2E8EA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 (reduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Aq_1549
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8eA00
1WF3A 1HH2P 3CJEA 4OX9C 4K0KC 1N32C 2UUAC 4B3MC 4JI2C 2PN2A 1IBKC 1USPB 4DR6C 4DV2C 2UUCC 2CXCA 5IWAC 2PT7G 5LMNC 4LF8C 4X66C 3EERA 4DCTA 4DV0C 4X64C 3T1YC 4JYAC 2CY1A 3IEVA 4X62C 2UUBC 3J81D 3AF5A 1IBLC 2E8CA 5LMUC 5A2QD 1FJGC 4LFAC 1KKGA 4JI7C 2JMPA 2BJOA 4AQYC 2UXDC 4LF7C 1N34C 3R9WA 4DV1C 1JOSA 2OPLA 4DR3C 1K0RA 1N2FA 1ZB9A 4GKJC 1ML8A 4DV7C 2DYJA 4KHPC 3IEUA 1EGAA 2ATWA 4GKKC 2E5LC 4NOZA 4LF4C 1NYEA 1HR0C 4DUYC 4LF9C 4JI6C 1J5EC 2EGTA 4DR4C 4DV4C 1HNXC 4DCUA 1USPA 3GKUA 2UU9C 2VQFC 2E7GA 4DUZC 1IBMC 4DR7C 5FLXD 2E8EA 4JI4C 1LQLA 4B3TC 4B3SC 4DV3C 3JAMD 1UKKA 2ASBA 2YCBA 4JI1C 4LF6C 4NXNC 3I07A 1MKYA 2XR1A 2UXCC 1PA4A 3OTOC 4JI0C 1N33C 2UXBC 3T1HC 5BR8C 2D7VA 4LF5C 1QWIA 4JI8C 2HJGA 1XNQC 4JI5C 4DR2C 1HNWC 1N36C 1WH9A 3AF6A 2QL8A 4YY3C 2ZM6C 1ZB8A 1VLAA 4BSZA 1HNZC 3J80D 4MH4A 4B3RC 2E8FA 3R9XA 4DR5C 4DV6C 3LUSA 2KZFA 2OPLB 2HHHC 1XMOC 4DCSA 4DV5C 4LFCC 1XMQC 1L2FA 5IT9D 4NXMC 4LFBC 1I94C 4JI3C 4MTNA 4JV5C 4DR1C 4X65C 2F4VC 2VQEC 4DCVA 4YHHC 4XX2A 1XNRC 2ONFA
chains in the Genus database with same CATH superfamily
1HH2P 3CJEA 2P2FA 4OX9C 2UUAC 1FUGA 4B3MC 1QM4A 2UUCC 2CXCA 5IWAC 4DG9A 3UOWA 4PUIA 2V7BA 3N2QA 4LF8C 3IMLA 4RMNA 1NY8A 4X64C 4JYAC 1V26A 4IZ6A 4NDNA 3FCCA 5A2QD 1KKGA 2JMPA 4LF7C 1N34C 3A9VA 5BSMA 2VSQA 2Y27A 1MXCA 5BURA 2MCQA 1MDBA 4RVNA 1GPMA 1EGAA 3TR3A 1HR0C 3O2EA 2QVYX 2D1QA 3GR1A 3GKUA 3PROC 2ZZMA 4DUZC 4DR7C 2E8EA 1BA3A 1MD9A 3UX3A 1V25A 2Z51A 3VNRA 2QVXX 3ETOA 4RLFA 4NXNC 4LF6C 3G7SA 5A1IA 1MKYA 2UXCC 3UZ0A 4BBYA 5GTDA 4JI0C 2E0GA 1VEHA 1N33C 2UXBC 1XS3A 4PZPA 1QWIA 4LF5C 1O90A 1XNQC 4JI5C 2VZEA 1HNWC 1N36C 2QL8A 5BUQA 1ZB8A 1VLAA 3NYQA 4EATA 3KXWA 2E8FA 1MDFA 1O93A 1XMQC 1AMUA 2Y4OA 2BH1X 4JV5C 2F4VC 2VQEC 1XNRC 2OO4A 3LNVA 1N32C 3I08A 3PBKA 4BC7A 3FCEA 4ZJZA 2QW0X 5LMNC 5K8FA 5A19A 4DV0C 2CY1A 4GXRA 3IEVA 3J81D 3AF5A 5BSWA 4RLQA 4LFAC 3DHVA 4JI7C 3VNSA 1JOSA 2OPLA 4DR3C 3CW9A 4GKJC 3K6RA 5A1GA 1ML8A 4DV7C 2ZZNA 4LE5A 2DYJA 4RVOA 3TUFA 1O92A 3IEUA 2ATWA 2YWBA 4G1IA 3A26A 3H2TA 4LF9C 5CZVA 2P20A 3AY0A 4GXQA 3CW8X 2P02A 1USPA 3NPDA 2UU9C 2VQFC 2E7GA 5CZXA 2KDNA 3E7WA 1LQLA 5AE2A 5KYTA 4B3SC 3JAMD 3B7WA 3LAXA 5E7QA 5BSRA 2QVZX 2DHMA 3I07A 4D57A 4ISBA 4L2ZA 1PG4A 3GPCA 3A9UA 3OTOC 2D27A 4ZLPA 3T1HC 1V60A 2DPLA 2D1TA 4DR2C 3TQIA 4BCAA 4L7IA 4PHTA 5BSUA 2ZM6C 2M5HA 1HNZC 4FUQA 3CQ3A 4IR7A 2M5OA 1P4EA 4RM2A 3L95X 4DV6C 4ODJA 2JNVA 5AE1A 5BSVA 4PUGA 3LGXA 4LFCC 1I94C 4JI3C 4WV3A 3UX2A 3R44A 4DG8A 4DR1C 4DCVA 4YHHC 1FLOA 2KZ0A 4G36A 1YJ7A 1WF3A 4FUTA 2PN2A 1IBKC 4DR6C 4RM3A 2PT7G 2MM9A 1XRCA 3A25A 5JRHA 4R0MA 4X66C 3EERA 4FTFA 2P2QA 3T1YC 2UUBC 1IBLC 2E8CA 5LMUC 4G37A 2OBVA 3L8CA 3TDEA 2UXDC 4AQYC 1T5DX 1WCJA 4DV1C 3RV2A 1K0RA 4BC9A 1N2FA 1ZB9A 3UEBA 3CQ2A 4L4QA 4KHPC 3GR0A 4GKKC 5BUSA 1M6XA 1IB8A 1NYEA 4GS5A 3N54B 1J5EC 4I9GA 2EGTA 5T8SA 4DV4C 2YX1A 1IBMC 3LNOA 5FLXD 4JI4C 4B3TC 2MMAB 1P4EC 5H9UA 3EQ6A 1UKKA 1M6XC 4KTVA 4OYCA 2D1SA 3NI2A 5T8TA 4R1LA 2D7VA 2WP0C 1XHJA 4JI8C 1O9TA 1WH9A 3AF6A 4YY3C 2CU6A 4HPVA 3SO4A 4BSZA 1LCIA 4MH4A 4B3RC 3R9XA 4DR5C 2OPLB 2HHHC 2WD9A 1XMOC 4D56A 4DCSA 1T5HX 4TPSB 3S82A 1L2FA 4LFBC 4NXMC 2Y4NA 4MTNA 5AE3A 2D28C 5IFIA 4XX2A 2NCLA 4K0BA 5DV9A 2D1RA 5KEIA 4K0KC 4JI2C 1USPB 5LCIA 4DV2C 1MXAA 3PESA 4DCTA 4PUHA 4X62C 1PG3A 1PU1A 1FJGC 4D4GA 2BJOA 5KYVA 3R9WA 4I9FA 1MXBA 1UWDA 4JM1A 3DAYA 3E7XA 2P2MA 2E5LC 3IPLA 4NOZA 4R1MA 1XRAA 4LF4C 5K85A 4DUYC 3ETCA 1RY2A 4JI6C 4D4IA 4DR4C 1HNXC 4DCUA 1XRBA 2P2JA 4DV3C 2ASBA 4PROC 3VNQA 2YCBA 2P2BA 4JI1C 2XR1A 1PA4A 3A4IA 1P7LA 5BR8C 1RG9A 2HJGA 3DLPX 3C5EA 4U5YD 5ADZA 1ULTA 3J80D 2AYAA 3LUSA 2KZFA 5BSTA 3NYRA 3CQ1A 2PROA 4DV5C 5IT9D 4OXIA 2YWCA 4WS9A 1TH5A 4X65C 3RG2A 2ONFA 4KTTA
chains in the Genus database with same CATH topology
1HH2P 3CJEA 2P2FA 4OX9C 2UUAC 1FUGA 4B3MC 1QM4A 2UUCC 2CXCA 5IWAC 4DG9A 3UOWA 2V7BA 3N2QA 4LF8C 3IMLA 4RMNA 4X64C 4JYAC 1V26A 4IZ6A 4NDNA 3FCCA 5A2QD 1KKGA 2JMPA 4LF7C 1N34C 3A9VA 5BSMA 2VSQA 2Y27A 1MXCA 5BURA 1MDBA 4RVNA 1GPMA 1EGAA 1HR0C 2QVYX 2D1QA 3GR1A 3GKUA 3PROC 4DUZC 4DR7C 2E8EA 1BA3A 1MD9A 1V25A 3VNRA 2QVXX 3ETOA 4RLFA 4NXNC 4LF6C 3G7SA 5A1IA 1MKYA 2UXCC 3UZ0A 4BBYA 5GTDA 4JI0C 2E0GA 1N33C 2UXBC 4PZPA 4LF5C 1QWIA 1O90A 1XNQC 4JI5C 2VZEA 1HNWC 1N36C 2QL8A 5BUQA 1ZB8A 1VLAA 3NYQA 4EATA 3KXWA 2E8FA 1MDFA 1O93A 1XMQC 1AMUA 2Y4OA 2BH1X 4JV5C 2F4VC 2VQEC 1XNRC 2OO4A 3LNVA 1N32C 3I08A 3PBKA 4BC7A 3FCEA 4ZJZA 2QW0X 5LMNC 5K8FA 5A19A 4DV0C 2CY1A 4GXRA 3IEVA 3J81D 3AF5A 5BSWA 4RLQA 4LFAC 3DHVA 4JI7C 3VNSA 1JOSA 2OPLA 4DR3C 3CW9A 4GKJC 5A1GA 1ML8A 4DV7C 4LE5A 2DYJA 4RVOA 3TUFA 1O92A 3IEUA 2ATWA 2YWBA 4G1IA 3H2TA 4LF9C 5CZVA 2P20A 4GXQA 3CW8X 2P02A 1USPA 3NPDA 2UU9C 2VQFC 2E7GA 5CZXA 3E7WA 1LQLA 5AE2A 5KYTA 4B3SC 3JAMD 3B7WA 3LAXA 5E7QA 5BSRA 2QVZX 3I07A 4D57A 4ISBA 4L2ZA 1PG4A 3GPCA 3A9UA 3OTOC 2D27A 4ZLPA 3T1HC 2DPLA 2D1TA 4DR2C 3TQIA 4BCAA 4L7IA 4PHTA 5BSUA 2ZM6C 1HNZC 4FUQA 4IR7A 4RM2A 3L95X 4DV6C 4ODJA 5AE1A 5BSVA 3LGXA 4LFCC 1I94C 4JI3C 4WV3A 4DG8A 3R44A 4DR1C 4DCVA 4YHHC 4G36A 1YJ7A 1WF3A 4FUTA 2PN2A 1IBKC 4DR6C 4RM3A 2PT7G 1XRCA 5JRHA 4R0MA 4X66C 3EERA 4FTFA 2P2QA 3T1YC 2UUBC 1IBLC 2E8CA 5LMUC 4G37A 2OBVA 3L8CA 3TDEA 2UXDC 4AQYC 1T5DX 4DV1C 3RV2A 1K0RA 4BC9A 1N2FA 1ZB9A 4L4QA 4KHPC 3GR0A 4GKKC 5BUSA 1NYEA 4GS5A 3N54B 1J5EC 4I9GA 2EGTA 5T8SA 4DV4C 1IBMC 5FLXD 4JI4C 4B3TC 5H9UA 3EQ6A 1UKKA 4KTVA 4OYCA 2D1SA 3NI2A 5T8TA 4R1LA 2D7VA 2WP0C 4JI8C 1O9TA 1WH9A 3AF6A 4YY3C 4HPVA 3SO4A 4BSZA 1LCIA 4MH4A 4B3RC 3R9XA 4DR5C 2OPLB 2HHHC 2WD9A 1XMOC 4D56A 4DCSA 1T5HX 4TPSB 3S82A 1L2FA 4LFBC 4NXMC 2Y4NA 4MTNA 5AE3A 2D28C 5IFIA 4XX2A 4K0BA 5DV9A 2D1RA 5KEIA 4K0KC 4JI2C 1USPB 4DV2C 1MXAA 3PESA 4DCTA 4X62C 1PG3A 1FJGC 4D4GA 2BJOA 5KYVA 3R9WA 4I9FA 1MXBA 4JM1A 3DAYA 3E7XA 2P2MA 2E5LC 3IPLA 4NOZA 4R1MA 1XRAA 4LF4C 5K85A 4DUYC 3ETCA 1RY2A 4JI6C 4D4IA 4DR4C 1HNXC 4DCUA 1XRBA 2P2JA 4DV3C 2ASBA 4PROC 3VNQA 2YCBA 2P2BA 4JI1C 2XR1A 1PA4A 3A4IA 1P7LA 5BR8C 1RG9A 2HJGA 3DLPX 3C5EA 4U5YD 5ADZA 1ULTA 3J80D 2AYAA 3LUSA 2KZFA 5BSTA 3NYRA 2PROA 4DV5C 5IT9D 4OXIA 2YWCA 4WS9A 4X65C 3RG2A 2ONFA 4KTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WF3 A;  1HH2 P;  3CJE A;  4OX9 C;  4K0K C;  1N32 C;  2UUA C;  4B3M C;  4JI2 C;  2PN2 A;  1IBK C;  1USP B;  4DR6 C;  4DV2 C;  2UUC C;  2CXC A;  5IWA C;  2PT7 G;  5LMN C;  4LF8 C;  4X66 C;  3EER A;  4DCT A;  4DV0 C;  4X64 C;  3T1Y C;  4JYA C;  2CY1 A;  3IEV A;  4X62 C;  2UUB C;  3J81 D;  3AF5 A;  1IBL C;  2E8C A;  5LMU C;  5A2Q D;  1FJG C;  4LFA C;  1KKG A;  4JI7 C;  2JMP A;  2BJO A;  4AQY C;  2UXD C;  4LF7 C;  1N34 C;  3R9W A;  4DV1 C;  1JOS A;  2OPL A;  4DR3 C;  1K0R A;  1N2F A;  1ZB9 A;  4GKJ C;  1ML8 A;  4DV7 C;  2DYJ A;  4KHP C;  3IEU A;  1EGA A;  2ATW A;  4GKK C;  2E5L C;  4NOZ A;  4LF4 C;  1NYE A;  1HR0 C;  4DUY C;  4LF9 C;  4JI6 C;  1J5E C;  2EGT A;  4DR4 C;  4DV4 C;  1HNX C;  4DCU A;  1USP A;  3GKU A;  2UU9 C;  2VQF C;  2E7G A;  4DUZ C;  1IBM C;  4DR7 C;  5FLX D;  2E8E A;  4JI4 C;  1LQL A;  4B3T C;  4B3S C;  4DV3 C;  3JAM D;  1UKK A;  2ASB A;  2YCB A;  4JI1 C;  4LF6 C;  4NXN C;  3I07 A;  1MKY A;  2XR1 A;  2UXC C;  1PA4 A;  3OTO C;  4JI0 C;  1N33 C;  2UXB C;  3T1H C;  5BR8 C;  2D7V A;  4LF5 C;  1QWI A;  4JI8 C;  2HJG A;  1XNQ C;  4JI5 C;  4DR2 C;  1HNW C;  1N36 C;  1WH9 A;  3AF6 A;  2QL8 A;  4YY3 C;  2ZM6 C;  1ZB8 A;  1VLA A;  4BSZ A;  1HNZ C;  3J80 D;  4MH4 A;  4B3R C;  2E8F A;  3R9X A;  4DR5 C;  4DV6 C;  3LUS A;  2KZF A;  2OPL B;  2HHH C;  1XMO C;  4DCS A;  4DV5 C;  4LFC C;  1XMQ C;  1L2F A;  5IT9 D;  4NXM C;  4LFB C;  1I94 C;  4JI3 C;  4MTN A;  4JV5 C;  4DR1 C;  4X65 C;  2F4V C;  2VQE C;  4DCV A;  4YHH C;  4XX2 A;  1XNR C;  2ONF A; 
#chains in the Genus database with same CATH topology
 1HH2 P;  3CJE A;  2P2F A;  4OX9 C;  2UUA C;  1FUG A;  4B3M C;  1QM4 A;  2UUC C;  2CXC A;  5IWA C;  4DG9 A;  3UOW A;  4PUI A;  2V7B A;  3N2Q A;  4LF8 C;  3IML A;  4RMN A;  1NY8 A;  4X64 C;  4JYA C;  1V26 A;  4IZ6 A;  4NDN A;  3FCC A;  5A2Q D;  1KKG A;  2JMP A;  4LF7 C;  1N34 C;  3A9V A;  5BSM A;  2VSQ A;  2Y27 A;  1MXC A;  5BUR A;  2MCQ A;  1MDB A;  4RVN A;  1GPM A;  1EGA A;  3TR3 A;  1HR0 C;  3O2E A;  2QVY X;  2D1Q A;  3GR1 A;  3GKU A;  3PRO C;  2ZZM A;  4DUZ C;  4DR7 C;  2E8E A;  1BA3 A;  1MD9 A;  3UX3 A;  1V25 A;  2Z51 A;  3VNR A;  2QVX X;  3ETO A;  4RLF A;  4NXN C;  4LF6 C;  3G7S A;  5A1I A;  1MKY A;  2UXC C;  3UZ0 A;  4BBY A;  5GTD A;  4JI0 C;  2E0G A;  1VEH A;  1N33 C;  2UXB C;  1XS3 A;  4PZP A;  1QWI A;  4LF5 C;  1O90 A;  1XNQ C;  4JI5 C;  2VZE A;  1HNW C;  1N36 C;  2QL8 A;  5BUQ A;  1ZB8 A;  1VLA A;  3NYQ A;  4EAT A;  3KXW A;  2E8F A;  1MDF A;  1O93 A;  1XMQ C;  1AMU A;  2Y4O A;  2BH1 X;  4JV5 C;  2F4V C;  2VQE C;  1XNR C;  2OO4 A;  3LNV A;  1N32 C;  3I08 A;  3PBK A;  4BC7 A;  3FCE A;  4ZJZ A;  2QW0 X;  5LMN C;  5K8F A;  5A19 A;  4DV0 C;  2CY1 A;  4GXR A;  3IEV A;  3J81 D;  3AF5 A;  5BSW A;  4RLQ A;  4LFA C;  3DHV A;  4JI7 C;  3VNS A;  1JOS A;  2OPL A;  4DR3 C;  3CW9 A;  4GKJ C;  3K6R A;  5A1G A;  1ML8 A;  4DV7 C;  2ZZN A;  4LE5 A;  2DYJ A;  4RVO A;  3TUF A;  1O92 A;  3IEU A;  2ATW A;  2YWB A;  4G1I A;  3A26 A;  3H2T A;  4LF9 C;  5CZV A;  2P20 A;  3AY0 A;  4GXQ A;  3CW8 X;  2P02 A;  1USP A;  3NPD A;  2UU9 C;  2VQF C;  2E7G A;  5CZX A;  2KDN A;  3E7W A;  1LQL A;  5AE2 A;  5KYT A;  4B3S C;  3JAM D;  3B7W A;  3LAX A;  5E7Q A;  5BSR A;  2QVZ X;  2DHM A;  3I07 A;  4D57 A;  4ISB A;  4L2Z A;  1PG4 A;  3GPC A;  3A9U A;  3OTO C;  2D27 A;  4ZLP A;  3T1H C;  1V60 A;  2DPL A;  2D1T A;  4DR2 C;  3TQI A;  4BCA A;  4L7I A;  4PHT A;  5BSU A;  2ZM6 C;  2M5H A;  1HNZ C;  4FUQ A;  3CQ3 A;  4IR7 A;  2M5O A;  1P4E A;  4RM2 A;  3L95 X;  4DV6 C;  4ODJ A;  2JNV A;  5AE1 A;  5BSV A;  4PUG A;  3LGX A;  4LFC C;  1I94 C;  4JI3 C;  4WV3 A;  3UX2 A;  3R44 A;  4DG8 A;  4DR1 C;  4DCV A;  4YHH C;  1FLO A;  2KZ0 A;  4G36 A;  1YJ7 A;  1WF3 A;  4FUT A;  2PN2 A;  1IBK C;  4DR6 C;  4RM3 A;  2PT7 G;  2MM9 A;  1XRC A;  3A25 A;  5JRH A;  4R0M A;  4X66 C;  3EER A;  4FTF A;  2P2Q A;  3T1Y C;  2UUB C;  1IBL C;  2E8C A;  5LMU C;  4G37 A;  2OBV A;  3L8C A;  3TDE A;  2UXD C;  4AQY C;  1T5D X;  1WCJ A;  4DV1 C;  3RV2 A;  1K0R A;  4BC9 A;  1N2F A;  1ZB9 A;  3UEB A;  3CQ2 A;  4L4Q A;  4KHP C;  3GR0 A;  4GKK C;  5BUS A;  1M6X A;  1IB8 A;  1NYE A;  4GS5 A;  3N54 B;  1J5E C;  4I9G A;  2EGT A;  5T8S A;  4DV4 C;  2YX1 A;  1IBM C;  3LNO A;  5FLX D;  4JI4 C;  4B3T C;  2MMA B;  1P4E C;  5H9U A;  3EQ6 A;  1UKK A;  1M6X C;  4KTV A;  4OYC A;  2D1S A;  3NI2 A;  5T8T A;  4R1L A;  2D7V A;  2WP0 C;  1XHJ A;  4JI8 C;  1O9T A;  1WH9 A;  3AF6 A;  4YY3 C;  2CU6 A;  4HPV A;  3SO4 A;  4BSZ A;  1LCI A;  4MH4 A;  4B3R C;  3R9X A;  4DR5 C;  2OPL B;  2HHH C;  2WD9 A;  1XMO C;  4D56 A;  4DCS A;  1T5H X;  4TPS B;  3S82 A;  1L2F A;  4LFB C;  4NXM C;  2Y4N A;  4MTN A;  5AE3 A;  2D28 C;  5IFI A;  4XX2 A;  2NCL A;  4K0B A;  5DV9 A;  2D1R A;  5KEI A;  4K0K C;  4JI2 C;  1USP B;  5LCI A;  4DV2 C;  1MXA A;  3PES A;  4DCT A;  4PUH A;  4X62 C;  1PG3 A;  1PU1 A;  1FJG C;  4D4G A;  2BJO A;  5KYV A;  3R9W A;  4I9F A;  1MXB A;  1UWD A;  4JM1 A;  3DAY A;  3E7X A;  2P2M A;  2E5L C;  3IPL A;  4NOZ A;  4R1M A;  1XRA A;  4LF4 C;  5K85 A;  4DUY C;  3ETC A;  1RY2 A;  4JI6 C;  4D4I A;  4DR4 C;  1HNX C;  4DCU A;  1XRB A;  2P2J A;  4DV3 C;  2ASB A;  4PRO C;  3VNQ A;  2YCB A;  2P2B A;  4JI1 C;  2XR1 A;  1PA4 A;  3A4I A;  1P7L A;  5BR8 C;  1RG9 A;  2HJG A;  3DLP X;  3C5E A;  4U5Y D;  5ADZ A;  1ULT A;  3J80 D;  2AYA A;  3LUS A;  2KZF A;  5BST A;  3NYR A;  3CQ1 A;  2PRO A;  4DV5 C;  5IT9 D;  4OXI A;  2YWC A;  4WS9 A;  1TH5 A;  4X65 C;  3RG2 A;  2ONF A;  4KTT A; 
#chains in the Genus database with same CATH homology
 1HH2 P;  3CJE A;  2P2F A;  4OX9 C;  2UUA C;  1FUG A;  4B3M C;  1QM4 A;  2UUC C;  2CXC A;  5IWA C;  4DG9 A;  3UOW A;  2V7B A;  3N2Q A;  4LF8 C;  3IML A;  4RMN A;  4X64 C;  4JYA C;  1V26 A;  4IZ6 A;  4NDN A;  3FCC A;  5A2Q D;  1KKG A;  2JMP A;  4LF7 C;  1N34 C;  3A9V A;  5BSM A;  2VSQ A;  2Y27 A;  1MXC A;  5BUR A;  1MDB A;  4RVN A;  1GPM A;  1EGA A;  1HR0 C;  2QVY X;  2D1Q A;  3GR1 A;  3GKU A;  3PRO C;  4DUZ C;  4DR7 C;  2E8E A;  1BA3 A;  1MD9 A;  1V25 A;  3VNR A;  2QVX X;  3ETO A;  4RLF A;  4NXN C;  4LF6 C;  3G7S A;  5A1I A;  1MKY A;  2UXC C;  3UZ0 A;  4BBY A;  5GTD A;  4JI0 C;  2E0G A;  1N33 C;  2UXB C;  4PZP A;  4LF5 C;  1QWI A;  1O90 A;  1XNQ C;  4JI5 C;  2VZE A;  1HNW C;  1N36 C;  2QL8 A;  5BUQ A;  1ZB8 A;  1VLA A;  3NYQ A;  4EAT A;  3KXW A;  2E8F A;  1MDF A;  1O93 A;  1XMQ C;  1AMU A;  2Y4O A;  2BH1 X;  4JV5 C;  2F4V C;  2VQE C;  1XNR C;  2OO4 A;  3LNV A;  1N32 C;  3I08 A;  3PBK A;  4BC7 A;  3FCE A;  4ZJZ A;  2QW0 X;  5LMN C;  5K8F A;  5A19 A;  4DV0 C;  2CY1 A;  4GXR A;  3IEV A;  3J81 D;  3AF5 A;  5BSW A;  4RLQ A;  4LFA C;  3DHV A;  4JI7 C;  3VNS A;  1JOS A;  2OPL A;  4DR3 C;  3CW9 A;  4GKJ C;  5A1G A;  1ML8 A;  4DV7 C;  4LE5 A;  2DYJ A;  4RVO A;  3TUF A;  1O92 A;  3IEU A;  2ATW A;  2YWB A;  4G1I A;  3H2T A;  4LF9 C;  5CZV A;  2P20 A;  4GXQ A;  3CW8 X;  2P02 A;  1USP A;  3NPD A;  2UU9 C;  2VQF C;  2E7G A;  5CZX A;  3E7W A;  1LQL A;  5AE2 A;  5KYT A;  4B3S C;  3JAM D;  3B7W A;  3LAX A;  5E7Q A;  5BSR A;  2QVZ X;  3I07 A;  4D57 A;  4ISB A;  4L2Z A;  1PG4 A;  3GPC A;  3A9U A;  3OTO C;  2D27 A;  4ZLP A;  3T1H C;  2DPL A;  2D1T A;  4DR2 C;  3TQI A;  4BCA A;  4L7I A;  4PHT A;  5BSU A;  2ZM6 C;  1HNZ C;  4FUQ A;  4IR7 A;  4RM2 A;  3L95 X;  4DV6 C;  4ODJ A;  5AE1 A;  5BSV A;  3LGX A;  4LFC C;  1I94 C;  4JI3 C;  4WV3 A;  4DG8 A;  3R44 A;  4DR1 C;  4DCV A;  4YHH C;  4G36 A;  1YJ7 A;  1WF3 A;  4FUT A;  2PN2 A;  1IBK C;  4DR6 C;  4RM3 A;  2PT7 G;  1XRC A;  5JRH A;  4R0M A;  4X66 C;  3EER A;  4FTF A;  2P2Q A;  3T1Y C;  2UUB C;  1IBL C;  2E8C A;  5LMU C;  4G37 A;  2OBV A;  3L8C A;  3TDE A;  2UXD C;  4AQY C;  1T5D X;  4DV1 C;  3RV2 A;  1K0R A;  4BC9 A;  1N2F A;  1ZB9 A;  4L4Q A;  4KHP C;  3GR0 A;  4GKK C;  5BUS A;  1NYE A;  4GS5 A;  3N54 B;  1J5E C;  4I9G A;  2EGT A;  5T8S A;  4DV4 C;  1IBM C;  5FLX D;  4JI4 C;  4B3T C;  5H9U A;  3EQ6 A;  1UKK A;  4KTV A;  4OYC A;  2D1S A;  3NI2 A;  5T8T A;  4R1L A;  2D7V A;  2WP0 C;  4JI8 C;  1O9T A;  1WH9 A;  3AF6 A;  4YY3 C;  4HPV A;  3SO4 A;  4BSZ A;  1LCI A;  4MH4 A;  4B3R C;  3R9X A;  4DR5 C;  2OPL B;  2HHH C;  2WD9 A;  1XMO C;  4D56 A;  4DCS A;  1T5H X;  4TPS B;  3S82 A;  1L2F A;  4LFB C;  4NXM C;  2Y4N A;  4MTN A;  5AE3 A;  2D28 C;  5IFI A;  4XX2 A;  4K0B A;  5DV9 A;  2D1R A;  5KEI A;  4K0K C;  4JI2 C;  1USP B;  4DV2 C;  1MXA A;  3PES A;  4DCT A;  4X62 C;  1PG3 A;  1FJG C;  4D4G A;  2BJO A;  5KYV A;  3R9W A;  4I9F A;  1MXB A;  4JM1 A;  3DAY A;  3E7X A;  2P2M A;  2E5L C;  3IPL A;  4NOZ A;  4R1M A;  1XRA A;  4LF4 C;  5K85 A;  4DUY C;  3ETC A;  1RY2 A;  4JI6 C;  4D4I A;  4DR4 C;  1HNX C;  4DCU A;  1XRB A;  2P2J A;  4DV3 C;  2ASB A;  4PRO C;  3VNQ A;  2YCB A;  2P2B A;  4JI1 C;  2XR1 A;  1PA4 A;  3A4I A;  1P7L A;  5BR8 C;  1RG9 A;  2HJG A;  3DLP X;  3C5E A;  4U5Y D;  5ADZ A;  1ULT A;  3J80 D;  2AYA A;  3LUS A;  2KZF A;  5BST A;  3NYR A;  2PRO A;  4DV5 C;  5IT9 D;  4OXI A;  2YWC A;  4WS9 A;  4X65 C;  3RG2 A;  2ONF A;  4KTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...