 1MW7A 4FF4A 4WZQA 2B4PA 4HI1A 2D3O1 3QT8A 1NDLA 2LQBA 3T1YJ 5KT5A 2ACYA 4I68A 2KVQE 3MR3A 4LFCJ 3MR7A 2E29A 4ODJA 2IRXA 4LBHA 4FPIA 1Q16B 3MEKA 1SL1A 2MJNA 2JZ5A 5DO2A 1OMSA 3NGDA 4LFBC 1QLNA 2HVHA 2CAJA 3KLEB 1XS3A 5IT9D 3IGNA 2XY5A 3IMQJ 3UQSA 1JLGA 1X9SA 3Q0AA 5HJYA 2CVIA 4JI1J 2OO4A 3ETCA 4RNMA 3CDUA 2V50A 3RB3A 5CABA 4YB1P 2F65A 1HNZJ 1UVIA 3KHRA 1I6JA 1T5DX 1XJWB 2UUCJ 3RZAA 2PSZA 1GPMA 1R0BG 2D74B 4JI4J 3GP9A 1NJXA 3KK3A 3SXLA 4G1QB 1NB2A 3UVJB 3VWSA 4DV7C 2Q66A 3C14B 3ONQA 4P6QA 2KT3A 3ENQA 3A4IA 2GIFA 3ZZOA 3W8GA 3OUYA 1WDDA 1XTZA 4KGXB 3DLEB 2WZ1A 2M9KA 5ETSA 1S6QA 2G0JA 4TPSB 1T3NA 4IFYB 4TXSA 2BDPA 3VGVA 2PN6A 4PWDB 1G7CB 1HQEA 2HS3A 2BYCA 1SQFA 1REGX 3FEZA 3K5PA 2YWHA 5CYQA 1M5HA 2RF2B 4OZLA 3KDNA 4LMZA 1Y9OA 5BR8F 1T03A 3SQGA 2P6SA 3Q8RB 4P2XA 1X8DA 3DM2A 1WUUA 2VQFJ 1Y11A 3Q8YA 3B6BA 3LNOA 4ZPAA 3KYLA 3CMAS 4ZN3A 2KFZA 5KFTA 5K14B 2QMXA 2R8IA 1KBRA 3UNGC 5A2QU 3RU0A 2WK4A 3ZZUA 2EFQA 3UR0A 1HD0A 2RQKA 5D4NA 1CJVB 4K4VA 2V0NA 4DR3F 4YFUA 1YBUA 3O2EA 4X4NA 1ZZFA 3D6FB 3D0GE 1XMQC 3DOMB 2POKA 2GIQA 4FZVA 1N6QA 2LU1A 5IXUA 2QO3A 4QWBA 4OZ5A 2V6AA 7FDRA 4DR6F 1C1CB 1ZETA 3A9UA 3L95X 3R1LA 1GQEA 1EARA 5J1NA 1R8BA 3ETMA 3I0RA 3OR2B 4LF4F 4MTNA 1SJ4P 4RL1A 2MTLA 2IVFB 2OMOA 3N5FA 1HFEL 5G0RA 4PPZA 1DQAA 1ZAXA 4GVBA 1S1WA 2DY1A 1TU0B 2QVYX 4HHUA 3KOAA 4AQYF 3D0IE 4C8MA 5K20B 1PAUB 2W24A 2P2CB 1FUGA 2E5IA 1JJ4A 4P73A 4WE1A 5I4MA 1K9MT 2GS8A 3OXGA 1S57A 2AYMA 4FYDA 3PR4A 3OL9A 2ZH3A 2YKPA 2L9DA 1AZSA 3G2XA 1KQFB 4ISBA 5FLXD 3PEJA 4N5SA 4DCJB 1DQ9A 1RLCL 2F4VF 1ULTA 4OI3A 5CCLA 4DX8H 1EKRA 5G4DA 5KFDA 2CJYB 1N36F 2DGVA 4RNHA 4RPFA 2RVJA 3GILA 3QLHA 2VG6B 2DGWA 4LQ9A 3ZTRA 3N2QA 3FSXA 4Y6IA 2DB1A 1KS2A 1A6LA 2RHQB 2YKMB 3D28A 4Y2CA 5IT0A 4NLVA 1HWIA 5D77A 4LSLB 1YG0A 3K0JA 4NOHA 4UZCA 3MFIA 4O4RA 4EEYA 2VV5A 1U48A 3M9NB 4RUCA 4FDFA 3D68A 4DCSA 2HLTA 2GQQA 4X4QA 2RKIB 3M2UB 5L9NA 3UZ0A 4WIQA 3BKUA 4JI7J 4TY9A 5K5MA 1T9YA 2B7CB 2IM2A 2PMWA 4I2QB 2FYXA 4DV0C 2P02A 1NPKA 1QE1A 3MAAA 2HGMA 2CQHA 5HSPA 1FNXH 1S77D 4ECTA 3AODA 4DR1J 2LQ9A 3MM7B 4LF6F 2RIJA 4UOCA 5IT9Y 4OQJA 4PG5A 1NB7A 4KFBA 4DR2F 3OT9A 3TO8A 3LTOA 4DV3C 3CW2C 2EFPA 3HVWA 4O3QA 1WF3A 5C42A 3AH6A 3GB0A 1XNRC 1HLWA 5HMWA 3CC7S 3P4UB 5EHHA 3CCES 2ZWPA 5B0FA 1S1VB 2QA2A 4IR7A 3AY0A 1MSWD 3HVAA 2H9ZA 4NCBA 3CCZA 5DG8A 3R2DJ 3IEUA 2DHAA 2DT9A 1H6KX 5B0GA 5GMDA 5KFKA 1MMLA 1ZS6A 3OBIA 2ZOFA 5HMYA 5LL6d 2Z57B 4P2FA 2FJWA 2NXEA 1HQUA 2FQQB 2RUSA 2IHR1 3PTWA 4ELTA 8ATCB 2DRBA 2A2DA 2M88A 4N41A 4NI2B 4BWMA 2EEYA 1N33F 1R0AB 2V2ZA 4NX9A 5BSTA 4PUGA 1Q0NA 2BJ7A 4KRWA 4ZPCA 2MGZB 3MURP 1IVZA 2XMJA 4OHZA 4WYLA 2EFVA 2EW9A 3RB6A 3MHYA 4DXLA 1HNXF 4X4SA 1T9VA 3MDFA 1OYDA 3H7HB 1RP5A 3AJ1A 1TH5A 4X66F 3GIIA 4FKXA 3VQTA 1RBOB 3K5NA 3VHQA 6FDRA 3C66A 4LSNA 4USTA 3R5AA 2HSEB 4QWCA 1S7IA 3M7VA 3IEVA 5U47A 5GAEI 1R6YA 5A8RB 4D56A 1GX5A 4NRUA 2D1TA 3H0PA 4KHMA 3QGGA 4J91A 3J80Y 4DX6A 2XC9A 4OL8A 4NLWA 3K5OA 4RBUA 1N5YB 2AZ3A 4ZPDA 1HYSB 1BA3A 6AT1B 3IA0A 1IBLF 2BV3A 2IM3A 2O5DA 1AUDA 1U1OA 3MXHP 3CDAA 1V3ZA 3HT3A 3N6LA 5T14A 4C8ZA 2JHEA 4I9GA 3H4DA 2P9EA 3GONA 1QJHA 3I0SA 1YBTA 2M5HA 3CJ8A 1RAOA 2BBEA 1ZYQA 2LMIA 4FUTA 1MDBA 2NCKL 4ZIWA 4KHPC 2F1FA 1VC5A 3TQEA 3X3UA 2CQBA 2C2ZB 4DG1A 3BDPA 4OX9C 3UOWA 3L7UA 5CCMA 3NP5A 4PCQA 1Q7YT 3PESA 3CCTA 3FCEA 1O9TA 2GNKA 1S1UA 4NASA 4CLWA 3CMES 2PA3A 4CI0B 4RO0A 2ZZMA 1AB8A 2AYEA 3D66A 1U02A 1Q5YA 1CC8A 5FLXY 4NA3A 2F3JA 3T1AA 3E51A 1RAHB 1H0HB 3J7A1 5J1PA 3QT6A 3RGIA 4JI8C 1A9NB 4CO5A 4GKKC 3HJVA 1FD8A 2QX0A 3MEEA 2UV8A 3BS9A 2VH7A 1R8PA 1LW0B 4NZ0A 1JJCB 2VBXA 2MY8A 5DG9A 1O6XA 4C4WA 4NLOA 2HJGA 1KLMB 4G1QA 4IOCQ 3UVJA 4NXMJ 4DV1C 4ETXA 1QAXA 4OHWA 3TAQA 1SQEA 3GJRB 1RGVA 4DBQA 1TKTB 1WOSA 3DHVA 4WFNQ 4DV6F 5HP1B 4CLYA 3ILIA 2JLEA 2LECA 4DX5A 3KLIB 3DYAA 2ZH6A 3DU5A 1S48A 2H1YA 1N34F 2JC0A 3PJ9A 1QTNB 3TEGA 3KTQA 3G8TA 4PWDA 2VSQA 2ABYA 3OTCA 2CJBA 1HWLA 4CLSA 3WZ0A 2MEWA 3NNHA 3R2CJ 1VJQA 3M6WA 5KFBA 2OAUA 2OSQA 2CUYA 4RVOA 1HR0J 3BEGB 2J9DE 4XDCA 2EPIA 3CWJA 4PQAA 4F26A 3SO4A 1U8WA 5LSLA 4WTYA 4TVAB 2W8KA 3HFKA 2K1RA 2EGTA 1U25A 3TUPA 5KFLA 4JI0C 5I3UA 2H5EA 3CCLS 1C1BA 1EGAA 5LMUC 2CPIA 3LALA 1RAGB 1YGYA 1X7VA 5K14A 2ASLA 4QOTA 2OELA 2R7RA 3QATA 1F9HA 1X9WA 5BUQA 4Q8EA 1YWXA 2PMZD 3D9BA 1FCAA 5EWFA 1J5EJ 3CPWR 1BQMB 4ZVOB 1CJVA 1WG4A 4FP9A 3S01A 2O1PA 4W4MA 2YQ3A 4Y65A 2DNZA 1XEZA 2FZCB 2WOMB 3DOMA 1VIXA 4ER8A 2BJDA 1CS4B 2WP0C 2IBOA 1ZM9A 1SXLA 1WC3A 4DR4J 3F56A 4EO8A 1L2FA 1C1CA 2ZHOA 2XSFA 5J2MB 3A13A 1R27B 4C0BA 1FVQA 2AZ1A 3A8EA 5D4LA 1U1NA 2OPSA 4RW8B 4RBVA 2DH9A 1VQ9S 2E1MC 2NREA 2WAQD 1JXEA 3EX7B 1X4BA 1PBAA 3M32B 3IXQA 1HWJA 4IRKA 3CJ3A 2BJ3A 5SUHA 1UKUA 3EQ6A 3W5YA 2GIRA 4HVZA 1CJKB 2M3DA 3J7YU 5HVHA 1BMQB 3PYGA 1CVJA 3VAIA 1I94F 3WC2A 4DLGA 1LQ9A 2HVEA 4ZVRB 4ZCMA 2VA2A 2XI3A 4EBCA 4H4OB 5HMXA 2P2JA 1U49A 3IWXA 4ZLJA 5HBMB 3HJFA 4I9FA 4LF8J 4F4YA 2HMIB 4FNHA 2BKNA 3FK4A 4QU7A 2ACMA 3HZEA 4DSKA 4B17A 3J7Z5 2GJ2A 4QWEA 3U1NA 1IQTA 1F9EB 2AX1A 2YKMA 3D1HA 1OPZA 1GXTA 2B56A 4ZIVA 5KT3A 1UPPA 2RDJA 2UXCF 4B3RC 3UI3A 3GJQB 1ML8A 4RNOA 2VFRA 8AT1B 2QTWA 2JOQA 2VG7B 5GADI 3W62A 5ETMA 3LP1B 3LGNA 1IBKF 1WJ9A 2NLWA 2E5HA 2MQQA 2MMYA 4LF5C 1FO1A 2RKIA 4EGLA 5HLFB 2XO6A 4P74A 2UUBJ 2KRRA 1IWGA 3EVMA 5GAHI 2KTQA 1F6TA 1XNQJ 3CTRA 4ZVGA 1U1KA 2F7VA 2WVEA 3EWGA 3SV3A 5E0OA 5IFMA 3FC9A 1C4AA 3DGVA 2N4DA 2DHXA 5F8LA 2CJ9A 1PYSB 3SV4A 2JVRA 2RS2A 3RG6A 4NLQA 1NY8A 3RBXA 2EWHA 3R1HA 2W2NP 4JV5F 2HW3A 1LKZA 2EI5A 3GTYX 3NKYA 4CH7A 4IDKB 2GW8A 2OEMA 2E9RX 2R42A 2CYYA 1HMVB 4F0KA 3CCRS 2IA0A 1ZB8A 1S1VA 1SJQA 3CCUS 2BH1X 1PJ7A 2PGCA 1RWKB 2H4YB 2OKQA 2HVIA 3PKMA 2C2MB 3C5EA 1RI7A 3HULA 5HATA 4FF2A 2CQDA 4S0MA 4P71A 3KDOA 3RW7A 4FF1A 3IRXA 1P8GA 5H9UA 4LFBJ 3FRYA 2ZNZA 5ETVA 4ZJLA 3N4WA 4K4ZA 5BJRA 4R0EA 4IQMA 4NI2A 3CJRA 3FBFA 1LK5A 2ZUAA 1R0AA 5C24B 2MZJA 9ATCB 2ZITA 2DHMA 4BC9A 1RDRA 1KSPA 4CLTA 2KT2A 2PE8A 2ROGA 4KTTA 3NS6A 3MM8B 2H5JB 2OUGA 3AFGA 2V94A 2NPIA 4DV7J 4LF1A 1VRTB 4K4SA 2OEKA 1DURA 3EMTA 1H2TZ 1SH0A 2HFZA 2ZH8A 4F04B 1EB0A 3NY0A 2P2BA 3KNGA 4DF8A 2WTFA 4JI6F 2XGPA 2KXFA 3EVOA 2HWIA 5CQGA 3I5BA 3OV7A 3N54B 3BPDA 4U5YD 4OYAA 1FFGB 5KFMA 3VAMA 3T5KA 3IO1A 5A8RA 1TP7A 4JI4F 1X5OA 1DBDA 4O3RA 1ZTWA 3CT9A 1GH8A 1AMUA 3I87A 1JK9B 3K6RA 3W66A 5FIIA 1HYSA 4QIEA 5BXIA 3A8IA 4K4UA 1BHNA 4YDDB 2HURA 1AT1B 2RS8A 2OPPA 2RAQA 4BS2A 4OI1A 4OX8A 2DGOA 4JI5C 4I2PA 4Z2XA 4WPAA 4FN5A 5A0YB 3KKFA 1WC1A 2AGQA 1ZPWX 5ETRA 4NCAA 4PUOB 3MFHA 3LWMA 3BYRA 1M5OC 5D4OA 3F73A 2ZJQQ 5HVFA 5I42B 5JVHQ 4XX2A 2VOOA 4GC6A 2YNIB 1WEXA 3LP0A 4LR8A 1KRPA 1XMQJ 1CJUB 1IXKA 4H4KC 2VQFF 2HNZA 1KTVA 4Z7CA 2QLBB 1GX6A 1K8AT 2CJXB 1RG9A 4FYXB 1VK8A 2DR8A 1QVGR 1DTTA 1IKWB 1TL3A 1R3NA 1X31C 3WDOA 2Y27A 5IOLA 5A1GA 2VBZA 3OVBA 4LF7F 1TL1A 4ZOSA 5CZXA 3IFEA 4B3TC 4Q0BB 4PRFA 1KOOA 3CD0A 2HQCA 4TYAA 4CP5A 3RB0A 4NL5A 4HH0A 1ROFA 2L08A 2Z56B 3PDNA 1RWXB 2MSTA 2J9DA 4D3HA 3R44A 3LAMA 2YKQA 1MXCA 1QVFR 2HBRB 1JLBA 1D1UA 1XN9A 5H1SV 4DS5A 1HNIB 1DRZA 1LW2B 3NGSA 1TV6A 2C3YA 4OZNA 2E44A 4CO0A 1MMNA 4B3SC 4KKOA 1BQXA 4RWXA 3H8YA 1TKTA 4K50A 3T5JA 4LBIA 5M2RA 4YMEA 5HP1A 3DDKA 4QYRA 3PG9A 4C97A 1ULRA 3IAM9 3KLIA 4RW4B 1U1MA 2UU9C 3F41A 1RT3A 2DBBA 3IM8A 4DWIA 1N5VA 2DEIA 3DN9A 2DNRA 2XNQA 2QV6A 1O93A 3VQSA 2EBGA 4U96A 3H40A 2M52A 2OJ3A 2QL5B 3PROC 3HVTB 3M1VB 4OHVA 3HHLC 3PEHA 1U2FA 4X4UA 2Z2MA 3H5UA 2VODA 1ZH5A 2RRBA 2HFUA 2MKJA 1TUWA 2AF6A 2IM0A 1BQNB 4NLUA 5D6GA 1D8ZA 2QL9B 1GMWD 3MPDA 2DO4A 4IG3B 2I2YA 1SUQB 4IH5A 3DDNA 1VCTA 4YR2A 5D0EA 4B9VA 3EGWB 2LQ5A 1JXLA 3PYDA 2O67A 1LWXA 4OJ3A 3A3PB 4HEA9 1VQNS 2DITA 3MCOA 4ILRA 4EATA 2VQEC 5A8KB 1CS4A 3MR5A 4YUDA 3CQ3A 5CD4A 4OYMA 4UOHA 1Q95G 5J2MA 3C6UB 3OLBA 1XNRJ 1Y5IB 4N47A 4AXIA 4ZJQA 1T9WA 5KG1A 4UW2A 2BABA 3ZZYA 1TR0A 2QLXA 4QBUA 4R5PB 3E7XA 4X4VA 1X60A 3HLUA 3PHTA 5LJ3Y 3MCSA 5C2CA 1CJKA 2Y9HA 3CD5A 3NOCA 3OTEA 1XBWA 3ZFVA 2D1SA 3BQ2A 4ED0A 2ZOGA 4NMLA 4DCPB 5DZ6A 4H4OA 3BO4A 1LFPA 3UW1A 1TKDA 4PUIA 3DRPB 3O1LA 4IRCA 4TYBA 3W9IA 1UFLA 3UE2A 2QRRA 4OYXA 4GKJF 4IZ6A 1X9MA 3ISZA 1PAEX 2RQMA 2HMIA 4NXNC 2V8GA 2XHCA 1FESA 2MZSA 2RD5C 4OXIA 4OLPA 3TWZA 4ZVPB 3ZTOA 4RVNA 1YBAA 3U27A 5IZHA 5IFIA 2QYGA 3E2EA 2HRYA 4LE5A 2EXUA 4F4ZA 1P1TA 2R7TA 4RW9B 5GAGU 1S59A 4B3MC 2LQJA 4DFJA 3P96A 2QVZX 2VG7A 3RRGA 2ZDPA 3C6TB 5BYQA 2LQ8A 1HBUB 4ZMMA 4QQBA 2CQIA 1J5OB 4RZRA 4OMFG 1S7HA 3BPSP 3GV5B 1BY9A 1NKBA 5HROA 4RM3A 1ITPA 3Q23A 3QRPA 1YRUA 2A6MA 2RQCA 3WX8A 4FUQA 5F8NA 4A8OA 1IBMF 2DNPA 3JAMD 3QT7A 1MN9A 3VALA 3AQPA 2ZH2A 2HWHA 4GS5A 3VAGA 2W4PA 1QY7A 4WP9A 1RYSA 2JEJA 2DXEA 3M8QB 1NUEA 4IDKA 3PW2A 2C3MA 2EC0A 3N0VA 4ZJZA 4JYAC 4KHPJ 1KN6A 4G1PA 3M30B 1OSCA 1XMOF 2W2MP 2JDJA 2HHXA 4IRDA 4OX9J 2XY6A 1S72S 1SL2A 4YY3F 3UD3P 2DNKA 2R4FA 3TR5A 3KLHB 4C8KA 2LU2A 2QIFA 1NO8A
chains in the Genus database with same CATH topology
3E01B 2HFOA 3R27A 2RMLA 4DV7F 5KFZA 3UQSA 5KAKA 2OPPB 1JLGA 3THPA 2W9CB 4D3GA 2YVSA 3QIPA 4KO0A 1X9SA 3PKYA 4WKYA 3Q0AA 3SZ2A 1DARA 1GT8A 4BWJA 2ZKUA 2DRAA 1X4FA 3H4BA 2CVIA 2B5JB 1G1XA 2OO4A 4I2PB 3ZZTA 3O6QA 2VBWA 3ETCA 4IH7A 1PGZA 3PBKA 4EZ9A 3HHDA 1F60B 4RNMA 3LAXA 1C0TB 4D4IA 1UP1A 3CDUA 1XMOC 2CQ4A 3RB3A 1KOHA 3TANA 4DR5C 3I6PA 3CF5Q 3GYNA 2UVUA 4YB1P 2DGXA 1YI2S 4TY8A 2YWCA 1UVIA 2QA1A 3KHRA 3AAWB 1I6JA 1T5DX 3RZAA 4DHVA 4YY3C 3I5CA 2PSZA 2L9WA 2OFGX 1GPMA 2D74B 2HVZA 1XRAA 1EETA 3GMGA 3K8VA 1IKYA 1NJXA 3KK3A 2YTCA 6FD1A 3K2YA 3SXLA 3TI0A 1DQ8A 1Q78A 1Y4ZB 2BA9A 3BGRA 4G1QB 5F0UA 4QIVA 2CJQA 3BN4A 1FRIA 3VWSA 1C0UB 3PJXA 1N5YA 4DV7C 5HL7Q 3LP0B 5FD1A 4BHQA 2CPHA 2GHVC 2Q66A 1TK8A 3ONQA 4P6QA 2KT3A 4KC5A 3ENQA 2OTJS 3A4IA 3MF5A 2CQCA 2FIUA 2YWKA 2HNZB 3CJ5A 3ZZOA 4PQUA 5AXMA 5LSRA 2KH9A 3NNAA 3VNSA 2BANA 4TKTA 3OUYA 1LWCB 2ROPA 2IJFA 3QAUA 3SCIE 2DR7A 1XTZA 1S1XB 3IAS9 3EZUA 2X1BA 5D3GB 1UA0A 2W4DA 3DLEB 4H4MA 1AW0A 3QJLA 2IAJB 4ICLB 1DTTB 2M9KA 2CG4A 1TL3B 3H98A 3Q22A 1S6QA 2VG5A 2GC8A 3MTJA 4TPSB 1T3NA 1WF2A 4IFYB 4TXSA 2BDPA 1HI0P 1LXNA 2U2FA 1HHTP 2IFXA 1TL1B 4YEAA 2PN6A 4PWDB 2WONA 4I7FA 1G7CB 3MECB 4ES1A 2C22A 1KD1T 1HQEA 2HS3A 2BYCA 1DFDA 1XRBA 2V4RA 3MMJA 4RWWA 2C42A 3GIMA 4O44B 1RTHB 1RK8A 2FLNA 3FEZA 1MKYA 3K5PA 2AJQA 4KIAA 2YWHA 3G6YA 1W2BR 5CYQA 1IKXB 5E3QA 1M5HA 4Q43A 4NLTA 4I56A 5EGYA 2R8GA 1H2UX 2RF2B 4LQ3A 4OZLA 1WG5A 1X5SA 3WX4A 2I8EA 4Y28C 2V7BA 4LMZA 2FLPA 1CSJA 1FKOA 1Y9OA 4J5OA 5KFQA 1DAXA 5BR8F 1UA1A 2XBPA 3HZGA 5F9NA 1FERA 1T03A 3SQGA 2P6SA 2WB4A 3Q8RB 2GMJA 3L09A 1R31A 2GFFA 2GJIA 2V4JB 5DQHA 1SH2A 4GMKA 2KM8B 2ZD1B 1JKHB 1X8DA 3DM2A 1JLBB 1XMQF 2JEIA 2ZHBA 5DDQC 4WS9A 3IR7B 2KKHA 1TV6B 5C25B 4ZPAA 3FCHA 3HHLA 3KYLA 5AXLA 3CMAS 4DV4F 3N28A 4O0IA 2JH3A 2WSFC 2KFZA 5KFTA 1RT2B 1HARA 2U1AA 5K14B 2QMXA 2R8IA 4ECQA 5BSWA 2Q1LA 2DJWA 2RRNA 3CJ2A 3TP2A 2HHQA 2HGNA 1KTQA 3UNGC 4CO1A 1RT7A 4KKOB 5KYVA 3FSYA 3RU0A 3TA1A 2LVWA 2WK4A 3H2VE 4KTQA 3ZZUA 2R2UA 1RT4A 1AXQA 2OLWA 3AJ2A 4I6AA 2Z8QA 2EFQA 5LMNF 1DHMA 4HDHA 4X2BA 4IYQA 1HBOB 2IC3A 3ENWA 3UR0A 1HD0A 4DSLA 4IFVB 4M95A 2CPDA 2RQKA 1V3RA 5D4NA 2UXDF 1SIWB 1S1TB 3KG4A 7FD1A 1NEEA 3MR2A 3M2VA 4K4VA 2V0NA 4DR3F 3O8WA 3I82A 3V4MA 4FS2A 5BR8C 4IUFA 2KYXA 4YFUA 3FJ2A 1QSYA 5A0YA 1PA4A 1VQPS 2P9CA 3QMQA 4P7TA 2N7CA 4X4NA 3M05A 1ZZFA 5LJ5Y 1LW0A 1RT3B 3D0GE 3TVKA 1XMQC 2LCWA 4DQIA 2JL9A 3HVRA 4PUOA 2POKA 3P6YC 2PT7G 3PVXA 2MZQA 2GIQA 2W8LA 2V5HG 1NK9A 2RNEA 4YR3A 2R7VA 1HR0F 1U7LA 2IVMA 2CXCA 1LWFB 4YQWA 2ROEA 3OR1A 4DV4C 5KG6A 1Y00A 5I42A 4Q8FA 4FZVA 1N6QA 2LU1A 4Y2AA 1RKIA 1UAWA 1KLMA 3TAMB 5A8WA 5IXUA 2QO3A 2X1GA 4QWBA 2IBKA 4RUHA 4RLEA 3DLLQ 4OZ5A 1K1QA 2YNIA 7FDRA 4DR6F 3G7SA 1C1CB 1ZETA 1FJGF 3A9UA 4G37A 2D3OR 3AHPA 3C8YA 2IRYA 3L95X 1JLFB 4A46A 3R1LA 2Q6CA 3BF4A 1GQEA 3AB2B 4LF9F 4DL6A 1JWWA 1QAIA 4DV6C 5J1NA 1R8BA 3CDBA 2C3UA 3HDSA 4KTVA 2ZOMA 1H2VZ 4ILLA 3JSBA 3R5BA 3I0RA 4QWDA 3OR2B 2N82B 2B6AB 2XI2A 2UXDC 4LF4F 1VBXA 4MTNA 2KYZA 1PG4A 1R89A 4DR3C 4Y2IA 5B08A 1SJ4P 2FJDB 1FEEA 3LUSA 3Q8PB 2D7VA 2VASA 2YNFB 4FXVA 2IVFB 2HZCA 3HXMA 3TVZA 2ASDA 1X4CA 2OMOA 2CFXA 1RYRA 3N5FA 1HFEL 4MKAA 5G0RA 4DS4A 4PPZA 1DQAA 4EYIB 1ZAXA 2Q43A 1JB0C 4YB6A 1Y5LB 4PPDA 3DRRB 4K0BA 2ZM6F 5JXSA 5IQQA 1P27B 2E9TA 5H9EJ 1S1WA 4PROC 4FVCA 2QVYX 1NJZA 4TNOA 3KOAA 3V6HA 2W25A 4DSJA 4Q0BA 1NJWA 4AQYF 3EPGA 3PX4A 1NK5A 1HW9A 1TKXA 3A9VA 1N52B 2YH0A 3D0IE 1FJEB 4C8MA 1PC5A 2XO7A 3TA0A 4DR6C 1Q8IA 3CJ0A 1FJGC 1JLQB 2W24A 1LCIA 1FUGA 5F8GA 2E5IA 3LP2B 3MPYA 4WE1A 4J9LA 1JJ4A 2SXLA 4IG0B 5I4MA 1WI6A 5A2QY 5KFUA 1K9MT 3RB4A 2E8FA 2DH8A 4HT7A 4LF9C 3OXGA 3OTBA 4P7VA 3M9MB 4WJBA 3GV7B 4B9NA 4DSIA 2AYMA 4FYDA 2L3MA 2ADCA 3V81B 3GQCA 2P2QA 2FJXA 2L48A 4ZLPA 3PR4A 1N88A 3OL9A 2ZH3A 3ZC4A 1O51A 1NHVA 2YKPA 2L9DA 1NU4A 1RY2A 1PSDA 2L9NA 1UVJA 1KQFB 4ISBA 5FLXD 2Y1RI 3PEJA 4TU7A 3R9WA 1UEVA 4N5SA 4WFYA 5KG2A 3LGXA 2ZM6C 1DQ9A 2ZH9A 3I07A 2F4VF 1ULTA 1TK5A 3R3TA 5F3TA 4QIWD 4OI3A 5CCLA 2VFSA 4DX8H 3PZPA 1WTBA 1MU2A 3H2UB 5E2QA 5G4DA 3QZ8A 4V19J 5KFDA 1R8CA 1KHVA 1VQLS 1N36F 3C46A 3UCZP 4AQYC 4ZCKA 2DGVA 4RNHA 3MM5A 4B9SA 4YOEA 1TFWA 3Q2TC 2RVJA 3OQ2A 3GILA 3UPFA 3QLHA 3Q8QB 2VG6B 3LO3A 2DGWA 4LQ9A 1EP4A 4C11B 4OJHA 5EWGA 1UJ5A 4KGKA 5A6PA 3N2QA 3FSXA 4Y6IA 1CEZA 2DB1A 1Q86T 2MZTA 1KS2A 4NZ6A 1A6LA 1X4AA 2J76E 2YKMB 2NUHA 1BQMA 3D28A 4CCHA 4WF9Q 2FD2A 3I08A 3IS9B 2ASBA 5K9FA 1KONA 3T19A 2QLWA 4RW4A 2BQUA 4LUBA 4Y2CA 3T9ZA 5IT0A 2E7XA 4NLVA 1HWIA 1U6ZA 5D77A 3CDWA 4LSLB 3VCDA 5L1LA 1YG0A 3K0JA 4NOHA 4EO6A 2W9BB 2OTLS 1HBNA 4EUVA 3MFIA 2UUTA 2WOMA 3JAMY 1DLOB 5DETA 4C9DA 4O4RA 3QYYA 1VHFA 2MJUA 5GTDA 4EEYA 2F4VC 2HPUA 2VV5A 3TQIA 1U48A 3M9NB 4RUCA 2G0CA 2M8DB 3K7RA 4DCSA 2HLTA 3BR8A 2GQQA 2I5JA 2CPXA 2WW8A 2P2MA 3J81Y 4RUAA 3PW7A 3IPLA 1N36C 4X4QA 4F3MA 4ECWA 3OXLA 2RKIB 3M2UB 4N76A 5L9NA 3V4IA 2Q79A 2YNGB 3UZ0A 3M2RB 3CXCR 4ZPBA 4ZP9A 1KFDA 2YNHA 3CJ4A 4UQGA 1NK7A 4M94A 4W92B 2CDQA 5KFCA 2ILZA 2O66A 4TY9A 5K5MA 4Y00A 1FXDA 2UVRA 1K0RA 1HBMB 2HNYB 2B7CB 3CE8A 2IM2A 3M6XA 4I2QB 2DNHA 2LEAA 2OMLA 4DV0C 1BD6A 2P02A 3HPOA 1NH8A 3V5RA 1QE1A 2OPQB 1HI1A 2ZE2B 4N8OA 4MTPA 4RW8A 2XLIA 1Y3KA 1VLYA 2HGMA 2JLFA 4OIXA 3CCMS 4AYBD 1XNRF 3KHGA 3SMZA 2CQHA 5DJBA 2ILYA 2ZC4A 1BQNA 3QO9B 3E8OA 4CZCA 2IMWP 1O0PA 5KT4A 1FNXH 1S77D 2BE2A 2JVOA 4ECTA 1C2PA 3KLFB 3NBPB 5F0WA 3M32A 4OZJA 3B82A 2WRMA 2R9LA 2X1AA 1N5SA 1WHVA 3UCGA 4CT9A 4A8FA 4NXNF 4J9NA 5H9FJ 2DGQA 1M5PC 4KSEB 2LQ9A 2DCUB 2BQ3A 3MM7B 5DS7A 2COLA 4LF6F 5ITHA 2Y4NA 2IJNA 1FE4A 2RIJA 4UOCA 5BYSA 1S0MA 2A2CA 2GV1A 5GVQA 5IT9Y 4OQJA 5KEIA 4PG5A 1NB7A 2UV8G 4TU9A 3CCVS 3V6KA 4KFBA 3QWUA 4OX6A 3F44A 2MDAA 4DR2F 2NSBA 4JV0A 5IT4A 2KXHA 2BJOA 3TO8A 1FA0A 2J6UA 3WC0A 1JLEA 1M5SA 3HHEA 2E5GA 3PW4A 2GCFA 2WB1D 4KT0C 4KJIA 4DV3C 2CPJA 3S7RA 2EFPA 2J0SD 2MKIA 3HVWA 2GX8A 4ATNA 1FF2A 5K85A 4ZDNA 4J9PA 4NYZA 4O3QA 2EFGA 3SSSA 4EBEA 2B7BB 5CZVA 5C42A 3AH6A 3JB9k 1WF3A 1JNRB 3GB0A 4QIFA 5J2NB 2L41A 1XNRC 2KJWA 4B9LA 5HMWA 4A8MP 3CC7S 2EVZA 5IQ6A 3LQVA 2PIIA 5KOXA 1RT6A 3H59A 5EHHA 2Q3PA 4A4JA 4JI3F 3CCES 2V9WA 4RW7B 4O3PA 4ED6A 4I6WA