3RG2A

Structure of a two-domain nrps fusion protein containing the ente adenylation domain and entb aryl-carrier protein from enterobactin biosynthesis
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
611
structure length
611
Chain Sequence
SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGRASIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Enterobactin synthase component E (entE), 2,3-dihydro-2,3-di
total genus 190
structure length 611
sequence length 611
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3rg2A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3rg2A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rg2A01
2K0YA 4PZPA 4CA3A 2CG5B 4R1MA 2LOLA 4WV3A 2KOOA 2K94A 3A9VA 2QNWA 2L9FA 3VNRA 2KGCA 3TSYA 4H2YC 5KP8B 2KOQA 1MD9A 1LCIA 1YJ7A 2P2MA 2P20A 3EJDA 2N5HA 4RMNA 4LGCA 2KGAA 2XZ0D 4BPFA 5HVCA 3C5EA 3O83A 4D4HA 3CW9A 2MVUA 5BSUA 2QVZX 4RVNA 2WD9A 3IEPA 4HKGA 2KOSA 2LTEA 4GR5A 2L22A 5BSWA 2PNGA 5K8FA 4NEOA 3FCEA 1AF8A 3PBKA 4RVOA 3E53A 2AFDA 2FHSC 3NYRA 4FUTA 5BUQA 3DLPX 5KYVA 2D1SA 5DWVA 1VKUA 4BPGA 4GS5A 4PWVB 1DNYA 1F80D 3EJBA 3T5CA 4RLQA 2P2FA 2L0QA 5BSTA 1V25A 3NY7B 1L0HA 4OYCA 5BSRA 2JQ4A 4E5DA 3IERA 2AFEA 1HQBA 3T5BA 5JRHA 3B7WA 1L0IA 3IPLA 2Y4OA 2CNRA 2K92A 2N6ZA 3IESA 2MR7A 5K85A 3IVRA 5KEIA 2AVAA 2KG9A 1NQ4A 2FQ1A 4RLFA 4U5YD 1ACPA 3T5AA 4DG9A 3LAXA 2KG6A 1OR5A 3G7SA 2LMLA 3O84A 2LKIA 2MR8A 1KLPA 2MD9A 3LMOA 2QVYX 4FUQA 3U17A 1MDBA 4H2XC 2L4BA 2D1TA 2ROQA 3E7WA 4GXRA 5BSMA 3R44A 1AMUA 3QYAA 4M46A 4BPHA 3LGXA 1V26A 2V7BA 3VNQA 4D4GA 4DG8A 4PXHB 3A9UA 4RM2A 3ITEA 2KWLA 3DHVA 2MF4A 1T8KA 4R0MA 3NI2A 3NYQA 4RM3A 2LPKA 3GZLA 3GZMA 2D1RA 3KXWA 4IR7A 5D6NA 3U16A 3VNSA 2KG8A 2N6YA 5KYTA 2FACA 3WV4A 3RG2A 3CW8X 5CZDB 5KP6B 3L8CA 2GDYA 5GTDA 3GPCA 4R1LA 2EHSA 2AF8A 5EJDA 2KR5A 2X2BA 5BURA 4D4IA 2EHTA 4G36A 5KP7B 5BUSA 5BSVA 2K0XA 2FVAA 2Y27A 2QW0X 5DV9A 4ZJZA 2FVEA 2D1QA 2Y4NA 3EJEA 3DAYA 4ISBA 2FAEA 5E7QA 3RIXA 3WV5A 1PG3A 4OXIA 2LL8A 2FADA 2VZEA 2JGPA 3LNVA 2M5RA 2N5IA 1T5HX 1MDFA 1RY2A 2P2QA 3O82A 2MVVA 3EQ6A 4W8OA 2VSQA 1ULTA 2K2QA 2KGEA 2K93A 1HY8A 1PG4A 2FQ0A 2KOPA 2KW2A 4EATA 3WVNA 2GDWA 2LIWA 2FVFA 4GR4A 2KORA 3FCCA 5IFIA 1T5DX 2N50A 3CE7A 2P2BA 3ETCA 2XZ1C 4D56A 4H2WC 2KGDA 2N98A 4MRTC 4IZ6A 4GXQA 1X3OA 4G37A 2CGQA 2LIUA 3E7XA 4D57A 2JU1A 2DNWA 2JU2A 2P2JA 2CQ8A 1DV5A 2FQ2A 2MY5A 1BA3A 2GDXA 5HV8A 2QVXX
chains in the Genus database with same CATH superfamily
3IP8A 4X95A 4TYWA 2X3UA 1NMYA 2GERA 3QPDA 3V5NA 5CDUA 3GLHB 1AQJA 2H1OA 5CYGA 2QU7A 2XDWA 2QD3A 5SYNA 5DHUA 1PR9A 4RF3A 2M98A 4IDGA 1YS6A 3HU2A 1NG9A 5HA5A 3NXSA 1G5IA 4NMXB 4H1HA 3MCUA 4BGIA 4Q93A 3TAUA 4BUJA 1GN8A 1U0OC 1ULZA 2N1MA 1EFRD 1X7HA 3U7QA 5FUMA 1QHNA 2BSXA 3JZDA 3MINA 5KCMA 2ERCA 3AY6A 2ZDQA 4PR0A 3ON5A 4DLWA 4F86A 2QX6A 1S8NA 4EY6A 3C41J 2ECFA 5TPWA 4O2LA 4UUPA 2PZBA 1FYFA 2YUTA 3G1TA 1OH6A 4LF8B 3BHNA 2ABWA 2HLHA 4OGGA 3JD3A 4E6EA 1UEIA 1WUJS 2BJVA 3GXBA 3P5SA 4CRWB 4LBVA 1IHUA 4W5JA 2FCRA 2GLXA 1WPXA 1CNFA 1JHRA 1UJ6A 3BWDD 2JZCA 2O8DB 9MHTA 2Z09A 3I0MA 4Q1BA 4MTLA 1AGPA 1YL6A 5CDFA 4NX2A 1JQBA 3JYNA 4BUCA 3WBHA 1FQOA 2H0AA 5F7XA 3EZFA 3ST7A 5JPDA 4GQBA 5F2NA 2R44A 2YV1A 3KSMA 1L7QA 2TS1A 2ZRFA 3QFHA 4KLRA 2DFLA 4OEHA 4QPNA 5ENDA 1NT4A 2IGTA 1DRJA 1GPYA 2YXDA 3OE7D 3EPRA 4TV9B 4LVCA 3NV7A 4OHCA 3K8QA 2II6A 4OHYA 3ORRA 3WLAA 5EIHA 3LV8A 1DS6A 1KS9A 2BVNA 4KZPA 5E8RA 3DT6A 4AJHA 1I5RA 1PLJA 2UZ0A 2XGSA 5DEOA 2ZT7A 1QQ5A 1O93A 2PHZA 4N01A 4MSUA 4UBOA 2F62A 5B57C 1SZPA 2JCSA 3OZSA 4UEJA 4LJKA 3ITEA 3JPYA 3QI7A 3W5DA 2D7CA 2PXXA 3EWNA 3S1AB 1GV1A 4KB5A 1TYBE 4NC9A 2IUUA 1X3LA 4X3CA 5BMVA 3GD5A 5M04A 3RS3A 4JLAA 2PUWA 1OZ0A 4GMGA 5HOEA 1NFFA 1R8XA 3WICA 3HKCB 2Q41A 3G5AA 2AW3A 3RG2A 2CLEB 5E6SA 1ETHA 5IS2A 4DR5B 5KDOA 1Y42X 3FCXA 4AK9A 3CCLP 1TM1E 3PGLA 3LHIA 4P92A 5GADl 5ENVA 2L19A 3ZH2A 5BORA 2CL6X 5AHWA 2FA9A 5C1PA 4RS4A 4YJ3A 1MFZA 2QW0X 2C2MA 3H2BA 3HGTA 1OAAA 4NZNA 1OAOC 3LS2A 4EYKA 3WLQA 1BGWA 5DF1A 3MWDA 4NFHA 5THQA 3R40A 1JRLA 1KDTA 4HUQB 1ADGA 3PJRA 2ID7A 4G4SO 2HB6A 3UV3A 5LN1A 1W9HA 3L8GA 1BC5A 2UVPA 2VN8A 1UM9A 2NN3C 1DHRA 3MWLA 3TLJA 4Q1VA 2JH8A 2WIGA 1ZA1A 4KO8A 3WGMA 1GZ4A 1C2TA 1OYYA 2FN4A 4ZI7B 5BYKA 1OI4A 3I9FA 3EY4A 3I83A 3WKBA 4ZZ1A 2QTZA 2W6IA 3EDQA 1C0KA 2VF4X 1BFDA 1ADYA 3LWZA 4PWZA 4B6QA 4CM9D 1NNI1 1V8OA 2GKOA 3BZBA 4IDCA 4YCBA 4MH0R 2IEDA 3TG2A 1DUIA 1WMFA 1L1RA 4B6GA 5AVUA 3BE8A 4XQ0A 2UYGA 2XX3A 3VKFA 1PR0A 2FGJA 2GILA 2IW3A 2JIZD 3L06A 2Q7DA 1SU6A 4JMLA 4YPOA 1P4SA 3B2EA 2ZVPX 1G5HA 3UMJA 5FCDA 2ALJA 3S1LA 1CQJB 2G6TA 1CY7A 1U3TA 2G7MC 3MAJA 4QYIA 3V80A 4B81A 1MAAA 5I4KA 2I3BA 5IHPA 3LPNA 1E2GA 1IHYA 3CXRA 1QV9A 3EXEB 1RXCA 3BGDA 1M6HA 4KXNA 4R1NA 2AQKA 4XGRA 4EYSA 2QD2A 2IXEA 3DNPA 4GI7A 4MS4B 3U3DA 2FPPB 3MTDA 2ZR7A 4FUTA 2FP4B 3AHGA 3OOWA 3A9TA 4P1ZA 2QUJA 2DAPA 2Q1YA 1O6BA 2JGDA 1A69A 4PWVB 2AKEA 3GZ4A 2JAQA 3PJFA 2H48A 2YHIB 3O03A 2M1XA 3ZIAA 4FHGA 5I8WA 5JU6A 3F6PA 3MGBA 1L0HA 1T10A 2AR0A 2Q4OA 3CSDA 2PUHA 4D8VA 4JVMA 2JJMA 3GRAA 1NTRA 1NXVA 1QJCA 1IB0A 4XPZA 4BNZA 1NBHA 4E3ZA 1H2AS 1CJUC 1PQ4A 4UFOA 5ILGA 2OAEA 4KI0A 3T1QA 1EJBA 5GWXA 1Q91A 1JBEA 4LXUA 4M8SA 5K85A 1G2OA 2HKIA 5T57A 3U7RA 3G89A 3N05A 5DKFA 1L5QA 3ZDEA 1GTL1 3CM0A 4IP0A 3WRYC 4DG9A 3N87A 4ENUA 1PGQA 2ZIZA 3RBZA 3AOEC 1ZWLA 5C5DA 1WB9A 1N5MA 3FHLA 2BGLA 2D2EA 1NZDA 3OZEA 4WFJA 4RJTA 4ZYUA 4ESOA 2WFLB 4DDHA 2WZQA 2IEGA 1B3BA 1GV0A 1MC4A 2BISA 3GMSA 2ERHA 3D6HA 1T8WA 2XT1A 5ECYA 5J40A 5TV2A 5CFLA 3MJEA 1Y9ZA 2KWLA 4YC7A 3SR4A 5LQKA 4FDTA 2PZEA 4RM3A 3GCZA 3G4SP 3W3AA 4IIEA 4PLVA 4XRGA 1IN4A 4A6XA 4EWLA 1T1IA 5LYJA 1EHCA 2C2KA 1PW7A 2Y77A 3B1YA 3KLNA 4MA5A 2C7PA 4GMDA 4TSRA 3IP7A 5ECWA 4JLPA 4OSPA 1EBBA 1U31A 4CF7A 2OHIA 4YAKA 2GZRA 3SVTA 1EH5A 1NX9A 2HDNB 3ICPA 3VI3B 1NV8A 4A8JA 1YB2A 4Z4IA 1RPAA 4KE6A 3DMTC 4PLTA 2EHTA 1LLFA 2NSJA 4ZVOA 2P3OA 1SUDA 5JH7F 1R6AA 1UBUS 3LP8A 4RABA 3MFQA 1LDNA 2JCYA 4MQUA 3WYNA 4MP8A 1YU9A 3LM8A 1XCGB 2O8EB 1AUQA 2A3NA 4HB0A 4JKYA 3TYXA 1ZICA 2CK3A 2O3JA 5JZBA 4E4YA 2WTUA 3N2KB 2F9FA 2PH1A 3ZWMA 2HRBA 5FV4A 1RHKA 3PPVA 4KC0A 4L8FA 1HE5A 1KYWA 2H7YA 3UJAA 2QM3A 2EJCA 3NVAA 1Z17A 1WXEA 4LV6A 5CAEA 3ASUA 3HO1A 1RRPA 4JV5B 4NIMA 4ZZ2A 3OOSA 1QTQA 2X9LA 2Q5HA 4X5OA 1P0IA 3PK0A 3A3PA 5IDQA 4HPXB 2AMLA 2H65A 1C41A 1X87A 1J2RA 4P3KA 2P9ZA 3FD8A 3IDSA 3B7GA 2Q07A 1UM9B 2WLTA 1Y9DA 3PJGA 4ND8B 3VR2D 1NJ5A 1TECE 3MILA 3HACA 2AYZA 3VR6D 4B6FA 5JV5A 2VSYA 1E9VA 2O2YA 4GI2A 1JYEA 2GHQA 4LS3A 3IEVA 4TVBA 3UUEA 4F2DA 4HZUB 5JSHA 4EG5A 2V4ZA 5DTQA 1YRLA 5CITA 5KWJA 3H87A 2AOTA 4ETIA 1SCNE 3RVOA 1KH1A 2E4VA 1EU1A 4RTKA 4FHDA 4ZI5A 3CD6P 3C6KA 3PKIA 4X1IB 4MQ6A 1SD5A 4X6YA 1T36A 2H4ZA 1RDFA 5BSUA 3VOSA 1Y4SA 2HA6A 1GQQA 2M32A 2VLIA 4NABA 4XUEA 5F3RA 5J9FA 3ZZTA 2XMGA 4DTCA 3WAJA 3OVMA 4JYMA 1GRVA 1MKYA 1INLA 3K20A 3NG1A 3MZ0A 4WJLA 3EN0A 3Q87B 3MS7A 1FXWA 2EG9A 5JZVA 1PCXA 3RYTC 4C03A 2V1UA 2A5DA 1IZ7A 3USCS 2FSGA 3VDRA 3KJNA 2QUIA 3ZGZA 4U2EA 3K0CA 1N25A 4J0KA 4XUGB 4B3CA 3DZIA 4CMAA 3ES9A 3MUEA 5EGNA 2Z58A 2JFBA 2XODA 1XBTA 4K0BA 2GBGA 1MX1A 2H7CA 2YTZA 3GG9A 5C8YF 3C7AA 4H17A 1BFUA 4WNYA 1N8KA 1ZK2A 3E0XA 3H42B 3UV6A 2UVQA 4GUAA 1Q81Q 2PUBA 2Q6KA 4EVIA 4CW7A 2BFDB 1Y6FA 1IN7A 2P27A 4DBZA 4WPGA 1LW7A 1OYWA 2RIRA 3QA3E 3DYVA 4J7AA 3QTTA 3T34A 2MD9A 2NYVA 2XF2A 2ZQZA 3FVQA 4MW1A 4N3GA 4EUFA 5HQ3A 1DT3A 4KQXA 4ESHA 3DE5X 3FJ1A 1IMOA 5TIIA 1UT6A 3UANA 4PV7A 1VSVA 2ZDHA 4DV4C 4QQKA 4ZGWA 2MYUA 3ASZA 1RHJA 5H5JA 3SIWA 2B20A 3VR5A 3CCFA 3AR5A 1BWPA 2JASA 3N2LA 2BHLA 2GEVA 4GKBA 3OTGA 2WIBA 4BGVA 2WFLA 4N1AA 3ZDDA 1FMCA 1U7UA 1UMDA 2C9OA 3F9RA 5KYUA 1X1DA 4V0RA 2QRHA 4Z1MA 2NZ2A 2OHVA 3RHTA 3IBYA 3W7VA 3QVKA 5I47A 1UZUA 2C82A 2QR5A 4DIMA 1QYDA 1OFUX 2R7MA 3AG5A 4MPPA 4PC7A 2PGDA 3JV7A 4GLFA 4CHTA 4A0GA 5ALPA 3L0DA 3I53A 3GMIA 1N32C 4MV3A 1CR4A 1QHYA 2K0XA 1RI3A 3ND8A 4ZYWA 3FOEC 1XMXA 3ROGA 1TI7A 5AI9A 5DGIA 1QK5A 2QI9F 4L76A 1JSLA 2J8ZA 3D4PA 1QC5B 4KXVA 4CI9A 4E5NA 1T3GA 3CMAP 1XEWX 2ZSDA 1S3SA 2NU9A 1TB4A 1Z29A 2HZBA 4NJMB 4PSDA 4UE6A 1TF2A 3V4PB 4C2AA 4EPRA 1I4OA 1LX7A 4URWR 1R5NA 3SSOA 2BZSA 5EI5A 2KOPA 3GPIA 4QELA 1OZGA 4ZI7F 3HDHA 5JD5A 4Q1EA 2HUPA 2KORA 3H4TA 4UAGA 3SQWA 3A1WA 3OZTA 2R00C 2NVWA 2AQIA 3CX7A 2IITA 3GJ0A 3MVEA 3PNLA 4LPSA 3JQFC 4WBNA 3AHEA 3RBAA 3HN7A 3QLUC 1YI2P 4PSVA 2O5CA 3HP4A 3DONA 2F1RA 1U6KA 3W3ZB 1MXCA 2AG1A 3G5MA 3L4EA 3L6RA 4JLMA 1ZW6A 3WL3A 5K5EA 1TFRA 2FCAA 2WVAA 1K27A 1ZM7A 1PUJA 3KT3A 4RK5A 5AOBA 1JBQA 5B2EA 4LYDA 4B3SC 2HXYA 3AUYA 1QRUA 3PQ2A 1I7PA 5GOZA 2ZB8A 3Q8XB 4CM8A 2LDXA 1W73A 1T0HB 2BFMA 3AYZB 1P33A 2KGAA 3DDSA 5BXYA 2BN4A 5IT5A 1X1QA 2V3CC 3KYCB 3AJAA 4HWSA 1TU0A 4RXUA 2VP6A 3DUFB 4HDCA 1OOEA 1N6PA 2JAPA 1UNKA 4FZ5A 1UOQA 3EGWA 3OECA 1RABA 1ID1A 5LCIA 1G8GA 2YINC 2O1XA 3KB1A 5LA6F 4ZK2A 3PBKA 1B2LA 1K4YA 3ZHUA 1L4KA 1XEWY 5DU2A 1N9ZA 1XTPA 2DQKA 4WA8A 2Q0HA 3E4CA 2P9XA 1CW2B 13PKA 1L5RA 2AD5A 3MMNA 3NAMA 4PU0A 3LVQE 2Z1NA 5EL0A 1TTTA 1GT91 1UP4A 4EPYA 1G2IA 4Z51A 1DC6A 4KPGA 1E3QA 4XEHA 1W4LA 4C7BA 1ZD1A 3CUYA 1T6BY 2QW1A 2D54A 2PR2A 2XZTA 3F47A 4FSDA 4Y2RA 5SY4A 1O5TA 1XRMA 5ULLA 2CL0X 1NXXA 3SBEA 5CB0A 2E49A 4MJ7A 3P20A 5ESXA 4G26A 2VJKA 1KFKB 4KR9A 3U26A 2W98A 2IYZA 3AHDA 4H9GA 5A4KA 1GKIA 3DZBA 5FOQA 5EQJB 3GMDA 3PKJA 3RC7A 2ZLBA 4GIBA 4JX9A 1FF9A 1MO6A 3FY4A 5EYPB 3CRVA 1WW8A 5AKYA 3NEYA 4HYTA 3VNQA 2HNAA 1RMYA 1ILWA 4AYXA 3A9UA 1B0ZA 5M7EA 1KI3A 5B3KA 1TGVA 3FB4A 2JATA 4FSXA 4AT1A 1SBCA 5DOZA 4R0MA 2YXEA 2IIPA 4DPKA 3PX7A 1M6YA 4EA8A 2NLOA 4F5DA 4BOYA 3A4YA 1U3CA 2ET6A 2QQEA 3IMCA 1RMQA 2VA9A 2SCUA 3HDTA 3IXQA 4KG7A 4Q05A 4WK2B 1TM2A 5EXXA 1ZH0A 4YCDA 4FZVA 5BMVF 3BJRA 1GLNA 1XR3A 1SXIA 4J1TA 4MW2A 3LRPA 3B70A 4Q4JB 5I9NA 4Y2UA 2G71A 3DDUA 1TYCA 5KQMA 4D8XA 1GZSA 4HMQA 5J4LA 1Q1ZA 2WTBA 2J48A 1B6GA 5ES3A 2QLLA 3R3UA 1TNDA 3HGQA 1DVRA 4KQEA 3FN4A 3DAYA 1UQUA 1ZC4A 2HO4A 3ICQB 1SU7A 1H6CA 3CG4A 2EP5A 4O2BF 2IX9A 3HI6A 3GW8A 4LPKA 4RHFA 3P9QA 3WWOA 4CKBB 4HN2A 4K9LA 4PH1A 1LPSA 3FPBA 3ILHA 3SQMA 4EI2A 1GFZA 4HGPA 1JIQA 4RIEA 3OCJA 2BFWA 2J9RA 4FW9A 1HZZC 4F5EA 1E0JA 5C51B 5CW2A 3A0UA 1UPCA 3WSTA 4Q4CA 1XRSB 3CLUD 3GR1A 4B3DA 1IVNA 3LBAA 4RFSB 1FDIA 3AR9A 4H6VA 3U2QA 1E18A 2QM8A 4NBKA 1UWLA 3WIUA 5AD1A 2JLWA 3AGPA 2E89A 2QUKA 2PN1A 4WDRA 4BJ3A 3DS5A 2AF4C 1O96A 3CH7A 4IRXA 5E38A 2CQ8A 3C5CA 4HI0E 1U8CB 5ESDA 4AECA 3U6BA 2D7JA 4AX8A 3EGOA 5BWOA 4XWKA 5LOVB 3A6JA 3DDZX 1P4GA 4RHEA 5DBFA 3G0VA 5EZ6B 2QUBA 3GBSA 5KP8B 2FQYA 2WJJA 5FKJA 1AURA 3LX4A 1V37A 1I3CA 1GPMA 2Q21A 2QRLA 1GILA 4G0XA 5DBGA 4EUKA 5K8TA 5KQGA 3UNXA 1KSHA 5KNBD 1JR3E 1ODKA 2QTVA 2ZIVB 2CVHA 3M1MA 3TR3A 1GHTA 2IXTA 3ISJA 2DHEA 2Q5FA 1PKEA 3ETDA 2BKXA 4K1LA 2HYDA 3OZDA 4QQRA 4AF8A 4P86A 5AVTA 3VSEA 3FFAA 3IUPA 3WKEA 2GO1A 5GJBA 3W06A 3EIWA 1P0MA 3CYFA 1JA9A 5KNBH 1TMOA 2VG8A 1IHOA 2I5PO 1Z12A 2NUTB 1FP4A 3M83A 4GWLA 4KH1A 3F5QA 2DFTA 4D92A 4CTJA 3T1VA 2EL7A 2IU6A 3J81A 2HHHC 2VSXA 2IPOA 2IW1A 4QDOA 4W7HA 1I5OA 3ZS9A 1PR2A 1Z82A 1FOEB 2HF9A 3D3WA 1OFHA 3OTWA 5A6VA 4F4UA 4A7PA 4Y2YA 1LVUA 4KN8A 1E3EA 3QHQA 4XM1A 2OORA 1JI3A 1OWPA 2F00A 1JNYA 1G5QA 1C1XA 2WSMA 3OZAA 1VGQA 3ZUGA 2W6MA 4YPFA 1T3HA 4QFBA 2BGUA 2AVAA 3W05A 4UHCA 2JJ2D 3UGKA 4CMEA 3G21A 2PZMA 3NTUA 5IBCA 2QN9A 3M3HA 1WEHA 3E3AA 4YA6A 3L7IA 4ZHSA 2C20A 4Y2TA 2BI8A 1NRJB 3RRYA 3ADOA 3FNFA 6PFKA 4TTQA 3GMTA 3GZNA 3GJYA 5PGMA 4EHJA 4AUKA 3B3FA 1Z37A 4RPJA 2R65A 5LMUC 4LF4C 4NCIA 5KX5F 1FQKA 2ZU0C 4IGFA 3TR6A 4DPMA 3LPAA 2VDLB 3NPDA 2FPOA 3VOAA 1V39A 4DRXA 4FGZA 3IHWA 4O02B 2OY0A 4CLDA 5TGTA 2HCFA 2PWBA 2PJRA 4UFNA 3V2GA 5K99A 3R5XA 4BVBA 3HN6A 1DC4A 4JI3C 4IXWA 3DZ8A 2GAOA 1XQWA 4M7OA 3ZZMA 2OZVA 2QN1A 3ACBA 4YJKA 5B4TA 1NXPA 3AOGA 4TOIA 3EPKA 5E6UB 1O57A 2OT3B 2QD5A 3H5RA 1CD5A 3P19A 4WFIA 1O4WA 2E4YA 1XZJA 2FSHA 4PSUA 2IUTA 1VCOA 2J9FB 1MVNA 3QH4A 5A1IA 5FPQA 2YVQA 1U9IC 3TQTA 3JVDA 2QQ5A 1GSOA 3EDOA 3KAPA 3IUNA 1NW9B 2FRXA 1RY2A 2IZ6A 4IPYA 3LQ2A 1ZMOA 4UBMA 3RD5A 2C7BA 4ITVA 1IK4A 1GEEA 5HGNA 3BWVA 1UKCA 4PEVA 4OHOA 2HBZA 4HH4A 3K9QO 2YHBA 4YMSA 3O8CA 4MUEA 4EKIA 3PWZA 1A9QA 2CVZA 3GJRA 3NUQA 4DCNA 2B98A 4ENTA 2MYNA 1OY1A 4XARA 3VPSA 1D5WA 4KLCA 1PVOA 2BMDA 2C29D 2NU7B 1VZ3A 2V9PA 1KPIA 4PUGA 1EFCA 1M2VA 3PJDA 4LOKA 4R1SA 1LWOA 4RGQA 2HK6A 4C9BA 2IHTA 1I8TA 3AY7A 1EFPB 4EGSA 3UJCA 2WAOA 3ICCA 3GROA 4CPDA 2LOLA 3EFOB 3S2GA 5IUJC 3SKXA 2CXUA 2EZTA 4U0JA 3Q41A 2HQOA 3KSDO 1RC8A 1E77A 1QUFA 2AF3C 4ARIA 1BD4A 1GUZA 4IH1A 1VFNA 4JODA 4JI0C 1VC2A 2F17A 2RIPA 4DV7B 3HV2A 5L7WA 3K9LA 1FXWF 1T6NA 4Q9LA 4JP3A 5FWYB 2B36A 1T15A 2WA2A 1EMVA 3ZHCA 4X6LA 3R9XA 1BWSA 3FUVA 1MQAA 1KMCA 3T95A 3X1MA 3OJ0A 2DLCX 5BRJA 1R8YA 3ONFA 2X0DA 1H93A 1SXHA 2HWKA 3FTCA 3B1ZA 3IAHA 5JNVA 3GVPA 3K09C 5AI0A 2DQSA 2JB9A 3WP0A 4D74A 3S82A 3GJ8A 2R6GA 3MT0A 1D2HA 1W36C 3PRKE 1MW8X 1AO3A 1Y6QA 3H7IA 2G8NA 3OZGA 5BYAA 4KQMA 3UN1A 3HXQA 2PA0A 1LRLA 1L7MA 2IY7A 1TJ3A 3D0OA 3VR4D 5KQLA 3ZCPA 1KQOA 1SC3A 4Q4LA 4ER5A 2MM9A 2O7SA 3IVMA 2MR7A 4JFRA 5AKEA 1ZXBA 3DJYA 2WJWA 2XMDA 3D59A 4DCPA 1G6OA 2DYJA 3O2QB 4XDYA 4IBOA 1GAWA 2UUBB 3OLWA 2QRVA 4W8HA 4RPIA 1P3DA 4X64C 2OO5A 4RPGA 1E5QA 1RWWA 1LPOA 4KWHA 3USZA 1TQHA 1X38A 1UMDB 4H2XC 4GKJC 1N5JA 1ZM4A 3BXGA 5J47A 2BGKA 2RONA 1G3IA 1UMKA 2P8JA 3DAPA 3KPUA 4GMXA 4M1QA 5GGYA 5U4QA 4M0CA 3TEJA 3BJEA 2YKGA 3PDIB 3DCNA 2C7QA 1QTIA 3OSZA 2CE2X 4R2MA 2BT4A 2IEIA 5D1HA 2IEYA 1VHNA 4H4DA 1GYRA 1GL7A 2ZKLA 4C08A 1FVOA 4DZZA 2VR1A 3EA4A 1UC5B 3M9XA 4QYWA 5CR9A 1W59A 4CODB 5T3UA 3TMKA 1QHGA 3DAGA 4TXMA 4AVYA 2Z6QA 2HWYA 3P52A 1Y3HA 4Q02A 1YGPA 4ZC8A 2QTBA 2OG2A 1USPB 3L8CA 1WF6A 3D4LA 3EIQA 3IDAA 3JQFA 4OMFG 4R1LA 1HSOA 1QAQA 4HT3B 1HFJA 2NSLA 4GOXA 1WZCA 4DILA 5EJ4A 1H6AA 3JQ7A 1FTSA 5JY6A 1RKXA 1V45E 2GM4A 3HSYA 3WNBA 2YFQA 5A5EA 5HCIA 3KKMA 3DFKA 4J2TA 4KRGA 5F1OA 4BEVA 4C29A 1XIVA 4QC2A 1VJ5A 4RVDA 4U0KA 2RJNA 4ZQBA 1FYDA 2RH8A 5DULA 1FQWA 5B1HA 4EFDA 1VE7A 1I7SB 3W4IA 2PAFA 3BDVA 1T5LA 4WN3A 2BI7A 3NHRA 3NHYA 4C7XA 4QXMA 3T7KA 2W8ZA 4W6QA 1W2GA 1PJ4A 4CCWA 4FGUA 1Z38A 3O90A 3TL2A 5JWRA 1Z0IA 1C5KA 2W48A 5T8TA 4UHDA 4RE6A 5HFAA 2QRZA 2ZUSA 4NY1A 3S5JA 1NJ8A 4FI3C 4JELA 1ESNA 2J32A 5DNEA 3DEYX 2GPBA 3KB2A 3IRUA 1ZKDA 4CLRB 1P31A 2BAGA 1PJRA 1RM3A 2WBLC 5AKKA 3E7XA 3L95X 2UZ3A 4AG6A 4FB5A 5C52B 3ETOA 4LFCC 5BNIA 1VMEA 1EJ2A 5DOVA 2CLKB 1KPGA 4OM8A 1VLLA 4BB9A 3D1JA 3L6OO 3UT6A 4DAEA 2WKWA 4XVUA 2G07A 2GJKA 2IYEA 4TSFA 3I2YX 3PQEA 4PC3A 1IJBA 3S5UA 1SUSA 1FEZA 2KHZA 1DL5A 4PCAA 2QAJA 2UZ4A 4ZVKA 1L6RA 4YRCA 3HKDA 1ZGBA 3BG5A 1EUDB 4JI1B 3VX3A 1ZMBA 1EFVB 3QU9A 1L5FA 3VC1A 2QVZX 3K73O 3LT4A 1JLLB 4QIHA 5I7AA 4XPIA 2XAAA 1HYGA 1Q0LA 4OQFA 2RHMA 3D5TA 1N0WA 2IK8A 1LB1B 2CD9A 3INNA 3RROA 5NLLA 2R3SA 4E6PA 3TI7A 4W5RA 5JZOA 5LXTA 1K8XB 1W5SA 1JHZA 2A67A 3C4QA 2FMHA 4BPGA 4NE9A 1V35A 3H9BA 4L3VA 4R2XA 3W79A 4ALNA 3WL4A 3MTGA 1X13A 1VHQA 3LMKA 4MYSA 4QKQA 2R4UA 1ZL2A 3OWXA 1I01A 4N7BA 2Y66A 1JQ5A 5T67A 1W36B 3MBIA 3MTBA 3JY6A 3PD7A 1CZUA 3AEKB 3PYLA 4CKEA 3RTEA 1N75A 3QVSA 1YRBA 2BEJA 3C3YA 5BN5A 3ANLA 3QKRA 1FU8A 1PG0A 1YRAA 3DS8A 5EWJA 3TRIA 3DVQX 1LDMA 4JIMA 1J22A 1UAGA 3I9V1 4U5YD 4D4KA 2C7RA 1E5DA 3E05A 2M6KA 4CE6A 2Y1KA 2ZUEA 2X13A 4TT3A 5HF9A 3WB1A 1PFQA 3QFCA 4E1AA 3DTVA 3FDIA 1Y6JA 3PHBE 2A30A 1D04A 5B3LA 2AHRA 1Z2PX 1YVUA 3EYAA 4TWRA 1RHRA 3W8NA 2P41A 2EW2A 3MQ4A 3M70A 3FZEA 2OBXA 1CB0A 5CIWA 3ND5A 1U8AA 4G3XA 4F9EA 3D64A 1QKJA 3OEWA 2P2YA 4B8YA 3R75A 5JRZA 3PNPA 2IDZA 2IY8A 2O2IA 2ODBA 4FMDF 1FP2A 1RKQA 1DLIA 2BTQA 4PAGA 3TQRA 1REQB 3KAJA 3DMPA 3F90A 2MSCB 2XQKA 3NTQA 4JJFA 1NXSA 1ORTA 2EX0A 1WR8A 3D0RA 4JA0A 4C89A 5L3QB 4CEJB 1XYYA 4LOLA 3MW8A 4RTRA 3ZVKA 4IOMA 2QLFA 1ZN2A 3QTBA 4LQLA 3U60B 4TRJA 3AF6A 3UO8B 5KU7A 1I3NA 3UAXA 4CTOA 3FOFC 4ZI3A 1S02A 1OBCA 4IPTA 4Y0AA 3ZCTA 4LZWA 5BVGA 3T5GA 2PMCA 1WXQA 2XKKA 2AR7A 3GLQA 3CJTA 4YP6A 1G8AA 3BH6A 2VOJA 2GWHA 5TS2A 2HXGA 5JZMA 4Z7NB 2P02A 1WU8A 2VP9A 2XYGA 2B3TA 1FY2A 4C04A 1N1EA 1Q95A 5TMEA 3HZRA 5LWQA 3T5DA 2X2PA 4CMGA 2H2IA 4GOJA 1VB3A 3F3MA 2GJAA 4B4KA 1KVSA 5JFOA 2PO5A 4CFYA 2FN8A 3B5EA 3Q0EA 2FY8A 4S24A 2N98A 2BRUC 2CCJA 4PVDA 1SO8A 4UU8A 2JFWA 1N2JA 1ZGZA 2H54A 3IEIA 4EW3A 2JU2A 1P0CA 2XADA 1DV1A 4BB5A 4ZOQI 2GA8A 5ESWA 1TZMA 4AAYA 5KYVA 2O06A 3C8UA 3CR7A 4N4AA 4EHAA 5CBPA 1HDGO 4FPXA 3BCRA 2IUFA 3MS2A 2EU8A 4WACA 1QIDA 2Z8YA 4AF7A 2R7KA 3PRHA 4HQ6A 4OIMA 5IJAA 5C1DA 4RMNA 3PWTA 1YZUA 4NCKA 1OVMA 1N2CA 2XCSB 4Y18A 5JQWA 4AKIA 3ZEIA 3KHSA 1FRVA 3SQNA 2RAFA 3IPAA 2V97A 1YUNA 1X15A 2L18A 3VNBA 1GXHA 3LLSA 1EUDA 3NUGA 3WNDA 5KPJA 2PIAA 3LO5A 5DSTA 2A7XA 1ONBA 4L08A 2C4MA 5GV8A 3S2SA 3RV2A 2BFFA 1M9NA 3NGMA 1L5ZA 1YA4A 5FOVA 4CM4A 2FZEA 4EY7A 3GLVA 2PTHA 1ZUNA 2HTEA 2OHOA 5A6SB 5NULA 4IM7A 3LRXA 3RARA 3UJ9A 4DKXA 1Z83A 1GOTA 1T2AA 2CUTA 5FO1A 2IHYA 3L0ZA 2R84A 4UAVA 4F6RA 4PCUA 4YAIA 1D6MA 4D3YA 4V0KA 3B7WA 4FB4A 1IQ0A 5BN4B 2G1UA 3L7KA 2QIOA 3ETJA 2P1RA 4GZ5A 5CGQB 2ACKA 1YKFA 1KDRA 1UMCB 3QLVA 1GGKA 2WTMA 4EENA 2IH4A 1HUQA 3ANYB 5GIOE 3VU8A 2IQ5A 5FOUA 1XD2B 1AZTA 2B1JA 4HCJA 5DASA 4CN9A 3A3OA 5FLKA 2LMLA 2JFZA 5ALIA 2Q6VA 1FSSA 2WSYB 4KR3A 2XMBA 4FIDA 1BX1A 4TSKA 4CIBA 4JI4B 4I4CA 2OGZA 3BD8A 1EKXA 5B3JA 5JUWA 4DLYA 1E9AA 3ZVRA 4MW6A 2W7TA 3BGVA 4AYTA 4CIVA 2FR8A 3AVYA 4B7XA 3K0CC 2C54A 2YOFA 1G64A 1FA9A 1EM8A 2WOJA 4X92A 3HQ4O 5AI4A 4JDPA 1CEYA 2H9YA 4PLWA 3FIUA 1GDHA 3HUDA 1J2YA 1KHTA 3IURA 4H1VA 2PX4A 2NAFA 4UQLA 3OE1A 1W7AA 2FEPA 1MH1A 1E9DA 2JHGA 2QPOA 3L1HA 4ZQEA 5IN5A 2PS1A 2PKRA 2EFEB 2FW6A 4JI3B 4GOMD 1DFHA 4KVGA 4UZFA 4DMRA 5AW2A 4LFBB 4I81A 3CLSC 1XRJA 1BFKA 2ZQ5A 1AS0A 1DAIA 1V4BA 3WTCA 2P9GA 4EPVA 4EI9A 2YUIA 2B4QA 4C76A 2GEFA 1HL7A 2KDNA 1C9EA 3OEED 4YHHC 4MKXA 2LXNA 5IW8A 5CCXA 1OD6A 3UPTA 1J0EA 3TQIA 4JCCA 3VTAA 1XF9A 1I14A 1GQYA 1MJFA 3BQNB 4MINA 2QSJA 4ZK6A 4CEJA 4TQAA 1HURA 2CFCA 1N5OX 3K9NA 1HE1C 3N8IA 4NS4A 1ISIA 3WFZA 3OAAD 4G56A 4C0BA 2FWAA 2NW6A 4L0DA 1BGXT 4J07A 1J9GA 2XHEA 3EE6A 4ZMRA 3N8DA 3KS9A 1DJOA 2VTEA 1OE0A 3D1LA 2H2WA 2H4YA 3QPAA 2XZ1C 1OREA 3EGIA 4BMSA 3I45A 4O59O 1JZTA 4QLOA 3RYFA 1GA4A 1XEXA 2DCUA 2VT6A 4YJFB 4HNRA 1X7ZA 3EIUA 3ZHSA 4C4TA 5EE9A 2J46A 2JU1A 2F1HA 1SPBS 1P2VA 3EPPA 1W2WB 4UAUA 2RE8A 3DMGA 1WG8A 3V46A 3NM5A 2VOEA 1T0IA 3IAUA 1V4NA 1VBMA 4ZA2A 2Y1CA 3D43A 1GSAA 2CF5A 2XYHA 3BRWA 4DUZB 3MTEA 2ZBQA 3REQB 3ZGXA 1DQYA 2CK3D 3ILYA 5TE9A 4ZAWA 4TS3A 4YWHA 3WGNA 4C7JA 5JPCA 2ZRQA 3DVAA 1NLFA 5KU1A 3T94A 2YMLA 2FUEA 3I64A 3G7UA 2WF8A 1RT9A 4MCAA 4MV8A 2VHUA 3UAYA 2JKZA 1MABA 4JUDX 3FVRA 3S0JA 3KQKA 2QJOA 5K20A 3V7YA 4DUZC 2Z2YA 4BV8A 2I2CA 1PEKE 3DS0A 3NOOA 1Z4PX 4KQ2A 1N2HA 1QGOA 4OBWA 2VWPA 4M87A 4Z3OA 2XLCA 1UBGA 2N46A 3BD6A 2G72A 4MUNA 1QR2A 1Z63A 3CCEP 1K7EB 3DYBA 4OI4A 1UOOA 2WU8A 3V7UA 1MQSA 1RXYA 3DDHA 5AOCA 5TDHA 4CNBA 4BEBA 1BQ4A 3GAMA 1DQRA 1Z5OA 3AC0A 4JBYA 4TQ9A 1R88A 1Z28A 1T1JA 3AMVA 3DLAA 5IF9A 4P4TA 1EZ1A 2OBYA 4BLUA 2DEUA 5ALHA 3VUEA 5EMHA 1B0PA 1LY1A 1NVMB 1Y7HA 2I62A 2QG9A 1OX6A 2NXJA 3L7MA 3LX8A 4R98A 3F78A 4P35A 4RWZA 4YLYA 4EVSA 5MHTA 1N7IA 1QF6A 1P0FA 2WV9A 3GDFA 4FYJA 1DIAA 1MW9X 3FG9A 4HZIA 5EHGA 4B3TC 1K7XB 1LJLA 1QP4A 1JHUA 3O1JC 5CT5A 1OR5A 1QH1A 2QN7A 3RAFC 2G1PA 4PICA 5AUNB 3UOWA 1AKWA 1HWYA 1RAAA 1UMCA 3DJFA 4K87A 3EOBI 4L4XA 4UMDA 3IUMA 5KWIA 1ZEJA 3R7BA 4F1KA 1WZIA 4JC5A 4JNCA 3LGXA 2GNPA 3RYIA 5H8WA 2QBYB 1NBMD 4K6CA 5AHRA 1PFUA 4DCTA 4OCZA 1BCRB 2G8LA 2ZBUA 5JYBA 3L6UA 1IXSB 2LPKA 2GN4A 5EIEA 1VE1A 3PHGA 5B1EA 5BT8A 3UWMA 1LS6A 1BO6A 1P9RA 1U3UA 3WFIA 3T4UA 3KEFA 3F4KA 1Z7EA 3X0DA 2REXB 1U65A 2BFEA 1JR3A 4Y9TA 1HOTA 2BE7A 5KPDA 3BCUA 3RS9A 4E88A 2J9GA 3HYBA 1ZB9A 1BKDR 4ENRA 3AFIA 2P2CA 4CDGA 4GHWA 5KYGA 1I9CA 3ZQUA 4C7VA 1DCMA 1TUBA 5LQMA 1XZAA 4GECA 1WUTA 3KOZA 1HY3A 1VHDA 1KP9A 2AYXA 3IIMA 4YAGA 3OZVA 3ZE8A 4L0CA 1KAHA 1OZHA 3M5WA 3FZGA 1N9GB 2TSYB 1T5OA 4PINA 4AP6A 1WMDA 2J3QA 2I9PA 2JEZA 4HS4A 2W0SA 4MUXA 2O1SA 4AKTA 4K6HA 3BT7A 4C1NA 4RK0A 3IUEA 5ESRA 2Z2IA 4J03A 4TV9F 4ZQGA 3LDHA 3CKYA 3HKBB 4Q7LA 2ZG6A 2Q3EA 1DWQA 4OJMX 3VO8A 1JB1A 3V6MA 1V3UA 5JSZA 2BRUA 3CE9A 4JQSA 3RHSA 3B1XA 1XZQA 3JAWA 2O5VA 4U9HS 5DLDA 2FPIB 1G20B 3ZS8A 2O3UA 1Y3AA 2C2HA 1UAYA 1KH3A 5HGJA 2UXBC 1NXWA 2R6CA 4XGIA 3MXTA 5K05A 1Y82A 3E03A 2FU5C 3G1UA 2P77A 5CLQA 3UKDA 1PL7A 2V6FA 3CA8A 1JDBC 1MC1A 4RA9A 5ERGB 2GXAA 4QTTB 2QTTA 3RYFB 2QRUA 3OQJA 1SVMA 1TEZA 1D2MA 2NAPA 1BH6A 5CB4B 2HBRA 4FHFA 3PGKA 1HMYA 7GPBA 2VYNA 1V5WA 4BDTA 1JG3A 2G08A 1KDZA 3TCNA 5FWDA 3UMVA 4AZWA 2ZAYA 3C24A 3FW1A 1WXGA 3PB3A 1MX9A 5K3EA 2J67A 1QC5A 1RQGA 1WSDA 3H2HA 4WCDA 5T6BA 3U1VA 1STOA 1AGXA 1Q44A 1PT9A 3ZUPA 1C7IA 3LG2A 3I12A 5EQDA 1DOZA 4LKRA 1G3UA 2CLMB 2ODQA 3LUJA 1KYXA 2L42A 1E32A 1XTSA 3VC3A 5FA8A 4AZVA 3AINA 3GLRA 4GPZA 4NG5A 3V1LA 5CFMA 1XTRA 4XD7D 4HDKB 1ENYA 4DA0A 3FKSD 4MI9A 4JJGA 4JLWA 3LBNA 4XD2A 4PLYA 3GLSA 2RAUA 5LP6B 2IEZA 4R51A 5C1BA 2SKEA 2CNBA 1MO3A 1P9NA 3NFYA 3IOYA 4KVAA 4R8RA 3KLBA 1MIOB 3BB4A 3F4BA 4MVJA 3TBFA 3ZK8A 3R6WA 2X9QA 3IKTA 5J4KA 2P9JA 3PFKA 4X20B 4YT4A 3E6AA 3IEKA 4UNRA 2TYSB 4B31A 4GVXA 5EGSA 5DN9A 4AIIA 4F3CA 1YO6A 3IMLA 3S27A 1ZPDA 5T64A 1II0A 4E5SA 2I34A 1IY1A 3RUEA 4AJ2A 1TD9A 3EIFA 1W6RA 1Y6ZA 4FOSA 3IEUA 1ECFA 3F71A 2CWDA 2C5LA 2LD4A 4WZZA 4ACAA 5E9AA 1QO7A 5ADZA 1TZCA 2IZZA 1EX1A 1VRCA 2VF2A 4QODA 1CEQA 4R6XA 1FPQA 1T1SA 4YXWD 4JI7C 3BDIA 2UZIR 4HXGA 2CUZA 4KXUA 1NSFA 3VGPA 1I7DA 2IBTA 1LJUA 1Y8QA 3ITKA 3O26A 3QY9A 5TX7A 4Q6BA 1SU4A 5LQNA 3DLTA 1YB4A 2FMKA 2I3AA 1IY2A 4LW8A 1PF7E 2BEKA 1P8JA 2D3WA 3HA7A 2CKMA 4TWJA 3V1MA 1ZB8A 3W78A 4EQZA 4YR9A 4UJ3A 1YMUA 1E2IA 1E20A 5JFTA 4ADSG 4INZA 1VLVA 1B43A 5FPHA 1XZGA 3HB7A 3DS1A 4LQCA 1EUCB 3C5HA 3FNIA 1DQSA 5G53C 1P7ZA 4MPDA 4DVJA 5ICCA 3UYKA 1NBEA 1Q92A 1K1EA 4I1YA 3PGMA 2G1KA 2P40A 5CVUA 2HWWA 2BUBA 3R3WA 1N6NA 1EXMA 4I4NA 4KE7A 4H7DA 4O2AF 4URZR 4UDOA 3PE3A 2LTAA 1SQ0A 3OT5A 5I7RA 4DEVA 4DR7B 1NNEA 3GFRA 4KOEC 1J33A 2C2BA 5A5FA 5BV2P 3M1LA 3KQMA 2NZXA 4O4IB 1DEKA 5KAMA 3B2NA 1WLSA 1XHJA 1I4DD 3P9RA 3ETNA 4ZEVA 3JQBC 4TYYA 3W5CA 1IUNA 4QASA 3ABIA 2B94A 1U8TA 1NVEA 2YWFA 4HB2A 4K9MA 4C6HA 5D51S 1FR2A 1DBSA 3BQ9A 3L05A 3MMSA 4J0EA 4OIFA 1RI1A 2A86A 1IB8A 4IZHA 2PL3A 1NVDA 2F8MA 1XMOB 2V0GA 5GZ3A 2D62A 5AK4A 4LY9A 1UP6A 5BR7A 4EHNA 3ZGVA 3FR7A 1UKVY 4GSLA 3L7BA 3M6UA 1H0SA 4RZ2A 3ORHA 5FUYA 4BLSA 1Z7YA 4DXAA 1T91A 3PEUA 2EZ4A 5A4AA 4IV5A 5HKKD 3ORSA 3DTTA 4RPCA 3E27A 1PQYA 3D0QA 3I6QA 5EC8A 4FXOA 3H3JA 5IXJA 3TTXA 1IN5A 4NXMC 3KKPA 3L5KA 1ENPA 1X7WA 2R6ZA 4RD3A 5EIFA 5ITZB 4R1QA 5KYYB 4E08A 2CL5A 4Q01A 4PS0A 4F93B 4FI3F 1I7QB 4N0DA 4LEIA 1CY4A 2WJ3A 2WMDA 5K0ZA 3LH5A 5E95A 2EF0A 4MA4A 3I5YA 1AX9A 1HNWC 3NOXA 3HBJA 4IIBA 4LFCB 3S6JA 2R86A 3MSXA 2E6KA 4IOJA 3P9NA 1HX7A 1U90A 3A6HA 3HB1A 5G1PA 1OXVA 1Z2DA 1VI6A 2C1EA 2DHMA 1C7ZA 1LBEA 2CGEA 2RHOA 4M9CA 2IF0A 3S44A 1QR6A 3AVQA 3RASA 5C34B 2BKVA 5I5GA 5BQPA 4DM4A 2EGTA 2IZ1A 4CNQA 2ANBA 3R6LA 5FTJA 4G5SA 4W1RA 1G0OA 2VXCA 1UMBB 4L16A 1RCUA 3IUYA 1G2QA 3TOVA 3IUQA 1JLMA 3B6MA 4D9EA 2QU8A 4RIHA 2EVWX 4G97A 5M34A 2K2QB 2D2VA 1J99A 4FYHA 4YMVA 1G6HA 2CVFA 2HIGA 1Q1BA 2RK6A 3SC4A 4ZCTA 2G9ZA 1XDSA 2Z5GA 3WDKA 5K8JB 2YZKA 3ZWKA 2BHRA 1Z0UA 3VV3A 3Q8MA 5DN6D 4KSBA 1GNPA 4P34A 3QYAA 2B7LA 3UWOA 3IQEA 3ZXUB 4R1OA 1XNGA 1O9TA 3V4VB 5JXHA 2UYHA 2EFJA 5DW0A 3ZKWA 1UZLA 4G0QA 4MLZA 2M6RA 2NT3A 1O9BA 5AKGA 1ABFA 3IUJA 1JDVA 2YZMA 1IOVA 1WP4A 3VH2A 5JJCA 4JUBA 3W1VA 5CYOA 1NNSA 2JZNA 1W85B 3TDEA 3EBOA 4MS3B 3U80A 5CA1F 2HIHA 3HG7A 4PRZA 4UCQA 1TAQA 5EXPA 2QRGA 1W4RA 2E4XA 1RPNA 2O0JA 2AFRA 2Z43A 4M55A 3ZU6A 4BJ5A 5EJDA 4YT8A 4DR3B 2WAYA 3WK7A 4RTJA 1CZKA 3ZLTA 2WSSD 3GJ7A 5FR1A 3U4IA 2YN2A 1A9TA 4EMTA 5F2OA 4YJ2A 4IJ5A 2ISCA 1A2OA 1Z0FA 3AM3A 5F7JA 4ECEA 5HUHA 2E5LB 3RIXA 2PX2A 1WBJB 1ZJ5A 3AHHA 1VL6A 3I4CA 4KR6A 3NTRA 2IHBA 2M5RA 2QNBA 1T9GS 4QYTA 1JSZA 1MAVA 5EMJA 5L3RA 3DR5A 4QDXA 3RVJA 1MJGA 2AQHA 3B3AA 4KUGA 1AD2A 2J5KA 1OH8A 1O1YA 1TC1A 1ZVQA 2IYNA 5FV7A 1KGSA 4QEDA 4UXHA 4WK6A 3CZRA 3EARA 3QHAA 4NQZA 4EX7A 5C18A 4X62B 2OOKA 4TV8F 1I2CA 2KMLA 1Q6ZA 3GOHA 4G0OA 5CA1A 2CXXA 4PPQA 1OWLA 3RTBA 2TRSB 1M0WA 5D1NA 1C3LA 1GTZA 1D1TA 3CZ5A 3SJZA 2LRHA 1N0HA 2O3SA 3FSEA 2VDWB 1ZAKA 2JBAB 4V0SA 4CQMB 1AGNA 1ZL0A 3K9HA 3K70D 1JG2A 2AFHE 3OBBA 2J1LA 3OZIA 3ZQ4A 1DHTA 1FTWA 1ECCA 3RSHA 1Z34A 1GNRA 2DHCA 3PDJA 4UTNA 1F9EA 1SD2A 1HL3A 2XYRA 3EEYA 2KGCA 1UBEA 2RC5A 1VPWA 2BD0A 2GBLC 2OV1A 3KKKA 4PQEA 4V03A 2P6NA 3VRLC 3NJ4A 4CMHA 3ZY2A 1KY2A 1A98A 3KJQA 4RIGA 4E2WA 2IT1A 3O2NA 3EMKA 3MN1A 4C4AA 2PPVA 2XVAA 3FSGA 1QLJA 4AM8A 5JANA 2AUNA 4KW7A 2IYVA 4M9XA 3WB9A 3WC4A 2AZXA 3F5SA 3GZJA 5G0TA 3TLZA 5IYZA 2R5FA 3OTQA 4NOZA 1G0NA 2LUOA 1AKNA 5BUQA 3OTOC 3CC7P 1A50B 4HWTA 4YR7A 5I8PA 1ZD8A 4RZXA 2QTAA 1R0RE 3ESCA 3H8JA 3B3QA 1JU4A 3Q12A 4PE5B 2VDKB 1B7GO 1E2KA 2Z9CA 1HR0C 1A5SB 1DO2A 1XDWA 3OC0A 5IASA 3L8EA 3GIDA 2W6JD 3R23A 4JS0A 3KRTA 1BVUA 1N2SA 4ML3A 3RUPA 2VA8A 3AEQA 1PJ2A 2ZDGA 4LZNA 5DIZA 1C9DB 4M0EA 4KAAA 1XRRA 4F3NA 4ODIA 5A19A 1K8QA 2AVNA 1GGFA 2RKOA 1NKTA 5A3JA 5BW5A 4ND5A 4FWTA 1CNMA 1S9DA 1RYEA 2CMFA 2QXUA 4DWWA 5DNCA 3L1VA 4QRIA 3U4QB 3GPLA 1RWQA 4Z7JA 3TW8A 4YRJA 2ZSJA 4TL7A 2JLVA 4W9NA 3HJGA 1EZZA 1RQLA 3PC8C 3TLMA 1Y4ZA 4IHAA 1UMBA 4JKOA 4O25A 4YUZA 3LGAA 2F8LA 1X1TA 1KI7A 2IIBA 5LNK1 1L9KA 1M2GA 3D7LA 2OL4A 4R2KA 1QPGA 2QL9A 3L6BA 4COPA 2Q7OE 4HO1X 5K3DA 5E3JA 1V11B 4XIFA 2CXPA 5KQSA 2ZGVA 2XLBA 2YNMC 1JIXA 2AJDA 3KTDA 4X97A 4EJSC 3W5SA 3GEHA 4W82A 3MJVA 3TMYA 4RULA 2DR2A 1Q11A 4WZBE 3EZ7A 3BXXA 5IKEA 3MMZA 1C3XA 1VJDA 5TPZA 3MBKA 1O6FA 4PLFA 1JV2B 2ZIAA 3BTOA 1C81A 2Q4TA 3BKWA 5SV2A 2O8CA 3ZCQA 2CNKA 3DTYA 1XK6A 2DQ4A 5KP7B 3RKSA 3FJOA 4TTAA 1VXOA 3U4DA 1OXSC 4DLNA 1W19A 3D2CA 1PDOA 4BNWA 4Q1CA 5F33A 3H17A 4KSCA 2C3OA 3VPGA 3IQGX 5IYZB 1D1SA 2XZLA 2GYWA 1XRNA 2BBOA 5JXGA 5KSOA 1Z73A 4JJ6A 4POAA 1GN9A 1T9AA 4Y6GB 8OHMA 4YO7A 5AXAA 1L5VA 2Q6IA 2UU9B 4I50A 2ZJFA 4PIMA 5CTJA 1E3DA 5EYPA 2N50A 4G1UC 3DEJA 1JU9A 1MNAA 1QVRA 1XCPA 3PFCA 1A2KC 1RXEA 2FPRA 2O4UX 4YJ2B 2I99A 3QKSA 5CPFA 4YUVA 1BMFD 1ZNXA 3IPRA 1X8LA 2AG6A 3KQSA 1C7FA 1BGVA 1UXGA 2AN9A 3A32A 2WKQA 1TKCA 3PP8A 5IN4A 1HZZA 2PKCA 3PVZA 2FWRA 5FNVA 4FQ5A 4MR8B 4AS3A 4E2XA 2DF8A 3ROMA 4L9AA 4L4ZA 4H6XA 2X1VA 1L5HA 4EP1A 4JJKA 4PQYA 5F9HA 3CFYA 1QKIA 3P9IA 5FL7A 3K0AB 4IH9A 4P9NA 1H94A 3VSCA 3PQ6A 3WAGA 2E8EA 1I13A 3LWNA 3WQBA 4IIFA 3KU1A 3Q20A 2OV2A 1CP3A 2WD9A 4TX1A 1UKEA 4HUJA 1SXJE 4CQNA 3BZUA 3VAAA 1CB7A 4O2AB 3CVUA 3GI1A 3IHLA 2R79A 1DC5A 4FJ2A 3LNOA 1YTUA 3DE0X 1N6OA 1NKSA 1ZOIA 1CZNA 2GCIA 2X1MA 3DFIA 4PCLA 4PNHA 5FWXA 3FDXA 4I55B 1KYVA 2R68A 3SP1A 3LYLA 4MP3A 1V8DA 2XBMA 1Z6TA 4ZAFA 2GLTA 4ZKDA 3KOYA 2YHUA 1XL0A 2OTCA 2DQYA 3E4DA 4ASUD 3FBGA 3T1TA 3W5UA 4A92A 3DF7A 4PZEA 1ZR2A 1QIGA 3GUZA 3PC8A 4FEAA 3ZHXA 1VE6A 1KDVA 5CLFA 2QAIA 2MTBA 4EGAA 5EG5A 3CQ3A 3VZDA 1JEAA 2FPWA 2H3HA 4J0DA 4ENWA 1ZOSA 4JROA 2JHCA 4W5QA 3QPCA 1JMYA 3BFVA 1DBIA 2Q3MA 2XIJA 4FBLA 4F3RA 3OX2A 1YWGO 2JZOA 3H4IA 2CBGA 4HATA 4XIYA 1T43A 4EBFA 3I9MA 5HZHA 2JFHA 2R8XA 3AI1A 3WNCA 4DNOA 3HJRA 4R3NA 2JFGA 4MVJI 4ZJYA 2R97A 4ARVA 2YYYA 3L02A 1QOZA 3GLUA 3TCXB 5ADVA 3GJQA 2C5SA 2C9BA 2OSBA 5MN4A 3WISA 1F3OA 5ALDA 4GGOA 2XDAA 2CXSA 3K5IA 3TKYA 4M0KA 1Q7CA 1DBRA 1PLLA 2HZ7A 3GUUA 3A2NA 2ZUDA 3GZNB 4Y6QA 5EZQA 2PSSA 3FCOA 3ZCSA 2A1TS 3EG9A 4XX1A 4B83A 3N9IA 3D3JA 3WI7A 4DCVA 1RXUA 2WPDD 4AICA 3UJ6A 3OQNA 2LDBA 1Z3CA 2F67A 3CLSD 4DRXB 4CQLA 4F8EA 1KQNA 2WWRA 1DIRA 2XKJE 4M21A 1TYAE 3UK1A 1ZD3A 3UWDA 2C99A 2FW1A 1ZRHA 1XZCA 2RJ3A 2N5IA 3LUCA 2CJFA 1XOIA 2OK8A 2C98A 3E1KA 4WLUA 3C87A 4U6SA 4QL3A 2IYUA 4QXPA 4Y2QA 5TS3A 4P7GA 4BTEA 3ZWBA 2PUFA 4CIAA 2KGEA 4HNVA 1Z4OA 4TYNA 3AIIA 2PH7A 2Z46A 1BRTA 2QGZA 1GZ5A 1YI1A 3CBQA 3M81A 3G9UA 4M1WA 3A11A 2XXMA 3CE7A 1K6JA 3T0GA 1EESA 3U44A 3GH1A 5A2QD 1ZFNA 3GLTA 4KACA 2BJWA 1T8YA 5FOWA 4MRTC 2I2AA 5JW6A 4OMCA 1U0JA 2JA1A 1PT5A 1S8OA 1YK0A 2OO7A 3BXPA 3IPYA 3QF7A 4IVNA 3TIFA 5FQOA 4J0FA 3UPDA 3HJCA 2OCYC 2QJTA 3ODGA 3U40A 3UQYS 1VHLA 4MKFA 2JAUA 3W2GA 3T6KA 3W3AH 1WDWB 2H0QA 2XT0A 3RC1A 2IQIA 3QJGA 3KLPX 4HAXA 3TRHA 2GM5A 1M10A 3ID6C 3Q11A 4OJNA 1MOSA 3MNFA 1O08A 4ZVMA 2XZ0D 1H1TA 2PIDA 2VYVD 2YV5A 4Q0MA 4Y6OA 4HAIA 4D9CA 4DMHA 1Z13A 4ZXPA 4EX6A 1J0BA 3GQBB 3VO9A 1Z9BA 2GPSA 1U7PA 4BO6A 2IGBA 3PGJA 2QAGB 3DOHA 1E2EA 1GPUA 2C96A 2V96A 3E5MA 3BERA 4HLUA 3WIBA 4J1SA 2Y99A 3OD5A 3TLAA 2FR1A 3AEUB 3GRUA 1YVEI 3RO7A 2HH9A 2PX5A 2IS1A 4D02A 4XKJA 1TK9A 1ZVMA 2GHRA 4DV3B 3DOJA 1ZG3A 2WY2D 5IAGA 1QB7A 1VSBA 1F0NA 1M76A 1RMTA 2R7AA 1PHRA 3G59A 3EZYA 4K2AA 4C22A 1S89A 1JHXA 3D4IA 3HP1A 3NONA 4OP3A 5I7VA 1ULSA 3ZJ5A 4F2HA 3SFZA 1Q22A 1RWOA 1OBFO 2V6MA 3A6LA 5G0SA 1F51E 2CD7A 2GFQA 3O8BA 1P6QA 4D0LB 4L2IB 4OA8A 4I1UA 2EZ9A 3SHQA 1B26A 4MH4A 1KGDA 3DZFA 4JYCA 2WPTA 2LKDA 2E5FA 3P2OA 4EL0A 1HDIA 1OVGA 4BJ6A 2V0NA 3DWGA 5B6IA 1XNRB 3SXPA 3U3KA 4B4UA 4D0SA 3FPGA 3K9BA 1E0AA 2IOYA 3ZXIA 4RBNA 1SVLA 2K5XA 4FNAA 3G6WA 4TTRA 5G41A 5FPTA 4OAPA 3EUFA 1UBLS 3CPEA 3NORA 4NDZA 2HA3A 4CG3A 1Q1EA 3UUFA 1YHZA 3AP3A 2GN2A 4JUAA 4UE2A 4YONB 3GAZA 1MBZA 4S1TA 1PG5A 3G8YA 1OX5A 1JIKA 2CFIA 1MTZA 3FYDA 3HMQA 3IT0A 3QKTA 4MULA 3RR2A 3STYA 3FPAA 2I4OA 4FDVA 3AJ8A 2F6RA 2HGSA 3NIDB 4RLHA 5FO0A 5ED4A 3KWMA 1RO2A 3CNHA 3ZOZA 4WBNF 3A4VA 3ZEAA 2WWTA 5COAA 3ZE1B 4O0LA 3U3RA 3IQIX 4U6QA 3U0BA 3NETA 3UXEA 1V1RB 1KOJA 4U0DA 1VCMA 1C3OA 4D6PA 1FRQA 5CLJA 1G6KA 3QFFA 3LYHA 1VCIA 1GFWA 2D1QA 4MWOA 3FWKA 3TTVA 3PGA1 2ZUCA 1S01A 3RUAA 4DZTA 2IX3A 1HNXB 4OSOA 5IARA 1QFYA 2PMDA 4R2IA 4KTVA 3HDJA 5DYYA 1ZESA 2DUUA 3FNQA 3VRHA 2EV9A 4ABYA 3CN9A 3WYEA 1H2HA 2I76A 4TMYA 2PZ8A 5CXSA 2D0OB 1GXSA 4X3PA 3RBXA 4RC9A 1BEEA 1SMKA 2HA5A 3VZQA 5MN5A 1I94C 3JALB 4W1PA 1RSZA 2ZUUA 4MQLA 5A0FA 3EQ7A 4UOZA 1OB2A 2CDNA 4EHIA 1U0BB 4RFVA 1O6ZA 1P2GA 4UDYX 5EUMA 5JJ5A 4IGIA 4DLKA 4Y2JA 5HKOA 2O3RA 5KUTA 3EFBA 3S29A 1QYVA 4WCFA 2CMHA 4PN3A 2PSEA 1H0RA 1I32A 3SS7X 1T3LA 3DOOA 3GJSA 3L4SO 4JFAA 2YXPX 3KG2A 3VYSB 5LQAA 5BMVB 4EJSA 1U3FA 2G09A 1U3VA 1RKBA 1ND6A 4UARA 3TOXA 4YAUA 2ZM6B 1CF9A 4C4OA 1P5FA 1JFFB 1ZBDA 4L72A 2XTNA 1MRNA 2C42A 4EGQA 1I5EA 1PE0A 3HNPA 3IAEA 3SEAA 2PXHA 4RTQA 5FLEX 5E4JA 3TVDA 3KO8A 3O92A 5E0KB 1IHPA 1X74A 1OLSB 1XCJA 2WV7A 4M8NE 5H4GA 1Q17A 3BFPA 2XD4A 3P4UA 2CB9A 4PC2A 1AKTA 4YFYA 1GG9A 4W9NC 1QRRA 4G67A 2IFTA 2PQ2A 3D8HA 3F7OA 3BK1A 4HF7A 5FADA 2QMEA 1U8UA 4BKUA 1NR5A 4ARZB 5TF4A 4IH4A 5B37A 2IYPA 3LOUA 2H57A 1NQTA 3SS9X 4E7OA 4E94A 4E5PA 3AVUA 3GUYA 4COCA 5GM2A 5DWVA 5BV7A 2P75A 1ZRMA 1B14A 2P4EA 4F71A 1EFVA 1H4QA 3U56A 5DEIA 1PD1A 1JHMA 2A3RA 2I6FA 3L0OA 2HI0A 4U2CA 3VPFA 2DHQA 5DXJA 2GETA 2BJHA 5B2FA 4NH4A 2C8VA 2JJ1A 1EWVA 1UBFA 2AFIE 5D3MB 1DKNA 3WRVA 2Z30A 1R4MA 2IDJA 4AUNA 4CLXA 3UMMA 1P1IA 2MU1A 3JARA 3MAAC 1UC8A 2I7XA 3KLMX 2Q1XA 1ACMA 1HQCA 5HGLA 1YZGA 2B6NA 2ZSHA 3EIXA 4FFNA 3C1OA 4RPKA 3RK1A 5T3YA 4O3FA 4EQ6B 2VTBA 2O8VA 3UC5A 2KPOA 4G4JA 3B5JA 1XWWA 2EYUA 3HVJA 3FB1A 5YASA 3BAZA 4L2IA 3W6UA 2P6RA 5K3FB 4Q7JB 3FRIA 5E2BA 3F97A 2WR8A 1WB6A 2PLFA 3E18A 3G8AA 3HXPA 3QM1A 2IPNA 2OGWA 3VTKA 4LF5C 1Z35A 4D4GA 3ZWNA 5IJZA 4KPFC 1G20E 1YZHA 4EDHA 4C7OA 5DM0A 3B1FA 2X8LA 2FKAA 4NCXA 4LRYA 4A0QA 4R69A 3LHFA 5ALUA 1FS4A 1TGYA 5FD8A 1U2QA 4L07A 5D3ZA 4DV2B 3UKOA 3IGFA 1U1FA 2C1XA 3WMWA 1QK3A 2Q4EA 2ASEA 1YVRA 1PDVA 3OA2A 3R3VA 3UT5B 1DBWA 3HBAA 4C0WA 4PZYA 2JFFA 1DRVA 5JI2E 5G4KA 1NMQA 3M4JA 2JGAA 1EJ0A 3MT8A 4GX0A 3CRQA 3D3NA 3MMXA 3GD7A 4KO1S 5EJFA 3OOYA 4HXFB 5IK2D 1ZY2A 4JU8A 5TMPA 1JMVA 4OYLA 3WJ1A 4B4VA 4M7PA 3N8HA 1B16A 2VTDA 4I8IA 1CJCA 4LI3X 4XOIA 2CYBA 1GZ6A 1RI4A 2O2ZA 1QFXA 2GDZA 1W96A 1F17A 4TMWA 1B1CA 1GKYA 4JI2C 1R5OA 3O82A 3ENZA 1K3FA 3QKSB 4HDRB 4W8OA 5EWMA 3SXUB 1EG2A 1CSEE 2CLDX 3BH0A 2WP0C 1XPJA 1PYDA 3MWJA 4FNGA 5AI5A 1GTRA 3DVRX 3O8RA 2JKVA 1B8VA 1G60A 2AK2A 3GNSA 3DV9A 4F2GA 1FYWA 3L7OA 3NH9A 4EYGA 1JEEA 5HFNA 3NATA 4IX9A 2VZ9A 3ZY6A 4BKMA 1UJ2A 4LYYA 1KDYA 4UJ5A 4OHZA 1E5LA 2V3WA 4BBJA 3HYSA 2FQ2A 1SIUA 4N7JA 4QUHA 1N6IA 1E1KA 4LC9A 3G23A 1HLPA 3TEMA 5LQJA 3LXXA 4WSOA 5T41A 1IRIA 1YKSA 4GRDA 5I8ZA 3W9YA 3AERB 1BE0A 3CUVA 1Z6ZA 5C46F 1IRXA 3THRA 4OM7A 2C7GA 5KOHB 5AIBA 3NWJA 3CPSA 4Q4AB 2I4LA 4MI3A 3BA1A 2DBQA 2IOQA 2NTJA 2ZTHA 5DRYA 1ZI9A 1D1QA 2A4MA 3ZWOA 4B33A 4D4HA 1NVVQ 1JHYA 4LN1A 1VKNA 2MR6A 3DQZA 4LJ8A 4OJYA 2IYQA 5KNLA 2VHQA 1MUUA 1C8KA 2JS7A 3TXYA 3ISVA 4GR5A 4CM7A 2XUIA 3AI2A 4XASA 2E1PA 3IVGA 3ZNPA 2ASVA 1Y3CE 3C3XA 4BCCA 2Y67A 4DQVA 1NE7A 1T34A 2V4UA 2WG1A 4FE7A 3SYMA 1H2BA 3DR3A 4UD2A 4TRMA 3T5CA 3H65A 1DWOA 5AXDA 4M86A 1EVYA 4YRAA 4A16A 4HQ0A 4D3SA 1NULA 4Z99A 4D25A 2RCYA 5JH7B 2OV8A 4AKGA 2X4GA 2XTJA 4KN6A 3O8QA 1KZ6A 3LC7O 2Y4OA 5TMDA 3H16A 3RU2A 3TQSA 1GADO 1N2FA 4FC7A 4JXJA 1FXUA 5AW0A 4ZWNA 1WVGA 2AJ8A 1F06A 2GHIA 2MHCA 3F1LA 2C03A 1MO2A 3C0KA 3CY6A 3M1YA 2WG2A 3QOXA 3Q9LA 5B7QA 1PT6A 3BL6A 2EBWA 3WAKA 1NSYA 4PTZA 2ATIA 1AG9A 5LU9A 1IY0A 4A8HA 1AB5A 2E4UA 1OFGA 4ND1A 3DD1A 4C14A 5JCOC 4JT2A 2OXEA 3KOMA 4JXKA 3INTA 1JG4A 3T1HB 3WB0A 1M0EA 2ZYDA 5GONB 2A5FA 1RFGE 1V5GA 3SKVA 3V00A 2Q3FA 1J1UA 5BR8B 3HADA 1N8NA 2WNHA 1DC8A 1C3JA 2FE1A 2FYTA 4OX9B 2AW5A 1LUAA 1A8UA 2IPAB 1YB5A 1U7DA 4MWTA 1Q7GA 5J2TB 2I9KA 4J2HA 5LBUA 1IJEA 1G42A 3U7JA 4HUTA 4AWAA 4DREA 1KVRA 3IAFA 3D5QA 1YJWP 1EFRA 2Q2OA 1E1QA 4KYIB 2PLRA 5FFNA 3IL2A 3EPHA 1RJDA 1EVIA 2E2WA 4PRKA 2JLBA 1QB8A 1CUGA 1ZUNB 4B6JA 3D9QX 1AKYA 2ZANA 1VKRA 1OA0A 5T4EA 1T5TA 3BMCA 3P2KA 3T9BA 3IIEA 2JLAA 2RDMA 3JQ8B 3LL4A 3UEOA 4BVEA 4X54A 4V38A 1G7RA 2TMGA 2IUYA 4N3AA 4NEQA 1Y1KE 3WK6A 1YL5A 2GK7A 1VGVA 1P5HA 2AV6A 4ZAYA 3VSAA 4HVCA 3O4IA 4J43A 4RZSA 4W5HA 4D9KA 2X41A 1F1BA 3I6IA 3ESDA 5IZCA 3HJNA 3AHFA 3ENQA 4MRVA 3JWEA 4EG0A 5K3SA 2JHPA 1GGNA 2JDID 3QE3A 1G7SA 2GDWA 1J4AA 1XMQB 5EE5B 4MCJA 2YWDA 1TVKA 2GVNA 3OE7A 4YRBA 1G8FA 1R10A 4BV2A 2CDAA 3L2OB 3EULA 3PL1A 3ZKAA 1NUPA 3EAGA 4PCVA 4PYKA 2PDAA 2O50A 2Z5FA 5BSKA 4R8MA 4ZALA 1Y63A 5UKDA 2WIFA 4UBNA 4WADA 3UA3A 5KC8A 7REQA 4QPDA 4GKVA 1G5PA 1L7DA 2IHJA 3GQBA 3AFOA 3R5JA 3SS8A 3ER8A 1DJQA 3M6AA 4PLPA 1GPJA 4GPIB 5CA0A 3S2UA 3P4XA 3W77A 4U0CA 3EERA 4J0QA 1W44A 1U11A 2AN1A 3NC4A 3LFTA 1L4EA 1ML4A 2CB0A 4XWGA 3H1FA 3KWFA 1LEHA 4ALMA 4BZWA 1KFCB 2N5HA 1E1CB 2IZOA 2Y71A 3LY8A 4F8YA 2FJPA 2N0SA 3WB2A 4CUKA 2JBHA 4G5FA 4II7A 2PUVA 3UAGA 4FE4A 4C3ZA 4F56A 1XTUA 2ZTSA 1U3GA 3RB8A 5EZYA 1D4ZA 1UJZA 1FDRA 1G8HA 3OHPA 3V4SA 1IHDA 2NUBA 4DNXA 4J4HA 1SUFA 3HCNA 3PFIA 4BV9A 1NQXA 2ZUFA 4W9MC 4CEHA 1E3WB 1OHHD 4L9RA 4GS5A 5HIAA 4DJEC 3MB8A 3MXOA 5DNVA 4JI5B 5A02A 2ZIFA 3BCSA 3QIAA 5F7OA 5JNUA 1ES9A 3N86A 4GM1A 4X1YB 4WECA 2IU3A 1WHTB 4BFLA 6NULA 1OMOA 3NEPX 1EQAA 5H16A 5GM1A 4TTIA 1BHSA 5GP1A 4DHWA 1XEXB 2Z5VA 1SOWA 6ADHA 3H1PA 5L8VA 4YRZA 5ICEA 2JAWA 1GQSA 3QOYA 4WLVA 5F4ZA 4AJPA 4WXMA 2Z1DA 4AQYC 2JEYA 2ZZKA 1C3VA 1UT8A 2HRCA 3KUUA 1M6XA 3QU5A 1CX9B 4LE2A 5IKXA 1AQIA 3P32A 3KPYA 1CZRA 5BS1A 3KC2A 2Z04A 1DMRA 1HDRA 5TJ9A 3NTEA 1LNZA 2RC6A 2W71A 2JIPA 1I2AA 2GD2A 1N34C 3DXFA 3NBYC 4FS3A 1ODCA 1QNLA 2HGZA 2ZI3A 4M1TA 1HC7A 1Y1QA 5ECGC 2OAP1 1XMPA 3KR9A 1J7KA 3TZEA 1DAOA 2QZ4A 3K0KA 3ZD6A 1LPBB 5GZ6A 3T9CA 1NUQA 1TTQB 3LX6A 1G6Q1 4DMGA 1DP4A 1NVKA 1XZ8A 4HX9A 4TUYA 3ER6A 1Q86Q 1XZNA 3BILA 4REQA 3TJMA 4E07A 4KXMA 3W6NA 5L4SA 1PNRA 2XV6A 5FPYA 2CXCA 1C1HA 2QG4A 2Q4DA 5JFGA 5JHGB 3AR7A 3RRNA 1OLXA 4KBGA 4W99A 4ICIA 1F2UA 1L4YA 4W7SA 2PV0A 5C1IA 4C0HA 1DKLA 2YNMD 3PUKA 3I9NA 4IV8A 3LKBA 5DX1A 1RE0A 5CNJA 4B79A 2RBGA 3A6EA 4NJOA 4OXXA 3RHFA 4G36A 3SKYA 2ONZA 3UPUA 3JALA 2FPGB 3ENVA 3ZYCA 5KVAA 3UX2A 4PR3A 4MUIA 5GGXA 3TM5A 2XRFA 4Y6RA 4DUGA 4ERNA 2YBDA 1FFXB 1T2CA 2JIOA 1QDUA 2RGRA 4JSYA 2DWCA 2JLZA 3KSRA 5E9JA 4ZO6A 4YN3A 1B2RA 4DSNA 1WD5A 3OUUA 1QHFA 1NN3A 3L84A 4M36A 4OQXA 4LDZA 4HSEA 2R8BA 2Y05A 1DBQA 1E6JP 4R01A 4RAOA 5AXCA 3TB6A 4G0NA 4LK3A 1Z0AA 1RJ9B 1TT7A 4OOEA 1O4VA 5ARDA 5KDLA 3LUGA 1T29A 5KYXB 3I8SA 3LPMA 5TGDA 4JDUA 4EKYA 1OWNA 2JNVA 4QM6A 3Q3CA 5CUQA 4LZJA 3A4LA 1R27A 3P96A 1OBVA 1LV8A 2L2QA 3DB2A 4NDNE 3PL5A 1X3OA 4QLBA 3GA5A 5DX0A 3PNQA 2XECA 4MS1B 5AQEA 4CDNA 3H7AA 2CY1A 3GDHA 1LRJA 3OPYA 1UFRA 2A8YA 2DWOA 1MVOA 2OV4A 3A9SA 4DW8A 2CNWA 1L7AA 2WQ7A 4RFLA 1V7CA 3KX2A 3OM0A 4MQEB 2EWMA 3VFDA 4MYRA 4P22A 2ZWOA 5BMOA 1E92A 2DZDA 5EZSA 9GPBA 2XMZA 4Q4JA 1X7YA 2F3RA 1T13A 4OGLA 3DP7A 2GYYA 3I23A 3UT0A 4BVAA 4MVYA 4NAUA 5I3ZA 2VYFA 1JX6A 1XKXA 2QX9A 4N5LA 3QKWA 1JEJA 1NUTA 2IP1A 3T54A 1VKOA 1XDUA 2ZM6C 2ILVA 3ML1A 4LDAA 1Y33E 1Q16A 3Q3HA 1C14A 2WF5A 4ZOEA 4EA9A 2WT4A 2V4MA 2OECA 3Q2IA 1YE5A 4PHFA 1AUVA 4RF5A 1QVGO 2HYIC 1GUDA 1SCAA 4B80A 1GXGA 4OGFA 2WRZA 1C7JA 2XVXA 4ZV9A 2PX3A 3IE1A 5KZMB 3L77A 3AVVA 3K53A 5E7MA 2QD4A 3I9KA 2R6AA 3AVPA 1YJ8A 4D80A 5LOVA 3O3OB 4F38A 3C6ZA 3DOIA 2GYKA 3SZMA 4YMHA 3KB6A 1U2GC 3W5JA 3ETHA 2B35A 4PG6A 3RFCA 4IXNA 2Z2ZA 3B3GA 2EQAA 2R1ZA 4JI5C 3L7JA 1Z5UA 3MTQA 1SXPA 2Y6VA 3MOGA 3QENA 3RYHA 3SR3A 1RE1A 2JMPA 1YI0A 1Z0DA 4CM9A 4N3NA 2C94A 2ZB3A 2UUCC 2ZSUA 4TTTS 1II9A 2FR8C 1ZJZA 1N1DA 1ATZA 3KT6A 5TQ2B 4J3FA 2Y92A 2Z4RA 4ND8A 1F4VA 4WXEA 3QIVA 3EUEA 4HV4A 2R0QC 5K8CA 1P5RA 2ZWVA 2HPZA 3RGGA 1QZZA 1WS6A 3SBDA 1A96A 2ZIXB 4HTFB 4QDUA 4L95C 3IR5A 4HG2A 3CVJA 1XYGA 2ZJAA 1Y0BA 1BN6A 4OK6A 1KRXA 1DPGA 5AVQA 1SZJG 3NP7A 5D3QA 2OP1A 3QWIA 1LTHR 5HE8A 4ZIRB 4J0JA 1K89A 1WOMA 3WZLA 1ISJA 1O97D 2ZTUA 3G02A 4KU4A 3RSQA 4AZ0A 4QEZA 1E79D 2YXLA 4KQIA 3RFUA 1GTJ1 4G4SP 1IQRA 3UG7A 3D81A 4ZVQA 3DDCA 3K31A 3U7QB 3WYDA 3A1CA 1PYOA 2GASA 1XJCA 4XIGS 4IOLA 1U0TA 1OR8A 1YZKA 5AJZA 2ZBRA 1KEEB 4YP7A 3T4EA 1JWLA 4X1KA 4UULA 4CT0A 4LQ4A 1HYQA 1Y6RA 1YC2A 3G2QA 5DXAA 5KX5A 4I1RA 2WAAA 1NOIA 5F1KA 1APBA 5FTLA 3WYBA 5HP4A 1BMTA 2Q1UA 4CQJA 1AKQA 1UL1X 3LU1A 1VBKA 1NVVR 4HEHA 3FVTA 4GVPA 3T7EA 2QXYA 2OARA 1VQ9P 4I14A 4A1FA 1YD7A 4BGDA 5CW1A 3G1WA 2QTRA 1IEXA 1XZDA 2AOWA 4ZRMA 5J5VA 1QE5A 2RJOA 5SZJA 4CF6A 2QPTA 1Q50A 1GPWB 4WFKA 2IYRA 3C8HA 5HV8A 1RR6A 2Y1DA 1QAOA 1W34A 3ESYA 2WABA 3RUFA 4K1XA 3C85A 1XAGA 1QG0A 3RNOA 1GT6A 3FPEA 3HTXA 1Z6PA 3CWCA 2PENA 4FYYA 2HBYA 3S7ZA 1UR5A 5T5QA 5AESA 4PRYA 3ZH9B 1Y81A 5J23A 3LA6A 2VLPA 3NDPA 1UINA 1BX3A 4L9WA 4U7JA 2PMWB 1PEDA 2JVJA 1WUIS 2O8FB 1O7JA 3QQ5A 1D2AA 4MHOA 2IOHA 3QXXA 3D6VA 3Q8WA 3GHYA 3HBFA 1LW6E 4C07A 4N8SA 1F20A 4OD0A 3UATA 5KNCH 5KJCA 3JQAB 3GLFB 1WSWA 1JVNA 1U4OA 4F11A 4DAOA 3ZI7A 1B23P 1SQGA 5LU8A 2V59A 1ORHA 3LUBA 3V8EA 4TVSA 5AUOB 2H1LA 4XPIB 3PCTA 3EGDA 5EJ6A 5JXIA 2ZVJA 3IQWA 1HEYA 1SXGA 2QLNA 1PAUA 1P7VA 4E3WA 4LNUB 4BBZA 4EHKA 1M2FA 3UHFA 2X86A 1NFRA 3KUKA 1FNMA 4RK1A 2QRQA 3TKLA 1FVXA 3W1WA 4L5AA 2REQA 1Y89A 2WKPA 1RYNA 3DBHB 4PYOA 4QBGB 4BN5A 2GYVA 3HRKA 3SC2B 4DQLA 3ZZ0A 1ULUA 2NXCA 4GD3Q 2WYVA 1NVTA 4RJKA 1XXHB 3WGHA 2W22A 2XR1A 1ZUD1 3W6OA 1B6RA 3SX4A 4G1MB 4B6PA 1RFLA 3QUQA 3QXSA 1CRZA 4UTVA 4F85A 4WUVA 3JQQA 3LLCA 4K40A 3ILXA 4AMBA 3MOIA 3DW3X 2YCBA 4KFUA 1KQFA 1OFTA 4KSYA 1ICIA 1T4DA 3LWDA 2V7BA 3GR0A 2NXWA 3ORYA 4DG8A 1PWZA 1QPBA 4LJAA 3DMYA 5HPYB 1O5OA 3OJLA 4AP5A 1Y1TA 2YC2C 2AX4A 2OLJA 2B7CA 1M2KA 2O5RA 2PM8A 1FU7A 2NADA 2QV7A 3OFSA 2FSPA 3U16A 1MO4A 4M88A 1U98A 2JD1A 4FWIB 1PSWA 4KE9A 2PA3A 3GWZA 1L5GB 1PW5A 1GTMA 1J06A 3WYFA 5K4HA 1EK5A 1ISPA 2HWUA 1GZHB 2DBYA 2GEUA 2QNRA 2X3YA 3F5MA 3V3TA 1XL1A 1LBSA 4EYQA 4YJGB 1OCEA 2OQIA 4GEGA 5AR1A 1XKQA 4ILKA 4XFDA 3RAJA 4HTFA 4ZOBA 1PP4A 2Q28A 1GUYA 3B9PA 3L46A 4FLMA 5BVHB 4QM7A 2QTFA 3SYKA 1II8A 1BDIA 2XMPA 4EABA 2X2EA 2ZPAA 2V55B 3WGJA 2IHKA 5KYUB 5LIPA 3CQ2A 1DDOA 1IB6A 1TCBA 4GSKA 3VU0A 4DDWA 4DCMA 2Z4TA 1IVSA 2AR9A 2BI4A 4KPUB 3HLKA 3IOMA 2Q3HA 4MMXB 4NONA 5DK6A 3QE0A 3ONEA 5BR1A 2G0NA 3DTNA 2P2QA 2EAUA 3EJWA 4IDPA 3MCTA 1PHPA 2I6TA 1SBTA 1XJQA 2QRVB 3KEQA 3PD0A 3R41A 1EJ6A 3VR4A 4DSOA 2HEGA 4EEXA 2WJ4A 1HLDA 5LZ9A 1LSJA 4ZYLA 1PJLA 1IM8A 4B7AA 1BCSB 4LG1A 4BCAA 1BA2A 2R8YA 4X94A 4HVAA 2VJNA 2PUDA 1WVIA 4YBRA 4UM9B 1Z26A 1EM6A 3EZXA 4YDSA 2MSEB 4ZQFA 5CA0F 2F90A 2BEWA 3U5TA 2VWQA 5CEFA 3SDSA 1KNXA 3D3KA 3R0ZA 2ZI4A 1OBHA 1OGYA 5EZYB 1H2FA 2W58A 4LDPA 2G80A 2HQ1A 3RTDA 1P75A 2NTNA 2WUEA 5FYQA 1FZTA 3O3NB 4QT0A 4CQMD 1D7OA 4LAFA 3LXRA 5FI3A 4FE3A 3HHPA 3K7EA 1NMEA 2D4HA 1HFEL 1LBIA 5BOVA 4UOEA 1LBHA 1SCQA 1JDTA 2G40A 4FW8A 4NMHA 3K4QA 1UBCA 4E51A 1EK1A 2WFMA 5DDIP 1NX6A 1NW5A 1GPBA 3BMNA 2WDZA 3PQCA 1CR6A 2SCUB 4H1TA 3FFBA 2FZKA 1PL6A 1SC6A 4UM7A 1CUIA 2H6EA 1OZFA 1U2DA 1SCUA 4U0BA 1UK9A 1QYCA 2XCOA 3N3AC 3NO4A 3NU1A 4GW3A 3V4RA 1ZK0A 4HY3A 4OMDA 4TWBA 3F3YA 2PU7A 3P94A 5BSRA 4DVGA 1ZIXA 3USES 4DA7A 4ZOLB 2C4UA 2FEMA 3D3EA 2WWFA 1IG3A 4TLCA 3HXTA 3AG6A 2JYLA 5KHAA 2VH1A 3JSAA 3KTFA 5A6SA 5HSGA 3IP1A 1DEHA 2GCEA 1EDOA 1ML8A 2JBAA 2JFNA 2P4QA 2RI6A 4GE0A 2VHCA 3VPDA 5BW4A 4G8CA 1OBOA 2REQB 1K8YB 1XALA 3DBHA 1OXMA 3IX7A 4FLEA 4IG4A 1B8PA 1DELA 3EMBA 1Q0UA 3U37A 4K26A 4EY5A 2UUAC 2TECE 5J1TB 5FWNA 5LKRA 3B89A 3KZNA 4K5QA 5A0TA 1P9LA 2P2ZA 2D1TA 4CMBA 4FM9A 3OD1A 3F6RA 1RYMA 3RK0A 1SOAA 3A1DA 2A84A 3B51X 3H8SA 1VQ1A 3KKNA 4EB6A 4IIVA 1ZD2P 4U5QA 5L3ZA 1BOOA 3CF4A 5C8YB 1O95D 1T0UA 1XROA 4RD1A 4CR8A 3W8FA 4E1BA 5A04A 3SQXA 3B9BA 4E1VA 1YBAA 2A78A 1SUIA 4LBYA 4RORA 5A4MS 2R85A 2C7OA 3FZQA 4Q21A 4OREX 4EHHA 1JR4A 1WX1A 4B3GA 1P74A 4X7MA 3UFBA 2AEJA 3DOCA 3K6KA 1LI4A