3RG2A

Structure of a two-domain nrps fusion protein containing the ente adenylation domain and entb aryl-carrier protein from enterobactin biosynthesis
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
611
structure length
611
Chain Sequence
SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGRASIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Enterobactin synthase component E (entE), 2,3-dihydro-2,3-di
total genus 190
structure length 611
sequence length 611
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3rg2A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3rg2A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rg2A01
4EATA 2KORA 2CQ8A 1MD9A 1T5DX 1BA3A 3VNQA 4D56A 1VKUA 2M5RA 1DNYA 2EHSA 5KP7B 4R1MA 3T5BA 5E7QA 2AVAA 4BPGA 3PBKA 2FQ2A 3GZMA 2JU1A 4H2YC 1KLPA 4FUQA 2DNWA 4D57A 2N5IA 2D1SA 4PWVB 4CA3A 4RM2A 2AFDA 4GXRA 5KYTA 4H2WC 2MVUA 2FVAA 3CE7A 3DLPX 2KOPA 2JU2A 3ETCA 3GZLA 4U5YD 2KG9A 2KWLA 2FHSC 2GDYA 2LL8A 2ROQA 4DG9A 1DV5A 3LGXA 3O83A 2QVYX 4RVOA 2KR5A 5DV9A 2P2MA 4FUTA 3T5AA 3A9VA 3FCCA 3E53A 2KOOA 2LPKA 2Y4OA 3E7XA 3VNSA 4W8OA 4LGCA 5K8FA 3EJDA 2MY5A 2P2QA 2L22A 3A9UA 4GS5A 5BSWA 4G36A 2CG5B 5BURA 2KGCA 4OXIA 2KG8A 2Y27A 3B7WA 3R44A 2FADA 4BPHA 1MDBA 5DWVA 2LOLA 2LTEA 3GPCA 5BSTA 3O82A 1V26A 4D4HA 4DG8A 2V7BA 3EJEA 2K94A 5D6NA 3DHVA 4PXHB 5KYVA 2MD9A 2P2JA 3NYRA 1LCIA 2N6YA 2MF4A 2L4BA 3LNVA 5BSUA 1F80D 3NI2A 2GDWA 4MRTC 4R0MA 2P20A 3IERA 1ACPA 2JQ4A 4RMNA 4M46A 2XZ0D 3ITEA 1HY8A 3FCEA 4NEOA 5IFIA 4GR5A 5CZDB 5BSRA 2MR8A 1L0IA 2QNWA 3IPLA 3IVRA 5HV8A 3L8CA 3E7WA 2D1TA 3CW9A 2LMLA 1V25A 5K85A 5BUSA 2N6ZA 3NY7B 3IESA 2QVZX 4PZPA 1RY2A 2K0YA 2KOQA 4H2XC 2X2BA 3U16A 4GXQA 1AF8A 5BSVA 1MDFA 2VSQA 2L9FA 5EJDA 3RG2A 2KGDA 2L0QA 2P2BA 4OYCA 5GTDA 3WV5A 1T5HX 3EQ6A 3C5EA 2KGAA 4RLQA 5BUQA 3WVNA 3KXWA 1YJ7A 2FQ1A 3EJBA 4IR7A 1T8KA 4D4GA 1L0HA 4RM3A 2VZEA 4ZJZA 3G7SA 2MR7A 1X3OA 4RVNA 4ISBA 2WD9A 4D4IA 3LMOA 3T5CA 2N98A 2LIUA 2D1RA 2JGPA 2N50A 2KOSA 4GR4A 4E5DA 2K93A 1NQ4A 2CNRA 2FAEA 1PG4A 2P2FA 5JRHA 2MVVA 1OR5A 5KEIA 2KG6A 2FVEA 3U17A 2LKIA 2N5HA 3TSYA 2KW2A 2LIWA 1PG3A 3WV4A 3CW8X 1HQBA 2FQ0A 2K92A 3DAYA 2K2QA 2Y4NA 4HKGA 1AMUA 3IEPA 3VNRA 4IZ6A 5HVCA 2QVXX 3LAXA 4BPFA 2FVFA 2GDXA 2CGQA 2EHTA 5KP6B 5KP8B 2FACA 2XZ1C 4WV3A 1ULTA 3O84A 4RLFA 2KGEA 2K0XA 4R1LA 5BSMA 3NYQA 3QYAA 4G37A 2QW0X 2AF8A 2PNGA 2AFEA 2D1QA 3RIXA
chains in the Genus database with same CATH superfamily
3AR5A 1KGDA 1LF0A 4FIDA 4HXEB 5F4ZA 4C0AC 1MXFA 2VQFB 1BA3A 1IPEA 3K6JA 3P0FA 4NJMB 4KDFA 2JJ2A 1GXGA 2PJDA 1E18A 2VI5A 3HY3A 5E38A 5AJVB 4ND6A 2QYHA 3BCSA 4DUGD 1M54A 2W5UA 1VCIA 3HWX1 2VHZA 3W9BA 1EG2A 4MWZA 3BMOA 5BQ3A 2XXAA 4K3UA 1FNMA 4YA6A 4DAOA 3DVSX 2M6SA 4LZWA 4KVFA 4WIAA 1FJHA 5BS1A 3HCWA 5L4LA 2WW8A 1A9XA 2R6DA 2IDZA 1WCIB 3AWIA 3C5HA 1NRIA 2JMPA 4I9GA 2V0NA 3CCJP 3GFBA 3KUUA 1L5GB 4ZYWA 3CU5A 3H19A 3NRCA 4A23A 2PZMA 3DWGA 4FCCA 1X8JA 2IHZA 3C43A 3ZVKA 1JYFA 5BN4B 2R86A 3CIFA 3IR7A 2IYLD 4HO1X 4Q1VA 1KEKA 5U4XA 1NNSA 1SBNE 1GSOA 1C41A 2PTHA 4URFA 2WYIA 1DXHA 2WU4A 2X5OA 5G1OA 2Y6UA 5FADA 1UBTS 1T1GA 4HPWA 1GITA 1GQYA 3H5RA 2BH2A 4RMGA 1OOEA 3CPSA 2GETA 1I7LA 1RAIA 2C4HA 1NT4A 3SZGA 1KDTA 1VHQA 3BCHA 1YHYA 4BEVA 3L1UA 2PT9A 2VAXA 4KI7A 5F1OA 1A7AA 1ZLYA 3PESA 1H6DA 4K6CA 5IF9A 3HDVA 4CRWB 3U44B 2K87A 1EQ2A 2P2JA 2H4WA 1EDZA 1VGRA 2H9AA 5ALIA 4M7WA 4CNQA 5A2QA 3DBVO 2Q3LA 3CJRA 2Q3JA 3HJHA 3G59A 2ODWA 2Y77A 2ZWAA 2N1MA 3I4CA 3VPDA 4RACA 1LQ2A 2H48A 4U5XA 1UMCA 4YRBA 2FSIA 3KXPA 3GYBA 1ZNWA 3MJTA 4TLCA 5AVVA 4H77A 1ZBDA 3BHMA 4YVFA 1PGOA 1S2NA 3R5TA 3RVPA 3VAAA 1CRWG 2RHDA 4RA6B 3AILA 1VHWA 2QX6A 1RI4A 2X5XA 2NXEA 2FPIB 1G8HA 4M7PA 1GDHA 3G2KA 2LMLA 3DOIA 5EJMA 4Y3UA 1HX7A 4O4LA 5ELLA 5HW0A 4RFSA 2FZWA 1A9RA 1LBIA 3GAZA 3LYHA 1Y3AA 1EE9A 2PXHA 3UC9A 1XVUA 4RTKA 1HO3A 3QFHA 1DAFA 4NJMA 3OPYA 2VJOA 3BIOA 2XDYA 4P7GA 3W8EA 1YJBA 1H8ED 3KT6A 1FDVA 2R6GA 1M34B 1XRMA 1X7XB 3B70A 3AR8A 4KK3A 4EJSA 1U2QA 3E3LA 1TMYA 3KL4A 3ONVA 1WQ4A 3GLHA 3T94A 3DOCA 4BZZA 2XITA 1B6SA 4WKGA 5DE3A 1PJ8A 4MMYB 3OIUA 5HS4A 1LZKA 4NG5A 2V7VA 1CY8A 5EXPA 1T8RA 1VZ3A 3U7JA 2PPLA 1KKGA 4BE4A 4KOEC 3QX9A 2FSGA 5DGIA 5FPQA 5JDIC 1MJGM 2ZE5A 5KBYA 1UDRA 4KUHA 2WKQA 3KTDA 5JAIA 2OGSA 4X92A 4E4RA 1DRUA 3W9SA 3HP7A 3F2VA 2P8JA 3I04A 4J6EA 1IVYA 1USIA 3CD6P 2OB2A 3NIWA 1DQSA 2O2JA 3A05A 5K45A 1PS9A 2CNKA 3IV6A 4RKEA 3KR9A 3EIQA 4RJKA 5FOXA 4C2UA 3ZVMA 2DVMA 3JQ6A 3UGKA 3IAM6 2EWVA 4P5EA 4TQAA 3VR6A 2IJGX 2VG8A 1QIKA 3CBGA 3DV2A 3Q7PA 4D0SA 5TX7A 3ZLBA 2GXSA 1TC1A 4W1QA 1L5OA 1VPDA 2DFPA 3TPFA 3J81k 2BSQA 2B1RA 1HKUA 3OD5A 5JD6A 2BFWA 2Q0HA 2GCEA 3NEYA 4FX2A 1DLJA 1S02A 3WQSB 2O57A 3F7NA 2CE2X 1I14A 1EM8A 121PA 4LXIA 1RJ9B 3L18A 1O1YA 3LXXA 1X19A 3B13B 3JQRA 5EGNA 3U4CA 3V2GA 1Z5ZA 3KELA 4B47A 4BGUA 3A70A 3IT0A 2O6HA 2R8RA 2J0UB 3H2KA 2KG9A 2XQJA 4ND2A 3R8FA 3O4VA 2RI1A 2BGKA 1RQNA 4PQYA 4EY4A 3HVKA 3AHEA 5DHFA 5GVRA 3K8ZA 4OIFA 3V8VA 1JT9A 1WZUA 1OE0A 4BL5A 4QQFA 3VRLC 4DLUA 4UOZA 2DYJA 1FVXA 1L1EA 3BKXA 1MG5A 4JXXA 1PUXA 4HQKA 4L16A 2EKLA 5G53C 1LDEA 4R8LA 4DXHA 1IN4A 4UJ5A 4WKNA 5E1OA 3G8DA 4GX1A 2J3JA 3DYBA 2OUIA 1SK9A 3OTIA 1RWOA 1A88A 3EVGA 3FTEA 2M1XA 3PLNA 3QSGA 4J2HA 1SZDA 1TU4A 4UE6A 3KQOA 4GX2A 3UBMA 1I1OA 3DXYA 4QQKA 3WYDA 2JKZA 1RXEA 2NZXA 3PC8C 4C03A 3RK4A 4DG8A 3F7OA 3KOZA 4O2AB 5LXTB 2P2ZA 2HZBA 1N3BA 5K99A 2GKOA 5B7PA 3T5PA 2EBHX 1ESZA 1EFLA 4U02A 4TS9A 3H2HA 1G20A 1UKBA 1VG1A 3EAQA 3KKLA 2ZLBA 3ON5A 3RW9A 1YZHA 2GCGA 4QJ3A 4DV2B 4MRTC 1LNQA 4XCXA 4EJSB 3ABQB 3PT9A 1JXOA 1T2NA 3UX2A 1YZGA 3KDAA 3LKBA 1MNAA 4PSDA 1LJUA 1X7WB 2ZSIA 4IV0A 2VAMA 2FEKA 1GZSA 1O0SA 1RLTA 2CFTA 3OC6A 4OBXA 3FMPB 4Z2AA 2GZIA 1U1GA 4Q1EA 1CJSA 1ZMRA 2C04A 3QU2A 1R4MB 2G40A 3WLRA 1ISFA 2XYVA 5FI0B 3ETLA 3FZEA 4KO2S 4O4LB 1WZNA 1EU1A 2CCGA 2XCSB 4G1FA 2FHSA 3VI4B 5KUTA 3V4LA 1ID8A 1TPZA 4B3RC 2MINB 3AETB 2Z2ZA 3H9CA 1C7EA 2ZQ5A 1A0OA 1CQPA 4F2HA 4BNWA 5FHRA 3ROFA 4EECA 1SJ9A 3FY4A 4UCFA 1MW8X 5H4HA 1WBDA 2XGJA 3UNXA 4E5VA 2AG8A 1RBYA 1PHPA 2VZEA 4BWYA 2CFRA 4JJEA 3ZN2A 5EERA 2WQ7A 1LC0A 2HBQA 2JGKA 2WU1A 3DTVB 4XYGA 3PXAA 3RWOA 3SM3A 2ZIWB 2EFEB 3I92A 2YNMD 3O1JC 2QPAA 3OWHA 4LJAA 1AM4D 4NESA 2M6KA 3R3YA 3I5XA 5DX8A 1V0JA 1NN3A 3BRSA 4EQZA 2GK4A 3FKSD 3M9XA 2JO0A 2JPDA 2EJVA 3KV1A 3QI2A 2XYRA 1BHSA 1XS3A 3NX4A 4IUBS 2Q2VA 3AVOA 3ICPA 1SBQA 5HFAA 3SYRA 1BDHA 4TLLB 3AP1A 5EHNA 4L95C 4DMCA 3DS8A 2G7MC 5CJJA 1CFZA 4L0CA 621PA 5JPDA 4IUYA 3O8QA 4MYRA 1VGQA 4Q7MB 2X9NA 1JQKA 3ZHVA 1L5NA 3QWIA 1JN0A 2UXDC 2XMSA 1UXHA 2X4IA 2CMHA 2NUAB 4JA2A 1Y8QA 5G40A 1ZVJA 3I56P 5LVAA 2VJKA 4IXDA 2X9QA 3TNFA 1L8LA 1J99A 3B5EA 4UHPB 4BC7A 3FDZB 4I55B 3ZLVA 2JI8A 3WY9A 2OCKA 4V0SA 1E7MA 1PJSA 1DJOA 2IPMA 4F9EA 1Q7RA 4MJ7A 1XRAA 3HADA 3AQ4A 2VHXA 3Q12A 1OB5A 1CY2A 1AE1A 2Y99A 5CTJA 4UUAA 4Z4FA 2R62A 2IEDA 1EOQA 1E2HA 3RFCA 5F3RA 4MDFA 4E2WA 4M1YA 1HK7A 4U3JA 1WE2A 7ABPA 3I5AA 5D85A 3O3MB 5JE8A 2A4MA 5CX1B 2J3KA 3H84A 3T8YA 3FX2A 3P52A 1XD8A 3JZMA 4J1TC 3OX2A 3TKYA 5IK2D 4O2BA 4J3JA 3BRQA 3P9CA 2QTTA 2XUFA 2VQFC 3PC4A 1V8BA 2AHRA 4DYHA 2CG5B 5IKEA 3SCZA 2HMSA 2O06A 3OQVA 3F3KA 2Z83A 1JDJA 3BGWA 1U9YA 3CIOA 3QLVA 4XLTA 1SH7A 3KVNA 4EB3A 1T9DA 1LFDB 2FFBA 2PQ0A 2XDQA 2IPNA 3EEQA 2WM9B 3K0AA 4S0XA 1F0YA 3WKAA 5A06A 5KWIA 4EG4A 2OMEA 1TJ5A 2ZT8A 4H2DA 1CR2A 2Y3IA 2I6TA 4HDSB 2HO4A 4M89A 4P7JA 3W05A 3LNVA 2C9CA 4TZKA 5TB5A 1DL5A 1DHRA 3U4IA 5L40A 2QG9A 1GADO 1BAJA 4DTIA 1B0ZA 5EZ6B 1KY5A 4E4YA 1IOVA 1TM4E 3AV3A 3WK9A 4IDQA 2ZRIA 3PF9A 4MZXA 4TTVA 1A5ZA 4EYQA 4LZLA 2W2LA 1IXSB 2IYNA 3CONA 4IDGA 3WLQA 4DCPA 2QQGA 1OXXK 2CNDA 2FPIA 2JGAA 2RB4A 3GLFB 2ISSD 3WWEA 2VIIA 3IULA 4E70A 1YR7A 2I6QA 4JM1A 4BYGA 4EPXA 2VDWB 4JOSA 1ODLA 1GAJA 2QL9A 1EK1A 2RKWA 2OECA 1OLSA 3WV5A 1A5BB 2XUDA 2XRFA 5LA6A 3WJ2A 1V8ZA 1C0EA 4IP0A 1M0TA 3ZY6A 3WLAA 4OGWA 4LNUB 4QT4A 3QFSA 3BUSA 4ER6A 1OASA 1OFVA 2WIAA 1NURA 1T36B 4Q9NA 1L4GA 4HQ0A 4XUEA 1KAMA 2VRNA 2XMRA 3C5VA 5EZYB 5LZ2A 5CVVA 1NLMA 3IIKA 3IDAA 5HR5A 4AD8A 4D44A 3EPHA 4GR4A 1QU3A 1BJRE 1OI3A 2XQVA 1XQ6A 3ZHZA 1YZ3A 4GQIA 2V1XA 2W6OA 4JX9A 3SNKA 1HRKA 4M88A 5HPYB 2HBYA 3AB8A 4FJ2A 2P9BA 3TBHA 2IXGA 5IJ9A 4XUGB 3QSYA 2QT9A 1KA9H 3EVBA 1UBCA 1ZWKA 3LUKA 1Z33A 1NULA 1V7QA 4JEIA 4WDQA 3HBJA 4ZT3A 4CLDA 4EW2A 3DE7X 1YE5A 4TLEA 5GIOE 1O9TA 3D81A 3L5KA 2BMEA 1DAOA 2V0CA 2HCFA 2OG1A 4V0MA 1RHQA 5BV0A 1ODIA 1NNLA 1B8VA 1JU9A 1WEHA 1Y6ZA 3AUUA 2G9QA 3G0CA 1CIJA 4D92A 1FZTA 2MINA 3M1MA 4UCQA 3MT7A 1K9MQ 2DZDA 1IK4A 3CEPB 4C7XA 1UAAA 1OCEA 2AQHA 1P3DA 2VLPA 3FZQA 4FWBA 1GPLA 3STXA 1MPTA 5HZKA 1P1KA 1H1LA 2G63A 4N6OA 5EESA 2WQZA 4CM8B 2GF0A 4CV0A 2C5AA 4M53A 3DWFA 3DL2A 1CEYA 2I7VA 4N8EA 4KR3A 4YT4A 1E5VA 2VF7A 2WYVA 4NENB 1QQ7A 2OILA 1QH1A 2RHWA 3EC2A 2QJTA 2F1KA 2XGMA 3BJIC 3UJBA 4EUKA 3VU9B 3D6AA 1AUPA 3UG6A 1X7ZB 4G26A 1TL7C 1QCYA 2O2GA 2EWMA 3QUBA 4MUGA 4MARA 4B8WA 4KNYA 4HEJA 1L9XA 3LPMA 3WIDA 2Z46A 2FRXA 3UWKA 1E58A 4FGWA 3WIVA 4CVNA 1NNUA 3CR3C 1IAQA 4TMXA 1QFXA 3K9WA 2JD1A 1MEEA 3WI7A 5JS7A 5KTPA 2VTBB 3ISVA 1E5LA 1MC5A 4JJAA 3VSBA 2ZWMA 3KVOA 4DLBA 5GGYA 2GZEA 1TE2A 2JIQA 2GZFA 4KPUB 4P31A 1FLDA 4XM1A 5CX4A 3ST7A 3L41A 3V34A 4A6PA 5G0VA 3LGSA 5E6UB 1S72P 3WK8A 3CEMA 1AS2A 3KQYA 5J5VA 3WLFA 1XLUA 4KBGA 3R7WB 5EEHA 4E31A 1SXJA 2DFDA 1ESCA 1RMTA 4WYMA 3VR2D 1DJLA 4F2PA 1QPGA 1HM5A 4IKOA 5SZHB 3FOWA 1N36C 2H11A 4JI7C 4MS4A 5DXFA 3EEYA 4PX2A 5B3AA 1MZPA 2WUDA 1N2JA 4BOYA 4B74A 1KMIY 1URPA 5CEJA 3MRVA 4AX8A 4L1KA 5JJIA 4FD2A 1N1MA 1RE0A 2IYXA 4LYDA 1MXAA 3JRNA 3C6XA 4OB8A 3UYLA 2NO5A 2GEUA 3UHFA 1YJ5A 3R7LA 5BMVB 4EDHA 3IPLA 1QU2A 1SK8A 3A0RB 3NORA 2QSJA 2YMLA 4WLEA 3VAZA 2AXPA 5I8PA 5L3SB 5JZVA 3BE4A 4X62C 3INNA 3NY7B 1BKYA 3ESQA 3Q3JB 3CMAP 2QUBA 4PO3X 5CFPA 4LC9A 1C8BA 2K0YA 1QGOA 2C2YA 1HG1A 4C22A 2F48A 3DCJA 3TXYA 3Q6NA 3RS3A 1SBYA 1OFTA 1KYZA 5HGOA 5AW9A 4IRXA 3M9WA 3C5EA 1E2EA 4BZPA 3H17A 1LX7A 4XFDA 2PX4A 3U5TA 5CB4F 2WWHA 3CB2A 5HDQA 2IZ5A 3SDZA 1GRVA 3OTQA 4Q37A 2GPBA 2Q46A 3B7GA 4XAQA 3X1JA 1VFPA 3NHLA 4ME6A 4UHHA 1FIUA 1QH0A 1E61A 4FI3C 4HZUA 3A0UA 1S0UA 3ORQA 3PJEA 2PSEA 3CVJA 5EL0A 2DFVA 5KX5A 4UM9B 2P5TB 2H7CA 2BY4A 3ED5A 4IS3A 4NJEA 3PHGA 3TZCA 2P4QA 1KR5A 5J5AA 3EA0A 3TK1A 5LWQA 2XF2A 3AESB 5KNDA 4JT4A 5CM9C 2TMDA 5AM1A 4ENTA 4M21A 3JQ9A 2QORA 4RAOA 2GSWA 4PM4A 1AZTA 2A5JA 3NANA 3NGXA 4CUKA 4MQUA 5IM4A 3AV0B 5CA1A 3BH7A 4BU1A 2FLVA 3SI7A 2DQ4A 2UUAC 2PNGA 4I3GA 3T3NA 4N5DA 3AY3A 1P7VA 3HKCA 1RLOA 1IZYA 2FSVA 1EH5A 4OGFA 3ZLTA 5KSWB 1H65A 4QOFA 4V0NA 3WICA 3THXB 1WUJS 2XB8A 4O4LF 1WZCA 2ZB2A 1TKRA 4J3FA 3PEEA 4DQKA 2EHSA 3IHWA 2Q2OA 1XPUA 5E7QA 4OBBA 5DMXA 3VBEA 2F9FA 4PIVA 5EIHA 3GCWA 4X3OA 1ZI9A 4D80A 2DNWA 2EKPA 3EJWA 4R1QA 3TD6A 3JAMD 4GUDA 4JKIA 1ZJWA 4FOPA 5HCUA 4I4TA 1N8TA 3N39C 1TADA 4FZ3A 2C5FA 1H3FA 4FSXA 4W6ZA 1N6KA 4RJJA 3ZNPA 3FLAA 2PT7G 1M1KQ 1Z5PA 2GD1O 1XV5A 4QUIA 1XD2B 1QG2A 4R0NA 4JV5B 3LGXA 5T3YA 3U80A 5C1BA 1I2MA 4OXRA 1CP2A 1JEQA 4XUDA 4BWGA 3D2AA 5L53A 1Y37A 3ZOKA 2LGJA 1NRWA 2IEAA 2PG3A 4QXAA 4W8OA 5KSPA 1BN6A 3ZDRA 1ONSA 4A6EA 3A9UA 3KWMA 2JLRA 2W6MA 5TNXA 4XPZA 4RVDA 1BE0A 1KERA 2IKQA 3IT1A 3PC3A 4HYYA 5C35A 4AMYA 2KSQA 5JECA 1S5PA 1PA4A 3A1FA 1W52X 3BEOA 1TOAA 4RTPA 3VX4A 1G8JA 2IHNA 3ET5A 3P27A 4EJMA 3HTXA 1AKRA 3TN7A 2C7BA 1BE6A 2QU8A 1TMGE 1EUDB 3D8HA 1A27A 3KKMA 2WPNA 3MTAA 4PICA 5BV7A 5JYCA 4H9GA 5CB0A 4GU5A 4N8SA 1XZMA 5D6NA 3G9QA 5EZ5A 2VJMA 5EINA 3THRA 4LS3A 4WVLA 1I13A 5DYWA 1XTTA 2DQYA 2Z6UA 1NTOA 3SDBA 1MP0A 1SPXA 3MCVA 2V3CC 3TDNA 4KPGA 2JQ4A 1RJ9A 3KYJB 4L7IA 3PRYA 2XZ0D 2I65A 4O3FA 5C8VA 3DEKA 3EWSA 4BVJA 3K5HA 3FHOA 1RT9A 2Z9CA 2G1AA 5U9CA 2IS4A 2ZRHA 1EXNA 4ZQHA 4AVYA 4RMIA 4C29A 4F56A 1C9NA 1KAEA 3UJ7A 4A27A 2GEDA 5HQJA 1CR6A 4PC2A 5KWEA 1X7HA 3LFHA 5FPYA 1NQAO 2WABA 4JL8A 2WJAA 3UXHA 2EJTA 4AJNA 3MGCA 5A03A 3Q3VA 1X38A 4HXGA 5BOSA 1QGED 1MO2A 3GT3A 4K1XA 5BR4A 3V9AA 1RM0A 5EJ7A 3B3JA 1Y7PA 5JVDF 5JIBA 1U7PA 4ZA2A 2VZ0A 3QU4A 3BF7A 2MU1A 1PDOA 2ACVA 3DHYA 3K2EA 4OK3A 4MPTA 5FA8A 1K63A 2QW1A 3ESCA 3TLMA 4MS1B 4DR1B 3ZHRA 2RKOA 3L7NA 2O7NA 4QXPA 4OAPA 4C0HA 5KX5F 3CJTA 4FD3A 1YCDA 1Z0KA 3DUWA 2PNFA 3A04A 1VE9A 1DC6A 3UKOA 3UCFA 3LBYA 4YJ3F 2IYUA 3OJXA 1KZHA 4O08A 4H3VA 3TGWA 1H2FA 3UF0A 4D26A 2VWHA 3TJMA 1TZMA 1PR2A 3M3HA 3LXUX 4HHEA 4N9WA 4IIUA 1KEZA 4KAAA 4CDMA 1XMQB 4CCYA 1AUMA 1NPTO 4ZK6A 1SU8A 4YWHA 5IM4F 2X0FA 1IVSA 3NALA 4RJTA 3U60B 3QFRA 2P27A 4N3BA 2MYUA 3WNQA 1BCRB 3WGKA 1M76A 2WILA 4IFBA 2X8LA 4YAJA 1CQJA 2V7TA 2WJZB 5BOVA 4E7PA 3I58A 4ARIA 1TTPB 1YDHA 1WXGA 2C9DA 2EF1A 4OOFA 4U0EA 4NXMB 3RIXA 3VU3A 2P41A 3GLKA 1X15A 3OLZA 4MUJA 4YDSA 3UB4A 5EE0A 1WU8A 1PRYA 4C43A 2W2MA 2WG1A 1C3VA 4KYIB 3ANSA 4RD3A 5GJCA 2ZJOA 2QJFA 1UXOA 1S9HA 3IMEA 3OX1A 2E18A 1Z15A 3O73A 2OLEA 2R11A 1KLPA 3IPAA 2H31A 4LI0A 1ECBA 4LNHA 4YQEA 1XEXB 2JFOA 4IZIA 2BFCA 4GI3A 2IOFK 3B6KA 4LZNA 2I91A 3NBKA 1JOSA 4NE7A 4NK5A 3FKSA 5E1MA 4C76A 1EHCA 4RLHA 1Q7CA 4XX1A 4DSNA 3D8NA 2QZ9A 2E49A 3QVJA 3LAWA 4FPXA 4RVOA 3ENQA 5I7UA 1XRPA 2J3DA 2PWZA 4FEGA 3A9CA 4JELA 4P4LA 3OTWA 4PZCA 3TSZA 3H4MA 4QOHA 3H1PA 1U8AA 2R87A 1B0AA 2E5LB 3L0CA 3F1LA 5DIFA 1Q84A 1TA9A 2I8LA 2WKPA 3CUKA 4Q47A 4DQUA 4Z7QB 5C53B 1B6TA 4JYMA 1CS0A 5HM6A 4TUYB 3NV9A 4WOCA 5I6DA 1F6BA 4DV7B 1II8A 2C1EA 4KP7A 4DLRA 1QM5A 4CQNA 4DV6B 1FYEA 3O21A 3R44A 1RDFA 4DILA 3VOBA 1R0YA 4Q9HA 1I94B 1FDIA 3O4RA 2H65A 3IAUA 4Q4HA 3L0PA 5JXJA 1GCAA 1I6KA 1FSFA 1UJCA 5A1JA 3ILVA 2F4VC 3B9QA 1FMCA 3A1TA 5C1PA 1XKTA 4IINA 4LHYA 5KYVA 4Q3DA 4ZYUA 4UUOA 3VTKA 3TNYA 5F9FA 1OHHA 1RXWA 1J5EB 4UEQA 3IAEA 2F3TA 5LD2C 4BO2A 4YRKA 4AMBA 2P20A 1WP9A 2AMLA 2MSDB 3OQJA 1EFRD 1L0BA 4QGBA 3TE6A 1D2HA 2FJUA 3ZQKA 5BNZA 1V60A 4D8YA 1BHQ1 1E7WA 1GZHB 1O96A 1P5JA 2RIRA 5B1HA 2ZI5A 1JQEA 3HY4A 4XGNA 5DNAA 5T4BA 1WM1A 1E7YA 1D2EA 5T57A 1BCRA 4ZYLA 3QRWA 4L78A 1F8XA 1KKUA 1NU6A 4C4RA 3IELA 1SG6A 1ZM7A 2FPUA 4RPKA 1G1MA 2P69A 4DLWA 2H0RA 1SOWA 2OD7A 1COWD 1N2CB 3C3PA 1QVRA 4LE2A 4GXQA 1HFJA 4DCVA 4TQGA 5CXUA 1G3MA 3D7LA 1QB7A 3O6VA 3SMVA 1LF5A 4O8CA 4HNTA 1MH9A 2VFAA 3CH6A 2QEXP 1BFKA 4J0CA 1QP8A 2JF0A 2PZEA 4B4UA 1QP7A 2FNAA 1N33B 1XEXA 3LX5A 5DTRA 1MAUA 1GEEA 2P02A 3LDFA 5TGZA 1E98A 3VR1A 1QE3A 1V96A 1ECPA 2YBDA 4EMUA 3D6JA 1NY6A 5C7IO 3QA9A 3CCEP 3RS9A 4OB7A 1UPBA 1ZM4A 4O2RA 2JATA 1Q22A 3CNQS 1BRMA 5KTNA 3HJFA 2PXXA 1EGAA 2ZJ8A 4FGSA 3RYIA 3GPBA 2OP1A 3LHSA 5AM0A 2QR5A 4DNPA 1SUCA 1E59A 1LBEA 4CW7A 1EDBA 1OJLA 3J80D 1QZXA 3F6RA 5FLYA 4ARSA 4ZVMA 5GADl 2ZS8A 4ARBA 5JI3E 2YZ7A 2JJ2D 4NS1A 3QENA 2IDMA 3TI9A 4LF7C 1V5GA 4KO4S 4BNTA 2ZJ0A 1KDVA 4EY3A 3HYSA 1VE1A 3R7WA 4C7BA 2MOKA 1CDDA 1EB9A 1WY5A 1NVUQ 4AKGA 2VDUE 4PLVA 3A2NA 1QNLA 4E09A 1EFHA 2JBAB 2PCJA 3QQPA 5KPJA 3HBMA 2Z51A 4COOA 1H3NA 4QE3A 5D6OA 5EKUA 3JY6A 2QTVB 1X7YB 3OI7A 3UXEA 4G0UA 4DANA 4ZQCB 4QU0A 4TRNA 3JW8A 4MITA 3K30A 5LBUA 4YJ2F 1Z2DA 3TUJC 2BELA 2NYRA 1OKKD 2R65A 3GUYA 4HG2A 3UK0A 2ZBVA 4MRMB 1SXJD 3OZ7A 1I1QB 1F2VA 4HLUA 4MRSA 5T4HA 3ZIAD 3FFWA 4DPLA 1FDTA 2QRNA 2IRWA 2ZAIA 2P62A 1ZVVA 4IRMA 2C9YA 2D59A 2B1JA 4KN6A 1UJ2A 2VYVA 3O83A 4IIVA 3VYVA 3HRKA 3ZZMA 4BATA 3I9JA 3NBFA 2VNJA 1I32A 2IWHA 5J2UF 2JIRA 4P6VF 3C4QA 2P5SA 3MINA 1ZQ1A 2OA0A 4MVJE 4Z7OB 2X7JA 4RMHA 2DERA 1Z5UA 4W99A 1Z3IX 3KQNA 2ZYAA 4ZICA 4IRUB 2EL7A 1L7DA 4H1HA 2HD4A 2YL2A 1V6AA 5AW7A 3E9RA 4OXIA 1D09A 2MSNA 1Y7IA 3GQBB 3LTEA 3DDUA 1VLHA 2E87A 3PDHA 1EFPB 3EIOA 2EL9A 3NPMA 1BDBA 1PEYA 4BMPB 4Z4HA 1FXUA 3PFIA 3OQOA 1VPVA 2I1WA 2SICE 5IAKA 3GBVA 3Q2OA 2BV3A 2ZZKA 4KB5A 5A1GA 5A05A 3GJ6A 3RV4A 3V8RA 1M90Q 3DFFA 2X4DA 3P2EA 3M1YA 3I08A 1JEJA 1K75A 1PYGA 2P77A 3IXLA 5ICEA 3AUYA 1O9HA 4J76A 3S1LA 1JDZA 1NXPA 1Y3DE 2E4ZA 2HA7A 4QREA 1KP2A 2B4RO 4OJKA 4RLSA 3ANMA 3WRVA 5BSHA 1KMHA 2O5CA 3RHSA 1W6RA 1TW3A 1WB6A 1YMVA 1BZYA 2VT2A 1IN5A 3IGFA 1YB5A 2WVGA 1PCXA 5ECGC 4OYYA 5IT9A 1F51E 1TEZA 3UCXA 1DC4A 4NZNA 3BGSA 3Q8LA 3TBFA 4DCOA 2XB9A 3SR4A 5AHWA 3B5JA 1LZLA 3KJIA 4BP9A 3JVDA 4DEVA 3U7EB 5CLFA 1SIBE 4IOKA 3KFLA 5ALPA 1JIXA 1E5TA 3QMMA 2J87A 4AUKA 2CWDA 4CKBA 2VEDA 5EUQB 4QU9A 4LN1A 4NXMC 4IPYA 5HJ5A 2BEWA 2A0KA 3M5DA 5FNVF 2OK7A 2XTAA 3NEJA 4IKPA 1IXKA 4RZ2A 4D9CA 4RV5A 4KIGA 3WGJA 5KYUB 2P9FA 3I83A 3H9EO 1JBKA 3KPUA 1V8FA 4QBGB 3I28A 4D4IA 4QGFA 3QPWA 4OHYA 4WCFB 1QLHA 2GCNA 2PX6A 1UKZA 3F6YA 1G9XA 2L42A 4F2GA 1WDTA 4IVQA 4BQSA 3M81A 3PIRA 1PW5A 1ZHFA 3UKDA 3GVXA 1V4BA 3BTUA 3FCAA 5L4NA 3HGTA 4FOTA 8AT1A 5IJ0B 2QM3A 3D8UA 5TPWA 2LWIA 4IICA 4Q48A 3LWNA 1FFSA 2X1LA 1DIOB 4BIIA 3GJ5A 2UXCC 2XBUA 3RKUA 2NACA 1RCUA 4PONA 4ER0A 1KH3A 4OL9A 1A9XB 3I6QA 3DBHB 4DYDA 4HB4A 2QTNA 2NXNA 1FVHA 2PKQO 4QULA 1BVUA 1DAHA 4H59A 4DMUB 5DTJA 5JAZA 3WFJA 1EFTA 3DQPA 2HYDA 4EATA 1FPMA 2PANA 1ZH6A 3H18A 1U6IA 3WWZA 1Y5LA 4JI6C 2NX2A 1I94C 4OM8A 4IHJF 2J7PD 4I9UA 2D6FA 4DQVA 3EDQA 5DJ5A 2WF8A 4H17A 3OE4A 2AUMA 5F2EA 2C1XA 4JGBA 1ZC3A 1UEXC 1LBTA 1ZVMA 1AH2A 1U8UA 4RXTA 3EMDA 1F4LA 2JFXA 3JALB 2NIPA 1FTGA 5BXQC 5AJYA 2VZ8A 1UIMA 4BNIA 4JQYA 1A69A 2C0PA 3SE0A 3OT1B 4J07A 1ZITA 2LE0A 1XSEA 2W93A 2PLFA 3PR1A 1Q74A 4B0OA 1N2EA 2C3YA 5E0OA 1R5JA 2XZPA 2ZOSA 3T5MA 3BBLA 3FSEA 5J4HA 1LPPA 3VNSA 3KC2A 5IBPA 4YHHB 4WNAB 3D1JA 4AY2A 1ZICA 2FJPA 3ZDBA 4O2BB 4QNMA 5KDOA 1R88A 3FCXA 2F8MA 2KZ0A 2HPAA 3OKCA 4PY2A 5K8UA 3GPLA 1DHTA 4UPEA 3GH1A 3ETNA 1Y80A 1M34A 3ETEA 3CLTC 5JAQA 2OB1A 3FCUB 3ZWVA 3L1VA 1U1DA 4QPJC 3ZU6A 1VB3A 4L5CA 4B2PA 4H0CA 2A78A 3AKCA 3UAWA 4M8LA 3CZ9A 2YWJA 2K94A 3T7KA 4MVJD 3ANYB 4H60A 1VA4A 2C3UA 4MPRA 3TNDA 1B41A 4QEKA 1JU3A 1T0UA 2G25A 2J4FA 1WCWA 1T3TA 3EGDA 3GGCA 4H3KB 1KARA 5BRAA 4NF2A 3GJQA 5AXDA 3GZJA 5HRUA 5LN1A 4R6WA 4DDWA 2R6AA 4M8SA 5FLEX 5TF4A 5HJ2A 3H8SA 4G65A 3V4ZA 3ZGLA 3L8HA 1SXQA 3IEXA 1E2UA 2D2FA 4EW6A 3PU6A 4Q15A 1T2DA 3K4HA 2FU5C 2WINI 1DCMA 1Y81A 2QL8A 1POXA 4K9LA 3HXTA 3V7YA 1MXBA 1YA4A 1N0HA 2XXBA 1Z0AA 3OJWA 4MHSA 1LI4A 4P0TA 3WLTA 3SQNA 3WLLA 4EKEA 5ALDA 5JCOC 3GJRA 3PGJA 1VMKA 5EI5A 4J0IA 2YHSA 2PYZA 1G19A 4C07A 3LPNA 4W82A 4X1YA 4EB8A 9LDBA 3T61A 2GZ2A 4RZ3A 3Q15C 1K8ZB 1T3HA 5CAEA 3RUDA 4C06A 2HXGA 1YVDA 2ZI7A 1E1QA 3GMDA 4GMKA 4DQ0A 2OKGA 1XFDA 2FPGB 1ML4A 2I55A 3CE6A 3G17A 3OSUA 4L4ZA 4W5TA 3B60A 4HAWA 1RFLA 2P2YA 4KR9A 5AMXA 2IZZA 3A3KA 4UW9A 2C2GA 1I2BA 2VJCA 4Q9IA 4AY4A 3LVRE 4LFAB 1NSFA 5IJWA 5C1DA 4DV2C 1P61B 1Z6YA 1AD2A 1FUEA 1VHNA 2QTHA 2XMCA 3AI1A 2QGZA 3AZPA 2O1WA 1WXXA 3I01A 3AESA 3ROEA 3LK6A 2GRJA 4IZ6A 3OJEA 2X3UA 2X9VA 1W93A 2YH2A 3MQFA 4PHHA 2LVBA 1IONA 3Q7QA 1XDBA 3KIPA 2YWBA 5KX5B 4B3SC 3DE2X 1N33C 1Q1QA 3QUAA 1GA1A 2H1IA 2QWXA 4HXYA 4BJHB 4B3RB 1J0XO 3LP5A 2CQ8A 1XLWA 4RS3A 5HKKA 1DKMA 4RA9B 1IBMC 2ARKA 4UULA 4ZTBA 2XIQA 3EQ8A 3PBKA 3MJFA 2Y71A 4YWJA 1YR2A 2PRYA 3G0HA 2QTFA 1KI8A 4D6YA 3TPZA 1V16B 5K5EA 1A04A 2PH3A 2XUZA 4QL3A 3FM9A 3ETCA 2X5KO 2V9PA 3DFUA 4LCBA 1ESNA 4MVXA 3H8VA 4PYIA 4V3BA 5LXTA 1W7AA 2JIZA 1WMAA 1ZESA 3AF3A 3RDPA 1WB5A 3AJEA 2D5BA 3CX3A 1GZUA 3DEYX 3DKPA 3KCNA 1NI3A 2A3NA 2C1ZA 3ZCSA 1XAGA 1X3SA 4QHYA 5DYGA 4EPYA 4P2BA 3EH1A 3L6DA 1MQ9A 2F4VB 5EMJA 2C31A 1T4CB 2WAOA 1GO2A 3H13A 4C6HA 3HXQA 2C2OA 3KLMX 4MRRA 3M82A 2QX7A 3MGAA 4OU5A 2BOVA 4JROA 5EUBA 2DLDA 2EC5A 2JAUA 2AVDA 4OQPA 2V96A 5TMDA 3O2NA 4FKMA 1R8SA 1VL5A 2ID9A 3H87A 3OPVA 3RR2A 3F8WA 5BNTA 2QUZA 3DDCA 5T5QA 1ZMBA 3IEMA 3NIGB 4D9IA 2VPXA 1KI2A 3RTBA 1GRNA 4JS0A 1ECLA 5FUBA 1UFQA 1JVNA 3A4MA 1ZOSA 4US0R 3GF4A 3K8YA 1JQ3A 3GMIA 4ZFNA 2PMWB 3NHFA 2A92A 3LKVA 4MRVA 3VPHA 2CXUA 1ZY2A 1W96A 3LF2A 3ETDA 2PNJA 3BEDA 3FOBA 2YMPA 3Q9SA 4MKRA 5FJIA 1BRTA 2BTOA 2QT1A 3HJNA 3HDTA 4X6LA 3G2JA 3BBPA 3DOHA 3P5BA 4ZCLA 3MS4A 1E4OA 3IOEA 2QNWA 2H54A 3PGVA 4YMLA 1YDEA 2V6GA 2ZB7A 2C97A 3RC3A 3TH5A 4NCKA 2TRSB 4X63A 4MUIA 3EDCA 1INLA 4EENA 3A2MA 2BN4A 1NXWA 4DWOA 1SU7A 1GT6A 1U4OA 4Y6PA 1W4ZA 5DCLA 2BZ1A 821PA 2JHCA 4F6RB 2IPXA 2UDPA 4CEHA 3U49A 1MVLA 2YZMA 4K6MA 4M0UA 3IL2A 1BFDA 1E0DA 3L6RA 1T8TA 4FP9A 5I9MA 2DLNA 3HJRA 1P2SA 1YJ7A 2ATVA 2WJYA 4X66C 3PPXA 3FN4A 1ZRHA 3IODA 3N6RA 4G4JA 1U80A 4WRRA 3HPQA 3CM0A 3DV9A 3K0HA 2P3OA 4YMIA 2XZOA 5K8TA 1UJBA 2IHVA 2JAQA 3VKUA 1DG1G 3QWBA 3THSA 5AM4A 1V6CA 2L17A 5CDHA 3CXUA 3GCGA 3THOA 4QU8A 4JT9A 5DKFA 3Q7TA 2NYUA 4K9SA 2WSYB 3GFFA 1UK6A 1JHXA 1SVLA 3KWLA 1Z2CA 4NBNA 1P3JA 2FLKA 4IBOA 5ES3A 3BIXA 2ZVPX 3NONA 2TMKA 2WF6A 3LBFA 2FE4A 1DWQA 1XHLA 4HPVA 2X2FA 4RPJA 3OUUA 1D7AA 3RHTA 2P0YA 3IDZA 3T6KA 2C2HA 2AOUB 4BPFA 1RWMA 2VYVD 4BP8A 3IE2A 1K9SA 4Q18A 4XGQA 1L6IA 4YRJA 1I80A 3T15A 1US8B 1TECE 4GNRA 2NO6A 5JJKA 3ZZNA 3AERB 2H7XA 3A4VA 4IO0A 2E6KA 1H2YA 2XUQA 2O8DA 4K26A 4YP7A 1ZGGA 2PWYA 1X8KA 2Y0EA 3QEKA 1L4EA 4FHCA 1HT2E 4QFMA 4RE6A 5EPUA 2HA6A 4KE8A 5CB4B 1HDYA 2ZK7A 1P3Y1 1L7XA 3BGVA 3ETGA 3IDQA 3PJGA 5B1DA 5KYUA 3UFXA 4M8NE 3T5BA 1HR0C 1XI2A 2TYSB 4PZDA 4V0ME 3P0RA 1TAGA 3DVAB 1A9TA 3TR0A 3NTXA 2M5OA 1A2KC 2HPZA 5EKTA 3KLPX 4X60A 1IMJA 2ZTUA 1M8KA 4C0SA 4L3WA 4YT5A 2KOPA 1J9EA 2ZYWX 4RZXA 1WMBA 1JH8A 3GFVA 3IRVA 1GTL1 1NQUA 3UB2A 4KZPA 3AKDA 1K88A 2D0DA 3I61A 3I0NA 3IDSA 2DM6A 2ODQA 3BTVA 4K88A 4EZEA 4U63A 4LGCA 5J3JA 2WKRA 6NULA 1ZHHA 1J70A 2GPSA 4MVCA 2PEMA 3LGAA 2Y0DA 1GPAA 1PJTA 1QKKA 5E4TA 3CH7A 3F71A 1G8AA 3W5IA 3WR5A 5JLAA 2HDOA 2Q7XA 1SKQA 3FFXA 4OHOA 4LYYA 4XJXA 2VZ9A 3SHTA 2QN7A 4L0QA 1CXZA 2A59A 2QMYA 1IPHA 4XLLA 2Z5GA 3BK7A 4DIBA 2PUVA 3B5IA 1USVA 2Z58A 5B4VA 2P9EA 5K3BA 2H4HA 3QPCA 4YCLA 4GYYA 3IVXA 4WY5A 2J9GA 5EC8A 2MCFA 4ZEVA 5THXA 1YIDA 2P0EA 3DMTA 3NC1C 4YUVA 4Q4CA 2DY1A 4TVSA 4Q7JB 1IBLC 2R4TA 4NAVA 4UQPA 4AMVA 5IAJA 5KYWA 3NHYA 1O54A 3KQLA 3PNQA 3REOA 1B1CA 3NATA 4C7OB 2B94A 1ZD2P 4ZAYA 4I66A 1VLMA 3A6LA 2C5GA 4CLOB 3DL0A 4DNXA 3PFNA 3OFVA 1T25A 3A7EA 1R5NA 5D01A 1EUCA 3H9GA 1ST2A 3L1KA 1XCPA 4IY1A 4N18A 5SYMA 2NZ2A 5HKKD 1Y1TA 4HC4A 5D1NA 1RWKA 5JWOA 3VZCA 3BJZA 3DOUA 2PV7A 3GO4A 4DN6A 1TLLA 5BV2P 1OXUA 2OM6A 5T8KA 5FI3A 2ZJ7A 1ULSA 3IOMA 2BC9A 1XYVA 1D4AA 2WU8A 2RGRA 4QDJA 4U9UA 1QCCA 3KXWA 1I2AA 2M1ZA 2RHBA 3AF5A 4Q1FA 5DHTA 4ZVQA 2PKXA 1QKIA 5SYAA 3PCXA 4U6SA 2PLRA 1QK4A 4Q4LA 5AP9A 1PYOA 3NYWA 3OOEA 2B78A 4HZGA 4INZA 2WTUA 1ZK3A 1TYDE 4G9BA 2D1RA 5LNK6 4UUMA 1GIAA 1ZM3A 3LP8A 2G82A 2P3LA 1V7PC 3LPLA 1OILA 1KIAA 4PUHA 5A9RA 2AYAA 1V4VA 4NY1A 2V58A 1N1GA 1Z6GA 2X6RA 3I42A 4PLZA 4A2CA 1VLVA 1U3WA 3C74A 1WUTA 4CKXA 3B7PA 1A9OA 5F77A 1UXGA 4XWTA 1G8SA 5CLLA 1GPDG 5TQ2B 1PFGA 1UZMA 2QJWA 5E6SA 5BQOA 4K9NA 1I3KA 1Z2PX 3H3FA 1PVOA 2FACA 3T9BA 2HDHA 4DR6C 4LDAA 4EHLA 1Z08A 2C78A 4KUGA 4H1WA 1K7YA 1WZEA 5EXXA 4TWZA 5C81A 5K0ZA 3L06A 4IJUA 3VKHA 4KRYA 2VXYA 3QJGA 5EKSA 4BFYA 2M8PA 2O9JA 4TSFD 1MD9A 4O6VA 4EKDA 5MF6A 1H05A 3N9IA 5I9TA 1B0UA 1VJGA 4OPMA 1XQ1A 3NHAA 3U81A 1G20E 3GNSA 1WAMA 3BXEA 4FSHA 4NCIA 1XYGA 1NJ1A 4XUCA 3DS5A 3R9WA 2QRLA 1ZB8A 1T35A 1USGA 2G8LA 4Y9RA 4H0NA 1X7XA 1GUZA 2ONKA 4NFYA 1P4RA 2OXEA 1V37A 2ESRA 4ALKA 1P0IA 2X1VA 1YU6A 4KBYA 1W88A 3RK1A 2C61A 4OK6A 3QVXA 1I6LA 3HM9A 3ZX5A 1YV9A 4FGKA 1ZCZA 3E2MA 4FDMA 3GGJA 2QRJA 4W6QA 4PRZA 5DF1A 2VBGA 4GRAA 2E3JA 4MIKA 5IW8A 5DASA 2VHUA 3TOCA 4AAYA 2FUKA 1NAHA 4Z1MD 4ZYTA 2YOFA 2VJPA 3UFBA 2QGFA 4P86A 4IFTA 5F1PA 1GCOA 2CNNA 1QNFA 1HQYE 1O5IA 2QTMA 3N86A 4EG6A 2APJA 2IYWA 4GX5A 4NBTA 4LJ5A 5HMMA 4BLVA 3P4UA 3PCTA 4OHXA 1QORA 3PF8A 2IV3A 2XADA 4B5KA 4GD3Q 3STHA 3KZKA 1B26A 1X7GA 3CF4A 4G89A 1PNVA 3K1YA 1QIGA 1L7QA 4QICA 4UFPA 1EZZA 1ZN2A 1A2OA 1TFUA 4PC6A 4X1KB 4AZWA 3NHKA 3GLIA 2YY6A 5B7QA 3U44A 4HZUB 4ZAVA 4WZ6A 5EJEA 4G5QA 3KZOA 2EG5A 1O6FA 3L7AA 3VR2A 5EMMA 1DCTA 1RYBA 1GZDA 1QUEA 2GLXA 2HPHA 4JU8A 4EH1A 4PN3A 4I5DA 3EHDA 2PMDA 4MUXA 2HMYB 2UUOA 3RTGA 1R37A 4PG5A 3RT1A 4F6RA 1RPJA 5IYZA 2LCFA 1BJTA 1UBSB 1UOEA 5I47A 3G85A 4Q02A 3OD1A 4R8KA 4K9QA 5HRAA 4YRPA 5I7SA 4OF4A 3CX8A 4ALJA 1PWHA 1A76A 4PXSA 1MVNA 6CHYA 3VISA 3DKVA 1Z5WA 1XOIA 4UNQA 2QLBA 3P9PA 4W7IA 1CP3A 1P5HA 5KTTA 1IM5A 2JJQA 4J8PA 3JATB 1ZH4A 2VRWA 3BE8A 4MS3A 4YMVA 1T4GA 2PPVA 3L84A 1FRNA 4FMDF 7MDHA 2F3PA 4PTYA 3E3NA 2ORED 1SCJA 4IVPA 5TQ2A 3WGVA 4RWEA 5CBKA 2G4VA 5BRNA 3RSGA 1LPAB 4IDCA 5IDQA 2R48A 4BO4A 4FYKA 3CPHA 2QUJA 3PC6A 2W6JD 3PV0A 1FW8A 1G8FA 2IODA 3A6HA 1WL8A 1PDWA 4RVHA 4C78A 2GJSA 2VUSA 5AVQA 1UP7A 4LISA 3AG6A 1P17A 3RODA 3FE2A 4EYGA 2B8TA 3VPBA 4KFCA 1TIBA 4FBGA 1E3WA 3OCJA 1IBMB 1UBFA 4LVNA 1RZRA 2IY7A 4U00A 4R7GA 2DH6A 2XB4A 1ULTA 1LQTA 1QC5A 4JFRA 2A57A 5F5NA 3ZE1B 3CLUC 5A6VA 2XT1A 2HREA 2FDXA 1C3JA 1JFLA 1GZ4A 2JDIA 3MB8A 3QBDA 5EJIA 3WA6A 5IH7A 3MD9A 2RH5A 3WNZA 3B2QA 4LY6A 3EQ7A 4G0VA 5AHOA 4D9FA 1P7CA 2GK6A 3VNQA 5EIWA 1L7PA 4MVWA 3ZZUA 1H0KA 4EEXA 2DPGA 3GBSA 4JI1C 1ZH8A 1EQAA 4Y9DA 4OFBA 2AX3A 5H68A 3KKZA 4WESB 3O8CA 1M1UA 1HV8A 1P7WA 4IJVA 4TXNA 5F4BA 4PWVB 4BBZA 4DIDA 2EHDA 5ALGA 3QWHA 2VPTA 1REQB 1V1MA 2YV5A 4NENA 4A8TA 5KQPA 2ZVDA 1BQEA 3P9SA 3AT1A 1JHQA 1Q15A 2JFBA 3EOZA 1QRDA 4BN5A 4BECA 5TVKA 4I1YA 4HDMB 1D2CA 3VR5D 5KREA 1U0HC 5I9NA 1JLKA 3EZ2A 4OQLA 3VR6H 1AQLA 1KO8A 3FCCA 8ABPA 2N46A 4ZC1A 3K35A 2B1QA 3CRMA 1V2HE 4EHJA 1P6UA 2Z95A 3S5JA 4N82A 4I6EA 3FTFA 1VIMA 1UAGA 1ML3A 4HZIA 1KNXA 2NSDA 2WG0A 5F7JA 5TEWA 1HR0B 1PFYA 4V1CI 2PUFA 3C7CB 4IIHA 4BFXA 4HUTA 3UMMA 1KZYC 1Z0ZA 1EUDA 1YRQA 2V6MA 4L5AA 4D4HA 1NN0A 3IQIX 3SZMA 5HZMA 4OH1A 4R83A 3KSDO 3D6VA 1X87A 4R40A 3EOAI 5ALOA 5BNWA 4GRDA 1GUAA 5FOSA 3WWOA 4AJEA 2EX1A 4M99A 1N57A 3CMMA 1E96A 3FDIA 4LJ6A 5HFJA 3KAKA 2ERHA 1T10A 3SGLA 3FNHA 1FK8A 1ONOA 1C0LA 3KUCA 1D7OA 1GCUA 3BIJA 2ZJZA 1NI5A 1T3SA 3MPUA 4MPPA 3BAFA 4Z8YA 3MWDA 3FCEA 1E7SA 4YXWA 1USWA 1N4AA 3BWVA 5CDTA 3FAKA 1VKJA 4GKAA 4ZQEA 5ALYA 5AVKA 3DC7A 1RIFA 4YP0A 1I1HA 3SVZA 1O0CA 3UJPA 1HNXB 3NTVA 3KJFA 4TSFA 4AKEA 3T3OA 4DPMA 1KK3A 1F5SA 4GE3A 1KHTA 1L7AA 2C8VA 2REXB 4LJKA 5TSDA 3T99A 3TZBA 4BVHA 4ETNA 1OIWA 3EGEA 3E7FA 1LLQA 3B9PA 3HFJA 3M6MD 3G82C 2CJXA 4ZK2A 3FNQA 4O1IA 2B5WA 4PZUA 3ONWA 2J5XA 2P2NA 3HCAA 4IR7A 3KOXA 4XIIA 3F5FA 1EUZA 5AK5A 4KWCA 3KP1A 1K5GA 4M9UA 4ZT6A 1MZ8A 2DBYA 1TVCA 1FYXA 3TW8B 3JAMA 1X39A 1DWPA 3VR4H 4BS9A 4NIMA 1OZAA 1HYBA 2DECA 3FYTA 3LQFA 4O5OA 3OKPA 1QQ5A 4CU5A 5JT1A 2WMNB 1QDUA 1Q1GA 3IHLA 5IN5A 2ZB8A 4PSAA 1Q86Q 4B3CA 1J00A 5KB3A 1Y34E 3QPDA 4FYHA 5A71A 1V3UA 2PO5A 4JUBA 1SIWA 4UEOA 3WHPA 2K92A 3PQ4A 2F64A 4MO2A 4PGMA 2A8YA 1JZQA 5C32A 3FZNA 3SJAA 3VO1A 3ETHA 5ALQA 1QE5A 3Q8KA 4PZAA 5IUKC 3AC0A 2EFHB 5DCUA 4GMHA 4BV2A 2YINC 4ZTZB 3WZLA 4U7PB 4RK4A 2NVUA 4NARA 1QCDA 2NTEA 4ZAWA 4M0MA 2OGWA 4TYPA 3OIDA 3K6SA 1R6VA 1K98A 3G29A 4G1EB 4WT7A 4A8JC 1N25A 1Z6XA 4QDZA 1JLHA 2EWWA 1UPTA 1JJ7A 2IXFA 5C4IA 4B3MB 1PQPA 4OP3A 4QARA 4ZOLB 4C3UA 4DYVA 4B82A 2HLDA 4CF5A 4DSZA 4EUEA 3BSFA 5JYBA 4EL5A 1NMXA 1Q3TA 1VYHA 1SVIA 2DT5A 2VH5R 3NAMA 2AKEA 3FPAA 3K0KA 2QL7A 3A1CA 1R9NA 4BFLA 1ZGCA 2DQZA 4RK7A 2JFNA 4MUNA 1L1RA 1SD1A 1FMTA 1T5SA 2Z4RA 3ND7A 1HL3A 2YDYA 1N1EA 4O2LA 5FWXB 3VHXA 1GP2A 2X3YA 1KKLA 2AJCA 1G21B 1V1RA 3GWGA 4CF3A 4ARVA 4MDHA 1J1ZA 4WK2B 2GBGA 4Q9KA 4LZAA 3NHSA 5FR1A 1DTWB 1BH2A 1YDWA 3K2IA 3NT2A 1B16A 4JR0A 1JSCA 1XZHA 2HA4A 1IFXA 3QKTA 5DW3A 3IQGX 3WB1A 4HI0E 3FI9A 4GS5A 1WIWA 1KS2A 3W6PA 3ZXYA 4B5LA 4EHKA 3HXLA 1U8YA 1ZRSA 3PL1A 1V9CA 3GDOA 3I9FA 3QGMA 3QVMA 4TWJA 1TEVA 2PS0A 3CN9A 1CZRA 4UTOA 1TQHA 3GMSA 1DEXA 2BONA 2FVYA 3V8MA 3VRHA 1N6NA 3ZWWA 4BXOA 2ZRLA 3L7OA 4PZ0A 1E89A 2CHUA 1W1IA 4R1SA 4MVJM 3VR6D 3I6ZA 2R84A 2WSLA 2R2GA 3DGEC 3GVIA 3R40A 4RPHA 1UKAA 2AL7A 3CMCO 3G8AA 3UWPA 4QM6A 4XVHA 1EMDA 2PVCA 1SCAA 1M6VA 4Z9FA 2Z2IA 3BJEA 2Z3WA 1NFRA 1T3ZA 1U6JA 2QLTA 1JIJA 4W9MC 4Y1RB 1RPNA 3R7BA 5LP6C 2Z6QA 4B4DA 3AR6A 4TYWA 5IK2A 5D00A 2VP0A 4DJ5X 2HQSA 1E64A 1KZ4A 3JARB 1SEVA 1U28C 2XOKA 4XJSA 4R6XA 3HL4A 3OE7D 1OH5A 3WOVA 1CCWA 4LY3A 3O4JA 4PGGA 2IYAA 4D7AA 4PYJA 3GFQA 4Z49A 3SJBA 5KU7A 1UDBA 2VUHB 1UADA 3CLRC 2C4TA 2GN4A 3OF2A 3OT5A 2IU3A 2UXBB 1GPH1 3GPDG 4IOJA 3RRBA 2GBIA 3ZDXB 3W3AD 1S1MA 1J9GA 1P72A 4MA0A 3AHDA 3AONB 4LF4B 4CEJA 5BSFA 3HK2A 1FU8A 2J32A 4NYIQ 4YIKA 4XSGA 2GWRA 1OF1A 4ETWA 4R7TA 4KV7A 1EJ2A 2YWFA 3QYPA 4I4TF 3L0BA 4BP3A 4BKPA 4EELA 4ENSA 1KO5A 4O4IA 2BI4A 4W5RA 1I5EA 4IFIA 2PD3A 2X0JA 3DH0A 1QYWA 2BGTA 2FVXA 3ORFA 4NS4A 4IJKA 3DLHA 4LRYA 4EBFA 5AQ1A 1NJ6A 3ER9A 4O8ZA 3P9YA 1QM4A 1OREA 4GG1A 2OARA 2A5FA 2W7TA 2KOSA 3AJ8A 3Q3IA 4R9SA 3U0VA 2OBVA 3GR0A 4DUYC 1T4BA 3DWEX 3EZYA 1PG4A 2PKEA 4X8OA 2V65A 1KWKA 2FFHA 2GN8A 4NDZA 3RS0A 4L9WA 5F52A 1YULA 1HDCA 4YX9A 2I5PO 4ZV7A 3K94A 4ZKEA 3IEPA 5K3FA 3PRJA 4P2GA 4DRZA 1XRRA 1Y89A 4ETIA 2ZIFA 3SHWA 3CTMA 1CNEA 4UVDA 1W8DA 1OGIA 1V11B 1O77A 3LFTA 2RCNA 5D8DA 4BV3A 1APBA 2EHTA 1W88B 3TZQA 2QAIA 4RDIA 4GL4A 3UTCA 2YASA 3IKMB 4DJJA 1UT8A 3ZX4A 1IB6A 5AR1A 2WJPA 2O0JA 1JA0A 2ZJ3A 1A7KA 2GDZA 4CR8A 2DMRA 4K0KB 3BSYA 3GRKA 3WGUA 4C0JA 4Z1MA 4DS3A 1DAMA 2MCQA 5AK3A 1K5HA 3QEAZ 2H1CA 1AK2A 1AGPA 2Q5QA 4E1VA 5FTJA 3ZJ5A 1D1DA 1V48A 3L8DA 3VZQA 2ZSJA 4TWAA 4PV7A 4P84A 4FDVA 1EGHA 3E9CA 4FHEA 4J0JA 1CDOA 1WA5A 3ACDA 4OHCA 5PGMA 3SC3A 4LFBB 3ELWA 1NBHA 1FFGA 1Z56C 3ICWA 3MD0A 1AK1A 2BPOA 1MLDA 2Z9BA 4BLSA 2QSYA 2GM3A 4OO3A 4EZIA 3MBOA 4IF4A 5GZ3A 3VSAA 4C6TA 1TJPB 1KY2A 3P19A 2FN3A 2QEQA 4QHSA 4DQDA 1N0UA 4HEA1 3ZVLA 3DVLA 4DL9A 5GOTA 4H3SA 3A32A 4MWBA 3AM3A 2Q4BA 4YLGA 1NFQA 5DMHA 2EATA 3W7AA 4U2GA 4CMCA 3GRVA 3IA7A 1PQUA 3TLKA 2J09A 2H0AA 2QU7A 3ESBA 4URVR 5JFGA 4R3WA 2JHGA 2Z0MA 4Z86A 4UBNA 2DC1A 4AP9A 4J0DA 2VF5X 4UTZA 1K08A 1S4QA 3RU7A 2C84A 1XTJA 4FFDA 1DI0A 4PFJA 2WWRA 1EZ4A 4M8IA 3RF7A 2ERYA 2RC5A 2BI7A 4Y1GA 5BYBA 2O7SA 3GLUA 3U62A 5KAPA 4WOBA 4QQ8A 2E1RA 1Z45A 2GASA 3C8HA 3LNCA 4PLFA 1DTSA 1H6AA 2COKA 2PFSA 2Z2YA 2HWUA 4HNAB 3ZZTA 1Q1EA 3LOPA 4L8VA 1P62B 1U9CA 1DC7A 2A0YA 2PYDA 2WWXA 3UMGA 1CZHA 5F51A 2MD9A 1H8HA 1LK7A 4U1RA 3E9YA 4CIDA 3P96A 2I34A 4WFJA 3QJYA 3CGGA 2ABWA 1IY1A 1ODTC 2AXQA 4NU5A 2UVPB 1LPNA 2ZUBA 4B40A 2NU9A 4ZT7A 2CL7X 3NWOA 2ACWA 1AIPA 1P7ZA 1LDNA 3HCCA 3ROXA 5C8ZA 2Q4TA 4NMWA 3GRUA 4E13A 2E37A 1KORA 2C95A 4AO6A 3V3TA 4YI3A 2QY9A 5F76A 2O8EB 3MUOA 3SR3A 1Y8AA 1GPBA 1U7ZA 2EFCB 4I5FA 4ALNA 1GUYA 1NZJA 2CJYA 3DP7A 4GLBA 2PENA 1PQ4A 3L7YA 2Q5JA 5K3FB 4ZANA 5HGXA 1FP7A 1L4FA 1JT2A 1AKQA 2JZCA 3QXXA 2GS9A 3NOQA 4TRMA 4ZHSA 5JCJD 4LDQA 3FMGA 4LV8B 2W42A 4A8JB 1VBFA 1UDWA 1MO3A 1R1DA 3HEAA 1ZOLA 5EQTA 1G4AE 2GZGA 3ELUA 1VLLA 2R00A 4I7EA 1PF7E 3X1DA 1MX9A 4YQFA 3G2MA 3R5XA 5D7BA 5IC5A 3OC0A 2WD9A 1OKKA 1TJ4A 2JCXA 2Z56A 3NWEA 3NT4A 1U7DA 4WFIA 4QOGA 1P1HA 4O4JB 3OIVA 4UU8A 4BTEA 2J5BA 5F23A 2P90A 3ZKWB 1CB7A 1R10A 2PZLA 1UT5A 5AVXA 4GYJA 3RC8A 1RHMA 3FPBA 3ES9A 3JQ9C 1Y82A 1YOVA 1T5BA 5EFZA 4YUXA 2DJ5A 4TX1A 4RYLA 3WYFA 1XTVA 2GTPA 2B2XA 3GLSA 3H2JA 2CLCX 2C7VA 3IP1A 2C8JA 3K6KA 2HIHA 1CQIB 1BWQA 1ADYA 2O8CA 3CRZA 3OOJA 1JR3E 2BFBB 3E8SA 3PDCA 1BWRA 1N0VC 4AMGA 3O2EA 4YI5A 3KEQA 5UKDA 4GX0A 1J1UA 3IEKA 2M9MA 4L75A 5GZ6A 3AY0A 1P4EA 4MO9A 1SGWA 3TI7A 4CIYA 4A15A 1YHZA 2L18A 2VYFA 2H92A 5K8LA 4YJHB 2GYVA 3WK4A 1GKLA 1Q6ZA 2ZBUA 1NOIA 2VP4A 3D43A 3MPOA 3Q9NA 3T12A 3N1UA 5KWSA 3G2LA 2WZQA 4D25A 1FP6A 1Y1KE 1PTJA 2REQA 4EPVA 1X9GA 2C2XA 3QELB 4E4TA 4MR7A 3K53A 4L15A 3CF4G 5EJ8A 3DZHA 4KQ1A 3I6IA 2XVXA 1SCUB 1YBVA 3UWOA 4AG5A 2H9YA 1OZ0A 1IB0A 1KYQA 3Q11A 4FKZA 1QVFO 1Q50A 1N32C 1R0BA 2CJFA 2A1IA 2XQGA 1FBNA 1QH8B 4BGEA 3FDFA 4DABA 3G2PA 5T7BA 2C57A 4AG3A 3D7NA 1JDUA 2GHRA 2FZLA 2CV1A 1YGYA 5IXJA 4OTZA 3U37A 1TPYA 1WW2A 3BMCA 4YJ2B 1BYIA 2WHQA 2EP5A 1BS2A 1NUPA 1ODFA 1RWWA 1U11A 2NUPA 3O5AA 2D28C 4B31A 5BWBA 3QU9A 2CEAA 1SC6A 3K16A 2CDCA 4P82A 1K4YA 1CFJA 3BXOA 1E1KA 2ORVA 1K7EB 4QGAA 2EEZA 3OZSA 1J42A 3GJTA 3SICE 3EXAA 3Q2IA 4HNAA 4OHKA 3KNZA 5G3YA 1QGZA 3MGBA 3RKRA 4BMDA 4U39A 4J0FA 2O3SA 3DLBA 4IX9A 1JU4A 4KPFC 3IPCA 4K03A 4EVQA 3K5IA 1R50A 3LMKA 2XCQA 3PQFA 3WZ2A 3TSAA 3UEOA 4X7PA 3WKBA 2OGUA 2ES4A 1XB2A 1BAPA 5A1IA 4GR5A 3CPWO 3FWYA 2GX6A 1HURA 5GIPE 4YRCA 2MR8A 4AG6A 4DB4A 2NAPA 4Q19A 5EJFA 3RSSA 5C1IA 2QG6A 5LJLA 3CW9A 3LUAA 3JYPA 4HQNA 3R0IA 4QTUB 3UV7A 1KRXA 1AMOA 5HKBA 3GMTA 4Z51A 1GPJA 1BA2A 3FG9A 5EE9A 4O4HA 4COPA 4HATA 1J0EA 2WB4A 3FNBA 1MH1A 4XKJA 4OYCA 4YMSA 4CPDA 4P32A 4DC9A 4I1RA 4U2KA 4NX2A 3RNOA 4U0AA 1BQ3A 1UMDB 3N2GA 3N70A 5FORA 4EFMA 3KQTA 4F5YA 1I4EB 3PJFA 3DAHA 1OFUX 5ECYA 5A5GA 2VLOA 4RM3A 3DJFA 1E6CA 2RAPA 4KE9A 4WN3A 5JG7A 4BAGA 4FN4A 2Q3EA 1IN1A 2ODPA 1R8YA 4ZVSA 3CCSP 4FFMA 4G5OA 2QMZA 5HIJA 3ICQB 3ZDZB 2MTBA 1NJ8A 3JWHA 2P6RA 1FSPA 1MO6A 4KXXA 2G80A 1XP5A 1CDEA 5JCZA 4N47A 5T67A 3CCLP 5ADUS 5AIBA 3P2IA 1TX4B 1OQAA 1OX6A 3EMVA 3CV3A 4HP8A 1QK5A 2O5VA 2NXWA 2PQ2A 2L19A 3CC4P 3CNOA 4J0EA 4U0KA 3S4YA 3I1JA 5AM2A 2HT1A 4EJFA 3M9LA 3KQSA 4ODJA 3GUCA 3ESAA 3H0DA 2BT4A 2NT4A 2X22A 5DHAA 1FMFA 2QVXX 3D4BA 5HYVA 1KF0A 3PWKA 1SZJG 1GV1A 1SY7A 2GEFA 2HJWA 3MWJA 2H1LA 3JU3A 4QFDA 3V4PB 3E3MA 3QOFA 3GDFA 5FUWA 3DBLA 4OYLA 5LDHA 3U56A 2WKWA 4D4JA 4LK3A 2MSWA 4WGGA 3UBTA 2ZUSA 3T06B 1E8DA 1VHJA 4MV1A 1PQWA 1C7RA 5HE8A 4UBMA 3AHCA 2B30A 4ZXPA 3RVLA 3L0OA 2H85A 1D8AA 1JFVA 4FFPA 3IRUA 4GXNA 2CXSA 3H3XA 1IUOA 4ZZ2A 3C6BA 4AIIA 1UZNA 2EOAA 2EP8A 3N8KA 1H93A 1W0JD 1YKGA 5FNZA 5AW6A 4CA3A 3AINA 4X97A 1RTTA 2IF0A 3EGWA 4IOMA 1E66A 2XUHA 1SIUA 2SNIE 1JDVA 2OORC 2XVZA 3TQSA 1T8PA 5K03A 5ISMA 1U0LA 2D62A 3EIUA 7AT1A 1GU0A 1NJFA 1OR8A 4FUTA 2OO4A 1V8PA 5EIFA 3FCSB 2CMGA 4PCVA 1V8OA 2V59A 4ZHQA 3KHSA 5FA5A 1C7FA 1NBAA 3NWJA 2OAQ1 2P1RA 2CSUA 4ABYA 5ETJA 1SHZA 4MGEA 1BQ4A 1K7FB 5LYJA 2JAXA 3ELYA 5EE3A 2Z08A 4JX8A 1KJ8A 2HA5A 4C30A 1Y7TA 2XKBA 4RDHA 3WGNA 2JARA 4II3A 4ZREA 3VYTB 1PJ4A 4KNVA 1QS0B 4TS1A 4UUBA 5HJ7A 1QANA 1J2YA 1MRZA 3IIMA 3W5VA 3CG4A 3KSRA 2WAXA 1NJ5A 4GF5A 1N2XA 1XT6A 5KNCA 2V1UA 1RZ3A 2GN2A 5EXTA 3ASVA 1W1UA 2ICAA 3WYEA 5JR3A 3PQCA 3FJOA 4EF4A 1W36C 2I33A 1SQ0A 1YB2A 2VTEA 3HCPA 1EKXA 3NP9A 4JI7B 1DAGA 2G04A 4IQ0A 4TPKA 4B3JA 1YI1A 3G0DA 4UDOA 3S0JA 3EFEA 2I7CA 4EKIA 2ZYUX 2YY5A 2Y1WA 2IX3A 2X86A 3LHKA 1DBRA 1RQ7A 1EBBA 3LHIA 4JJKA 5DTIA 4C7OA 1XTUA 1IAVA 1UKYA 1Y1RA 1RABA 1RM3A 2JW5A 3BDVA 3COVA 3CT6A 4IXMA 3WGOA 4CF6A 4EWLA 4EX7A 4K0BA 3CUUA 1KD1Q 2QMOA 1W59A 3RIHA 1XWFA 4QTTB 1TVKA 2NUTA 4HWRA 5E8JA 1XXHA 3FRJA 3WGZA 4TKLA 1JRLA 2CHGA 2H00A 4HEHA 3IBYA 4NMHA 2VBCA 5LB4A 5HUJA 4F4HA 2CUTA 3VYRB 1G3QA 3Q7EA 1N9GA 2BGMA 3HDHA 1ESMA 4MW0A 1DQNA 4OQQA 1HQDA 1LKZA 1H0SA 2CXQA 3KD2A 4WK0B 4YAEA 2ATEA 4D42A 5FV7A 4DV0B 3OZFA 2MSEB 3CCBA 1JMKC 3VHXB 1KQSO 1R0XA 1Z0JA 1HI9A 2O14A 1OTYA 1L5SA 2XOKD 4JWTA 4DQLA 5IVHA 2HWKA 3DZBA 1TTTA 1EXDA 2B8JA 1EX1A 1SU6A 1FRVA 1G2PA 2FWMX 3CRRA 1E3JA 4ED9A 3BXGA 2ZYDA 1TM5E 4BQRA 5CW2A 1LLFA 4JJFA 2H1WA 2IP1A 4P38A 5D3MB 4JIMA 1GSIA 5DLYA 3BMNB 3T7TA 4D46A 3W2HA 1FDOA 4WNIA 4MCAA 1I5OA 2AMJA 2NQ2C 2NU8A 4GVXA 1KO1A 4J9VA 5CMLA 2OYRA 4MGIR 3FZGA 2NP7A 4RGBA 3ANNA 1GNTA 2G83A 3ISJA 2XMQA 4WEOA 4ESEA 8ATCA 2XMGA 5DX0A 6REQA 1PEKE 3ABOB 2R5FA 1NMEA 3L05A 4A0HA 1M1ZA 3E35A 4DV1B 4GAEA 5TJ9A 2MVUA 3M6VA 2OPLB 2R6HA 3DVRX 1QO0D 4R31A 4GZLA 1XL1A 2FHSC 1H8HD 3PDJA 4X8HA 3VX3A 3C5WP 2VWQA 3P94A 1K8YB 3PA6A 4LJ7A 1PR3A 4DLNA 2W4IA 4KN9S 5F9HA 1A7JA 3CKMA 3ECCA 3EBLA 3UGTA 1D6MA 4FGZA 4JXZA 1DARA 1RQGA 2PSDA 2II6A 4R8SA 4F9FA 5C1OA 3NTRA 2YVLA 3NBQA 1JPJA 3F5DA 3EG9B 1M6HA 1MIOA 1N2CE 2BKAA 2VDRB 2YFKA 3DMHA 3FGPA 1E3DA 3IO3A 3L8YA 4J7XA 1XRSB 4NL4H 5AHKA 1V45E 2P1ZA 1VIVA 2BD0A 1OXSC 3DYVA 4FFSA 4HS4A 4OV6B 2NSHA 5FBZA 4B83A 3TTVA 1UXIA 1ULAA 4WLFA 1IQPA 3ED1A 3TIVA 1CERA 3JYNA 5TIIA 3GPCA 1QS0A 2AEJA 4G07A 3ZDYB 4OHBA 3OTOB 3PHBE 3K72B 3DOJA 4EO7A 3PPIA 4G2NA 3TJRA 4PAOA 2ZYTX 3AVUA 5L4SA 2R6ZA 1IMQA 2I4MA 2FN4A 2QM7A 3DM5A 3LE8A 4JYAC 3LQKA 4PTZA 1LVGA 5B3LA 2D06A 2LUOA 5EY5B 5HZHA 2W6ZA 3LRXA 1GAWA 1WABA 3QXSA 4WLNA 2DY0A 2YFHA 3LZ6A 2PL1A 5A9TA 3RHZA 3T1NA 2IYFA 3GLRA 2Q07A 5K6TA 1GJRA 2HJGA 1CVLA 1D0SA 1W4LA 1QGDA 2I3DA 2UUCB 4CN8A 1PJQA 2PL5A 2ENUA 2FN8A 3QXCA 2D7JA 2PL3A 4PAWA 5DTEA 2ZZMA 4YJDA 4FFNA 1MR3F 4CKEB 5FLXD 3AYXB 2J0SA 2OO5C 3M6UA 3LYLA 4UATA 4G23A 4XFKA 1ONBA 2YRXA 1LV8A 1NXTA 4I3HA 4B4OA 5TMPA 4H27A 1HLPA 4MZDA 1HYHA 3I4FA 1HEUA 4RETA 4A8PA 4KR7A 2QR3A 1F4PA 3R0ZA 4G24A 4UCXA 3W4JA 1FLVA 4BV9A 4O29A 3L4BC 3CUSA 2PUJA 2V74B 4E3ZA 2BTEA 4WD3A 1ND5A 2XNDA 2FP3A 4GOND 4ML3A 3N28A 2IHTA 4O25A 4KMSA 4OUKX 4TM8A 5DB4A 3IQFA 2PKCA 2QRQA 3ZWNA 1DZIA 4H3HB 1D4OA 3WJ7A 3K0AB 4LK2A 4MWSA 4OBWA 1XVAA 3ASZA 1YFZA 2QUIA 1CYDA 2YWGA 3VZRA 5JS6A 1KI6B 2DBZA 2B8NA 2HJRA 3HBLA 2Z5LA 1MFPA 1FZQA 1K3TA 3KQWA 1XMPA 4ZYVA 3MMZA 5SICE 3K9QO 3GLFE 3HYTA 4GUAA 1VC2A 1QF7A 2WZBA 3P9NA 3HFRA 1AUVA 3OA0A 4UM9D 3QK7A 1CETA 1MT0A 4FDLA 4LGVA 3DW3X 3NVMB 4ND7A 1R18A 1W85B 4WV3A 2C98A 1GGKA 2XJ9A 4OMDA 4E51A 4EMSA 2DWQA 2OO7A 1I8TA 2HTFA 4JJGA 3PTZA 1RKVA 4A91A 5JSUA 3H3JA 2C7GA 1O9BA 1GYRA 1TYEB 1YVEI 3HYCA 1RQPA 1PD1A 3CRVA 3I9KA 4Q1CA 1P4JA 5T41A 3W3ZB 3H1TA 3ZWYA 2REOA 4C01A 5ED4A 1U9ZA 4UKDA 1L2TA 2A5LA 3HJGA 1GUDA 4DY4A 1YR8A 2QTVA 1OV4A 3U7FB 2AVAA 2VRCA 3VR3D 4AJ9A 1OWMA 1M1YA 1ZOOA 4ZZ0A 5B7NA 3WJ1A 3EUWA 1EM8B 2C00A 4L85A 1RMQA 2UYCA 1X14A 3EOBI 3VI3B 2H4ZA 1L4BA 1BS9A 5KDDA 5H3LA 1JEYA 2Z1NA 2LL8A 1FYVA 1WF3A 1AGXA 1NL3A 2C82A 2VJMB 3RNLA 5DV9A 1II0A 3IQDB 5AK0A 3K0BA 4LVCA 5IKOA 4F5ZA 2QW8A 3P9XA 1IXYA 4UQLA 2EJBA 4W7SA 3GG9A 3H1GA 5AVSA 2R1ZA 3DQZA 5JSKA 2VSXA 4IJ6A 5JTUA 3QF7A 3PTAA 5IYZB 5ADVA 4N1AA 3RSZA 4HAYA 4MH0R 3HN7A 2BJHA 3MT9A 2FMFA 5DM2A 2GZ3A 2B25A 1XVLA 2FZKA 3JQFA 3K5WA 4KYVA 2E82A 5AK6A 3AVQA 2GTHA 4HRXA 1U04A 1WCJA 4ZOAA 4R01A 1VHLA 5K3AA 5LU9A 1TJYA 4FLMA 4NU0A 3AFMA 3DTVA 2OE2A 1AUOA 1E77A 3EDOA 1YS2X 4FYWA 4JA0A 5IASA 4GBGA 5A5VA 3GROA 4UAJA 4Z0TA 1TT7A 1C3XA 1RRMA 1OWOA 3UFXB 2G4LA 2MYNA 1N1DA 3C87A 2IVZA 2C9MA 3O90A 4BKQA 1KAQA 1R8JA 3KUKA 4MI9A 3CSDA 1NUHA 4OQYA 4Y2TA 3V4OA 4I1SA 4XVRA 2QYOA 1NUTA 1QH1B 1JKJB 1B6RA 1M9NA 5H0IA 5IRCD 4D9BA 3RVJA 3UT0A 1DG3A 1QHYA 3LOUA 2G08A 4EW1A 3T7JA 5I5GA 4AC9A 5AUQA 2VJAA 5A19A 3HB5X 3W5AA 1H5UA 2K5XA 1R0SA 4IAOA 5ESDA 1HOXA 1KJIA 2N6ZA 1KAGA 2H8GA 4TSRA 2O3UA 3TQRA 3DA8A 2XX3A 3KLNA 5J1TB 2VJBA 1DEAA 4WTOA 3WNBA 1QZZA 4YDRA 2E4VA 5B2ZA 4ZWNA 5H1YA 3WBKA 4JI4B 3MFYA 2OK8A 3D1VA 3G0OA 2RGYA 3KAPA 3PQ2A 2GD2A 3S2FA 3TL3A 1EUYA 2VUTA 3JQAD 1KDRA 1MNQA 2G6BA 1V39A 4A2QA 1VPEA 4BFSA 4IXTA 4UVGA 4Y6OA 4U2BA 4Z9AA 4ALLA 1O03A 4YONB 4ZQBA 3ESZA 4C0KA 1W5BA 2H07A 3JARA 3QUCA 3ZU5A 2EIXA 4PHGA 1C5KA 1F2TA 4POAA 4R5HA 4TRJA 4AY6A 4QBIA 2FWBA 3F5SA 2N50A 2PR7A 2P6UA 1GG2A 3DFMA 3FGNA 1TUBA 3S2UA 3PG5A 3TRDA 3FNFA 2J5RA 3ETJA 1ZH0A 2WSMA 3HKBB 3UCEA 4DV1C 3UGQA 4JITA 1H5QA 1GU7A 1K4KA 8OHMA 2FVEA 2QNRA 2ZSDA 4Z0PA 1KE2A 4CMJA 2XMZA 4IGKA 2NO1A 3NLLA 3NM6B 2D00A 1F14A 1CRLA 4P34A 4R98A 3L1HA 4GKBA 2CXTA 2Q5CA 2C42A 1B14A 3C24A 5LZ5A 3WNCA 4QJBA 3W5BA 4ENUA 4QUAA 3LAXA 1QP0A 1E9AA 2G6TA 4CQLA 3WLIA 2ANCA 4C2AA 4CLRA 1QHXA 2F4NA 3RADC 2J0VA 3MN1A 4P54A 5ERYA 3J7TA 3ZGOA 4RVUA 5KQRA 2FFAA 1U0NA 2AF8A 4C4TA 1USPA 2Q2NA 3G1UA 3UJHA 4BJ5A 2NXJA 3HO8A 3QPBA 1Z4PX 3R75A 2WWYA 2ZRGA 2D1YA 4OVKA 4BNHA 1HH4A 4LBZA 4TWIA 1W4CA 1N6LA 1R0KA 2AH5A 4J1SA 5CU7A 3W9UA 2ACEA 3U6KA 5KP7B 4UJ3A 3GLGB 2H52A 4BYMA 2GUWA 2PZBA 3C1TA 4F8EA 4RFLA 2DB3A 4TZ6A 1LTKA 4ZQFA 5K0JA 4QBFA 3U40A 2JRLA 4IUDS 1E5DA 1CRZA 1I6WA 1JHUA 3DUFA 2OQ2A 2YIDA 3ZXUB 4QG7A 5D1HA 3KKEA 4I5IA 2RJ3A 2VP2A 5DM70 1RHUA 2BCJQ 3SOZA 2KODA 3QVSA 3LUPA 4BNXA 1IHUA 1KYXA 2CF6A 3YASA 1AS3A 3B8HA 2R85A 4J03A 4B6JA 3FHCB 5JRZA 2GA9A 3PI7A 5KKNB 3CF0A 2ASBA 1AX9A 4KR0A 3CCCA 5K8FA 1GTMA 1CY0A 2W58A 4RZHA 5BORA 5HWSA 2H4JA 3EZXA 1TK9A 3SQWA 1KOGA 1D5WA 2NU6A 2BFAA 4ER7A 4P5PA 1G7SA 3HL0A 1PL0A 2BKEA 1RBQA 2BTQB 3PNSA 2W48A 3JZFA 4BX9A 1Z8DA 2ODAA 1X1BA 1E1MA 3MW8A 5EKXA 5BN1A 5JBQA 3HBNA 2R6R1 4JH0A 2KJQA 4HNUA 4W5NA 2CZGA 2XTMA 5DT2A 4B79A 2Z3VA 3BD9A 1YMQA 2JK0A 3NCTA 3RREA 1TA4A 3DR3A 1Q0RA 1Q5PA 1YQ9A 4M22A 3T95A 2HF7A 1NTRA 2PTGA 3COYA 4PSVA 1CY7A 5IJ0A 3SEAA 2YZNA 2JGMA 3EIEA 5IDWA 1NI4B 4M46A 3GA0A 4DDMA 2F2TA 1O96B 4D97A 2WYOA 1RKBA 2BKXA 1MT3A 1QFJA 3U7HB 1UBHS 4FMDB 2NGRA 3D4IA 3IH5A 5J1SB 4RHXA 1FXWA 3OLCX 3DW1X 3DLAA 3MSCA 2Y0PA 1VHTA 3HR7A 5HV8A 3NV7A 4H4CA 1M0WA 2XTZA 4RV9A 2CGEA 4J94A 3ZHBA 2YOGA 4MTNA 1UM9A 2R8BA 3VC3A 2YJ3A 1DKQA 5FEUA 3DPSA 2ANBA 1YDFA 1XMVA 3ABIA 3DEIA 4J49A 3TB4A 1GA4A 2FPKA 4MCIA 1J8FA 4NNJA 3N7TA 5CVDA 1QB8A 4ZQIA 4G5XA 3QF4A 2G9NA 4QO7A 5AQEA 3TQOA 1K86A 1NXVA 1XKXA 2BEWB 1MQAA 2QX4A 5CEFA 4JFAA 4RPIA 3P9QA 1SRRA 4JIGA 3INGA 3Q8XB 5JARA 1KFCB 4MYCA 4UBIA 3CRQA 4R9VA 1ORTA 2BSAA 2HCTA 2OV2A 3V8BA 1QV6A 4P4SB 3DEJA 3GVCA 3N5CA 3H1EA 4M49A 3TQHA 5IF3A 1VRWA 3CQ9A 4MQMA 4J7CA 1KQGA 4BUZA 1PL7A 4YH1A 1Z0UA 1W0CA 2H6EA 2DPHA 3QMPA 1EHIA 4X93A 4C3ZA 4FVTA 1VKOA 2OBLA 2ZIGA 1P74A 3F3SA 3V8NA 4OH7A 5LP6B 2Y9MB 2BZSA 3FSJX 4WINA 2C4KA 2YV4A 4TMVA 1U8CB 4TKUB 3FR8A 4XD7D 2RHTA 4TS4A 4WADA 5H9WA 2IEZA 3FXAA 1RM4A 3W6UA 1EVQA 2W8BA 3RU2A 2YJ6A 4DR3B 2BBWA 3G6WA 2PZFA 3HXMA 5KP6B 1VYVA 2BFMA 1OI4A 3T5GA 2V6BA 1L4LA 4C9BA 1Q0QA 3SMQA 3DTVD 3UHPA 4BQIA 5HTOA 1YK1A 3BH6A 4CMKA 1RWPA 3K1AB 4JB3A 2EVWX 3GT4A 4KQKA 2JJ1A 4JMPA 5CYPA 2A94A 3F8SA 3UAGA 5CFMA 4S04A 4U7DA 1SUAA 3FI0A 5JHGB 1F9EA 3EIWA 2TMGA 2IT1A 2DKOA 1P4SA 4KQXA 2OLJA 1RYFA 2A0XA 2MMAB 2AW5A 3OIYA 4MQFA 3HKEB 2Q5LA 1SPBS 1HNXC 3KPJA 1MC4A 2I3BA 3HEMA 3V9PA 4DFDA 3H86A 4KLNA 5DBIA 4AJ4A 1TGYA 2ZJYA 2BFEB 3QVGB 4REOA 4C08A 1OI7A 4DRXA 1G8GA