3RG2A

Structure of a two-domain nrps fusion protein containing the ente adenylation domain and entb aryl-carrier protein from enterobactin biosynthesis
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
611
structure length
611
Chain Sequence
SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGRASIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enterobactin synthase component E (entE), 2,3-dihydro-2,3-di
publication title Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 190
structure length 611
sequence length 611
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3rg2A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3rg2A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rg2A01
3NI2A 2LTEA 2WD9A 3DAYA 4RLFA 1AMUA 3A9VA 3L8CA 2LKIA 4D57A 2K0YA 3E53A 1AF8A 3CW9A 5BUSA 1X3OA 1V25A 2AF8A 5DWVA 3EJDA 4NEOA 2FVEA 2MR8A 4IR7A 3TSYA 2Y27A 2JU2A 2V7BA 3O83A 5HVCA 5BSTA 2KWLA 2KORA 5K8FA 2KOSA 4PWVB 2FQ1A 3VNSA 4RM2A 4WV3A 3GZLA 2N50A 3RIXA 4OYCA 2MVUA 2P2QA 2D1QA 3R44A 4LGCA 2LL8A 3WVNA 2LPKA 2KG6A 2KOPA 2K92A 4BPFA 2Y4OA 2Y4NA 4M46A 3NYQA 5KEIA 2KGEA 2MF4A 3U17A 2D1TA 5KP7B 5KYVA 2KG9A 2MR7A 3NY7B 2FAEA 2AVAA 2FHSC 2L9FA 3C5EA 4G36A 4GS5A 2JQ4A 1HY8A 4U5YD 5E7QA 2N6YA 2QNWA 4DG8A 3WV4A 1YJ7A 1LCIA 4R0MA 2QVXX 5KP6B 3O84A 2L0QA 4RVOA 2JU1A 2FADA 1KLPA 2FACA 1T5HX 2QW0X 2AFDA 4IZ6A 1RY2A 4R1LA 2KG8A 2AFEA 3LMOA 5GTDA 3ITEA 4GR5A 5BSMA 2D1RA 1VKUA 5KP8B 2DNWA 1ULTA 2K93A 2XZ1C 2K2QA 4E5DA 2N98A 4D4IA 4H2YC 2N6ZA 3IESA 2LMLA 2N5HA 3VNRA 3DHVA 3GPCA 2CNRA 1T5DX 3T5BA 3LAXA 4RVNA 1MD9A 2LIUA 4DG9A 2CG5B 5BSWA 2KOOA 5BSVA 4ZJZA 5BUQA 5CZDB 2D1SA 4H2XC 2PNGA 4GXRA 5K85A 3VNQA 3FCEA 3LGXA 2FQ0A 2KGAA 2KR5A 2P20A 3WV5A 1F80D 2JGPA 3QYAA 2L4BA 3DLPX 2XZ0D 4HKGA 2KW2A 5JRHA 2VSQA 1L0IA 4BPHA 4OXIA 3A9UA 4PZPA 1DV5A 4PXHB 2P2MA 4EATA 4D4GA 1V26A 4G37A 5DV9A 4CA3A 2P2BA 1MDBA 3EJEA 5HV8A 4BPGA 1OR5A 1DNYA 4GR4A 3T5CA 2LOLA 5EJDA 2MVVA 4D4HA 2VZEA 3O82A 3EQ6A 5D6NA 2K0XA 2P2FA 3IEPA 4MRTC 2CGQA 3FCCA 2CQ8A 3IERA 1NQ4A 2EHTA 2FQ2A 3CE7A 3G7SA 2GDXA 3KXWA 5KYTA 2KOQA 3RG2A 5BURA 2X2BA 2N5IA 3LNVA 3IVRA 1PG3A 2M5RA 3EJBA 4RMNA 5IFIA 2QVZX 4RLQA 2GDWA 2GDYA 1T8KA 2MY5A 1BA3A 1MDFA 3NYRA 4FUQA 3IPLA 2MD9A 3B7WA 2KGCA 5BSRA 2LIWA 2L22A 4ISBA 4RM3A 2K94A 3U16A 2QVYX 4GXQA 2EHSA 3T5AA 2FVFA 3E7WA 3ETCA 3PBKA 2P2JA 3GZMA 1PG4A 4D56A 3E7XA 3CW8X 4R1MA 4W8OA 4H2WC 1L0HA 1ACPA 5BSUA 1HQBA 2ROQA 2KGDA 2FVAA 4FUTA
chains in the Genus database with same CATH superfamily
2CE2X 2JFNA 5J5VA 4GICA 1D2RA 5C81A 2JFBA 3NHWA 4GYYA 1UBSB 4YT5A 3BD9A 3RU7A 4M46A 4RFSB 2HDHA 4BZPA 2HRCA 2VPTA 1GGNA 1ZKDA 4P8RA 1CV2A 1POWA 721PA 5EPEA 5DI3A 3R7DA 2GHQA 5EIEA 1K7XB 4S1OA 1ZMRA 3ANMA 1RHMA 2CC2A 1KO5A 3U0BA 1AV6A 1GNTA 1NG9A 2ZZNA 3AL3A 4XLZA 1KE2A 3OWXA 1WCIA 1KYZA 2FEMA 4GL2A 4MVJD 2GF0A 2OO5C 3ZGZA 2IH2A 4GPEA 1KMCA 3TPCA 2YWGA 1RCUA 1T6ZA 3BAFA 4J0JA 1KDVA 1T0IA 2NYAA 2RGYA 3JD2A 1SQFA 3CLVA 5AVSA 3CZ9A 3P9NA 1D7AA 4CM1A 2RE8A 4YJ2A 1MHPA 3O47A 5CX4A 3KOUA 3RT9A 1IG3A 4BTEA 1UMBB 2P1RA 4JQSA 4WESA 2XJ9A 3DMNA 2FN3A 3B7GA 1QRJA 3CR8A 4YALA 4HNUA 3S7ZA 4IWYA 2HAEA 1N2EA 1F3LA 1B26A 1PK8A 1RRMA 3B3AA 1EK0A 2HXGA 4XSGA 4IGKA 4CQJA 4UXJA 5KYYB 2E3JA 2HSDA 3OZRA 4JEHA 5G40A 3FVRA 1F80D 2IEGA 1GADO 5EIXA 3GJRA 3UZ0A 3NOVA 1UMCB 2C92A 3CV3A 2Q5JA 3HVJA 4P2BA 1P8AA 3SQWA 3RTEA 4TKMA 3LRYA 3FLEA 1HYBA 3JZFA 1JLSA 2P5TB 4ZTBA 2A30A 4N7RA 2ZTUA 5IFIA 4EO4A 4DV1B 1T8KA 2HT6A 1K2VN 4XB6B 1UODA 1ZM2A 1U5BA 3TR6A 4OSPA 1YL7A 2ODAA 1OPXA 3CWZA 3NUGA 1VB3A 3P7MA 3IEIA 4CM4A 4EWLA 2VRNA 4MW9A 3FTCA 2XKJE 1KETA 1MV8A 5A9RA 4JI8B 3GRFA 3OMXA 3U7GA 2V5AA 4JLKA 3IAM6 2HEIA 3OEHD 1QR2A 1XDZA 1A97A 2H2WA 4O63O 3FVTA 2DNWA 1U8EA 3KKQA 3KC2A 2X1VA 1A4XA 1UAAA 3OZCA 1RKBA 4Z9AA 1XFAA 5T8TA 4OHMA 4FMCB 3DB2A 3OSUA 4G81A 3QLJA 3GJTA 3NKLA 2MINA 3IQZA 4YP6A 4JQYA 4C0BA 1XZQA 1QSGA 3TQQA 5C3UA 1XIVA 3O03A 4LF7C 1VKJA 1QCDA 1SBQA 4FBGA 3H9BA 1UFQA 1FFSA 2UVQA 3C3PA 2ZQYA 3QP9A 5HKOA 3BMQA 4DNPA 4MWGA 3ZIUA 3DFZA 3WBKA 2I80A 3ZY5A 1JAIA 2KOSA 4DMUB 3I9NA 1HNZB 2JKZA 2O2IA 3K53A 4B4UA 3BAZA 3TBFA 3GAZA 1TGVA 3E3AA 1EOQA 2F3QA 2F1OA 1XTBA 4DTIA 2JLBA 1UJ6A 1I0ZA 4P4GA 4JXJA 1BE6A 3K09A 4H2YC 1CCWA 4YH1A 1QTNA 2VHCA 4KZPA 1C8VB 5JALA 1C14A 3FUCA 3QG5A 4N6OA 4QYIB 1ESCA 4GOJA 1QIMA 2QLMA 4FGJA 5ERYA 3ZLJA 2CL0X 4EEXA 4H7IA 5T4HA 1QOQB 3IUPA 3UX2A 1WO8A 2AYZA 3JYOA 4JUCA 4DA0A 4G4GA 4A5SA 1YOVA 4BVLA 1TLFA 1GQSA 3F8WA 3UOAB 1XTPA 1CQJA 3F6SA 3E9NA 4QT4A 3KL2A 2PMDA 1Q81Q 3CSDA 1JG7A 5AXAA 1WAMA 4PSUA 3ESRA 4GR2A 2ZYWX 4RGBA 1QRUA 3PUZA 3PIRA 4OKNA 1W8DA 3H2TA 4FNMA 2B69A 4DIEA 2ZB8A 3H4MA 5B6PA 2X5KO 3BXOA 2B9EA 2FFJA 2VK4A 4BX2A 1NQTA 2WJJA 2XLBA 3D81A 1UAYA 3JZIA 1SUPA 3KQVA 2GZMA 2J7PD 3ROQA 1KJ8A 5ISMA 2QR2A 2M2IA 1CF9A 4QGSA 3DE6X 5AJWA 1NOJA 2HCJB 1Y34E 4Y0NA 2HK6A 3QLUC 2ZI7A 3IJRA 2ZYVX 3OA0A 2FZ4A 2J08A 2I1VB 2RK3A 2YOGA 1XG5A 3W8FA 2LKDA 3EVCA 2FMIA 2RDMA 4M9XA 3T4EA 4GNKA 5CFRA 1WXQA 4G1FA 2GEBA 4IIGA 2YQ4A 2HTFA 1L7PA 1F2VA 3WKDA 4KQ9A 4EJMA 5DPMA 3KQPA 4G1IA 3BD8A 4QREA 1YCGA 4K88A 1U2GA 4F7DA 4IR7A 5F9MA 2O20A 4EJSA 1DO2A 1XEFA 4XYGA 1TLLA 5D6OA 3STXA 4OHZA 3ZW8A 3WMWA 3LCUA 4CQMB 1Z28A 3QE2A 2WM2A 1IQ0A 1N6OA 1NW7A 2P0YA 3IQDB 2QD2A 1PDWA 3ZCPA 3OIYA 4V03A 2WF7A 3DLPX 4YMLA 2PWYA 4BXOB 4RKRA 1J24A 3MAAC 5L3SA 1NF9A 3B3JA 4PQEA 5I6DA 2B5WA 3FLAA 3L77A 2J5KA 3QFSA 2MD9A 2W0MA 2D4HA 2OG1A 5I4BA 4XUDA 5JADA 2BSAA 5LLSA 5DM4A 5JOQA 4D80A 5IC4A 3SC2B 2Z8YM 2YWCA 2C2GA 3QKSA 4LK2A 1FNMA 3PHGA 4R3UC 2OO3A 4D46A 2Q3DA 4BZWA 4WBNA 2PGAA 4I1YA 2PGDA 4LGVA 3A6FA 4NNOA 1J23A 4QASA 4MH4A 5HJ7A 1X8LA 2LIVA 3V8BA 4F2HA 3P0IA 4GLJA 3UCEA 2RB5A 4QA9A 1AKRA 3VR6D 1Q3HA 1Y98A 3ADCA 2H57A 4KB5A 1SWVA 1P33A 5GJBA 1ADYA 4JJAA 5G1NA 3ED1A 1IUPA 2WTUA 1R18A 3BERA 3P19A 3QFTA 3IODA 3EG9A 3ABQB 3GJ0A 2ZTVA 3QVJA 4DV0B 1EVYA 4O3FA 2H85A 2O19A 5IDVA 4B3RB 3PITA 4QO8A 3H86A 3JVVA 2RSLA 1KPGA 1RRFA 2MR8A 5J3JA 5HRUA 1FFHA 4PWVB 3GFBA 1MH1A 4GP6A 4JR0A 4FMCF 4IGEA 3ZY4A 3HVHA 4O33A 3RBZA 3BICA 1ZOLA 4RVSA 2DCMA 3A9SA 4UCXA 2K2WA 1BMQA 1SUDA 1W9MA 4LYGA 1QPGA 1Y1SA 1LLQA 3TD6A 5DU2A 3HY4A 3JQ9C 4RANA 1AQJA 3EEYA 2YCLA 4Z49A 1QDEA 2OHOA 3A0RB 4QQNA 2XTJA 4CI9A 5TQ0B 3OCVA 2E8CA 5DK4A 2JIPA 4NFYA 2HV8A 4M0PA 1YJNP 1DWPA 2JZCA 4NTZA 1Z34A 1MC4A 1CQXA 3AMVA 1CEEA 1BFKA 4NPHA 1VHJA 3A2KA 3KALA 1I0LA 4KVAA 2I4MA 5EL0A 4W63A 3U3DA 5BSUA 4M1ZA 1NBEA 2DHRA 3ESZA 5BSFA 4DB4A 4YBZA 1ZGJA 3LHFA 1RRVA 1Q7YQ 4F5YA 4Z5XA 5ECGC 1AV7A 4K2HA 2X13A 1TFUA 4PUIA 2ZJ0A 1FYDA 4YREA 3STVA 2J6IA 2GCEA 2PL5A 2H1IA 4XFYA 1OC2A 3EDYA 1DELA 4LE0A 1XS3A 3KXKA 1LLFA 2HPZA 3HFGA 1YZVA 5KVCA 5KTRA 4DIFA 2XWSA 3SE0A 4ZQIA 4CI0B 3DJFA 5JJKA 3RUFA 1X42A 5FADA 4RESA 3I08A 3P4UA 2DWUA 3AQIA 1MAHA 2O8FA 2J59A 3VAZA 1TO1E 3QX8A 4L2ZA 1SUWA 1L3CA 3BMXA 4TSKA 2GAOA 4ZI5A 5HQJA 2LIWA 4OYLA 2BI7A 5L4SA 3R7AA 1B76A 1VSTA 3K2QA 1L3BA 1FUEA 4ER5A 2E4AA 2X86A 3K15A 4WCFC 5GM2A 2F48A 3DEYX 4CGZA 5ENDA 5IXSA 4XFXA 1XZBA 3Q2OA 4DPKA 4EKGA 1YC5A 4PG6A 2JEZA 4RK4A 5C37A 5C34B 1Z3CA 4GM1A 3CU5A 2I62A 1SBTA 4KX3A 3PQFA 3ND6A 3VVCA 4CFSA 4CTOA 3ZWBA 3WLMA 1RPNA 1QLWA 4BKQA 3Q72A 2QDKA 4BL5A 2L6EA 3UB2A 5L4NA 4BNVA 4DNFA 4G0WA 3MGCA 1J5XA 1A4UA 3R20A 2D2VA 4NAUA 1SBHA 2OB1A 3WDMA 1O95C 1PVOA 5BN5B 3EPHA 3VVLA 5EHZA 1M66A 4AF6A 1ZH2A 1TAQA 1K9SA 5FUXA 3HLKA 2B30A 5IM4A 1WXXA 3KZOA 3FYCA 1GXGA 5E6SA 2P9YA 1XJWA 2XZOA 1FNNA 2CXXA 1JEDA 1QJ4A 3MJ4A 1J99A 2R60A 3VZSA 3HU5A 5AQ1A 2QJWA 3G88A 1VFNA 4RQBA 4K40A 4ZYLA 4LNUB 2ZDHA 4RWZA 4UTNA 1NXTA 1B2LA 4F4IA 5E2AA 2BONA 1QTIA 3CJTA 4CCWA 4BSZA 1FQKA 821PA 1LRLA 1TU0A 5L6MB 2VDQB 1P74A 3LQKA 4HNRA 1GUDA 3CX8A 2ZIAA 4NE2A 1SVIA 4F97A 5B1IA 1PJTA 1V8FA 3K9GA 2ZG6A 3WK7A 3K5IA 1GCIA 3K9FC 4YRAA 4QUIA 5ADHA 5DHRA 4WZ6A 2R7AA 1TF5A 1RLOA 4ZAGA 4F1WA 3NKFA 4BO6A 2VT3A 1KMNA 4R3NA 1MNAA 4HEHA 1AKTA 4WCVA 1UKCA 2YV1A 4B5LA 5MF6A 4NYIR 3F4BA 2B37A 4CJXA 3DMFA 1Y9ZA 5KO2A 1N7JA 3VHXB 3AWIA 4RZ2A 1KFCB 3KLNA 1M1XB 2NUPB 4RF3A 2H9AA 2BJHA 3NW9A 2HWUA 3ICQB 3KHKA 2UDPA 5GAJA 1N1GA 1A43A 1DQRA 1E63A 1PSDA 3M81A 4FMDB 4XXHA 1DEXA 3IH5A 2CL5A 3CZPA 1MB9A 1DUIA 3PQCA 1CR1A 3ANNA 3ZW7A 4BMYA 5F2OA 1MJNA 4ZA2A 1X80A 4G0PA 2WICA 4ZANA 4Z3KA 4GP9A 3I5MA 4NBWA 4MMYB 4HH4A 4FDLA 2NT4A 3WWYA 2Q0XA 1SULA 2N9UA 4OF4A 3V7FA 1Q7EA 1M2EA 3W9YA 3HP1A 4B2IA 5A2GA 3MBKA 2AX3A 4UOQA 2R6DA 2OV1A 1K8QA 3V7YA 4IFBA 3VJLA 5ALVA 2FLVA 2CVPA 3LBNA 4HI0E 2XWPA 1EVZA 4H31A 4YWHA 4JI4B 1MVLA 3GUUA 1NRWA 5FBWB 2Q46A 2HMWA 1YHZA 2P6PA 4OQPA 1M5UA 5ILQA 4RIHA 4GEGA 3W9SA 3LUDA 4RK1A 3WK8A 2YWRA 4Y2HA 1OX5A 3BILA 3M4YA 1H6CA 3TLCA 3EUFA 3RABA 1K8XB 3T3IA 4IV0A 1WB5A 5LQJA 4F4JA 1RMYA 2XGMA 3MINB 1DAHA 4KE9A 2FPMA 1N2SA 4QNRA 2EKPA 3AY3A 1G7CA 1EQAA 1XCOA 1PLKA 4L22A 4XX0A 2I2XB 1QGUA 3JW8A 4NDNA 4DV2B 1APBA 3CQ9A 1Y1PA 2V3VA 4PWYA 3VU1A 4G0MA 1XTVA 4PQGA 2LXNA 4WCFB 1A8UA 2ONTA 1FUIA 2WTMA 1YACA 221PA 2GZ3A 4NFHA 2G7MC 1TQ8A 1ISGA 2IEYA 3WLJA 2FVEA 5G02A 1K5GA 3GJ4A 3PICA 4DY6A 5HVCA 4OQXA 3RAGA 5ETJA 3U4IA 3UTCA 3C3CA 2O4UX 1B00A 3OQ1A 5JFOA 4YJHA 5LMCA 1SHUX 1Z0DA 3WGGA 2XUQA 2E82A 1JKJA 3GJQA 3ILSA 2QL8A 3S2UA 1TZ2A 2JZNA 1SQSA 1TQDA 2DTDA 3C3JA 1EB8A 1VQKP 3OURA 4O59O 3EXEB 5J4KA 1NIPA 1W35A 2LIPA 2JHCA 1H85A 3HACA 4OXXA 4RMJA 5IAGA 2MVVA 3WMRA 1AO3A 1YI0A 1EUDA 3G1GA 3PNYA 4UE3S 4EW3A 2BR4A 4S12A 1NTOA 2O6LA 1NXQA 4BZXA 3BH7A 2O1WA 1IATA 2KGDA 4P58A 3NPDA 3BH6A 5D7BA 1YZKA 3RC2A 2I7CA 3T1NA 5AK5A 1R0RE 3U6BA 2Z98A 5DM2A 4NJEA 3KKNA 4CLHA 5DN6A 1IYZA 1RHUA 1Z2OX 1SC3A 4IOJA 5BQOA 1DBIA 1JW9B 1NLUA 3COJA 1OIVA 2H17A 2VAWA 3ID6C 3ZD6A 1PJQA 4MWZA 4CLEA 4B85A 3IPXA 5CM8B 4Z4IA 1TRKA 4TKUA 4TKZA 3GRRA 4I8DA 1EWKA 2H1OA 3DFUA 1ISMA 1PL0A 3R6TA 3P4YA 3MWDA 5JZSA 2H8GA 2EHTA 4GXTA 2AG5A 2EJBA 1F4LA 3V8EA 3VMMA 3L4EA 3WL8A 3IT2A 1SIWA 3L82B 3AKDA 4D98A 1CZRA 1EFHA 1PT9A 2P62A 4YPOA 5EE0A 2YCBA 4EELA 4F46A 4F5DA 5H9UA 1SHKA 4YRMA 1NKSA 4HDCA 5K3BA 3IMLA 3IQWA 1JBKA 4B3TB 2NQ2C 1J5EC 4OXNA 4X85A 3OZWA 3L8MA 1VMAA 3PHCA 5LQUA 4G2NA 1UQRA 3W3AH 3ZBTA 5CIWA 1M2OA 5BW6B 1MORA 5BNTA 4LXUA 1H69A 4LHXA 5ED0A 5H68A 2C9DA 2RCNA 2H08A 2W9XA 4DIKA 2WHPA 3UWPA 1PKEA 1V1RA 2B1GA 1LSJA 4DKXA 3HU3A 1S96A 4GE0A 2Q9CA 3JQGA 4KLAA 5REQB 5KVAA 1GDDA 2XNDD 1UFRA 4LDNA 4BQPA 1K6XA 1VXRA 1RJFA 2A0FA 1KIAA 2HJVA 3PC8C 2OV8A 4DLWA 5HZKA 1JDZA 3NVAA 4TTRA 3PCXA 4FMDF 4B74A 4ML3A 3P2JA 4YROA 2PT7A 2Q21A 3HCAA 2FZCA 2PPVA 4AULA 2GLTA 5J58A 1TM4E 5F1OA 4TLLB 4TZTA 1TYCA 4YV7A 2ACKA 5JSKA 5AJUA 1TU3A 2BLLA 2OPHA 3KVNA 1NUHA 1IVSA 1H8HD 4AY4A 1G60A 4YQZA 1MJHA 4RVNA 5HJ5A 3AJEA 4DUGA 1D2HA 3RIEA 3JQFA 5T67A 3H97A 5MN5A 1U6IA 2Y1KA 3PJFA 1UJNA 1MABA 2GZAA 3TLKA 4BV9A 2D3TA 3ELBA 4XQCA 4IMPA 1OUMA 3LFTA 2FQYA 2BYTA 3WBFA 3EUAA 1P2SA 1TYAE 2IS4A 3R3JA 2OFFA 4MWBA 3E3NA 4L8YA 5K0GA 1UBOS 1L4NA 4V0MA 2WWRA 3PQ6A 4NHEA 4BLWA 2HSZA 1GKLA 3MWKA 4C3VA 4URUR 3RS2A 3OX3A 3WOVA 5CBPB 1IUKA 2C5SA 1XVAA 5A19A 2AOVA 2XD9A 4PLPA 1Z4IA 1VIYA 3OX4A 2B3TA 1U6KA 4HXGA 4D2IA 5L45A 5JCOA 1Y5MA 5P8WA 4BFVA 5DNCA 2J3HA 2VJMB 3C8ZA 5ES3A 3JAWB 1V3TA 2WIDA 5L3ZA 1D2CA 1NNUA 4TWRA 3IELA 4UDNA 1NYLA 1XNRB 5HRAA 3ZCQA 3KR2A 4C1NA 4N5HX 1L7MA 4EABA 2Q3CA 3NOXA 5KNDA 1H0RA 4FN4A 4ZC1A 5BSRA 1GT91 1W8IA 1L5RA 1ZESA 4N8EA 3ZBPA 3H0EA 1V5FA 3DT8A 2GA8A 3QOXA 1JIUA 3VR0A 1VE6A 3TVTA 4YRRA 1AKQA 4GMGA 1T9BA 3SHTA 3JQ8B 1MHTA 1D6SA 3OZ7A 3V2GA 2OBLA 2M32A 4AROA 4DGQA 3NY7B 1QS0A 2ZJ8A 3B1ZA 4Q3NA 2O5CA 2PL9A 1VJCA 2PRZA 1JDSA 1C3LA 4U0BA 4Y6QA 3OHSX 1ZGCA 4NU0A 4P7BA 1YIJP 3FLMA 1AZTA 5AKLA 4IIUA 3EMVA 4YIKA 3QQ5A 4LXIA 1XA4A 5C8DA 4F96A 2VWHA 1QXSA 3H9CA 4XWKA 3C3BA 4CMKA 1K86A 1C4XA 4OQDA 3EAQA 4HTFA 3K0CA 1TTTA 2C7RA 3DZFA 1T1GA 2JJ2A 4IRXA 4O02B 1QH1B 4B4DA 3FCOA 4A27A 4DHEA 1I80A 3GLUA 5EHXA 5HGLA 4KI0A 2R8EA 4WFJA 3B8EA 4IRUB 1J5EB 2CXQA 1YRQA 2C3YA 3S29A 2Y4OA 3MCUA 4DG8A 1EXDA 1ZJ6A 4OOEA 4PZLA 4PCVA 3BDIA 1LPBB 1B15A 2H4ZA 4DWVA 1K7SN 3IA7A 1PK9A 3R7NA 1E79D 2JFXA 3CMCO 5H02A 4PRZA 1YR8A 1LBIA 2M8LA 3E84A 3RJZA 3C24A 2E6KA 1UOOA 2Q6KA 3FWKA 1VMKA 2HSGA 3HWRA 2YJZA 3RVQA 1VIVA 2A78A 3FLBA 1ENOA 1ZSYA 4LJYA 3ZKWB 4Q6BA 4BX3A 3RD5A 3P9ZA 1LW6E 1GPDG 1BA2A 4ZMSA 3FFXA 1XALA 5CM9C 2HCBA 5CH8A 2BVNA 2CMHA 3RF7A 4KQXA 3VI4B 1VHLA 3ABRB 1ADGA 5CDGA 2DQYA 1FA9A 1P0QA 4ZARA 5CDSA 2BKLA 2C97A 1OREA 5K4HA 3UT5B 2M5HA 1VRCA 3Q3VA 4M53A 4MQ5A 1QIDA 3ZU4A 1RY2A 4DT1B 2K93A 4ABTA 1Q0SA 3DLTA 2DR2A 1VL2A 1QC5A 3IDSA 4EB8A 3HYTA 5ESXA 1DPGA 5KWEA 2J9XB 4B2LA 4AY6A 4NBRA 1JPNA 1EFAA 5TMPA 4RTKA 1AKYA 1ECBA 4UBLA 3ENZA 2FNAA 4MXDA 1H2BA 5TVKA 3WYCA 1P7VA 2JGNA 1S3IA 1QCCA 3EJWA 1V5WA 2BCEA 2W2PA 2PT7G 5DTJA 4GYJA 3DOHA 1H4VB 3O1LA 4IY1A 2C57A 2QN7A 3ZLUA 2WHYA 4TLCA 2PUDA 1CUVA 4P7FA 1P73A 4GX5A 4BVHA 3DMDA 2CK3A 4EMSA 3HRHA 2B8EA 4BB0A 4K46A 2I2AA 2Q4DA 2P77A 2QTZA 2QJTA 2FSSA 2A1UA 4OM7A 2A9OA 3USES 3AZOA 5G41A 3GBVA 3ROXA 2A7QA 2Q5QA 1T43A 3ETHA 3DWEX 2BBOA 3ZE1B 1P4JA 1U1GA 3VVBA 3KQYA 2WJGA 4UM9D 4NMMA 3UB4A 2YHSA 2Z08A 3CLUC 1TC1A 1LWOA 2CJYA 1G5RA 4QOFA 2WOJA 3WHKA 4Z2YA 3OEYA 3TOSA 3PPWA 4KN8A 4KQMA 4EAAA 3V7UA 3WWDA 1OX6A 1KS9A 4IDAA 1MVNA 4YTEA 2HSWA 2JAOA 2XNKA 2QL5A 2J67A 4XX1A 3ZDAA 1EHCA 4TM8A 1RJDA 3CEPB 5DGCA 4WNCA 4CHGA 5FTKA 2RMKA 4HHEA 5DLPA 4Q3LA 3S40A 5LA6A 3UJ7A 3TZCA 5F33A 4QATA 4BLUA 3CH5A 2MSCB 1SU7A 2D2IA 3CURA 1TTQB 4V3BA 2BUCA 3ZI7A 2ZM5A 4PH1A 4HUJA 1RC0A 2V7VA 1YVUA 4UU0A 3TLXA 4HSEA 2V7QA 4G24A 2I29A 3QNMA 3QY9A 2P9ZA 4WK4B 1E2MA 2QBYA 3RJ5A 3C39A 2J6HA 3MJDA 1C9YA 2W2KA 3I2IA 1ZI6A 1NUAA 3VH1A 2YMQA 5E6UB 4LQLA 1HQYE 2NZUG 2O8NA 3X1YA 3ELUA 1L7DA 1QYWA 1F2TA 5B7PA 4XQ9A 1V48A 4IHJB 3H1AA 4D3YA 4RY2A 2NACA 4XVCA 3A3NA 2Z2KA 5EERA 2CKMA 3L41A 2OV3A 4NE9A 2VT7A 4DBLC 1AKWA 4J49A 3AP3A 1XZIA 3MPUA 4I3HA 1OXVA 3KPWA 1Y6GA 4W9MC 4ARZA 3U17A 5I9MA 3PQ4A 4CW7A 1OC4A 3HR8A 3R6LA 1HC7A 3U48A 2PWZA 3QLUA 1OH5A 3AINA 4PX9A 2HMVA 3EZGA 1G41A 4R2WA 4OBBA 4KQJA 3FY4A 4DCJA 3M5WA 1NLMA 1Q7RA 4YUVA 2NAFA 4R1OA 3FTPA 2V8OA 1YS2X 4GL4A 4Q3AA 2BM1A 4AURA 1JIQA 1JLKA 3KTAB 1QV6A 3H9JA 3Q7EA 3PFHA 1FLOA 4Y7DA 3LHSA 4FFNA 3AJ9A 1PZGA 1QHHB 2YOHA 1J0BA 2WPTA 1I1NA 4S2EA 3IMKA 1VQ4P 3ZLBA 3R0QA 1JJFA 1ZW6A 4O1HA 4TS1A 1W2HA 2UUCB 5FBKA 2QR5A 3USZA 3G0OA 3P05A 1RWPA 1Q86Q 3UYLA 3K1JA 2VRBA 4V02A 5B36A 3P2EA 3ZLTA 1UCFA 4G9BA 3VO2A 2NVUB 4E2YA 2JAQA 3H2YA 1E6WA 3A6LA 2Z9BA 4Q00A 1NVUQ 3GLFA 2D27A 1E3IA 1GRCA 5AR1A 3HKEB 3PXAA 2Q1UA 4YRIA 3PE6A 4UREA 2C4TA 5J2TB 3QV1A 4AZ3A 2ZTMA 2LW7A 1SXJC 1G8PA 1R9NA 4G6ZA 3GIWA 2GEKA 1L5FA 1G3QA 3ZVNA 4RKWA 5IDWA 1GVNB 2IVFA 4FTFA 3K9QO 5BN5A 4YAEA 4EHFA 4EO9A 4FLMA 1MKYA 1N5LA 2W2MA 1YJBA 4F8JA 4JL5A 2ZUCA 1DSSG 3OZAA 3DAFA 4HGQA 1X9HA 2GZEA 2Q6LA 4IXDA 3N0TA 4JBWA 1PGQA 4G0ZA 1KY4A 5CVCA 2X41A 1GZ5A 4RBNA 3LHDA 3JQEA 2W37A 3OZVA 4R83A 1E3MA 2UZAA 3AVXA 3NPMA 4LNUA 4QRDA 4KRFA 1EDZA 2ZP1A 4UD2A 4C4AA 3PXDA 3PUKA 3FF1A 1RQ7A 5IEJA 5CX1A 4TWZA 3SNKA 2GJKA 3G29A 5HQ3A 4A91A 2VBFA 4ZOCA 4F3YA 3KP1A 1RI3A 2ORED 2CFCA 3VTZA 5D2CA 2AOTB 1Q15A 5JU6A 2CXOA 1QKKA 1XLVA 1LW7A 4Q9JA 1IXYA 5B55A 3STHA 4CT5A 1JJ7A 4HTAA 4I6JA 3QLEA 2O05A 3AQ4A 5ES4B 4WGFA 3BCSA 1AKEA 5ALFA 4QUHA 2DCUA 3K30A 3D8NA 3B60A 1CUDA 2FZLA 1ZNVA 1E89A 1HNZC 5IVDA 2PNFA 3STWA 5TMDA 2HGSA 3FGOA 3HC7A 1JB9A 2OENG 4OYCA 5CYGA 2Z9DA 2QIPA 3A1WA 4R40A 4HJRA 4HADA 3OLXA 4NI5A 1L5QA 1Q1EA 3JQ9A 3NUQA 3QF4A 2ZSAA 2IBTA 3SJBA 1BWRA 3F0TA 3WAKA 3GX1A 4N1AA 3QQPA 3W8RA 2X7XA 2L69A 1CUAA 1XU9A 3SDBA 1RO2A 1J70A 4PZPA 1G3IA 1WZ2A 2FUG1 1X94A 3NJRA 2WJZB 4ZI7A 3S8MA 1KJWA 3Q6MA 2A7XA 5DASA 5FTLA 3R5SA 3UH0A 5H59A 3ADOA 4NG4A 4UNPA 2GDWA 1ZP6A 4G67A 3HB5X 3BJMA 3HABA 2ZUTA 1QIFA 1M2FA 1W36C 4KMRA 3FCYA 4CCAA 2DKFA 4IX9A 2W6PA 4FOSA 3OM9A 4AF8A 3SQOA 4HAYA 3CPJB 4FBLA 1VHNA 5KHOC 4I8IA 3IQIX 3H7IA 1MO2A 4GUDA 2SICE 3DLBA 4D4MA 1BN6A 3CVUA 1AQ6A 3GQBA 3NDPA 4MVJP 2EEPA 4NYIQ 4AECA 4AVYA 1EFDN 2D4AA 4EMBA 4IHJF 3A32A 4U3JA 4U7WA 5E0OA 4ZIRB 4KITB 4XTRA 1DTWA 4QJ5A 1X87A 2VPZA 2CCKA 4Q0MA 2Q9BA 1XSEA 2Q0HA 3N8KA 1BMTA 3MGBA 1EGAA 2CFOA 4KJXA 3P96A 3S8EA 3PS9A 4ZICA 1XN4A 3DBIA 2YWBA 1NFRA 1L5VA 1MC5A 2P6OA 3BFKA 3RVKA 5ELXA 1DOHA 2HNBA 3P5SA 2W2XA 1AGXA 3CLRD 2OBVA 1Y5RA 3BL5A 3UJ3X 3EGXB 4WLEA 2QQ0A 1ZEMA 5I01A 3GT4A 2JU2A 5EEGA 3RK1A 2DU8A 2YNMD 3HKCB 3VNSA 2AJLI 4DXHA 1T9GS 4PIPA 1QUEA 3WIDA 4M49A 5BT8A 2FMTA 3NHBA 2V6GA 3FMFA 3JD3A 3LP8A 4BDTA 3TUIC 4YV0A 3MOSA 1DJOA 5LMUC 2ALJA 3C41J 2KDNA 2JBAB 2PGIA 1BDJA 1FX0A 4RK0A 3GJSA 2H1SA 3GJ3A 2A0YA 1TIPA 2OTCA 1SXJB 4Z4GA 2ZBGA 5LMNB 5FLKA 4EATA 1TEHA 1O95A 2AZXA 4GI7A 2I1WA 3RVDA 1Q6ZA 3SSOA 1XV5A 5COBA 1ZNZA 5THQA 2IUEA 1N32C 5AO9A 2P0AA 2XVAA 1YQ9A 2CF5A 1FVFA 1C1DB 3TLGB 1LRKA 2M6SA 3DFMA 1JR3D 2B8NA 2J3EA 4QHTA 3E9MA 2FVAA 1K4YA 3G8YA 1S2GA 3IP8A 4E6PA 4MUJA 1GDHA 3HBMA 3FF4A 2AZTA 3L0BA 5J2TF 4IDFA 3JQCA 1QRSA 4X1KB 3MMXA 1FMFA 2ZAIA 3GB9A 3I2YX 1G5IA 2MMGA 2JB9A 1LXCA 4HWRA 5FOXA 3UEOA 1T5IA 1A8HA 3TQIA 2NUTB 1K8ZB 2R48A 4TTQA 3QBDA 3MB5A 1ZI8A 4TTVA 5JAQA 2QYSA 1E69A 4IOMA 4ASUD 4BNFA 3OFKA 2H4FA 4E2FA 1ESMA 4DV0C 1JSRA 1OU0A 5C52B 3CVYA 2JAXA 3DPSA 4B3RC 3NIFB 4OPMA 3CG0A 4OHXA 4DJEC 2GXUA 2ZBUA 4GYKA 3DL4A 3CLHA 2QE7A 1M0EA 3V46A 5AI8A 2X4DA 1I7QB 4EUKA 2XDQA 4MQEA 1CNEA 3KEMA 3MQ2A 4CG1A 2OGUA 1EAMA 4E13A 3HNOA 4D26A 3WLRA 2WM8A 5FORA 1J9ZA 3LMOA 2G0AA 3KBBA 2GBCA 3UK0A 1HM5A 2CVHA 4WI1A 1DQZA 2WI8A 1ZPDA 2W6OA 5M29A 1AK9A 4JKYA 1N2XA 4NDNE 1R5OA 4BJ5A 3CVWA 1K92A 3OH8A 4JYAB 2H7XA 1A8SA 1QZ3A 4BKPA 1W36B 4RLSA 2GYVA 4KXQA 1FTYA 3LU1A 2OBBA 1EWRA 1OYWA 2BPOA 4DJDC 1QQTA 5CAEB 2UZIR 4D8WA 3FJOA 4AJHA 3E2IA 3T6KA 4HT3B 3P9RA 2X9LA 1OTHA 2PG3A 2I8LA 1BQ3A 1NQAO 3AUFA 5AJTA 2PUFA 2BUBA 1ISIA 5G3YA 3FOEC 3ORFA 3R74A 2JFOA 2XKKA 2I2BA 3VDQA 5JNVA 4MGHA 1V45E 1NZFA 4WX2B 2ZRCA 1A9RA 1TT5A 3T3HA 4CTJA 1J0EA 2APJA 2BMEA 2X1LA 3SYLA 4RSHA 5IS2A 4KREA 2CFTA 3GLHB 4OQEA 3C3YA 1AHNA 4D4GA 4MP6A 3K2IA 1K2WA 2IXBA 4RD0A 1QE0A 4KKVA 4NZMA 2JFHA 1G66A 1Z0UA 3L8YA 3LXRA 4D8YA 1JILA 1OA1A 2HHJA 4UTRA 1G3RA 1BAJA 2XMGA 4DCCA 1C0IA 5BN3A 1HDYA 4G0NA 1OCEA 4LG1A 2NZ8A 3ZD9A 1GR1A 1I9GA 1JAZA 3ZY2A 4XLLA 4QL3A 4BLPA 3Q7QA 2JFYA 2GJSA 1TIBA 4KLNA 3VBCA 1GNVA 3GL9A 2RGCA 5BUZA 2Q4OA 2JIDA 1OH8A 4Q01A 5LMUB 3T0GA 3C7KA 1U0OC 4BWYA 4M9UA 4HDNB 3UBTA 3BJIC 2IK8A 5BPFA 4CLDA 1RZRD 3WP0A 3ZEAA 3MD9A 1X1TA 3GU3A 3QUSA 1ZOOA 1J9EA 4LHZA 3U4GA 1K4MA 4TUYB 2QF7A 2HIAA 2NUAA 1T2AA 3VM6A 3SI7A 1N32B 4KXXA 1CD5A 2J3QA 1DX4A 5DYNA 3EHDA 3KM0A 1NI5A 4C08A 3B6MA 1U2PA 5EMJA 1PVDA 2ILTA 1N6PA 2OD9A 2GDYA 2V3CC 4ALIA 4IQ4A 4C87A 4DWWA 2VLQA 4MJ7A 3CT4A 5JD6A 1NBHA 1VLJA 4TKVA 4KH0A 3W5CA 4DLNA 4JVMA 3EMBA 5ALYA 3I0NA 4ZPJA 1RDFA 1S2OA 6CHYA 3CISA 2GBPA 1J25A 1VQOP 4BJ1A 1BD3A 3UK7A 3AUYA 1TL7C 2WJ4A 3OU2A 3BB3A 5BNIA 3WQQA 1A5BB 4LCJA 3G2LA 4BNGA 4UHDA 4U7DA 3I1FA 1HLPA 5A9SA 3JPYA 5HFAA 3LCVB 1JS1X 1TM7E 3DNFA 1YJWP 4IIJB 4AJNA 4UHFA 1JR2A 4R2KA 1VDZA 2FW6A 3HJHA 1KY3A 2IOQA 5K0CA 3IERA 4XWOA 1PBTA 4ENRA 3KLOA 2DFNA 3VX4A 5LBUA 5L7YA 1I36A 1Z7GA 5BSKA 1KMIY 2ERYA 1DQSA 3H0DA 2GCPA 1EFPB 3EBPA 1T2NA 4L0CA 2QT0A 5DNVA 2WJHA 4HFNA 1R66A 4LXQA 3NBAA 2H1RA 4EUSA 4JLWA 4JOQA 3WDSA 2LDXA 4KNYA 3CR7A 2GAFA 2O4CA 1CUXA 3ZDBA 1F51E 3A1DA 1T6BY 1WZIA 2JH8A 4Q1FA 3A3KA 4YP0A 1NLFA 2J32A 2JLCA 4B6FA 2JFPA 4DV6B 3C6QA 4HWKA 4FGSA 2WWXA 1U3DA 3VTAA 4BGIA 1CF4A 1MH9A 2O2ZA 2RD2A 4AJ4A 4K81B 1JNXX 1OFGA 5FYDA 2FXIA 1F3OA 3D2LA 4L9RA 1X1QA 4IVNA 3IRVA 4F3CA 5TY0A 1HT2E 2VCYA 2Z04A 4GC5A 2VJLA 3N0WA 3PC8A 2RB4A 3MMNA 1K4KA 1Z73A 4L5BA 3AI3A 1H0SA 2Y9PB 4IUYA 2Z5GA 5CA1A 1DT5A 3UF0A 3VR3A 4JI4C 3ZWCA 3J80D 4GLLA 1FRZA 1TJYA 5AIAA 3V4PB 1C9NA 3DZKA 1UT5A 4M22A 3HU1A 5B3LA 3WX0A 4WZAA 3QVLA 4LY6A 2QX7A 4IINA 1T8WA 4WXEA 3LA6A 3M89A 4NPAA 4F9FA 1X1BA 1MB2A 3QKRA 4XQ0A 4M9QA 4R7ZA 3OFNA 5JH7B 4F6RB 4H60A 4PYLA 1V2GA 3F73A 5AK3A 1ZDMA 2WKPA 3MNFA 3JS5A 4FD2A 3P9IA 4E1AA 4FEEA 3H5WA 1BYIA 3VR5A 1KGDA 4AN4A 2KB0A 4DV2C 4UXIA 4K3UA 1Q92A 5T7BA 2Y93A 3F9RA 2W4MA 4UEJA 2FW8A 4LCBA 1UEIA 2ZJ2A 1Y7LA 3IAXA 5FWAA 1F7VA 2MSDB 3U4DA 5KYXB 4F56A 1VQ6P 4M7PA 4FJ2A 1YB1A 1J9GA 5EUQB 3QYFA 1RYHA 2C1EA 3FYDA 3Q3EA 4HZUA 2HRDA 1G16A 4OD0A 1ZG3A 5EJGA 3I1IA 4QKQA 3ETJA 5FFMA 1J1IA 5U4XA 1ENZA 4N9QA 1YE5A 4IXNA 4MDYA 3UN1A 1YUBA 3DMRA 1XTRA 1QLHA 1FZTA 4EX6A 1RC1A 2IEZA 1WKCA 3FNHA 4OHBA 1UK7A 3KAPA 1Z7YA 3V00A 3SM3A 2QW8A 4BOYA 1PFWA 1Q74A 3ND9A 3GCDA 3UKJA 4DRXB 3QXSA 4QGGA 3R4VA 3WGJA 3GJZA 1UM8A 4YFYA 2VOEA 1G63A 3T3EA 1Z63A 2IOYA 3RADC 4C0JA 5HNKA 4NENB 3CCSP 1MIOB 3FHCB 4NEOA 3U3JA 4BYGA 2MYPA 4TUYF 1CZOA 2N1MA 3ZE7A 4L7QA 3UK1A 3ITNA 4GS5A 4TL9A 3TINA 4DANA 5BR1A 1MA3A 4DQLA 3T1HC 3KWMA 1DJQA 3HJBA 2Z8ZA 5DO9A 2AD1A 2Q5IA 5HF6A 3RYIA 2Y2UA 2IHTA 1D2GA 3G71P 1ESDA 2IP2A 3CLSD 5ENZA 1ORRA 4MWEA 4OX9Y 3N7TA 4JP3A 1H1LB 5JQWA 5CT5A 1QAOA 3KOYA 2BV3A 2QTAA 1RYZA 3HFJA 1WL8A 1DCTA 3THWA 5EXEA 4HJXA 1LS1A 2QOEA 2JA1A 2BEJA 3MTJA 4K6FA 4X65B 4PR3A 2SCUA 3V2HA 4PBRA 4YACA 1XVTA 3UWMA 4JI3C 2F8SA 5TPWA 4NZOA 2ZYIA 4HATA 1M5RA 4NV0A 4GQIA 2XRFA 3UJDA 4QUEA 5AM0A 2GB4A 1R8SA 3DSRA 2JVJA 5E1DA 3C7AA 4B3TC 3TW4A 2GJ9A 3S1SA 4IIJF 1U7HA 2OXFA 3UENA 4YRNA 2F4VC 1ZU4A 3SQLA 3DD5A 4V2IA 3O8BA 1YIOA 1Q50A 4E5UA 1K08A 3O2EA 3FKQA 3QV2A 4UCQA 4OCZA 3COSA 4GOMD 2E0GA 2JIBA 2O48X 3KEQA 3UAZA 5H16A 2Q0SA 3DVRX 3MQFA 4M60A 1XA3A 3GPBA 3WGTA 4JLBA 1SVLA 4QVKA 4DMLA 3DDZX 2IXEA 4B7CA 5EVCA 3PGJA 2QNIA 3Q7SA 2O2YA 5U9CA 1XN1A 2GLUA 4F8EA 2CCGA 3OA2A 2GI4A 2GZFA 3SX4A 4BQEA 1I5EA 1KEEA 1IWPB 2E4UA 3CYFA 3TWOA 3L6BA 5EIHA 4D41A 2FOXA 2NVWA 4F3RA 4GWGA 3AUTA 3VHLB 1O97C 1NASA 4KTVE 5AK4A 1PWYE 2BOVA 1A7JA 3MM4A 1BU8A 3PTAA 1WV0A 4G5YA 3HGQA 4Y2UA 1KY2A 3QE0A 2X0RA 4QOIA 3W5JA 1Q1AA 1B42A 5FAKA 3NCTA 5IKMA 4KR7A 4L78A 1MU0A 1BDBA 1ZUHA 3S2FA 4H1TA 5BW4A 1PN3A 2B4AA 3O8RA 4WERA 4B9EA 2H9YA 2DSNA 5JDIA 3MTAA 1NULA 4RKYA 3ERCA 4DLBA 1IC6A 1J07A 4BTLA 4CM5A 4YQEA 1TJ4A 3V4ZA 4MLPA 2JS7A 2QRGA 3N2KB 1WF3A 4BNJA 4J1SA 3W06A 3EZXA 1K0RA 3I28A 5JH7F 3F96A 4UHEA 2ST1A 3LUPA 3IRUA 1U1FA 4DFDA 4QUJA 3B9BA 3DEZA 4QQ8A 1DGQA 2NTEA 2OKCA 3IMCA 3DTVA 4MR7B 4ZVUA 3C3WA 1Q0QA 4MTCA 1CIPA 1JN0A 4LHYA 1BVUA 3GAAA 1NNEA 5KNCD 2QTHA 4YCAA 4L2IB 2YVQA 4NQRA 2Q6OA 3GJNA 4IG4A 3ZU3A 2IYYA 3IV6A 3QX3A 3DLCA 2HA6A 1PWZA 1J20A 5KDOA 5DV9A 4P3XA 1XNRC 5DTEA 4TWIA 4C0HA 4EYKA 1AUXA 1EXVA 3LF2A 2BMVA 4DF3A 4QUBA 3WKCA 4PCLA 4K5QA 3RYTC 1PSZA 4DEVA 3Q7IA 3GVIA 4BN4A 5T8KC 4JJ8A 3U56A 2BFOA 3TW8B 4KO4S 4XDHA 1M7HA 2ZUBA 3EXIB 4YAFA 1JTEA 4IIEA 4BQOA 3O90A 5SYAA 4XSVA 3NP9A 5ALKA 2FGJA 4CEIA 1QQAA 4B4VA 2CDCA 2J41A 1ZU5A 4G8CA 3IJ5A 3T1HB 2J9GA 3FNIA 2C7PA 1R12A 4WNIA 3UFBA 1WE2A 1U4NA 2DQKA 3P9PA 1P1FA 3PPVA 2CXHA 3AF2A 2YY7A 4HDSB 1ETUA 5AHOA 5DNUA 3L5OA 3A31A 2IU6A 5EWLA 1RKUA 1Y8RA 5B3JC 3FCXA 4DLRA 2Z5LA 3HO8A 4QECA 2IDJA 1MQSA 3MJHA 2IE8A 1KU6A 1L7XA 5JHGB 3GEMA 3IVRA 4JI3B 2X1HA 2GAJA 3B7WA 4AM8A 6ABPA 3LL4A 4UJ3A 3BXXA 1LBQA 2OZEA 5EJ8A 2DUJA 3FDXA 4RFSA 3O94A 1OFIA 3TGPA 3LQRA 5GZ6A 2GNPA 1K1EA 4US2R 4F5WA 3G1UA 5BRNA 1BZYA 1VG8A 3FDIA 2F4VB 1A9XB 1HURA 3GLFE 3UBMA 4JD5A 7MHTA 2F59A 2YN2A 3G0VA 2ID8A 2OFWA 4JSTA 3TLEA 2BFFB 1YITP 5JS1A 1JFFB 1JVBA 1J00A 5K85A 3B8HA 1QK5A 2DULA 3AVOA 2F43B 3T7TA 5DW0A 1TYDE 1R3UA 5JSZB 5AHRA 1TB4A 5JG7A 3O38A 2AZMA 2L42A 2BISA 2QG9A 2KOQA 2IYFA 1KP3A 2PEYA 4CDRA 1KYXA 5CURA 1JX6A 3NPAA 4Z1MD 2QTVB 1Q1GA 4XDZA 1HF3A 3KHTA 1WOMA 2N42A 4ZVTA 4WA8A 1KQSO 1FDUA 1UMBA 2OZVA 4NXMC 4ALKA 4OLBA 3OUTA 5AVZA 2Q27A 4XWGA 4JYCA 4LPSA 2PRYA 3PQ8A 4EA6A 3N05A 1UBKS 4IXWA 1DQPA 4FDVA 3NEPX 3HMKA 3R7BA 1CQIB 1ZK4A 5IEBA 5KYYA 4W6ZA 1YBHA 1O92A 4ZRMA 4CEHB 2IZ6A 1PJSA 3GRVA 3INTA 1UMCA 4L15A 2PAFA 4DLLA 3QU9A 3I4CA 2JBAA 4D5EA 2EJUA 2Y76A 1U0FA 2VF8A 4FDAA 1H94A 3H19A 3KB1A 3UMJA 4PLYA 5IVIA 4BVEA 2OD2A 2AEMA 4QPZA 3FNGA 1G9TA 2Q62A 1D9ZA 1E7RA 1UXGA 2F67A 2PRIA 1ISFA 3K9HA 1PNRA 2UKDA 1V0JA 3NATA 2FRVA 3IUNA 2WF5A 4OP3A 1EWQA 2GZ2A 4JWTA 3BFPA 4JBNA 4RTJA 4WOPA 1W30A 4KLZA 4JB8A 2VNKA 1O94D 1XHLA 1H8EA 1T9CA 4D5GA 5DMXA 3DEIA 3TFOA 1SUBA 2X2PA 2GD6A 4PTYA 4OH7A 1PWXA 2QRUA 4B6QA 4RV5A 4R7GA 5CNMA 5HPYB 1I30A 1WVGA 2MHCA 3B2NA 3O8DA 1EGHA 2ZT7A 4X1KA 2F62A 4W9RA 4LBZA 1RM5A 4RNCA 1R8QA 3BKWA 1SY7A 4Z51A 3NIBA 4PICA 4F4DA 4BJ6A 3HXKA 3I5YA 4QEDA 2V7UA 1AQIA 1NOKA 3TLAA 4GXRA 2KR5A 1NJ5A 3Q8WA 2L4BA 2O54A 2QY6A 1S8AA 4DUZB 5EMNA 3MJVA 1PK7A 5A3JA 1EA5A 4KN5A 1TAGA 1SVOA 2VA8A 3RHSA 2NSDA 4ER6A 4MUGA 3WZMA 1BE8A 5FTJA 4ECAA 4EM6A 4QBIA 3OC6A 2XNJA 1VIDA 3UV3A 4OGFA 4UU7A 4XVUA 1E3TA 1KVTA 1Z3IX 3KSRA 1VBMA 1WUHS 2Q8PA 4JL8A 1E4EB 2VXCA 3EOBI 2F7SA 1BEUB 4R81A 4EY8A 1HDZA 3OJWA 1KVUA 5C8XA 4AZ0B 1MC1A 4L8LA 4NBVA 4J3NA 4UPDA 3UKOA 5EKDA 1Z7EA 4KO1S 5KEIA 4UW9A 4X45A 5IT9D 4QYIA 1EM6A 1LV8A 5KYNA 3H8SA 4ARIA 3UGJA 4Z0NA 3DZBA 5FWYB 3KBOA 1FJXA 4D9NA 4IWNA 2JCYA 1AF4A 1FXWF 3A6ZA 4XGRA 2CZCA 2LV8A 2AF4C 4GMFA 1TJ5A 1OJLA 5DBHX 2EQAA 3T38A 5FPTA 13PKA 1HGXA 4Y6SA 3AR4A 1D1SA 1FL9A 1V96A 5CAEA 1UBTS 4JGGA 1V7PC 3LNCA 3T0IA 2ZZKA 5AQEA 1HTTA 4TQ9A 1THGA 2WJYA 4L9AA 1VQNP 3KQLA 1IDOA 2V6JA 3SICE 1B73A 4R6XA 3FETA 4Z9BA 3PVZA 1DC4A 3N3BC 1R6AA 4QFMA 1P77A 1XZCA 3LVRE 4OYHA 5AVUA 5KP6B 3FB4A 5IAJA 2OO5A 4J2HA 1E64A 5J5CA 2LE0A 4CIBA 1KS2A 1GQOA 1R8XA 4RHYA 3SGLA 3ECCA 1N9ZA 2LBPA 5TGTA 4R2LA 2I3DA 1S2NA 4GWKA 4QX6A 2GR9A 2DBRA 2ZXEA 3DNMA 4N48A 2RI0A 4GPD1 5DCYA 2WU0A 4PNPA 5IKPA 2D8MA 4Q1AA 2WUVA 1PSWA 2R5NA 1I7SB 2Y99A 3C7TA 2X2BA 2VNIA 5JO9A 2XF2A 4ADSG 2WYWA 4NXMB 4JLMA 4BV3A 2Y1FA 1G8AA 4EFDA 3R5HA 1Q1QA 4ENQA 2RBEA 3W7VA 1L0HA 3CMEP 4C88A 3BWXA 2GZJA 5IMBA 2XUHA 3EUWA 5JAIA 1LQ2A 1KYQA 2UUCC 1C9JA 4CQMA 2IHZA 3H3XA 2ZAMA 2ATEA 2GHIA 4M38A 3VPHA 3RVPA 4WYMA 1EINA 1NMSA 1CXZA 3FHTA 1HY8A 1WS6A 4FFSA 3SU8A 2IYWA 4NF2A 3KQHA 3MTGA 3KQMA 2KG8A 4BXOA 1M34B 2WM3A 2AQHA 5JNLA 2QUIA 3UJ8A 2NU7B 3MCZA 2FLWA 2GRJA 2CBGA 1ACLA 3ZJYA 5C18A 1OKKD 3ZGLA 2PUGA 4KQIA 1GTZA 4QIHA 4WSOA 2BGNA 3G9TA 4U9IS 1TKAA 3MW8A 3LWNA 4URFA 3O31A 3LLUA 2OECA 4ZRNA 3C5VA 3SC2A 3LRPA 4NOZA 3MELA 2FE4A 1RWNA 3K20A 3PNQA 1VBFA 1QFSA 1Y6RA 5C4MA 2HQSA 2Q5EA 2M6LA 2R4QA 3OECA 1K8AQ 2VDLB 4C2AA 1T5OA 2JPDA 3L7MA 2IYEA 3PDJA 3KOZA 3RV3A 2FPSA 4V0OA 1QHFA 3GP8A 1GQYA 2HF9A 4Q6WA 2FHSC 3G82C 4R9VA 1Y63A 4ZAWA 3KX2A 4IW3B 4CMEC 2FN8A 4MINA 4AYWA 1RQLA 1L5KA 3EZLA 3N59A 4LHWA 4NZPA 2P9EA 2OFXA 1OA0A 1RABA 3E7DA 2AJ8A 4QT0A 5H3HA 3CKKA 5TGDA 4O29A 3GJYA 1OLXB 3RANA 3T4XA 1VLZA 2I4IA 3DDUA 2HHLA 4UNNA 3R5XA 3RWOA 4DXDA 3BHJA 3GNTA 2WSSA 3HPQA 4JQCA 1A9PA 4Q5IA 1LY1A 4B76A 4CMBA 4IDNA 1GIAA 2C9OA 5EIBD 2BFWA 1AUQA 1XJCA 4LJ8A 4G09A 2OHGA 2K7ZA 3EFOB 5LZ4A 5F3DA 4OA8A 4WK0B 4X54A 4MMZB 1Q1NA 4C0XA 1UK6A 1BHSA 3MSXA 4OB6A 3GZLA 1S6YA 3MGAA 1FFAA 4GUAA 4R01A 1W0JA 3AT1A 5ICSA 4YCMA 4L7VA 2JU1A 2IPXA 4S3MA 5TQ0A 3VU9B 3HYRA 3SKXA 3RUAA 3ROTA 2CYCA 4UTVA 2ZDGA 2CYBA 5FHRA 3JQAD 3G9QA 2WHEA 4BAUA 4N6GA 5COQA 3PYXA 1JYEA 3FOAA 2JFVA 3E81A 1GRRA 3HYCA 4GD3Q 4MS4B 4RHUA 4JMPA 2LVBA 1RAIA 5IJ0B 5BY2A 1A5SB 3ASYA 5T64A 1MF7A 4FYXA 2PUTA 3N8DA 2YYZA 5ECWA 2ZR8A 4GKVA 4CEJB 2J3MA 2PZKA 4MKGA 2C7QA 4D4KA 4E46A 3QF7A 1UKVY 1CEQA 4XGKA 1RAAA 3ZU2A 1WX1A 3IB6A 2VQEC 3BHNA 4LDQA 2P3QA 2RBGA 5BV7A 1ODCA 5THKA 1SCUB 5F1PA 3JYPA 1OW3B 3DAHA 4KW7A 4CM6A 2SECE 2BZSA 4RPHA 4Q37A 4P80A 4KXWA 4AP6A 1Z6ZA 3K9LA 4X1OA 4EB3A 1CS4C 3H2ZA 3KO8A 4CLXA 3MLBA 4PH0A 4FFRA 2IE0A 1YJCA 1DG1G 1S8FA 2ZE6A 3CXRA 1YI1A 3CNOA 2G6TA 4C6HA 3WRXC 3OIGA 3AV0B 5EJ7A 2HU7A 4JODA 2AHOA 2FR0A 1E2IA 2AUMA 4JCCA 1IH8A 2WABA 2FVXA 2NQTA 4I5GA 1N36B 3K8OE 2CHQA 1Z88A 3D9QX 2EFJA 5KYXA 4B6RA 2PNGA 3PUWA 5HRCA 1P1KA 2HU8A 5CT6A 3MYRA 5CU7A 4ZGWA 3U44B 2HIGA 4QFBA 3JX9A 1R64A 3A27A 3E4CA 5KUTA 3LOUA 1L7VC 2ZAYA 3FB1A 4MUIA 3Q3IA 4XROA 2B3DA 4UPEA 1XVUA 2YHIB 3GLIB 3EIWA 4YY3B 3A1UA 1CIVA 3DGEC 4PO8A 5EJFA 2IJGX 4WKBA 3ZE0B 3OE7A 4RTRA 2JGIA 5KZMB 3VNQA 5LMNC 4HAOA 2POCA 4YXFA 1W29A 1XE3A 3MN1A 3UMBA 4JXXA 4L6AA 4B7UA 5A7GA 1W1WA 2R8PA 4JJZA 4MW5A 3O74A 2KE5A 2QU7A 4PIVA 1EP3B 2GASA 2QA4P 4A36A 3SSMA 2ZSEA 1U0BB 1R8JA 4AJ9A 3FJ1A 1CVIA 5LDDC 4C0WA 1H6BA 1VKOA 2GWRA 1IBKC 1JLMA 3NEAA 1RTKA 1PT5A 1H5QA 3H6KA 3RNLA 3IR7A 4FWIB 3RG6C 3FOFC 4MRAA 1X19A 2AG1A 5DLEA 4EW6A 3E70C 5FBVB 1MIOA 4AAYA 3BFJA 1E5QA 3PXEA 1RMTA 3DKKA 2B0JA 2AL7A 1CUGA 3VDMA 3O8QB 2QA5A 4CKYA 1W7AA 1NQ5A 3EIHA 3T7AA 2H9IA 3EPKA 4GR5A 3NYIA 3SZLA 5DMHA 3JWEA 1WCV1 1M2KA 3K0SA 2P30A 5LZ7A 3VU3A 2VPYA 1ABEA 2Y3IA 1XGKA 2TYSB 2ATVA 5DHPA 3IGFA 3I9FA 3BRQA 4C7OB 1H1LA 1OI3A 1ZICA 1RRKA 5IF3A 4BC0A 2BZ1A 2H1CA 1MX3A 2YHUA 1RYEA 1YZQA 2I65A 2XQIA 4HEA1 1GAWA 2BHNA 4MW4A 4XB1A 1T6YA 3KYDB 4WZAE 4EECA 4X0EA 1KAQA 1ATZA 3VHXA 2LTEA 4GVLA 1Q11A 2FQWA 4K9RA 4EHIA 4MGKR 2NUPA 3ABZA 3P8ZA 4WUVA 2VH2A 4PHFA 4DDWA 1SEVA 3HXTA 4MVYA 4Q05A 4PCUA 2PLNA 3IAAA 1WZUA 2OLJA 4MPDA 1L7OA 4NYMQ 1WY5A 2ES4A 4N3AA 4X3CA 4D9JA 2RHBA 4EX7A 4JYAC 5E4FA 4MUAA 1M2WA 1RE0A 3AWDA 4LVNA 1LDYA 1NVGA 5ICGA 4C4OA 2A2ZA 1KZ7B 3TECE 1R4AA 4FZ3A 1KRWA 2BD0A 2FWBA 1UWKA 4JY7A 4PPYA 2GYWA 3AM1A 3B36A 4L08A 4REQB 3OAAD 1NLYA 2AWOA 4Q02A 3KD3A 4OQQA 5DWVA 1X8XA 1JQBA 2VQEB 4CNQA 3AGQA 4C89A 4KG7A 3M1AA 3I6QA 2VWPA 4TGLA 2MOKA 5JQGB 2YASA 4G5HA 5C5EA 2O8CB 3Q3HA 2IYVA 4YQYA 3MINA 4M0DA 4CETA 1XPJA 4IDCA 1RQ2A 3GZTB 1NBMD 2AN4A 2W90A 3CUVA 3MJFA 1O9GA 3M33A 4ODIA 2RK4A 3DV9A 1MAAA 3EWAA 2YZKA 1XVVA 3QEMB 2V7GA 1A8OA 4WCFA 3LX4A 1CLEA 1CRQA 2D74A 1T2EA 5FCDA 1T0JB 1GGVA 1Z26A 1FDRA 5TARA 2YV2A 4QPPA 3RLFA 4TWBA 5DTIA 4A8TA 4R2JA 3BSWA 3CX4A 3RVLA 4MKHA 3LLVA 4BS9A 1L5LA 4CODB 2XMQA 3FRJA 3VJKA 3ND7A 1G5QA 3PSHA 5K8CA 1QB8A 2EJTA 1MT3A 4M6WB 1U8YA 3R0JA 5EXXA 4J0HA 1OXKB 5JPIA 1V4VA 2QMEA 3NAQA 4PHHA 1R6TA 3UICA 3EXEA 2Z44A 1E3EA 5BP7A 1LTKA 2R65A 4D8XA 4K9LA 2AC7A 4OIMA 3STUA 2OXIA 2M1ZA 4QGHA 1QO7A 3C1OA 4H7EA 4CF4A 2W2LD 3AF1A 4K03A 1J2TA 4E1VA 3TGLA 1L4FA 1BJTA 3B9RA 1JU3A 1IY9A 3KJEA 3UFXB 1IBKB 1X86B 5CLFA 4D8UA 3Q8KA 4BE9A 4YCCA 3OT1B 2AG6A 3L06A 5F51A 3EAGA 2H5LA 2VTBB 2O2DA 2AN9A 5A1JA 2QJFA 2IYLD 4P5PA 3TKLA 1H6DA 2ASEA 1GQFA 2CEKA 2B5OA 2Y2VA 3PXUA 1YO6A 4X9XA 5HW0A 3C6BA 4H3KB 1RTTA 4YONB 4L8WB 4FJ0A 5F21A 4HS4A 1YZHA 2Y0DA 4KXFB 3T0FA 5IC5A 3QXXA 1A72A 5ICMA 1EWVA 4DJJA 1FNDA 4JP2A 3VJMA 3REFA 3CSSA 2ZJ6A 5JBNA 3PXCX 1TTHA 2Q3EA 5FPQA 2G1UA 4RA6B 4XEUA 5C8VA 3T95A 2OOSA 1NHGA 5L4LA 4IO1A 3LF1A 1U2RA 1TH5A 4DMCA 1N1MA 5BNFA 3ZVMA 3JR7A 3E82A 4D6XA 2OHJA 4EPVA 5F7ZA 3OFVA 2EHDA 1JEOA 3ZE9A 4JOSA 1DP4A 4RH1A 2DE0X 1Y8ZA 1SXPA 1C41A 4NBSA 4B87A 1SHLA 1V39A 1ULHA 3K8YA 1LX7A 1NAHA 2D1YA 2PGNA 3R9XB 1PJZA 1OPRA 3J81D 2RHGB 2ETVA 1UBJS 1UEXC 4ZYUA 1EEXB 4MAFA 1YDGA 5CD1A 5KYVA 2FW7A 4Q18A 4DV6C 1IRXA 1E2HA 1N2HA 3Q88A 3O8LA 4GHWA 5JISA 4QWWA 2CHEA 1VFPA 4CKWB 4ZMRA 4JZKA 3K35A 4JB2A 1J4AA 4QOHA 2XMSA 2JZOA 3GRPA 3IAS1 3TTYA 4I5EA 4P3PA 5REQA 2KBEA 2Q3BA 5JJLA 2WYOA 3V8QA 2NM0A 3LC1O 1P6XA 2EVWX 1UKZA 4GGPA 1E32A 1U2QA 2BFEB 4Y6RA 3WGVA 2GCOB 3PEFA 3OPYI 3DZDA 3G3EA 3L1KA 5ESWA 5JCZA 5TQJA 4RD1A 2VPXA 3BZUA 2Z1MA 4RHFA 2ZIVB 3EFHA 2JH3A 3LUCA 4ANFA 1A4IA 1IN6A 3FWPA 3PQ2A 1C30B 4Z4EA 1XDDA 1SB8A 3E7FA 5LDHA 2B83A 3TSCA 2IELA 2H54A 3UPUA 2XRMA 3E8SA 4JM1A 4GMDA 1KVRA 3D6FA 2WC1A 2XDAA 5E9JA 3DLIA 3RAFC 2P6MA 2QSUA 4CEHA 1OGJA 1ZCFA 1CW2B 5AICA 1KO1A 4EGAA 3A6JA 3QMWA 4K9MA 2B1QA 1QX4A 4P83A 1NUSA 4HDAA 1RYFA 1I3NA 1WOYA 2QTMA 1NUUA 4R8KA 3BZBA 4BN5A 1ZGAA 5C5CA 1YFLA 3MB8A 4LE5A 3KOOA 2X8WA 4WLUA 1N8TA 4Z3DA 1U8ZA 2YWJA 2QENA 5JQGF 3E23A 1PFKA 1N0WA 2ZM6C 4EB0A 5ALWA 4UC0A 5CBPA 4P3YA 4OMDA 2Y1CA 2IYPA 3EMKA 2GFQA 1UZUA 1L8AA 1VMIA 3CM0A 4X60A 2DBVO 4FOLA 4MB2A 4UZSA 4UUMA 2E9SA 2P35A 3DDHA 3KPJA 5EKUA 2W6IA 4AC9A 4D0LB 5JTTA 1T5HX 1CZKA 2VJMA 4QUKA 4BFWA 2ACVA 3JAWA 1UC5B 5H3CA 2PKWA 4N5DA 1S7CA 3L79A 4JROA 5CGQB 3RS5A 1GARA 2WHRA 3DS3A 4DBLE 4J3JA 3EA4A 1ZGGA 1E59A 3WQRA 5T8KA 5IFLA 3GWGA 2BCGY 1U7XA 3WLLA 2EFDB 1VJGA 4P6VF 3Q7TA 1W59A 2O06A 3C74A 2C5FA 5E0KB 2E4VA 4LECA 1FUUA 3CLTD 1F6DA 3JQ8A 2ZIGA 3PD7A 2FWNA 1PT8A 3EAFA 4JVNA 2ORVA 1BX3A 5D01A 4DDVA 4ZEOA 1IZ0A 1GL3A 3D02A 2PD4A 4HUTA 4V39A 4IIXA 4RUKA 3OVMA 1GWNA 2CVFA 5E3IA 2XT0A 3IR6A 5B3JA 1RPZA 2YWEA 3FPKA 2IPOA 5K0FA 1MJFA 3BEDA 3DL2A 3OZGA 1XXLA 1XRRA 4Z4QA 1TVCA 1XTSA 1QH1A 2MMAB 1FXUA 4WMLA 5ALEA 1Z45A 1YQEA 3RG2A 1RR6A 2M5RA 3MLEA 4B6JA 4X65C 5LLDA 2VH5R 5EZ5A 3R5KA 1PZEA 4IZOA 3IALA 1H2RS 4EUNA 1NBAA 3H4EA 1KQ3A 2B34A 2HMSA 1BD4A 2HO5A 3H5AA 1E9AA 1YI2P 1L5YA 4R54A 3SCZA 2XODA 1CP2A 3OJLA 4G8JA 2XMPA 4BNTA 4RGYA 1E1KA 1NBWB 4M55A 5DBEX 3FPAA 2ZJ4A 1ZUWA 3HN6A 2GDZA 1ZL2A 3SHFA 1IMQA 4KMSA 2YQ5A 3OCWA 1YS9A 1J6UA 3FMOB 4H2DA 3UHFA 2NV0A 1DKMA 1Y7HA 1FDOA 1X1EA 3LQ2A 3U2QA 4XFZA 4J7CA 3GVPA 3PEUA 1KNXA 4H0NA 4V0ME 1N2OA 3ANSA 3NYWA 3ZKWA 2AJTA 1NT4A 1PCXA 3R0VA 4CV2A 4N0DA 5D6NA 3T9CA 1GQQA 1CU1A 2AIRA 3C1UA 2KHZA 2YBDA 3ILYA 3CCQP 3MBOA 1BS1A 4PPFA 3FHOA 3NIWA 1AF7A 1KBZA 3UT5A 1ODFA 3VHRA 1XD2B 4HWSA 3E22B 1V9SA 2OL4A 3DWIA 3IPYA 4UAJA 1WDWB 3RS3A 1V2HE 1DE0A 3HSYA 1SCBA 1T1JA 3HWWA 4BV8A 2ZVJA 3H8JA 4DT1A 5HS4A 3UT0A 3H99A 1Z8NA 4ETNA 4G5QA 4L76A 5IYZB 4F2WA 4PC2A 1JBEA 5FULA 2F8LA 1T5TA 4HGOA 3G1WA 1E7YA 2B4QA 1T5DX 1PT6A 1HE8B 5J4HA 4U2BA 3SQMA 1RI1A 3PD0A 1BEEA 4REOA 2QPLA 3H5RA 2UYYA 4MVJH 3BDAA 4EEZA 5DDIP 4IQFA 3KWLA 3O73A 4CN9A 1IIRA 3GI1A 2ZM6B 4KAJA 1TZCA 4WIAA 1RWBA 4JCOA 2ZSBA 4DLVA 2QN6A 4WFIA 3I0MA 4OI1A 3EIEA 2GFIA 3S28A 3QKWA 3UZUA 4FX2A 4KI7A 1KMQA 4AWBA 2G09A 2PBRA 3LGSA 1PW7A 4B79A 4D3DA 4FSDA 3STYA 3WA7A 1U9ZA 3EDCA 1Q22A 5CCBA 1LK0A 4E07A 2D1TA 1BMFD 1WBJB 2NYVA 4I5IA 1JA9A 1UJ2A 5CFMA 3KQTA 2QP4A 5TLSA 5KC8A 3CRQA 3R09A 1ZISA 1BWPA 1E2QA 1KGSA 3ZIAA 4BIIA 2HWWA 3WL7A 1KBQA 1FTGA 1LDGA 4DMMA 5AK6A 5DNYB 5ARBA 2I3ZA 3D0KA 3CONA 3IIEA 4EVQA 2NWQA 4RDIA 2VH1A 1CR0A 5TMBA 1RE1A 4XTCS 4RM3A 4EI7A 5BYBA 2P2ZA 3ONVA 4NYMR 4DUYC 3F6YA 3RS9A 4HAZA 1XYYA 1MQ8B 1IJBA 1DG9A 1VYVA 3H5LA 2P9XA 1X7WB 4RW0A 4TVKA 2VK1A 1OTXA 2JHFA 2GESA 2GEFA 5CNIA 2IIQA 2NNWB 3PXXA 2QRLA 2QNWA 4B82A 4Y2YA 2WVAA 1B1AA 3OFSA 2RGNC 4JI7B 3O9MA 1QH0A 5ALIA 3QVUA 3VU9A 4QBGB 4MLZA 4C7XA 1MEEA 5E6UA 3AVUA 3A4TA 3I76A 2GEJA 2EAUA 5EJ2A 3WWZA 3BMOB 2Y1GA 3U9LA 4EJ0A 2BZ0A 1BTOA 4IHJA 5K8LA 2X8AA 3G4SP 3K8ZA 1IMPA 1IBMC 5IJAA 3IEPA 2MMCA 1Z0FA 4JA0A 1RYYA 2JJ1A 2BFPA 1UWLA 5HCIA 4MRRA 1NJ2A 2XUJA 2Z1DA 1PVVA 2OD7A 1KWGA 2AQ8A 4A8PA 3G85A 3W5VA 2HN9A 2XHZA 1N2ZA 3CB2A 3ZWKA 3ROZA 3OZUA 4GF5A 4K86A 3X1MA 1M9NA 2AH5A 2WFLB 4ZHQB 2PO7A 3LQ1A 3CB4A 3R24A 5DIZA 4KWTA 4BP9A 4U0KA 3B2EA 5T57A 4EMTA 1NVWQ 4CUJA 5F76A 4GKBA 4I5FA 1KO4A 4B5KA 1G2PA 1IEXA 4Y30A 3AHFA 2QLFA 3U7FB 1XDUA 1TMGE 2V97A 4CN8A 1N0VC 1P7PA 2DM6A 5CLHA 4RSRA 4IZIA 1I2MA 3W1VA 5JECA 3H05A 3KTAA 1KP9A 2F17A 1E3QA 3KNZA 4D43A 4PAMA 3LT1A 3NTLA 2G17A 4G86A 1GNPA 4BO9A 3UEBA 1KFKB 1G20B 2DHEA 2AI1A 3BGWA 1QHHA 3NNNA 5AJZA 3TNFA 3W5AA 1DEHA 2EHSA 3MQ4A 4CM7A 4RY9A 4XRQA 4P7JA 2UXCC 1Z4LA 2HIHA 2ZRIA 4YRSA 5AW0A 4AI6A 4H08A 2V7BA 4MUEA 2NVUA 2WE7A 3HGTA 4YRDA 1NY5A 1X1RA 3TE6A 4MCAA 3HKEA 1AGYA 2GNAA 4RQAA 1N3BA 1HH4A 4W9NC 2YHIA 3GLIA 5J2TA 1IMJA 5EJIA 5IASA 5IZ4A 2C4WA 5CFOA 4I9UA 1VECA 3JQ7B 2IEIA 3LT2A 5LWQA 1MOZA 4C05A 4Q4JB 1CZLA 1Q3TA 3N6VA 3G21A 4YAGA 2JKVA 4TLAA 3SQNA 4JITA 5CXXA 1M10A 4JBIA 3ZY3A 2DHMA 4L4QA 4DCGA 1W44A 3H6GA 4J0GA 4GC9A 4K28A 2LGJA 2WTAA 1CF2O 4GX0A 3EGOA 2P9JA 4P5EA 4HGNA 5EJ4A 4RV4A 3O8QA 1K5PA 1O77A 4UNIA 4BFUA 3A3OA 5HQTA 1GZSA 1J7JA 3X1ZA 5DCUA 4HWPA 4KEAA 4LGMA 1RWMA 3LYAA 1C3XA 1MX5A 4ZDIA 2AOTA 3U7QB 2EGUA 4BP8A 1GR0A 4Z7NB 2JIRA 4DUZC 1FOEB 3DQPA 1MAWA 4X7MA 4XCXA 2GBLC 4S0ZA 4BPRA 1D0VA 5AFSA 4DUYB 1RQXA 3IVMA 4R51A 2CNNA 1BEZA 3KQOA 4B2YA 5GVRA 2ODEA 1YR1A 1SZPA 2VCEA 5FBQB 2ZJAA 2PDAA 4Q3BA 3ACDA 4JJKA 2QD5A 6PFKA 3CEJA 5LQDA 5GJVC 4G1EB 4ID9A 1JDPA 3TQOA 3KETA 2PMCA 2BGMA 1K3UB 5IN5A 5E8JA 1NDUA 4NY1A 4HNAB 4ZVSA 1YRWA 2HFJA 2H2AA 3GZJA 3GGGA 3STTA 3R5FA 4U39A 4IP0A 5F12A 5BWOA 3I9V1 5KKNB 3DKRA 5ER9A 1GDTA 4P31A 2QORA 2L2QA 1IXKA 2I6TA 4MKRA 1I24A 2BHLA 3TEFA 4EYGA 1NP3A 2QMYA 3VR6H 1IBMB 5M7EA 5EXTA 2G72A 4ZYVA 3M6FA 2BFNA 4LW8A 4MO9A 1YTLA 2L18A 1D2NA 1OI2A 4HLQB 2IZ5A 4CV1A 4DIBA 5B4VA 1GGFA 1CUZA 4M7RA 1OBFO 3TSWA 2ZPUA 2W93A 1ZN8A 4XRGA 1XZKA 2XUIA 1GTRA 1G42A 3D7LA 4D9MA 4HPWA 1W2GA 1H5UA 2GRAA 3ETLA 3BK1A 1U5AA 2GK3A 3D1VA 1KK2A 1RQGA 4EG5A 1KMMA 3X1XA 1NXSA 4W7IA 3BREA 5LP1A 2J5QA 4IIYA 3GDGA 4ZIRA 2YVLA 3ESCA 3GARA 4L4XA 4FMPA 2QMQA 3LRTA 1D3AA 3K4HA 3WRXA 2ZSIA 4HRXA 5I7VA 1TOAA 1KNQA 4J0CA 4R9RA 1M76A 5IUKC 2LRHA 1ULSA 2NX2A 4ZHQF 2BCJQ 4RD3A 2WRZA 1Y3CE 3FX2A 2CXRA 4TWAA 2Z4TA 5DF1A 4BBAA 3OM8A 4C4YA 3ZLVA 2ADFA 1ZVVA 2J1LA 2UXCB 1OZGA 4W5NA 1DS6A 3EGXA 3ZDFA 1DC6A 5JV5A 2Z2IA 1MZVA 4Q39A 4RTQA 3ROMA 5I7RA 4HEJA 3HKCA 4ZYYA 4IV8A 3WIUA 5EC8A 3EVBA 2JJMA 1SUAA 1WXHA 2XTZA 2GZRA 1VQ8P 1P7CA 2D1FA 3T5PA 4RK6A 1G8MA 1P31A 2ZLBA 2PLWA 4LZWA 1FYVA 3BGSA 4WLNA 1SGWA 5AD1A 4M6WA 1SXJA 2OB2A 3QVOA 2XCOA 5LZ9A 1EDBA 1FJGB 5ICCA 5TMEA 1P2DA 4RTNA 2HRBA 2D5BA 1JHMA 1S72P 3LCJA 3K72B 1E0HA 3HJAA 4TTTS 4C0QC 1P0CA 2J4DA 2ZB7A 1EZ1A 1RZVA 2TMDA 4MS3B 4E2XA 1SKBA 4O08A 5TJ9A 2J3KA 1C1DA 3TLGA 4QBHA 1A4RA 3PGA1 4CKXA 2BFCB 3VYWA 4C14A 1SCQA 4EPWA 5FWXB 4YK7A 5LQMA 4U6QA 1U90A 1IAVA 1SCAA 3OT1A 2HRRA 1ZXLA 2HT1A 1X74A 4KV9A 1MX9A 5AUPB 1TA9A 4QOJA 2HQOA 3MWLA 3GNSA 2IHUA 2CB9A 2M8NA 4AJEA 4B3GA 4CF6A 1QRRA 4GSKA 1E1RA 2MM9A 2JLWA 2BSXA 2B4YA 3AVQA 4YT4A 4Q7MB 4KMMA 2NUTA 1W25A 4WKOA 2AMJA 2DPMA 5IMSA 1FFWA 5F1YA 3D5EA 1AUVA 1FUYB 3H4TA 3RIMA 4WZBB 3IHWA 3UJ6A 3AR6A 4X91A 4IGIA 1CZHA 1NN3A 1UOPA 3W4KA 3HJUA 2R00C 2FV8A 1PW5A 1QPBA 3V48A 1MENA 2UZ1B 5KQSA 3QI7A 2HI0A 1WMAA 3FA2A 1ZD5A 3V1TC 4YGXB 2C4MA 5CLIA 4AG6A 1V5GA 3USCS 4O2LA 2P2JA 3AKCA 2OPBA 3OF3A 1DV1A 4QO7A 1MRZA 1CERA 3O4FA 3C15C 1P7WA 2R85A 2ZI9A 4FONA 1O1YA 3AK4A 3KKLA 3WBHA 2VJYA 4X1YB 4DN6A 4JLAA 5ALTA 5I7AA 4BO2A 3KXPA 1P4RA 1KJYA 1TUIA 5E38A 2VYNA 4INOA 4IHQA 1BN7A 3N58A 1DC5A 3IE0A 4B4WA 1A88A 2XGJA 1BROA 3V4RA 1G3MA 1SD1A 3M4ZA 2YIJA 2Q45A 2KOOA 2PUAA 4WTOA 1VKZA 4TT3D 4CE6A 3RDPA 3MCAA 1VZ3A 5A4DA 2DERA 2ZULA 4YXWA 4XI9A 3SG0A 4U0EA 3AVPA 3LCMA 2BH1X 4LPKA 1LVGA 2VHXA 1JZTA 5JXJA 3EXG2 1Z0IA 3EZNA 4KFUA 1U11A 1Q7GA 5FOUA 4UVDA 2DHCA 2D2EA 2CFSA 1Z5WA 3O3NB 1GSIA 4ETIA 2W11A 2EX1A 1MEOA 3UX3A 1TUGA 4CFZA 2QQGA 1NYTA 4TZKA 3R9KA 4OREX 3GJ7A 1XX6A 3CZRA 5HUJA 3ONDA 3T1QA 2R66A 5FRDA 4M0LA 4WAUA 1Y89A 3GLHA 3PFKA 2HPHA 1UBNA 5YASA 4BNYA 3NEJA 1EP2B 2EYUA 4GPBA 2OMKA 3NTRA 1YE3A 1BWQA 3NASA 3LZDA 1WETA 3IAM1 5KNBA 4RKQA 2PNJA 1PQ4A 3S55A 5EJMA 4TMWA 5EE1A 1IN8A 3O21A 4PLZA 1N36C 3UMYA 1JH9A 2JF0A 3BX1A 2XZPA 4ESVA 4D9EA 3ZTYA 2O8EB 1S9DA 3PNLA 4PZUA 5DCWA 4CG0A 1LLCA 2BBTA 3ZCTA 3BSSA 4BO4A 4IV5A 3THRA 2X9GA 3IHLA 3HMQA 4HDNA 3PQ5A 4BWVA 1P0PA 4PC7A 1DG3A 1XTZA 2UAGA 3I3SR 2CE7A 1RAHA 2XUZA 2MF4A 1IB0A 4TYWA 4Y98A 1LF5A 2RHDA 2JQ4A 4YY3C 1GNRA 4BMNA 3ETOA 4TUYA 1XTQA 1C29B 4R16A 1U4OA 3UMSA 2CHVA 3H17A 2A9PA 4ZHSA 1PEYA 4LV5B 4DA8A 2N5HA 1UOQA 3SHOA 2WSYB 1RHRA 2P6RA 1BS2A 1YR2A 3AR5A 3FMPB 4FYJA 1HO3A 3DHEA 1UWVA 3ZD7A 2ZETA 4WDRA 3WO0A 1BXZA 2QAJA 1Z2NX 1P4AA 4M21A 4OIFA 2X77A 4RE6A 4KVZA 4YJDA 3BE5A 3SN6A 3FWNA 3O5AA 3PBKA 2FEPA 3EEQA 1E1YA 3K0BA 2X4LA 1XMQC 2D28C 1G7SA 2JDIA 4DV5B 4NH0A 4JLSA 2CWWA 4U2GA 4KL8S 1NVAA 1JHRA 2XHEA 3DOOA 2IDZA 2C3UA 3H2IA 1TW3A 5T5QA 4FKMA 1DZ3A 2FSFA 2ZUWA 2XH8A 3G0CA 3CWCA 1WSBA 1PFYA 4IIJA 3UMCA 3QBTA 3KJGA 4V0LA 3ST7A 4GECA 2CV0A 2OESA 1CYDA 2OGWA 2XJ4A 3CRVA 1T35A 2P7HA 3GCXA 5I4TG 4LQ4A 4A03A 3QWBA 1Z08A 4RAOA 3ZW9A 2F90A 3R0IA 2YIVX 2PZFA 1XZAA 1J39A 1EFPA 5CG1A 4U0CA 5FPSA 3PRKE 1NVVR 1U8TA 3HXMA 3CNBA 2N75A 4QXOA 5K9ZA 2VNAA 5SYMA 1NIJA 4W5TA 4N8DA 3IQEA 2XOKA 1SG0A 3ETDA 4RF4A 3QFRA 2AVNA 1ZOSA 4QDTA 1OZAA 4AWXA 2ZUSA 3BIJA 4MQLA 2B7CA 4ZT6A 1Q12A 3KS9A 4AT1A 2KG6A 4DR4B 3BH0A 1BNCA 3UXEA 4Y6OA 4PYQA 1K7CA 5FR2A 5LUAA 4GX1A 1JBQA 1GRNA 4RY8A 2ZRPA 1ZYUA 3MT9A 4BEJA 2R97A 1I6KA 3T7EA 2YHAA 1YQUA 3SEZA 3BUSA 2BUAA 2XOXA 4FOTA 2LNDA 2UXDB 2X6TA 2C1ZA 3A2MA 2G08A 3O8CA 5D5HA 2ID4A 3G2OA 4FD3A 4PSCA 3KTDA 3BL8A 1XQ1A 3K70B 2XAAA 3BQ9A 4FEGA 2ROQA 2EG5A 4J6FA 2H2FA 4NDZA 3JY6A 4AN1A 3E22A 4TS9A 2PPLA 2F55A 2G4LA 4WV3A 4CMIB 5JH7A 4E08A 3KVRA 4F6RA 4O4HB 1RXEA 1R50A 4AMUA 2WF9A 3K94A 1TAHA 4XDYA 5I8ZA 3TOVA 2ZSFA 4HGPA 1EEHA 3RSSA 4X62B 2P2LA 3F98A 2WPDD 3WV5A 5GV7A 3UJHA 2R7LA 3GFFA 4B6EA 1D2EA 1JAYA 1ZKMA 3KZKA 5AH0A 1P0IA 2DWQA 5JJBA 3ZJ4A 3UV7A 3FFAA 2JEOA 3F97A 3F6CA 2BGWA 2FWAA 1UKBA 3NO4A 4MRVA 3L4SO 4BMSA 1TVKB 2E1MA 1Z75A 2JIQA 1VE5A 2MU1A 2IGBA 4O5AA 5G53C 4UEWA 1W1IA 5HG0A 3F3MA 4LMPA 4ZKDA 1YZFA 8MHTA 2W83A 2Y0PA 5B4UA 3ZWNA 3OTWA 4W5QA 3VR2A 2PUHA 3C43A 4HLUC 3VPBA 1CX9B 4DRXA 3O3MB 3QPDA 5BSGA 4MWDA 1KZ4A 5KSWB 1K30A 1OOEA 5AJXA 1UKAA 3WJAA 1UBGA 1YGPA 5DYIA 3M6XA 1QU2A 3OUZA 4MEJA 1WXDA 3TEJA 3AZQA 3QTTA 4ARVA 2VC2B 1XMQB 4EHNA 1G8JA 3RUEA 4NENA 4D82A 2VHTA 3FVVA 4MEBA 1VE1A 1FYFA 3B70A 2K94A 1ZIPA 1SUEA 2ZT8A 3K3PA 1I94C 1U2EA 4JLDA 3OQNA 2AE2A 2BH9A 4G1BA 1TJ3A 4DIDA 3KTFA 1KR2A 2VP5A 1YIDA 4R98A 2GA9A 4I6EA 2RH9B 2EGTA 4ON9A 3AVWA 4J7XA 3LPDA 4MKFA 1WW3A 4GBGA 4OJTA 3TTTA 2B2NA 2NN3C 4YGYA 4F91B 3U1BA 3CXUA 5M3BA 3FIJA 4HR7A 4XYBA 2HKIA 2YFQA 4TS4A 5JD3A 4JUDX