2E8EA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 (reduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
b'MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Aq_1549
publication title Crystal Structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8eA00
3EERA 4DV3C 2E8CA 4KHPC 1QWIA 4OX9C 4DV2C 4JI8C 5LMNC 1XNQC 1VLAA 1K0RA 1HNXC 4DV5C 4LFAC 1FJGC 1N32C 1XMOC 1L2FA 3GKUA 4LFCC 1USPB 4YHHC 1J5EC 2XR1A 4LFBC 4X65C 4DR6C 4B3TC 1JOSA 2CY1A 3T1YC 4LF6C 4GKJC 2UXBC 4DV7C 3R9XA 2D7VA 3R9WA 1WH9A 4DV6C 1N33C 4X62C 1UKKA 1HH2P 2HJGA 5BR8C 1N36C 3IEUA 4DCSA 2VQEC 4JI5C 2PT7G 4DR7C 4NXNC 3I07A 4JI1C 2UXCC 2QL8A 4DV0C 2ONFA 1MKYA 2UUBC 1LQLA 4JI6C 2BJOA 4JI7C 1HNWC 1N2FA 4X64C 4DV1C 2ZM6C 4DCVA 2E8FA 4YY3C 4DUZC 4DR5C 4LF9C 1I94C 4JI4C 4B3SC 4XX2A 1IBMC 2UUAC 4LF8C 3JAMD 4JI2C 4NXMC 4DR4C 2OPLA 4BSZA 1KKGA 4DR3C 4B3MC 5A2QD 5IT9D 4MH4A 3CJEA 2UXDC 4DCTA 5IWAC 2E5LC 2YCBA 2UU9C 4LF7C 3AF5A 1WF3A 2VQFC 4DV4C 4GKKC 4K0KC 4DR1C 1IBLC 2ASBA 1IBKC 4JI3C 3IEVA 1N34C 2JMPA 4NOZA 3AF6A 3T1HC 2OPLB 4MTNA 2EGTA 3J80D 4DR2C 1NYEA 1HR0C 4JYAC 1PA4A 2PN2A 4DUYC 1HNZC 2E8EA 1ZB8A 3LUSA 2E7GA 1ZB9A 5FLXD 1XMQC 3OTOC 2KZFA 4JI0C 1EGAA 2DYJA 2ATWA 4LF4C 4DCUA 2UUCC 1XNRC 4AQYC 4JV5C 1ML8A 2CXCA 5LMUC 1USPA 4X66C 4LF5C 3J81D 2HHHC 2F4VC 4B3RC
chains in the Genus database with same CATH superfamily
2MCQA 2E8CA 1MXBA 1GPMA 1T5DX 3DLPX 2D1RA 2YWBA 5BUQA 1N32C 2QVZX 1XMOC 3EQ6A 3LGXA 5A1IA 2P2FA 3TUFA 4RLQA 2KZ0A 2OO4A 3C5EA 1J5EC 2XR1A 4LFBC 4RMNA 1O93A 4ISBA 4LF6C 2P2QA 4DV7C 3PBKA 3R9WA 2HJGA 4DCSA 5K8FA 3PESA 4ZLPA 4R0MA 4JM1A 4PUIA 2WD9A 4I9GA 2YX1A 4RLFA 3A25A 1ULTA 4JI6C 4JI7C 1HNWC 4DG9A 1N2FA 4YY3C 4DUZC 4DR5C 1P4EC 2UUAC 4LF8C 4D4IA 4JI2C 2M5OA 5A1GA 4BSZA 1KKGA 2MMAB 4B3MC 4U5YD 1LCIA 4DCTA 5BSTA 1WF3A 4EATA 5BUSA 2ASBA 4JI3C 3IEVA 4NOZA 3AF6A 4MTNA 4OYCA 1NYEA 1HR0C 3IMLA 3N54B 4DUYC 1VEHA 3LUSA 4LE5A 3SO4A 5H9UA 1MDFA 1QM4A 2DYJA 2ATWA 4LF4C 1XNRC 4AQYC 1ML8A 1MDBA 3VNRA 2MM9A 1T5HX 3EERA 4KTVA 4RM2A 2Y27A 3LAXA 4DV5C 5AE3A 3NI2A 3NPDA 3NYRA 1P4EA 2CU6A 1USPB 3CQ2A 3CW8X 5BURA 4D56A 4D4GA 2NCLA 4RM3A 5KYTA 4DR6C 2P02A 3UX3A 1JOSA 5BSUA 1O92A 3R9XA 4DV6C 4X62C 1N36C 5BSMA 4DR7C 5LCIA 4NXNC 3I08A 2VSQA 4JI1C 2QL8A 2UUBC 1LQLA 3RV2A 2BJOA 3H2TA 5E7QA 3S82A 4X64C 4DV1C 2ZM6C 1PG3A 1I94C 4BBYA 1AMUA 1BA3A 4NXMC 4DR4C 2OPLA 3GR1A 2ZZNA 3K6RA 5A2QD 2Y4NA 2UXDC 5GTDA 4IZ6A 3PROC 2VQFC 4DV4C 4K0KC 2M5HA 5JRHA 1IBLC 5AE1A 2OBVA 1IBKC 1MD9A 1N34C 5BSRA 3NYQA 1MXCA 2QVYX 1XRBA 4GXQA 3KXWA 1HNZC 1ZB8A 4R1LA 1PU1A 1ZB9A 5FLXD 2AYAA 1PG4A 3OTOC 4JI0C 1EGAA 3L95X 4BC7A 4BC9A 5KYVA 1P7LA 5CZVA 2VZEA 2CXCA 1XS3A 2D1SA 5LMUC 4LF5C 4RVOA 2F4VC 4KHPC 5A19A 1QWIA 4L7IA 1XNQC 1VLAA 3FCCA 1K0RA 4LFAC 1FJGC 3GKUA 1RY2A 3CQ3A 5BSWA 2PROA 2YWCA 4OXIA 4GS5A 3T1YC 4GKJC 2D7VA 1O90A 5BR8C 2KDNA 3IEUA 4JI5C 2VQEC 3DAYA 3A4IA 1O9TA 3CW9A 4I9FA 2ONFA 4WV3A 3UOWA 1NY8A 3E7XA 2E8FA 4LF9C 2V7BA 4JI4C 4B3SC 4KTTA 4PZPA 2JNVA 4PUHA 1RG9A 4DR3C 4GXRA 2Z51A 5IT9D 4MH4A 2E0GA 5IWAC 2QW0X 2E5LC 4TPSB 2UU9C 3AF5A 4WS9A 4FUTA 4NDNA 4IR7A 4PHTA 4G1IA 3A9UA 5KEIA 3FCEA 2D1TA 2EGTA 3J80D 4JYAC 3LNVA 1PA4A 2PN2A 2ZZMA 2E8EA 3A26A 2BH1X 5DV9A 2E7GA 1M6XC 1V25A 4BCAA 2D27A 3VNQA 5AE2A 4DCUA 1V60A 3GPCA 2UUCC 3R44A 5K85A 1USPA 3CQ1A 4X66C 3J81D 3TQIA 2HHHC 3A9VA 4DV3C 4OX9C 4DV2C 4JI8C 5LMNC 1HNXC 3O2EA 1L2FA 1WCJA 1V26A 1IB8A 5T8TA 1TH5A 4LFCC 1UWDA 4YHHC 3IPLA 1XHJA 5ADZA 4DG8A 4R1MA 2P20A 1FLOA 4X65C 4B3TC 5T8SA 2CY1A 2UXBC 3L8CA 3ETOA 1WH9A 1FUGA 2P2JA 4FTFA 1N33C 2P2BA 1HH2P 1UKKA 3DHVA 4L2ZA 2Y4OA 3G7SA 4L4QA 2PT7G 2P2MA 3UX2A 3LNOA 3I07A 4K0BA 4RVNA 2UXCC 4DV0C 1MKYA 3AY0A 4ODJA 4HPVA 3ETCA 4PUGA 4DCVA 1M6XA 4G36A 3E7WA 4XX2A 1YJ7A 1IBMC 3JAMD 5BSVA 2DHMA 2WP0C 3CJEA 1MXAA 2D28C 4ZJZA 1XRCA 2YCBA 4LF7C 3VNSA 2QVXX 4GKKC 4DR1C 3UZ0A 2DPLA 5CZXA 4PROC 4D57A 2JMPA 3RG2A 3T1HC 2OPLB 4DR2C 3TR3A 3UEBA 3N2QA 4G37A 1XMQC 2KZFA 1XRAA 3B7WA 3TDEA 3GR0A 4FUQA 4JV5C 5IFIA 2D1QA 4B3RC
chains in the Genus database with same CATH topology
2E8CA 1MXBA 1GPMA 1T5DX 3DLPX 2D1RA 2YWBA 5BUQA 1N32C 2QVZX 1XMOC 3EQ6A 3LGXA 5A1IA 2P2FA 3TUFA 4RLQA 2OO4A 3C5EA 1J5EC 2XR1A 4LFBC 4RMNA 1O93A 4ISBA 4LF6C 2P2QA 4DV7C 3PBKA 3R9WA 2HJGA 4DCSA 5K8FA 3PESA 4ZLPA 4R0MA 4JM1A 2WD9A 4I9GA 4RLFA 1ULTA 4JI6C 4JI7C 1HNWC 4DG9A 1N2FA 4YY3C 4DUZC 4DR5C 2UUAC 4LF8C 4D4IA 4JI2C 5A1GA 4BSZA 1KKGA 4B3MC 4U5YD 1LCIA 4DCTA 5BSTA 1WF3A 4EATA 5BUSA 2ASBA 4JI3C 3IEVA 4NOZA 3AF6A 4MTNA 4OYCA 1NYEA 1HR0C 3IMLA 3N54B 4DUYC 3LUSA 4LE5A 3SO4A 5H9UA 1MDFA 1QM4A 2DYJA 2ATWA 4LF4C 1XNRC 4AQYC 1ML8A 1MDBA 3VNRA 1T5HX 3EERA 4KTVA 4RM2A 2Y27A 3LAXA 4DV5C 5AE3A 3NI2A 3NPDA 3NYRA 1USPB 3CW8X 5BURA 4D56A 4D4GA 4RM3A 5KYTA 4DR6C 2P02A 1JOSA 5BSUA 1O92A 3R9XA 4DV6C 4X62C 1N36C 5BSMA 4DR7C 4NXNC 3I08A 2VSQA 4JI1C 2QL8A 2UUBC 1LQLA 3RV2A 2BJOA 3H2TA 5E7QA 3S82A 4X64C 4DV1C 2ZM6C 1PG3A 1I94C 4BBYA 1AMUA 1BA3A 4NXMC 4DR4C 2OPLA 3GR1A 5A2QD 2Y4NA 2UXDC 5GTDA 4IZ6A 3PROC 2VQFC 4DV4C 4K0KC 5JRHA 1IBLC 5AE1A 2OBVA 1IBKC 1MD9A 1N34C 5BSRA 3NYQA 1MXCA 2QVYX 1XRBA 4GXQA 3KXWA 1HNZC 1ZB8A 4R1LA 1ZB9A 5FLXD 2AYAA 1PG4A 3OTOC 4JI0C 1EGAA 3L95X 4BC7A 4BC9A 5KYVA 1P7LA 5CZVA 2VZEA 2CXCA 2D1SA 5LMUC 4LF5C 4RVOA 2F4VC 4KHPC 5A19A 1QWIA 4L7IA 1XNQC 1VLAA 3FCCA 1K0RA 4LFAC 1FJGC 3GKUA 1RY2A 5BSWA 2PROA 2YWCA 4OXIA 4GS5A 3T1YC 4GKJC 2D7VA 1O90A 5BR8C 3IEUA 4JI5C 2VQEC 3DAYA 3A4IA 1O9TA 3CW9A 4I9FA 2ONFA 4WV3A 3UOWA 3E7XA 2E8FA 4LF9C 2V7BA 4JI4C 4B3SC 4KTTA 4PZPA 1RG9A 4DR3C 4GXRA 5IT9D 4MH4A 2E0GA 5IWAC 2QW0X 2E5LC 4TPSB 2UU9C 3AF5A 4WS9A 4FUTA 4NDNA 4IR7A 4PHTA 4G1IA 3A9UA 5KEIA 3FCEA 2D1TA 2EGTA 3J80D 4JYAC 3LNVA 1PA4A 2PN2A 2E8EA 2BH1X 5DV9A 2E7GA 1V25A 4BCAA 2D27A 3VNQA 5AE2A 4DCUA 3GPCA 2UUCC 3R44A 5K85A 1USPA 4X66C 3J81D 3TQIA 2HHHC 3A9VA 4DV3C 4OX9C 4DV2C 4JI8C 5LMNC 1HNXC 1L2FA 1V26A 5T8TA 4LFCC 4YHHC 3IPLA 5ADZA 4DG8A 4R1MA 2P20A 4X65C 4B3TC 5T8SA 2CY1A 2UXBC 3L8CA 3ETOA 1WH9A 1FUGA 2P2JA 4FTFA 1N33C 2P2BA 1HH2P 1UKKA 3DHVA 4L2ZA 2Y4OA 3G7SA 4L4QA 2PT7G 2P2MA 3I07A 4K0BA 4RVNA 2UXCC 4DV0C 1MKYA 4ODJA 4HPVA 3ETCA 4DCVA 4G36A 3E7WA 4XX2A 1YJ7A 1IBMC 3JAMD 5BSVA 2WP0C 3CJEA 1MXAA 2D28C 4ZJZA 1XRCA 2YCBA 4LF7C 3VNSA 2QVXX 4GKKC 4DR1C 3UZ0A 2DPLA 5CZXA 4PROC 4D57A 2JMPA 3RG2A 3T1HC 2OPLB 4DR2C 3N2QA 4G37A 1XMQC 2KZFA 1XRAA 3B7WA 3TDEA 3GR0A 4FUQA 4JV5C 5IFIA 2D1QA 4B3RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EER A;  4DV3 C;  2E8C A;  4KHP C;  1QWI A;  4OX9 C;  4DV2 C;  4JI8 C;  5LMN C;  1XNQ C;  1VLA A;  1K0R A;  1HNX C;  4DV5 C;  4LFA C;  1FJG C;  1N32 C;  1XMO C;  1L2F A;  3GKU A;  4LFC C;  1USP B;  4YHH C;  1J5E C;  2XR1 A;  4LFB C;  4X65 C;  4DR6 C;  4B3T C;  1JOS A;  2CY1 A;  3T1Y C;  4LF6 C;  4GKJ C;  2UXB C;  4DV7 C;  3R9X A;  2D7V A;  3R9W A;  1WH9 A;  4DV6 C;  1N33 C;  4X62 C;  1UKK A;  1HH2 P;  2HJG A;  5BR8 C;  1N36 C;  3IEU A;  4DCS A;  2VQE C;  4JI5 C;  2PT7 G;  4DR7 C;  4NXN C;  3I07 A;  4JI1 C;  2UXC C;  2QL8 A;  4DV0 C;  2ONF A;  1MKY A;  2UUB C;  1LQL A;  4JI6 C;  2BJO A;  4JI7 C;  1HNW C;  1N2F A;  4X64 C;  4DV1 C;  2ZM6 C;  4DCV A;  2E8F A;  4YY3 C;  4DUZ C;  4DR5 C;  4LF9 C;  1I94 C;  4JI4 C;  4B3S C;  4XX2 A;  1IBM C;  2UUA C;  4LF8 C;  3JAM D;  4JI2 C;  4NXM C;  4DR4 C;  2OPL A;  4BSZ A;  1KKG A;  4DR3 C;  4B3M C;  5A2Q D;  5IT9 D;  4MH4 A;  3CJE A;  2UXD C;  4DCT A;  5IWA C;  2E5L C;  2YCB A;  2UU9 C;  4LF7 C;  3AF5 A;  1WF3 A;  2VQF C;  4DV4 C;  4GKK C;  4K0K C;  4DR1 C;  1IBL C;  2ASB A;  1IBK C;  4JI3 C;  3IEV A;  1N34 C;  2JMP A;  4NOZ A;  3AF6 A;  3T1H C;  2OPL B;  4MTN A;  2EGT A;  3J80 D;  4DR2 C;  1NYE A;  1HR0 C;  4JYA C;  1PA4 A;  2PN2 A;  4DUY C;  1HNZ C;  2E8E A;  1ZB8 A;  3LUS A;  2E7G A;  1ZB9 A;  5FLX D;  1XMQ C;  3OTO C;  2KZF A;  4JI0 C;  1EGA A;  2DYJ A;  2ATW A;  4LF4 C;  4DCU A;  2UUC C;  1XNR C;  4AQY C;  4JV5 C;  1ML8 A;  2CXC A;  5LMU C;  1USP A;  4X66 C;  4LF5 C;  3J81 D;  2HHH C;  2F4V C;  4B3R C; 
#chains in the Genus database with same CATH topology
 2MCQ A;  2E8C A;  1MXB A;  1GPM A;  1T5D X;  3DLP X;  2D1R A;  2YWB A;  5BUQ A;  1N32 C;  2QVZ X;  1XMO C;  3EQ6 A;  3LGX A;  5A1I A;  2P2F A;  3TUF A;  4RLQ A;  2KZ0 A;  2OO4 A;  3C5E A;  1J5E C;  2XR1 A;  4LFB C;  4RMN A;  1O93 A;  4ISB A;  4LF6 C;  2P2Q A;  4DV7 C;  3PBK A;  3R9W A;  2HJG A;  4DCS A;  5K8F A;  3PES A;  4ZLP A;  4R0M A;  4JM1 A;  4PUI A;  2WD9 A;  4I9G A;  2YX1 A;  4RLF A;  3A25 A;  1ULT A;  4JI6 C;  4JI7 C;  1HNW C;  4DG9 A;  1N2F A;  4YY3 C;  4DUZ C;  4DR5 C;  1P4E C;  2UUA C;  4LF8 C;  4D4I A;  4JI2 C;  2M5O A;  5A1G A;  4BSZ A;  1KKG A;  2MMA B;  4B3M C;  4U5Y D;  1LCI A;  4DCT A;  5BST A;  1WF3 A;  4EAT A;  5BUS A;  2ASB A;  4JI3 C;  3IEV A;  4NOZ A;  3AF6 A;  4MTN A;  4OYC A;  1NYE A;  1HR0 C;  3IML A;  3N54 B;  4DUY C;  1VEH A;  3LUS A;  4LE5 A;  3SO4 A;  5H9U A;  1MDF A;  1QM4 A;  2DYJ A;  2ATW A;  4LF4 C;  1XNR C;  4AQY C;  1ML8 A;  1MDB A;  3VNR A;  2MM9 A;  1T5H X;  3EER A;  4KTV A;  4RM2 A;  2Y27 A;  3LAX A;  4DV5 C;  5AE3 A;  3NI2 A;  3NPD A;  3NYR A;  1P4E A;  2CU6 A;  1USP B;  3CQ2 A;  3CW8 X;  5BUR A;  4D56 A;  4D4G A;  2NCL A;  4RM3 A;  5KYT A;  4DR6 C;  2P02 A;  3UX3 A;  1JOS A;  5BSU A;  1O92 A;  3R9X A;  4DV6 C;  4X62 C;  1N36 C;  5BSM A;  4DR7 C;  5LCI A;  4NXN C;  3I08 A;  2VSQ A;  4JI1 C;  2QL8 A;  2UUB C;  1LQL A;  3RV2 A;  2BJO A;  3H2T A;  5E7Q A;  3S82 A;  4X64 C;  4DV1 C;  2ZM6 C;  1PG3 A;  1I94 C;  4BBY A;  1AMU A;  1BA3 A;  4NXM C;  4DR4 C;  2OPL A;  3GR1 A;  2ZZN A;  3K6R A;  5A2Q D;  2Y4N A;  2UXD C;  5GTD A;  4IZ6 A;  3PRO C;  2VQF C;  4DV4 C;  4K0K C;  2M5H A;  5JRH A;  1IBL C;  5AE1 A;  2OBV A;  1IBK C;  1MD9 A;  1N34 C;  5BSR A;  3NYQ A;  1MXC A;  2QVY X;  1XRB A;  4GXQ A;  3KXW A;  1HNZ C;  1ZB8 A;  4R1L A;  1PU1 A;  1ZB9 A;  5FLX D;  2AYA A;  1PG4 A;  3OTO C;  4JI0 C;  1EGA A;  3L95 X;  4BC7 A;  4BC9 A;  5KYV A;  1P7L A;  5CZV A;  2VZE A;  2CXC A;  1XS3 A;  2D1S A;  5LMU C;  4LF5 C;  4RVO A;  2F4V C;  4KHP C;  5A19 A;  1QWI A;  4L7I A;  1XNQ C;  1VLA A;  3FCC A;  1K0R A;  4LFA C;  1FJG C;  3GKU A;  1RY2 A;  3CQ3 A;  5BSW A;  2PRO A;  2YWC A;  4OXI A;  4GS5 A;  3T1Y C;  4GKJ C;  2D7V A;  1O90 A;  5BR8 C;  2KDN A;  3IEU A;  4JI5 C;  2VQE C;  3DAY A;  3A4I A;  1O9T A;  3CW9 A;  4I9F A;  2ONF A;  4WV3 A;  3UOW A;  1NY8 A;  3E7X A;  2E8F A;  4LF9 C;  2V7B A;  4JI4 C;  4B3S C;  4KTT A;  4PZP A;  2JNV A;  4PUH A;  1RG9 A;  4DR3 C;  4GXR A;  2Z51 A;  5IT9 D;  4MH4 A;  2E0G A;  5IWA C;  2QW0 X;  2E5L C;  4TPS B;  2UU9 C;  3AF5 A;  4WS9 A;  4FUT A;  4NDN A;  4IR7 A;  4PHT A;  4G1I A;  3A9U A;  5KEI A;  3FCE A;  2D1T A;  2EGT A;  3J80 D;  4JYA C;  3LNV A;  1PA4 A;  2PN2 A;  2ZZM A;  2E8E A;  3A26 A;  2BH1 X;  5DV9 A;  2E7G A;  1M6X C;  1V25 A;  4BCA A;  2D27 A;  3VNQ A;  5AE2 A;  4DCU A;  1V60 A;  3GPC A;  2UUC C;  3R44 A;  5K85 A;  1USP A;  3CQ1 A;  4X66 C;  3J81 D;  3TQI A;  2HHH C;  3A9V A;  4DV3 C;  4OX9 C;  4DV2 C;  4JI8 C;  5LMN C;  1HNX C;  3O2E A;  1L2F A;  1WCJ A;  1V26 A;  1IB8 A;  5T8T A;  1TH5 A;  4LFC C;  1UWD A;  4YHH C;  3IPL A;  1XHJ A;  5ADZ A;  4DG8 A;  4R1M A;  2P20 A;  1FLO A;  4X65 C;  4B3T C;  5T8S A;  2CY1 A;  2UXB C;  3L8C A;  3ETO A;  1WH9 A;  1FUG A;  2P2J A;  4FTF A;  1N33 C;  2P2B A;  1HH2 P;  1UKK A;  3DHV A;  4L2Z A;  2Y4O A;  3G7S A;  4L4Q A;  2PT7 G;  2P2M A;  3UX2 A;  3LNO A;  3I07 A;  4K0B A;  4RVN A;  2UXC C;  4DV0 C;  1MKY A;  3AY0 A;  4ODJ A;  4HPV A;  3ETC A;  4PUG A;  4DCV A;  1M6X A;  4G36 A;  3E7W A;  4XX2 A;  1YJ7 A;  1IBM C;  3JAM D;  5BSV A;  2DHM A;  2WP0 C;  3CJE A;  1MXA A;  2D28 C;  4ZJZ A;  1XRC A;  2YCB A;  4LF7 C;  3VNS A;  2QVX X;  4GKK C;  4DR1 C;  3UZ0 A;  2DPL A;  5CZX A;  4PRO C;  4D57 A;  2JMP A;  3RG2 A;  3T1H C;  2OPL B;  4DR2 C;  3TR3 A;  3UEB A;  3N2Q A;  4G37 A;  1XMQ C;  2KZF A;  1XRA A;  3B7W A;  3TDE A;  3GR0 A;  4FUQ A;  4JV5 C;  5IFI A;  2D1Q A;  4B3R C; 
#chains in the Genus database with same CATH homology
 2E8C A;  1MXB A;  1GPM A;  1T5D X;  3DLP X;  2D1R A;  2YWB A;  5BUQ A;  1N32 C;  2QVZ X;  1XMO C;  3EQ6 A;  3LGX A;  5A1I A;  2P2F A;  3TUF A;  4RLQ A;  2OO4 A;  3C5E A;  1J5E C;  2XR1 A;  4LFB C;  4RMN A;  1O93 A;  4ISB A;  4LF6 C;  2P2Q A;  4DV7 C;  3PBK A;  3R9W A;  2HJG A;  4DCS A;  5K8F A;  3PES A;  4ZLP A;  4R0M A;  4JM1 A;  2WD9 A;  4I9G A;  4RLF A;  1ULT A;  4JI6 C;  4JI7 C;  1HNW C;  4DG9 A;  1N2F A;  4YY3 C;  4DUZ C;  4DR5 C;  2UUA C;  4LF8 C;  4D4I A;  4JI2 C;  5A1G A;  4BSZ A;  1KKG A;  4B3M C;  4U5Y D;  1LCI A;  4DCT A;  5BST A;  1WF3 A;  4EAT A;  5BUS A;  2ASB A;  4JI3 C;  3IEV A;  4NOZ A;  3AF6 A;  4MTN A;  4OYC A;  1NYE A;  1HR0 C;  3IML A;  3N54 B;  4DUY C;  3LUS A;  4LE5 A;  3SO4 A;  5H9U A;  1MDF A;  1QM4 A;  2DYJ A;  2ATW A;  4LF4 C;  1XNR C;  4AQY C;  1ML8 A;  1MDB A;  3VNR A;  1T5H X;  3EER A;  4KTV A;  4RM2 A;  2Y27 A;  3LAX A;  4DV5 C;  5AE3 A;  3NI2 A;  3NPD A;  3NYR A;  1USP B;  3CW8 X;  5BUR A;  4D56 A;  4D4G A;  4RM3 A;  5KYT A;  4DR6 C;  2P02 A;  1JOS A;  5BSU A;  1O92 A;  3R9X A;  4DV6 C;  4X62 C;  1N36 C;  5BSM A;  4DR7 C;  4NXN C;  3I08 A;  2VSQ A;  4JI1 C;  2QL8 A;  2UUB C;  1LQL A;  3RV2 A;  2BJO A;  3H2T A;  5E7Q A;  3S82 A;  4X64 C;  4DV1 C;  2ZM6 C;  1PG3 A;  1I94 C;  4BBY A;  1AMU A;  1BA3 A;  4NXM C;  4DR4 C;  2OPL A;  3GR1 A;  5A2Q D;  2Y4N A;  2UXD C;  5GTD A;  4IZ6 A;  3PRO C;  2VQF C;  4DV4 C;  4K0K C;  5JRH A;  1IBL C;  5AE1 A;  2OBV A;  1IBK C;  1MD9 A;  1N34 C;  5BSR A;  3NYQ A;  1MXC A;  2QVY X;  1XRB A;  4GXQ A;  3KXW A;  1HNZ C;  1ZB8 A;  4R1L A;  1ZB9 A;  5FLX D;  2AYA A;  1PG4 A;  3OTO C;  4JI0 C;  1EGA A;  3L95 X;  4BC7 A;  4BC9 A;  5KYV A;  1P7L A;  5CZV A;  2VZE A;  2CXC A;  2D1S A;  5LMU C;  4LF5 C;  4RVO A;  2F4V C;  4KHP C;  5A19 A;  1QWI A;  4L7I A;  1XNQ C;  1VLA A;  3FCC A;  1K0R A;  4LFA C;  1FJG C;  3GKU A;  1RY2 A;  5BSW A;  2PRO A;  2YWC A;  4OXI A;  4GS5 A;  3T1Y C;  4GKJ C;  2D7V A;  1O90 A;  5BR8 C;  3IEU A;  4JI5 C;  2VQE C;  3DAY A;  3A4I A;  1O9T A;  3CW9 A;  4I9F A;  2ONF A;  4WV3 A;  3UOW A;  3E7X A;  2E8F A;  4LF9 C;  2V7B A;  4JI4 C;  4B3S C;  4KTT A;  4PZP A;  1RG9 A;  4DR3 C;  4GXR A;  5IT9 D;  4MH4 A;  2E0G A;  5IWA C;  2QW0 X;  2E5L C;  4TPS B;  2UU9 C;  3AF5 A;  4WS9 A;  4FUT A;  4NDN A;  4IR7 A;  4PHT A;  4G1I A;  3A9U A;  5KEI A;  3FCE A;  2D1T A;  2EGT A;  3J80 D;  4JYA C;  3LNV A;  1PA4 A;  2PN2 A;  2E8E A;  2BH1 X;  5DV9 A;  2E7G A;  1V25 A;  4BCA A;  2D27 A;  3VNQ A;  5AE2 A;  4DCU A;  3GPC A;  2UUC C;  3R44 A;  5K85 A;  1USP A;  4X66 C;  3J81 D;  3TQI A;  2HHH C;  3A9V A;  4DV3 C;  4OX9 C;  4DV2 C;  4JI8 C;  5LMN C;  1HNX C;  1L2F A;  1V26 A;  5T8T A;  4LFC C;  4YHH C;  3IPL A;  5ADZ A;  4DG8 A;  4R1M A;  2P20 A;  4X65 C;  4B3T C;  5T8S A;  2CY1 A;  2UXB C;  3L8C A;  3ETO A;  1WH9 A;  1FUG A;  2P2J A;  4FTF A;  1N33 C;  2P2B A;  1HH2 P;  1UKK A;  3DHV A;  4L2Z A;  2Y4O A;  3G7S A;  4L4Q A;  2PT7 G;  2P2M A;  3I07 A;  4K0B A;  4RVN A;  2UXC C;  4DV0 C;  1MKY A;  4ODJ A;  4HPV A;  3ETC A;  4DCV A;  4G36 A;  3E7W A;  4XX2 A;  1YJ7 A;  1IBM C;  3JAM D;  5BSV A;  2WP0 C;  3CJE A;  1MXA A;  2D28 C;  4ZJZ A;  1XRC A;  2YCB A;  4LF7 C;  3VNS A;  2QVX X;  4GKK C;  4DR1 C;  3UZ0 A;  2DPL A;  5CZX A;  4PRO C;  4D57 A;  2JMP A;  3RG2 A;  3T1H C;  2OPL B;  4DR2 C;  3N2Q A;  4G37 A;  1XMQ C;  2KZF A;  1XRA A;  3B7W A;  3TDE A;  3GR0 A;  4FUQ A;  4JV5 C;  5IFI A;  2D1Q A;  4B3R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...