2E8EA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 (reduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Aq_1549
publication title Crystal Structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8eA00
5LMNC 4LFBC 2D7VA 2YCBA 3CJEA 2E8FA 2HJGA 4DV0C 4DCTA 4DV2C 1XMQC 1N36C 4X62C 3EERA 4K0KC 1NYEA 4MTNA 4OX9C 2UXCC 1N33C 3J80D 1XMOC 2VQFC 3R9XA 2XR1A 4JYAC 4JI0C 4LF8C 1HNXC 4GKJC 1UKKA 2KZFA 4X64C 4JI2C 2UUBC 4B3SC 2ONFA 2DYJA 4LF7C 4JI8C 1HR0C 1IBMC 4DR7C 1WF3A 4XX2A 4JV5C 4AQYC 1ZB9A 4YY3C 2UU9C 3J81D 4LF5C 2E7GA 2ZM6C 4DR1C 2EGTA 4DR6C 1HH2P 1N34C 3I07A 1HNZC 2E5LC 4DR5C 4DR3C 4NXMC 2PN2A 1KKGA 4X65C 4JI6C 4DV3C 4B3MC 4JI4C 1ML8A 3AF6A 1VLAA 4LFCC 4KHPC 3LUSA 4LF6C 2VQEC 4DUYC 4DUZC 2UUCC 4B3RC 3GKUA 5A2QD 1IBKC 2E8CA 4X66C 1MKYA 1XNRC 2OPLA 3AF5A 4BSZA 4NOZA 4DV5C 3OTOC 3T1HC 1I94C 1XNQC 1QWIA 4JI5C 2OPLB 1USPA 4DV4C 1PA4A 1USPB 5IT9D 2UUAC 5LMUC 4DV1C 2UXDC 3IEUA 4B3TC 1WH9A 4DCSA 3T1YC 4JI1C 2F4VC 1HNWC 4DV6C 3IEVA 4JI3C 3R9WA 2E8EA 4YHHC 2BJOA 2CXCA 2ATWA 5IWAC 4LFAC 1J5EC 4LF4C 1N2FA 1EGAA 1ZB8A 2QL8A 2ASBA 4DR4C 1N32C 5BR8C 2JMPA 4GKKC 4DCUA 4DV7C 4NXNC 1K0RA 4JI7C 2HHHC 5FLXD 1LQLA 4MH4A 1IBLC 1FJGC 3JAMD 2CY1A 1JOSA 4DR2C 2UXBC 2PT7G 4DCVA 1L2FA 4LF9C
chains in the Genus database with same CATH superfamily
3NYQA 5LMNC 5A1IA 4PHTA 5BSTA 4KTTA 4K0KC 4K0BA 4MTNA 4RM3A 4BBYA 1XMOC 1PU1A 2P2JA 3A9UA 4ODJA 3R9XA 3UX2A 4LF8C 1HNXC 4GKJC 4U5YD 5BSRA 2D1TA 4G1IA 1UWDA 4GXRA 1MD9A 2MM9A 1MXAA 1AMUA 4DG8A 2P2MA 3A9VA 4AQYC 1ZB9A 5CZVA 2UU9C 3J81D 3NYRA 4FUQA 2D1SA 4GXQA 3PESA 4DR6C 5LCIA 1HH2P 4L7IA 1P7LA 1KKGA 5ADZA 4DV3C 5AE3A 4B3MC 2M5OA 2WD9A 4ZJZA 4KHPC 3LNVA 2BH1X 2QVXX 3L95X 2VQEC 4DUYC 3NI2A 3GKUA 3AY0A 2E8CA 1QM4A 4X66C 1MKYA 2V7BA 4PUGA 4I9GA 3N2QA 2OPLA 4BSZA 1I94C 4NOZA 3OTOC 1LCIA 4JI5C 2OPLB 1USPA 1USPB 2UUAC 5LMUC 2UXDC 4DCSA 4JI1C 2F4VC 3CW8X 3R9WA 2E8EA 1O92A 2BJOA 2CXCA 1V26A 3LAXA 4TPSB 3TDEA 3VNQA 1EGAA 1ZB8A 4DR4C 4D4GA 4G37A 5T8SA 2OO4A 3NPDA 4R0MA 2Y4OA 4IR7A 4OXIA 2CU6A 4DR2C 3GPCA 4RVOA 2Y4NA 4LF9C 5BUSA 3FCCA 1T5DX 2D7VA 2P2BA 2WP0C 3C5EA 4X62C 1YJ7A 2E0GA 3PBKA 2VSQA 4R1MA 1N33C 4PZPA 4FUTA 4D57A 4ZLPA 1UKKA 4KTVA 4X64C 3IPLA 2ONFA 4PUHA 3EQ6A 4RLQA 4YY3C 1XS3A 4LF5C 2E7GA 5BSUA 3A4IA 2M5HA 2D1QA 4I9FA 4JM1A 5BURA 4JI6C 4BC7A 1V60A 3AF6A 1VLAA 4LFCC 2D27A 3VNSA 2UUCC 4B3RC 2YWBA 3ETCA 1XNRC 3T1HC 3UEBA 4DV4C 1O90A 1XRAA 3CQ3A 1PA4A 3LGXA 5IT9D 4DV1C 2P02A 5E7QA 4YHHC 4GS5A 4R1LA 4LFAC 1J5EC 1VEHA 3TUFA 2QL8A 4PUIA 5BSWA 3O2EA 2MCQA 4NXNC 1K0RA 1T5HX 4L4QA 2HHHC 1XRBA 4FTFA 3UOWA 1IBLC 5T8TA 3JAMD 1JOSA 4RM2A 3L8CA 5DV9A 3G7SA 4DCVA 5BSMA 1MDBA 1L2FA 4LFBC 2D1RA 2AYAA 5K8FA 2YCBA 3KXWA 1FLOA 2HJGA 4DCTA 5KEIA 4DV2C 1N36C 3EERA 1NYEA 1P4EA 3K6RA 3E7WA 3UX3A 4JYAC 2XR1A 1XHJA 2Y27A 4NDNA 2KZFA 1P4EC 4JI2C 2DYJA 4JI8C 1HR0C 4DR7C 3CQ2A 2DHMA 3RG2A 2NCLA 2QVZX 4JV5C 2MMAB 1MXCA 2ZM6C 4DR1C 1N34C 1HNZC 5AE2A 1XRCA 4NXMC 2PN2A 1V25A 4X65C 3GR0A 4RLFA 3UZ0A 1ML8A 2OBVA 2P2QA 3LUSA 2Z51A 4RVNA 4DUZC 5JRHA 3AF5A 1XNQC 1QWIA 3PROC 3GR1A 2P2FA 2YX1A 2D28C 3LNOA 2KDNA 4IZ6A 1RY2A 4WS9A 4DG9A 4JI3C 4LE5A 1TH5A 3SO4A 1M6XA 3IMLA 3E7XA 2ASBA 3R44A 3CW9A 2JMPA 2YWCA 5GTDA 4JI7C 3H2TA 3VNRA 4WV3A 5FLXD 5A19A 3I08A 1FJGC 1M6XC 5IFIA 4RMNA 3RV2A 3B7WA 2ZZNA 3CJEA 2E8FA 4DV0C 1XMQC 4OX9C 2UXCC 2KZ0A 4D4IA 3J80D 2VQFC 3DLPX 1NY8A 4JI0C 5K85A 4BCAA 2UUBC 2QW0X 1PG4A 4B3SC 4LF7C 1IBMC 1ULTA 1WF3A 4XX2A 5H9UA 4L2ZA 1O9TA 4BC9A 3S82A 2EGTA 5A1GA 1MDFA 3I07A 5AE1A 2E5LC 4DR5C 2PROA 3ETOA 2DPLA 4OYCA 5KYTA 4DR3C 1FUGA 4HPVA 2P20A 3A25A 3FCEA 4JI4C 4LF6C 1GPMA 4PROC 5A2QD 1IBKC 1O93A 1MXBA 3TR3A 4DV5C 2JNVA 3A26A 3IEUA 4B3TC 1WH9A 3DAYA 3T1YC 1HNWC 4DV6C 1WCJA 3IEVA 2ZZMA 4ISBA 5BUQA 2VZEA 4G36A 2ATWA 5IWAC 3TQIA 4LF4C 4D56A 3DHVA 1N2FA 1N32C 5BR8C 4GKKC 4DCUA 4DV7C 1RG9A 1BA3A 4EATA 1IB8A 3N54B 2QVYX 1LQLA 4MH4A 5BSVA 5KYVA 3CQ1A 5CZXA 2CY1A 2UXBC 2PT7G 1PG3A
chains in the Genus database with same CATH topology
3NYQA 5LMNC 5A1IA 4PHTA 5BSTA 4KTTA 4K0KC 4K0BA 4MTNA 4RM3A 4BBYA 1XMOC 2P2JA 3A9UA 4ODJA 3R9XA 4LF8C 1HNXC 4GKJC 4U5YD 5BSRA 2D1TA 4G1IA 4GXRA 1MD9A 1MXAA 1AMUA 4DG8A 2P2MA 3A9VA 4AQYC 1ZB9A 5CZVA 2UU9C 3J81D 3NYRA 4FUQA 2D1SA 4GXQA 3PESA 4DR6C 1HH2P 4L7IA 1P7LA 1KKGA 5ADZA 4DV3C 5AE3A 4B3MC 2WD9A 4ZJZA 4KHPC 3LNVA 2BH1X 2QVXX 3L95X 2VQEC 4DUYC 3NI2A 3GKUA 2E8CA 1QM4A 4X66C 1MKYA 2V7BA 4I9GA 3N2QA 2OPLA 4BSZA 1I94C 4NOZA 3OTOC 1LCIA 4JI5C 2OPLB 1USPA 1USPB 2UUAC 5LMUC 2UXDC 4DCSA 4JI1C 2F4VC 3CW8X 3R9WA 2E8EA 1O92A 2BJOA 2CXCA 1V26A 3LAXA 4TPSB 3TDEA 3VNQA 1EGAA 1ZB8A 4DR4C 4D4GA 4G37A 5T8SA 2OO4A 3NPDA 4R0MA 2Y4OA 4IR7A 4OXIA 4DR2C 3GPCA 4RVOA 2Y4NA 4LF9C 5BUSA 3FCCA 1T5DX 2D7VA 2P2BA 2WP0C 3C5EA 4X62C 1YJ7A 2E0GA 3PBKA 2VSQA 4R1MA 1N33C 4PZPA 4FUTA 4D57A 4ZLPA 1UKKA 4KTVA 4X64C 3IPLA 2ONFA 3EQ6A 4RLQA 4YY3C 4LF5C 2E7GA 5BSUA 3A4IA 2D1QA 4I9FA 4JM1A 5BURA 4JI6C 4BC7A 3AF6A 1VLAA 4LFCC 2D27A 3VNSA 2UUCC 4B3RC 2YWBA 3ETCA 1XNRC 3T1HC 4DV4C 1O90A 1XRAA 1PA4A 3LGXA 5IT9D 4DV1C 2P02A 5E7QA 4YHHC 4GS5A 4R1LA 4LFAC 1J5EC 3TUFA 2QL8A 5BSWA 4NXNC 1K0RA 1T5HX 4L4QA 2HHHC 1XRBA 4FTFA 3UOWA 1IBLC 5T8TA 3JAMD 1JOSA 4RM2A 3L8CA 5DV9A 3G7SA 4DCVA 5BSMA 1MDBA 1L2FA 4LFBC 2D1RA 2AYAA 5K8FA 2YCBA 3KXWA 2HJGA 4DCTA 5KEIA 4DV2C 1N36C 3EERA 1NYEA 3E7WA 4JYAC 2XR1A 2Y27A 4NDNA 2KZFA 4JI2C 2DYJA 4JI8C 1HR0C 4DR7C 3RG2A 2QVZX 4JV5C 1MXCA 2ZM6C 4DR1C 1N34C 1HNZC 5AE2A 1XRCA 4NXMC 2PN2A 1V25A 4X65C 3GR0A 4RLFA 3UZ0A 1ML8A 2OBVA 2P2QA 3LUSA 4RVNA 4DUZC 5JRHA 3AF5A 1XNQC 1QWIA 3PROC 3GR1A 2P2FA 2D28C 4IZ6A 1RY2A 4WS9A 4DG9A 4JI3C 4LE5A 3SO4A 3IMLA 3E7XA 2ASBA 3R44A 3CW9A 2JMPA 2YWCA 5GTDA 4JI7C 3H2TA 3VNRA 4WV3A 5FLXD 5A19A 3I08A 1FJGC 5IFIA 4RMNA 3RV2A 3B7WA 3CJEA 2E8FA 4DV0C 1XMQC 4OX9C 2UXCC 4D4IA 3J80D 2VQFC 3DLPX 4JI0C 5K85A 4BCAA 2UUBC 2QW0X 1PG4A 4B3SC 4LF7C 1IBMC 1ULTA 1WF3A 4XX2A 5H9UA 4L2ZA 1O9TA 4BC9A 3S82A 2EGTA 5A1GA 1MDFA 3I07A 5AE1A 2E5LC 4DR5C 2PROA 3ETOA 2DPLA 4OYCA 5KYTA 4DR3C 1FUGA 4HPVA 2P20A 3FCEA 4JI4C 4LF6C 1GPMA 4PROC 5A2QD 1IBKC 1O93A 1MXBA 4DV5C 3IEUA 4B3TC 1WH9A 3DAYA 3T1YC 1HNWC 4DV6C 3IEVA 4ISBA 5BUQA 2VZEA 4G36A 2ATWA 5IWAC 3TQIA 4LF4C 4D56A 3DHVA 1N2FA 1N32C 5BR8C 4GKKC 4DCUA 4DV7C 1RG9A 1BA3A 4EATA 3N54B 2QVYX 1LQLA 4MH4A 5BSVA 5KYVA 5CZXA 2CY1A 2UXBC 2PT7G 1PG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN C;  4LFB C;  2D7V A;  2YCB A;  3CJE A;  2E8F A;  2HJG A;  4DV0 C;  4DCT A;  4DV2 C;  1XMQ C;  1N36 C;  4X62 C;  3EER A;  4K0K C;  1NYE A;  4MTN A;  4OX9 C;  2UXC C;  1N33 C;  3J80 D;  1XMO C;  2VQF C;  3R9X A;  2XR1 A;  4JYA C;  4JI0 C;  4LF8 C;  1HNX C;  4GKJ C;  1UKK A;  2KZF A;  4X64 C;  4JI2 C;  2UUB C;  4B3S C;  2ONF A;  2DYJ A;  4LF7 C;  4JI8 C;  1HR0 C;  1IBM C;  4DR7 C;  1WF3 A;  4XX2 A;  4JV5 C;  4AQY C;  1ZB9 A;  4YY3 C;  2UU9 C;  3J81 D;  4LF5 C;  2E7G A;  2ZM6 C;  4DR1 C;  2EGT A;  4DR6 C;  1HH2 P;  1N34 C;  3I07 A;  1HNZ C;  2E5L C;  4DR5 C;  4DR3 C;  4NXM C;  2PN2 A;  1KKG A;  4X65 C;  4JI6 C;  4DV3 C;  4B3M C;  4JI4 C;  1ML8 A;  3AF6 A;  1VLA A;  4LFC C;  4KHP C;  3LUS A;  4LF6 C;  2VQE C;  4DUY C;  4DUZ C;  2UUC C;  4B3R C;  3GKU A;  5A2Q D;  1IBK C;  2E8C A;  4X66 C;  1MKY A;  1XNR C;  2OPL A;  3AF5 A;  4BSZ A;  4NOZ A;  4DV5 C;  3OTO C;  3T1H C;  1I94 C;  1XNQ C;  1QWI A;  4JI5 C;  2OPL B;  1USP A;  4DV4 C;  1PA4 A;  1USP B;  5IT9 D;  2UUA C;  5LMU C;  4DV1 C;  2UXD C;  3IEU A;  4B3T C;  1WH9 A;  4DCS A;  3T1Y C;  4JI1 C;  2F4V C;  1HNW C;  4DV6 C;  3IEV A;  4JI3 C;  3R9W A;  2E8E A;  4YHH C;  2BJO A;  2CXC A;  2ATW A;  5IWA C;  4LFA C;  1J5E C;  4LF4 C;  1N2F A;  1EGA A;  1ZB8 A;  2QL8 A;  2ASB A;  4DR4 C;  1N32 C;  5BR8 C;  2JMP A;  4GKK C;  4DCU A;  4DV7 C;  4NXN C;  1K0R A;  4JI7 C;  2HHH C;  5FLX D;  1LQL A;  4MH4 A;  1IBL C;  1FJG C;  3JAM D;  2CY1 A;  1JOS A;  4DR2 C;  2UXB C;  2PT7 G;  4DCV A;  1L2F A;  4LF9 C; 
#chains in the Genus database with same CATH topology
 3NYQ A;  5LMN C;  5A1I A;  4PHT A;  5BST A;  4KTT A;  4K0K C;  4K0B A;  4MTN A;  4RM3 A;  4BBY A;  1XMO C;  1PU1 A;  2P2J A;  3A9U A;  4ODJ A;  3R9X A;  3UX2 A;  4LF8 C;  1HNX C;  4GKJ C;  4U5Y D;  5BSR A;  2D1T A;  4G1I A;  1UWD A;  4GXR A;  1MD9 A;  2MM9 A;  1MXA A;  1AMU A;  4DG8 A;  2P2M A;  3A9V A;  4AQY C;  1ZB9 A;  5CZV A;  2UU9 C;  3J81 D;  3NYR A;  4FUQ A;  2D1S A;  4GXQ A;  3PES A;  4DR6 C;  5LCI A;  1HH2 P;  4L7I A;  1P7L A;  1KKG A;  5ADZ A;  4DV3 C;  5AE3 A;  4B3M C;  2M5O A;  2WD9 A;  4ZJZ A;  4KHP C;  3LNV A;  2BH1 X;  2QVX X;  3L95 X;  2VQE C;  4DUY C;  3NI2 A;  3GKU A;  3AY0 A;  2E8C A;  1QM4 A;  4X66 C;  1MKY A;  2V7B A;  4PUG A;  4I9G A;  3N2Q A;  2OPL A;  4BSZ A;  1I94 C;  4NOZ A;  3OTO C;  1LCI A;  4JI5 C;  2OPL B;  1USP A;  1USP B;  2UUA C;  5LMU C;  2UXD C;  4DCS A;  4JI1 C;  2F4V C;  3CW8 X;  3R9W A;  2E8E A;  1O92 A;  2BJO A;  2CXC A;  1V26 A;  3LAX A;  4TPS B;  3TDE A;  3VNQ A;  1EGA A;  1ZB8 A;  4DR4 C;  4D4G A;  4G37 A;  5T8S A;  2OO4 A;  3NPD A;  4R0M A;  2Y4O A;  4IR7 A;  4OXI A;  2CU6 A;  4DR2 C;  3GPC A;  4RVO A;  2Y4N A;  4LF9 C;  5BUS A;  3FCC A;  1T5D X;  2D7V A;  2P2B A;  2WP0 C;  3C5E A;  4X62 C;  1YJ7 A;  2E0G A;  3PBK A;  2VSQ A;  4R1M A;  1N33 C;  4PZP A;  4FUT A;  4D57 A;  4ZLP A;  1UKK A;  4KTV A;  4X64 C;  3IPL A;  2ONF A;  4PUH A;  3EQ6 A;  4RLQ A;  4YY3 C;  1XS3 A;  4LF5 C;  2E7G A;  5BSU A;  3A4I A;  2M5H A;  2D1Q A;  4I9F A;  4JM1 A;  5BUR A;  4JI6 C;  4BC7 A;  1V60 A;  3AF6 A;  1VLA A;  4LFC C;  2D27 A;  3VNS A;  2UUC C;  4B3R C;  2YWB A;  3ETC A;  1XNR C;  3T1H C;  3UEB A;  4DV4 C;  1O90 A;  1XRA A;  3CQ3 A;  1PA4 A;  3LGX A;  5IT9 D;  4DV1 C;  2P02 A;  5E7Q A;  4YHH C;  4GS5 A;  4R1L A;  4LFA C;  1J5E C;  1VEH A;  3TUF A;  2QL8 A;  4PUI A;  5BSW A;  3O2E A;  2MCQ A;  4NXN C;  1K0R A;  1T5H X;  4L4Q A;  2HHH C;  1XRB A;  4FTF A;  3UOW A;  1IBL C;  5T8T A;  3JAM D;  1JOS A;  4RM2 A;  3L8C A;  5DV9 A;  3G7S A;  4DCV A;  5BSM A;  1MDB A;  1L2F A;  4LFB C;  2D1R A;  2AYA A;  5K8F A;  2YCB A;  3KXW A;  1FLO A;  2HJG A;  4DCT A;  5KEI A;  4DV2 C;  1N36 C;  3EER A;  1NYE A;  1P4E A;  3K6R A;  3E7W A;  3UX3 A;  4JYA C;  2XR1 A;  1XHJ A;  2Y27 A;  4NDN A;  2KZF A;  1P4E C;  4JI2 C;  2DYJ A;  4JI8 C;  1HR0 C;  4DR7 C;  3CQ2 A;  2DHM A;  3RG2 A;  2NCL A;  2QVZ X;  4JV5 C;  2MMA B;  1MXC A;  2ZM6 C;  4DR1 C;  1N34 C;  1HNZ C;  5AE2 A;  1XRC A;  4NXM C;  2PN2 A;  1V25 A;  4X65 C;  3GR0 A;  4RLF A;  3UZ0 A;  1ML8 A;  2OBV A;  2P2Q A;  3LUS A;  2Z51 A;  4RVN A;  4DUZ C;  5JRH A;  3AF5 A;  1XNQ C;  1QWI A;  3PRO C;  3GR1 A;  2P2F A;  2YX1 A;  2D28 C;  3LNO A;  2KDN A;  4IZ6 A;  1RY2 A;  4WS9 A;  4DG9 A;  4JI3 C;  4LE5 A;  1TH5 A;  3SO4 A;  1M6X A;  3IML A;  3E7X A;  2ASB A;  3R44 A;  3CW9 A;  2JMP A;  2YWC A;  5GTD A;  4JI7 C;  3H2T A;  3VNR A;  4WV3 A;  5FLX D;  5A19 A;  3I08 A;  1FJG C;  1M6X C;  5IFI A;  4RMN A;  3RV2 A;  3B7W A;  2ZZN A;  3CJE A;  2E8F A;  4DV0 C;  1XMQ C;  4OX9 C;  2UXC C;  2KZ0 A;  4D4I A;  3J80 D;  2VQF C;  3DLP X;  1NY8 A;  4JI0 C;  5K85 A;  4BCA A;  2UUB C;  2QW0 X;  1PG4 A;  4B3S C;  4LF7 C;  1IBM C;  1ULT A;  1WF3 A;  4XX2 A;  5H9U A;  4L2Z A;  1O9T A;  4BC9 A;  3S82 A;  2EGT A;  5A1G A;  1MDF A;  3I07 A;  5AE1 A;  2E5L C;  4DR5 C;  2PRO A;  3ETO A;  2DPL A;  4OYC A;  5KYT A;  4DR3 C;  1FUG A;  4HPV A;  2P20 A;  3A25 A;  3FCE A;  4JI4 C;  4LF6 C;  1GPM A;  4PRO C;  5A2Q D;  1IBK C;  1O93 A;  1MXB A;  3TR3 A;  4DV5 C;  2JNV A;  3A26 A;  3IEU A;  4B3T C;  1WH9 A;  3DAY A;  3T1Y C;  1HNW C;  4DV6 C;  1WCJ A;  3IEV A;  2ZZM A;  4ISB A;  5BUQ A;  2VZE A;  4G36 A;  2ATW A;  5IWA C;  3TQI A;  4LF4 C;  4D56 A;  3DHV A;  1N2F A;  1N32 C;  5BR8 C;  4GKK C;  4DCU A;  4DV7 C;  1RG9 A;  1BA3 A;  4EAT A;  1IB8 A;  3N54 B;  2QVY X;  1LQL A;  4MH4 A;  5BSV A;  5KYV A;  3CQ1 A;  5CZX A;  2CY1 A;  2UXB C;  2PT7 G;  1PG3 A; 
#chains in the Genus database with same CATH homology
 3NYQ A;  5LMN C;  5A1I A;  4PHT A;  5BST A;  4KTT A;  4K0K C;  4K0B A;  4MTN A;  4RM3 A;  4BBY A;  1XMO C;  2P2J A;  3A9U A;  4ODJ A;  3R9X A;  4LF8 C;  1HNX C;  4GKJ C;  4U5Y D;  5BSR A;  2D1T A;  4G1I A;  4GXR A;  1MD9 A;  1MXA A;  1AMU A;  4DG8 A;  2P2M A;  3A9V A;  4AQY C;  1ZB9 A;  5CZV A;  2UU9 C;  3J81 D;  3NYR A;  4FUQ A;  2D1S A;  4GXQ A;  3PES A;  4DR6 C;  1HH2 P;  4L7I A;  1P7L A;  1KKG A;  5ADZ A;  4DV3 C;  5AE3 A;  4B3M C;  2WD9 A;  4ZJZ A;  4KHP C;  3LNV A;  2BH1 X;  2QVX X;  3L95 X;  2VQE C;  4DUY C;  3NI2 A;  3GKU A;  2E8C A;  1QM4 A;  4X66 C;  1MKY A;  2V7B A;  4I9G A;  3N2Q A;  2OPL A;  4BSZ A;  1I94 C;  4NOZ A;  3OTO C;  1LCI A;  4JI5 C;  2OPL B;  1USP A;  1USP B;  2UUA C;  5LMU C;  2UXD C;  4DCS A;  4JI1 C;  2F4V C;  3CW8 X;  3R9W A;  2E8E A;  1O92 A;  2BJO A;  2CXC A;  1V26 A;  3LAX A;  4TPS B;  3TDE A;  3VNQ A;  1EGA A;  1ZB8 A;  4DR4 C;  4D4G A;  4G37 A;  5T8S A;  2OO4 A;  3NPD A;  4R0M A;  2Y4O A;  4IR7 A;  4OXI A;  4DR2 C;  3GPC A;  4RVO A;  2Y4N A;  4LF9 C;  5BUS A;  3FCC A;  1T5D X;  2D7V A;  2P2B A;  2WP0 C;  3C5E A;  4X62 C;  1YJ7 A;  2E0G A;  3PBK A;  2VSQ A;  4R1M A;  1N33 C;  4PZP A;  4FUT A;  4D57 A;  4ZLP A;  1UKK A;  4KTV A;  4X64 C;  3IPL A;  2ONF A;  3EQ6 A;  4RLQ A;  4YY3 C;  4LF5 C;  2E7G A;  5BSU A;  3A4I A;  2D1Q A;  4I9F A;  4JM1 A;  5BUR A;  4JI6 C;  4BC7 A;  3AF6 A;  1VLA A;  4LFC C;  2D27 A;  3VNS A;  2UUC C;  4B3R C;  2YWB A;  3ETC A;  1XNR C;  3T1H C;  4DV4 C;  1O90 A;  1XRA A;  1PA4 A;  3LGX A;  5IT9 D;  4DV1 C;  2P02 A;  5E7Q A;  4YHH C;  4GS5 A;  4R1L A;  4LFA C;  1J5E C;  3TUF A;  2QL8 A;  5BSW A;  4NXN C;  1K0R A;  1T5H X;  4L4Q A;  2HHH C;  1XRB A;  4FTF A;  3UOW A;  1IBL C;  5T8T A;  3JAM D;  1JOS A;  4RM2 A;  3L8C A;  5DV9 A;  3G7S A;  4DCV A;  5BSM A;  1MDB A;  1L2F A;  4LFB C;  2D1R A;  2AYA A;  5K8F A;  2YCB A;  3KXW A;  2HJG A;  4DCT A;  5KEI A;  4DV2 C;  1N36 C;  3EER A;  1NYE A;  3E7W A;  4JYA C;  2XR1 A;  2Y27 A;  4NDN A;  2KZF A;  4JI2 C;  2DYJ A;  4JI8 C;  1HR0 C;  4DR7 C;  3RG2 A;  2QVZ X;  4JV5 C;  1MXC A;  2ZM6 C;  4DR1 C;  1N34 C;  1HNZ C;  5AE2 A;  1XRC A;  4NXM C;  2PN2 A;  1V25 A;  4X65 C;  3GR0 A;  4RLF A;  3UZ0 A;  1ML8 A;  2OBV A;  2P2Q A;  3LUS A;  4RVN A;  4DUZ C;  5JRH A;  3AF5 A;  1XNQ C;  1QWI A;  3PRO C;  3GR1 A;  2P2F A;  2D28 C;  4IZ6 A;  1RY2 A;  4WS9 A;  4DG9 A;  4JI3 C;  4LE5 A;  3SO4 A;  3IML A;  3E7X A;  2ASB A;  3R44 A;  3CW9 A;  2JMP A;  2YWC A;  5GTD A;  4JI7 C;  3H2T A;  3VNR A;  4WV3 A;  5FLX D;  5A19 A;  3I08 A;  1FJG C;  5IFI A;  4RMN A;  3RV2 A;  3B7W A;  3CJE A;  2E8F A;  4DV0 C;  1XMQ C;  4OX9 C;  2UXC C;  4D4I A;  3J80 D;  2VQF C;  3DLP X;  4JI0 C;  5K85 A;  4BCA A;  2UUB C;  2QW0 X;  1PG4 A;  4B3S C;  4LF7 C;  1IBM C;  1ULT A;  1WF3 A;  4XX2 A;  5H9U A;  4L2Z A;  1O9T A;  4BC9 A;  3S82 A;  2EGT A;  5A1G A;  1MDF A;  3I07 A;  5AE1 A;  2E5L C;  4DR5 C;  2PRO A;  3ETO A;  2DPL A;  4OYC A;  5KYT A;  4DR3 C;  1FUG A;  4HPV A;  2P20 A;  3FCE A;  4JI4 C;  4LF6 C;  1GPM A;  4PRO C;  5A2Q D;  1IBK C;  1O93 A;  1MXB A;  4DV5 C;  3IEU A;  4B3T C;  1WH9 A;  3DAY A;  3T1Y C;  1HNW C;  4DV6 C;  3IEV A;  4ISB A;  5BUQ A;  2VZE A;  4G36 A;  2ATW A;  5IWA C;  3TQI A;  4LF4 C;  4D56 A;  3DHV A;  1N2F A;  1N32 C;  5BR8 C;  4GKK C;  4DCU A;  4DV7 C;  1RG9 A;  1BA3 A;  4EAT A;  3N54 B;  2QVY X;  1LQL A;  4MH4 A;  5BSV A;  5KYV A;  5CZX A;  2CY1 A;  2UXB C;  2PT7 G;  1PG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...