3RG2A

Structure of a two-domain nrps fusion protein containing the ente adenylation domain and entb aryl-carrier protein from enterobactin biosynthesis
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
611
structure length
611
Chain Sequence
SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGRASIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enterobactin synthase component E (entE), 2,3-dihydro-2,3-di
publication title Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 190
structure length 611
sequence length 611
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3rg2A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3rg2A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rg2A01
1AMUA 4H2XC 4D57A 3VNRA 2N98A 2LOLA 2K94A 5BSTA 2L9FA 2K93A 2PNGA 4RLFA 3WV4A 3IVRA 2LTEA 1T5DX 3VNQA 2KG8A 2CQ8A 2Y4NA 3RG2A 5BUQA 3O83A 1T5HX 2P2BA 2FQ0A 1PG4A 4PWVB 1DNYA 1YJ7A 4H2WC 2FQ1A 2DNWA 4ZJZA 3FCCA 1L0HA 2GDWA 2KGDA 2AFDA 2ROQA 3EJEA 5D6NA 4R0MA 2N50A 1MDBA 2JQ4A 2LIWA 2JU1A 2K2QA 5KP7B 3G7SA 3LNVA 2KOSA 2AVAA 2MY5A 2D1QA 4ISBA 5BSMA 5K8FA 3IEPA 3FCEA 2AFEA 2QVZX 4GXQA 2KGCA 2LPKA 4PZPA 4PXHB 2P2QA 4RM2A 4NEOA 2CGQA 2QVYX 1V26A 1KLPA 1ACPA 2FVAA 1V25A 2MR8A 3T5AA 2N6ZA 4BPHA 1L0IA 2GDXA 2L22A 2QNWA 2K0XA 3EJBA 3B7WA 4D4HA 5KP8B 4H2YC 2FHSC 2Y4OA 4BPFA 5E7QA 2N6YA 3C5EA 4IZ6A 4RMNA 4U5YD 2KGEA 3VNSA 4E5DA 2XZ0D 2KG6A 3RIXA 1RY2A 3E53A 1ULTA 3O84A 4GR5A 3U17A 1OR5A 5CZDB 3L8CA 3T5CA 4EATA 3DHVA 4G36A 3NY7B 3LGXA 2KW2A 4D4GA 2FVFA 1LCIA 3ITEA 5KP6B 2QW0X 5BSWA 2MD9A 5KEIA 2FQ2A 5DV9A 3NYQA 2X2BA 2KR5A 2VZEA 3GPCA 2KORA 2VSQA 4HKGA 4D56A 2D1SA 3WVNA 1BA3A 2KG9A 1DV5A 2WD9A 4IR7A 5BSUA 2FADA 2M5RA 4OXIA 1T8KA 2LMLA 4DG8A 4BPGA 5BUSA 3IERA 3PBKA 5BURA 1F80D 2KOQA 2JU2A 3CE7A 4RVOA 4OYCA 3CW9A 2KWLA 1NQ4A 4FUTA 2KOPA 4W8OA 1AF8A 4RLQA 3WV5A 2K0YA 3IPLA 5JRHA 2EHSA 3NYRA 2LKIA 1PG3A 2LL8A 2KGAA 2N5IA 2P2MA 2CNRA 5KYVA 3GZLA 4GR4A 3E7XA 2XZ1C 2MR7A 3TSYA 3LMOA 3DAYA 3EQ6A 4FUQA 5KYTA 4R1LA 5HVCA 5K85A 3ETCA 2MVUA 4GXRA 2MVVA 2JGPA 3IESA 5HV8A 3LAXA 5DWVA 2V7BA 3DLPX 4G37A 2FACA 5BSRA 2MF4A 2N5HA 3O82A 2FVEA 3A9VA 2L0QA 2L4BA 2K92A 2AF8A 2LIUA 3KXWA 2GDYA 4GS5A 3GZMA 4MRTC 4RVNA 3T5BA 1HQBA 2EHTA 5EJDA 2P2FA 4WV3A 4R1MA 2QVXX 1X3OA 2KOOA 2Y27A 3R44A 3CW8X 4RM3A 3U16A 5BSVA 4CA3A 4D4IA 4M46A 1MD9A 5GTDA 1MDFA 2FAEA 2P2JA 3E7WA 2D1RA 3NI2A 4LGCA 3QYAA 2CG5B 2D1TA 1HY8A 2P20A 1VKUA 3A9UA 5IFIA 4DG9A 3EJDA
chains in the Genus database with same CATH superfamily
3E5RA 3D3KA 3IB6A 1PFWA 4FZJA 3LLUA 4N65A 2BCJQ 4L4SA 1JA1A 4D7AA 2F00A 2CFCA 4A8JB 3K8QA 2ALJA 3JQDA 2XKJE 5EP2A 1JHUA 3DS3A 1ZL0A 4FFLA 4NSNA 5DCUA 3OZFA 1GPUA 2R86A 3QV2A 1QYDA 5TC4A 4Q16A 1RY2A 4DLTA 1U0SY 1G5PA 4BBAA 1EU1A 2BFOA 3VSEA 1Z25A 4JZYA 1V3UA 1NPYA 4Y6QA 4EPWA 1WS6A 3V42A 4RS4A 1VG9B 4MH4A 2P8JA 3F7MA 2VJKA 3K1AB 2A5DA 4GECA 2AOTA 2V8OA 1FOEB 3RVJA 2P41A 1KYIA 4BJ1A 3OIUA 3FZQA 3DLPX 3SSMA 2FACA 2Q4DA 3GUHA 1EINA 5EMNA 4RL6A 4RK5A 3WQRA 3EF3A 1TO2E 3NI2A 1L9XA 1ISSA 2R8XA 1RQNA 5AXDA 4JR2A 2ZAMA 3EXIA 3QUBA 3P26A 1B8PA 2AD1A 3KJHA 2EDAA 2I99A 1M8FA 1ODCA 5BYBA 2ZIZA 3JAMA 3ODGA 3OE7A 4MW0A 4HDKB 4D99A 4TV9B 2CBXA 4H1WA 1KH1A 4JEMA 3TM5A 2NNLD 4M1OA 2OR3A 3H17A 1PBNA 3ZNQA 4TMKA 3KTAB 2QP9X 2WOJA 3PZRA 5JU6A 4RFLA 1YS9A 3R41A 1Y8CA 1OSNA 3THRA 2DKFA 3F3MA 1IWBB 2XKAA 2FSGA 5AVSA 2IF0A 5IC4A 1JR3A 3IKLA 1HFKA 3HFSA 5BORA 4HDSA 3CFYA 2B8WA 5DIZA 1ZOSA 1K6IA 1IQRA 1EG2A 2WYIA 4K86A 4ZTBA 2PT7A 3WKCA 4G5HA 1VZ3A 1S8FA 1W59A 1Q0QA 3WGNA 1JFFA 1V4VA 1YVRA 1K27A 2L82A 1JX6A 4BV8A 1TJYA 4IUBS 4X5OA 5TIIA 1W1UA 4Y2SA 1JLKA 3IDOA 2DT5A 2PT7G 3WGKA 1QF6A 2COEA 3U3OA 3N0WA 1VJGA 1VSQA 2FN3A 3ZWYA 4BPFA 2D1YA 3ZVMA 3BMCA 2XW6A 5EUCA 2F55A 4YH1A 2PVPA 5TR9A 4HNTA 4JP8A 4AB1A 3NT4A 2KLBA 3WIUA 5F52A 3RSSA 3TIFA 1S2MA 1VRCA 1H94A 4N41A 1JPJA 1F0YA 3K1ZA 4D97A 1RI5A 2PX2A 2JVIA 4JC0A 1XZFA 1L8QA 4ZHQB 3U4AA 2HIAA 2HT6A 3CWCA 1XJ5A 5BP7A 1Y5IA 5B30A 4G6ZA 4H16A 1CXZA 3ZK8A 2I2FA 3LF2A 1BHSA 5D51S 3IH5A 4R5MA 2WTMA 3QEKA 3VC2A 3U3XA 3R7NA 5AW8A 2YIJA 3T94A 1PL6A 1PLKA 4BUJA 1JAHA 2HRRA 4BFLA 4ZOCA 1J5XA 1GARA 1YRLA 1Y33E 4BNDB 4PFKA 2HHHC 3GN2A 2HDWA 2H2GA 3NCTA 4KV9A 4NENB 1XTVA 3ND8A 4XUDA 4CQJA 3I9V6 1KZ6A 2J9FB 3LT2A 5AKGA 5EIEA 2BGUA 4M9UA 4B3DA 5LBTA 4L07A 2H4ZA 3PRYA 1JEJA 3PDUA 1OPRA 3GRVA 1XCJA 3VV3A 2Q0XA 3WGLA 1G291 3MWDB 1W88A 1XDBA 3T7SA 1I80A 4LJYA 1UBLS 3EIFA 2HXGA 4KL8S 1SCAA 3AVQA 2QRMA 4X7RA 1NVVR 3F6YA 2RHCA 2IZ0A 4QDXA 2HXYA 5G4KA 1U0GA 3BN3A 4TLCA 5K0FA 1TU3A 4QT4A 5E3IA 3TJZA 3PNLA 4D3XA 5AFSA 2NGRA 4CQLB 4CLRA 4Q5IA 4P35A 4F3TA 2JQ4A 1FLVA 4A8JC 2QL6A 1ISGA 2DEUA 3COZA 2IX9A 1UUFA 1V37A 1XEFA 1N2JA 3G9XA 3TTYA 3OM8A 2G25A 3ASZA 2RARA 3VNAA 2Q2QA 2HOQA 4EATA 1NVUQ 1NJIQ 3ZUPA 2C5HA 4QRHA 1X8JA 1RYBA 2Y8EA 3DZJA 2B1RA 2IV2X 5I47A 1ELOA 4KFUA 2AFIA 3SS8A 1NVFA 5KNBD 1H2WA 2DSNA 2OQRA 1N5LA 3PI7A 4WSOA 3IE1A 3DKPA 1P9WA 5J3JA 1OGJA 2HRQA 2GN4A 2AB0A 4UVIA 5ADVA 4XQ0A 3UJCA 1O95D 1RI4A 3GYGA 1EFTA 1LH0A 2Z2KA 4JYBA 4FHCA 4FM9A 4KODA 4RYDA 2YNMC 3ZU2A 3SXUB 4KR0A 1ZI8A 3KOWA 1O0SA 4W8HA 4QZVA 3SGLA 5TF4A 2K5UA 2FAEA 2XE8A 3DE3X 3QG1A 3ZJ4A 4UJ5A 4DG5A 2QJOA 3U7GA 2BELA 3IVAA 4BRSA 3PEYA 3EWNA 5D5HA 3BVPA 1NFQA 3I8XA 2IPAB 2C3YA 1GCIA 2NPOA 1XKLA 3R40A 3P0IA 4RDCA 4GICA 2B1IA 1U65A 1I7SB 4DMMA 2D2EA 4CDRA 2VJYA 3LY8A 1EDDA 4CTKA 3B53X 1ZSNA 3QVTA 1UXKA 5DM0A 5HFJA 2GHQA 2OO4A 1DBSA 4NCIA 3KYDB 3L49A 2P4EA 2CYBA 2BMWA 5JXHA 1WD5A 2N5IA 2XT1A 1CQIA 1LLQA 5GONF 3H5VA 1V16A 1BKSB 1WV0A 3EY9A 4RQBA 2C07A 4MPTA 5KJEA 4RM3A 4AWBA 4ZDJA 5EP1A 2BEWB 1AUXA 2FPSA 1B1AA 3HY3A 3DUFA 3TD6A 1AKMA 4BLQA 4RV4A 3AB8A 5DBOA 4DQXA 2O57A 4UAUA 2E9SA 5EIXA 3TLJA 2UUPA 2X9VA 3ZXXA 3IP7A 2O07A 2GCOB 1XDZA 4G0ZA 1BXKA 2IDJA 5ALVA 3JVUA 1LBTA 1Y34E 3VNSA 4CLOA 3H42B 2YKGA 1QVRA 1XPJA 2D28C 3G9QA 3D1LA 3HB1A 3PHBE 2FG6C 3W8EA 3AM1A 13PKA 3ONFA 4RMHA 4GBED 3GU3A 6ADHA 1G7TA 2ZROA 4NCAA 3QVXA 4BFUA 2QZJA 5IEBA 3PNPA 4BWYA 3VRHA 1JDUA 4RS3A 3UGTA 4UATA 3VO8A 1VL2A 1UNKA 2O3QA 2YX1A 4P2BA 1VYUA 5HDBB 1BHQ1 2Y66A 5B4TA 3U9LA 5KSWB 1NHWA 4BXOB 3LL7A 3RFUA 3KV1A 4WOJA 1YVUA 2YXDA 2FF7A 1PLJA 4RTNA 1RHJA 2Q3FA 2H3EA 3RVPA 4OSEA 2FN7A 1LNZA 2RBEA 4ZCPA 4E11A 3I4LA 4KFTA 1CVRA 3MJEA 3RODA 2ONYA 1PR4A 4FNOA 3FCXA 5CBPA 4KO8A 4JM1A 3M1IA 4QFDA 4Y2YA 3V7YA 1Q57A 1M8JA 1V47A 2D8AA 4RE6A 4MDYA 3PESA 3OCWA 1APBA 4PRKA 5ECYA 4IHJA 4LOKA 4U9HS 3DG9A 5CFNA 3SYRA 2BKUA 5C1OA 2P91A 4C0WA 5CIYA 4R8MA 1G20A 1BVHA 3VDXA 1I36A 3NXSA 2HSWA 4UPEA 1KARA 5KB3A 4MYUA 3LLCA 3QKWA 4LQDA 5ALNA 4FCWA 4REQB 4CR7A 2FETA 1RVDA 3OPMA 1VRWA 3HP4A 4H31A 2QIOA 2C8JA 4L5CA 2H5JA 4X45A 3F67A 4DVJA 2I2CA 4FNAA 2HJHA 3U62A 3A2NA 1ZVVA 2XRYA 4CTJA 2AN1A 1YU6A 4A0FA 2VSNA 3GLGB 4BNLA 2CUKA 1KJYA 5AJHA 2A8YA 1BTOA 2UYOA 6NULA 1OLXB 1RWNA 1MX3A 8AT1A 1P0PA 1H69A 3H9EO 3VDQA 5ERXA 3AL0C 1EBBA 1Q15A 3DL0A 3OOJA 4DAOA 2J3MA 3GMSA 3L4BC 2H57A 4AMUA 3VAYA 3DDCA 2AR7A 5CX1A 5AVUA 3CZ5A 4UNRA 2ID9A 2QW8A 2NUTB 3IURA 5E1BA 3C3CA 2FPMA 2LPKA 3OOYA 4OHPA 5JD6A 1ZN8A 5DPMA 4CUKA 5CT5A 1Y8QB 2RH9B 1YTUA 4Q3KA 1P5ZB 3TVDA 3PQ2A 5FULA 1ORWA 3N70A 2B4KA 5A6SB 3EGEA 2Y1FA 3DEZA 2QPOA 3AZOA 4ESEA 4G0MA 3M9LA 5KO2A 7AT1A 2JDIA 3R9XA 1C7EA 2CD7A 2RJOA 5ED0A 3RV3A 4K5QA 4B79A 2HAEA 1U6JA 3USES 2AK3A 4FTWA 1E2PA 4FMDB 3K92A 1NC1A 2B2NA 3W06A 4FJ2A 2V0NA 3VPBA 4B44A 2XXAA 4R40A 5T3UA 3HLTA 3PQEA 3V1KA 1E2DA 1PJLA 3OCYA 3QKUA 2YWFA 4XYGA 4LDRA 4CHGA 5F7OA 4AMGA 2Y4OA 1IBLC 1P2BA 1JG4A 2Q2NA 2ZYGA 1UFQA 1RTTA 4IMRA 1YMQA 1ECCA 4C6SA 2WD9A 3AETB 3OO0A 2O2SA 2QPAA 2W98A 2O2ZA 5KREA 2DQZA 1X9GA 1EVZA 2C77A 1UDXA 3RRXA 2OXCA 5F12A 4RTJA 1KA9H 2H1CA 4M7OA 4UTOA 4NP6A 2QR2A 1EPUA 3IJEB 1JXOA 4NVRA 3D4LA 5JAOA 2ZYSA 3AJ9A 2L18A 5CR9A 3V8BA 1UMDB 1U2DC 4W1PA 3PEUA 2IU0A 1F14A 3QHQA 3OJFA 2CU6A 2RGCA 3DT8A 1DKQA 4F5EA 1NUAA 3OM9A 4L8GA 4EHIA 1D4FA 1SKYB 4HFRA 1GZVA 4IHKA 2ECOA 4JUDX 1KD1Q 1FFWA 3RIXA 3H4MA 4JVLA 5GJWC 5LP6A 2GPAA 1ZD9A 2J5RA 5C4MA 4DIUA 3FOEC 3BMNB 3OD1A 5BQPA 1JLRA 4EDFA 4BFSA 3HK2A 1YJQA 1NOKA 2VPWA 5CNIA 4OQMA 4QU9A 3REFA 3TGLA 2GXAA 2YVKA 2GGSA 2Q41A 1GR1A 1J49A 4YP0A 1UBCA 1H23A 3BIJA 3T7AA 4BZQA 2ZT8A 2XQFA 3VPFA 3VAZA 3R2JA 4CODB 1ECBA 3GJQA 5KQPA 3HEAA 4NY1A 5HRCA 5LC1A 2ZJ7A 5GZ6A 2WTBA 5DN9A 1YCFA 3OHPA 4JX9A 2UZ1B 1HDIA 4F8EA 1IMJA 3PNBA 4WCFB 5JNLA 1V8OA 5D6OA 3EZ7A 4G9GA 5KSZA 1PR6A 2DKNA 3FAKA 5D5QA 1IZ0A 2VRBA 2ZUUA 5JALA 1N2CB 2JANA 5LOVA 5CYFA 2V5AA 3LBYA 3BHMA 2FV8A 5C8XA 2JGDA 2AFHE 1LKZA 3IT0A 4U9UA 3Q20A 3GPCA 1VMDA 2IXAA 4LRYA 1D2MA 4L2IB 4MKIA 2WBLC 4I6JA 2AK2A 2IYZA 4FDMA 1E1KA 2R1UA 2W48A 3FFAA 1B0AA 1OASA 2H63A 3Q2IA 4OGFA 2ERYA 4O4LB 3CRQA 3R5XA 4ML3A 4Y9TA 3LMKA 4LF8B 4NYIQ 4EMSA 1FJGB 4WMLA 4OA8A 4DM7A 5EMMA 1ZD5A 2HPAA 1ZLYA 2ORIA 2JH3A 2I8AA 1EXVA 2HHLA 1HG1A 3DKVA 4RBNA 1GQFA 4DWVA 1YKGA 1GZSA 2EWWA 4N0QA 3RM3A 4A2QA 2BEVB 1FXUA 3ZLTA 4ISBA 3DBLB 3MMPA 3DULA 3WB9A 4OFBA 4XJXA 2QZSA 4V0RA 1P62B 1DFIA 3HV0A 3K0BA 2HQ1A 1RTKA 4P34A 2HIHA 4U2EA 1WCJA 5ALEA 3CVUA 5CM9C 2QZ9A 4C4TA 2IZ5A 1N2EA 3V4LA 2GNPA 1FYEA 1W48A 4OKNA 4CKEA 4XCQA 2D6FA 1J56A 3CPHA 2B8JA 5ALHA 1ZHHA 5TS2A 2RC6A 4YRFA 3UYKA 1G21B 4IZHA 3OZCA 1PQUA 3PI6A 2D2XA 5SICE 1GV0A 2EFDB 1L5SA 4R2JA 2JLSA 2IP2A 3VKFA 2VTEA 2O5RA 4RVDA 1TQDA 4AMZA 3OPYB 5DLPA 2NQTA 2C7PA 3UJPA 2VLPA 4KPUA 1KRHA 3TW8B 3PRHA 4O8ZA 1F12A 2DUNA 4OI2A 821PA 2V9CA 4DRXA 3COVA 1PEKE 4XTCS 3AEQA 2RG1A 3EODA 4RGVA 2E49A 5TPWA 5J2UA 3LT5A 4LY6A 2YY6A 3IT2A 1YRHA 1DL5A 1Q7GA 2CB9A 4LW8A 2HM7A 4HH1A 4BMDA 4WOKA 3CGWA 3NG1A 2OT3B 3EY4A 3UXHA 1F6DA 6REQA 1UJCA 3NHAA 2D8MA 4IVNA 4NEQA 4FUTA 4F9GA 3RYTC 2P6UA 3WLQA 3SFVA 2CCGA 3HS3A 4OKIA 2J3HA 3DMNA 3NAMA 1UPCA 3IP6A 5H3LA 1IXSB 2GN9A 4R1MA 3U3RA 3JYHA 4M1QA 2ZB4A 3E27A 1U1EA 3BEDA 3LX8A 1K92A 5ES4B 3JV7A 3WB0A 3SSAA 1AS0A 4JXXA 2QM8A 2ATEA 5L40A 3KVOA 9GPBA 3MBOA 1RAAA 5C32A 5LLTA 2CWOA 1Q82Q 1HFEL 3EMVA 1XAGA 4TOIA 5THKA 2YR0A 2JFPA 4ZVTA 1OIXA 1CJMA 4GNKA 4FEEA 4B9AA 1QRRA 5F2NA 3HU1A 3DVLA 4U0FA 7REQA 3C15C 3EHEA 1MB0A 5JZSA 1X1QA 2C7VA 2IE0A 2D5IA 5EWJA 1FLAA 1A69A 1PUXA 5DB4A 3ELUA 4OXYA 3KJEA 1QC5A 2C2ZA 1QO7A 1P7LA 4Q93A 2CXOA 4YAJA 1RLMA 3PDJA 2W2OA 1K3UB 3QE0A 1OTHA 2RAVA 2QROA 4BKMA 1DQRA 3N7UA 4MIOA 3L0BA 4L22A 4B7ZA 2Y27A 1S4MA 5HIAA 4F7DA 3AR8A 1LU9A 1IAQA 4Q4AB 1WXEA 3A10A 1JMYA 3A9UA 3T4UA 1KDYA 2IE8A 1XYGA 3C3PA 2BHRA 3GHHA 1IOLA 5JCJA 2O8DA 3STTA 5GVSA 4O3FA 4IPYA 5DI3A 4WCFC 2MY5A 2A5LA 1QE0A 3T7RA 1S4QA 1XFAA 4B09A 3ETLA 4EAQA 5CEEA 2JJ1D 1EQUA 2QSJA 2YWGA 3U1VA 2XCTB 1NNSA 3K4HA 2JGRA 1SQ5A 4XRQA 2FLKA 5T64A 1S8AA 3MF4A 4EG5A 4JB2A 1OBOA 1KYTA 2CGEA 1KYYA 3JASA 5B3JA 3DLAA 4ARZA 3TSYA 1U99A 2QA5A 1SZPA 1H1DA 3B1ZA 1BVYF 3BXEA 4IIDA 3LP8A 5LMNC 2NAFA 2VDOB 4LF8C 2YL2A 4RDIA 1FJGC 3SHWA 2O7VA 1VB5A 2ZU0C 1JKJA 5DX8A 4RCYA 3OUZA 4M87A 2QYHA 1TVEA 4HLUA 1KQ3A 3N2KB 2LTEA 2H7CA 4XVHA 4FCTA 4Q21A 2BM0A 1KO5A 3AKCA 1G9SA 3ET4A 2WU0A 4K1LA 2DWQA 1LEHA 1GZ6A 3KM0A 3QLUC 5CUQA 2ODPA 5B5SA 2OV1A 3OETA 4W9NA 5KDOA 3AFNA 1W30A 4IOKA 4MKGA 1GXSA 1PKXA 4N49A 3LQYA 4LF6B 3OT1A 5JZMA 2Q8QA 3PC3A 2YJ4A 3ME5A 4R4JA 4G85A 1JIUA 3HA2A 3IILA 4HQFA 3HWSA 2NVUA 5G1OA 4Q3OA 2O2DA 2GZFA 1SRRA 3VVCA 2Y1WA 1FSSA 1FMFA 4BP8A 2VJDA 3TZEA 4XYBA 3GRPA 3CT4A 4K88A 4ON9A 4JI1B 4HFJA 2PUJA 5JZVA 4RHYA 4IV8A 1NI4B 2WZQA 4Y9DA 4NOJA 3R44A 1VGQA 2QSUA 3ABOB 3ZBQA 4D25A 2JBAA 3GIDA 4LMAA 5DHQA 1P80A 4F6LA 3WNVA 3S99A 3QEMB 3MZ0A 4MWBA 2C95A 2QQEA 4MVJG 4GG1A 2VHJA 1CKEA 2LW7A 1NW9B 4ZV7A 3T1QA 1FVFA 1PT6A 2F1RA 3EDYA 2VNHA 1DX4A 5B58C 1U04A 4RNCA 3IDSA 4XD7D 4LOJA 2JB9A 2PUVA 3HL0A 3NALA 4BWFB 5LYJF 3KJXA 2H4YA 5DGXA 4RTOA 5CVTA 3IEIA 3UMMA 5DMHA 2C3UA 2FSVA 1L5FA 3WL3A 4ZEWA 4HXEB 4HAIA 4V39A 2X1LA 1UP6A 4KXUA 5A3SA 4P4SA 4KPFC 3WGYA 2NO7A 3RDPA 2ZI3A 3ZV7A 2WUVA 2QY6A 1T3TA 1RWXA 3H5WA 2WJZB 3PFGA 4PWYA 2VAVA 3D64A 2Z45A 4OU5A 3BRQA 4N9WA 1QR6A 1HDGO 3VH1A 1ZVJA 3DL2A 1V3TA 3ITKA 1C9YA 2GZRA 2OZKA 1OIVA 2EZUA 1C3VA 4EMBA 3R76A 3W5SA 1SBNE 2YC2C 3IVGA 4FJ0A 1QIGA 2Y6UA 2XGJA 1HNXB 3TLKA 2FY8A 1HOTA 1X42A 4ITVA 2KPOA 3AW9A 4XEUA 4MMYB 1RLUA 1N9GA 1V41E 2DY0A 3SLGA 4L1KA 4JQSA 3WWPA 3F2IA 3JQ7B 1KBZA 1CUHA 3I9KA 3E22B 2XWQA 3VZSA 3SC6A 1X3OA 1KTVA 2BEUB 2A1UB 2DXIA 5EESA 3QFHA 4JUIA 1J8YF 1U9YA 3LU1A 3RB8A 2PNGA 4AZ3B 4TWZA 1WX1A 1T5DX 2GWRA 1UDBA 4PFSA 3I64A 4KQ2A 3FCCA 1UBJS 5L3QA 1T2DA 3GLQA 3N1UA 3A9RA 2GBGA 4O2LA 1B73A 1QQ6A 3IT1A 4Z86A 5K0GA 1NBME 4OVKA 2Z5GA 5KTYA 1AU9A 1IBMB 4CFSA 2MR5A 3LRXA 3G5MA 4R2HA 5FHQA 1E8NA 1WSBA 4PBRA 2ZCJA 1C81A 2X0IA 3UV7A 3AVXA 3S2IA 2GJ4A 1SC4A 5FLXA 5B12A 2NLOA 3EXHB 3LLSA 5HQ3A 1JG2A 2I55A 5JZOA 3ZLJA 4ARIA 1XMIA 3GG9A 5JS1A 3M34A 2MCQA 3TQQA 2M1XA 3OOEA 5AI8A 2FOLA 2JIQA 4MRTC 5F3WB 2CSXA 4P80A 2JI7A 2BT4A 3KHTA 1G8YA 2HWUA 1SC3A 4TRNA 4TV8A 4DPKA 2AHOA 3C3EA 2I62A 1CY0A 2HF7A 4CETA 3WGJA 16PKA 2G63A 1ETHA 3WHLA 3ZU3A 1ULHA 4LVOA 3PPYA 3B9QA 4OXNA 1WJGA 2IU3A 3LHSA 4Q4HB 3IPYA 2JARA 1NDQA 1M2GA 1DGQA 4LF6C 3GUZA 4EHFA 2QW0X 3GNSA 2DGDA 1R10A 4ZYVA 3NBUA 3SICE 2PKEA 2PKXA 2CXSA 2WKWA 5BQFA 3HZQA 1N2IA 1FSGA 4QUDA 2MSKA 1K5GA 4Y2RA 3RG6C 2ZUSA 3DD5A 2XADA 4D6XA 2OK8A 1VQ6P 2N1BA 1WRBA 4RA9B 2G7MC 3Q2KA 1NKSA 3AHEA 2VZLA 1QQAA 4HLNA 4JI1C 1F51E 5FQNA 2B78A 4Z7OB 3FHCB 3O7MA 3QYAA 1ISFA 1NQAO 5AE2A 3A4IA 4ZJUA 3T1TA 1C3XA 3L8YA 4HDOB 1U8UA 3IJRA 1V8ZA 4H2WC 4DBVO 4C5CA 2HSGA 4YJGB 1KDOA 4J6EA 1T8TA 3ZZ1A 1ZAYA 3DW1X 4TKUB 2OLKA 2O1SA 2IBTA 4I4NA 2IH2A 2JFVA 4PC6A 2CDCA 2QE7A 2IRWA 3VPCA 2VHXA 4Q19A 1ENPA 1N6RA 5CAEB 3WGIA 2QHXA 1SXJE 2ZWVA 3I9V1 2PUGA 4JBLA 3AJRA 3M81A 1FU7A 1CUEA 3LUHA 3ZY2A 4BX0A 2Y2VA 2VJAA 4H0CA 2BUAA 4QYIA 2EBWA 2DKOA 1EOQA 1XLWA 2EP7A 4OQDA 1MJHA 1BW9A 4OUKX 3VZDA 1XO1A 2ZTMA 1J07A 4HADA 2RE8A 5AESA 1RKBA 5KYKA 1TK2A 2ZYTX 1PT8A 1UZLA 1JU4A 4COOA 3QWBA 2FSFA 3OE5A 1MPXA 4J0KA 4XZ3A 1RJGA 4HAOA 1F0PA 4RY8A 2WICA 1L0BA 1M6XA 2FR8C 1TO6A 2GAJA 3CCMP 3OY2A 2NP7A 4D80A 3SSNA 1DRWA 3WSTA 4EFKA 1SH7A 1ZRHA 4L9SA 1PK8A 3ASVA 3OFND 1MT3A 4CTMA 1VIYA 2KODA 1DCKA 4YC7A 1MRZA 4N39A 2WW8A 3AR3A 3LD9A 2DTEA 4BO9A 3PHHA 3GK3A 3GC6A 4IMPA 3DP7A 4RJKA 2GNAA 4ZOBA 1HNXC 3WL6A 3NWBA 2A4KA 4UPDA 2HRZA 4YBRA 2VL7A 3GLHE 1SCNE 2C4HA 1CZHA 4G4SO 1AUQA 4M49A 4NHOA 5K2OA 4GPIB 2J8ZA 3L1KA 3WI7A 3ND7A 3RRFA 1VHTA 2B82A 1ZNZA 2R7AA 1UC4B 1X7XA 2YYSA 3MCWA 2YS6A 4EBBA 4CQMA 2RHDA 5DBIA 4IVPA 4OXQA 1Z6YA 5AW9A 4BGIA 2WQZA 1W7AA 4PO9A 1JKMA 1JQEA 3MWLA 1OH6A 1XJQA 3G26A 5DKFA 1OH5A 4TQ9A 2FPIA 2AQ8A 4ENRA 1IBMC 1QYXA 3B6KA 3BE4A 3DCJA 3MG9A 4MS4A 5FNVF 3OSZA 2WZDA 5BV2P 4H7HA 2XMQA 4CL8A 2WWHA 1ZK1A 1E99A 1T9CA 4WK0B 4IKOA 5BVGB 3A27A 4KB5A 1MXHA 3EXHC 3ADCA 4D9MA 2GFIA 4GLLA 3W6UA 3FGOA 4DYVA 2IUTA 1Z7YA 4B9EA 3OIGA 3A1UA 3CHYA 4FMCB 1USVA 2V59A 4RD0A 3BX1A 1XN4A 4UREA 2IYWA 1U0BB 1QO0D 5EGNA 3MCTA 1JXAA 1NGSA 1A8UA 4EUHA 5KOHA 2YN4A 1T5TA 3JAKB 3WLTA 4JUCA 4RGBA 4X6XA 2HPZA 2P1DA 3DV0B 4V0SA 1O6ZA 5IT4A 2WIKA 2IEAA 2CVHA 4ZGGA 3HFRA 4MRNA 1JDBB 4JX8A 2OUIA 4YO7A 1J2EA 2AVNA 3Q9NA 3IMLA 3B5EA 3AERA 2LCIA 1IONA 4DLPA 2QT9A 4OK3A 4JASB 5CA1A 3JQ8B 3E7XA 3EG9A 4MLZA 2YHBA 4J0CA 2QDXA 3EZYA 5G1NA 3TSAA 1RJ9A 2JNWA 3S28A 2FZKA 1HNNA 2HBQA 4B83A 1QZ3A 2A57A 1AM4D 1M5RA 2Q5EA 3E18A 4NZOA 4PS0A 3CV3A 1CE8A 1BDHA 3DS2A 5FBZA 1I7QB 4GGMX 4KE9A 2HNKA 2E8CA 3WGOA 5GOZA 2J48A 1C80A 3NT2A 2BR3A 2RKOA 4XWAA 4RAQA 2WKRA 1TC2A 3Q11A 4WCDA 3RS0A 3ICEA 1B42A 1QPBA 3T3OA 1P77A 1Q50A 1ZICA 5BOSB 3BULA 1QCDA 1PVOA 3MOSA 4CV3A 3T4XA 4HDCA 2PZ8A 3G1GA 3HG7A 4ZO9A 3LKZA 3MTAA 2PH1A 3TNLA 4CM4B 4DIFA 1JJIA 4ND8B 3N6XA 3E84A 4WLNA 3D59A 5I8ZA 4AN0A 1I5OA 1NP6A 4DJAA 4IJMA 2VUIB 3ETGA 4E7OA 2YYYA 2H4XA 3FLBA 3SIWA 2YQZA 2VS1A 2ZI6A 4JYMA 5K8LA 4MVCA 4TLEA 4WXEA 4YECA 5B64A 2FW7A 5EJDA 3L7BA 1E2BA 1PS8A 2R6R1 4EF6A 3I2FA 1NNEA 2WVGA 3W9UA 5A71A 1TFRA 3M9XA 1T34A 4H2XC 2GETA 3NHPA 1A76A 4JJ6A 2RIPA 4JVNA 1W96A 3IEKA 1GUFA 1EVIA 1OILA 3H2SA 2AE1A 4KTTE 5FF9A 5JSUA 2Q2OA 1JSCA 4QGGA 4WUTA 1B26A 1GEEA 2Q8PA 1C30B 2R65A 3O84A 1TRKA 3RK0A 3A3OA 4DR2B 3VR2D 4B84A 5AM0A 5IFLA 4JLDA 1L3BA 5CH3A 4KXQA 3CVXA 3NP7A 3NRBA 4J1TC 3L8DA 1N6KA 2V6BA 1XDUA 1EUCB 3BCRA 3O2JA 2Q6LA 4Y6LA 1OD6A 1RR6A 1GNQA 1NFFA 4HNAA 4BSZA 4B5KA 2UVPB 2RGWA 3RVKA 3HBFA 3HYBA 1USPB 4X20B 3L6OO 1ISRA 3T0IA 3SC3A 5KVCA 1R9JA 3H6KA 2OO5C 3FPJA 4DWWA 4UUQA 1U98A 1VL8A 2O6HA 4X62B 2I6UA 3TB4A 1NTOA 4MUGA 1V5FA 4HV4A 1FPMA 2JZOA 4JVSB 2Q3CA 4WFQA 4C0KA 1YRQA 3EYAA 1ZEMA 1KEEA 5IJZA 1GJRA 3ABQB 4US1R 4TMVA 1EFVA 5G3ZA 1P1HA 3OP1A 1OX4B 3EZFA 1WF6A 2R8OA 3I5XA 5A4DA 2CXRA 5TQVA 3KJIA 4E2ZA 4BNHA 3ER8A 3OJXA 3RS2A 3GRYA 4UTRA 4QYMA 3V32A 3DM9B 5EMLA 1EFPB 4R1LA 4CCYA 1P3DA 2CL6X 5K4GA 4LJKA 2PV7A 4IL5A 3ORQA 3UXYA 1J8DA 3FLAA 2ZK7A 2PWPA 4DJJA 2E7ZA 1U7PA 3TXXA 2N9UA 3RBZA 2H65A 4EJSA 3P97A 1RBQA 1KOLA 2I6FA 2VJQA 3CZAA 4U0EA 1Z47A 4Y2QA 3IQEA 5F5LA 1SQ0A 3VHXB 1DMRA 2X0NA 3WYNA 4MS3A 3CF2A 1XRQA 4ECAA 1B6SA 3OJEA 1ZR4A 3KYBA 1TZCA 4GC9A 3ROEA 1ACMA 3FIJA 2IHZA 5CLGA 3FWPA 1GGFA 2JFOA 1C0LA 3RT1A 1F1BA 1QJCA 1SOVA 1NJSA 4EKNB 1TM2A 8ABPA 2G82A 1JDBC 1MP0A 4FHEA 4X85A 2A9RA 1M76A 5G3YA 1NMQA 4ZAXA 4NTZA 1RIFA 4E3WA 2HGSA 3I30X 3CZCA 1MIOA 4ZC1A 2XB6A 4K8RB 3IP1A 1E0SA 2YVUA 3W4JA 5HOQA 5ICSA 3VGJA 2VSFA 4TUYA 5AOCA 1WMDA 2CUNA 4YT8A 1M8PA 3X1DA 1L5GB 1JSXA 1MORA 3JATA 1MAWA 5I8WA 3ZHTA 1N3IA 4LYEA 3OJOA 1V60A 5DH9A 4DR4B 3PIRA 4LRTB 2W2VA 4U0JA 5HF5A 1LY1A 3TVTA 2DQYA 4HH4A 3ZJ5A 3OE1A 2ZZKA 4CU2A 5JQGB 4LK2A 1SOMA 5FP0A 3NVDA 2W0MA 5SY9A 2I91A 1KSGA 1M54A 1M1YB 3W5AA 1CERA 1Z34A 2Z51A 5AQ1A 1LUAA 4GU5A 2NU7B 1YZLA 1IRIA 1RQGA 1FNCA 4HGPA 3NETA 2QBYA 1W4LA 5BR1A 3AW8A 2XT9A 4I1RA 5A2QD 1H8HA 1MTOA 1Z73A 3LBHA 5DLYA 2HEGA 4GKAA 3L1HA 1OXSC 4D8UA 4AAYA 4XLTA 1ODKA 1UAGA 5JI2E 1PFGA 1JB9A 4FFSA 5ALJA 4B40A 1R6AA 2QQ0A 4ZANA 3FI9A 4WK6A 2G71A 4TTAA 1NAIA 3ILXA 3KCQA 1XCPA 3AB7A 2RHJA 3IAXA 2PX3A 3T1NA 3PP8A 2OV2A 4DR2C 2I1QA 4F5WA 3H2TA 1AX9A 1GQ2A 2Y6VA 3OFVA 4RSHA 3E0XA 4CWAA 3IBCA 4RA6A 1E1YA 4K6GA 2O3RA 4BJ5A 1N78A 4ISCA 4FBGA 4Q3EA 4W6ZA 3NTOA 5KNDH 3P0HA 4K2HA 1W36D 2UAGA 1Q1ZA 3M83A 5H70A 1ZCBA 3MCZA 1DEHA 2FCAA 1FQJA 3D8RA 2ARKA 4TQAA 4RY0A 4CGYA 1ZR2A 1ZJ5A 5EE1A 1R3DA 2J09A 3A3KA 6LDHA 1XVIA 4JCOA 2Q0HA 3I0MA 1UZMA 1Z36A 3BICA 2YJTD 3B13B 4WK4B 5L3SB 2C1EA 1DMSA 4X62C 4D5GA 3E6AA 4Z0PA 2VJCA 2QAJA 3RC3A 3V4PB 2W6ID 5CA0A 2MYNA 3TXAA 3B89A 1RYZA 5CIWA 3FYCA 1EQ2A 2V98A 4Z0TA 4MJLA 1UANA 3SIRA 4JT9A 5BSWA 4JOCA 3A6JA 2BISA 2CNWD 2CMDA 2R62A 3R3YA 4EVIA 1J22A 4Q34A 2JB0A 2DULA 2PGJA 1G2IA 5TV2A 2YBDA 3VTKA 2QUZA 2BFWA 1FYXA 1YDEA 5FA5A 4HDNB 1Z8FA 3ZWVA 1TECE 3P0FA 1WZUA 2Y1DA 1KERA 1TC1A 1KDPA 1SHUX 5AK3A 1RZRA 5BN3A 4EELA 4JBYA 2RHRA 1YJBA 5E8RA 3GZNB 4Z99A 1V6SA 2LOLA 4KQHA 4UZEA 2ZUEA 1JQ3A 2UYGA 3JQGA 1S9DA 2R68A 1V3VA 5F2KA 2ZJOA 4RTLA 2Z5FA 2X8JA 5LSAA 1FR2A 2XLCA 3UG6A 4Y6SA 1IY2A 1PAUA 3HVRA 3KBBA 3DZFA 1Y3FE 3TK1A 1Y4SA 2BHTA 1M6NA 3WWOA 4LFAB 4F72A 2LNDA 3BE6A 3ES9A 2OB1A 2NYVA 5ICFA 4TKMA 4ZAZA 1G2OA 3CCJP 4OHMA 4FD3A 4CKBB 4YCCA 3P9NA 1VA4A 2I3DA 3VZRA 1V71A 3EBPA 3WA6A 3L8EA 4EI8A 1OXTA 1UBTS 2X8AA 2PE5A 4EY5A 1OKKD 3NHBA 3IOEA 1HQBA 5BV7A 1B2LA 2O2IA 1Q14A 1O97C 3CW8X 2YXNA 1CSEE 1UP4A 1F8UA 1IRXA 1RHUA 4AIRA 1YE8A 3ZCXA 3SM9A 4QD3A 3C14C 3RV2A 5JLJA 4N4AA 3CINA 4EB6B 4RVCA 2AEJA 4MI6A 4N54A 1OF1A 4P4TA 4DR4C 4CJXA 3SHTA 4P4LA 3AEYA 2Z4TA 3EZNA 1UZUA 4B8YA 3ZV3A 2L22A 5ALPA 1PX0A 2XDQB 1MOSA 5BUZA 1DCFA 1WPQA 4YJ3F 5HILA 1MQSA 2GYWA 2XOKA 1P9RA 1ENOA 1FU8A 1TB4A 3FYUB 2XD9A 5FTJA 5CDGA 4QPCA 3SZGA 3DE4X 1NNI1 1H2ZA 4D0SA 5CLLA 5C7IO 2H11A 4LDZA 1R64A 4HAUA 3QXXA 4M7RA 2PN1A 4EEKA 2VTBB 1UDAA 4NATA 1NU6A 3CO5A 5LZ4A 2D2IA 1L2TA 1KWKA 4FN4A 1LI7A 1G3UA 1QE3A 2N3ZA 5TQ0A 2XGGA 1VL6A 3UJAA 1BE1A 4FEAA 2GN1A 3DAFA 2XNHA 4Y98A 4J0DA 1ACLA 1T0UA 1TAGA 2R66A 2XZTA 4P58A 1RO2A 3W34A 1N3BA 5LP1A 1VQOP 2BKEA 1EK5A 1R0RE 3LBAA 4HPWA 1MAUA 5BYJA 4YN3A 1LNQA 2R3SA 3TI9A 2YVQA 1YZTA 3K6JA 2WSYB 2WMNB 3ND6A 4P1ZA 1FX0B 1A3CA 1ZXLA 2FH5B 3S82A 3PHIA 1U8ZA 1GZ4A 4OEHA 3U7IA 4A91A 4IUDS 4DARA 3E1KA 4NJEA 5INTA 4M0CA 4BNZA 1RYEA 1SUPA 4GX5A 1YZGA 4RULA 2OFFA 2GZDA 4G4JA 4JLWA 3JALB 5LD2B 4QVKA 2XOXA 1TKCA 3AJ8A 2BE7A 2NZWA 4B6FA 3PVCA 3KHKA 4ZO6A 2OXRA 5EQJB 4FW9A 4OQEA 1NF8A 5K8FA 3NTVA 5FDFA 2VVTA 1ZJYA 2R96A 3CVWA 3DF7A 3RSFA 1IJEA 3CCBA 1V7ZA 3G23A 5JXIA 3N05A 1M34B 5EFZA 1RRGA 1U1DA 2W6MA 4QLOA 3LPCA 2HW8A 2HNBA 3OT5A 1E60A 3GWGA 4PPGA 3K9LA 1EM6A 5LXTA 3BHJA 3CMAP 4BMZA 1KXJA 1S7GA 5AJYA 4FFVA 2Q3LA 4KQXA 4Y1EA 4TTQA 3JQBA 4YRTA 3TL3A 3BTVA 5J47A 1HBJA 2Y0EA 3Q87B 1GU1A 3Q4GA 4IIHA 3BYZA 1T1GA 4FXOA 5A9SB 3MGAA 2Z3WA 4M8NE 2WJWA 3KKEA 4HWGA 1PD1A 2VZ0A 2CLKB 3U16A 1E0DA 1DIAA 1SXHA 1T6BY 2QXYA 5EJ2A 1XELA 3I73A 3RW9A 1A9XA 4B2PA 3RANA 3LFTA 3NTEA 1FRQA 1DLIA 2CNKA 4LF5B 4R2LA 3PNSA 5I7OA 1ZP6A 3RG2A 3SNKA 2IZOA 2OGUA 3A1DA 4CG2A 4XFYA 1TIKA 1K98A 2DH6A 4YQZA 1XZJA 4ZVNA 3B9RA 5REQA 2J3JA 4HK4A 5D85A 1PFUA 3IAS6 6PFKA 1J8MF 2QMOA 2XTMA 4LFAC 4MWCA 3CJRA 2L19A 3TTUA 2JASA 3NDBB 1CUZA 5T4HA 1U4NA 4RY9A 4XQ9A 2O9JA 3RO7A 2RG7A 1GAXA 3L0ZA 2WSMA 4IDAA 1G8MA 4NE7A 4AQYB 3BJRA 3IQWA 5I51A 1ZEJA 2H0AA 3WTCA 2OC9A 4GI3A 1QRSA 4DA0A 1IN5A 4DIBA 4EG1A 1UWDA 1QS0A 4OLBA 1Q6ZA 5ALLA 4RAOA 5IK2D 2CWDA 1NT4A 4R71A 3TG2A 3F4LA 3T9BA 1XTUA 2IDZA 1Z2EA 2FP4B 3ZD7A 2PNFA 5P21A 1L7RA 2VXBA 4GZ3A 2GO7A 4LJ5A 5JISA 1VE3A 3E9CA 4JBNA 1BN7A 2C57A 1N2XA 4LJ4A 3PDWA 3ESDA 1E9SA 2GPNA 2J59A 4B3CA 3KT3A 1U2SA 3I3OA 4C7MA 4J49A 3SX0A 1LZLA 3GFGA 2EHDA 3FYUC 1A7UA 4YJ2A 5BSKA 1AUVA 4KEAA 3HKEA 2PQ0A 4RHTA 3O74A 1J97A 5A0VA 2AMVA 4AO6A 4E30A 1WZEA 1BE0A 4OG2A 3LVBA 2L0QA 1K4MA 3AZPA 1P3JA 3QEAZ 3JQRA 2KOOA 1JHPA 2ZBPA 3TRJA 4IHAA 2M6KA 2C59A 2AVDA 1FSPA 1OBVA 1CV2A 1N6PA 3FDXA 1LB1B 1WCXA 3SYNA 4LJ7A 3V34A 1E62A 1KVRA 3SIPA 4LIPD 4PAWA 5EHQA 4QTXA 4DLBA 1JHAA 3VKGA 4TV9F 1L0HA 3S68A 2QTLA 3GGPA 1RW4A 1TM5E 4JI6B 1S9HA 4LHXA 1V26A 1M8GA 4CM9A 1XSEA 5TNXA 3KX2A 4JK3A 1IWPB 5KSYA 3WRXC 2FMIA 3A25A 4ZT7A 1BWPA 2GNOA 2VT6A 1C0EA 3CZ4A 4OBEA 2G76A 4CMGA 3GDFA 4RTRA 4H3KB 1UPFA 4RK1A 4TVOA 4XDZA 3QK7A 2GK7A 2QRPA 1BD3A 1DAKA 1HK7A 4WFJA 2AQKA 4UPVA 3EASA 4BP3A 5TGZA 1MABA 1XQYA 2DLDA 2H4WA 4N6OA 5SZJA 4TT3A 5C8YA 1JU3A 3OEWA 4QUKA 2JJ8A 3KIPA 3PUXA 3HXKA 3FVTA 4Q24A 3ZNPA 2ZJZA 3M6VA 3I1JA 4KIFA 5LD2C 1C7JA 5CB4A 1V6AA 5KAPA 4M9SA 1K8RA 3ZXYA 1PWXA 4PGFA 1HMPA 4R1OA 4C0SA 4P0PB 3W7BA 2TSYB 3WLOA 4DM4A 2CNOA 4G0PA 2AYYA 4ZZ2A 2FXIA 3DZIA 5JTUA 3E58A 3RWBA 4ZHQF 5IT0A 1CQJA 3EGCA 3HN2A 2NYAA 3KE8A 1ZCAA 1G6Q1 1F2UA 2DECA 1WPGA 2XYPA 2C92A 4NYMR 1I2MA 1UOPA 4RHFA 2W11A 2NVBA 3QKIA 2X4GA 1QVAA 1WW3A 2FK8A 2NP6A 5BWCA 3EIXA 3IUPA 1ML8A 1OB2A 4EVSA 4XUCA 1KYZA 1Y5NA 4C0HA 2W90A 1W4ZA 2R97A 4RO0A 1OAKA 3GHYA 1FX1A 3DMTC 4GQAA 4WLEA 5CDFE 1T8YA 3U09A 1DSSG 3O4GA 1ECGA 4PYRA 3NGXA 4B3XA 4RXUA 2IY8A 1P44A 4GP7A 5C1BA 1KSFX 1P2TA 3TR0A 3Q1LA 2D06A 3DLBA 5JQWA 2AW3A 4BVEA 3PNYA 3QW4B 3MSXA 1DJQA 1RP7A 2G5GX 5HK9A 4C1BA 3P20A 3MTGA 4YXWD 1YGPA 4WY5A 4J6FA 2OO3A 3LDAA 5EZ5A 5JBIA 2XB9A 4CV1A 1TLFA 4PC3A 4PG6A 1QAQA 3F5MA 3GR6A 1EP9A 4C7VA 1SRQA 2F90A 4WADA 3V6MA 1JLLB 1XF9A 4AQYC 4DS3A 4MA4A 2R60A 2W0SA 1L3IA 3HJRA 3W78A 4MV8A 5FV7A 4M83A 3U3JA 4BQPA 2OCIA 1YB4A 1NVTA 1WXGA 2Z83A 1XZAA 2QY9A 2D13A 1IN7A 1WMSA 4DG9A 1MVOA 4ZDWA 1LWNA 2IUYA 3ELBA 3G71P 1PU2A 4JJZA 3TUZC 1NF9A 4H17A 1SXPA 1UFKA 1ML3A 4BKOA 1L5VA 4D0LB 2ZR8A 2ZRAA 7ABPA 1R0LA 1ZPDA 2WV7A 4BASA 2ZJYA 1GZ5A 1U28C 4ABYA 2FF5A 3WGTA 3B7WA 2FX5A 2Q2WA 5HA5A 1FUEA 3K9QO 4NMHA 2DPHA 3R0JA 2DPYA 1KKUA 3H4IA 4DQLA 4XVQA 3C45A 4OQLA 1MC5A 3D3EA 4YJDA 3KKMA 1TMYA 5A4JA 2VYQA 4PC7A 2QTAA 4ZOAA 1NRWA 1DPGA 3UMRA 2HQBA 3EIUA 1DUSA 1PR1A 4Z7JA 3ZD6A 4D26A 1XQ1A 3VR6A 2PS9A 3KLBA 4RUKA 4AJLA 1YUNA 3C6KA 1PYGA 3FYDA 1KNXA 2JLZA 2BHNA 3Q6MA 3D4BA 4I3HA 5MF6A 2P30A 5B4UA 4P0QB 3URMA 1NIJA 5D00A 2W9XA 3GBSA 1WF3A 3TECE 2WP8J 2PSDA 1I4TD 5BV0A 5HCUA 1Q83A 2Z8YM 4H6PA 4L5BA 3CXCO 3ORRA 1QPGA 1T5OA 2DFDA 1PWYE 2ZRCA 1GU7A 3LW8A 3J80A 3M49A 5F1PA 2CZGA 2W83A 2JGMA 4FBLA 1Y3HA 1FTWA 1U2GA 5J4HA 1D07A 2YN0A 1JLMA 3FIUA 3LTEA 2WPNA 4PM4A 5HRUA 1L8LA 3GLIB 1F8GA 5BNZA 2PM8A 1M1NA 3KKQA 2ZTVA 1RXVA 1XLUA 1RPZA 2ZTUA 4P7FA 2IS1A 1TCCA 4IDEA 2HDOA 1PJAA 1B1CA 2ZIWB 3PLAE 2QTGA 3CSSA 3B60A 2QVGA 2GILA 1JMKC 4PHCA 1NQWA 4EOGA 4OQPA 1Z5ZA 1RHKA 1T2EA 1Y89A 3FPCA 2D3WA 1D0IA 2WNHA 1Z5OA 4EUFA 2ZVQX 3UWOA 4BLRA 4PN7A 3ASYA 3U1TA 1CUJA 1F2VA 4BLPA 1GUZA 2GM9A 1OY1A 4H2YC 4OM7A 1S3IA 4FR2A 1LF5A 1QH8A 2ACKA 2QT1A 4FZ3A 4Q37A 1EFHA 5G53C 2F7SA 4MSUA 3WGZA 5JC1A 4Q3NA 3PS9A 3GJSA 1IBRA 4CKWA 1TPZA 2ZU6A 4AW9A 1A43A 3JAMD 2EBFX 3OE7D 4IDDA 4MVJA 2KZFA 5A7GA 4EW6A 2I4IA 2F8MA 4QECA 3JYPA 4PVDA 1QYWA 2P4SA 1R6XA 3NHUA 3ZD8A 1CUGA 3VJMA 4LF7B 2HMAA 4G37A 1XMQB 2W71A 3HJTA 1XTQA 4URHA 1AB5A 4AJHA 2G09A 5JXJA 3SI7A 3AUAA 4PLHA 3C8MA 1MB3A 1UP7A 2P2NA 1Z0SA 4F6RA 1DRKA 1VI6A 1JR3D 5DBEX 2ROQA 3ENKA 4MDHA 2QLNA 2PGDA 2Q9UA 2GARA 1VCOA 2PRZA 3ZCVA 2DFKB 5TDHA 4ZT3A 2CHVA 5BT9A 1M6EX 4DT1B 3PD0A 4TYPA 5HE9A 2QD5A 1D9ZA 3T95A 4EG3A 1HE1C 1TQ8A 4L9AA 2OTJP 1PNOA 2G5PA 3L5OA 3ONEA 1GG2A 3SR0A 4CMEC 4XCXA 3TQOA 1B16A 1I6WA 4ACBA 2BKXA 1V9SA 3MYYA 4U7PB 4G07A 5A5VA 4LJ6A 3F6CA 2FEMA 4K6CA 4Z1MA 2HBYA 3IUQA 3S2YA 1IZ7A 3AKZA 2O2CA 5I9MA 1CUYA 1XA4A 4J16C 2J5QA 2Q2VA 2QRZA 3E4CA 1UEXC 1Q0ZA 4HCJA 4L72A 3SWWA 1XALA 4JEUA 4M37A 1P7CA 5CG2A 5HE8A 4B6RA 3TQSA 1ZXBA 1OXBB 5FBRB 2BDEA 3OZAA 3INNA 1C4KA 3KQWA 1KFCB 1F2TA 3T8YA 4PNHA 1ESNA 4AYWA 4NEHB 4C0JA 3TNDA 3CF0A 1NASA 3WK7A 3D3WB 1JFVA 4D41A 1LF0A 1ZS9A 5IP5A 4KFRA 3D8SA 4DSNA 2BJOA 2V0GA 3LHKA 1RLJA 4Q7KA 3K0AA 1CD5A 2X2FA 1KDTA 4J4TA 1UR5A 1NMEA 3FNRA 2PR2A 4K9QA 4AY5A 5TVKA 2CLOB 1G4AE 2IYXA 1EHIA 3VISA 2AR9A 4GM4A 3ZBTA 1FFGA 2HU7A 3FFBA 5IAKA 3ZZTA 3CGGA 1ZKDA 1DU4A 3II6X 2HBRA 5D1NA 3BBLA 3ETCA 3WB2A 4QUJA 1WNFA 3BDAA 3MTDA 3M4JA 4ZU1X 1QTIA 3MEQA 3WR5A 4WNIA 3AGPA 1EDEA 3ZI7A 1Y3CE 2VHUA 4V0ME 1IJFA 3L4SO 4YRBA 1P2DA 5D7BA 3C4QA 1UFOA 1CF2O 4H15A 1YS1X 3TDNA 3TLEA 4HDRB 5G1PA 3NBMA 2QN3A 1XXHB 1P1BA 3NTRA 3A1WA 2OSBA 1Z5UA 1ZN9A 3V8MA 4PHFA 5HGOA 1KY3A 3S5UA 3OJCA 1GQRA 4DGQA 3SX4A 1GR0A 5LM3A 2P3LA 1VIMA 3NVMB 3BCSA 2FA9A 3MB5A 5T4BA 2XECA 1IJBA 3PKZA 5LA6A 3IMFA 1DXHA 2CHFA 3HVIA 4AJJA 4FMDF 2DCUA 3VR0A 4UOZA 1FRVA 3SF8B 2FVEA 1K66A 3TJMA 3GGDA 1EFAA 4L9WA 3P9IA 4JVMA 1XVLA 4ENQA 1KOFA 4TYQA 2R47A 1E2GA 1P0QA 3C3KA 1YWGO 3CR3C 3P0RA 4AKHA 4AMVA 4DLUA 3RNOA 5JATA 4MMZB 3P32A 4EAAA 2KOSA 4BDTA 1XWIA 1NV8A 3R9KA 5CM8B 5E6RB 1JA9A 3GFTA 4HLDA 2YWHA 3A6EA 2LXNA 1CS0A 2IX3A 4M54A 3VMFA 1BMFA 1V8BA 3UT5B 4EM6A 3G0VA 5FX2A 4GP9A 1RU3A 1ZHOA 1QIIA 1T5SA 2ZYDA 5H8WA 3JARB 1NZFA 2UUOA 1K4YA 1Z0ZA 4KK4A 2V54A 2X5NA 2JBHA 3GO4A 2PL5A 5E38A 1ONSA 4L3WA 1IEQA 2QN6A 3P7MA 1XZ8A 2VAPA 5C18A 2VWHA 1IG0A 3CA8A 4DCCA 1FS4A 3G88A 1JSLA 2FFBA 1C29B 4PFQA 3ZUGA 5BNTA 4BLUA 4NX2A 4LF7C 1XMQC 4PLGA 2JGLA 1JL3A 3ZC3A 1SIUA 2F1HA 4RVHA 1C7ZA 3TLGB 5EUQB 3SVZA 2FZCA 4Z9FA 2XIJA 1VMAA 1R15A 1ZGZA 1RJFA 3WLLA 2HXSA 3G3EA 1BO6A 5IUNC 1MDBA 1CY4A 1VCIA 1RZVA 4M7WA 2UYYA 1L5QA 1MOZA 2J3DA 2PKQP 3RU9A 3WLKX 5E6UB 4K9OA 1P9LA 3QSYA 2Y05A 3BSSA 4IXDA 5I9IA 4C06A 3A1NA 1ONOA 3EUWA 2H54A 4RDHA 3THXA 3B9PA 3K72B 4OX9B 1WDLA 1VHNA 2RI0A 4HVAA 1UFRA 4XX0A 3L02A 2Z5VA 2GN2A 2O8BB 1G7SA 5KHOC 5CEFA 2AV6A 3RRNA 5CLFA 3HXOA 4Y7CA 1DOAA 3G6WA 4S1VA 4MB2A 2A9VA 4M1ZA 2I8CA 2XGMA 4O8CA 1SXIA 1TTQB 5HZKA 1G5IA 3UAXA 2AMLA 2GYUA 4P53A 2FPPB 2MINB 3TD2A 5M3BA 2RKBA 1HV8A 2HT1A 2RIRA 2ABWA 2MSWA 5CDUA 3EXG2 3SAJA 4FYWA 2Y67A 3HYTA 2FPGA 4UDYX 3V1YA 2EGUA 4A1OA 3UA4A 3I72A 1V25A 2MR8A 1AV7A 3FFTA 2I2XB 1YRAA 1Z2AA 3JWHA 4KR3A 5F35A 1VJ1A 2YHIA 4YAEA 3OSUA 1T0HB 4DMHA 3G0GA 1EFCA 1YASA 5DM1A 3I6YA 4O4LF 2YWCA 3FLMA 1PP4A 4RFSA 2JCXA 4BL5A 4H7PA 5K9ZA 1RZ3A 1TM1E 4D98A 9LDTA 3EFBA 2IA5A 4HLQB 2C88A 4RV5A 1MO6A 1GTZA 1VCHA 3VU9B 3PROC 3CE6A 4HAVA 4OAQA 2EJUA 5BSHA 1FS6A 1GNVA 3QEJA 4J75A 5DK6A 2YHSA 3FWZA 4L28A 4P3KA 3AUXA 4K7JA 4B4UA 2QLJA 2ZKIA 5C3UA 3B6JA 4F9EA 4BZXA 3E8XA 3VPGA 2LPMA 3AF0A 3JX9A 3DDSA 4M98A 4UFPA 3SHVA 4LBWA 5IBPA 4QJ5A 5IVKA 2IBSA 4O4JA 4US2R 3MN1A 3IPAA 1Q3TA 4UTZA 3AWIA 4DR3B 5F9FA 4H7DA 4K6HA 4H6XA 4BNIA 3VGPA 4PCAA 3WSVA 3HLYA 2J3KA 2WR8A 4HNVA 3NMUF 4O4IB 1P0IA 4KQJA 4KBGA 3H1EA 4WKGA 4CCWA 2ORED 2F9LA 4IYJA 3NW9A 3RAJA 1EM8B 2EW1A 5KYGA 3EEBA 1L2FA 3PXBA 3L4JA 4N8DA 1KZYC 2V7BA 2JK1A 4Z49A 4E1AA 5FBHA 2PIDA 8LDHA 2EIXA 1JWAB 1ZM4A 3H8WA 3MUNA 5ILOA 3U26A 2X0JA 5JJLA 4UTVA 1PHPA 4NXMB 2CQ8A 4JBGA 3IRVA 2WA2A 2FFRA 4EENA 4OHOA 1CHDA 5DGCA 3L1VA 4L3OA 3EMBA 5C1IA 4X95A 4LV5B 5A1TA 2ZBGA 4UHEA 1KQGA 2HL6A 2G5CA 3PBKA 1OU4A 1XP5A 4PZYA 4ND2A 1OFUX 1Z2NX 1F8FA 3C6QA 1D0SA 2ZRFA 4MS1A 1QPZA 3CKYA 3ROKA 3MILA 2P2ZA 4LYAA 1M2VB 3DE7X 2IHYA 4C22A 4UUBA 5ULLA 4M22A 4UFNA 3ZV4A 3P5SA 1E3EA 1INLA 4BFCA 2CT8A 3BJIC 5DN6A 2V96A 1L1FA 2CB0A 3RS7A 1XQVA 1JYSA 5K4AA 5SV2A 2BMJA 2H2WA 3BXFA 4FLMA 2JDID 3RJ5A 4WXHA 4PW0A 4EGAA 4AJOA 1ID8A 3QVUA 1PTKA 4P0TA 1C4WA 2E8FA 1U9CA 3N76A 1OC2A 2A59A 4HGZA 4HN4B 3C6MA 4EZIA 4II3A 4MQ4A 2HD4A 1W2BO 1EXDA 3EX7C 4M9RA 3LCMA 2WP0A 2DJ5A 4OX9C 3OQ6A 2GN0A 4UUOA 1VQLP 3CLUD 1GAQA 4W1SA 1MW8X 1V7PC 3GLFA 4P7GA 5L4NA 1KAGA 2Y0BA 3AHJA 2O05A 1AD2A 1Z06A 3WBKA 1BS2A 1QK4A 4JI4B 3FPBA 2AOUA 1VJ5A 2PXXA 3FSEA 3G0OA 1C0IA 1VLMA 3C2QA 4WNAB 1LBIA 3KQHA 4U2DA 4WKPA 1G3RA 1KIAA 2QP3A 2FN4A 4H27A 4QRIA 2N98A 5E0OA 1KMMA 1RG9A 4YXFA 2ZSHA 4S2EA 1LW7A 3H86A 5K8VA 3MUEA 1WP9A 2HA4A 3HU2A 1N5IA 5FR1A 3W6PA 4YRMA 4DCGA 2I7DA 4EH1A 3TNFA 1BH2A 1PDVA 3H19A 4KOAA 1AUMA 4Q39A 2B5OA 5FBWB 1D1TA 4V0LA 3L8HA 4AUEA 5JCZA 4J1SA 4CIDA 1VKRA 1D1DA 2FN9A 4HBZA 4WA8A 2X8LA 4ZKDA 4RPCA 3UW1A 3HYCA 5LKRA 2BGGA 4U7DA 4OHVA 3RSOA 4HXGA 1F0KA 2IPMA 3K2EA 2BF7A 4NARA 4ZO7A 1WEKA 1FZTA 5BR7A 4BRWA 4MWGA 3GJTA 2GFQA 4MP3A 1M10A 3ZW7A 1KI6B 4C4YA 4MV3A 3PPXA 3ZOKA 3H9UA 1GFWA 2RCYA 4DR7B 4HAWA 4MW7A 1V9LA 4ZJZA 3BXZA 5TT1A 3OQOA 2NZUG 3A9SA 2IOHA 1P18A 1KJJA 2X8WA 4C78A 2CK3A 5MN6A 4I2VA 4R51A 1U9IA 4DR3C 3MINA 3PT5A 1E7WA 4HKGA 1UAYA 3AI3A 1L4MA 2FADA 3LOPA 4W5NA 2X2PA 1YBAA 3KK0A 2GEVA 4B80A 3FPKA 2GCPA 1BMTA 2J4FA 1VKOA 1CZKA 3UJ3X 1A9PA 1VIDA 2O23A 4ER7A 4ENPA 5T5QA 5AW1A 3NKLA 1SC6A 4B4DA 1T3LA 1GHTA 2IEYA 3STYA 2VQFB 1L4HA 4V1CA 3RGGA 3BZUA 1F6BA 3IUNA 2ZJ3A 4JP1A 3T38A 1U2RA 1USIA 421PA 1VE7A 1C3OA 1T8WA 2GZAA 2GJ8A 1PYOA 1WCYA 2JAZA 1MA3A 4HQOA 5F9HA 3G2HA 1MQ8B 5AK5A 4YAKA 1P2UA 1CVLA 3V1MA 3H2GA 2RJ3A 3AP1A 3ZHVA 1J09A 2W6OA 5EG5A 5AW3A 2XAUA 3EDCA 1N5JA 3Q3GE 4QJ3A 1NW8A 2VHYA 1V39A 3J81A 1RPJA 2P9HA 2HSJA 1FU4A 4TYWA 2HADA 2JKZA 2Q9AA 4GVLA 2B9EA 1MG0A 2OBVA 4BEJA 4EIWA 2QPTA 3DTVD 1EX1A 2Y4NA 3LFHA 2ZIXB 4XR4A 1IVYA 1A9TA 3FTQA 4QOHA 5KP7B 4C6TA 3LYUA 3PDCA 1SEPA 4D4JA 4NL4H 3BGSA 1THZA 3FHJA 4RF4A 2UZ3A 5T6MA 4M0KA 3AUJB 1IN8A 2QTVA 1K4KA 1KJWA 1UJ4A 1P45A 1V8FA 1JQ5A 4TWIA 3A1FA 1JPVA 3E35A 5CZDB 2X76A 4WZ6A 3CC7P 2YWRA 5DTMA 2OY0A 3M89A 2I4OA 1HDCA 1XQWA 4K0RA 5KYWB 1KBOA 4X91A 1EB8A 4QODA 4JI4C 3FNBA 1N7GA 3TRFA 3UMCA 4X84A 3I1YA 1OR8A 1UJ2A 3LXUX 3HXQA 4EZEA 4JSYA 1H3EA 3I5UA 2PUFA 3T7IA 3TGWA 2WWVD 2XRMA 1TJ3A 5COQA 3STVA 3H3JA 3HLKA 3PIIA 4DW8A 3FF4A 3EFEA 1LVHA 2GS9A 4I14A 3QQ5A 1X3LA 1U9JA 1WQ1R 4D0NA 3A37A 1V9CA 1NE2A 1O93A 5DBGA 1A9ZA 2GWHA 5JXWA 3RAPR 5E4YA 2FMTA 2PGAA 4YP9A 1Z56C 3M1AA 2KX7A 1P19A 4RWZA 5IJWA 3UUGA 1FSFA 3JQCA 1XPUA 2EXXA 2FW9A 2OWDA 1M90Q 2K4MA 3PR1A 1I01A 5C5EA 1S2NA 3G0CA 3OKAA 1B8UA 2Z3ZA 2VI5A 2D0OB 4HO1X 2WM9B 3BFXA 1AMOA 1X9IA 5GZ1A 4LI3X 4Y30A 1O96B 1QH1A 3BMOB 1WXIA 2FK7A 4DREA 1K8AQ 3MJDA 4G2TA 1YI8A 3Q9LA 1KOGA 2J0QA 2DT8A 4GS5A 1XMXA 5BY2A 4I6EA 5HJEA 4C4PA 2ZQYA 3TD9A 4MLPA 2HQSA 1OA0A 1YMVA 1KJ9A 2K2WA 1U0LA 3RGWS 1SCQA 3LQKA 1R4NB 4XDGA 2HREA 3IBSA 4F56A 4Y2VA 4Y67A 1CB0A 2W8BB 1LJLA 5AHRA 4DR7C 3MELA 3N86A 1PG4A 4K6FA 3CUTA 3N2QA 1Y8RA 3IC5A 4NJMB 3CLRD 4L15A 3GGJA 1E5TA 1CR0A 4UTNA 3DT9A 2C3PA 2QMQA 3EVFA 4AIIA 4RHXA 2L17A 4EZBA 3WAKA 5JCJD 3QJ5A 3FKSA 2C2BA 4CZ2A 2V45A 2X0RA 1XN1A 4LA4A 2ZRPA 5CCXA 1OU0A 1TUBB 3VKUA 3W8FA 5FYQA 2WDZA 4RKEA 1UMCA 5ERGB 1W8IA 3MRSA 2Q9BA 5KNCH 2ANBA 621PA 4F1JA 1DAMA 1Z6AA 4G0YA 1PD0A 1GL7A 4D8TA 4B3BA 4ALLA 1Q7YQ 4DFDA 4TM8A 4AY4A 1NRIA 2AN5A 4HD8A 4PGGA 3WL8A 3QVGB 2JCSA 3VVLA 4DDTA 3I92A 1QIDA 1ESEA 2ISSD 5H7XA 2VQFC 3ZS9A 4MWOA 2FAXA 2QX9A 1RT9A 4G1VA 3ZKWB 1BEZA 2AW5A 3LG2A 2ESRA 1SCUB 3BS4A 1GPWB 2QU8A 2Y9PB 3T06B 1Z6GA 3CRMA 3TCKA 1ULSA 3J7AC 3AR9A 3MJVA 3DXYA 1IQ0A 4PNEA 3PFCA 3ILYA 1ZIPA 2YJNA 1T1SA 1XTTA 2OLEA 1W0KA 4GPAA 3U13A 2JAXA 1ZK2A 1YV9A 4LSWA 1JKIA 1AMNA 2AI1A 4D3DA 4MX8A 4BVGA 4QFBA 3M3HA 4KDEA 3AF4A 2IU6A 1Q7RA 3KFLA 3K9GA 1P4AA 1K7FB 3K9HA 4DLSA 4NULA 1X87A 3QLEA 1Y37A 4FSHA 2EGGA 4Q47A 3U6KA 1Y3AA 3O73A 1FYDA 3ZCTA 2QM7A 2WQ6A 4F5DA 1ISPA 4B3MB 4ZXPA 4EYOA 3Q9UA 4IMJB 4YT5A 2OBBA 2WG2A 3NBYC 4CGZA 3I04M 4WZAA 5IAJA 1P4RA 3MWKA 1C7RA 4G3XA 1CRZA 4NU6A 1S0UA 2P5UA 1O94A 3PSHA 4RMNA 1WW2A 2PT9A 1NSYA 4C4OA 1X86B 4X97A 1Z4OA 1NBHA 3AIOA 1C9EA 3H84A 4RPJA 4L95C 1TYDE 3JQAB 1CC1S 2I3ZA 2A78A 3S2UA 1G4HA 3MERA 1P6QA 4PCLA 1F8YA 1LK5A 1IBKB 3L06A 1U0HC 2PKWA 5JD3A 4EYSA 5CJ2A 1PR3A 4XJSA 3G9UA 5BYAA 4XGRA 3H47A 3TGPA 4V2UA 4DA4A 4YAGA 1E69A 1OREA 3TAUA 4EFDA 3LOQA 1OFHA 4Q6BA 1QLHA 3MS2A 2H85A 4INZA 1YK0A 4XAQA 4HZUA 4B46A 3GUVA 4REMA 1JI0A 1R0ZA 2AL7A 4IQGA 2RK4A 4N7BA 4GXQA 5CVUA 3VR5A 3CLHA 2FQWA 1SY7A 2R5NA 3T9FA 2XNKA 2G8NA 4ATNA 1GGJA 3IS3A 4QBFA 3OX1A 3MMXA 3WO0A 4R6XA 3FVWA 2VDVE 2XZ0D 2OYSA 1SXGA 2AOXA 1FFYA 1LLUA 5IPFA 1JQKA 2J0SA 1AT1A 3F5SA 2VZ8A 2FQ2A 1H9AA 1HDOA 3O8OB 2Z0MA 4WHMA 4MGHA 1QWOA 1SHLA 1CUXA 4Q3BA 3RUEA 2R8BA 3EA4A 3LRTA 2AFHB 2EDCA 4FMCF 2PUCA 3NIWA 2C83A 1V45E 4JOBA 1XJWA 3RYCB 4LE2A 1N5KA 3AKDA 3P9KA 4KUHA 4G1FA 1P9OA 2I2AA 4P4UA 2X23A 1N1MA 1TD1A 3HKDA 2AKEA 2R8PA 1J33A 1GUAA 4NKRA 3WBBA 3PQ6A 1KEKA 2VJMA 2OCLA 4MI3A 3MCAA 1WZ2A 4C3UA 1L7XA 4G67A 3C8HA 1XMOB 3CLSD 4UMFA 3Q41A 1PJ8A 3ECAA 5CVCA 4LRWA 3QVSA 2BBTA 3ETDA 3RF6A 2R6DA 1I6LA 2JYGA 3R0QA 5AUPB 2VYCA 2GM3A 3NUZA 4RETA 1IUPA 1XQXA 4IF4A 1PEAA 5EUMA 1DAIA 3HN7A 2V3VA 4C5AA 1K7XB 1XEWX 2L42A 2GD0A 4DV0B 1A5SB 3LHIA 3FUCA 2ZOSA 5FL7A 4DG8A 3T3GA 3PL1A 3JY6A 1XNGA 3QXGA 4EW3A 3G28A 2H5IA 3MUOA 2NUAA 1OI2A 2IS2A 4KACA 2EKQA 5F7XA 5GPBA 1ZA2A 1A9QA 3UTCA 3W2TA 2HWYA 4L6AA 1PWEA 3FROA 2Q49A 5FLXD 4R9UC 1ODIA 4S2UA 3RSCA 2GHRA 1U8YA 4JZKA 1T9KA 1O0BA 3R6LA 5IDWA 3L84A 1OLSB 4AJIA 5CB6A 5DMXA 3KXKA 2WHPB 4ME6A 5DTEA 4P3OA 4Q1BA 1E96A 5G41A 3QU7A 5I7VA 3UTDA 3KOYA 1YIOA 4MUHA 2XYGA 2QU7A 3DA8A 2HUNA 3MGGA 1Z5VA 1TAQA 3PG5A 1M8KA 3SY8A 2X58A 3GZ4A 4JU9A 4GSLA 3GEMA 3C5CA 2IGBA 3KUUA 1ICIA 3NHLA 4PG4A 2N46A 2VOEA 1NU8A 3DOOA 1TEVA 1Y4UA 4LXUA 4EVRA 3GH1A 3P2MA 4LF9B 2Y1XA 3M5CA 3R75A 2WM3A 4AKEA 3QKSB 4BO6A 1XI2A 1E1NA 4GYWA 3BJZA 4NOLA 2D1TA 2X86A 4DNXA 4KXVA 1Z12A 2CFOA 3CC4P 1T1IA 3RLIA 5DCKA 4B3MC 3WS7A 2VNKA 3F6EX 3WRYA 1CZRA 3LIPA 1T2VA 5E2BA 4DV4B 2O6LA 2OCAA 2FR1A 3A6LA 4NBKA 5EIBD 2ZUVA 3PWKA 4YASA 1WB5A 1P4JA 2AXQA 5F4ZA 1ZIDA 3CRVA 4MZDA 1DUVG 1H42A 5IJ0A 2QLLA 2JAUA 5ARDA 1IBKC 1QE5A 3QUTA 2QE7D 5JH7B 4CMCA 1H9BA 1AG9A 4HEHA 3JS5A 3QUQA 1SZDA 5T8SA 1PO7A 3I5YA 5KPDA 4UOEA 4FZ5A 2OORA 3R0ZA 4XSVA 1JG1A 1JIVA 1HDYA 3UX2A 2OC4A 4J3JA 1E5LA 3SYLA 3CEJA 1FQWA 5JJBA 4HNQA 2BKLA 2GPJA 5TLSA 1JAZA 4KAJA 4PQYA 4UU1A 4COKA 2XWPA 3S81A 4CEIA 4KUEA 2EQAA 3MPOA 3UT6A 2WAOA 5GWXA 1SEVA 2B4YA 3B6ZA 1XV5A 1ZK3A 1LCIA 721PA 4M88A 1YH3A 2DFLA 1D0VA 3V00A 4BPGA 1HX7A 4BNNA 2FJPA 4IDQA 1G66A 4NPAA 2FU5C 3O3CA 3MMNA 3BB4A 3WADA 2WU4A 3BH0A 3HSSA 4IO1A 1M7HA 5IVDA 2K2QB 3B3AA 3D3JA 3MAAC 3UPTA 3RC1A 1MB9A 3FXAA 5C51B 2QLMA 2FZ5A 3U0VA 1PJBA 3LUJA 1K3TA 4N01A 3B3GA 5AJTA 4BMOB 4WQMA 4EA6A 4MUAA 4JLNA 1WCWA 4V03A 1XMOC 2AQIA 4FW8A 4XTRA 2RFLA 3HH8A 1VZ2A 2G9VA 5MFZA 3VJKA 1ZJZA 4NU8X 4Q9IA 3K2BA 2NV6A 4QGHA 3H11A 3QV1A 1DV2A 3DDHA 3LT4A 4I5GA 1IM5A 3I9NA 1KTIA 4PO8A 3P52A 1UJNA 5G40A 3K0CA 3ACDA 4KI0A 4DV0C 1Y80A 3HJUA 2XMGA 2E7GA 2BD0A 1XZBA 1VOTA 4CQMD 4QBGB 1X1CA 3KYCB 2QX7A 2GEUA 1XD2A 3DF9A 1JV2B 4DQKA 4HX2A 1RWQA 3GL9A 1RBYA 3HJGA 4LF5C 4O2RA 4NZPA 3ZBUA 2NIPA 5DHPA 5ABPA 5ELXA 1H6AA 1JIIA 1U8EA 3RASA 2JLXA 2OUKA 3WNQA 2QW1A 2IWRA 1Y6GA 2C42A 1MO4A 1S3GA 3RK4A 4JLKA 3RABA 1UEJA 2AYXA 5JQGF 1DX6A 2A14A 1KC8Q 4D2IA 4EW1A 5H68A 3ANSA 4JMPA 2J7KA 3JRNA 1PV4A 1W8DA 4ROTA 4EG4A 3VOBA 3JD2A 1FTGA 3K9NA 2O1EA 2Z8XA 5K3FB 1BA2A 3PHGA 4JBHA 1Z4KA 2I7XA 2D0PB 1X15A 1D9XA 2F9MA 5GONA 4UE3S 2XEDA 2P2LA 1VEHA 1DOZA 5A02A 2ZUFA 3WMRA 2OZEA 3RSZA 4FOPA 2I4MA 3ZPXA 1QSGA 5L6LB 2KGAA 3GCGA 4NCKA 4K6KA 3CXUA 3QP9A 3EFOA 3QLVA 4PRYA 4LF9C 4BY9E 1G63A 2DAPA 1ZGJA 3IHLA 2QRNA 5IHXA 1EX6A 1HFWA 1UBSB 5D3ZA 5E1OA 5I9LA 1AQNA 3N28A 4NH4A 3VDNB 4KGDA 2I4NA 1GSIA 1U2QA 3IAHA 1PR0A 1MHPA 3RVQA 4H7JA 2QVZX 1DZIA 4ZK6A 3ST7A 1UJBA 4HDMA 4JNKA 4AN1A 3JZAA 2B9VA 1FXWA 3E9QA 3CTPA 4DV4C 5AKEA 5DEOA 3FX2A 3FWYA 3ICOA 1PHRA 1L7MA 3T1VA 2BRUC 4P81A 4PZZA 1AQLA 3RS8A 3HJBA 4MV7A 3TIGA 1IBCA 3P9XA 1BQEA 3CQ2A 2PGOA 3S2FA 1M2OB 4J0EA 1JKXA 2HO5A 3AUYA 2PO7A 3K0EA 2XV1A 4BUZA 2NO1A 4LYJA 3KXWA 4W5HA 1F4VA 2P77A 2BSQA 3M33A 5BV1A 4JYCA 4YI3A 4JI6C 4EL5A 1RACA 1TXGA 3TLAA 4Y2TA 4US0R 2GA9A 4EFLA 1E1CA 1QAOA 5BW5A 2JYLA 2I67A 5CJPA 1H1LB 1UK8A 2IV3A 1Z62A 1DI0A 2JK0A 2R6GA 1MH1A 1D6MA 2J08A 1X9HA 1GTMA 1K7CA 4FFPA 1DC8A 4IZIA 3TBKA 5FUVA 3L6CA 4OUDB 5AM2A 3HB9A 4KVFA 4UVHA 1IB6A 3JD4A 3GRFA 3GRZA 4HSGA 3GFSA 3L07A 3TG8A 2E5LB 1FP2A 3CH7A 4WINA 1SQFA 1USKA 2QRVB 1HDZA 3AR7A 2PSJA 1JALA 3OEEA 2PUEA 4DMFA 3DAPA 3IQFA 2HK9A 5E6SB 3BTSA 1QHIA 4K8OA 2I6XA 5IM5A 2C7GA 2IHJA 3TRKA 3O8NA 4U6QA 4DV5B 4P2GA 3PYLA 5SZHB 1SA0A 4MEBA 2H1OA 4L5IA 2G9NA 4CT0A 2W2LA 5FFFA 5IDXA 3ZZNA 3KUXA 2BFPA 4A2PA 4XUGB 3AEKB 1HQKA 5DIFA 2JEYA 1KZ1A 3EK2A 1IFXA 3HHEA 2JFXA 5KOJB 3DFZA 2CL5A 3PNQA 3HCAA 4I6GA 4DDVA 1IEXA 4BGDA 1IVNA 3KO8A 1G1MA 4TM7A 2VPQA 1SUEA 2AMJA 2GAIA 5K01A 1F20A 4YA6A 2PX5A 2YCLA 5A3VA 4IKEA 4J07A 2B21A 4N5LA 2HJGA 5I8PA 2WYUA 3U3KA 2PU5A 3I0ZA 4XLLA 5LU8A 4PROC 3K15A 3UXEA 1LPAB 1S7CA 4OLJA 5DRYA 1XKQA 3F3KA 3WLJA 1ZHFA 1KMCA 3RT9A 2RD2A 5AM1A 1QQBA 1OT3A 1ZESA 1Z4IA 4NCXA 1MLDA 1SVNA 2NYRA 1KJZA 1J20A 4DDMA 2R6AA 4DA9A 2B1JA 3UK7A 4YEDA 3L7YA 4W7IA 2EKZA 2CBGA 3GAMA 2DBQA 2R4UA 5KBYA 1TL7C 4I4IA 3I9JA 2A7XA 1JHXA 3OTOB 4Z2YA 5KSPA 1WVIA 1CEIA 4YCBA 1LTHR 4PICA 1OE0A 3AUTA 3E9NA 3FTEA 1CVIA 1RQPA 1ZD8A 3PCRB 1YKSA 3RFVA 4G26A 3X1ZA 2ZRQA 3TDEA 4MWEA 1SHZA 4I9HA 3CIOA 4BB6A 4C4RA 3V7UA 2V6GA 3K2IA 4N0MA 1SXJB 4GI7A 2YWDA 4RLQA 1QTQA 4ND1A 4DCOA 1KU6A 2WWFA 1ARZA 3WK6A 4TXLA 2GK3A 1MQ9A 3TLMA 4I50B 2PEOA 1FQKA 4WH0A 2ODQA 2VCHA 4WX2B 4QGSA 3KR2A 5ALGA 4WA7A 3QBVA 1M6YA 4HTFA 5DCYA 1DWPA 4CW7A 2CXNA 1G7CA 2J32A 3QXCA 1GPH1 3G0BA 1AKWA 4TWBA 3AEXA 3UV6A 3UCFA 4HWOA 1O58A 2ZRKA 5J63A 5IYZA 5FRDA 1F38A 1QP7A 1XTRA 1N57A 1F5SA 4GZLA 3EEQA 3QRWA 1K7EB 3RROA 5HJ5A 2MJLA 2XLBA 1OXXK 5EQFA 4YK7A 3O1HB 4IQ8A 1GGKA 1Y3IA 3TIVA 4NV1A 2ATXA 4M0FA 1BN6A 3OZRA 1XRNA 4EGSA 2BGJA 4I3FA 4GO1A 2PENA 5AI5A 4QU0A 1O5OA 3WMGA 1W4RA 4MUJA 2FZGA 4U7GA 3TRIA 4BC7A 3VPDA 1L1EA 3GLHB 1KMHB 3AVVA 1VJTA 6Q21A 2H4HA 3CYFA 7CEIA 5KDDA 3ONWA 1NT2A 4I2NA 2WAMA 4N3AA 2D1RA 3AHFA 2PD3A 3NHSA 1J0CA 5FWNA 4XJVA 2ZM6B 2PLWA 2D7DA 4KNYA 4BZWA 5J9FA 3W4IA 2G72A 1H8HD 3FVQA 4B73A 1AQJA 5IN4A 4UE2A 5IS2A 1IB8A 1JFRA 4J0FA 5M29A 3K20A 3U17A 4BJ6A 3EE6A 1RYMA 3AINA 5TSDA 4D3ZA 2FX3A 2E5LC 1J9EA 2H4JA 3WGHA 4PLYA 5HS4A 1A98A 1ZJ4A 3RRJA 4L50A 4EF4A 1A7AA 4XE5A 2WTEA 4ASUA 2CVOA 2P9CA 4DLNA 5FA8A 3F49S 4EKGA 1SB9A 4EX6A 3LM8A 1AZTA 1HUQA 4N5NA 1TW2A 4OQ4A 4ZMRA 5D2CA 3N2GB 4H7KA 1KVTA 4R3NA 3GW8A 2J46A 5EP4A 1ZMTA 4DV5C 4IIYA 3CNNA 3HADA 2UZ0A 4KK3A 2FG7C 5JLAA 1C1DA 2NXWA 2H92A 3B6MA 2GBIA 3HDJA 5IARA 1VMKA 3O1LA 5HCNA 1Q92A 1QG2A 4MXDA 5J2TA 4DKJA 3KUCA 1WW8A 1JQJC 4HR7A 1BMDA 1PZGA 1JEOA 1M3SA 3SM3A 3OZXA 1Q0SA 1K7YA 3C6ZA 3EJWA 3MUFA 5FEMA 3PGLA 4JGBA 4AL4A 2APJA 2WJVA 4D3YA 3KQOA 2Q6TA 2EFEB 1Y5RA 1G6HA 1PS9A 1RFGE 4XPIA 5K05A 4PPNA 3I58A 2O8EB 3UUEA 5CB0A 4P54A 3FYHA 1Q16A 2VDWA 3ORFA 1R6BX 2P4UA 1QGDA 4LE1A 2VDMB 3FSGA 1WXQA 5KX5B 4N7RA 1TZBA 3C70A 2Z46A 2ASEA 2EBHX 3PCTA 2QTNA 2FQYA 3FUXA 3K5WA 2CLMB 2GO1A 2QAGA 3F8TA 2FQXA 2H2DA 3QU4A 2ZYUX 3CEAA 1AN9A 3ZU4A 5BMVA 5LZ2A 4CM1A 3NNSA 2XQVA 4GX0A 3JWGA 2PEQA 3OTOC 1RZRD 3DVAB 1IY0A 2BI4A 5AM4A 3MT0A 1U3TA 4FKZA 4FYJA 4UU8A 2HSDA 1VQ4P 4Q01A 4XIIA 2JHGA 5IAOA 4O4HB 3PTAA 4ZXFA 4YQYA 1JT2A 2NXCA 4ZEVA 1F4PA 3HKBA 1SXJC 4B6SA 3SZMA 1JPUA 1QRAA 2CC2A 4LJSA 2CCJA 3KQQA 4AKTA 1UDWA 5C7YA 4NBVA 4PANA 1T36A 3T7TA 2PAAA 3TAXA 1M2NA 2B5VA 4UVEA 1QYVA 4CIYA 1NWCA 1JDVA 3GH3A 3IELA 2HHJA 2A9OA 1UK9A 4CIAA 5CW1A 4AT1A 1HRKA 4M60A 5CT9A 4PZEA 3LJKA 2BUCA 1U6KA 1O5TA 4G0UA 2PBZA 3CTMA 3MMZA 4Y6PA 3SHQA 1RWBA 4M0PA 1L4FA 3INTA 1UT8A 2P0EA 3IAEA 2R25B 4X8OA 4PUIA 2IHTA 1EWTA 1B6RA 3L7OA 3U9TA 1TYCA 5ILGA 1PL8A 1Z75A 2H0QA 2TMDA 2PT5A 3N2EA 5CYOA 2W2NA 1XRCA 4C2UA 3AONB 4Q15A 2ZTSA 1FZQA 1DAFA 2DLCX 4LNUB 4OV6B 4QXQA 2YWBA 5B2ZA 1HF3A 2CJWA 3NC0C 1Z4PX 3LCVB 4LCBA 4KR9A 3OUUA 2I7TA 4WGFA 2BFMA 3LF1A 5ADWA 5HP4A 2FEPA 5EYPB 2VWGA 3ZE1B