3RG2A

Structure of a two-domain nrps fusion protein containing the ente adenylation domain and entb aryl-carrier protein from enterobactin biosynthesis
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
611
structure length
611
Chain Sequence
b'SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGRASIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enterobactin synthase component E (entE), 2,3-dihydro-2,3-di
publication title Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 190
structure length 611
sequence length 611
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3rg2A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3rg2A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rg2A01
2L0QA 4OYCA 1NQ4A 3GPCA 3QYAA 2LPKA 2D1SA 2EHTA 2FADA 2K92A 5KP6B 2D1TA 2VZEA 3E53A 4G36A 2FVFA 2FQ0A 2FQ1A 4R0MA 3GZMA 2VSQA 5K85A 1DNYA 3KXWA 2N5HA 2P2FA 3B7WA 4RM3A 1RY2A 2LOLA 5D6NA 1F80D 5IFIA 4M46A 5BSMA 1MDBA 2Y4OA 2KG8A 2N98A 3ETCA 2P2JA 2P2BA 3A9UA 3WVNA 2V7BA 3WV5A 4WV3A 3CE7A 2KOPA 2CGQA 2KGCA 4BPGA 4FUQA 4ZJZA 5BSUA 3U17A 2LMLA 1X3OA 4H2YC 4CA3A 2M5RA 2KGEA 2P2QA 2PNGA 2JGPA 2QVZX 4LGCA 2KR5A 3T5AA 2KW2A 2MR7A 3FCEA 4IR7A 4BPFA 4EATA 4G37A 2L22A 2X2BA 3CW9A 5JRHA 4DG8A 2MD9A 4HKGA 5K8FA 3IPLA 2AF8A 2Y27A 3FCCA 4U5YD 3PBKA 4OXIA 3ITEA 4D4HA 2QVYX 4R1LA 3DLPX 1HQBA 1T8KA 1T5HX 3E7XA 3LAXA 3NY7B 4PWVB 1PG3A 4ISBA 1ULTA 4IZ6A 3LMOA 4GR4A 2KOSA 2N6YA 2QVXX 2FAEA 5DV9A 3NYQA 4H2XC 4NEOA 2K93A 2KWLA 2KGDA 2K0YA 4D4IA 2EHSA 3LGXA 2N50A 3TSYA 2KGAA 3G7SA 4RMNA 2FVEA 3IVRA 2AFDA 2XZ0D 2MF4A 1MD9A 1AF8A 5DWVA 3C5EA 4D56A 2LKIA 3EJDA 3GZLA 4PXHB 5BUQA 3T5BA 2FVAA 2CQ8A 2CNRA 2K2QA 4GXRA 4GXQA 1L0IA 2KORA 2MVVA 1LCIA 5BSRA 3VNRA 2MVUA 1OR5A 4RVNA 4D57A 5EJDA 3E7WA 2LTEA 2CG5B 2AVAA 2DNWA 2FQ2A 2K94A 4W8OA 2KOQA 5KYVA 2XZ1C 4MRTC 4R1MA 2LL8A 3VNSA 2Y4NA 4RVOA 3IERA 5KYTA 5HVCA 2WD9A 4RLQA 3A9VA 4E5DA 5BSVA 3EJBA 1T5DX 3WV4A 2QNWA 1ACPA 1PG4A 2D1QA 1YJ7A 2KOOA 5CZDB 5GTDA 4RM2A 5KP7B 2AFEA 3LNVA 2LIUA 3EQ6A 2N6ZA 2QW0X 3R44A 3O84A 3O82A 5BUSA 2FHSC 2JQ4A 1VKUA 2N5IA 3RG2A 2ROQA 3NI2A 3L8CA 1V25A 4GR5A 1HY8A 4PZPA 1V26A 5HV8A 4FUTA 2D1RA 1MDFA 1DV5A 5KEIA 3T5CA 2L4BA 3NYRA 4DG9A 5BURA 2JU2A 2FACA 2GDWA 2L9FA 3VNQA 3IEPA 2P20A 3CW8X 5BSTA 3EJEA 3IESA 4RLFA 1KLPA 1L0HA 2P2MA 2MY5A 2GDXA 3U16A 5E7QA 4D4GA 2LIWA 3O83A 2K0XA 4GS5A 2MR8A 2KG6A 2GDYA 1BA3A 5BSWA 4H2WC 3RIXA 4BPHA 2KG9A 3DAYA 1AMUA 2JU1A 5KP8B 3DHVA
chains in the Genus database with same CATH superfamily
2HO5A 4JI3C 3AK4A 3F9IA 4EKGA 1JJFA 5A1TA 3UWKA 4C29A 5GJVC 1SU6A 3GGGA 2JHPA 3OLVA 4LJRA 3R41A 3V3KA 2AZ4A 4DHEA 2QP3A 3THRA 3IA7A 1Z2EA 3NEAA 3TSOA 2AMJA 3OBIA 4ARUA 1SIWA 1EZ1A 4LHEA 3GGOA 1IG3A 4OF4A 2W70A 1M34A 2IIQA 4NYIR 3PITA 4LVUA 3DZGA 3TQFA 3PIDA 1K8AQ 4B4WA 1Y6QA 3EVAA 1WZNA 4BJ5A 2VHQA 2LKCA 2N6ZA 2GN1A 1PT8A 3N7TA 4YTEA 1M34E 2GZRA 4XVCA 1V25A 4ZOBA 3DMDA 1XNQB 3F4KA 4PAWA 1YT5A 3LT5A 4JXKA 1HE2A 5E3JA 2IUTA 4P3XA 3PA6A 1DXHA 1QOQB 3KXDA 3IQEA 1ZCAA 2I78A 1JUDA 4QLOA 1R18A 2C9BA 3DOFA 3O91A 4R2LA 4YCMA 2QYOA 4X66B 3P9SA 4IQ4A 1F80D 5L95A 3DMFA 4RGQA 3SC6A 2XIQA 1JG3A 4OQLA 3FSRA 3SZLA 4JAVC 4A82A 1Q92A 3LA6A 4UMVA 3OQMA 1L5OA 5JD6A 1JDUA 1UM8A 1CQIA 1GNTA 1XPJA 2WOJA 3TSYA 2JFXA 1E8DA 5EZ6B 3CQ2A 5DWVA 2HF7A 1YCHA 3VTFA 1II8B 3S7TA 4KL8S 2QAJA 3OE1A 1ZPDA 4HTFA 3EFOB 5DXJA 1ZH8A 1XHLA 4ZVVA 3N2YA 2QI9C 2W6JD 3T3DA 1X8KA 1OHHA 1XDWA 3HXPA 4YRTA 4UZSA 2XGOA 1O5IA 4BC9A 1RO0A 5DW3A 5BRJA 1CS4C 1NW4A 2ZBDA 5I7RA 3AOEC 3SBOA 2IPOA 2Q4EA 1JH8A 1J2YA 3GLKA 3ZJ5A 1OR8A 1MG0A 2HO4A 3ZN2A 2QZZA 5J47A 1AKWA 3OWOA 3O7MA 3NUQA 1ORVA 1CYDA 2IY8A 3KX2A 4ZGGA 4O6VA 1P4JA 3UAYA 5EJGA 4WD3A 1ZN8A 4EABA 4NIMA 5FPQA 3BULA 2LCIA 3A6EA 4PIMA 3FA2A 3SVLA 1GUFA 2A0WA 2G09A 3SJBA 1AS0A 5F3WB 1P62B 2WIBA 3AVOA 1K9VF 3UENA 1MV8A 4OLHA 4KAJA 1CY6A 3CR3C 1OXMA 2OLJA 5T8TA 4E13A 2EAUA 2CNRA 2XUPA 5JCZA 1ST2A 4OK5A 1Y5MA 2HIHA 1QP0A 4DCMA 4GZMA 3R7NA 2PX6A 4WTOA 3F2VA 5HCUA 3NTOA 1DJOA 4D5GA 2BGWA 4NMLA 4AY6A 2ZYHA 5A6SB 3ZV3A 3G0DA 4C6SA 4LZLA 2JI7A 4Y0VA 2NYVA 4Z4CA 1BWSA 1AQYA 2C1ZA 4UU1A 3CZQA 1BDJA 1EFTA 3JQAB 3CVJA 3WS7A 3HTXA 2JGMA 3KSRA 3ROMA 5EZQA 5I5GA 5C34B 1JDBC 4XFKA 3E23A 1HL3A 2C88A 4R2JA 1Y6JA 3EMDA 4P22A 3H0EA 3INRA 1P31A 2ZATA 4KYUA 3U3DA 2OMEA 1Y7TA 4EX6A 2H52A 5LJIA 4GMDA 4XOIA 2WABA 3ZWCA 4ZI7B 4NZZA 2GSWA 1W2HA 4F1WA 5AMXA 2OV6A 1V39A 4MV0A 1WSDA 4MVJD 4B87A 3T1HC 1ISGA 2JO0A 1YZQA 2II6A 3B5IA 4CUKA 4HG2A 3T5TA 4RPCA 3ANLA 3AHGA 3TEMA 3ULKA 1OB2A 1G8PA 1XQWA 1HYBA 4Z4IA 3Q4GA 1RXVA 1QFZA 1E9DA 1KFJB 3G4SP 2OXEA 2QYTA 1TF5A 3KXWA 4RAQA 1QDEA 1N6PA 2WW8A 1U7HA 1MX1A 1Z6ZA 4NV0A 4KQ2A 3LI2A 1FQOA 3AHJA 1TKCA 4MLCA 1SOAA 3P96A 4DMKA 3P2EA 5SV2A 3WKBA 4FOSA 3OHSX 4CM9A 1NN1A 3SNKA 2X0FA 1RJGA 3UQYS 4HBZA 4WLFA 4QOHA 3Q8MA 5KDOA 4URYR 2Z1NA 1Y8RB 1RRKA 2D7DA 2XODA 3E9CA 2OORA 4JSYA 1Z2NX 3L5OA 1IQRA 4WVFA 3TTXA 5HBRA 2WT8A 3ZZNA 3NOVA 4MKGA 2P9TA 3FYSA 2YCBA 4CFSA 4NPHA 3TZCA 8OHMA 4S1VA 1WR8A 5ENZA 5HF5A 3L4BC 4EB8A 4BDTA 1XTPA 4JIMA 2AWNA 2R87A 4JB3A 4R6WA 5AJZA 2ONZA 1M9NA 3CE6A 5DT9A 1NBWB 2MYNA 2GBLA 1HLDA 1EBFA 5KNBD 1VLAA 2PRKA 3GOHA 4A5SA 3I4CA 1FSZA 2Z5VA 4YQZA 5IAOA 4QBIA 1JN0A 3S7ZA 3KYJB 3YASA 1D6JA 1KEVA 4F3KA 1IOZA 2EC5A 4KQWA 4LJ9A 3O8OA 4E21A 2ZBEA 3RVJA 3BK1A 3OEHD 1MOSA 3MBKA 1ECFA 3ZZUA 1J9ZA 3CMAP 1I10A 4N6OA 3B48A 3JR7A 3L0OA 1QO0D 2Y77A 5JDIC 2Z9DA 4I9NA 4KPUA 5DBFA 5IEBA 1LLCA 4KH0A 1Z26A 3GK3A 4OQNA 3UIEA 2PENA 5KZMB 5CG2A 1U9ZA 2DWUA 2CXQA 2ZRNA 1NPYA 1Z7BA 3W7VA 2DHQA 4QRHA 4JXJA 1QGUA 1Z4KA 1O94D 1W88B 4IQFA 4EVRA 3NIFB 5IFIA 4FGJA 1N34B 2Q5EA 1G8FA 2LMLA 5C46F 2WHPA 2OGZA 3CRQA 2GN6A 2AZDA 4FZRA 4MB2A 4WZBB 4GKKC 2GR9A 3OFSA 1J0DA 1Z45A 1RI3A 3FTFA 2R6R1 3O6VA 5LLSA 5I47A 5AJUA 1XTTA 3QEBZ 5AESA 3GZNA 2EW2A 4TV9B 3R9XB 1HQYE 4H7KA 3TN7A 3VGJA 2HK8A 2FDXA 4CHTA 5DGXA 5CXSA 1F51E 1CSEE 1YHQP 1K7FB 3E84A 5AKKA 1T29A 5CW2A 1QXSA 2GJ4A 3GR0A 4OYLA 1YJXA 4NPAA 1YDGA 4GBGA 3A32A 2A0UA 2RGRA 1PIWA 4OYCA 2V7GA 1SU7A 4HDKB 1H93A 3DS5A 2FQ1A 4OMFG 4L9WA 3OT1B 1N0IA 6REQB 2FPIA 1QIHA 1AKQA 1L4MA 4XLZA 1UJ4A 4QRDA 4V2UA 4RTKA 4BL5A 2YZ2A 1FJHA 1GVNB 4IOMA 2X2BA 4G5RA 1V43A 4JSRA 3TE7A 3HY3A 4B3CA 4A2CA 2DWCA 4CIWA 1QYWA 3K0AA 3GAFA 1XTIA 4RV4A 2JA1A 2QRPA 1JHUA 4IJWA 1TO6A 1HG1A 4M1MA 3EXHA 5DEIA 4B7UA 4NOKA 1OC4A 3N2LA 2FR1A 2ORYA 4UOEA 2HB6A 3GJQA 3WRYA 3EIEA 1WW8A 2CE7A 4EFMA 3WLHA 4B6FA 1F2VA 2QPOA 4TLEA 1W49A 2WUFA 4CFYA 3DBRA 2NU6B 3TMAA 1LPPA 1KVTA 4FWBA 2O8FB 2WU4A 4D4MA 2RC6A 4UD2A 1VECA 3RS4A 5D3MA 3ML1A 3MQFA 1MC4A 1CJMA 421PA 1DKPA 2ZUCA 3R9KA 3KKKA 4MTNA 3RAGA 2B83A 3I07A 2FPXA 2LPMA 5JLJA 4S0XA 3A9CA 5G40A 5ULLA 1WBJB 4QTYA 3RH0A 2IZ0A 1R5BA 1JE0A 3RVOA 2IRWA 4NEOA 3L1KA 2KWLA 1DC6A 4ZD6A 5ALFA 5KMGB 4RKFA 1O90A 1GYQA 4ZYYA 3ZH9B 5HIJA 2WVAA 3ENZA 1XE3A 3G88A 3Q0TA 4GPD1 3K73O 3MMXA 4YLGA 3WA7A 2XF2A 2PLNA 5TGZA 1AUPA 4E3WA 3K8QA 3D7NA 1IBMC 3RC2A 2HT1A 1UBCA 2B78A 4EHHA 4C0KA 2FP3A 3CVOA 3OBBA 1EWVA 1H3EA 2XYVA 2AHOA 2C3YA 1YFKA 2WMNB 2I7CA 2K7ZA 3GAAA 3MJCA 3ZS9A 5C18A 3MCWA 3KLPX 2HA2A 1WUHS 5E2AA 1SCAA 4LBZA 2Q4TA 3PUIA 4J7UA 2ZI7A 4G85A 1DRJA 4WESB 4NBLA 4FNOA 4DT1B 3RS9A 1LTHR 2JH3A 5KSWB 3ABOB 3EEYA 3Q41A 3OZCA 2AD1A 4EM6A 2PMWB 4GR6A 1OPRA 4JGIA 1DOZA 2V74B 1F8UA 3UZUA 1UP4A 2W6CX 2P9YA 2XNHA 2BONA 3FM9A 2FSUA 2GF2A 3PI6A 4BQIA 3SR0A 1L5YA 1X3LA 4C76A 5AYVA 3OIWA 2CHFA 2GKSA 4TZ0A 2Q5IA 3OCJA 2E7GA 1JV2B 4DE5A 4J7XA 5H70A 3D3JA 2PZBA 4JUAA 4UJ3A 3M4YA 4EJ6A 1UK9A 1U3TA 1O6CA 4ZDJA 4PROC 4IHJA 5TT1A 5ANRB 4AS3A 1TYAE 4QPDA 1K4YA 3ORRA 4GVLA 1GGKA 1U99A 1QKIA 4QBGB 4HADA 1I6KA 4PO9A 1TUIA 2VO1A 5JC1A 2DXIA 3SHTA 4F7WA 4YUWA 4ZAWA 1YBFA 2Q1XA 2LWIA 3BH7A 4BYMA 1O8BA 4AJHA 2JLCA 2G9UA 3DS0A 3IULA 1A4IA 3GCWA 1E3SA 3VKUA 4OM7A 1ZITA 1G5PA 2ODQA 3BPSA 3IX7A 4JEMA 4ZEXA 1MFZA 3HBLA 3QSYA 1QAMA 5DNDA 5IKMA 4RU1A 1XGKA 1MQ8B 3PUJA 3HNRA 3KQWA 1XSEA 4N5HX 4PG5A 1O97C 1XFDA 3M4JA 5FWNA 2I6QA 1NJIQ 3TLXA 2PKQP 1VM6A 4RMHA 3M5CA 3T3IA 3BHIA 1WCWA 3QLVA 3E82A 1UPAA 2Z0MA 3HJNA 3CSSA 3O2QB 5CTJA 3FUWA 3HKDA 1PGNA 4WOBA 3VOTA 4M9ZA 3U1BA 5COAA 1ORDA 1GL3A 2Y92A 1P7ZA 1GPMA 4S24A 5B1SA 3QFCA 4J9VA 5BR4A 4OXNA 5DEOA 4TRRA 4OH7A 4DW8A 4G5OA 3DC7A 4Z4QA 5J4YA 2ZAMA 4Y6QA 3KDPA 1MJNA 2D0DA 2C96A 3KSDO 1O95D 3AOGA 1RZ3A 3EMKA 4GE0A 1J0XO 2VDNB 1YB7A 1AMOA 1MH9A 2GFQA 2VJMA 1VHWA 5HK8A 3LDGA 4MUGA 3G68A 8GPBA 3QYPA 4A0GA 5FUQA 1TCBA 2GAJA 4FSXA 4KMRA 4AKEA 4FUTA 4UNRA 3KYCA 1TLFA 3QTLA 5H4HA 5KAPA 3IESA 4ZPJA 1YU9A 3PQ3A 4N12A 5B1DA 4BKMA 1ENPA 2OORC 5F51A 1AUMA 5DHPA 3UW1A 2X15A 1HDGO 4TM7A 3R3WA 5C7YA 2VP5A 4FYJA 3K9QO 1QCDA 1RABA 2AF4C 4TLBA 4U2FA 2M1XA 2JATA 2H54A 3U56A 2IZOA 4BRWA 5FDFA 2ECOA 4EECA 3CG0A 4MUEA 1RMYA 2OD2A 3G28A 2XQFA 5MN6A 4JP3A 3MEQA 3ZGNA 1G41A 3UAGA 4QM7A 1JP7A 1Z4QA 1SCUA 2GBLC 4XJSA 4C2BA 4YT2A 3NHJA 3IMEA 4ENSA 5ERXA 1RI4A 4NJOA 4ER6A 5A9SB 1ZVQA 3W06A 1QC5B 2XGGA 1V1JA 2LKDA 4GP6A 3WWDA 2JU2A 1E6CA 5B3LA 3FZQA 3I0MA 3DDHA 4P33A 4XGRA 3N0WA 1E4EA 4PUIA 1UM9B 2FUG1 3F6EX 3U39A 3HN7A 1NSTA 1Y5RA 6LDHA 1VL8A 3Q7RA 2FKNA 5TPZD 4IOLA 5BSUA 5DDIP 3AZOA 1Q1AA 5ALZA 4DEYA 1D2RA 3CLVA 2I1LA 4LXQA 1Z6MA 2EL9A 1HI9A 1C5KA 1CIPA 2QP4A 3D59A 3SVZA 2DFKB 4Y0AA 3C3KA 2BM9A 1TVKB 1TM7E 5ENDA 2PUCA 3B20A 5FL7A 4XWGA 2EBUA 3JZDA 5AW2A 5IVIA 3NEJA 4UBOA 4E6PA 1E1CB 3T9EA 3GJZA 3E3AA 4YPFA 2DHMA 1PTJA 3VZRA 4KN5A 4ZRDA 2JCGA 4JYZA 1E2MA 4O5OA 1YQTA 3CC8A 4HGRA 1MQSA 1GKYA 1F8XA 2XMSA 3WAKA 1FVXA 3VZSA 5DP2A 3MWYW 4DIMA 4Q01A 2E85A 4DIOA 3BD6A 5CB4A 3G2LA 5BVGB 3BWBA 2O20A 2VYCA 1EM8B 4D9BA 4B43A 1UEJA 3OG9A 4N18A 3WGZA 3O47A 3FFWA 1YS4A 1QHFA 5TQ2B 4FZ3A 3KWJA 3SFTA 3GCXA 4UVDA 2NOAA 3FHCB 3U7EB 3WNZA 5CX1B 4R1LA 3W7BA 4FIDA 2W22A 4P86A 5EJ2A 2JIPA 3C7AA 3KC2A 1E2UA 1AGRA 2Q45A 1YJCA 3O8RA 1YMUA 3U44A 1DZ3A 1E9CA 3PC2A 4P4NA 3JARA 4JQCA 2NV6A 3HP7A 2BLNA 1YOVA 4LNUB 4NNOA 4IHJF 1YL6A 3WKEA 2X41A 4WLOA 2JJ8A 3B6KA 2BUAA 1DAEA 2G1KA 2C5GA 2OZEA 1JEOA 4WN9B 2PS1A 3GEEA 1M6YA 4ES6A 3AJDA 1XNRC 4IRXA 1IRXA 2VBIA 4BQNA 2CDNA 5D8DA 2VZ8A 3EXHC 2RHRA 3E3OA 2YHBA 2CXPA 3SJAA 5BNWA 1ZKDA 4H77A 2V54A 5E2IA 4Q47A 1W34A 1RWPA 4M0MA 3WRYC 4J2TA 5K6AA 4OKIA 3H11A 1HFKA 2IPMA 2TYSB 2VRNA 1HE1C 1ZLXA 4BWFB 2VYQA 4EJ2A 3IPLA 5C8YA 1ZCZA 5HIIA 4FTWA 1KQSO 1R8YA 3QIVA 4IIXA 2PX4A 2VDUE 1RIIA 2JLSA 3AM4A 2CD9A 2VNIA 5DYTA 1HSZA 1J0BA 1Y34E 4DDUA 5BV8A 2AOXA 2VLPA 1T3HA 4Q3LA 4BIMA 3ESAA 3RU3A 2YZNA 3TBFA 4CU5A 1U1CA 5EMJA 2ZIZA 3KFVA 3C70A 2P20A 3EJEA 3KAKA 2R1VA 4Y18A 3JSAA 4Q34A 2HQRA 3MLAA 1AQJA 3UG7A 1EIAA 1KMMA 3KB1A 2RH8A 2WUDA 5FLXA 3B6ZA 3R3YA 3GMIA 4R84A 4M8KA 1V4BA 5IXSA 3D3KA 3JV7A 5BN4B 4LZZA 4CT5A 3GXOA 4KPGA 4BEVA 3RRMA 3PWTA 4XLTA 4UE2A 3RE1A 3W8NA 4HCJA 1Y7LA 2D74A 1SBTA 1JALA 1FPMA 2ZTHA 1N2FA 2CXTA 5CEJA 2BHSA 1O08A 4P7JA 4PINA 5CLHA 4DSUA 5ALDA 1N32B 1ULHA 3L4SO 2WFAA 3PQEA 4C4ZA 5BSVA 1F0PA 2WZDA 2LR0A 1CY8A 1Y1QA 2Y8EA 4B6OA 4G0WA 4R1UA 2IEIA 1YRHA 3P5SA 3GLIA 3W4IA 5KJ6A 2FZVA 2Z95A 2TRSB 3ZYZA 3QFHA 1KQNA 1NZJA 4FGZA 5FWXB 4G0MA 4BZWA 3B8EA 3GLIE 4JVLA 2FRXA 2IEGA 1KZYC 2CVFA 5CFMA 5JI3E 2FN7A 1VKNA 1Z34A 3KXIA 2XXAB 1MAUA 1CRPA 4O4JA 4ER0A 1U28A 4FFLA 5IN4A 3NNNA 1E64A 4KE9A 3K2IA 2XKAA 4WA7A 2FF5A 3L8ZA 3L7LA 4KR2A 4LRQA 4WMLA 3ORQA 4HQ0A 3DE0X 3ZCUA 5DLQC 2FGKA 4O1IA 3K6SA 2I2AA 5AM2A 1KI6B 1VSTA 4DR1B 5H16A 4GYKA 3IIJA 1SOMA 1HTWA 4YXWD 3PEWA 2OILA 3RBAA 4BYGA 1DRWA 1JMVA 3RKSA 3B9RA 3KV3O 1RTKA 1KDTA 3NANA 1B0ZA 1WY5A 4KN9S 5GIPE 1O0SA 3EZFA 4BY9E 5A7GA 1M5TA 3FVTA 1UC5B 1GTVA 2GDYA 1IAVA 2L6EA 4BX9A 5ALSA 1OYOA 1NW9B 3NPDA 1UBTS 3CXCO 4QUDA 1PK9A 4B76A 2JGFA 4RF5A 1KI7A 4I08A 1ZN9A 2E55A 3KB6A 5BOSB 4D6YA 2C2XA 3M33A 3Q9SA 3ZWBA 4CNQA 3N87A 3ZWPA 4E14A 4B3TC 1X8LA 3GQBA 1NKTA 1HFWA 1CKEA 3D7LA 4XDZA 1JJ7A 4MMZB 2YCLA 1YJNP 2HU7A 1YHYA 2C7QA 5FX2A 3GZLA 4GE3A 2FVAA 3TG8A 5CB4F 1L3IA 3MQ2A 4RHEA 5ETJA 1T8RA 4ICIA 3WXBA 1TQ4A 1US8B 1HM5A 4GHWA 3KCQA 3PIRA 5A4MS 3UK0A 3ANTA 4RNDB 4XX1A 4JT4A 4PANA 1U02A 3WR5A 2HNKA 2Q9AA 1G2QA 4CW7A 5C37A 4ZYVA 4MUYA 3V1UA 2WPNA 1C4WA 4AF8A 2J0UB 4WNCA 2XXJA 4V2IA 1S89A 3RUDA 1TFRA 4D46A 3VYWA 4ND8B 4YO7A 1WQ4A 5BR8C 4KODA 5BWBA 2WIFA 3U37A 3MWFA 3ESXA 4DPKA 2VI5A 1ZK4A 2POQX 1E8NA 1XK7A 4WVLA 3B1YA 3KLOA 1QAOA 1H2YA 3GBVA 2R44A 4KPEC 1M2KA 1Y4AE 2W2KA 2X1LA 2FV8A 1SKBA 1RVV1 4QDJA 3TNFA 4HNVA 3OTOC 4E5SA 1W25A 4QOSA 1DQPA 1OX4A 1V9CA 1V48A 2FMUA 1C9DB 1TTPB 1NDHA 3PEFA 1NHGA 2D3WA 2XGMA 4FILA 3IERA 1O6FA 4OO3A 4O8CA 1M0SA 2R47A 3LU1A 3FNFA 2ZB7A 3TR5A 1F6BA 3JWJA 4R2HA 1A2BA 2C9DA 3Q5EA 4LTMA 1BDMA 1H1DA 1NYTA 4GH5A 4DLSA 3KOWA 4RKQA 1NXOA 1XXHB 1HDIA 1SCIA 5C8YF 3UF0A 4X95A 2AN5A 2RGBA 2B98A 2GBGA 2QDXA 1NPDA 5HXAA 3H5TA 4MWZA 1SBQA 1FLNA 4DV7C 3RV4A 3T99A 4R54A 1JI0A 4PU0A 3OIVA 3EBLA 5HRCA 3GFVA 1KJNA 3AIKA 4NCKA 4D3SA 2XRZA 3K70C 4R8SA 4K28A 3FG9A 3ZGXA 2JCBA 2PE5A 3WMEA 4QYTA 3BFVA 4PQEA 3EGOA 3GBPA 2FZEA 1RWQA 1VP9A 2LL8A 1A98A 4P32A 1JA1A 1HXHA 3PJDA 5FI1B 3LBAA 3KIPA 2DPGA 2OPLB 3CZCA 2CKDA 1W59A 3LVQE 4TWZA 4MR8B 1GSHA 1BXRB 5CM8B 2ORED 3IPYA 1RZRA 1DUVG 4G0PA 5LA6A 4LDQA 4M1ZA 5ICSA 4R0MA 3WGLA 3L7CA 1P1IA 2AS0A 5HTKA 3UT5B 2QB5A 1T1SA 1IPEA 3MHPA 3AGQA 1MZ8A 3ZUPA 2QN6A 2JD1A 3IMGA 5T8SA 1NUQA 4JIGA 4M53A 1GDDA 3I5AA 3OCCA 3DTYA 3PB3A 4RH1A 3E1KA 1ZS9A 4RQTA 3MINA 4Y2JA 1PQUA 4C43A 5AP9A 4P35A 1RCUA 5LQDA 4JMLA 1GTG1 4C0QC 2OAP1 3IBGA 2GPJA 1N2OA 1O9TA 1YJAA 3KNZA 2ZRAA 1KO5A 4US2R 4G4SO 1KRXA 4DYHA 2YJ4A 3ROFA 3FNRA 3A6DA 4A8PA 3TQQA 3K5IA 5KJFA 4CR6A 3CLUC 2YVLA 4Q66C 1IZ0A 3UJ8A 3U81A 5ECYA 4HLCA 1U80A 1RJFA 2C5FA 1NGSA 1Z63A 5C7LO 4QECA 4AP5A 4E08A 3FGNA 2V9PA 4YECA 2OP0A 3GT4A 4FOTA 3THXA 3TXYA 3HCPA 1C30B 2MSEB 5AVYA 4PZ0A 2Z3ZA 1M10A 2L69A 3CFYA 2E4AA 4IOJA 1S8OA 1W4ZA 4ERXA 1VXOA 4LDZA 5ITZB 4D9FA 2L19A 5KYWA 4EBBA 1JBEA 3IALA 1XFAA 4N7MA 1N5OX 2X1VA 3VR2D 4RMJA 4H6WA 3WX0A 2C9ZA 4KV9A 1PL6A 3EGWA 4YCDA 5K6AC 5C2JB 3KTAB 3BSSA 4NVRA 3QBEA 4X0EA 5EVJA 2L18A 1W96A 3SE7A 1Y4SA 3IUEA 5D3QA 3HCNA 3OUZA 2FW7A 3DNFA 1XMXA 3O9VA 4WZAB 2YDYA 2NU9A 3WGJA 2W6QA 2R85A 3UMYA 4D26A 4F71A 2D3TA 4XWAA 5T4FA 1WA5A 4PCUA 4ZFNA 1DBVO 1KMCA 3RTAA 2KR5A 2CFTA 3CX6A 4E31A 4EEZA 3PFWO 4PC2A 4FYXA 2V3WA 2GJAA 1R50A 4YRBA 2WPTA 3H0CA 1C4XA 4UU8A 1KXZA 5EUCA 1AM4D 1QR2A 1OB5A 2ONYA 5BQXA 5DM2A 3GU3A 2FP4B 2ZEJA 5TV2A 3NPAA 2AJDA 1OLOA 1MT3A 4UEQA 2VVTA 1FYDA 3AILA 1VLZA 3QE9Y 2F8SA 2PVPA 3SZGA 1L1RA 3TF5A 4ZAGA 3ZHSA 4M99A 3OZUA 3H0DA 3TLCA 3ZLUA 4B46A 2VAMA 2BEUA 1NXQA 1A7JA 1T6YA 4B2YA 5A02A 2ZJBA 3IUBA 2YL2A 1AO3A 2ATEA 4M88A 3LY8A 4YCNA 2JDIA 1MA3A 5FOUA 4KV7A 5EJFA 2ZWMA 2P7HA 5CA1A 1ZYUA 2ZYSA 3LHDA 5IWAB 1RWXA 3LBHA 3GX1A 4U9UA 4UAUA 1QTRA 3EB9A 5MDHA 3E9QA 3T7JA 3GHHA 1HZZA 1S1CA 1KE2A 3ZJ4A 3QWBA 4R0NA 4OLJA 2RGAA 1Q57A 3PUZA 1QONA 1W5EA 3HHEA 3IPRA 1Q2XA 3SI7A 4E5PA 4G5QA 5DO9A 3S2YA 3AL0C 1VFNA 1I7DA 4BAZA 5CT5A 4JJFA 3EYAA 5JDIA 3MILA 4LX0A 2DSTA 2GZJA 1LQTA 4BX8A 1A04A 3F74A 3E58A 3RG6C 5LWHA 3X1ZA 1D04A 2VDJA 2IXTA 1K4MA 3C3PA 4GI7A 2WWWA 1U5CA 2N42A 1F2UA 3SBDA 2PN1A 3F6YA 5KHAA 2PCLA 2YXBA 4I8DA 1SCQA 3UUEA 3NM4A 5AQ1A 2EIAA 3RAEC 5KQRA 3Q8KA 1GTL1 2P6OA 2BGRA 1D0IA 3HWX1 4TWRA 1CD5A 1KYYA 1OA0A 4ZAYA 1YD7A 1T3ZA 3GUUA 1LBEA 5LA6F 5FOXA 3G1GA 3G71P 3BL6A 5ALPA 2X9VA 1E2JA 3I9V6 3BMNA 3EBOA 3X1DA 2ZJOA 3VQTA 3C45A 1D8AA 1FUEA 2B4RO 1TCCA 1O0BA 3SXUB 5AHWA 3L41A 1H6BA 2B35A 4L28A 3QTBA 3PCXA 1KYZA 4N9WA 4RVCA 4L9RA 2FZWA 4AZVA 4MV1A 4G1IA 4M1EA 4UU7A 1TM3E 1I3KA 2BGGA 1DEHA 2QE7D 1DQZA 5H3CA 2V97A 1E7YA 4F4DA 3PDIA 5T5QA 2P2BA 3BSFA 3ABZA 5BVHB 3AP3A 3DMRA 1PJRA 4PFQA 4GX2A 5E4JA 1EFUA 4FT2A 3SYTA 3EH2A 2DR0A 4IDAA 3ZIAA 2WT9A 4PZLA 1T35A 4D98A 1Z4JA 4B6RA 3U3JA 3TSCA 3CCVP 3VR5D 2GYVA 5B53A 5I7FA 5DF1A 1FLAA 3AWDA 1JVBA 3BRQA 4YYZA 3KKZA 2IH5A 4AS1A 2VDPB 4J4BA 2Y66A 1Y1PA 2QSYA 3HXKA 2JJ2D 4JSTA 1PDWA 2JHAA 4Q9HA 1DWQA 4G65A 4I6EA 2HLDA 3BD9A 1MZPA 1X13A 4XWKA 4ZT2A 2W4MA 3V33A 4JI8B 4YK7A 3HCOA 3OTHA 2VUUA 3TO5A 1PHPA 4GX1A 3ZK8A 4XA8A 4CM4A 3KPWA 2UUBB 1D7AA 2VT6A 4M6WB 3E03A 4CEJB 2YBEA 3BRWD 3NNSA 1WVGA 2OC4A 4TXLA 2YASA 1PR5A 2I7TA 1Y3DE 4KFUA 1RW4A 2EJTA 4HFRA 3OIGA 3DTJA 2GTIA 4WBNB 2CL5A 1CY4A 2HAEA 2BFPA 2AX4A 2PGLA 2PD6A 4J0FA 5IHXA 3I2KA 2VP3A 4B1FA 2KGAA 1A1SA 3I01M 3A6ZA 2O8VA 3QWAA 4ZJYA 1GPDG 1WDTA 3NAMA 3GLRA 4EJMA 3DBLA 3AJAA 2LCQA 2JFPA 2O3QA 2JGNA 1EGVB 4FHFA 4RZ2A 1S8AA 1QHXA 2WG1A 1OVGA 2D5IA 4LHSA 1VPTA 1BEUB 1HE4A 5D5HA 2HQSA 3OQPA 2VYVD 4BNNA 5C5IA 1C80A 3U09A 1KF0A 4KIWA 3DOCA 2AYAA 1X7XA 2D0OB 4Y6PA 1MXFA 3RBVA 4ZOEA 2OD9A 1SVMA 3MBIA 3G0CA 3MT0A 1BCSB 4KOAA 4Y9RA 3HZQA 3F5QA 1ISRA 4YMGA 1DFIA 2G07A 4AJ1A 1EVZA 3CO5A 4Q1AA 1CTQA 7CEIA 1YJBA 2HWXA 2CEAA 1QQTA 1Z5VA 4ML3A 3PNQA 2OV8A 4MA4A 4U9HS 1TEVA 5E7JA 3TI9A 3V6LA 2NO5A 4BBYA 1HYGA 1F4LA 2PRSA 3F67A 1FZQA 5CCEA 2R79A 3DKVA 2XUIA 1D8TA 5AJVB 1TO2E 3O84A 3SIXA 4FONA 2LBPA 4RXUA 5IARA 4I36A 5EUQB 2NU8A 3DO5A 1OIWA 4UMDA 4KBFA 2IBTA 5JBNA 3L0YA 4HLUA 4BVLA 4TQAA 4BGUA 2XZOA 4R16A 2VLNA 1K8ZB 1IYZA 3RF6A 4TVKA 2FPOA 5CA1F 5AVTA 2PEJA 3BTUA 5IUJC 4DV1C 1H6CA 2PQMA 3H8WA 3EVZA 3DWGA 2XTMA 3VHXB 1IN6A 1X3OA 2CLKB 4E4RA 1Y48E 4IR7A 5I51A 4X64B 1IPFA 2XDAA 1O94C 4XD2A 1D1PA 4DV2B 1FP7A 3OJFA 4IEFB 1OLXB 2BELA 5K8JB 4RPIA 5E8RA 2C7BA 2XX3A 4IWYA 4W7HA 3W3AA 3CUKA 3JAMA 1PWZA 1A5ZA 2OFXA 1L8OA 3NR2A 3CNLA 2AQHA 3OTQA 4F12A 3FMFA 4NDNA 2BFCA 2NZ2A 4MYDA 4WJKB 1IG0A 1SVNA 2P4QA 3H1PA 4FHDA 1F8YA 3W1VA 3FOEC 5LP6A 3FPLA 2OFOA 1P0FA 2DLNA 3OZBA 4W5TA 2GRJA 3R8FA 3OPQA 1PYDA 4D1YA 3QY0A 1XP5A 4NDNE 2ZIAA 4D5EA 1PR6A 1B23P 2R6GA 3EZGA 3W3AH 3KAQA 2I6GA 4I2VA 4YRKA 1Z07A 1ZVJA 3ZDFA 5HP4A 3L8FA 1YJQA 2PGJA 3CWQA 4F2DA 5AQEA 1MDBA 5LMNB 4AF7A 3CRVA 5DHQA 4BQEA 2I4NA 3HKCA 3IP6A 3CN9A 3C74A 3OC6A 4HL6A 4DRZA 2J9FB 4Y7CA 4ALLA 2ZWPA 4ZCLA 5C7IO 1Y1KE 5JJIA 2DRIA 2QUZA 4GLLA 4RABA 2DYJA 3C6QA 1BEEA 1ML4A 4LRXA 3MGEA 4Q4CA 1VMIA 3V8PA 1OIXA 3N2QA 4HD8A 4IJKA 4YMUA 2WYWA 4GOMD 2DQYA 4LOIA 3GRVA 4BE9A 4RA9A 2CMKA 1GZ6A 1HX7A 1H65A 3OIDA 2Q1YA 2AUTA 2Z04A 2VTKA 2Y99A 3QVGB 4D81A 4RVHA 3BUSA 4ZRMA 1P2VA 5T57A 2AG1A 2CV1A 4HLNA 3ILYA 4MWSA 1HOXA 1N1EA 1TZMA 2ZBQA 4TZTA 3TI7A 2HJVA 4AX4A 3VJKA 1VBNA 5A6VA 2J3QA 5L7WA 3ZY4A 4OAOA 2A9PA 4HEA6 1GA6A 4H4CA 5AW9A 4QNMA 4J16A 3D3EA 1QP7A 2JIBA 4D99A 1LBQA 1XZCA 3GRYA 3EPKA 5BMOA 5AUNB 2KW2A 4ND3A 2JVIA 3C5VA 1GCAA 4N65A 2J9ZB 2CJWA 3G7UA 2JLVA 1BGWA 2I3ZA 2UUOA 4D9KA 1I7SB 3BEOA 1M6VB 2PVSA 4DLTA 4PGMA 2ZXUA 3F7TA 1MX3A 1WQ3A 2QR2A 4EQ6B 3KEOA 1VG0B 4CM8A 4FHGA 3ESYA 3FY4A 2RHJA 4BJ3A 1RKUA 2WJ3A 4JT2A 2AXQA 4M3NA 3F4LA 3ABIA 4BNLA 1SPXA 3X0DA 2R0QC 2ZITA 4ROSA 2DGYA 4A15A 3I32A 2ZW9A 1PLKA 1IN1A 1TQDA 4IGFA 3KT3A 1HZZC 2B6HA 3VNBA 3T41A 4S2UA 4EZIA 4R1QA 5AE3A 5AHRA 5F7XA 1FMJA 1N0UA 1N0HA 3IR5A 3MJVA 4P93A 3KZMA 2DULA 2FG6C 2YJ3A 2PSEA 3WSWA 1JLRA 1R8XA 1I36A 3PQ2A 3R7WA 1G7SA 2ZSAA 5K03A 2IHNA 5UKDA 4Z99A 3G1UA 4E5NA 1UANA 2ZIGA 5CRIA 5I9MA 2G76A 1LVHA 1MXAA 3R3SA 3BKWA 5BSHA 4ODIA 1FFYA 5JZSA 1C50A 3G89A 3CUUA 1XMVA 4AS2A 4KO4S 1U7PA 3LK7A 5JNUA 4D0LB 3WWEA 2H1HA 1UAYA 4OGLA 4E33A 2FPLA 2ZYTX 1AQNA 5BWLA 3BERA 3KHKA 1PR0A 2O8DB 5DHSA 3W5BA 1E4YA 4RWEA 2ORVA 4DMCA 3RVKA 4GR9A 4Q00A 1T0PA 4N39A 5JS1A 5AW5A 3T3EA 2K4MA 4E2XA 1HNNA 4DAEA 3E15A 1R4MA 4BMOB 2VHXA 1DAOA 1DC3A 1ZSYA 4K9PA 2NMVA 3AEUB 3W77A 5BRAA 2AXEA 4RDCA 1AXEA 2B4TO 2OBLA 3ZQ6A 3I64A 3EGDB 3EF0A 4DMRA 4HHEA 4MIEA 3G5LA 1C0EA 1ADBA 5AK6A 4NAUA 5A04A 3B6JA 1IB8A 1ZR2A 5DBHX 5EP1A 1CY1A 2ZAGA 3ZD9A 3ROGA 1GU0A 3UMGA 4ALNA 2XMCA 3T5BA 3K72B 5BR1A 4M54A 1JSXA 1HLFA 1L4LA 3DAFA 5LBIA 1RZUA 2Q6KA 2XT9A 3ZE8A 4U7FA 4XQGA 1WCIB 2MSWA 3DL0A 4QYIB 4KSBA 2FFJA 3SBEA 3AKDA 3HJBA 1E0AA 4JP8A 1DAGA 3AF0A 5CJJA 1DC4A 3KOMA 1J09A 1CUWA 1OBFO 1RAHA 1S7GA 3RB8A 1E0KA 1ISMA 2B8JA 4NXMC 1Y3HA 1L5HA 3SF8B 1T9KA 3DHVA 3BB1A 2E9SA 1Z4LA 3D6NB 1ZM3A 2NT4A 1Y1SA 4CLDA 4PHTA 1M8KA 5F98A 1TYDE 3O0DA 1GLVA 4HYQA 3BWEA 3L6CA 4ETNA 1M2OB 3AVQA 1BD3A 3R5JA 3MXOA 5LP6F 4MUNA 1GFWA 1A5TA 3CQ1A 1FFAA 3WK9A 2B9VA 3I9OA 4RH3A 2UYCA 3WMGA 1OREA 1TRHA 5L3SA 4P92A 1A96A 4H7DA 4OXYA 5EZSA 4BMCA 2V7UA 5K45A 2I4IA 4DN6A 2K2WA 3CCSP 1IH8A 1KTIA 5E2BA 3B4QA 2G9NA 2HLNA 2P91A 1N77A 1M2HA 2QX6A 5T67A 4I55B 1Z25A 3PK0A 4UXJA 2YWJA 3T4UA 4MW1A 1GA4A 1D3AA 4CM5A 1X9HA 1XEFA 1ZJWA 2GO7A 4FSDA 1E2NA 4JJ4A 1VG9B 1E9SA 2CLCX 1E63A 3SDZA 4YJ3B 4AULA 4CJXA 3K1AB 1YZTA 3T7AA 2NADA 1QG4A 5K0GA 3JQRA 3L0BA 1H23A 4HSGA 1UJMA 4YT4A 1DPFA 5LQSA 3R5FA 4EFNA 3ZE2B 3IILA 4EY3A 1OLSB 4P54A 3WSVA 1LUAA 2HRCA 5JVDB 1B43A 2Z83A 1XQ9A 1G66A 4K6KA 1QGED 5HHTA 1TA0A 3DNPA 5A0VA 2OL4A 1T2CA 1C0KA 4NICA 3H2TA 1HNXB 3ZEAA 1ZOLA 5LLDA 2HF9A 3G8CA 2KG9A 3ZHRA 3FUXA 3VRLC 3FPSA 1FYXA 3S29A 2D1SA 4JDPA 1CUBA 1JLLA 4HZUA 1GGEA 5REQA 1ZCFA 4QULA 2WSMA 2Q4RA 2QW8A 2KGEA 1V45E 3AV0B 4EI2A 3GT0A 4HLUC 5GMOA 1U0RA 1XRAA 5DN9A 1BJTA 4QQKA 2PBLA 1GKLA 2YVQA 4DR3C 3A9TA 4F4JA 2AFIA 2G70A 3VISA 2KORA 2OWEA 5DGCA 2GSDA 1KP3A 2O8CA 4H35A 2FFBA 4C21A 5AWFC 1NG1A 4PH0A 4DLNA 5HIMA 5GTDA 2B36A 2IJGX 3NTUA 3W8DA 2JHFA 4CDRA 2BBOA 4DUZC 4JYMA 1YULA 2AFIE 4Q4HA 4K1XA 1TF2A 1DADA 1LPSA 3DS8A 1U3DA 1NQVA 5I8WA 1MQ9A 1UWCA 1AH2A 2IUYA 3GLFB 3HB7A 1VXRA 2C0CA 1MG5A 1F2TA 1QKJA 4GDFA 4J29A 2X2OA 4MPRA 2Z46A 3DUWA 4PGFA 3VVCA 1OTYA 2AVDA 4YQYA 5CBPA 1HF3A 5F5LA 4CF7A 5LP6C 3N86A 3OE7D 3QMWA 3INTA 3TH5A 3TPCA 3ISJA 2NUAA 1D1DA 1ANKA 4WK6A 3GRCA 5HW0A 5E6UA 3A3NA 2X0NA 1AB5A 4GNKA 5F77A 4B3SB 1DEKA 3SK0A 4FKMA 3KL2A 1KHHA 1Z2CA 5KI6A 2Y9PB 4GXQA 1O4VA 4KG7A 2MCFA 3GFBA 4LXIA 4TTQA 4RYLA 2V8BA 3G5MA 4LF6B 1VQOP 2ZVJA 1EFVA 4O29A 3LSTA 4UVEA 4QUBA 4UM9D 1KJQA 1K7EB 3KQHA 3FNEA 4IPYA 4EYEA 4GGMX 3QF7A 2IUEA 1XWFA 2ISSD 2EG5A 1IIRA 1VBFA 4RVUA 2G0NA 4QOFA 4DSNA 821PA 5LQUA 2O6HA 2G4VA 2L0QA 5KJEA 4UM8B 5C1OA 4FYKA 4PRLA 4ZT5A 2C8VA 2PV7A 2QENA 4X5OA 3E9MA 2IZ1A 1SXJD 1VL0A 1MB9A 5EJ4A 2YHIB 4E2WA 1GD1O 2BL4A 5EMMA 3LW7A 4TKLA 2Y0BA 3ZU3A 1RVDA 2XCIA 2EFCB 4X8LA 3RODA 1AZTA 4H08A 4QGFA 3GY0A 4ECEA 3WL6A 1IC6A 3RBXA 4FBMA 2H4FA 2IBSA 5BV2P 4R1MA 1DIAA 4J16C 2YV5A 5CFRA 2VAPA 2IWHA 5FPYA 1T2AA 4QELA 2I4TA 2ATWA 3DEJA 4OX9B 3HZOA 4UXIA 3B3GA 1EA7A 1ONPA 5HZHA 4IDGA 2P2DA 3KB8A 3A3OA 3UO8B 4TSFD 3PI7A 2JFUA 1KARA 1JR3D 5JYBA 3IAHA 1SKAA 1NQ4A 1G8KA 3MWDA 4NS1A 1NBIA 1KVRA 2CB0A 4Y67A 1SURA 1FFDA 2VS1A 4ZYXA 1KC1A 1XNJA 2O0JA 1JFFA 2WJJA 3IMLA 3SR4A 3VAZA 3ITEA 3OKPA 3OJ0A 2EZUA 3BIWA 4UUQA 1OZFA 1H4VB 1IMJA 3K05A 1L4BA 3ZNPA 2DNWA 2V4ZA 2J3LA 3ZLBA 1WHSA 2XZ1C 2YWGA 3GRAA 2BKUA 4YP0A 1PQWA 4C6TB 1PR9A 4S04A 2CNNA 2IXFA 5HOQA 3C6XA 3P9NA 1UOQA 3P4UA 4C03A 4JCCA 3CUYA 3CPWO 2FQWA 3VNQA 4AZ3B 3N2IA 5J23A 4FD2A 1Y3IA 3T15A 1L7EA 3KOXA 4LHZA 2EJBA 1J56A 1K97A 2XCLA 1LS6A 4OHZA 2XQIA 1TNDA 4BFVA 1J90A 4YP9A 3N74A 3F6PA 4R5HA 4B33A 1TUBA 1PS0A 3PICA 4NI5A 3ETHA 1KRWA 4A1FA 2YXDA 1CY7A 1P4AA 5E1DA 4F84A 1HDZA 3HA2A 2XADA 4ZHQA 2JGRA 1U2EA 4MGKR 4YI3A 2EKQA 3A4VA 2B2CA 1J06A 5LXTB 3GPIA 5FOWA 4H0NA 2RG1A 2VRCA 3K9GA 1XYYA 4G5YA 3LKDA 4KK4A 4WKNA 3KYDB 2C2GA 2QRMA 1R64A 4J0CA 3FLBA 3NDRA 4MDYA 1W1WA 5AVQA 5MHTA 3T12A 2DFVA 2GPTA 4H0FA 4NMMA 5ALEA 3L7YA 4DMHA 4NJMB 1VQ9P 5E6SB 1Z2AA 2I33A 2F4VC 3QW4B 4POAA 5L3QB 2ZZNA 2C4TA 2HBQA 3TLKA 4GMGA 2FG7C 2WHXA 2ZI4A 1J4AA 3A1CA 4LF4C 1G2PA 1FDOA 4L3OA 3VZCA 3IQDB 2X0DA 1T5IA 5BS1A 4BIIA 2J87A 5KYXA 4W5WA 4QYXA 1VIVA 1L5MA 1SM4A 3UWMA 4ZIRA 3HB9A 4PX3A 4C88A 4DCTA 4OYHA 4HF7A 3PPXA 2F1OA 4DVJA 2CMGA 5FL3A 3FYUA 1PQYA 1XCJA 4YR9A 1N5DA 1OR5A 3DP7A 1B8NA 2UUCB 1RTTA 1V11B 2F48A 4KAXA 1E9RA 3ZE1B 3PX3A 3RS5A 4PG4A 5IM5A 2XYRA 3D8BA 3DS2A 1NIJA 2COUA 2IYUA 1SUIA 2VWGA 3UHPA 3DTVB 3BGIA 2R25B 3ROZA 5I4KA 1E2KA 4BKOA 3KKEA 2QMQA 3IT2A 5E6RA 3WYBA 4UBJA 4BEJA 3PXGA 5HGXA 2QN3A 5BSWA 3TZLA 3RJMA 4C4AA 4RHYA 4PC6A 1E1RD 2C4KA 5KC8A 5FTMA 2OO4A 3C39A 1D2HA 1E92A 1B00A 4PZYA 5DNWA 3RAPR 1DFGA 1HDXA 3EOBI 3B85A 5ENVA 4NBVA 4JI0B 2MSKA 2F43A 1M6NA 2LCFA 3OAAD 4MRNA 1E9VA 4WY5A 3R5HA 1T8KA 4TLMB 3TK1A 4QPCA 5HTOA 3W78A 4DGSA 1DLJA 1SBNE 4BNZA 1BU8A 5BN3A 4PVDA 5KREA 4UDNA 4LC9A 2JGDA 2OVBA 4X62B 4NCHA 3NOOA 2P78A 1WXDA 5IJ9A 3JASA 1WBBA 1XZDA 5FD8A 5KTNA 4KLNA 2DKNA 2C57A 3NVDA 1TADA 2IYSA 1I94B 1U4SA 3E35A 1UXHA 2J3KA 3D8SA 4TKVA 3BREA 4HB0A 1C7FA 3NONA 4EKNB 1PFQA 3W8EA 4Z9AA 4DV3B 2OHGA 3FVWA 4TMXA 4HS9A 4W5NA 2I8LA 1HK7A 4ZCIA 2BGUA 1DBQA 3AL3A 2VJAA 1XMIA 4JFAA 3P9ZA 2VJCA 2O7VA 3UVEA 1JHVA 1ZGCA 2GCGA 5DZSA 2QX7A 3WBKA 3KR2A 2GZHA 1UBGA 3OZWA 1VMKA 3PFIA 4XFDA 2I5PO 4EMBA 2PLFA 4GGOA 4ZT3A 1NPTO 2LRHA 2WTEA 5TGTA 4OFZA 1TZCA 2ZB8A 3EG9B 4C4PA 4D82A 1T4DA 2QMZA 3PQDA 3A6KA 4E5UA 1YS6A 1F3OA 3Q6NA 4H27A 3HO6A 1HE3A 3EQ6A 1MW8X 3P9PA 3AR7A 3FOFC 4YJDA 5KTMA 4EKIA 2ACKA 1KOGA 1VRVA 3DP9A 3AUYA 2WKRA 1FUKA 4K87A 3S2EA 3BQNB 5J5VA 4U3JB 1Y8AA 5ELMA 4ZZ1A 4K7JA 3VYRB 2YC4C 5IUKC 3EPHA 5IF9A 2QEXP 1GARA 2Y68A 2C5AA 4U2KA 2AC4A 3E3LA 1SHZA 4YB8A 2H06A 2W6JA 4NYMR 1GCUA 2YOHA 5KOJB 3ZY5A 3QVJA 2FK8A 1PFYA 1MCZA 4NFLA 2HY7A 3K20A 2HREA 4XM0A 4DIKA 4DR2B 1QORA 2PO5A 1V95A 2PEZA 1L4HA 5LQKA 4DNPA 1QRSA 4CMJA 3ZWWA 3FZGA 1DB3A 1RHRA 2MT9A 3DDWA 1RRVA 1Q0LA 2NUPB 2QU7A 3UMMA 1T8SA 2Q6IA 5BQ5A 4BFTA 1EP2B 3HGQA 3EUEA 1DMRA 1WCYA 3JQQA 4ASUD 1PX0A 4DSAA 2OY0A 3RV2A 2RBKA 1WSAA 3ZXYA 3CD6P 3EZXA 4P9NA 1YR9A 4I4CA 3VR0A 2FZCA 2H7VA 2VCHA 2YZ7A 4C04A 1UC9A 4PS1A 3PGXA 4NDZA 5ED0A 4EF5A 4ZHQF 3VTZA 1E32A 3S99A 4BFLA 4LQLA 3S1AB 2WIDA 4OQXA 2AC7A 1VJTA 2ASVA 3NHUA 3TRKA 3NHLA 2H2DA 3GG2A 4F93B 2COKA 1LX7A 1REQA 1X9IA 3HSKA 4PLTA 5AI8A 2JEOA 3H4TA 1J5EC 3GFQA 3SYLA 1U5BB 1QFYA 2M6SA 1ORRA 3IOYA 1ZD9A 4OP1A 5KU1A 2QL8A 4DTCA 4FMBB 4D4LA 3EDOA 3H3FA 2HDNB 3WGHA 2O2IA 4LJSA 1T15A 5AJWA 3WHIA 1P19A 3F46A 4Q9LA 4NCBA 3TG2A 5JROA 2DUNA 2Q5HA 2ZRIA 1I3LA 5CIWA 1C3OB 4DR4B 1ICEA 3OHMA 3ZWAA 2ZBUA 2VZLA 1W4AA 3LQQA 4R8KA 3WBHA 2YH2A 3GROA 1PZXA 3SQWA 3PFNA 1GPJA 3FOBA 4URUR 1G2IA 4LXXA 1STOA 1CUGA 2ZB3A 2I76A 4WX2B 3TIGA 4X20A 4C4XA 4MVJA 1ZA1A 4WBSA 3CRNA 3KALA 3HO1A 2N3ZA 5JARA 3M6XA 5DXFA 1HL7A 4MKIA 1I2CA 3FFAA 3B8HA 1DU4A 1N8TA 4MVJE 4LRSB 1XQYA 4CYMA 2XGJA 3W05A 3IVRA 2BMEA 2PIAA 4X85A 1E6KA 1IUKA 2JZNA 3HB4X 4NBWA 1KP9A 1U31A 3M4XA 4MVJH 4XIJA 2H1CA 3HZRA 3JWIA 2ETXA 3UC5A 2XNJA 5CFOA 1KY2A 1YVPA 1MORA 2V3VA 4KAAA 5FA8A 3RABA 1NTOA 3WBFA 2ONCA 3NLLA 4JI1C 2G6TA 1XR3A 4LI3X 1H94A 2JBAB 3GJRA 4RTJA 1E3TA 3EQZA 4Y2HA 4ZQHA 3FCEA 2XTZA 4B8WA 4KIUA 2SHKA 1L3BA 4TLDA 1HDCA 2G6BA 3R0ZA 2E1RA 2RIPA 4WRRA 2P9XA 1UEIA 1OROA 3V2IA 4JU9A 3H65A 3WL3A 4E4TA 2AXPA 5C9ZA 5EMKA 3NWBA 4FEAA 3I04A 1YV9A 1TIBA 2WFLA 3VGPA 3KP1A 4TROA 3X1YA 4OP2A 1M6HA 4ZLPA 5KNBA 1EP9A 3L8MA 1A8HA 1BN6A 5G3YA 4U0FA 4MROA 1VJRA 5JI2E 3OQIA 3UJDA 3ZBPA 4JKIA 1S2MA 5LQJA 2VXYA 3WLEA 1VSQA 3PTAA 4BVHA 4MR7A 3V2GA 4JLDA 4BPHA 3OEHA 4NH4A 4LQ4A 1IFXA 2IP1A 4RY0A 2CV2A 1C29B 1IVSA 3FDZA 1ZD4A 1TAUA 3O8BA 4RTMA 1QO0A 2H5EA 4ACBA 5KNBH 4RD3A 3MGBA 3T3NA 1J8FA 3DVQX 4YDSA 5JCXA 2ODAA 5GJWC 4C5AA 1RBYA 5IAEA 4MVJG 2JIDA 4Z3OA 4CKEA 1ZNQO 4Y2SA 3RO7A 3FAZA 2PH1A 4GMXA 5FH9A 2AFDA 1IY9A 2NLOA 4EIWA 4EG3A 3ESBA 3UK6A 1O94A 1QG2A 3UHAA 6PFKA 4PO3X 4GWGA 4PLVA 2G08A 4OHCA 2I54A 5GM1A 2FPPB 1I4EB 1EG7A 4B4KA 4EPRA 2Y2UA 3DEFA 3WGOA 4JKOA 4PPQA 5BURA 3UMSA 2HSEA 3PXAA 4GX5A 2X42A 4NARA 4P5EA 3GB9A 2DJIA 3FYUC 2REQA 1RM4A 3U5ZB 3HI4A 1GUDA 4XKJA 3EVDA 2EERA 4UCFA 5PNTA 1DUSA 3OP4A 1J8YF 2MINB 1URPA 4D8TA 3AX6A 3ID6C 2P9QA 2XA2A 2WLSA 3CY6A 4DM3A 4MMXB 1J6UA 4W63A 5DTMA 1ZU5A 3LZ6A 4NRDA 3V4ZA 2R6DA 3FWZA 3WICA 1YRQA 2HBYA 4IMPA 1HG0A 3OICA 4FNMA 4AECA 3Q5GA 4Y2VA 4NR0A 5HF6A 3BBLA 5EPUA 2ACWA 1PJTA 4CR7A 2HRZA 3BIOA 2IWRA 2HDHA 2QX9A 3TLYA 3EQ7A 4R9SA 1S0UA 1ENYA 2NO0A 3BL8A 4JI2B 2RH9B 1YNOA 2A5YB 4NBTA 3N2GA 2ZETA 4KJZA 4MV7A 2HRRA 1BXIA 1KO4A 2PYIA 3IQIX 5BS2A 3KT0A 4RPLA 1YZKA 4NOJA 3CZRA 3LO8A 3QVXA 2BEVA 3LLSA 2AG8A 3W2EA 1L7RA 3MMPA 3AYXB 5L9AA 2QUJA 2PZAA 3AVPA 4L5JA 4F91B 2Q5OA 3MJTA 2DFNA 1D7OA 4FPXA 3MCZA 5CVUA 1FTGA 3I12A 2KDNA 1WE2A 3DBOB 5DXAA 1PHRA 4DUGD 4BFZA 1I2MA 1XQXA 4KACA 3FVQA 2B8NA 2E6UX 2MYUA 2VL7A 4AKHA 1NN5A 1W85B 2CY0A 1PZMA 3G02A 1Y4DE 2YQ4A 1ENZA 3H04A 3GFRA 1XUOA 3PDWA 5THQA 4TXMA 4MVJF 3OQVA 3ZIUA 1CYEA 1A27A 2B25A 1YITP 4R8LA 2QZSA 2MOKA 3I73A 1P5JA 4BB9A 1QGAA 3HJRA 3LBYA 4E7OA 1XZEA 1HA3A 4CMCA 3VKWA 2PL9A 3ROQA 2CLMB 1GN9A 4KWTA 3J80D 3S0JA 4AY3A 3ICWA 3TGWA 3U43A 4H16A 4YRIA 1EM6A 3QEAZ 2OBNA 3UZ0A 3DPIA 4W82A 4PWVB 1SIUA 4HUJA 3AR3A 2J09A 4PNEA 4L3WA 1XEXB 4CL3A 1AF8A 4AM8A 3QFFA 3SM9A 1U3CA 1I4OA 2VCEA 3L18A 3AVVA 3A4NA 4RVSA 2W48A 1KK2A 3BYZA 3G85A 3BMOB 3WYEA 3JXEA 3TKLA 4LDAA 2AMYA 1BE8A 4QEZA 4C4SA 3RGGA 1I6MA 3A1EA 3SHFA 1AD2A 4PZ9A 3H75A 4CKCA 3I23A 4Z53A 4R68A 3ZGLA 1G4UR 5FBVB 1NWHA 2V1UA 2ZJYA 2WJHA 4ZCSA 1YZVA 4C0AC 4BMNA 4TUYB 4ND1A 1TM1E 4KTTA 2N6YA 1SBIA 1VLJA 3ZCTA 2ANBA 3UWSA 2KX7A 2XPCA 1QS0B 1D2MA 1BW9B 1Y7PA 2YWEA 4KTTE 4EF6A 4F9FA 3FOZA 3UCXA 3BVPA 3PHBE 2QNWA 1MTZA 5IAJA 3VMMA 1E3LA 1AV6A 2DPYA 4J0KA 5L4SA 5L3VA 3FNIA 4UDXX 2NVWA 4JROA 2ZSJA 3RIMA 1OLUB 3GLHB 3NOXA 4P83A 1THZA 5KWIA 4MICA 4HDOB 4URFA 4L7VA 5JJKA 4PAOA 3FETA 1SRRA 2PKEA 3U4GA 3NKFA 1UWDA 1CRWG 5DULA 4BZZA 1V7QA 2YFHA 3RARA 5IAAA 2DP4E 2WPDD 3O8QB 1GT6A 1T0BA 3ZZTA 1ZOIA 2JA2A 2YIVX 2Q9BA 4HKGA 2OHXA 4UE3S 2Q4BA 2HSWA 1U98A 2NZ8A 4D79A 3AETB 5G41A 2QD3A 1JDNA 2B2XA 2WVGA 4CKWB 3ELYA 1BGXT 3KQPA 3HCFA 4UUBA 5KQSA 4M9SA 5ICMA 2HLPA 2OCBA 1Q3TA 1Q6YA 2BFBB 1THGA 5JTTA 1L8AA 2C99A 1XRPA 1PYOA 2O9JA 1F17A 1VJDA 2JKVA 3AEXA 4Z8YA 1PX2A 4B4DA 1GQRA 2OZVA 4MW0A 2AG6A 1KEEA 4H7FA 2R751 4DV5B 3KSUA 1O95A 1OBVA 4HP8A 1DX6A 5DFAA 4K9RA 1L3CA 4B35A 1J21A 5CVJA 3T35A 3ER9A 2ZSKA 1WMSA 3QVOA 4U2DA 4DMFA 1H4QA 1TCAA 3JQ6A 2OOKA 1P8JA 3USZA 2PNGA 2UZ0A 2G9RA 5JJBA 2ODWA 3WQRA 1E59A 4PWYA 2YHUA 1GWNA 2P0AA 5ITSA 1OCEA 1FE8A 5B55A 5JV5A 1WSWA 1YBMA 1V0JA 1P2UA 4FFDA 2WHYA 4DIFA 5T3UA 2VPQA 2JCSA 3WRVA 3WFJA 5TMBA 1I30A 4NYMQ 4WERA 3E3MA 1EZZA 2ZU6A 1TTTA 1YO6A 5DT2A 3SCZA 4C30A 1JPUA 2P2CA 2W6MA 3JWGA 4D3YA 2D8MA 3TSAA 3KE9A 2O1XA 1JAYA 5KB3A 2WV9A 3U19A 1YJWP 4ZCRA 1O7JA 2D0PB 3EJBA 1P3DA 3PSHA 4CM1A 1V5FA 4JYPA 4QA9A 1T5SA 4DCUA 2F1JA 3IQHX 3O3NB 4L15A 1CUIA 3FSEA 5TMEA 4FGLA 2FEKA 2XUOA 2ERYA 4FHCA 3LGAA 1ZRMA 3I3OA 4M22A 4N47A 3LRYA 1GFIA 2ORIA 5JEDA 3BTSA 4ZALA 2WF7A 2A1UB 5EY5B 2I9PA 2BUCA 4UBNA 1S8NA 4AXBA 3LXMA 4BVAA 4BV8A 3GDOA 3ENNA 4LYJA 3DLTA 4C0SA 1BHQ1 3QUTA 4L7QA 2W6ID 4FOOA 3RYFB 4IVPA 2IXDA 1XZIA 2C59A 4G81A 5TPZA 4DIEA 3ZV5A 4N01A 5BUSA 4O4IA 1NY5A 1EUYA 3A6LA 4XYMA 3A1FA 1U4NA 5A3SA 2UYHA 2A5DA 2NVUA 3VJRA 4E46A 1NF9A 3CF0A 1S9HA 1C9KA 3ZNQA 1A7KA 3Q11A 5FPKA 1M1NB 5JU6A 4YCAA 3GDWA 5JPIA 2EARA 1OXXK 1BU5A 2RGCA 5BSKA 3EXEA 3HDJA 5AD1A 5CLJA 3RS0A 4BTEA 5CGQB 4EA8A 4N5NA 2HN9A 1H5QA 4X41A 2VPZA 3EIOA 4KUGA 1ECCA 1KKLA 4QX6A 1ZGHA 1YKFA 1LVGA 1YQWA 3VFDA 3RRYA 1WZ2A 4YY3C 4KGXA 1T9ZA 2GCNA 4MLDA 4ER5A 2DR3A 2CLFB 1Y0BA 5H5JA 4FWIB 3CF4A 4R1PA 1N92A 4BC7A 3KFXA 5KPJA 1Q22A 3TCKA 1MB2A 2QX8A 1JXAA 1WMAA 5KNLA 3GCZA 2HMYB 4YA6A 4HDAA 4QXMA 1AQIA 2QJFA 2GEVA 1U7ZA 5LMUB 3IAM6 2VP9A 2QNBA 2G9QA 2CMFA 1NXVA 4XSHA 3JWHA 3NORA 1Q0RA 4NBSA 3A0UA 1WVIA 3N6RA 2ZDHA 1EX9A 4YRLA 4Q4JB 1WU8A 4D4KA 5AKIA 5ALMA 4C78A 4CGYA 2AW5A 1UMKA 4NAHA 4BPRA 3U62A 1A9YA 3AMVA 4OIFA 1MC8A 1Q1BA 2FQXA 2JFNA 4MP8A 3A31A 3LYHA 3JAWA 1ZXLA 2D2FA 3IUYA 3WIBA 5F4BA 5KEIA 4JA0A 5BQOA 5ALYA 1MGOA 2ZSFA 1JQEA 1VKOA 1DV2A 1YZUA 5F35A 3NAQA 2DG2A 1LLUA 3E9NA 3L6EA 3DVAA 3D7RA 4KH1A 3ELDA 1RPJA 4UDYX 4P81A 5BW8A 1DAFA 4MV5A 2WNSA 3CH7A 4OV6B 5AI0A 1RE0A 1YFLA 4ODJA 1KI9A 3ONFA 5HFAA 1BWQA 5EGSA 1ZD8A 3AKCA 2HEIA 1AN0A 2FUEA 1MOZA 3PNYA 3HKBA 4YH1A 1XMOC 1XAJA 4UUMA 1W36D 1H5NA 4HDMA 1NXPA 1FQWA 1NJ6A 1RHMA 2B4YA 1B0AA 2WA1A 3ECSA 2Y1CA 3GUYA 3WGMA 3NAGA 3B7PA 1ILEA 4BRSA 1O96B 2MTBA 3R7BA 4ME6A 3O26A 3RTDA 4JBIA 5K4AA 2R5FA 1L2TA 3CF4G 1XC7A 3WL4A 1ZUNB 2FEWB 2ILTA 2ZBPA 3HABA 1Z0IA 3KEGA 3FXAA 1E66A 1UDBA 1JKIA 2QLMA 4S1NA 1ID1A 4BPFA 1HNWB 5T8KC 1TYBE 1KFKB 3MTGA 1ULTA 1EI9A 3O2SB 3R3UA 3ZXXA 1A50B 2DBQA 5JRJA 2ECFA 3WK4A 2O07A 1JKJA 3DBHB 3Q15C 3JPWA 4HWSA 4ZMRA 1V71A 4IEIA 1ZB8A 3N3AC 2QR3A 1SQ5A 3ER6A 4PYRA 5DPMA 1F5NA 2RAFA 2Q9CA 3CNHA 4QVGA 3QV1A 3GJ6A 3L8CA 4TPSB 3QE2A 4DM7A 2O2DA 2YY6A 2PEOA 2YUIA 1KAGA 3EUWA 1EK1A 5FUMA 1VG1A 5BXQC 4HQ6A 4J4HA 2FQQA 3M9WA 2H51A 3B82A 3I72A 3NETA 5D86A 4LTNA 2P4HX 3E0XA 3RT7A 4BFXA 1X74A 2WYVA 5CHEA 4KO8A 3DL4A 3HSYA 1RAAA 4F8JA 2NYAA 4YXWA 2BZGA 4JODA 1FFBA 2J33A 5HYVA 4D45A 4UXHA 1C3LA 4FJ1A 2C5HA 4RC9A 4O4IF 4OBWA 2PS3A 1M8FA 2JGKA 4K9LA 2IIVA 3OKAA 4MQEB 3UJAA 2C2ZA 4GYYA 4K3UA 2QM0A 3VHRA 3KJNA 1YNSA 1Z3CA 2WWYA 1XCPA 3CGGA 2J5KA 4FMDB 2BZ1A 3QELA 1HQCA 3A2NA 2YNMD 4D9CA 4F4CA 2IYAA 1CY2A 1U4OA 3KAPA 5AKYA 1BEZA 3EC7A 2JC3A 1KWKA 5E4YA 3RRJA 1SZDA 5TEWA 4UTPA 4BUZA 4AUKA 1T8WA 5FFMA 1W7AA 1TZBA 3KCNA 3GJ7A 1E0SA 3CLKA 3S68A 2DQ4A 4LSZA 2HUNA 3L0ZA 1QIDA 3MOIA 4RA6A 4Z1MD 3FLAA 1YUMA 1UK7A 3HH8A 5ALOA 3DFIA 3QF4A 5DCYA 1O95C 1Q44A 1U7XA 3GGCA 1YJ8A 3IV7A 1OU0A 1IHOA 2P5UA 1Q2UA 4MMYB 3RSHA 1U8XX 4WN3A 1DBPA 4D3DA 5DK4A 1N5KA 5HVCA 2NUTA 5FPPA 4W6ZA 1Z8DA 1Z4OA 4HDNA 4HDRA 9ABPA 3F3SA 2CXHA 1GGHA 3Q7IA 2VDWA 1GA1A 4PS0A 4HWTA 3TAHA 4OI1A 2OFFA 4CT0A 2EIHA 3UFBA 1WPXA 4ZAVA 3QNUA 2JPDA 1D4FA 3RJ5A 1SJ9A 4WASA 3V5NA 1V8ZA 4MO9A 4Z0PA 2OQ2A 4MEBA 1S3GA 3ZVLA 4FFWA 4RQAA 2VSXA 2DT5A 1G3RA 2OM6A 2NG1A 3DLAA 4QUIA 1UDWA 3U9TA 4MPJA 2UUAC 4YP1A 4HRAA 1YTLA 3K5HA 3UJ9A 4K0RA 2B5OA 3KKPA 2ZTVA 5DJ5A 1E5QA 1KJZA 3D2LA 4F2HA 4IJ5A 1SCJA 4C01A 1GGVA 4WE3A 3WLRA 1XDBA 4Q7JB 1UT6A 2QRVA 4G1UC 2P35A 1KERA 5DTIA 1VPDA 2XT6A 4OG2A 5HRAA 2Q3FA 4KO3S 4W8HA 2V7VA 5IT9D 1GPWB 1FDWA 3SJUA 4HWPA 3ITDA 1C1XB 3C8MA 4DR7B 4IV8A 1V26A 2ZTLA 5C53B 1JEQB 2A84A 1N36C 2GEKA 1NMQA 2P2MA 1D0SA 3GO4A 4G0VA 2BDTA 4UPEA 1TQ8A 4UCXA 1DKUA 4OSEA 3ZU6A 3T5GA 1TK9A 2BMDA 2LOLA 1A77A 1JIUA 2ZRCA 3DE7X 4RY8A 2QLTA 1JG4A 4MUBA 2XEXA 2MR7A 1A9SA 4MQBA 2ID9A 4DG8A 4IDCA 5TQ0A 4LJYA 2H4XA 2A2ZA 3E7XA 2A3NA 4MVWA 4FT4A 2R6JA 3OQNA 4PRYA 1L5ZA 1CP3A 1M2EA 4DRXA 4AKTA 4YO8A 2RB5A 4ZZ0A 3ZZMA 3BJEA 4YAWA 3IOCA 5SYAA 4DQXA 1CFZA 4OQZA 4QFCA 4XB6B 4BFUA 1VB3A 2XTJA 4LF8C 4MARA 1NJGA 2CHEA 4AY5A 4DF3A 2F3TA 2NVOA 4AJJA 3U1TA 4UE6A 3SJZA 2MDTA 3ZXIA 3UFXB 4B82A 4DLUA 4ND4A 4ZVSA 1RFLA 4OHKA 3B51X 4L72A 1DT3A 2PZFA 1T1EA 2DR2A 1EWTA 2Q29A 1CIJA 4KLAA 3BILA 4ZOLA 3ILHA 4F97A 1BGVA 2IYXA 2MJLA 1D2NA 4B6EA 3RBZA 4BN5A 4CUJA 2XE4A 5MFPA 1H1LA 1A71A 3GV0A 1UMBA 4RKEA 3A7EA 3MAJA 3DE1X 1VHQA 3PX7A 4AMYA 2N50A 4YJ2B 1QAQA 5I9IA 2W00A 4C7OA 3EZLA 5K4GA 4OUDB 5JASA 1JQDA 2W7TA 5JXJA 3Q7QA 4XFXA 3NWJA 3WV4A 2PRYA 1ZAYA 2GVNA 2C4NA 1ZMOA 4HMOA 1UADA 4FR0A 3PE6A 5BNIA 2CN1A 1N9GB 2J3HA 3RSQA 5BSTA 4OKSA 3LO5A 5THKA 1EDZA 1UIMA 3CVVA 2VTBA 4QNNA 3VR2A 1AIPA 4BU0A 1OXSC 4F6RA 3MCUA 4M46A 5E4FA 4E12A 4JI5C 1KMHB 2CGQA 2D06A 4HLDA 1YI2P 4ZJUA 2X9LA 4XWTA 1G5HA 1ULSA 2G1JA 3O4RA 2XCSB 3H83A 2AR7A 1WPQA 3O2JA 3BZUA 4DCPA 5JYDA 5DMXA 3JYNA 3KOOA 3A4IA 3UMVA 2OGTA 2NN3C 5DYNA 5A06A 2E4ZA 4DWWA 4P7KA 1FRZA 1VE6A 3T9CA 5FORA 3T38A 1BHSA 3U7HB 2XE8A 2IEAA 4II2A 2CBZA 4DR6B 3NHZA 4CQNA 3E5HA 1TB4A 3DJYA 1X70A 2GM4A 1I7QB 4BLUA 1UIRA 1UP6A 2P30A 1MBZA 3KR1A 1HQDA 3G8YA 4DEXA 1F8GA 3W6PA 5F2NA 1Z6YA 3MTDA 3OZIA 3GD5A 2QTGA 4FUQA 4OFXA 2CNWD 4FMPA 3MK31 3A36A 4ZT7A 2RGGA 3WRWA 3IAUA 3WTBA 2GA8A 1RE1A 3SC4A 4KQKA 4ZC8A 4G56A 3IV9A 4PY2A 4GMHA 1Q0ZA 3I8SA 3UA4A 3I6BA 4G1MB 3U48A 1NXTA 2PN2A 4HN2A 2B7BA 1QLJA 3B78A 3AU9A 4C5BA 1ZUHA 4U7PB 3SXJA 1SZCA 5L4NA 3OKFA 1FMLA 1FU4A 2HW8A 1J8MF 4C20A 2O5CA 3QXHA 1TUGA 3JSXA 2O2XA 4XPIA 3RU9A 1BMFD 1PK7A 3FLEA 5DSTA 3OM9A 4LXYA 1P6XA 2WBLC 4FYPA 1IWBB 4PIPA 1RQRA 1E58A 2HH9A 6GPBA 5FCDA 1KZ7B 3UPDA 5LD2C 1KK0A 2EHSA 5AHXA 4ZOQI 2HHHB 2ECKA 4ZVLA 2HV8A 4II7A 1GQOA 4FTFA 2E5LB 1SRQA 2WAOA 4EPTA 3RYIB 3PJEA 4UC0A 3GLTA 3PG5A 1ACPA 3MS4A 1PJBA 2BJVA 1IY0A 1BJKA 1P4HA 1UJBA 2O8EB 1QHNA 3C4VA 3QFSA 3HYCA 2YJZA 2RAPA 3FI0A 4MR9A 1J5XA 3CH6A 3WWYA 3RYHA 1XHJA 5DIZA 5DI3A 1XNHA 1T9DA 2XBMA 1U1EA 5I8ZA 3H4IA 3TPFA 4IG9A 5HJ5A 1Q7CA 1HQKA 4Z9XA 1Q7GA 4H2YC 3A14A 4IPTA 3RW9A 3GNLA 3HDGA 5K05A 1HDRA 1NE2A 1V1RB 1CB0A 2BWJA 1S5PA 1YI0A 4QHSA 2GPYA 4FFRA 4A8JB 3SY8A 1V35A 3LVBA 2QE7A 2OXIA 2VT2A 2Z51A 1PNRA 4HNUA 3N0VA 4LV5B 1FFEA 4BFYA 1YQUA 3CM0A 5LNK1 2JIRA 4NOLA 4DUPA 2PR7A 5AK3A 4C3OB 4ZOLF 4PZPA 1IK6A 4JXXA 4FW9A 4G63A 2VQSA 1SA0B 2GJSA 3ORFA 4QICA 3OJOA 3KVYA 3R3ZA 3VR5A 3LM8A 5P8WA 3T7RA 5G4LA 1NXXA 5GM2A 1WL8A 4MYRA 1PU1A 1SGWA 1RMTA 5CK4A 1ZGAA 3LMKA 1L1QA 1ZLYA 2A0XA 1R6VA 1CF9A 1T9GS 5B2EA 3L40A 2JJ2A 4I4IA 3D3WA 1D5CA 1ZRHA 2ZYGA 3UKJA 4ZI5A 3Q3VA 5CAEB 4E1AA 4XQ0A 4OHBA 2OO3A 2HCBA 5B5SA 3DWIA 1RCFA 3VR5H 2B92A 5GOTA 2YYSA 1BZYA 2K94A 2HM7A 3BRWA 4F7DA 1JHOA 3H6KA 1JXOA 1O87A 1FFWA 1EFPA 3FTNA 1U9IA 3QPWA 3HYSA 1ZXBA 3KYBA 1FJGB 2P1ZA 4A7PA 1RKXA 2D7VA 4DKXA 3FDXA 2GBPA 4EUSA 1GYRA 1H2HA 1SVKA 3V80A 1FX0B 5HUHA 3T4EA 5AFSA 4QXQA 2GI4A 4MQLA 1GXGA 4XDGA 4YXFA 4JLSA 2GEFA 1QFMA 2IITA 2RD2A 2Z6UA 2QQFA 4MI3A 1D2EA 1F1JA 1T5BA 1GFZA 2QTRA 2ATCA 3QKSB 4R05A 3KZ1E 3QNMA 4DNFA 4CFZA 5BNZA 4QG3A 3OTGA 1U1FA 2R7LA 3FNBA 3ZKAA 1FXSA 4C7BA 2VYVA 4IMRA 4RL6A 1KO7A 1Z6TA 2P5SA 2UYQA 2AN9A 3OM8A 1RRCA 1HKUA 2XMPA 1ZMXA 5K0BA 4BECA 1JWBB 3VH2A 5BRNA 2ERXA 4UW9A 4QQRA 4HO1X 3G2JA 4ARZB 1PJ8A 1DJLA 1BD4A 1ZNZA 2FWJA 2OG1A 5I7UA 1ADGA 1LLFA 3E5RA 4NKRA 4RADA 5A3RA 4A0QA 4EF4A 2GB4A 4BLVA 5F52A 5AUOB 3BMQB 3VJLA 3D6MA 3T1QA 3HXLA 1MVOA 5FAKA 3DFZA 2V6FA 1CQPA 3BJRA 3MGGA 1AJEA 5A5EA 2PNJA 2Z2XA 2K92A 1XMQC 3CIOA 4YDQA 4O4LB 2IOYA 5K3AA 1Z6GA 4UOQA 1YHZA 2XNSA 2YN4A 1SUCA 1L7NA 1XWIA 1ML8A 2M5RA 2XMZA 2UVQA 3HCBA 2AF8A 2Q0SA 4DCVA 1N2XA 3Q10A 4MIYA 1NR5A 3LPCA 3TAUA 2A86A 2QRLA 3GT3A 5KNCD 2FAEA 3ZVKA 1Q1GA 2ZJAA 2E4WA 4DZRA 1OXUA 4YJFB 1KDVA 5IDXA 4R0VA 3QMMA 4R71A 4I5FA 1QFJA 4OQFA 2IU4A 4EJ0A 4XJTA 2B1RA 1I7PA 5B3KA 1C9YA 3HEAA 1RQNA 1L7XA 2CCGA 3RFVA 5D5QA 5HPYB 4PCVA 2XRMA 4LVOA 3CWCA 1VLQA 4XYGA 4Q02A 3VVLA 1XQ1A 3D6HA 1UPCA 3AIIA 2ZR8A 5KVQA 3BHJA 5FHRA 3AR6A 4MKZA 221PA 2PK3A 5CPFA 2ISCA 1AB6A 2IYPA 2NQTA 4P98A 2KOPA 2BLLA 1CCWA 4OM8A 2OCAA 5MGNA 2DHDA 3C7CB 2VDQB 3PDJA 3T0FA 4YAEA 2Q5LA 2HRBA 4U39A 3AY6A 2HFKA 5FEUA 1F7UA 1JG7A 2OBVA 4EGCB 3W3ZB 3UJCA 3IO5A 1ORHA 5C1DA 1GAWA 4Q3DA 3M1AA 4NULA 3I0NA 4G8CA 3HJGA 4MQMA 3DFKA 1A9QA 4XQ9A 4U1RA 4HEJA 2GEJA 4I99A 1S72P 3L0PA 4KBGA 5A03A 3H2IA 1C8KA 4ZVKA 2I4MA 2ECQA 1MAAA 2OYCA 2JG3A 4L0DA 1ECBA 3QY9A 2XNDD 3HKEA 5FI5A 1WXEA 5HFNA 4EL5A 3X1XA 1IXSB 4ZPXA 2C5LA 5B57C 2A9FA 4L8YA 3VSCA 5I9TA 4MW6A 3MWEB 4RGBA 3NHFA 3VXKA 1FLOA 3EX7C 1JE1A 1JMYA 4NXNC 4YRZA 1LLQA 1K66A 2JAWA 1RI1A 4KO1S 3N7UA 1XLUA 4MS3B 1N6OA 2QN7A 3HDTA 2IH2A 2BDEA 4TT8A 5LQNA 2WICA 3KE8A 1E79D 5JAQA 1MVNA 3P0HA 5CZDB 3LPDA 2EF0A 2W2QA 5KWSA 4KPYA 4YAKA 4YMLA 5HDBB 4RK0A 4PUHA 1UQUA 3L4JA 5CNJA 2X5JO 4YHHB 2GM3A 3TECE 2A4KA 3ZLJA 1R6XA 3ZD7A 1OYVA 5FNVF 4UAJA 1NSYA 3S6JA 2WE7A 1DV1A 2WB2A 3TQHA 3N8IA 3CPHA 3OTIA 4RJLA 4QATA 1CZUA 1Y3AA 1OQAA 3NBQA 2NXJA 4TRMA 3N8HA 4PN3A 2AYYA 2BFWA 2J1LA 2G77B 1YRAA 1QVFO 4BV9A 1D4ZA 4QXOA 3C1UA 1U3GA 2V1XA 1V1MB 2GYYA 1VLHA 4NPCA 4FFBB 4W1QA 1QVVA 3DQQA 3NUGA 1GRQA 1ZESA 2FW8A 2N0SA 2ZJ8A 5ESDA 1FS6A 4U63A 3L8EA 1MNAA 5CHYA 4FDMA 1F12A 2W8ZA 4Z6KA 2WJ4A 5C81A 3LV8A 3WISA 4ZK2A 3TNLA 2QVCA 1PWXA 2MSDB 1NBHA 1ZSVA 2X5NA 1FFGA 2NGRA 1UDCA 3TVDA 2ZXEA 3HXOA 4AMVA 4U5QA 1P0CA 1FFXB 4F06A 3CVUA 4J2HA 5TF0A 3TOVA 2XIJA 1WKCA 3IKMB 3SC2B 4AMZA 4DCSA 4A73A 2ZVDA 4LGMA 3DUFA 1KJYA 2V6MA 3QVVA 2KG6A 1L1FA 5GY7A 1KD1Q 3GZMA 1Y1LA 2WOOA 1NVFA 1KWGA 3LFUA 1UKAA 1E7WA 1BX1A 4CN8A 2C5EA 3L6DA 5AVJA 2GASA 2PJDA 4BNTA 2HU5A 1OFTA 5EKTA 2P8JA 4ZO4A 3EFBA 4NMHA 1OH7A 1LF5A 4RTNA 4L22A 4PSCA 2JGLA 1EK0A 1QYIA 4XIYA 4LF7B 3COVA 4ALIA 3JRXA 4FN5A 2OQIA 4IFBA 2LIVA 3H5WA 3LGSA 3LE8A 2QGZA 5HM6A 4GLJA 4CODB 3CLTD 3NWPA 3HR4A 3DHNA 3DXXA 4RDHA 2P4UA 4NFSA 1EYZA 4Q16A 1NUAA 1XD2B 4TTSA 3U9LA 5K8CA 5GONB 3T3HA 4LYHA 4WJZA 3LJKA 1NW6A 3TL2A 2FSFA 1YDEA 3RUEA 1Z35A 4EUKA 4FLEA 1ZCJA 4GKVA 4WW0A 3TM5A 1Q84A 2X2PA 1XELA 2FJPA 2OTJP 1PF7E 4BVJA 1G64A 2IV3A 3ZVNA 2P65A 2RK3A 1ZEJA 2RI1A 4LYGA 2A67A 4V0RA 4B8YA 5BYKA 4P84A 2I55A 4P7GA 1XTJA 3HYBA 2QUHA 4DRYA 4Q7EA 3GJ8A 4TV8A 1D0VA 1CR1A 2YV3A 2WF6A 4NECA 1T9AA 4JGBA 5B7NA 1LU9A 2WT4A 5DX0A 3K9HA 3L07A 3GT7A 4URWR 4XE5A 5LPNA 2C03A 1CEEA 3G2HA 2VUSA 4AUEA 4BQFA 2A5GA 4PE5B 1DQSA 1GZ3A 2IXBA 5HKBA 3IT3A 4RDIA 4B2PA 1VLMA 5K8IA 1UMDA 1P39A 5ALUA 4PN7A 5IJ0A 1SU8A 1P5ZB 1WDMA 2Q5CA 4P2BA 1EP3B 1L4FA 2ZI3A 4KWEA 1WEHA 2VNHA 4TXNA 1YHNA 4LBVA 1QU2A 3VYVA 1USIA 1DDOA 1U9IC 5E9JA 1JXMA 1N8NA 1J20A 3R77A 2PEQA 1Z83A 3TL6A 1X7DA 2KOSA 2F3RA 3ROKA 3CVWA 2CYAA 3M0EA 3V7WA 1ACMA 3ABSB 1EFAA 1H2WA 3B2EA 4EI7A 5JSZA 3NT4A 4JC5A 5AW6A 1EWYA 1EUCA 3NHSA 1LBIA 4QBFA 2ZIXB 4E5DA 4RLQA 5F3DA 4REQB 4E4YA 2PO7A 1QCZA 3NMUF 2YYZA 3CCLP 4Q37A 2ZE5A 1V8BA 2R66A 2E8CA 1XZAA 1FUYB 1E61A 4HAWA 1VC2A 1SG6A 1Z06A 3D6VA 1WB6A 4GUAA 1D5WA 4Q6WA 4OK3A 1L7VC 1ZISA 5JAIA 1G17A 4XJXA 1QVAA 3T1HB 1XAGA 3ER8A 3I2IA 1DQRA 1GGFA 2C97A 3U4IA 3AF3A 2AOTA 1P5RA 4YRFA 4B7XA 1VIDA 4X6LA 5KOYA 2CNKA 2HV9A 4ZVOA 4AFNA 2HDOA 2C7VA 3PHIA