2E8EA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 (reduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Aq_1549
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8eA00
1N34C 2CY1A 4NXMC 4LFAC 4JI8C 2UUCC 1ZB9A 4LF9C 4DV5C 4JI4C 2ZM6C 4MH4A 4DV7C 4DR6C 1KKGA 3LUSA 1HNWC 4YHHC 5IWAC 4K0KC 1USPB 2ASBA 4DR4C 1HNXC 4DV1C 4DV6C 4JI6C 3AF5A 4LF4C 2OPLA 2DYJA 2JMPA 3JAMD 4OX9C 4JI3C 4JI5C 4JV5C 2XR1A 4X64C 3AF6A 1N33C 4JI2C 1UKKA 2CXCA 4X62C 3J81D 4DR2C 1I94C 2QL8A 4LFCC 1PA4A 2UU9C 4B3SC 2ATWA 4JI0C 2KZFA 4AQYC 2PN2A 2UUAC 2E8CA 2E8FA 3CJEA 3GKUA 2HJGA 2OPLB 2YCBA 2EGTA 3EERA 3OTOC 1WF3A 1LQLA 1HH2P 4NXNC 4X65C 4DV4C 2E8EA 1WH9A 3J80D 5A2QD 1L2FA 5IT9D 4DR7C 4LFBC 4DR3C 4YY3C 4B3RC 3R9WA 4GKKC 3IEUA 2VQFC 1JOSA 1IBMC 4MTNA 1XMQC 1ML8A 4NOZA 4LF8C 5LMUC 1FJGC 4DR1C 2UXDC 4DV3C 3IEVA 1ZB8A 1MKYA 2UXCC 1XMOC 2ONFA 4LF7C 4GKJC 2F4VC 2PT7G 2E7GA 4DUZC 4JI1C 4B3TC 4BSZA 5FLXD 4LF6C 4JYAC 2VQEC 2BJOA 1N2FA 4DR5C 1VLAA 2HHHC 3T1HC 4B3MC 4KHPC 4X66C 4DV2C 2UUBC 1QWIA 1XNRC 1USPA 4DCTA 1HNZC 1K0RA 1J5EC 1HR0C 1NYEA 5BR8C 1N32C 4DUYC 2E5LC 1EGAA 1IBLC 1N36C 4DCUA 4DCSA 1XNQC 2UXBC 4XX2A 1IBKC 4JI7C 4DV0C 3R9XA 4DCVA 4LF5C 3I07A 2D7VA 5LMNC 3T1YC
chains in the Genus database with same CATH superfamily
4NXMC 3PBKA 3A26A 1ZB9A 4MH4A 5IWAC 1MXAA 3GPCA 4DR4C 3NYRA 1MXCA 5GTDA 2MCQA 2JMPA 2YWCA 2P2FA 4JI5C 1IB8A 4L2ZA 1WCJA 1UKKA 2CXCA 2D1SA 1BA3A 1QM4A 4ISBA 4R1LA 1PA4A 2UU9C 4FUQA 4JI0C 2KZFA 3DAYA 3UOWA 3LAXA 4KTTA 2QVZX 3GKUA 4RLFA 2YCBA 2WP0C 2OBVA 2EGTA 2BH1X 1WF3A 3NPDA 5CZXA 2QVXX 1O93A 4X65C 2NCLA 2DHMA 1L2FA 5IT9D 4RVOA 3RV2A 4FTFA 3IEUA 1O90A 5K8FA 4MTNA 1O9TA 2P02A 5LCIA 1V60A 1XMQC 1ML8A 4NOZA 2UXDC 4D56A 4I9FA 4DV3C 2P2MA 1ZB8A 5JRHA 4RLQA 2F4VC 2PT7G 2E7GA 4DUZC 1MXBA 3LNOA 4DR5C 2HHHC 3CW9A 1PG3A 5BSTA 1XRAA 4DCTA 1HNZC 3CW8X 1K0RA 1HR0C 1NYEA 4OXIA 3IPLA 3VNSA 2CU6A 4DCUA 3UZ0A 1XNQC 1LCIA 4DV0C 4BBYA 4DCVA 4DG9A 3I07A 2D7VA 4KTVA 1N34C 1XHJA 3AY0A 3TQIA 5BSWA 5CZVA 4BC9A 4DV7C 4YHHC 2P2BA 1T5HX 2V7BA 5BURA 4G36A 5KYTA 1HNXC 4DV6C 4JI3C 3PROC 1XRCA 1GPMA 3E7XA 5A1IA 3L95X 1I94C 2QL8A 2M5OA 5A1GA 4ZLPA 1MDFA 3UX3A 4B3SC 2ATWA 5BUQA 2PN2A 4G1IA 2OO4A 3UEBA 2JNVA 3EQ6A 1XRBA 3EERA 4RM3A 1LQLA 1O92A 2QW0X 2MMAB 2E8EA 1WH9A 5A2QD 3FCEA 2D1RA 4RMNA 4GKKC 1M6XC 3CQ3A 1IBMC 4FUTA 4K0BA 4GXQA 5A19A 2D1QA 5KYVA 1P4EA 4LF8C 4DR1C 1FJGC 3N2QA 4BCAA 3TDEA 4D57A 1AMUA 2D27A 3G7SA 3ETOA 4GKJC 3KXWA 4LF6C 4BSZA 5FLXD 2VZEA 2VSQA 1VLAA 3A9UA 3T1HC 4B3MC 4D4GA 4DV2C 1PG4A 1XNRC 2KZ0A 1USPA 3NYQA 2Z51A 4R1MA 5KEIA 4DUYC 4JM1A 1EGAA 3CQ1A 4DCSA 1P7LA 3FCCA 4XX2A 1IBKC 3UX2A 4PUHA 3GR1A 3T1YC 2YWBA 2CY1A 3E7WA 3TR3A 4LFAC 2ZZMA 4WS9A 4JI8C 2UUCC 3IMLA 4DV5C 4JI4C 2ZM6C 2ZZNA 4D4IA 3LUSA 3B7WA 5T8TA 2AYAA 4K0KC 2ASBA 1V26A 4U5YD 4DV1C 5K85A 3AF5A 4LF4C 2OPLA 3JAMD 1VEHA 3A4IA 4JV5C 4X64C 3A25A 3AF6A 4OYCA 3J81D 3R44A 1ULTA 4LFCC 2Y4OA 2UUAC 1FUGA 4GXRA 1NY8A 3DLPX 5BUSA 4L4QA 1UWDA 1HH2P 1YJ7A 5T8SA 4DV4C 4DR7C 2Y27A 4YY3C 3R9WA 3GR0A 2KDNA 1MDBA 3IEVA 1MKYA 4WV3A 2UXCC 5DV9A 2ONFA 1XMOC 4JI1C 4NDNA 2VQEC 2BJOA 1N2FA 1MD9A 3ETCA 3VNRA 1QWIA 1T5DX 1RY2A 3SO4A 2QVYX 1J5EC 3TUFA 4I9GA 1IBLC 4R0MA 2UXBC 3I08A 5AE3A 4JI7C 3C5EA 3R9XA 3A9VA 1TH5A 4PUGA 4LF5C 4HPVA 3L8CA 5LMNC 5AE1A 2M5HA 4LF9C 2Y4NA 1KKGA 4DR6C 1HNWC 1USPB 4JI6C 2DYJA 4OX9C 4G37A 4ZJZA 4PHTA 3H2TA 3S82A 4L7IA 2XR1A 1N33C 4PROC 4JI2C 4X62C 3CQ2A 4DR2C 1P4EC 2P2JA 3LNVA 5E7QA 3NI2A 5ADZA 5AE2A 1PU1A 4AQYC 1M6XA 2E8CA 2E8FA 3CJEA 4GS5A 4LE5A 5BSRA 2HJGA 2MM9A 2OPLB 3VNQA 4TPSB 3OTOC 3RG2A 4NXNC 2P20A 3J80D 4LFBC 3PESA 4DR3C 4B3RC 5BSUA 4PZPA 2VQFC 1JOSA 2DPLA 5LMUC 3O2EA 4RM2A 3DHVA 2YX1A 4EATA 2P2QA 3N54B 3LGXA 4LF7C 4DG8A 5BSMA 2D28C 4RVNA 4B3TC 4JYAC 3K6RA 4ODJA 4KHPC 4X66C 2UUBC 4IZ6A 4IR7A 5IFIA 1RG9A 4PUIA 5BR8C 1N32C 2E5LC 1N36C 5BSVA 1FLOA 5H9UA 1V25A 2E0GA 2PROA 2WD9A 4BC7A 2D1TA 1XS3A
chains in the Genus database with same CATH topology
4NXMC 3PBKA 1ZB9A 4MH4A 5IWAC 1MXAA 3GPCA 4DR4C 3NYRA 1MXCA 5GTDA 2JMPA 2YWCA 2P2FA 4JI5C 4L2ZA 1UKKA 2CXCA 2D1SA 1BA3A 1QM4A 4ISBA 4R1LA 1PA4A 2UU9C 4FUQA 4JI0C 2KZFA 3DAYA 3UOWA 3LAXA 4KTTA 2QVZX 3GKUA 4RLFA 2YCBA 2WP0C 2OBVA 2EGTA 2BH1X 1WF3A 3NPDA 5CZXA 2QVXX 1O93A 4X65C 5IT9D 1L2FA 4RVOA 3RV2A 4FTFA 3IEUA 1O90A 4MTNA 1O9TA 2P02A 5K8FA 1XMQC 1ML8A 4NOZA 2UXDC 4D56A 4I9FA 4DV3C 2P2MA 1ZB8A 5JRHA 4RLQA 2F4VC 2PT7G 2E7GA 4DUZC 1MXBA 4DR5C 2HHHC 3CW9A 1PG3A 5BSTA 1XRAA 4DCTA 1HNZC 3CW8X 1K0RA 1HR0C 1NYEA 4OXIA 3IPLA 3VNSA 4DCUA 3UZ0A 1XNQC 1LCIA 4DV0C 4BBYA 4DCVA 4DG9A 3I07A 2D7VA 4KTVA 1N34C 3TQIA 5BSWA 5CZVA 4BC9A 4DV7C 4YHHC 2P2BA 1T5HX 2V7BA 5BURA 4G36A 5KYTA 1HNXC 4DV6C 4JI3C 3PROC 1XRCA 1GPMA 3E7XA 5A1IA 3L95X 1I94C 2QL8A 5A1GA 4ZLPA 1MDFA 4B3SC 2ATWA 5BUQA 2PN2A 4G1IA 2OO4A 3EQ6A 1XRBA 3EERA 4RM3A 1LQLA 1O92A 2QW0X 2E8EA 1WH9A 5A2QD 3FCEA 2D1RA 4RMNA 4GKKC 1IBMC 4FUTA 4K0BA 4GXQA 5A19A 2D1QA 5KYVA 4LF8C 1FJGC 4DR1C 3N2QA 4BCAA 3TDEA 4D57A 1AMUA 2D27A 3G7SA 3ETOA 4GKJC 3KXWA 4LF6C 4BSZA 5FLXD 2VZEA 2VSQA 1VLAA 3A9UA 3T1HC 4B3MC 4D4GA 4DV2C 1PG4A 1XNRC 1USPA 3NYQA 4R1MA 5KEIA 4DUYC 4JM1A 1EGAA 4DCSA 1P7LA 3FCCA 4XX2A 1IBKC 3GR1A 3T1YC 2YWBA 2CY1A 3E7WA 4LFAC 4WS9A 4JI8C 2UUCC 3IMLA 4DV5C 4JI4C 2ZM6C 4D4IA 3LUSA 3B7WA 5T8TA 2AYAA 4K0KC 2ASBA 1V26A 4U5YD 4DV1C 5K85A 3AF5A 4LF4C 2OPLA 3JAMD 3A4IA 4JV5C 4X64C 3AF6A 4OYCA 3J81D 3R44A 1ULTA 4LFCC 2Y4OA 2UUAC 1FUGA 4GXRA 3DLPX 5BUSA 4L4QA 1YJ7A 1HH2P 5T8SA 4DV4C 4DR7C 2Y27A 4YY3C 3R9WA 3GR0A 1MDBA 3IEVA 1MKYA 4WV3A 2UXCC 5DV9A 2ONFA 1XMOC 4JI1C 4NDNA 2VQEC 2BJOA 1N2FA 1MD9A 3ETCA 3VNRA 1QWIA 1T5DX 1RY2A 3SO4A 2QVYX 1J5EC 3TUFA 4I9GA 1IBLC 4R0MA 2UXBC 3I08A 5AE3A 4JI7C 3C5EA 3R9XA 3A9VA 4LF5C 4HPVA 3L8CA 5LMNC 5AE1A 4LF9C 2Y4NA 1KKGA 4DR6C 1HNWC 1USPB 4JI6C 2DYJA 4OX9C 4G37A 4ZJZA 4PHTA 3H2TA 3S82A 4L7IA 2XR1A 1N33C 4PROC 4JI2C 4X62C 4DR2C 2P2JA 3LNVA 5E7QA 3NI2A 5ADZA 5AE2A 4AQYC 2E8CA 2E8FA 3CJEA 4GS5A 4LE5A 5BSRA 2HJGA 2OPLB 3VNQA 4TPSB 3OTOC 3RG2A 4NXNC 2P20A 3J80D 4LFBC 3PESA 4DR3C 4B3RC 5BSUA 4PZPA 2VQFC 1JOSA 2DPLA 5LMUC 4RM2A 3DHVA 4EATA 2P2QA 3N54B 3LGXA 4LF7C 4DG8A 5BSMA 2D28C 4RVNA 4B3TC 4JYAC 4ODJA 4KHPC 4X66C 2UUBC 4IZ6A 4IR7A 5IFIA 1RG9A 5BR8C 1N32C 2E5LC 1N36C 5BSVA 5H9UA 1V25A 2E0GA 2PROA 2WD9A 4BC7A 2D1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 C;  2CY1 A;  4NXM C;  4LFA C;  4JI8 C;  2UUC C;  1ZB9 A;  4LF9 C;  4DV5 C;  4JI4 C;  2ZM6 C;  4MH4 A;  4DV7 C;  4DR6 C;  1KKG A;  3LUS A;  1HNW C;  4YHH C;  5IWA C;  4K0K C;  1USP B;  2ASB A;  4DR4 C;  1HNX C;  4DV1 C;  4DV6 C;  4JI6 C;  3AF5 A;  4LF4 C;  2OPL A;  2DYJ A;  2JMP A;  3JAM D;  4OX9 C;  4JI3 C;  4JI5 C;  4JV5 C;  2XR1 A;  4X64 C;  3AF6 A;  1N33 C;  4JI2 C;  1UKK A;  2CXC A;  4X62 C;  3J81 D;  4DR2 C;  1I94 C;  2QL8 A;  4LFC C;  1PA4 A;  2UU9 C;  4B3S C;  2ATW A;  4JI0 C;  2KZF A;  4AQY C;  2PN2 A;  2UUA C;  2E8C A;  2E8F A;  3CJE A;  3GKU A;  2HJG A;  2OPL B;  2YCB A;  2EGT A;  3EER A;  3OTO C;  1WF3 A;  1LQL A;  1HH2 P;  4NXN C;  4X65 C;  4DV4 C;  2E8E A;  1WH9 A;  3J80 D;  5A2Q D;  1L2F A;  5IT9 D;  4DR7 C;  4LFB C;  4DR3 C;  4YY3 C;  4B3R C;  3R9W A;  4GKK C;  3IEU A;  2VQF C;  1JOS A;  1IBM C;  4MTN A;  1XMQ C;  1ML8 A;  4NOZ A;  4LF8 C;  5LMU C;  1FJG C;  4DR1 C;  2UXD C;  4DV3 C;  3IEV A;  1ZB8 A;  1MKY A;  2UXC C;  1XMO C;  2ONF A;  4LF7 C;  4GKJ C;  2F4V C;  2PT7 G;  2E7G A;  4DUZ C;  4JI1 C;  4B3T C;  4BSZ A;  5FLX D;  4LF6 C;  4JYA C;  2VQE C;  2BJO A;  1N2F A;  4DR5 C;  1VLA A;  2HHH C;  3T1H C;  4B3M C;  4KHP C;  4X66 C;  4DV2 C;  2UUB C;  1QWI A;  1XNR C;  1USP A;  4DCT A;  1HNZ C;  1K0R A;  1J5E C;  1HR0 C;  1NYE A;  5BR8 C;  1N32 C;  4DUY C;  2E5L C;  1EGA A;  1IBL C;  1N36 C;  4DCU A;  4DCS A;  1XNQ C;  2UXB C;  4XX2 A;  1IBK C;  4JI7 C;  4DV0 C;  3R9X A;  4DCV A;  4LF5 C;  3I07 A;  2D7V A;  5LMN C;  3T1Y C; 
#chains in the Genus database with same CATH topology
 4NXM C;  3PBK A;  3A26 A;  1ZB9 A;  4MH4 A;  5IWA C;  1MXA A;  3GPC A;  4DR4 C;  3NYR A;  1MXC A;  5GTD A;  2MCQ A;  2JMP A;  2YWC A;  2P2F A;  4JI5 C;  1IB8 A;  4L2Z A;  1WCJ A;  1UKK A;  2CXC A;  2D1S A;  1BA3 A;  1QM4 A;  4ISB A;  4R1L A;  1PA4 A;  2UU9 C;  4FUQ A;  4JI0 C;  2KZF A;  3DAY A;  3UOW A;  3LAX A;  4KTT A;  2QVZ X;  3GKU A;  4RLF A;  2YCB A;  2WP0 C;  2OBV A;  2EGT A;  2BH1 X;  1WF3 A;  3NPD A;  5CZX A;  2QVX X;  1O93 A;  4X65 C;  2NCL A;  2DHM A;  1L2F A;  5IT9 D;  4RVO A;  3RV2 A;  4FTF A;  3IEU A;  1O90 A;  5K8F A;  4MTN A;  1O9T A;  2P02 A;  5LCI A;  1V60 A;  1XMQ C;  1ML8 A;  4NOZ A;  2UXD C;  4D56 A;  4I9F A;  4DV3 C;  2P2M A;  1ZB8 A;  5JRH A;  4RLQ A;  2F4V C;  2PT7 G;  2E7G A;  4DUZ C;  1MXB A;  3LNO A;  4DR5 C;  2HHH C;  3CW9 A;  1PG3 A;  5BST A;  1XRA A;  4DCT A;  1HNZ C;  3CW8 X;  1K0R A;  1HR0 C;  1NYE A;  4OXI A;  3IPL A;  3VNS A;  2CU6 A;  4DCU A;  3UZ0 A;  1XNQ C;  1LCI A;  4DV0 C;  4BBY A;  4DCV A;  4DG9 A;  3I07 A;  2D7V A;  4KTV A;  1N34 C;  1XHJ A;  3AY0 A;  3TQI A;  5BSW A;  5CZV A;  4BC9 A;  4DV7 C;  4YHH C;  2P2B A;  1T5H X;  2V7B A;  5BUR A;  4G36 A;  5KYT A;  1HNX C;  4DV6 C;  4JI3 C;  3PRO C;  1XRC A;  1GPM A;  3E7X A;  5A1I A;  3L95 X;  1I94 C;  2QL8 A;  2M5O A;  5A1G A;  4ZLP A;  1MDF A;  3UX3 A;  4B3S C;  2ATW A;  5BUQ A;  2PN2 A;  4G1I A;  2OO4 A;  3UEB A;  2JNV A;  3EQ6 A;  1XRB A;  3EER A;  4RM3 A;  1LQL A;  1O92 A;  2QW0 X;  2MMA B;  2E8E A;  1WH9 A;  5A2Q D;  3FCE A;  2D1R A;  4RMN A;  4GKK C;  1M6X C;  3CQ3 A;  1IBM C;  4FUT A;  4K0B A;  4GXQ A;  5A19 A;  2D1Q A;  5KYV A;  1P4E A;  4LF8 C;  4DR1 C;  1FJG C;  3N2Q A;  4BCA A;  3TDE A;  4D57 A;  1AMU A;  2D27 A;  3G7S A;  3ETO A;  4GKJ C;  3KXW A;  4LF6 C;  4BSZ A;  5FLX D;  2VZE A;  2VSQ A;  1VLA A;  3A9U A;  3T1H C;  4B3M C;  4D4G A;  4DV2 C;  1PG4 A;  1XNR C;  2KZ0 A;  1USP A;  3NYQ A;  2Z51 A;  4R1M A;  5KEI A;  4DUY C;  4JM1 A;  1EGA A;  3CQ1 A;  4DCS A;  1P7L A;  3FCC A;  4XX2 A;  1IBK C;  3UX2 A;  4PUH A;  3GR1 A;  3T1Y C;  2YWB A;  2CY1 A;  3E7W A;  3TR3 A;  4LFA C;  2ZZM A;  4WS9 A;  4JI8 C;  2UUC C;  3IML A;  4DV5 C;  4JI4 C;  2ZM6 C;  2ZZN A;  4D4I A;  3LUS A;  3B7W A;  5T8T A;  2AYA A;  4K0K C;  2ASB A;  1V26 A;  4U5Y D;  4DV1 C;  5K85 A;  3AF5 A;  4LF4 C;  2OPL A;  3JAM D;  1VEH A;  3A4I A;  4JV5 C;  4X64 C;  3A25 A;  3AF6 A;  4OYC A;  3J81 D;  3R44 A;  1ULT A;  4LFC C;  2Y4O A;  2UUA C;  1FUG A;  4GXR A;  1NY8 A;  3DLP X;  5BUS A;  4L4Q A;  1UWD A;  1HH2 P;  1YJ7 A;  5T8S A;  4DV4 C;  4DR7 C;  2Y27 A;  4YY3 C;  3R9W A;  3GR0 A;  2KDN A;  1MDB A;  3IEV A;  1MKY A;  4WV3 A;  2UXC C;  5DV9 A;  2ONF A;  1XMO C;  4JI1 C;  4NDN A;  2VQE C;  2BJO A;  1N2F A;  1MD9 A;  3ETC A;  3VNR A;  1QWI A;  1T5D X;  1RY2 A;  3SO4 A;  2QVY X;  1J5E C;  3TUF A;  4I9G A;  1IBL C;  4R0M A;  2UXB C;  3I08 A;  5AE3 A;  4JI7 C;  3C5E A;  3R9X A;  3A9V A;  1TH5 A;  4PUG A;  4LF5 C;  4HPV A;  3L8C A;  5LMN C;  5AE1 A;  2M5H A;  4LF9 C;  2Y4N A;  1KKG A;  4DR6 C;  1HNW C;  1USP B;  4JI6 C;  2DYJ A;  4OX9 C;  4G37 A;  4ZJZ A;  4PHT A;  3H2T A;  3S82 A;  4L7I A;  2XR1 A;  1N33 C;  4PRO C;  4JI2 C;  4X62 C;  3CQ2 A;  4DR2 C;  1P4E C;  2P2J A;  3LNV A;  5E7Q A;  3NI2 A;  5ADZ A;  5AE2 A;  1PU1 A;  4AQY C;  1M6X A;  2E8C A;  2E8F A;  3CJE A;  4GS5 A;  4LE5 A;  5BSR A;  2HJG A;  2MM9 A;  2OPL B;  3VNQ A;  4TPS B;  3OTO C;  3RG2 A;  4NXN C;  2P20 A;  3J80 D;  4LFB C;  3PES A;  4DR3 C;  4B3R C;  5BSU A;  4PZP A;  2VQF C;  1JOS A;  2DPL A;  5LMU C;  3O2E A;  4RM2 A;  3DHV A;  2YX1 A;  4EAT A;  2P2Q A;  3N54 B;  3LGX A;  4LF7 C;  4DG8 A;  5BSM A;  2D28 C;  4RVN A;  4B3T C;  4JYA C;  3K6R A;  4ODJ A;  4KHP C;  4X66 C;  2UUB C;  4IZ6 A;  4IR7 A;  5IFI A;  1RG9 A;  4PUI A;  5BR8 C;  1N32 C;  2E5L C;  1N36 C;  5BSV A;  1FLO A;  5H9U A;  1V25 A;  2E0G A;  2PRO A;  2WD9 A;  4BC7 A;  2D1T A;  1XS3 A; 
#chains in the Genus database with same CATH homology
 4NXM C;  3PBK A;  1ZB9 A;  4MH4 A;  5IWA C;  1MXA A;  3GPC A;  4DR4 C;  3NYR A;  1MXC A;  5GTD A;  2JMP A;  2YWC A;  2P2F A;  4JI5 C;  4L2Z A;  1UKK A;  2CXC A;  2D1S A;  1BA3 A;  1QM4 A;  4ISB A;  4R1L A;  1PA4 A;  2UU9 C;  4FUQ A;  4JI0 C;  2KZF A;  3DAY A;  3UOW A;  3LAX A;  4KTT A;  2QVZ X;  3GKU A;  4RLF A;  2YCB A;  2WP0 C;  2OBV A;  2EGT A;  2BH1 X;  1WF3 A;  3NPD A;  5CZX A;  2QVX X;  1O93 A;  4X65 C;  5IT9 D;  1L2F A;  4RVO A;  3RV2 A;  4FTF A;  3IEU A;  1O90 A;  4MTN A;  1O9T A;  2P02 A;  5K8F A;  1XMQ C;  1ML8 A;  4NOZ A;  2UXD C;  4D56 A;  4I9F A;  4DV3 C;  2P2M A;  1ZB8 A;  5JRH A;  4RLQ A;  2F4V C;  2PT7 G;  2E7G A;  4DUZ C;  1MXB A;  4DR5 C;  2HHH C;  3CW9 A;  1PG3 A;  5BST A;  1XRA A;  4DCT A;  1HNZ C;  3CW8 X;  1K0R A;  1HR0 C;  1NYE A;  4OXI A;  3IPL A;  3VNS A;  4DCU A;  3UZ0 A;  1XNQ C;  1LCI A;  4DV0 C;  4BBY A;  4DCV A;  4DG9 A;  3I07 A;  2D7V A;  4KTV A;  1N34 C;  3TQI A;  5BSW A;  5CZV A;  4BC9 A;  4DV7 C;  4YHH C;  2P2B A;  1T5H X;  2V7B A;  5BUR A;  4G36 A;  5KYT A;  1HNX C;  4DV6 C;  4JI3 C;  3PRO C;  1XRC A;  1GPM A;  3E7X A;  5A1I A;  3L95 X;  1I94 C;  2QL8 A;  5A1G A;  4ZLP A;  1MDF A;  4B3S C;  2ATW A;  5BUQ A;  2PN2 A;  4G1I A;  2OO4 A;  3EQ6 A;  1XRB A;  3EER A;  4RM3 A;  1LQL A;  1O92 A;  2QW0 X;  2E8E A;  1WH9 A;  5A2Q D;  3FCE A;  2D1R A;  4RMN A;  4GKK C;  1IBM C;  4FUT A;  4K0B A;  4GXQ A;  5A19 A;  2D1Q A;  5KYV A;  4LF8 C;  1FJG C;  4DR1 C;  3N2Q A;  4BCA A;  3TDE A;  4D57 A;  1AMU A;  2D27 A;  3G7S A;  3ETO A;  4GKJ C;  3KXW A;  4LF6 C;  4BSZ A;  5FLX D;  2VZE A;  2VSQ A;  1VLA A;  3A9U A;  3T1H C;  4B3M C;  4D4G A;  4DV2 C;  1PG4 A;  1XNR C;  1USP A;  3NYQ A;  4R1M A;  5KEI A;  4DUY C;  4JM1 A;  1EGA A;  4DCS A;  1P7L A;  3FCC A;  4XX2 A;  1IBK C;  3GR1 A;  3T1Y C;  2YWB A;  2CY1 A;  3E7W A;  4LFA C;  4WS9 A;  4JI8 C;  2UUC C;  3IML A;  4DV5 C;  4JI4 C;  2ZM6 C;  4D4I A;  3LUS A;  3B7W A;  5T8T A;  2AYA A;  4K0K C;  2ASB A;  1V26 A;  4U5Y D;  4DV1 C;  5K85 A;  3AF5 A;  4LF4 C;  2OPL A;  3JAM D;  3A4I A;  4JV5 C;  4X64 C;  3AF6 A;  4OYC A;  3J81 D;  3R44 A;  1ULT A;  4LFC C;  2Y4O A;  2UUA C;  1FUG A;  4GXR A;  3DLP X;  5BUS A;  4L4Q A;  1YJ7 A;  1HH2 P;  5T8S A;  4DV4 C;  4DR7 C;  2Y27 A;  4YY3 C;  3R9W A;  3GR0 A;  1MDB A;  3IEV A;  1MKY A;  4WV3 A;  2UXC C;  5DV9 A;  2ONF A;  1XMO C;  4JI1 C;  4NDN A;  2VQE C;  2BJO A;  1N2F A;  1MD9 A;  3ETC A;  3VNR A;  1QWI A;  1T5D X;  1RY2 A;  3SO4 A;  2QVY X;  1J5E C;  3TUF A;  4I9G A;  1IBL C;  4R0M A;  2UXB C;  3I08 A;  5AE3 A;  4JI7 C;  3C5E A;  3R9X A;  3A9V A;  4LF5 C;  4HPV A;  3L8C A;  5LMN C;  5AE1 A;  4LF9 C;  2Y4N A;  1KKG A;  4DR6 C;  1HNW C;  1USP B;  4JI6 C;  2DYJ A;  4OX9 C;  4G37 A;  4ZJZ A;  4PHT A;  3H2T A;  3S82 A;  4L7I A;  2XR1 A;  1N33 C;  4PRO C;  4JI2 C;  4X62 C;  4DR2 C;  2P2J A;  3LNV A;  5E7Q A;  3NI2 A;  5ADZ A;  5AE2 A;  4AQY C;  2E8C A;  2E8F A;  3CJE A;  4GS5 A;  4LE5 A;  5BSR A;  2HJG A;  2OPL B;  3VNQ A;  4TPS B;  3OTO C;  3RG2 A;  4NXN C;  2P20 A;  3J80 D;  4LFB C;  3PES A;  4DR3 C;  4B3R C;  5BSU A;  4PZP A;  2VQF C;  1JOS A;  2DPL A;  5LMU C;  4RM2 A;  3DHV A;  4EAT A;  2P2Q A;  3N54 B;  3LGX A;  4LF7 C;  4DG8 A;  5BSM A;  2D28 C;  4RVN A;  4B3T C;  4JYA C;  4ODJ A;  4KHP C;  4X66 C;  2UUB C;  4IZ6 A;  4IR7 A;  5IFI A;  1RG9 A;  5BR8 C;  1N32 C;  2E5L C;  1N36 C;  5BSV A;  5H9U A;  1V25 A;  2E0G A;  2PRO A;  2WD9 A;  4BC7 A;  2D1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...