2E8EA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 (reduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Aq_1549
publication title Crystal Structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8eA00
4B3MC 3R9WA 1N33C 4DV0C 4GKKC 2QL8A 4DCUA 3J81D 2HJGA 4JYAC 1PA4A 2D7VA 4AQYC 1IBLC 1HH2P 4DR4C 4LF5C 4NXMC 4DV4C 1IBKC 1HR0C 1XNRC 3I07A 1LQLA 2JMPA 4X65C 4LFCC 2OPLA 2VQEC 1FJGC 3T1HC 4DV1C 3J80D 2E8FA 4LF4C 4BSZA 1N36C 4LF9C 4KHPC 1WF3A 1I94C 4DUZC 4DR7C 4X66C 2OPLB 1QWIA 1HNWC 2UXDC 1NYEA 5FLXD 4LF7C 2ATWA 1ZB8A 4XX2A 4X62C 4B3RC 4DV7C 5IWAC 1J5EC 3AF5A 2UUBC 2UXCC 2KZFA 2PN2A 4MTNA 3OTOC 5LMUC 1IBMC 2HHHC 1UKKA 1K0RA 2ASBA 3EERA 3IEVA 2CY1A 1XMQC 3T1YC 1N2FA 4LFAC 2VQFC 2E7GA 4X64C 3CJEA 5IT9D 1N34C 2UUAC 4LF8C 4B3SC 4DV3C 3LUSA 1XNQC 2XR1A 4DR2C 4NOZA 2UUCC 4JI8C 4JI3C 4DCTA 4DR1C 3AF6A 2BJOA 1HNZC 1L2FA 4OX9C 2EGTA 4DCVA 5BR8C 1ZB9A 4JI0C 3R9XA 4JI7C 4JV5C 3GKUA 1USPA 4DV5C 2UXBC 1ML8A 4K0KC 4YY3C 1HNXC 4JI5C 2ONFA 4DCSA 4NXNC 2F4VC 4JI6C 5A2QD 1EGAA 5LMNC 4MH4A 1USPB 4DR3C 4JI1C 4B3TC 2DYJA 4JI4C 2E8CA 4DUYC 4DR6C 3IEUA 4YHHC 2ZM6C 2E5LC 4GKJC 1VLAA 2PT7G 1N32C 4LF6C 4JI2C 4DV6C 2E8EA 4LFBC 2YCBA 2CXCA 3JAMD 4DR5C 4DV2C 1MKYA 1KKGA 2UU9C 1JOSA 1XMOC 1WH9A
chains in the Genus database with same CATH superfamily
5K8FA 4B3MC 3R9WA 1N33C 2QL8A 4DCUA 3J81D 3SO4A 2HJGA 3S82A 4D57A 4JYAC 4GXRA 2D7VA 1P4EC 5CZXA 4DR4C 3TDEA 4DV4C 2D1TA 1O9TA 2P20A 3KXWA 2JMPA 4LFCC 3T1HC 3DAYA 3IMLA 3IPLA 2D27A 4L7IA 3ETCA 2KDNA 5AE1A 1I94C 2P2MA 4DUZC 5A1GA 2OO4A 4X66C 1QWIA 5FLXD 2ATWA 4FTFA 4DV7C 4DG8A 2UUBC 2P2BA 3EQ6A 1ULTA 5BUQA 2KZFA 5T8TA 1MXBA 4MTNA 3OTOC 1IBMC 5BSTA 3EERA 3IEVA 3PBKA 3LGXA 3DHVA 4G37A 2WD9A 4BBYA 2QW0X 1V60A 4DR2C 2DPLA 2P02A 4TPSB 4OXIA 3AF6A 1HNZC 5BSUA 4GS5A 4DCVA 1PG4A 5BSRA 2QVXX 1QM4A 4JV5C 3GKUA 4R0MA 1XRCA 1USPA 1ML8A 5KEIA 4R1LA 3ETOA 4DCSA 5A2QD 1EGAA 3A25A 1MDFA 1O92A 2DYJA 3VNQA 4JI4C 4G36A 1MXCA 4PZPA 4FUTA 4DUYC 3IEUA 3FCCA 2E5LC 2PT7G 4BCAA 4LFBC 2ZZMA 3JAMD 2WP0C 4K0BA 3CW8X 4HPVA 1PU1A 1VEHA 1XS3A 4D4GA 3DLPX 5BUSA 5A1IA 4GXQA 2E0GA 2OBVA 4U5YD 1IBKC 1GPMA 3A9UA 2AYAA 4IZ6A 1XNRC 3I07A 3GR0A 4X65C 2D1RA 2OPLA 1FJGC 4RM3A 4DV1C 3J80D 4BSZA 4RLQA 4DR7C 2UXDC 1NYEA 1ZB8A 4XX2A 2MM9A 5IWAC 1J5EC 4RVOA 1TH5A 3LNVA 2D28C 1MD9A 1K0RA 2CY1A 1PG3A 4G1IA 1XMQC 1N2FA 2QVYX 3UX3A 2VQFC 4X64C 2DHMA 5BURA 2CU6A 1XNQC 4NOZA 4JI8C 4DCTA 1XRAA 1FUGA 1L2FA 4OX9C 3CQ3A 5ADZA 4ZLPA 4DV5C 2UXBC 4ODJA 4K0KC 4YY3C 4PUIA 4NXNC 3CQ2A 3NYQA 5CZVA 4BC7A 5LMNC 2VZEA 1USPB 5A19A 1M6XC 5AE3A 1LCIA 4DR6C 1V26A 3K6RA 3LAXA 4GKJC 4PUGA 3H2TA 1N32C 3A4IA 5KYVA 4JI2C 3GR1A 2YCBA 1KKGA 1JOSA 4WV3A 1NY8A 4I9GA 4L2ZA 5JRHA 2P2JA 2MCQA 4GKKC 4KTVA 1AMUA 1PA4A 3R44A 5AE2A 2YWBA 1P7LA 3UEBA 2ZZNA 3NPDA 1FLOA 1YJ7A 3CQ1A 2M5HA 5GTDA 2P2QA 5K85A 3NYRA 2E8FA 4LF4C 4KHPC 4LF9C 3LNOA 3B7WA 2OPLB 3UOWA 3CW9A 3L8CA 1BA3A 3PESA 4RLFA 4I9FA 2VSQA 3AF5A 5LCIA 2PN2A 4PHTA 2HHHC 1UKKA 4L4QA 3T1YC 3UZ0A 4LFAC 2E7GA 1MDBA 3CJEA 1N34C 2UUAC 4LF8C 4B3SC 4DV3C 3LUSA 5BSWA 2UUCC 2BH1X 1UWDA 5E7QA 4DR1C 4WS9A 2BJOA 2Z51A 4D56A 3VNRA 3R9XA 4JI7C 3N54B 1V25A 4JI5C 2ONFA 4DG9A 2F4VC 4JI6C 2QVZX 3A9VA 2PROA 4EATA 1RG9A 3UX2A 5BSMA 3O2EA 3PROC 4YHHC 2ZM6C 1VLAA 3GPCA 4ISBA 2Y4NA 4DV6C 1IB8A 1O90A 2CXCA 4DR5C 4DV2C 4PROC 2UU9C 3VNSA 5BSVA 1T5HX 1WH9A 4DV0C 4LE5A 3N2QA 3RG2A 1T5DX 4AQYC 1IBLC 2NCLA 2M5OA 2KZ0A 2P2FA 4R1MA 2Y27A 1HH2P 4LF5C 4NXMC 5IFIA 4ZJZA 3E7WA 1HR0C 2YX1A 1LQLA 3I08A 5KYTA 2VQEC 2Y4OA 4RVNA 3C5EA 3NI2A 5H9UA 3E7XA 4JM1A 2V7BA 1N36C 1WF3A 2YWCA 4IR7A 1WCJA 1P4EA 1HNWC 3AY0A 4LF7C 1O93A 4X62C 2JNVA 4B3RC 2D1QA 4RM2A 2UXCC 2MMAB 1XHJA 5LMUC 2ASBA 4KTTA 4RMNA 3TQIA 5IT9D 3RV2A 4BC9A 2XR1A 3TUFA 1MXAA 3L95X 4JI3C 2EGTA 5BR8C 1ZB9A 4JI0C 3FCEA 3G7SA 3TR3A 1HNXC 1XRBA 5T8SA 5DV9A 3A26A 4MH4A 4D4IA 4DR3C 1RY2A 4JI1C 4B3TC 1M6XA 4FUQA 2E8CA 4OYCA 2D1SA 4PUHA 4NDNA 4LF6C 2E8EA 1MKYA 1XMOC
chains in the Genus database with same CATH topology
5K8FA 4B3MC 3R9WA 1N33C 2QL8A 4DCUA 3J81D 3SO4A 2HJGA 3S82A 4D57A 4JYAC 4GXRA 2D7VA 5CZXA 4DR4C 3TDEA 4DV4C 2D1TA 1O9TA 2P20A 3KXWA 2JMPA 4LFCC 3T1HC 3DAYA 3IMLA 3IPLA 2D27A 4L7IA 3ETCA 5AE1A 1I94C 2P2MA 4DUZC 5A1GA 2OO4A 4X66C 1QWIA 5FLXD 2ATWA 4FTFA 4DV7C 4DG8A 2UUBC 2P2BA 3EQ6A 1ULTA 5BUQA 2KZFA 5T8TA 1MXBA 4MTNA 3OTOC 1IBMC 5BSTA 3EERA 3IEVA 3PBKA 3LGXA 3DHVA 4G37A 2WD9A 4BBYA 2QW0X 4DR2C 2DPLA 2P02A 4TPSB 4OXIA 3AF6A 1HNZC 5BSUA 4GS5A 4DCVA 1PG4A 5BSRA 2QVXX 1QM4A 4JV5C 3GKUA 4R0MA 1XRCA 1USPA 1ML8A 5KEIA 4R1LA 3ETOA 4DCSA 5A2QD 1EGAA 1MDFA 1O92A 2DYJA 3VNQA 4JI4C 4G36A 1MXCA 4PZPA 4FUTA 4DUYC 3IEUA 3FCCA 2E5LC 2PT7G 4BCAA 4LFBC 3JAMD 2WP0C 4K0BA 3CW8X 4HPVA 4D4GA 3DLPX 5BUSA 5A1IA 4GXQA 2E0GA 2OBVA 4U5YD 1IBKC 1GPMA 3A9UA 2AYAA 4IZ6A 1XNRC 3I07A 3GR0A 4X65C 2D1RA 2OPLA 1FJGC 4RM3A 4DV1C 3J80D 4BSZA 4RLQA 4DR7C 2UXDC 1NYEA 1ZB8A 4XX2A 5IWAC 1J5EC 4RVOA 3LNVA 2D28C 1MD9A 1K0RA 2CY1A 1PG3A 4G1IA 1XMQC 1N2FA 2QVYX 2VQFC 4X64C 5BURA 1XNQC 4NOZA 4JI8C 4DCTA 1XRAA 1FUGA 1L2FA 4OX9C 5ADZA 4ZLPA 4DV5C 2UXBC 4ODJA 4K0KC 4YY3C 4NXNC 3NYQA 5CZVA 4BC7A 5LMNC 2VZEA 1USPB 5A19A 5AE3A 1LCIA 4DR6C 1V26A 3LAXA 4GKJC 3H2TA 1N32C 3A4IA 5KYVA 4JI2C 3GR1A 2YCBA 1KKGA 1JOSA 4WV3A 4I9GA 4L2ZA 5JRHA 2P2JA 4GKKC 4KTVA 1AMUA 1PA4A 3R44A 5AE2A 2YWBA 1P7LA 3NPDA 1YJ7A 5GTDA 2P2QA 5K85A 3NYRA 2E8FA 4LF4C 4KHPC 4LF9C 3B7WA 2OPLB 3UOWA 3CW9A 3L8CA 1BA3A 3PESA 4RLFA 4I9FA 2VSQA 3AF5A 2PN2A 4PHTA 2HHHC 1UKKA 4L4QA 3T1YC 3UZ0A 4LFAC 2E7GA 1MDBA 3CJEA 1N34C 2UUAC 4LF8C 4B3SC 4DV3C 3LUSA 5BSWA 2UUCC 2BH1X 5E7QA 4DR1C 4WS9A 2BJOA 4D56A 3VNRA 3R9XA 4JI7C 3N54B 1V25A 4JI5C 2ONFA 4DG9A 2F4VC 4JI6C 2QVZX 3A9VA 2PROA 4EATA 1RG9A 5BSMA 3PROC 4YHHC 2ZM6C 1VLAA 3GPCA 4ISBA 2Y4NA 4DV6C 1O90A 2CXCA 4DR5C 4DV2C 4PROC 2UU9C 3VNSA 5BSVA 1T5HX 1WH9A 4DV0C 4LE5A 3N2QA 3RG2A 1T5DX 4AQYC 1IBLC 2P2FA 4R1MA 2Y27A 1HH2P 4LF5C 4NXMC 5IFIA 4ZJZA 3E7WA 1HR0C 1LQLA 3I08A 5KYTA 2VQEC 2Y4OA 4RVNA 3C5EA 3NI2A 5H9UA 3E7XA 4JM1A 2V7BA 1N36C 1WF3A 2YWCA 4IR7A 1HNWC 4LF7C 1O93A 4X62C 4B3RC 2D1QA 4RM2A 2UXCC 5LMUC 2ASBA 4KTTA 4RMNA 3TQIA 5IT9D 3RV2A 4BC9A 2XR1A 3TUFA 1MXAA 3L95X 4JI3C 2EGTA 5BR8C 1ZB9A 4JI0C 3FCEA 3G7SA 1HNXC 1XRBA 5T8SA 5DV9A 4MH4A 4D4IA 4DR3C 1RY2A 4JI1C 4B3TC 4FUQA 2E8CA 4OYCA 2D1SA 4NDNA 4LF6C 2E8EA 1MKYA 1XMOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M C;  3R9W A;  1N33 C;  4DV0 C;  4GKK C;  2QL8 A;  4DCU A;  3J81 D;  2HJG A;  4JYA C;  1PA4 A;  2D7V A;  4AQY C;  1IBL C;  1HH2 P;  4DR4 C;  4LF5 C;  4NXM C;  4DV4 C;  1IBK C;  1HR0 C;  1XNR C;  3I07 A;  1LQL A;  2JMP A;  4X65 C;  4LFC C;  2OPL A;  2VQE C;  1FJG C;  3T1H C;  4DV1 C;  3J80 D;  2E8F A;  4LF4 C;  4BSZ A;  1N36 C;  4LF9 C;  4KHP C;  1WF3 A;  1I94 C;  4DUZ C;  4DR7 C;  4X66 C;  2OPL B;  1QWI A;  1HNW C;  2UXD C;  1NYE A;  5FLX D;  4LF7 C;  2ATW A;  1ZB8 A;  4XX2 A;  4X62 C;  4B3R C;  4DV7 C;  5IWA C;  1J5E C;  3AF5 A;  2UUB C;  2UXC C;  2KZF A;  2PN2 A;  4MTN A;  3OTO C;  5LMU C;  1IBM C;  2HHH C;  1UKK A;  1K0R A;  2ASB A;  3EER A;  3IEV A;  2CY1 A;  1XMQ C;  3T1Y C;  1N2F A;  4LFA C;  2VQF C;  2E7G A;  4X64 C;  3CJE A;  5IT9 D;  1N34 C;  2UUA C;  4LF8 C;  4B3S C;  4DV3 C;  3LUS A;  1XNQ C;  2XR1 A;  4DR2 C;  4NOZ A;  2UUC C;  4JI8 C;  4JI3 C;  4DCT A;  4DR1 C;  3AF6 A;  2BJO A;  1HNZ C;  1L2F A;  4OX9 C;  2EGT A;  4DCV A;  5BR8 C;  1ZB9 A;  4JI0 C;  3R9X A;  4JI7 C;  4JV5 C;  3GKU A;  1USP A;  4DV5 C;  2UXB C;  1ML8 A;  4K0K C;  4YY3 C;  1HNX C;  4JI5 C;  2ONF A;  4DCS A;  4NXN C;  2F4V C;  4JI6 C;  5A2Q D;  1EGA A;  5LMN C;  4MH4 A;  1USP B;  4DR3 C;  4JI1 C;  4B3T C;  2DYJ A;  4JI4 C;  2E8C A;  4DUY C;  4DR6 C;  3IEU A;  4YHH C;  2ZM6 C;  2E5L C;  4GKJ C;  1VLA A;  2PT7 G;  1N32 C;  4LF6 C;  4JI2 C;  4DV6 C;  2E8E A;  4LFB C;  2YCB A;  2CXC A;  3JAM D;  4DR5 C;  4DV2 C;  1MKY A;  1KKG A;  2UU9 C;  1JOS A;  1XMO C;  1WH9 A; 
#chains in the Genus database with same CATH topology
 5K8F A;  4B3M C;  3R9W A;  1N33 C;  2QL8 A;  4DCU A;  3J81 D;  3SO4 A;  2HJG A;  3S82 A;  4D57 A;  4JYA C;  4GXR A;  2D7V A;  1P4E C;  5CZX A;  4DR4 C;  3TDE A;  4DV4 C;  2D1T A;  1O9T A;  2P20 A;  3KXW A;  2JMP A;  4LFC C;  3T1H C;  3DAY A;  3IML A;  3IPL A;  2D27 A;  4L7I A;  3ETC A;  2KDN A;  5AE1 A;  1I94 C;  2P2M A;  4DUZ C;  5A1G A;  2OO4 A;  4X66 C;  1QWI A;  5FLX D;  2ATW A;  4FTF A;  4DV7 C;  4DG8 A;  2UUB C;  2P2B A;  3EQ6 A;  1ULT A;  5BUQ A;  2KZF A;  5T8T A;  1MXB A;  4MTN A;  3OTO C;  1IBM C;  5BST A;  3EER A;  3IEV A;  3PBK A;  3LGX A;  3DHV A;  4G37 A;  2WD9 A;  4BBY A;  2QW0 X;  1V60 A;  4DR2 C;  2DPL A;  2P02 A;  4TPS B;  4OXI A;  3AF6 A;  1HNZ C;  5BSU A;  4GS5 A;  4DCV A;  1PG4 A;  5BSR A;  2QVX X;  1QM4 A;  4JV5 C;  3GKU A;  4R0M A;  1XRC A;  1USP A;  1ML8 A;  5KEI A;  4R1L A;  3ETO A;  4DCS A;  5A2Q D;  1EGA A;  3A25 A;  1MDF A;  1O92 A;  2DYJ A;  3VNQ A;  4JI4 C;  4G36 A;  1MXC A;  4PZP A;  4FUT A;  4DUY C;  3IEU A;  3FCC A;  2E5L C;  2PT7 G;  4BCA A;  4LFB C;  2ZZM A;  3JAM D;  2WP0 C;  4K0B A;  3CW8 X;  4HPV A;  1PU1 A;  1VEH A;  1XS3 A;  4D4G A;  3DLP X;  5BUS A;  5A1I A;  4GXQ A;  2E0G A;  2OBV A;  4U5Y D;  1IBK C;  1GPM A;  3A9U A;  2AYA A;  4IZ6 A;  1XNR C;  3I07 A;  3GR0 A;  4X65 C;  2D1R A;  2OPL A;  1FJG C;  4RM3 A;  4DV1 C;  3J80 D;  4BSZ A;  4RLQ A;  4DR7 C;  2UXD C;  1NYE A;  1ZB8 A;  4XX2 A;  2MM9 A;  5IWA C;  1J5E C;  4RVO A;  1TH5 A;  3LNV A;  2D28 C;  1MD9 A;  1K0R A;  2CY1 A;  1PG3 A;  4G1I A;  1XMQ C;  1N2F A;  2QVY X;  3UX3 A;  2VQF C;  4X64 C;  2DHM A;  5BUR A;  2CU6 A;  1XNQ C;  4NOZ A;  4JI8 C;  4DCT A;  1XRA A;  1FUG A;  1L2F A;  4OX9 C;  3CQ3 A;  5ADZ A;  4ZLP A;  4DV5 C;  2UXB C;  4ODJ A;  4K0K C;  4YY3 C;  4PUI A;  4NXN C;  3CQ2 A;  3NYQ A;  5CZV A;  4BC7 A;  5LMN C;  2VZE A;  1USP B;  5A19 A;  1M6X C;  5AE3 A;  1LCI A;  4DR6 C;  1V26 A;  3K6R A;  3LAX A;  4GKJ C;  4PUG A;  3H2T A;  1N32 C;  3A4I A;  5KYV A;  4JI2 C;  3GR1 A;  2YCB A;  1KKG A;  1JOS A;  4WV3 A;  1NY8 A;  4I9G A;  4L2Z A;  5JRH A;  2P2J A;  2MCQ A;  4GKK C;  4KTV A;  1AMU A;  1PA4 A;  3R44 A;  5AE2 A;  2YWB A;  1P7L A;  3UEB A;  2ZZN A;  3NPD A;  1FLO A;  1YJ7 A;  3CQ1 A;  2M5H A;  5GTD A;  2P2Q A;  5K85 A;  3NYR A;  2E8F A;  4LF4 C;  4KHP C;  4LF9 C;  3LNO A;  3B7W A;  2OPL B;  3UOW A;  3CW9 A;  3L8C A;  1BA3 A;  3PES A;  4RLF A;  4I9F A;  2VSQ A;  3AF5 A;  5LCI A;  2PN2 A;  4PHT A;  2HHH C;  1UKK A;  4L4Q A;  3T1Y C;  3UZ0 A;  4LFA C;  2E7G A;  1MDB A;  3CJE A;  1N34 C;  2UUA C;  4LF8 C;  4B3S C;  4DV3 C;  3LUS A;  5BSW A;  2UUC C;  2BH1 X;  1UWD A;  5E7Q A;  4DR1 C;  4WS9 A;  2BJO A;  2Z51 A;  4D56 A;  3VNR A;  3R9X A;  4JI7 C;  3N54 B;  1V25 A;  4JI5 C;  2ONF A;  4DG9 A;  2F4V C;  4JI6 C;  2QVZ X;  3A9V A;  2PRO A;  4EAT A;  1RG9 A;  3UX2 A;  5BSM A;  3O2E A;  3PRO C;  4YHH C;  2ZM6 C;  1VLA A;  3GPC A;  4ISB A;  2Y4N A;  4DV6 C;  1IB8 A;  1O90 A;  2CXC A;  4DR5 C;  4DV2 C;  4PRO C;  2UU9 C;  3VNS A;  5BSV A;  1T5H X;  1WH9 A;  4DV0 C;  4LE5 A;  3N2Q A;  3RG2 A;  1T5D X;  4AQY C;  1IBL C;  2NCL A;  2M5O A;  2KZ0 A;  2P2F A;  4R1M A;  2Y27 A;  1HH2 P;  4LF5 C;  4NXM C;  5IFI A;  4ZJZ A;  3E7W A;  1HR0 C;  2YX1 A;  1LQL A;  3I08 A;  5KYT A;  2VQE C;  2Y4O A;  4RVN A;  3C5E A;  3NI2 A;  5H9U A;  3E7X A;  4JM1 A;  2V7B A;  1N36 C;  1WF3 A;  2YWC A;  4IR7 A;  1WCJ A;  1P4E A;  1HNW C;  3AY0 A;  4LF7 C;  1O93 A;  4X62 C;  2JNV A;  4B3R C;  2D1Q A;  4RM2 A;  2UXC C;  2MMA B;  1XHJ A;  5LMU C;  2ASB A;  4KTT A;  4RMN A;  3TQI A;  5IT9 D;  3RV2 A;  4BC9 A;  2XR1 A;  3TUF A;  1MXA A;  3L95 X;  4JI3 C;  2EGT A;  5BR8 C;  1ZB9 A;  4JI0 C;  3FCE A;  3G7S A;  3TR3 A;  1HNX C;  1XRB A;  5T8S A;  5DV9 A;  3A26 A;  4MH4 A;  4D4I A;  4DR3 C;  1RY2 A;  4JI1 C;  4B3T C;  1M6X A;  4FUQ A;  2E8C A;  4OYC A;  2D1S A;  4PUH A;  4NDN A;  4LF6 C;  2E8E A;  1MKY A;  1XMO C; 
#chains in the Genus database with same CATH homology
 5K8F A;  4B3M C;  3R9W A;  1N33 C;  2QL8 A;  4DCU A;  3J81 D;  3SO4 A;  2HJG A;  3S82 A;  4D57 A;  4JYA C;  4GXR A;  2D7V A;  5CZX A;  4DR4 C;  3TDE A;  4DV4 C;  2D1T A;  1O9T A;  2P20 A;  3KXW A;  2JMP A;  4LFC C;  3T1H C;  3DAY A;  3IML A;  3IPL A;  2D27 A;  4L7I A;  3ETC A;  5AE1 A;  1I94 C;  2P2M A;  4DUZ C;  5A1G A;  2OO4 A;  4X66 C;  1QWI A;  5FLX D;  2ATW A;  4FTF A;  4DV7 C;  4DG8 A;  2UUB C;  2P2B A;  3EQ6 A;  1ULT A;  5BUQ A;  2KZF A;  5T8T A;  1MXB A;  4MTN A;  3OTO C;  1IBM C;  5BST A;  3EER A;  3IEV A;  3PBK A;  3LGX A;  3DHV A;  4G37 A;  2WD9 A;  4BBY A;  2QW0 X;  4DR2 C;  2DPL A;  2P02 A;  4TPS B;  4OXI A;  3AF6 A;  1HNZ C;  5BSU A;  4GS5 A;  4DCV A;  1PG4 A;  5BSR A;  2QVX X;  1QM4 A;  4JV5 C;  3GKU A;  4R0M A;  1XRC A;  1USP A;  1ML8 A;  5KEI A;  4R1L A;  3ETO A;  4DCS A;  5A2Q D;  1EGA A;  1MDF A;  1O92 A;  2DYJ A;  3VNQ A;  4JI4 C;  4G36 A;  1MXC A;  4PZP A;  4FUT A;  4DUY C;  3IEU A;  3FCC A;  2E5L C;  2PT7 G;  4BCA A;  4LFB C;  3JAM D;  2WP0 C;  4K0B A;  3CW8 X;  4HPV A;  4D4G A;  3DLP X;  5BUS A;  5A1I A;  4GXQ A;  2E0G A;  2OBV A;  4U5Y D;  1IBK C;  1GPM A;  3A9U A;  2AYA A;  4IZ6 A;  1XNR C;  3I07 A;  3GR0 A;  4X65 C;  2D1R A;  2OPL A;  1FJG C;  4RM3 A;  4DV1 C;  3J80 D;  4BSZ A;  4RLQ A;  4DR7 C;  2UXD C;  1NYE A;  1ZB8 A;  4XX2 A;  5IWA C;  1J5E C;  4RVO A;  3LNV A;  2D28 C;  1MD9 A;  1K0R A;  2CY1 A;  1PG3 A;  4G1I A;  1XMQ C;  1N2F A;  2QVY X;  2VQF C;  4X64 C;  5BUR A;  1XNQ C;  4NOZ A;  4JI8 C;  4DCT A;  1XRA A;  1FUG A;  1L2F A;  4OX9 C;  5ADZ A;  4ZLP A;  4DV5 C;  2UXB C;  4ODJ A;  4K0K C;  4YY3 C;  4NXN C;  3NYQ A;  5CZV A;  4BC7 A;  5LMN C;  2VZE A;  1USP B;  5A19 A;  5AE3 A;  1LCI A;  4DR6 C;  1V26 A;  3LAX A;  4GKJ C;  3H2T A;  1N32 C;  3A4I A;  5KYV A;  4JI2 C;  3GR1 A;  2YCB A;  1KKG A;  1JOS A;  4WV3 A;  4I9G A;  4L2Z A;  5JRH A;  2P2J A;  4GKK C;  4KTV A;  1AMU A;  1PA4 A;  3R44 A;  5AE2 A;  2YWB A;  1P7L A;  3NPD A;  1YJ7 A;  5GTD A;  2P2Q A;  5K85 A;  3NYR A;  2E8F A;  4LF4 C;  4KHP C;  4LF9 C;  3B7W A;  2OPL B;  3UOW A;  3CW9 A;  3L8C A;  1BA3 A;  3PES A;  4RLF A;  4I9F A;  2VSQ A;  3AF5 A;  2PN2 A;  4PHT A;  2HHH C;  1UKK A;  4L4Q A;  3T1Y C;  3UZ0 A;  4LFA C;  2E7G A;  1MDB A;  3CJE A;  1N34 C;  2UUA C;  4LF8 C;  4B3S C;  4DV3 C;  3LUS A;  5BSW A;  2UUC C;  2BH1 X;  5E7Q A;  4DR1 C;  4WS9 A;  2BJO A;  4D56 A;  3VNR A;  3R9X A;  4JI7 C;  3N54 B;  1V25 A;  4JI5 C;  2ONF A;  4DG9 A;  2F4V C;  4JI6 C;  2QVZ X;  3A9V A;  2PRO A;  4EAT A;  1RG9 A;  5BSM A;  3PRO C;  4YHH C;  2ZM6 C;  1VLA A;  3GPC A;  4ISB A;  2Y4N A;  4DV6 C;  1O90 A;  2CXC A;  4DR5 C;  4DV2 C;  4PRO C;  2UU9 C;  3VNS A;  5BSV A;  1T5H X;  1WH9 A;  4DV0 C;  4LE5 A;  3N2Q A;  3RG2 A;  1T5D X;  4AQY C;  1IBL C;  2P2F A;  4R1M A;  2Y27 A;  1HH2 P;  4LF5 C;  4NXM C;  5IFI A;  4ZJZ A;  3E7W A;  1HR0 C;  1LQL A;  3I08 A;  5KYT A;  2VQE C;  2Y4O A;  4RVN A;  3C5E A;  3NI2 A;  5H9U A;  3E7X A;  4JM1 A;  2V7B A;  1N36 C;  1WF3 A;  2YWC A;  4IR7 A;  1HNW C;  4LF7 C;  1O93 A;  4X62 C;  4B3R C;  2D1Q A;  4RM2 A;  2UXC C;  5LMU C;  2ASB A;  4KTT A;  4RMN A;  3TQI A;  5IT9 D;  3RV2 A;  4BC9 A;  2XR1 A;  3TUF A;  1MXA A;  3L95 X;  4JI3 C;  2EGT A;  5BR8 C;  1ZB9 A;  4JI0 C;  3FCE A;  3G7S A;  1HNX C;  1XRB A;  5T8S A;  5DV9 A;  4MH4 A;  4D4I A;  4DR3 C;  1RY2 A;  4JI1 C;  4B3T C;  4FUQ A;  2E8C A;  4OYC A;  2D1S A;  4NDN A;  4LF6 C;  2E8E A;  1MKY A;  1XMO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...