2E8EA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 (reduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Aq_1549
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8eA00
1L2FA 5FLXD 2VQEC 4LFAC 1N32C 4LFCC 2HJGA 1MKYA 4DCTA 5IWAC 4DR2C 4DV1C 2ATWA 1N2FA 1NYEA 3I07A 4KHPC 4LF9C 2DYJA 2E8CA 2E5LC 4MTNA 2PT7G 2VQFC 4X65C 4AQYC 4DV4C 1J5EC 1UKKA 4YHHC 1IBKC 2E7GA 4DV5C 4B3SC 2ONFA 4JI8C 4DV6C 2OPLB 4MH4A 2KZFA 2YCBA 5IT9D 1WF3A 4DR4C 2F4VC 1FJGC 2UXBC 2ASBA 2JMPA 2CXCA 2UXDC 1HNXC 4X66C 4YY3C 3T1HC 4GKJC 1JOSA 4JI2C 4DCUA 3CJEA 1VLAA 4GKKC 4JI5C 2QL8A 4DV0C 3GKUA 2PN2A 4JI6C 2BJOA 5LMNC 4B3TC 2ZM6C 2HHHC 3IEUA 4LF7C 4NOZA 4DUYC 4DR5C 4DR1C 3LUSA 4DCSA 4JI1C 3AF6A 4X64C 4DUZC 1XMQC 4JYAC 1XMOC 4DV2C 2UXCC 1XNQC 2UUAC 4XX2A 4X62C 2D7VA 5A2QD 3J81D 1USPB 5LMUC 2UU9C 4DR6C 3AF5A 1HNZC 3EERA 3OTOC 1I94C 4LF4C 4JI0C 4LF8C 4BSZA 2E8EA 1ML8A 4OX9C 1HR0C 4B3RC 2UUBC 1LQLA 2CY1A 1KKGA 1WH9A 3IEVA 1K0RA 4DR3C 1IBMC 3T1YC 4DV7C 1ZB9A 4DCVA 4DV3C 2UUCC 4NXNC 3JAMD 1HNWC 4JI3C 1PA4A 1HH2P 4NXMC 4LF6C 4K0KC 2XR1A 1XNRC 1N34C 4LFBC 3J80D 1N36C 2EGTA 4LF5C 1USPA 1QWIA 4DR7C 1EGAA 4JV5C 2OPLA 1N33C 1ZB8A 1IBLC 3R9XA 3R9WA 4B3MC 4JI7C 2E8FA 5BR8C 4JI4C
chains in the Genus database with same CATH superfamily
1L2FA 4R0MA 4L2ZA 4FTFA 1IB8A 5K8FA 2V7BA 1WCJA 3CW9A 4MTNA 4X65C 4AQYC 5E7QA 4RVOA 1UKKA 5H9UA 5KYTA 2ONFA 4MH4A 4JM1A 3O2EA 4D4GA 2F4VC 2D1SA 2CXCA 3R44A 4IR7A 2QVXX 3VNSA 4GKJC 4IZ6A 4DCUA 2Y4NA 4OYCA 4DV0C 5T8SA 3E7XA 3IEUA 1GPMA 4DUYC 1V26A 3LUSA 4DCSA 4JI1C 4X64C 4KTVA 1XMOC 4G37A 4DV2C 5AE2A 2UUAC 3NYQA 4RM2A 3TR3A 4X62C 3PESA 3GR0A 5A2QD 3J81D 4D4IA 2UU9C 3LAXA 1HNZC 3EERA 2YWBA 1HR0C 4R1LA 4GXRA 2CY1A 1WH9A 5KEIA 1K0RA 1ZB9A 3TQIA 1UWDA 4GS5A 4NXMC 4LF6C 4K0KC 2XR1A 5KYVA 1N34C 2D1RA 4LFBC 1N36C 2Y27A 4ODJA 1P4EA 3R9WA 3ETOA 4JI7C 1LCIA 5FLXD 4LFAC 1N32C 2P2QA 5ADZA 4DCTA 5CZVA 2VSQA 1N2FA 4FUTA 1NYEA 3UEBA 4I9FA 2PT7G 2VQFC 4RVNA 2E0GA 2YWCA 1J5EC 5BSWA 1O90A 4HPVA 1IBKC 2E7GA 2ZZNA 2YCBA 5IT9D 1FJGC 4D57A 3DLPX 1XRAA 3A26A 3CQ3A 4YY3C 1AMUA 2QW0X 4JI2C 4G36A 4GKKC 5JRHA 4JI5C 3GKUA 3FCEA 2KDNA 4JI6C 3CW8X 3UX2A 2P2JA 4B3TC 5BSRA 4LF7C 1TH5A 4DR5C 4I9GA 5T8TA 1BA3A 3E7WA 3TDEA 3I08A 4LE5A 4NDNA 4OXIA 1MDFA 4PUGA 3UX3A 5AE1A 4TPSB 3EQ6A 3AF5A 4ISBA 4JI0C 2D27A 2E8EA 3RV2A 3NPDA 1PU1A 2UUBC 1KKGA 4FUQA 4RLFA 2P2MA 1P7LA 4DV7C 4NXNC 2YX1A 3PBKA 1XNRC 3J80D 4WS9A 2MCQA 4L7IA 2WD9A 4JV5C 2OPLA 1ULTA 1O93A 3CQ1A 3DAYA 1T5HX 5BR8C 5GTDA 2CU6A 4JI4C 3RG2A 3TUFA 4U5YD 3LNOA 1V25A 1T5DX 4DR2C 4DV1C 4WV3A 2ATWA 1NY8A 2OO4A 5BSTA 4DG9A 1XS3A 5BSVA 4DV4C 4YHHC 5LCIA 5A1IA 4DV5C 2OPLB 4DR4C 2UXBC 2ASBA 1VEHA 2Z51A 3H2TA 4RLQA 2UXDC 1HNXC 1QM4A 1RY2A 3KXWA 5A19A 1JOSA 3N2QA 3CJEA 2Y4OA 4KTTA 1VLAA 4PHTA 2M5OA 5AE3A 2P2FA 1M6XA 2MM9A 2BJOA 2ZM6C 4PZPA 1FLOA 4BC9A 4NOZA 3GR1A 2PROA 3AF6A 3C5EA 4G1IA 2UXCC 1XNQC 3VNRA 3LGXA 1XHJA 4XX2A 5BSMA 3AY0A 5K85A 2OBVA 2D7VA 4RMNA 4DR6C 5BUSA 2M5HA 3OTOC 4K0BA 4LF8C 4BSZA 2DHMA 3UOWA 3UZ0A 4B3RC 1LQLA 3IEVA 4DR3C 3T1YC 5CZXA 1XRBA 4DCVA 2UUCC 4JI3C 1PA4A 4R1MA 1MD9A 4LF5C 5DV9A 1EGAA 4DR7C 2AYAA 4D56A 5BURA 5BSUA 2E8FA 3A4IA 2P02A 2VQEC 3L95X 4L4QA 4LFCC 3K6RA 2HJGA 3PROC 1MKYA 5IWAC 1O9TA 4BCAA 3I07A 4KHPC 4LF9C 2DYJA 2E8CA 2E5LC 3IPLA 3A9UA 2P2BA 1MXBA 4DG8A 2ZZMA 3G7SA 3S82A 3A9VA 4B3SC 4JI8C 2VZEA 1MDBA 4DV6C 2BH1X 2D28C 1PG3A 2KZFA 1WF3A 1XRCA 2QVZX 2JMPA 2WP0C 4ZJZA 1RG9A 4BBYA 5A1GA 4X66C 1P4EC 3ETCA 3T1HC 3B7WA 2QL8A 2MMAB 2PN2A 5LMNC 2D1TA 2HHHC 2DPLA 3A25A 3VNQA 4PUHA 4ZLPA 1V60A 4DR1C 2P20A 3GPCA 4RM3A 4DUZC 2JNVA 4GXQA 1XMQC 3L8CA 1M6XC 3NYRA 4JYAC 1O92A 2NCLA 3N54B 3FCCA 4EATA 3LNVA 4PUIA 1FUGA 5LMUC 1USPB 5BUQA 1PG4A 1MXCA 1I94C 4LF4C 1ML8A 4OX9C 1IBMC 4DV3C 3JAMD 1HNWC 1HH2P 3SO4A 1MXAA 2KZ0A 4PROC 3NI2A 2EGTA 2D1QA 1USPA 1QWIA 1YJ7A 3CQ2A 3DHVA 1N33C 4BC7A 1ZB8A 1IBLC 3R9XA 5IFIA 4B3MC 2QVYX 3IMLA
chains in the Genus database with same CATH topology
1L2FA 4R0MA 4L2ZA 4FTFA 5K8FA 2V7BA 3CW9A 4MTNA 4X65C 4AQYC 5E7QA 4RVOA 1UKKA 5H9UA 5KYTA 2ONFA 4MH4A 4JM1A 4D4GA 2F4VC 2D1SA 2CXCA 3R44A 4IR7A 2QVXX 3VNSA 4GKJC 4IZ6A 4DCUA 2Y4NA 4OYCA 4DV0C 5T8SA 3E7XA 3IEUA 1GPMA 4DUYC 1V26A 3LUSA 4DCSA 4JI1C 4X64C 4KTVA 1XMOC 4G37A 4DV2C 5AE2A 2UUAC 3NYQA 4RM2A 4X62C 3PESA 3GR0A 5A2QD 3J81D 4D4IA 2UU9C 3LAXA 1HNZC 3EERA 2YWBA 1HR0C 4R1LA 4GXRA 2CY1A 1WH9A 5KEIA 1K0RA 1ZB9A 3TQIA 4GS5A 4NXMC 4LF6C 4K0KC 2XR1A 5KYVA 1N34C 2D1RA 4LFBC 1N36C 2Y27A 4ODJA 3R9WA 3ETOA 4JI7C 1LCIA 5FLXD 4LFAC 1N32C 2P2QA 5ADZA 4DCTA 5CZVA 2VSQA 1N2FA 4FUTA 1NYEA 4I9FA 2PT7G 2VQFC 4RVNA 2E0GA 2YWCA 1J5EC 5BSWA 1O90A 4HPVA 1IBKC 2E7GA 2YCBA 5IT9D 1FJGC 4D57A 3DLPX 1XRAA 4YY3C 1AMUA 2QW0X 4JI2C 4G36A 4GKKC 5JRHA 4JI5C 3GKUA 3FCEA 4JI6C 3CW8X 2P2JA 4B3TC 5BSRA 4LF7C 4DR5C 4I9GA 5T8TA 1BA3A 3E7WA 3TDEA 3I08A 4LE5A 4NDNA 4OXIA 1MDFA 5AE1A 4TPSB 3EQ6A 3AF5A 4ISBA 4JI0C 2D27A 2E8EA 3RV2A 3NPDA 2UUBC 1KKGA 4FUQA 4RLFA 2P2MA 1P7LA 4DV7C 4NXNC 3PBKA 1XNRC 3J80D 4WS9A 4L7IA 2WD9A 4JV5C 2OPLA 1ULTA 1O93A 3DAYA 1T5HX 5BR8C 5GTDA 4JI4C 3RG2A 3TUFA 4U5YD 1V25A 1T5DX 4DR2C 4DV1C 4WV3A 2ATWA 2OO4A 5BSTA 4DG9A 5BSVA 4DV4C 4YHHC 5A1IA 4DV5C 2OPLB 4DR4C 2UXBC 2ASBA 3H2TA 4RLQA 2UXDC 1HNXC 1QM4A 1RY2A 3KXWA 5A19A 1JOSA 3N2QA 3CJEA 2Y4OA 4KTTA 1VLAA 4PHTA 5AE3A 2P2FA 2BJOA 2ZM6C 4PZPA 4BC9A 4NOZA 3GR1A 2PROA 3AF6A 3C5EA 4G1IA 2UXCC 1XNQC 3VNRA 3LGXA 4XX2A 5BSMA 4RMNA 5K85A 2OBVA 2D7VA 4DR6C 5BUSA 3OTOC 4K0BA 4LF8C 4BSZA 3UZ0A 3UOWA 4B3RC 1LQLA 3IEVA 4DR3C 3T1YC 5CZXA 1XRBA 4DCVA 2UUCC 4JI3C 1PA4A 4R1MA 1MD9A 4LF5C 5DV9A 1EGAA 4DR7C 2AYAA 4D56A 5BURA 5BSUA 2E8FA 3A4IA 2P02A 2VQEC 3L95X 4L4QA 4LFCC 2HJGA 3PROC 1MKYA 5IWAC 1O9TA 4BCAA 3I07A 4KHPC 4LF9C 2DYJA 2E8CA 2E5LC 3IPLA 3A9UA 2P2BA 1MXBA 4DG8A 3G7SA 3S82A 3A9VA 4B3SC 4JI8C 2VZEA 1MDBA 4DV6C 2BH1X 2D28C 1PG3A 2KZFA 1WF3A 1XRCA 2QVZX 2JMPA 2WP0C 4ZJZA 1RG9A 4BBYA 5A1GA 4X66C 3ETCA 3T1HC 3B7WA 2QL8A 2PN2A 5LMNC 2D1TA 2HHHC 2DPLA 3VNQA 4ZLPA 4DR1C 2P20A 3GPCA 4RM3A 4DUZC 4GXQA 1XMQC 3L8CA 3NYRA 4JYAC 1O92A 3N54B 3FCCA 4EATA 3LNVA 1FUGA 5LMUC 1USPB 5BUQA 1PG4A 1MXCA 1I94C 4LF4C 1ML8A 4OX9C 1IBMC 4DV3C 3JAMD 1HNWC 1HH2P 3SO4A 1MXAA 4PROC 3NI2A 2EGTA 2D1QA 1USPA 1QWIA 1YJ7A 3DHVA 1N33C 4BC7A 1ZB8A 1IBLC 3R9XA 5IFIA 4B3MC 2QVYX 3IMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2F A;  5FLX D;  2VQE C;  4LFA C;  1N32 C;  4LFC C;  2HJG A;  1MKY A;  4DCT A;  5IWA C;  4DR2 C;  4DV1 C;  2ATW A;  1N2F A;  1NYE A;  3I07 A;  4KHP C;  4LF9 C;  2DYJ A;  2E8C A;  2E5L C;  4MTN A;  2PT7 G;  2VQF C;  4X65 C;  4AQY C;  4DV4 C;  1J5E C;  1UKK A;  4YHH C;  1IBK C;  2E7G A;  4DV5 C;  4B3S C;  2ONF A;  4JI8 C;  4DV6 C;  2OPL B;  4MH4 A;  2KZF A;  2YCB A;  5IT9 D;  1WF3 A;  4DR4 C;  2F4V C;  1FJG C;  2UXB C;  2ASB A;  2JMP A;  2CXC A;  2UXD C;  1HNX C;  4X66 C;  4YY3 C;  3T1H C;  4GKJ C;  1JOS A;  4JI2 C;  4DCU A;  3CJE A;  1VLA A;  4GKK C;  4JI5 C;  2QL8 A;  4DV0 C;  3GKU A;  2PN2 A;  4JI6 C;  2BJO A;  5LMN C;  4B3T C;  2ZM6 C;  2HHH C;  3IEU A;  4LF7 C;  4NOZ A;  4DUY C;  4DR5 C;  4DR1 C;  3LUS A;  4DCS A;  4JI1 C;  3AF6 A;  4X64 C;  4DUZ C;  1XMQ C;  4JYA C;  1XMO C;  4DV2 C;  2UXC C;  1XNQ C;  2UUA C;  4XX2 A;  4X62 C;  2D7V A;  5A2Q D;  3J81 D;  1USP B;  5LMU C;  2UU9 C;  4DR6 C;  3AF5 A;  1HNZ C;  3EER A;  3OTO C;  1I94 C;  4LF4 C;  4JI0 C;  4LF8 C;  4BSZ A;  2E8E A;  1ML8 A;  4OX9 C;  1HR0 C;  4B3R C;  2UUB C;  1LQL A;  2CY1 A;  1KKG A;  1WH9 A;  3IEV A;  1K0R A;  4DR3 C;  1IBM C;  3T1Y C;  4DV7 C;  1ZB9 A;  4DCV A;  4DV3 C;  2UUC C;  4NXN C;  3JAM D;  1HNW C;  4JI3 C;  1PA4 A;  1HH2 P;  4NXM C;  4LF6 C;  4K0K C;  2XR1 A;  1XNR C;  1N34 C;  4LFB C;  3J80 D;  1N36 C;  2EGT A;  4LF5 C;  1USP A;  1QWI A;  4DR7 C;  1EGA A;  4JV5 C;  2OPL A;  1N33 C;  1ZB8 A;  1IBL C;  3R9X A;  3R9W A;  4B3M C;  4JI7 C;  2E8F A;  5BR8 C;  4JI4 C; 
#chains in the Genus database with same CATH topology
 1L2F A;  4R0M A;  4L2Z A;  4FTF A;  1IB8 A;  5K8F A;  2V7B A;  1WCJ A;  3CW9 A;  4MTN A;  4X65 C;  4AQY C;  5E7Q A;  4RVO A;  1UKK A;  5H9U A;  5KYT A;  2ONF A;  4MH4 A;  4JM1 A;  3O2E A;  4D4G A;  2F4V C;  2D1S A;  2CXC A;  3R44 A;  4IR7 A;  2QVX X;  3VNS A;  4GKJ C;  4IZ6 A;  4DCU A;  2Y4N A;  4OYC A;  4DV0 C;  5T8S A;  3E7X A;  3IEU A;  1GPM A;  4DUY C;  1V26 A;  3LUS A;  4DCS A;  4JI1 C;  4X64 C;  4KTV A;  1XMO C;  4G37 A;  4DV2 C;  5AE2 A;  2UUA C;  3NYQ A;  4RM2 A;  3TR3 A;  4X62 C;  3PES A;  3GR0 A;  5A2Q D;  3J81 D;  4D4I A;  2UU9 C;  3LAX A;  1HNZ C;  3EER A;  2YWB A;  1HR0 C;  4R1L A;  4GXR A;  2CY1 A;  1WH9 A;  5KEI A;  1K0R A;  1ZB9 A;  3TQI A;  1UWD A;  4GS5 A;  4NXM C;  4LF6 C;  4K0K C;  2XR1 A;  5KYV A;  1N34 C;  2D1R A;  4LFB C;  1N36 C;  2Y27 A;  4ODJ A;  1P4E A;  3R9W A;  3ETO A;  4JI7 C;  1LCI A;  5FLX D;  4LFA C;  1N32 C;  2P2Q A;  5ADZ A;  4DCT A;  5CZV A;  2VSQ A;  1N2F A;  4FUT A;  1NYE A;  3UEB A;  4I9F A;  2PT7 G;  2VQF C;  4RVN A;  2E0G A;  2YWC A;  1J5E C;  5BSW A;  1O90 A;  4HPV A;  1IBK C;  2E7G A;  2ZZN A;  2YCB A;  5IT9 D;  1FJG C;  4D57 A;  3DLP X;  1XRA A;  3A26 A;  3CQ3 A;  4YY3 C;  1AMU A;  2QW0 X;  4JI2 C;  4G36 A;  4GKK C;  5JRH A;  4JI5 C;  3GKU A;  3FCE A;  2KDN A;  4JI6 C;  3CW8 X;  3UX2 A;  2P2J A;  4B3T C;  5BSR A;  4LF7 C;  1TH5 A;  4DR5 C;  4I9G A;  5T8T A;  1BA3 A;  3E7W A;  3TDE A;  3I08 A;  4LE5 A;  4NDN A;  4OXI A;  1MDF A;  4PUG A;  3UX3 A;  5AE1 A;  4TPS B;  3EQ6 A;  3AF5 A;  4ISB A;  4JI0 C;  2D27 A;  2E8E A;  3RV2 A;  3NPD A;  1PU1 A;  2UUB C;  1KKG A;  4FUQ A;  4RLF A;  2P2M A;  1P7L A;  4DV7 C;  4NXN C;  2YX1 A;  3PBK A;  1XNR C;  3J80 D;  4WS9 A;  2MCQ A;  4L7I A;  2WD9 A;  4JV5 C;  2OPL A;  1ULT A;  1O93 A;  3CQ1 A;  3DAY A;  1T5H X;  5BR8 C;  5GTD A;  2CU6 A;  4JI4 C;  3RG2 A;  3TUF A;  4U5Y D;  3LNO A;  1V25 A;  1T5D X;  4DR2 C;  4DV1 C;  4WV3 A;  2ATW A;  1NY8 A;  2OO4 A;  5BST A;  4DG9 A;  1XS3 A;  5BSV A;  4DV4 C;  4YHH C;  5LCI A;  5A1I A;  4DV5 C;  2OPL B;  4DR4 C;  2UXB C;  2ASB A;  1VEH A;  2Z51 A;  3H2T A;  4RLQ A;  2UXD C;  1HNX C;  1QM4 A;  1RY2 A;  3KXW A;  5A19 A;  1JOS A;  3N2Q A;  3CJE A;  2Y4O A;  4KTT A;  1VLA A;  4PHT A;  2M5O A;  5AE3 A;  2P2F A;  1M6X A;  2MM9 A;  2BJO A;  2ZM6 C;  4PZP A;  1FLO A;  4BC9 A;  4NOZ A;  3GR1 A;  2PRO A;  3AF6 A;  3C5E A;  4G1I A;  2UXC C;  1XNQ C;  3VNR A;  3LGX A;  1XHJ A;  4XX2 A;  5BSM A;  3AY0 A;  5K85 A;  2OBV A;  2D7V A;  4RMN A;  4DR6 C;  5BUS A;  2M5H A;  3OTO C;  4K0B A;  4LF8 C;  4BSZ A;  2DHM A;  3UOW A;  3UZ0 A;  4B3R C;  1LQL A;  3IEV A;  4DR3 C;  3T1Y C;  5CZX A;  1XRB A;  4DCV A;  2UUC C;  4JI3 C;  1PA4 A;  4R1M A;  1MD9 A;  4LF5 C;  5DV9 A;  1EGA A;  4DR7 C;  2AYA A;  4D56 A;  5BUR A;  5BSU A;  2E8F A;  3A4I A;  2P02 A;  2VQE C;  3L95 X;  4L4Q A;  4LFC C;  3K6R A;  2HJG A;  3PRO C;  1MKY A;  5IWA C;  1O9T A;  4BCA A;  3I07 A;  4KHP C;  4LF9 C;  2DYJ A;  2E8C A;  2E5L C;  3IPL A;  3A9U A;  2P2B A;  1MXB A;  4DG8 A;  2ZZM A;  3G7S A;  3S82 A;  3A9V A;  4B3S C;  4JI8 C;  2VZE A;  1MDB A;  4DV6 C;  2BH1 X;  2D28 C;  1PG3 A;  2KZF A;  1WF3 A;  1XRC A;  2QVZ X;  2JMP A;  2WP0 C;  4ZJZ A;  1RG9 A;  4BBY A;  5A1G A;  4X66 C;  1P4E C;  3ETC A;  3T1H C;  3B7W A;  2QL8 A;  2MMA B;  2PN2 A;  5LMN C;  2D1T A;  2HHH C;  2DPL A;  3A25 A;  3VNQ A;  4PUH A;  4ZLP A;  1V60 A;  4DR1 C;  2P20 A;  3GPC A;  4RM3 A;  4DUZ C;  2JNV A;  4GXQ A;  1XMQ C;  3L8C A;  1M6X C;  3NYR A;  4JYA C;  1O92 A;  2NCL A;  3N54 B;  3FCC A;  4EAT A;  3LNV A;  4PUI A;  1FUG A;  5LMU C;  1USP B;  5BUQ A;  1PG4 A;  1MXC A;  1I94 C;  4LF4 C;  1ML8 A;  4OX9 C;  1IBM C;  4DV3 C;  3JAM D;  1HNW C;  1HH2 P;  3SO4 A;  1MXA A;  2KZ0 A;  4PRO C;  3NI2 A;  2EGT A;  2D1Q A;  1USP A;  1QWI A;  1YJ7 A;  3CQ2 A;  3DHV A;  1N33 C;  4BC7 A;  1ZB8 A;  1IBL C;  3R9X A;  5IFI A;  4B3M C;  2QVY X;  3IML A; 
#chains in the Genus database with same CATH homology
 1L2F A;  4R0M A;  4L2Z A;  4FTF A;  5K8F A;  2V7B A;  3CW9 A;  4MTN A;  4X65 C;  4AQY C;  5E7Q A;  4RVO A;  1UKK A;  5H9U A;  5KYT A;  2ONF A;  4MH4 A;  4JM1 A;  4D4G A;  2F4V C;  2D1S A;  2CXC A;  3R44 A;  4IR7 A;  2QVX X;  3VNS A;  4GKJ C;  4IZ6 A;  4DCU A;  2Y4N A;  4OYC A;  4DV0 C;  5T8S A;  3E7X A;  3IEU A;  1GPM A;  4DUY C;  1V26 A;  3LUS A;  4DCS A;  4JI1 C;  4X64 C;  4KTV A;  1XMO C;  4G37 A;  4DV2 C;  5AE2 A;  2UUA C;  3NYQ A;  4RM2 A;  4X62 C;  3PES A;  3GR0 A;  5A2Q D;  3J81 D;  4D4I A;  2UU9 C;  3LAX A;  1HNZ C;  3EER A;  2YWB A;  1HR0 C;  4R1L A;  4GXR A;  2CY1 A;  1WH9 A;  5KEI A;  1K0R A;  1ZB9 A;  3TQI A;  4GS5 A;  4NXM C;  4LF6 C;  4K0K C;  2XR1 A;  5KYV A;  1N34 C;  2D1R A;  4LFB C;  1N36 C;  2Y27 A;  4ODJ A;  3R9W A;  3ETO A;  4JI7 C;  1LCI A;  5FLX D;  4LFA C;  1N32 C;  2P2Q A;  5ADZ A;  4DCT A;  5CZV A;  2VSQ A;  1N2F A;  4FUT A;  1NYE A;  4I9F A;  2PT7 G;  2VQF C;  4RVN A;  2E0G A;  2YWC A;  1J5E C;  5BSW A;  1O90 A;  4HPV A;  1IBK C;  2E7G A;  2YCB A;  5IT9 D;  1FJG C;  4D57 A;  3DLP X;  1XRA A;  4YY3 C;  1AMU A;  2QW0 X;  4JI2 C;  4G36 A;  4GKK C;  5JRH A;  4JI5 C;  3GKU A;  3FCE A;  4JI6 C;  3CW8 X;  2P2J A;  4B3T C;  5BSR A;  4LF7 C;  4DR5 C;  4I9G A;  5T8T A;  1BA3 A;  3E7W A;  3TDE A;  3I08 A;  4LE5 A;  4NDN A;  4OXI A;  1MDF A;  5AE1 A;  4TPS B;  3EQ6 A;  3AF5 A;  4ISB A;  4JI0 C;  2D27 A;  2E8E A;  3RV2 A;  3NPD A;  2UUB C;  1KKG A;  4FUQ A;  4RLF A;  2P2M A;  1P7L A;  4DV7 C;  4NXN C;  3PBK A;  1XNR C;  3J80 D;  4WS9 A;  4L7I A;  2WD9 A;  4JV5 C;  2OPL A;  1ULT A;  1O93 A;  3DAY A;  1T5H X;  5BR8 C;  5GTD A;  4JI4 C;  3RG2 A;  3TUF A;  4U5Y D;  1V25 A;  1T5D X;  4DR2 C;  4DV1 C;  4WV3 A;  2ATW A;  2OO4 A;  5BST A;  4DG9 A;  5BSV A;  4DV4 C;  4YHH C;  5A1I A;  4DV5 C;  2OPL B;  4DR4 C;  2UXB C;  2ASB A;  3H2T A;  4RLQ A;  2UXD C;  1HNX C;  1QM4 A;  1RY2 A;  3KXW A;  5A19 A;  1JOS A;  3N2Q A;  3CJE A;  2Y4O A;  4KTT A;  1VLA A;  4PHT A;  5AE3 A;  2P2F A;  2BJO A;  2ZM6 C;  4PZP A;  4BC9 A;  4NOZ A;  3GR1 A;  2PRO A;  3AF6 A;  3C5E A;  4G1I A;  2UXC C;  1XNQ C;  3VNR A;  3LGX A;  4XX2 A;  5BSM A;  4RMN A;  5K85 A;  2OBV A;  2D7V A;  4DR6 C;  5BUS A;  3OTO C;  4K0B A;  4LF8 C;  4BSZ A;  3UZ0 A;  3UOW A;  4B3R C;  1LQL A;  3IEV A;  4DR3 C;  3T1Y C;  5CZX A;  1XRB A;  4DCV A;  2UUC C;  4JI3 C;  1PA4 A;  4R1M A;  1MD9 A;  4LF5 C;  5DV9 A;  1EGA A;  4DR7 C;  2AYA A;  4D56 A;  5BUR A;  5BSU A;  2E8F A;  3A4I A;  2P02 A;  2VQE C;  3L95 X;  4L4Q A;  4LFC C;  2HJG A;  3PRO C;  1MKY A;  5IWA C;  1O9T A;  4BCA A;  3I07 A;  4KHP C;  4LF9 C;  2DYJ A;  2E8C A;  2E5L C;  3IPL A;  3A9U A;  2P2B A;  1MXB A;  4DG8 A;  3G7S A;  3S82 A;  3A9V A;  4B3S C;  4JI8 C;  2VZE A;  1MDB A;  4DV6 C;  2BH1 X;  2D28 C;  1PG3 A;  2KZF A;  1WF3 A;  1XRC A;  2QVZ X;  2JMP A;  2WP0 C;  4ZJZ A;  1RG9 A;  4BBY A;  5A1G A;  4X66 C;  3ETC A;  3T1H C;  3B7W A;  2QL8 A;  2PN2 A;  5LMN C;  2D1T A;  2HHH C;  2DPL A;  3VNQ A;  4ZLP A;  4DR1 C;  2P20 A;  3GPC A;  4RM3 A;  4DUZ C;  4GXQ A;  1XMQ C;  3L8C A;  3NYR A;  4JYA C;  1O92 A;  3N54 B;  3FCC A;  4EAT A;  3LNV A;  1FUG A;  5LMU C;  1USP B;  5BUQ A;  1PG4 A;  1MXC A;  1I94 C;  4LF4 C;  1ML8 A;  4OX9 C;  1IBM C;  4DV3 C;  3JAM D;  1HNW C;  1HH2 P;  3SO4 A;  1MXA A;  4PRO C;  3NI2 A;  2EGT A;  2D1Q A;  1USP A;  1QWI A;  1YJ7 A;  3DHV A;  1N33 C;  4BC7 A;  1ZB8 A;  1IBL C;  3R9X A;  5IFI A;  4B3M C;  2QVY X;  3IML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...