3RG2A

Structure of a two-domain nrps fusion protein containing the ente adenylation domain and entb aryl-carrier protein from enterobactin biosynthesis
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
611
structure length
611
Chain Sequence
SIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASAGRASIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Enterobactin synthase component E (entE), 2,3-dihydro-2,3-di
publication title Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
pubmed doi rcsb
source organism Escherichia coli
total genus 190
structure length 611
sequence length 611
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.7.7.58: (2,3-dihydroxybenzoyl)adenylate synthase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3rg2A03
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3rg2A02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rg2A01
4RM2A 2KOPA 4R0MA 4ZJZA 2FACA 2QW0X 2AFDA 2K2QA 2FQ2A 2KOOA 2FAEA 2MVUA 4PXHB 2D1QA 4D4HA 3IPLA 2VZEA 1OR5A 3R44A 5BSTA 3IEPA 2CQ8A 4GXQA 2N6YA 2JGPA 2CGQA 3EJBA 4H2WC 2QVZX 2K0YA 2L0QA 3L8CA 4R1MA 1V26A 2ROQA 1KLPA 3B7WA 5KP8B 3WV4A 1MDBA 1T8KA 3NI2A 5KEIA 2N5IA 4BPFA 1RY2A 1NQ4A 3NY7B 1T5DX 1PG3A 4IZ6A 5GTDA 3WV5A 3T5AA 4M46A 2KORA 4BPHA 5KYVA 2JQ4A 5CZDB 2FADA 1L0IA 2LTEA 3LAXA 2LL8A 5IFIA 2K0XA 5DV9A 2MR8A 2KR5A 2GDXA 2QNWA 3GZMA 2D1RA 3PBKA 3E7WA 5K85A 3E7XA 4NEOA 4D4IA 4GS5A 2K94A 5BSWA 3LGXA 3CW9A 2P2BA 4WV3A 2Y4OA 3ETCA 3E53A 1MDFA 5HV8A 2P2FA 2L22A 3RG2A 2FVEA 3LNVA 3IESA 3O82A 2KGAA 3GZLA 4RLFA 4RLQA 4ISBA 4H2XC 1ULTA 3G7SA 2N98A 2KW2A 3CE7A 3GPCA 4FUTA 5BSMA 1AMUA 2X2BA 1DNYA 3NYQA 3U17A 2KG9A 2GDWA 1PG4A 2WD9A 4R1LA 5KP7B 3FCEA 2FQ1A 4FUQA 5BUQA 4GR4A 4G37A 4MRTC 4DG8A 1MD9A 5D6NA 2P2MA 3LMOA 2P2QA 4OXIA 3ITEA 4HKGA 2FVAA 1HY8A 3IERA 2GDYA 4GR5A 5JRHA 3IVRA 4RVOA 3EQ6A 5BSUA 4D4GA 5K8FA 5HVCA 1LCIA 4RVNA 3EJEA 4W8OA 4H2YC 2V7BA 2Y27A 4OYCA 5KYTA 2KWLA 2Y4NA 5BURA 3CW8X 2KGCA 3O84A 2EHSA 3DHVA 3VNRA 3EJDA 2VSQA 1L0HA 2KGDA 2L9FA 2AVAA 2P2JA 1BA3A 5BUSA 4CA3A 2FQ0A 4IR7A 1VKUA 5DWVA 2MD9A 3A9UA 4D57A 4E5DA 2CNRA 1YJ7A 3RIXA 3FCCA 2LMLA 3QYAA 4D56A 2MR7A 3T5CA 2KG8A 2KGEA 2KOQA 1AF8A 4RM3A 4G36A 4LGCA 3VNSA 4PWVB 5BSVA 2AFEA 2P20A 1HQBA 3KXWA 2D1SA 4RMNA 1V25A 1ACPA 2L4BA 2KG6A 3U16A 2FVFA 2EHTA 4EATA 2JU2A 5KP6B 4BPGA 2K92A 4PZPA 2CG5B 2N5HA 2PNGA 2LIUA 3C5EA 2M5RA 1T5HX 3VNQA 3TSYA 3NYRA 2LKIA 2LPKA 5EJDA 2D1TA 3T5BA 2N6ZA 2LIWA 3WVNA 2LOLA 3O83A 2XZ0D 4DG9A 2MF4A 2AF8A 1DV5A 3DLPX 1F80D 2XZ1C 2JU1A 3A9VA 2MY5A 2FHSC 5E7QA 2QVYX 3DAYA 1X3OA 4U5YD 2N50A 2MVVA 2QVXX 2KOSA 2K93A 4GXRA 5BSRA 2DNWA
chains in the Genus database with same CATH superfamily
1CWUA 2NO7A 2RG7A 3U0VA 5TS3A 2XB6A 3QBDA 3G0OA 4F3NA 1U3UA 1Q50A 4HKTA 2WAYA 1ESDA 4J7CA 5KVCA 4X20B 1OF1A 3RB8A 4HBZA 3SZLA 4JOQA 4BAGA 1P9RA 3L79A 1E9SA 4EO4A 3JYQA 4LKRA 3EPKA 1MRZA 1ZH4A 1KI2A 5F3DA 5AJHA 3MOGA 4QFDA 2ZYGA 1JB1A 3DQPA 2OPBA 3IR6A 4M87A 4J1TA 4LVOA 3PITA 4GLJA 4ZOLB 2DP4E 3KTDA 1G0OA 1WB6A 4CTMA 1T24A 2VOEA 1AQUA 4YGXB 4E5NA 4V0NA 1OVGA 2XYRA 3GLHB 1FDTA 1S2NA 2GFHA 3DOIA 3HP1A 4TUYB 3ZY2A 1QNFA 1A2QA 2J5XA 2J48A 4K9QA 5IJWA 1DG9A 3B9PA 4TMWA 4E30A 3R9WA 1Z7EA 2HY7A 1NMZA 3LX8A 1W5EA 4AO8A 3V4PB 3UWKA 1EFCA 3WKEA 2OYRA 1U3WA 3DYBA 4MO9A 2P75A 4UFOA 5EKSA 2V1XA 4NU0A 4RD2A 4AO7A 3IAEA 2WNSA 2HLDA 4ZYXA 5EIEA 1XRAA 1LQLA 4RTNA 5ADHA 4R81A 3VR3A 3MOIA 4XH9B 1NDUA 4G36A 1VIDA 2AN5A 3DVRX 2F3RA 1L3BA 2ZSIA 2CLCX 1VG8A 4AJ9A 4BBPA 4ND5A 2BHVA 3H04A 1U9IA 4I4CA 5I8ZA 5L95A 3C1UA 2WDPA 4WKOA 3WO1A 4AY4A 2Z2IA 3BWMA 2B20A 1GYRA 3AK4A 1U3TA 3DHNA 3PKJA 2GHRA 5CDFA 3F78A 3CB2A 2AOUB 3B5EA 4QOIA 4N7RA 1SRQA 2GVZC 4AG6A 3TZ6A 4RKQA 2VRNA 2A5FA 1JMYA 1O94D 4YRRA 5FDFA 3PGA1 3TPFA 1Z7YA 5EIFA 3Q9LA 1HE1C 1E6WA 3KD3A 4GR5A 1A71A 4O02B 1N9KA 1XPOA 1XAHA 2KGCA 4B44A 5LJIA 1AQLA 2A3NA 1MO3A 3O21A 5L3QB 1KKGA 4II3A 3WIOA 5AJTA 4RXMA 1DWUA 1G5HA 4KYVA 4OBXA 1XK6A 3GLIE 4G84A 1CDOA 4KSBA 1I2MA 4JBNA 1U0NA 2BJWA 1PK9A 4BQOA 1ODJA 1U2SA 3N5KA 4L0QA 3VJLA 2BGMA 3KT6A 1ML8A 1BFKA 2XQIA 5IDXA 2HHCA 3PUWA 1K08A 1XB2A 2GNPA 1LC3A 2CVZA 2VKQA 3CFYA 1KDZA 1YZ3A 3S44A 4EDHA 4Z9YA 4WBNA 2EKBA 3CH6A 5F7JA 3E70C 1BEUB 2C61A 2CVOA 5LA6B 4OQNA 3KU4A 4HMQA 2VUUA 3L04A 1O3YA 3OJOA 5FPHA 2DQSA 2HK6A 2Y2UA 4UPDA 2KE5A 3DB1A 1F7VA 4R5MA 1YJWP 3D7SA 4QXAA 4RX1A 1JLHA 5I7FA 2FPPB 4MA4A 3GJ4A 4UNIA 2PJDA 3D3NA 3LKBA 1TCUA 3O8QB 2ZM6C 5KJEA 1ZGBA 5KTTA 4I4TF 3V46A 4LOIA 1VBNA 2GK3A 4RO0A 3TAXA 4OHPA 3EOZA 3FE2A 3EISA 3NOQA 1NSFA 1G7TA 3BGVA 3FHTA 1R4MB 1HMPA 1VL8A 2JKYA 5EUQB 1MJNA 1P2TA 5JJIA 4DT1A 2ZB4A 3E5RA 5GVSA 2D7DA 4IV8A 4E5MA 4WCDA 5A9TA 1CR2A 1HFWA 1T0UA 1G8AA 4HO1X 3GVXA 1YI8A 5I4BA 1CQZA 2BF7A 2Q2WA 1HT2E 4Y8VA 5JBQA 2J3IA 3LFUA 1E3WB 1KGDA 2HEGA 4QUKA 5H9VA 4NY1A 2O0LA 1Y98A 2Y1KA 2QGZA 2PH5A 2TRSB 2WHPB 2QY9A 3BXXA 3OA0A 4DA0A 4ZCTA 3U43A 1YQDA 3VHXA 4DLYA 2VJQA 2G80A 5DBHX 4O1IA 3H7AA 3GNLA 3QX9A 3R2JA 4W1RA 3PE6A 1WCWA 1VSTA 4MS1B 4Q7MB 4DM4A 5JVDF 2OFFA 4UUNA 5K3DA 3UH1A 3SC4A 3CUWA 4I3FA 2MVUA 4BFXA 1PN3A 4JBXA 2PGXA 2FWIA 3X2FA 2LCQA 3OWOA 4PCLA 4A3SA 5DLEA 1CJTC 2AMFA 4KEAA 3EOBI 1O94C 1LLQA 1VJCA 1KFCB 4NRDA 2C07A 4TVBA 3OLVA 4GKJC 3LWZA 1Z08A 2VHJA 3QTBA 2G8LA 5FFFA 5CTJA 4OCZA 3NTLA 1JQ3A 5KNBD 4L8WB 1CTQA 1T3TA 1WUKS 2WJYA 4HZIA 5EJIA 4AN1A 2AVAA 1SBHA 4YCSA 1VE6A 3CWZA 2O5EA 3BC1A 1RPAA 4RIFA 1WXHA 1XQYA 1JP7A 3EXHC 3TOVA 4KN9S 3P0JA 1RYEA 3NWEA 2XVAA 3D2CA 4FU0A 4MV7A 5CVCA 3KLMX 2CXTA 2RJ3A 1P2VA 4ZKDA 3NLLA 2IHUA 5EA2A 3OMWA 1Z9BA 3W5AA 2XZTA 3ZXSA 3U1BA 2AN9A 2ZRKA 3ESBA 1HI9A 3DYIA 1WWKA 4S1NA 1D6JA 2V0CA 4RLFA 3PS9A 1L5MA 2ZJ6A 1S1MA 4E5PA 1YSCA 3GLFB 2R8PA 2WRZA 1YH3A 1V4VA 1BHQ1 5GADl 1CKEA 2QN8A 3GD5A 1BJTA 2FPOA 1OX6A 3LK6A 3CLUC 3KLNA 2ODNA 3F5SA 4GYJA 4D3DA 1E2EA 2Y0EA 4NVRA 4TKZA 3N2YA 1SU8A 2AGVA 2VSYA 5P21A 1NVFA 1MQ8B 4QVGA 1WZ2A 2CUTA 3Q5EA 3I56P 1D7AA 1M0EA 1X0XA 2EARA 1KQFA 3HI6A 4JKIA 2C4WA 1NQTA 1AKQA 2QE6A 3V7FA 3PNPA 4DREA 4US0R 4X3PA 4KV9A 1H1LB 1HRDA 5KSYA 1M8FA 5LXTA 2N98A 1Z5GA 3C3XA 4ZVNA 1FNDA 3LP5A 3FW1A 4TVOA 1XMOB 3B8HA 1QH0A 4IQFA 5ICCA 3PGMA 4AJ1A 1RRPA 1TC1A 4Q3AA 4J4HA 5JDIC 3MJEA 2I66A 3RVLA 5FOXA 1N7JA 3EXG2 3B13B 4RTRA 4RFSB 2W2LD 2KQUA 4DR3C 4LY0A 1PQYA 3DUFA 4EITA 3X1JA 3PEYA 4XVQA 1Z6GA 4CVNA 4O6VA 2JJ2D 4RV4A 4DV5C 1LQ2A 3HCEA 5L3SA 4JI5B 3QVXA 2JBAB 4ZCRA 4IJKA 2TSYB 5F52A 3A0RB 3GQBA 1LBIA 2VP6A 1SBZA 2ZI6A 3EIUA 3PJDA 3OCYA 5CBKA 2VA8A 2BL4A 2EP5A 2PLRA 1ZISA 4RORA 4DABA 3H87A 3ZWAA 2XTZA 1FX0B 3K4HA 2PGAA 4BUCA 3I52A 4NPHA 4IXDA 4TLMB 1T9CA 5FWXB 1N3BA 3SSAA 1JXMA 2NU8B 3ZWOA 1OCEA 1AZTA 2YJZA 3A3OA 4D42A 1Y8ZA 1KFJB 3ANNA 3V34A 2R7KA 3A1SA 2M5OA 1Z29A 3IBSA 2JD1A 4C14A 3GJXC 2BLLA 4Y2VA 4D5EA 3BWCA 1CIPA 1O6BA 2H4ZA 4M38A 1VDMA 1Z47A 1RKVA 2AOTA 4DC9A 1FFBA 4PRKA 1U3FA 3NMUF 4H6XA 1YVEI 3ZLBA 3U7FB 4TKVA 2XOKA 3I92A 4RA6B 3JWJA 1AQIA 4O2LA 1ZINA 3CJTA 1USPA 4LBWA 4UHDA 1JJAA 1DWQA 1U0JA 2OXRA 4OQZA 2M2IA 3KTAA 4YCLA 2UXDB 2KW2A 3RBAA 1D2MA 3WAJA 1KJZA 1E9DA 1GCGA 2J9FB 4IMJB 5CLQA 5SZHB 4RNCA 4L16A 3UMGA 1EXNA 2KB0A 4M8LA 3F6RA 1R8JA 1HXHA 2WYVA 3V32A 3RU2A 1K9MQ 1B42A 5J4VA 1M34E 1M0WA 1SIWA 4DLXA 3FOZA 2JHGA 4RZIA 3FZNA 5TSDA 1TIPA 2A9KA 2FSHA 3TLMA 2J6CA 5BQXA 2C5FA 3ZW8A 3THYB 3V4RA 2QPOA 3PCRB 3UPDA 3HI4A 3GXOA 3QPCA 1A43A 3HM2A 4P9NA 3F4KA 5HBGA 1TJNA 3I62A 2QMOA 1YS4A 4BMPB 4G2TA 1QK3A 1O57A 4EZIA 2AJBA 4G9BA 1WO8A 1R9GA 5ICMA 3O75A 4U7JA 4RETA 2J9GA 2G88A 5G4KB 4DMGA 2IOQA 1H2XA 3RC2A 4MI9A 2ACEA 3JS5A 3BMOA 3FYDA 3INNA 4YMHA 2XCTB 5FOTA 4DCSA 2VYNA 4W5RA 1BVHA 3MQFA 1WUTA 2DUNA 1BE0A 1IBMC 1VCOA 3ZDQA 4IDCA 1V7CA 4Q19A 4C4PA 3A3PA 2JJYA 4KR3A 5AVOA 4GX2A 1ZMTA 3OX4A 2B4KA 3DMGA 2YOGA 3BTOA 4H2DA 3B5IA 3RYCB 4D9MA 1ZNQO 3DAFA 4AUNA 2BSXA 5L3VA 1HNZB 4CBVA 5TLSA 4V0QA 1CIVA 1T1RA 3MMPA 3L7KA 5K0BA 3WWEA 5K99A 2QNWA 5CM8B 4R1NA 1WW8A 2X0KA 2B98A 1WD7A 1WMDA 2J3KA 2P78A 1GN8A 2WU4A 3FVTA 2HRDA 1TF7A 3ND8A 4AKTA 3EMBA 2D27A 4O5OA 2J9RA 3B1ZA 3QFHA 4BLRA 4ZANA 1YDFA 5C8VA 4A10A 3D4LA 2QY6A 1ZSVA 2ZVPX 3F1KA 4BPBA 4DG5A 2ID9A 2QL6A 4S35A 3RCBA 5B7PA 3WK9A 4WLOA 2EL7A 3B4QA 1C7ZA 1L8AA 2VQEB 5A2QA 3CTMA 3EC2A 1PNOA 1F8GA 1W88B 5AKEA 4EO7A 2P40A 4RJTA 1NHGA 1CUWA 3IAFA 4Z9AA 2V7TA 2PD4A 3F3KA 1YR3A 3ZGXA 3OZXA 3GPIA 1F17A 3BRSA 8ADHA 3EIEA 4J0CA 1WNFA 2LE0A 5JC8A 1D1QA 3BXEA 4MYHA 5DYYA 5FLKA 3GFFA 3F9IA 3EGIA 3M8KA 5DHRA 2CDNA 2CXPA 3K31A 1EVIA 4O29A 3AEQB 2O0KA 2CLKB 1SXJD 1PW5A 2Q6KA 3OFKA 1QP4A 1V39A 5IFKA 5BN5A 1CHNA 1Z5PA 1WU8A 5L7WA 2AYAA 3I8XA 5MGBA 5FOUA 1ZJJA 4MV1A 3WWPA 3H84A 1ZGGA 2BFCB 1GTZA 4HH3C 5JMOA 3WQQA 4I50B 1UWCA 1ZAYA 3CPEA 3AB8A 3NRCA 1EK6A 1NFQA 4N9QA 3H1BA 3REOA 4LDNA 4G2NA 1W0CA 3KZ1E 3UGQA 3AI2A 5FWYB 1H5QA 4I4LA 2CLMB 1Z2DA 1KA9H 4Q9AA 3OQ1A 1A7AA 1RFGE 4KX3A 3PR3A 1GLGA 1GU0A 3AV0B 5A3JA 3C8HA 5LQDA 1PX2A 2ZJ7A 1UPCA 1OPXA 4FYIA 2FP4A 3HSSA 2F2TA 2R6HA 3C8MA 4UC0A 5ILQA 2W11A 4EELA 2BSAA 4IXMA 4A0SA 3K2EA 5LU8A 2BFAA 2HK8A 1DIAA 3DJFA 3M81A 4TXNA 3D6MA 4LRXA 2OV8A 1IY8A 5DB4A 1AD2A 4DLBA 1JE1A 2WTBA 4EI9A 2WVAA 1KO4A 3WDKA 3HZQA 1QNLA 2I8CA 3DCIA 1X7WA 5AJVB 1FVOA 2HCJB 3CIOA 1SUIA 1R0YA 4DCNA 4OLJA 3QNWA 5M04A 3HBMA 1UM9B 3LQ4A 1NRXA 4I7EA 4X54A 1N33C 1VPDA 4Q7LA 2KJQA 3LUKA 3PNMA 5FEUA 1FUIA 3D64A 1TKCA 3WQRA 4E1AA 5EGSA 4JBYA 2R00A 3CLKA 4Y6QA 3GI1A 3TBKA 4R2LA 1DVRA 4XASA 2G1PA 1RO0A 1B3RA 5JYDA 1A8SA 3U7IA 1CRQA 1GPMA 3W6OA 1JQEA 2XXBA 3VNRA 2R3SA 1QGUB 4LOKA 3PEWA 4ZQEA 2PZBA 3IKJA 2GM4A 1JECA 4TZTA 2Z04A 2FEWB 4EG7A 1N57A 2V97A 4FFOA 2VRCD 1UBOS 1K68A 5TT1A 3T5BA 3V1NA 3STTA 2IS1A 4R0VA 1OOEA 2ZUUA 4WA7A 1GXHA 4U3JB 1NM5A 1ZM2A 1BVRA 4AB1A 2G9VA 1RPZA 1AF7A 5AHKA 1CRPA 3THWA 1HDYA 4RA9A 4DIKA 1K1EA 2BJHA 1B0UA 2GXQA 4WY8A 1MC1A 2BEKA 4DDKA 4HH0A 3KJXA 3OH8A 4AVYA 1CQIB 1W9HA 1LS1A 4FHEA 1SXJC 4YJFA 2DY1A 4IH9A 5KX5A 4OH1A 3KR1A 2ZIUB 1FFAA 3DL2A 4UU1A 2V9PA 3ETNA 4IDGA 4P4SA 3RARA 1EVJA 2YV5A 4FXOA 1IMQA 1BKYA 4BQRA 2ZBUA 3ZIDA 1RXWA 1JWAB 2E8CA 3ZPXA 4PX9A 4WXHA 2XNCA 4D56A 1PQUA 2VHXA 4UEOA 3QX8A 4Q03A 13PKA 3RM3A 5KKAA 5BSFA 4IVRA 1GLVA 2YXNA 2WUFA 1NT2A 3ZCTA 4KXLA 1IXZA 4RJKA 3KG2A 3G9QA 2BFDB 5DBGA 2VLQA 4ZU6X 3AVUA 1N0WA 3B12A 3I4CA 3BF8A 4HH1A 3EPHA 4YXWA 2H4XA 3PD1A 3W5DA 2YTZA 4OHMA 5JECA 3U5ZB 4QLAA 4YCAA 1M2HA 1NWCA 2PS3A 1RJWA 3REQB 5H02A 1M2OB 3T7DA 3ED5A 1FQKA 4GI5A 2QUHA 5JSZA 1A7JA 1XVVA 3H5TA 3HKDB 3RO7A 3VPBA 4OI2A 2BWJA 4J03A 2Q8NA 4CIWA 4UTVA 3ICWA 2FSGA 1NVBA 4FQ5A 4Q6BA 1NQXA 5KWJA 3ECCA 1IFXA 4KE7A 2B82A 3K70B 1Q95A 5FJJA 1PFGA 2MMCA 4PXAA 3B82A 2PT7G 1TDJA 3B9RA 4I9UA 1O87A 3FI9A 4EMTA 2FW7A 2A0UA 1UKZA 4BX3A 4ZKEA 3Q2OA 2FW9A 3LOUA 2XRZA 1W85A 1F5NA 5TGTA 4FP9A 3W9UA 4D02A 1STOA 4B4UA 4DA9A 4LK3A 4ZO6A 4RPGA 1CNFA 1WXQA 1Y8RB 4MV8A 3BIWA 2OV1A 1WXWA 3SVLA 5GOZA 1H42A 4ZCMA 4UXIA 3V2UA 3Q41A 3L1HA 2XD4A 4GVLA 1AKMA 1O9TA 2YJ4A 4X00A 5BYJA 2CB0A 2A7QA 5AW0A 4YECA 4ILEA 2X8JA 2XR1A 4PNHA 5K8FA 4UNNA 1OASA 1MJ5A 3H1AA 1W1WA 3S8YA 4XYEA 1VJGA 2OD2A 4DL9A 1FF9A 1CXZA 1FDRA 1TA4A 2NPOA 2ZZNA 2IEGA 1XTQA 1QH9A 4CMCA 4P38A 1VI2A 4UAGA 3H18A 1WD5A 4M9CA 1KH3A 1A5SB 5GPBA 3CG4A 3V4VB 5BV2P 1V3QE 2M6SA 3WYFA 3DLTA 1IPHA 4JI6B 2ORVA 4KR9A 5LL6P 3VRLC 3W5HA 2XJ4A 3WRYC 2PVSA 1ZWLA 4KGVA 4ZVSA 2HR1A 2CGQA 2ROQA 4J9UE 3EYWA 2XT0A 3BJZA 2PMWB 1JH8A 4JYMA 1W1UA 3VU9B 1M3SA 4BB0A 1PVOA 1JPNA 4EECA 3KJGA 4ROSA 4RTJA 5I48A 4GYYA 3EB9A 4EVIA 3D4NA 3GT4A 2QLMA 3T9AA 3NYQA 4R1LA 1WXIA 4A23A 2Q45A 4ND6A 4M9SA 5KJFA 2B4YA 1SK8A 4PG8A 5HQTA 5JTTA 1D2AA 2X0RA 1IBKC 5UKDA 1A82A 3K20A 2EWWA 5EMHA 4ZEMA 1O97C 1YR6A 1KYIA 3HO8A 1FEZA 1XZMA 3GGCA 1Z4NA 1CZRA 1C3OB 3INGA 4CQLA 3ZJUA 3BMQA 2FZKA 1PJAA 2QUBA 3HEBA 1I1OA 3A06A 4CTNA 1IY2A 1QZUA 4DMMA 3E22A 5DNCA 3QPAA 2NTVA 2C2YA 2PS9A 2FHPA 1JHDA 1KDRA 2HF7A 4Z0HO 3BN3A 2Y68A 4FGJA 3VO9A 1DTEA 1X3LA 2IIQA 2W6ID 2HDWA 1J20A 2WIDA 2W7TA 5KU1A 3FPAA 1KJ8A 2R6GA 4IIHA 1LD3A 3ZGZA 3BGSA 3BL5A 2PA3A 2IWHA 2WF9A 3U7HB 2YOFA 1L4GA 1QIMA 2B61A 4YAOA 4Y3UA 1L5VA 1XTPA 3EC1A 5GY7A 2PBZA 4KN5A 1JFTA 2I7DA 2F3UA 1L1QA 3SQLA 4LX0A 3GT7A 4TTQA 3IMKA 4J2TA 4UBOA 1J0DA 1FQJA 1Q91A 1QHHB 4F91B 4MWSA 1S0UA 4BX9A 1HDRA 3JQ7A 1RWOA 1AUQA 3K8OE 5SYMA 4TMFA 1YS6A 3T9EA 2NMVA 3DKIA 4Y2GA 2UUAC 2PQ0A 1TX4B 5IDWA 4AYTA 3IODA 1NDQA 2FB9A 1QHFA 2B6NA 4B81A 4JH0A 3U80A 1QPZA 1JMKC 4X93A 2CBZA 4I3HA 4IIYA 3W3ZB 3F5DA 5HKLA 1XN1A 2XAAA 3OSUA 1NN0A 1IULA 2AMVA 1L7QA 2A3RA 2ZTUA 2HK9A 2OB2A 1HY8A 2NU9A 3KDAA 3GJ5A 1NAHA 3HP7A 5TVKA 1T4DA 3KUDA 4QDTA 1OZHA 1GGJA 3RT1A 2IPXA 3W2FA 4XIJA 3I45A 3T7RA 3UWPA 4X6XA 4RMJA 2P9BA 1WOMA 1HT3A 2YHSA 4NNOA 4UUPA 3AL2A 3PENA 3L77A 4ED9A 2OTCA 1ND5A 2HA7A 2YHBA 2D1TA 4Z51A 5IKPA 4N01A 1C81A 4JBIA 2QVYX 2C97A 5IS2A 2WB4A 2EBWA 2PRKA 3C5HA 2R97A 2PQMA 2P91A 1WRBA 1IUPA 4DIFA 2H5IA 4I9FA 3BDVA 3HN7A 2ZDHA 4H7JA 3D6NB 3U31A 3RFFA 2XBMA 1CDZA 5KHAA 1I30A 4N5NA 2H2GA 5MN4A 3QKSA 4F6RA 3NTUA 2R60A 1TJYA 5TMPA 1WZUA 3BWXA 3GD7A 3BBPA 1Z06A 1TM1E 3LHDA 3WNZA 3MS7A 1WAMA 1TEHA 5CITA 1IHOA 5FBRB 4MP3A 4GMHA 1EFVA 3MWDA 2BGUA 3EXHA 2XRMA 5I7EA 4DLUA 1UBHS 1MX9A 2NO0A 3L46A 3I04M 1SOWA 4UE2A 3E2DA 4YY3C 3LT0A 4KSYA 3M6WA 4BN0A 4G1CA 2Z5GA 2VAXA 1Q81Q 2R47A 5K2MA 3GYBA 2CCGA 2BGGA 4X92A 1N78A 4URUR 3QUCA 5DTEA 3SYTA 3T8YA 2BSQA 2FOIA 2G7ZA 2A0YA 2H4FA 3DS3A 4YS6A 2CLIB 2R2GA 3TIIA 2X15A 5ERXA 1N34B 5FI3A 4R68A 3U3ZA 2H4WA 4D8WA 4KOEC 3BJRA 4P7KA 3KJIA 4B7AA 4PZUA 3KQKA 2D1YA 2FUG6 3R77A 5TPWA 3LA6A 1W59A 3T34A 3GWZA 3PK0A 5CEEA 1WXXA 4BMNA 4Q37A 1Q1QA 2CJYA 2Y77A 2C5BA 1G8YA 4RIIA 4IIJA 3AR7A 3ANLA 1JEDA 2CMFA 4CIXA 4GM0A 5K3FB 3U4QB 3BQMB 3R6LA 1TPZA 1AKWA 4CT0A 4DLVA 3G5UA 3JARA 1WSBA 4H27A 1RBMA 4XIIA 3PQCA 3C3DA 3CLHA 5J43A 2GLTA 2GZHA 1GKKA 1OIXA 4I9GA 3S1AB 3ZBTA 4LHSA 3H6KA 3G02A 1SCIA 1DGQA 5D3KA 2R5FA 1CUGA 1Z37A 2PXHA 4RBNA 3O73A 2GR9A 1KY3A 4LZPA 5JDIA 5EMNA 4HN9A 4CODB 5AXAA 2FQ0A 3FOWA 4NCKA 1CS0A 4E5YA 3P9ZA 1IHYA 1DQZA 1FPMA 1E9CA 3AYXB 3BICA 5FNZA 4ZQFA 1R5OA 5EE3A 5ETJA 3PQDA 4GPBA 2FI1A 2PGDA 2PBFA 2XQJA 3M3HA 1F48A 1KBOA 5LYJA 3AIKA 3IHKA 2W6ZA 5BN3A 1QIGA 2GCIA 3ZDDA 1YL6A 1C30A 2QT1A 2XGOA 1MIHA 4BJHB 2PIAA 3KV1A 5JS7A 4DRZA 1RZUA 3KEMA 4AMZA 4MZDA 2C8JA 3R7WB 3N6XA 5FADA 5BSHA 1UK9A 3TLZA 2OILA 3UHPA 3KK0A 1U1CA 5FL3A 5KNBA 5JY6A 1U9YA 2JCVA 1FXSA 1D5WA 4YFYA 1F3LA 4GOMD 1YGYA 3JAKB 1XEXB 2R9VA 1KFBB 2V8BA 3MCUA 1LU9A 1GZ4A 2W2KA 4R2JA 4FT4A 2P69A 1AN9A 1JSZA 5IBQA 5LZ8A 4DAEA 3WGOA 1N2CB 1QKKA 1Z3IX 2PS1A 1GRNA 2E5FA 3KYJB 3MGKA 2W8BB 1OLUB 1VE3A 3HXOA 4AF6A 2R2AA 3TKLA 1G20A 3CUTA 4GOXA 4CTJA 4JLNA 5BQ3A 1F0YA 4L9RA 3EHEA 1M1UA 3EWIA 4P32A 4WVLA 4JI4C 2O2YA 1YC5A 2ZBPA 3FGOA 2OFOA 2D1RA 4CMJA 1AXRA 3KQLA 4ZRMA 5K1ZA 5AW8A 1ADCA 2GEDA 3D8UA 2IWRA 4I08A 5FD8A 4GVXA 2EF0A 1XLTC 5IXSA 4U7DA 3OJWA 4ZMBA 1W5BA 2D2FA 3I37X 2Q6OA 5E1OA 5FT9A 2Q99A 2FLWA 4YUYA 1NVUQ 5JH7B 2DE0X 3H2IA 4EKYA 3FA2A 3VQTA 3L9XA 1BXGA 4UTXA 3PQ5A 1H2EA 2QLTA 3TBFA 2FMIA 3PGKA 3ZK8A 5DYWA 3MJFA 4TTRA 2LRHA 2P5SA 2TS1A 4Y2TA 3H17A 2C8LA 5T67A 1E0AA 4ZK2A 5LMCA 2I4OA 4BFSA 4O4JF 3ZE2B 3DVAB 3GU3A 5GVRA 3OIFA 4M1QA 1I0IA 1E6JP 3I6YA 4FNGA 5D86A 1K2VN 1ODCA 2V6JA 3I05A 2OSVA 4BVGA 1JDUA 4RCZA 2X5XA 1CUBA 3WB2A 1VLHA 4JLSA 3L7NA 4XUCA 2W2LA 3EEIA 2KZFA 4HZUB 1KIFA 1W7AA 4RMIA 5CCEA 1MLDA 3FLMA 4E08A 4IDFA 4AC9A 1KVUA 3I9LA 3ZV4A 4DLRA 3O95A 1OH8A 1HETA 4FYPA 1Z4OA 4POAA 1EK1A 5ITSA 3TD2A 1ZIOA 3A6JA 5H16A 1G8SA 4I5EA 1T9DA 4HNUA 1WQ4A 1DXQA 3CN7A 4W1QA 4M8KA 1MO2A 3EK2A 4FNAA 3BCUA 3GRKA 4UTNA 1BGWA 3AF2A 1XTZA 3PHIA 4X45A 3RQIA 1PS8A 1ORIA 4EF5A 2NTEA 3RJ5A 3LMKA 2AI2A 2PNFA 3U6KA 3D3WA 5CH8A 3W3AH 2NSDA 2VPPA 1INLA 2ODEA 3OLZA 3PHHA 3EH1A 3KWJA 3WIVA 1OBCA 4H4CA 1HMYA 3OMXA 1MP0A 1XQWA 4C2UA 4WKBA 2J0VA 2ATWA 1AA9A 3BE8A 4BVJA 3G28A 2XHEA 2UU9C 2G4VA 3TE7A 2CFSA 2O2SA 2P2SA 4K0KB 2ZBGA 3NP7A 3B20A 5ALQA 5J2TB 2HBRA 1HDXA 1PZEA 3MELA 1I3MA 3PEUA 4LI3X 3GRCA 1J99A 5ALYA 3GPDG 3DS2A 1IEWA 2JBGA 3U13A 2YMPA 4WBXC 2VSNA 2VXBA 1E3QA 3N54B 5I47A 4QZVA 1T9AA 4CCSA 4S2EA 4B4WA 5FOVA 3W1EA 4ZOCA 4LI0A 2F9LA 1TKAA 1ZNZA 3H97A 3IAM1 5BSEA 1Q77A 4HGZA 3JZMA 3JALA 1OLSA 4IOKA 3B2QA 3TRIA 4KGZA 1GUBA 1FJGB 2DLCX 3ITDA 5AW9A 4P33A 2SICE 2NAFA 4XOUA 1BDBA 4ZFNA 4YBRA 1B6SA 3L93A 3FKSD 4EM6A 5YASA 1XDZA 1EXDA 3P9IA 3PC6A 3A6DA 3F5MA 1QF6A 1VL6A 4OQEA 2VQFC 5G02A 2QK4A 1CE8B 3DDNA 4XDGA 3AI3A 4Y9SA 2BI4A 3EMDA 4FHDA 1IL0A 2IL1A 4A5OA 5A4MS 3J81D 3HXTA 3P9XA 2FWRA 1HLFA 3QE9Y 1US8A 4Y98A 1T5BA 4F96A 1KYZA 1AUXA 2IU6A 2W0MA 4YCCA 5DSXA 2YWJA 3M1YA 1XCOA 3Q10A 1QGOA 3TI9A 4M0MA 4ES6A 2J0UB 1EFTA 4OJYA 1FP2A 3GLIB 1V2GA 3EVEA 4FYVA 1EP1B 4F5YA 1QH1B 1T9GS 4QX6A 4ZOEA 3IA7A 3QP9A 1GPJA 2ORYA 4WIAA 4OATA 2P2FA 3U7QB 2WJPA 2DUUA 3FMVA 5EP2A 3SHFA 2YRWA 2WHXA 3V7WA 2G3YA 4LC1A 4L8GA 5KCMA 2OENG 2XNHA 1YJQA 5JD4A 3RBVA 5KVQA 1O95D 1PV1A 2VWPA 1UBFA 5K8VA 4YONB 5EJ7A 4Q3CA 2C82A 2P11A 3EASA 1G8JA 4YLYA 2LD4A 4IRMA 2FWNA 1OWPA 3F47A 4C78A 3OU7A 2OV6A 4COOA 4HRVA 2ISCA 1UQRA 2NVWA 2Y92A 4L57A 2BC9A 2QJFA 2POQX 1NXQA 3RW9A 1YOVB 2CB9A 1UBJS 2WJWA 4C7BA 3OZIA 3X44A 1TU3A 2W8ZA 3GUUA 1L5LA 3SZRA 1SM4A 1AGXA 1MDBA 1JF8A 2DKFA 2NO5A 3PXBA 3HGTA 3DTTA 4Y9RA 3EUEA 2AJDA 1LLDA 2XSZA 1OFHA 4NSNA 4FYKA 5KTNA 4D4JA 4FX5A 5TJ9A 3E15A 3WLMA 4JWTA 2EWMA 3DEYX 3EFOA 4URXR 1G2QA 3EMKA 1AS3A 4M7OA 2VWQA 2QR3A 3A70A 3Q5GA 2W6MA 1K73Q 4UEQA 2IH2A 1M90Q 4EX6A 2UXBC 1BYIA 1KK1A 5ITVA 4IV0A 4B6RA 2HMVA 4U2CA 2GBIA 1WHTB 5KYXA 1JEYA 4XM2A 4JXJA 2W22A 1MPTA 2WR8A 5EWJB 2JIQA 1R10A 4MGHA 4WFKA 2ILTA 1GARA 3X1MA 1E9EA 5HIMA 2D5AA 4GEKA 1J8MF 2VHVA 5IXJA 3N87A 1B8OA 1Q7RA 4RDHA 3QLJA 5H82A 3IVAA 4JSTA 5JE8A 5KQLA 1DKUA 2J6IA 4P7JA 2QZPA 4HTAA 1R0BA 4C6RA 2P1DA 4IGAA 1LY1A 4BC7A 1KTVA 4YCNA 4XR4A 3O1IC 2J6BA 3B6JA 4X7BA 2B0JA 2F4VC 5TX7A 4KBFA 3EIOA 1CQJB 1D1DA 4JYZA 4MRSA 2PSEA 1D4OA 1SXJA 2EJTA 1USWA 2H9YA 1TO2E 2PMDA 4IHJA 1M2GA 2G36A 2H1HA 4C4YA 2C8VA 4HD8A 3V4LA 3C3YA 3GGGA 2RCNA 3C5CA 1CEEA 4LYDA 3AB7A 1V1MA 1YA6A 2VZ0A 3HE3A 3GOQA 1KZGB 1ONOA 2QSYA 2BE9A 1QCYA 7CEIA 3F6CA 9LDTA 3LY8A 5T8SA 2CUKA 3M70A 1E32A 3MLEA 2IYZA 2FR0A 5CVJA 1ZKDA 1QRDA 1PWHA 1HFEL 1XZPA 4ZHQB 2QROA 3LE8A 2C9DA 4ZEWA 3K2IA 4R2HA 3C98A 2AFDA 3MYRA 3FTEA 1H9BA 2I34A 2NU6A 1ZR4A 1LBHA 2PKYX 5C18A 1VQ7P 3GVCA 3K1YA 1P74A 1LNQA 3PD0A 3QF7A 1S2LA 2V3VA 4RHFA 3HJTA 1C4KA 4AQDA 3KVYA 4D1YA 1LJUA 4OUDB 4XAQA 1NY6A 2ECQA 3ZCXA 5HVCA 2A88A 1VMKA 2Q6LA 3DL0A 5JTUA 3R9KA 1FYDA 4ALMA 5IAKA 4L15A 4W5JA 4CL3A 2XQFA 1MB0A 2NUPA 7YASA 1G291 4C43A 4KXFB 2V3WA 1U1GA 1GSAA 2ACWA 1HKUA 2P1ZA 5FNVF 1WR8A 2BEWA 1WPXA 1BXZA 2CNDA 3VKHA 4BBAA 3Q85A 4KVAA 3VRHA 3LBHA 4NLLA 2WSSD 4LWPA 2PH3A 4CLRA 2ONJA 1VA5A 5AI0A 2X3FA 4MQ4A 1RP1A 2HJRA 4Q15A 4L50A 1POXA 4YRMA 3TSAA 4QEKA 5HRCA 3ZHQA 4G4IA 2P67A 2CDBA 2ID4A 3GFPA 4MEJA 4WV3A 5BWOA 3MUEA 3ZGOA 1X1RA 5BNZA 1NXTA 5CB4F 5C2JB 1EVZA 1VB3A 4M53A 4DQKA 4EPVA 1NUAA 3UJ6A 5AI5A 4RVNA 2IYWA 1XQXA 4XD7A 1P8JA 2IP4A 3AR9A 4WXEA 1WDTA 2HWYA 4FD3A 5DNUA 4WYMA 4Y0VA 1MKYA 4HDSA 3IPXA 2PV7A 1C0IA 2REQA 2R5NA 4E7OA 1VQKP 4IL5A 2NACA 4L7VA 1U94A 4NYJR 3WRWA 5G0SA 3UICA 5HGJA 2PUBA 1NYRA 4K1LA 2FRVA 5CXUA 1ORWA 3GLGB 4P4TA 2GN2A 3SJCA 2YIMA 2BFFB 1KARA 3LQKA 3MFYA 1LBEA 4O2AA 3WRYA 4XZ3A 2FEXA 2AIRA 4XEHA 5J1TB 3N7AA 2C7GA 1PWXA 5K09A 2P4HX 4JB0A 4K9RA 1P4JA 2VPQA 2OGWA 5K0SA 2OYSA 1A9XA 3UXEA 4OXRA 3TUZC 3IKVA 2GWRA 4GYKA 4WBSA 4NEHB 2AVNA 4UM5A 5F73A 2PKXA 1D0IA 1JMVA 4YH1A 2FG6C 1WW3A 1SD1A 1I0ZA 3IT0A 1T3GA 3JYPA 1UP6A 2J4DA 2VSOA 1NVMB 1N3YA 3WJAA 4Y6PA 1Y8QA 5ERYA 3NHBA 1H1DA 1L7RA 3KJZA 4DE5A 1RZ3A 5GJCA 2AZXA 3AJRA 4U6NA 5IVPA 2IH4A 4Q93A 1KMHA 3H0KA 1AQYA 1I4LD 1F2UB 2I3ZA 3BH0A 5FUVA 2GEKA 1ZAKA 1D3AA 4J0QA 1F1JA 4Q3NA 4GXRA 1EAMA 3EIQA 2O8CB 2EIHA 4Q7JB 3CPSA 2QMEA 1GXSB 1A88A 5JCOC 5CXQA 4R71A 5KHLB 2F3TA 1XQ1A 4GX0A 1JIUA 1WUIS 5FPYA 1WMEA 5ELMA 1KFEB 3ONNA 2NPFA 1UBGA 3I2HA 1IQRA 3HA3A 1NBEA 2RBGA 3DHEA 4UCFA 3H2KA 3CCFA 3LUHA 2VDOB 3EVFA 3GDFA 4UKDA 3NH9A 3LT5A 4RSHA 5LQSA 1J00A 1GQ2A 2DSNA 5IK2A 4H3HB 1Y4ZA 3K5HA 1NVAA 2A9JA 2Z6UA 2L4BA 4O4IB 2NLOA 2HUPA 2R62A 4U02A 4N47A 4CLXA 4XYLA 1Y1KE 2O3QA 2HMTA 2VNSA 1M72A 5C34B 4HLQB 1W8IA 4X62C 1LPPA 1IQ0A 3ND6A 4OGGA 3QU2A 1ZNWA 1ORTA 4NPCA 1PR1A 1V4NA 4GBED 1CIJA 4B6QA 1RTKA 4YMSA 4Z4EA 3TTVA 3IV7A 2GM5A 3U9SA 3OFVA 3QQPA 1ZD8A 4ZARA 2V7EA 5CGZA 3CUSA 5TVGA 4DCVA 1N7IA 1X8KA 1XE3A 4F6CA 2MSDB 1T8YA 4ZC8A 5DN6D 5IJ0A 2DH6A 4F71A 4G8DA 3DE5X 2GCNA 3K0KA 2PV0A 5KU7A 2BVNA 1I8TA 3DV0A 3IXMA 4YX9A 1GJRA 2Q1SA 3OT4A 1CY2A 1NT4A 2RH4A 1IYZA 4TL8A 2VTEA 1TO6A 4DIUA 4XYGA 5FL7D 4HYQA 1AMNA 1T8WA 2F62A 3R7LA 3RYIA 4HJRA 3NXKA 3RJTA 3LX6A 2HPAA 2QVZX 3U4DA 1VIMA 4MUHA 3T3NA 3F2VA 4CM6A 5CA1B 4ARCA 2CXRA 4F3CA 1D8TA 3KIPA 1ISGA 1M6VB 5ALWA 3QKUA 4KX5A 2A14A 5BQPA 2DR2A 1GCUA 5ESDA 1NI4B 1UKEA 1ADGA 3O8LA 3VMMA 4LFBB 2MOKA 3H4IA 2FN7A 3GRVA 2IGTA 3DDZX 2IZZA 5BR7A 2F8TA 3G3EA 5EUCA 4ZZ3A 2AMLA 3O0TA 4L4RA 2B4TO 3UJBA 3VX4A 1PLJA 2PVCA 4G23A 1QVGO 4I55F 3SZUA 4DAOA 2YWEA 2FG5A 3S99A 1HT0A 4TRJA 3QEBZ 2WSMA 1CJSA 1I24A 4F5EA 1N2IA 3DTJA 3EDOA 1UXGA 3VHLB 1T2UA 3AY3A 4AFNA 5C81A 3V1YA 5IT4A 1ONSA 4MJ7A 2FFHA 3DBLB 3KOXA 3RFUA 4JUAA 4L0DA 2X23A 1BHJA 1E60A 1X38A 1PGNA 2I65A 2GERA 4M8SA 3FR8A 4R51A 5LMUC 2LKDA 4Q21A 1NJ2A 5KBYA 1R0WA 2B3DA 2IIVA 1VE9A 3SBOA 3HJUA 4BNDA 5IWCA 4C4RA 2M8LA 3MF4A 2WHRA 1LRJA 2JLBA 3SBEA 3ZEAA 1DC4A 4Q4JB 1TW2A 3CMAP 3A10A 3B7GA 2QKYA 3WKCA 1XYVA 4BFTA 4LJSA 4NE9A 4BX0A 4D4LA 3GEEA 3B3FA 2MYUA 1L4NA 4RULA 2OT3B 5JT1A 4FFWA 5CNJA 1LVHA 2ZYWX 3LUJA 3CCBA 4GI2A 1Y3CE 1EVQA 1ZKMA 5JXHA 4HP8A 1R6AA 3LHSA 4BFCA 4PQFA 4Z8YA 2P6NA 4PHGA 1K4MA 3MGEA 4DV2B 5JCPA 5BMVB 3WK5A 1CUUA 1NF3A 4M0KA 2H54A 2ONTA 1W0KA 4DBVO 1UBNA 9GPBA 4F3RA 3FWYA 3L1VA 5ES3A 3NBYC 1UEJA 2H0QA 1X80A 2K0XA 2PM8A 3PGVA 1JLRA 1BVYF 4HDCA 3U3MA 1BQ4A 4FE4A 5AK6A 2ZSAA 3DEAA 1E96A 4LFCB 4JP5A 1E7SA 3KYBA 1YVRA 2XDQB 2IEAA 1ODTC 5DX1A 2NADA 3EJWA 4UEKA 2ORED 4C7MA 4CMBA 4N6GA 1J1UA 7AT1A 1II9A 1EFAA 4JY7A 3ZV6A 1NZJA 4HPJB 4DUPA 3WNBA 3HG7A 4OFZA 1QVVA 3GMIA 3A04A 4C4ZA 4P35A 3QFTA 2N47A 2I76A 1JN0A 2DBRA 2ZQ5A 3LP6A 1E9FA 1BW9A 3ODGA 3IYLW 4N76A 2WD7A 3GCZA 2IDJA 4BNTA 4DV1C 4DDUA 1U2TA 3Q3VA 3O03A 5EKDA 2Z56A 3KJQA 1O6CA 3BSWA 2ERXA 1QG2A 3ZX5A 3Q7IA 5L3ZA 3CLVA 1A3CA 3E8SA 4ZEVA 5DRYA 4M1KA 3DBIA 2C5SA 4DR6C 1OFVA 3DO5A 4ASUD 3ETHA 5L51A 1PUJA 3EX7C 1X19A 3SLRA 1QAMA 5CBPA 4XE5A 2HJWA 3SEQA 1IAVA 4GU5A 3LWBA 5GIPE 4AJKA 5C52B 4MUNA 3NP9A 2V5UA 4BL5A 4Z9BA 2BUAA 3R0IA 1ENOA 3DWIA 2VT6A 1MG0A 5HDQA 5HEKA 2I22A 4QG7A 3EVBA 2X76A 1N25A 3O7MA 2GZ3A 2IOYA 5E2BA 3DT9A 3U4HA 2B25A 4OAQA 2YS6A 4H4DA 5FBVB 4Z2YA 2O1SA 3A1VA 4ZA2A 1HSZA 3P97A 4HDNB 4L0MA 3TGWA 3ECSA 3VYWA 3ELYA 3DS1A 4G1EB 2UXCC 3TH5A 2WYWA 3OOEA 5BYAA 5BSWA 4FN4A 4YYEA 4NG5A 2AFHB 1BX0A 1IRIA 4KHPB 4E07A 3DDHA 4KQXA 2WFAA 4ZJYA 3HGMA 3LBNA 3NEJA 1T6ZA 1P6UA 4DZZA 2RC5A 1S1CA 1YS9A 3QVJA 4W7IA 1XLTA 1OY1A 2YQZA 2IYXA 4ANFA 2QYHA 1QONA 4BLVA 1VP9A 2CEKA 1U6JA 3NBUA 5CA0F 5DBOA 3Q72A 2B37A 3RANA 1Z7BA 5BSVA 4HADA 1MC8A 3OTHA 4IIDA 4CV1A 4JZKA 4TTIA 2QF7A 1B93A 4JVLA 3QX7A 4IP0A 4O2BA 4FFPA 1XDUA 3C15C 2VWHA 1YONA 4RPJA 4XRQA 3C0KA 1MB2A 1OXMA 2ZRIA 4BGUA 1W52X 3COJA 3LUCA 2K2WA 5EHXA 3EG9A 3NDIA 2FPUA 4AZ3B 4BP8A 3GG2A 5I9NA 2NXJA 3VZQA 4DZTA 4OQPA 4LVNA 2NZ8A 4CM8B 2L22A 5LD2C 4JLWA 3B51X 1H2FA 1DJMA 4ZI5A 1YHYA 5ECGC 3IJRA 3VR5H 4DMFA 1XRLA 1IHXA 3FSJX 2RI0A 4F12A 1B1CA 2PZFA 4ND4A 2ZDQA 2BZ1A 2UDPA 4NZOA 1VIVA 5F78A 3CKMA 4UBLA 4NHOA 3F7OA 1YJBA 2IP1A 3OZFA 1DWPA 2GMWA 4NXNC 1E2HA 3HYLA 3MBKA 1JFLA 3UCEA 1WX1A 1YDGA 4PLTA 3IUMA 2HXYA 5K3BA 2O8DA 1E0HA 4S1OA 3IUYA 2W90A 4LF9C 2PZEA 1ZONA 1W73A 3RLFA 4RDXA 1RLUA 3QZUA 4R8VA 3ZQUA 4I2VA 5LMNB 3BOSA 4BS9A 2VP0A 2W6OA 4RVHA 5DHPA 3WBKA 3WXMA 2QSUA 1QZ3A 3GVHA 1GT6A 4EB0A 2RKBA 1PD0A 3HS3A 5EQTA 3RASA 1AE1A 1K8XB 3IILA 3MXOA 1T0JB 3MWEA 1WVGA 1CEXA 2C7BA 1DJNA 3RC7A 5JQGF 4P4UA 3GB9A 3WLQA 2OHFA 2DVMA 2R6FA 1U8ZA 1X1QA 4L3WA 2L9FA 1JIXA 1O6GA 2EGHA 4XQ9A 16PKA 4F21A 2YX1A 4FNMA 3H9JA 4XSGA 3OQJA 4X8OA 1G41A 3EXIB 3MQ4A 3FSEA 3THXB 3NPMA 4J94A 3I53A 4X60A 1O1YA 4YRQA 2FWPA 3R5KA 4ZI7B 4QWMA 3OC0A 3RHSA 2NUAB 3CF4G 4U0KA 2BMVA 1JPUA 4H0NA 2ZCJA 5TJHA 1Z8FA 4C0XA 3P9KA 5C4IA 2IEBA 3S2IA 1UZAA 4G89A 5JNTA 1BD3A 3MT0A 2CJFA 4PS0A 5JBNA 3WGGA 2FPIA 4CUJA 1A7UA 1JR3E 2F48A 4YP0A 4AG3A 3FTDA 1IUNA 4WXYB 5A1TA 1ZD9A 2IUFA 2A94A 4KSCA 2IW1A 1YJAA 4JJ8A 2ZYRA 2RK3A 2ZP1A 4ZZ2A 3IC5A 2WPDD 4EJ0A 4V1CB 1ADYA 4L6CA 5JAPA 5CCXA 1XA0A 4TV9F 4F84A 3HA7A 4FC7A 3L18A 4FZ3A 1X6VA 5BO5A 3AFNA 1PZMA 2OPLA 3WR5A 4A16A 3UUWA 1CB7A 3T4EA 3IOCA 3GJRA 3R6DA 2J8ZA 1XX6A 1TJ4A 5SV2A 2W42A 2FWMX 3JR7A 4XUEA 1TIKA 4P1ZA 4AMGA 5AOVA 4CU2A 1FVXA 4QUIA 3IT3A 1B2RA 2A57A 1UJMA 4JEIA 1DL5A 1SUSA 2VPZA 4EEKA 3AEKA 2EL9A 1MC5A 3L8EA 3R1IA 2RGGA 1B0AA 3UCXA 1Z4IA 5AM3A 4U8GA 1VC2A 2VT7A 3NDJA 2OSBA 4PXYA 4OA8A 2FE1A 1MZ8A 4M0EA 4ZT7A 4B71A 3W6UA 4GNRA 1M1YE 4D92A 4HNAB 3FLAA 4YLEA 5J3JA 3FPFA 1P91A 3AZOA 2WWFA 2AUMA 4ALJA 3ZLUA 1KI7A 3Q3EA 1VL1A 3KAJA 3HZOA 4KPYA 4YWJA 1NIPA 4U2FA 4DR5B 2I4IA 3FYHA 1YDWA 2H11A 3NETA 2PWAA 1Z88A 4MSUA 1GZVA 4G25A 1GNPA 3TZBA 3GXBA 1JDBC 1H5UA 1UXKA 2CV1A 3FFAA 4LNHA 5KNDD 1IBCA 3ZW9A 5LKAA 4QG3A 3HVJA 3NHYA 1X3SA 4OK5A 4ZZIA 2C0PA 3EQ6A 1NW5A 4A8JC 4BUJA 1R5NA 4FC6A 4HQFA 3LQ1A 3X1DA 3SS9X 2IS6A 4P22A 4G0MA 5CMLA 3BWDD 2EQ5A 3DEIA 4DJFC 2KG8A 3M6UA 4Y2SA 3CCEP 2E5LB 2NIPA 2BI7A 3SYKA 1E69A 4BPGA 2GESA 2C96A 4ZP1A 4KDFA 3IKLA 1S2GA 3UPTA 1P77A 2WE8A 1CLEA 5CIWA 3FKJA 3AGPA 3MJRA 5IULC 4LZAA 4WESA 2HX1A 1L7OA 1ZJ6A 1O92A 2JJQA 1EK5A 1X77A 2GZEA 5HRAA 5HKBA 2DTDA 1FTYA 1DEHA 1E8MA 4TSFD 5BT9A 5BW4A 4ISBA 4EL5A 3LYAA 1I2AA 2GZIA 3AC0A 5DYNA 1NG9A 3FKSA 1ZU5A 3OMLA 1YKFA 3ANXA 1SQFA 1G9SA 1UIRA 4EHKA 4A8PA 4JMPA 1ILEA 2HUNA 1O93A 1BA3A 1RRFA 3IO5A 3ZKAA 3J81A 4BVLA 1U2QA 2WHEA 4P83A 3SQWA 2WVJA 5J4LA 1GUYA 2PRSA 1ZX1A 1YC2A 4UDYX 3VPSA 3HCDA 4EVQA 1M74A 1H93A 4ERNA 2IS2A 2GSDA 1J1IA 2CBXA 1JFFB 4IIEA 5B6PA 1QV7A 2WWIA 5JAMA 1TFUA 2JFGA 2FZVA 1DMRA 2JEYA 3CNQS 2YHAA 1SBIA 2O1WA 4LECA 1O94A 1KO8A 4QOSA 3PVZA 3X1KA 4CMEC 4PUIA 2ZEJA 1RLMA 1YTLA 1MZVA 4MAAA 1J9GA 1YR2A 4EX7A 2VKTA 3T1TA 5A02A 1B6TA 3IO3A 4CRWB 1PR6A 1T5IA 4QGSA 4L72A 1FMFA 3GCXA 5JJLA 3A9SA 3X1YA 1NR5A 2DWPA 4YAIA 3CG0A 4P2GA 4TMTA 3JR3A 3P9RA 1AGPA 4U7HA 2YWBA 3V2GA 4DRXB 3LSYA 5CNIA 2BHTA 2QM0A 4YMLA 3DE1X 5JIBA 2PA0A 3N7UA 3D5EA 3ILHA 4HQ6A 4QREA 4B3SC 3M1IA 4Q12A 2UV8A 2B30A 1V5FA 5DX8A 1KI9A 2V9CA 1XHEA 2FPXA 3UMFA 3QLVC 1E58A 2BGTA 5AYVA 2HF8A 1VQ4P 4BEWA 1N92A 3LKZA 2WYOA 1RPJA 1M1NA 4OI0A 1RDFA 1PJ2A 4MP8A 1KI1A 3A7DA 5J23A 1M2FA 1SIBE 3HDTA 2M1XA 3TLEA 1GKLA 3LGXA 2LW7A 1ZOIA 3DTVD 1X92A 3CE6A 1PJRA 2XA9A 4D26A 2LDBA 1R0ZA 4JI8C 1IBRA 5JSQA 3NDPA 4QTZA 5AVYA 1L7DA 2ZLBA 1UAGA 2EFCB 2RBEA 1GAJA 3MINA 3HYNA 3P0EA 2P2ZA 4RK7A 4JI0B 3EIXA 1GRVA 2XUKA 3FPJA 4ZQBA 2GT1A 2D8MA 4MQBA 5FKJA 2W2XA 2FN9A 2ZUEA 1NL3A 4G5FA 5HDBB 3OKFA 3NAQA 3ENNA 3MXTA 2QLLA 4V0OA 2QD4A 1WEHA 4XQ0A 4LEIA 4I1SA 4PG4A 5BT8A 4EUFA 1FYVA 3BL6A 5K8JB 4ZAXA 1ZRHA 4CEIB 4QRIA 2E0GA 5CZXA 1MR3F 2AF4C 4DTIA 3T3EA 3L1IA 1HURA 2DH5A 2JI7A 4ZPXA 2ANCA 4KLRA 4DDWA 2GUGA 1X7YA 1FP4A 3PI6A 1Z6ZA 1OA0A 2I8AA 4EI7A 1HM5A 1N5JA 5A0VA 2Z5FA 3F90A 3PKIA 2PRZA 1EB9A 1NURA 5AXBA 4J1QA 4E2YA 1TTTA 3U2QA 3PHJA 5IZ4A 2G8NA 4IGFA 4DC1A 3ZKWA 1LPOA 3SR4A 1HG0A 2V4ZA 4L85A 5IVHA 1K75A 4PZAA 1VA4A 5HQ3A 2GZAA 4EA8A 5CLHA 4CGZA 3AX6A 3ZCUA 3GKLC 1E4OA 2Q49A 4O08A 3UZUA 2PLNA 1Q57A 3B38A 4QBGB 2C3YA 4MHOA 1BH6A 4Q9LA 1SCUB 1XVAA 5JCOA 5HFNA 2WYHA 1A9TA 3LCVB 3HCOA 4PNPA 2HWUA 1KAHA 1EQAA 3WC4A 4FX2A 4NENB 2OVBA 1CR6A 1XLVA 2YC2C 5EXDA 2JVIA 1HQCA 4WCFC 3ZHUA 2Q1YA 2ZU0C 4QFMA 4P2BA 2OXIA 1K88A 3TMAA 1QUEA 3DF9A 3B36A 1HC7A 5IJAA 4BVEA 3BFKA 1VTKA 4LE2A 4DQUA 3MJVA 2Z2ZA 2KGEA 4JV5B 5AE3A 1MH1A 3HCBA 5DSZA 5BN1A 1Q2UA 2F9MA 4LXHA 4L9AA 4KK4A 4YCBA 4GD3Q 2WSSA 5AVJA 3V8NA 5DYTA 5IYZA 4F7WA 3QXSA 3V97A 1HGXA 3QWAA 2RJOA 4OHZA 5EKTA 2K2QA 3IEPA 2H1RA 3E9EA 4RYDA 3Q87B 4PAGA 2DUMA 4N9WA 1KJQA 3PV0A 3K9LA 3G71P 4FJ0A 4NOKA 3ORSA 1KWGA 5C5IA 1XPRA 2WM9B 4ARBA 4IOLA 2GEUA 5LOVA 3K8ZA 1IIRA 4WJZA 5DK4A 3OIUA 4LJ7A 2OV4A 3HR7A 4FHCA 3SE0A 1K7EB 1PZHA 1J09A 4E5KA 2Q3EA 1ZMXA 4JJAA 1NNUA 1T91A 3UXYA 1JIQA 3W1VA 1F9AA 1EZZA 1ONPA 2VSQA 5CD1A 1X2BA 4P31A 4GZLA 1Y9ZA 3OI7A 4AWAA 4D9EA 2MR7A 3ZQ4A 3JQGA 1YU6A 3HVRA 1DPFA 2PT5A 2JK0A 3F73A 3L8YA 3A4IA 2FPRA 3TQRA 1V1JA 4W8HA 3F1LA 2C2XA 2CW5A 1A5BB 1VGQA 2XCUA 4AWBA 4H6WA 2PUWA 4WN9A 4PLGA 1JWLA 3O8OA 4OD0A 4PZ0A 5HF5A 4WOBA 2QN6A 5AK4A 3SR0A 2X6QA 3IQWA 1UKCA 2PRIA 3TDKA 1UANA 5EJMA 1POWA 1SUAA 1ZUNB 1OUMA 4AJ4A 1T5SA 3KKZA 5LCXA 4CL8A 1MUUA 2H85A 3LRTA 4RD1A 4C76A 2OBYA 2JJ2A 4ZCLA 5KDLA 3PX7A 2JF0A 2XWBF 1B14A 4Q24A 3E9ZA 4P5DA 3E9QA 4N3GA 4U2EA 3QXXA 2B36A 2QAGC 4B31A 2JU2A 3IOBA 4PPNA 3D6JA 1F0KA 2A33A 4V0RA 4YCDA 2EZUA 3RSGA 4YK7A 3VH3A 4W7SA 3LKDA 3FWZA 2C59A 4KXUA 3NXSA 4ZIRB 1G4AE 3EDCA 4QJ5A 3CXRA 3HXQA 2QRPA 3R5HA 3NONA 3WWCA 1DJPA 3SC3A 1YFJA 2I7TA 5E8JA 2W58A 3L92A 4NZPA 3PKZA 4QTUB 3NKLA 4TMVA 4FFBA 1M1XB 5K20A 3AOEC 3B3QA 1JIVA 2KZ0A 2JFHA 2VR1A 4ZRNA 2ZR7A 2FWJA 4P4NA 1U4NA 3C3AA 2G6BA 4DR1B 4JJFA 3AY7A 1RMQA 1IWBB 3IR5A 1SCKA 4F5DA 3I61A 2A9PA 2JZCA 2DFNA 2Q9BA 3WYCA 4LJ9A 1KTIA 2QT9A 1IN8A 3DD5A 3QE4A 3NT4A 4AURA 1PBNA 5E95A 3OQHA 4YHBA 5D1NA 1G7RA 2XE4A 5KYWA 3UOAB 2NTJA 3N9IA 3SX0A 3SVTA 1SVSA 2H2WA 3FFBA 3KXDA 1DO0A 5JISA 2EHDA 3L49A 1ADBA 3K92A 5F9HA 4LGYA 3ICCA 3CVVA 4Z4CA 1EP2B 3OUTA 4EPYA 5IDQA 1XHLA 1OKKD 5H0IA 2VTVA 3OZWA 2AF3C 3OZBA 4L78A 2V6FA 2C9ZA 4LYAA 3MK31 1SHLA 1W29A 2R48A 1XU4A 3SM3A 4MUIA 2PUHA 1UK6A 3WL7A 4UATA 4RGQA 4BGDA 4NBSA 5EIOA 5DHTA 3H75A 1BN7A 3D5QA 3OIGA 2COEA 1XTTA 2O7RA 3D2LA 2ZJ0A 1EHYA 1VLQA 5THKA 3SU8A 4HSEA 5JSYA 1Q0UA 2G40A 3K1TA 5IFLA 3THOA 2X8WA 4YPFA 4KFCA 1THMA 2OP0A 2PXXA 1FP1D 4M54A 2RI6A 4MQEB 4QE3A 3UAXA 4KPUA 5CP8A 1NVVQ 3O4IA 1Z17A 4UM8B 1TO1E 2BZ0A 3CX3A 1JG7A 2VOJA 2D3TA 4D2IA 1HTTA 1RJEA 3K7EA 1MRSA 4B2IA 3KR0A 1G16A 1XTUA 1ISMA 1I7SB 3KQNA 3MRTA 2Q5FA 5D3MB 4PIPA 2XXAB 3NTVA 5HXAA 3T3OA 1KOLA 2ZBEA 5KYUB 1DZ3A 3JU3A 3UWSA 1Q2XA 3P1JA 2E6KA 2AB0A 3TNLA 3FHJA 2VSXA 3SX4A 1QK5A 4Q6WA 4A5SA 4MEAA 1A5ZA 3UK1A 2QG4A 2JIDA 3L8GA 1YK1A 3QY0A 3CEAA 1H2RS 4MWGA 3ZLJA 3QPDA 3N58A 3ONFA 4YDHB 3LAWA 3RAGA 1H6AA 3EDYA 4UOZA 2IVFA 4PG5A 4F92B 1JHZA 4U39A 2Q5CA 1U0HC 3K9GA 4MB0A 2EEPA 1ID8A 3ZBQA 1OMOA 1GDTA 4RTLA 2F1OA 3HJNA 2WYIA 1DOZA 3RFXA 4HAIA 2OQIA 3TTYA 3V1LA 4P54A 2EIAA 4KO4S 4FYWA 2IEDA 3MIZA 4RZHA 4NYIQ 5J2UB 1XD8A 5K85A 1OBHA 4YRJA 3FFWA 2JZNA 1RJDA 1UJ4A 4ARSA 3W5JA 4KHZA 1WVMA 3NWPA 4COPA 4J76A 5D2CA 4DHEA 4R3UC 1VKOA 3PUKA 4JEUA 2FMFA 1DQPA 3G89A 4BKQA 2I6QA 3FPEA 3QPWA 1GL7A 3O90A 1Z56C 1D2HA 3GJTA 1QOQB 1ZUWA 3TPZA 1SBYA 3VYTB 4AXBA 2NYUA 5CDFE 2PH7A 1EMVA 1DBQA 3BKWA 3U1TA 4BIIA 1AO3A 1KEZA 4Q18A 3HDJA 2QXUA 3COPA 2YXBA 1E89A 2B8EA 1Z3CA 5JS2A 3OCJA 1NKVA 4DV0B 1RJ9A 4FDAA 4I4TA 1QDUA 3W8EA 1SHTX 2WM8A 2QTVB 4MPTA 5JDCC 2PZKA 3HUTA 3STWA 2GLUA 3VDXA 3F0TA 1ONBA 2OBXA 5A0TA 4O59O 2G1UA 2OKCA 5FLXD 1KMCA 1W581 2AXQA 5CYPA 3OTOC 1DNPA 1ZM7A 3LHKA 3G6EP 4F9TA 2GEJA 4D8XA 1E2BA 1HT1E 5B7QA 5LPNA 1WV1A 3BX1A 4WLNA 1XRPA 1OH5A 5AUOB 3O6VA 1LVGA 3ZC3A 4I46A 4LS3A 4HX9A 4RK0A 4WLVA 4HAVA 4DMHA 1JEQB 5AI8A 5FP0A 3CZ9A 1OQAA 2QJOA 4OPMA 3RTCA 5LUBA 3VZPA 4N5IX 4BO9A 2JH3A 2PUTA 3V9PA 3B9QA 4M7WA 4Q1AA 3PVSA 1L7XA 1T9HA 4KIGA 1OLXA 1Z2AA 5LN1A 3QPVA 5JNVA 3HFSA 1ZM9A 4KDEA 3B89A 3IQEA 1IXSB 2JGJA 4HT3B 1APBA 4HVTA 1O95C 1CUIA 1AA6A 5K0JA 2AEFA 5JVDA 3K1JA 1ACLA 2ZSDA 1W87A 4MIOA 4JJ6A 4RZSA 1EX1A 3ORRA 5FA8A 1I9CA 3B1KA 1XV5A 2CNKA 5BNWA 3H9BA 2J0QA 4OQDA 2OV2A 1A1VA 4D4GA 4Y6SA 4KAJA 1HOXA 4HGNA 4ZO4A 2OD7A 1DO2A 2IU4A 3S3TA 3EPPA 4PINA 5HS4A 2ID8A 3AI1A 2QTTA 2XDAA 3C3EA 1SQ0A 5F1PA 2QEXP 4LHXA 5I5GA 3DAOA 4YUZA 4DMRA 4E46A 3PQ6A 1EGQA 3WMWA 3G5MA 4XROA 5SYNA 3N8KA 3UMYA 3NHKA 4IGEA 2NZWA 3SDSA 1NQOA 1ZUHA 1PT8A 4L02A 3ENWA 3G0CA 4IG9A 5FV4A 4L5AA 1P1KA 1Q1AA 4GEGA 4JP3A 1YIJP 2GH1A 4QWWA 4OFXA 1QG4A 1QGZA 2F64A 2JJMA 1XMQB 2DBZA 4HXFB 3NHMA 5E6UB 1GPWB 2PMCA 4R1UA 1XKLA 1NNLA 1DCKA 1TUGA 3E3LA 2QTGA 2XZDA 3BMNA 1VPTA 2VRCA 3MWLA 4QSHA 3OX1A 5CPFA 3DLIA 1TIBA 2R65A 4YT5A 4OV6B 4NC9A 4Z5XA 2XZOA 4KWCA 3DD1A 4CFSA 2PY6A 1CSEE 3MCZA 2JU1A 3V1KA 3OPYI 4FFVA 4DYDA 1ZB8A 2E7GA 3F8WA 2AJ8A 4KNWA 1NC1A 1XCGB 1MENA 4NJMB 2ZYVX 1G0NA 1BOFA 3LP8A 3NG1A 1VI5A 1H66A 4EAAA 1OFGA 5TQJA 4URYR 4N5DA 2H1FA 4MICA 1CEQA 1EVKA 2UYGA 1QO0D 5LB4A 3EIFA 1SGWA 3I23A 5TQ2A 1UKYA 3Q9NA 2AV6A 5B30A 1EE2A 2QP4A 4BO8A 2AFIA 1RIFA 3DOCA 2Z2KA 3BK1A 5EHZA 1C50A 2BJOA 5AVSA 4ZV9A 2CMKA 1S8FA 4GKVA 4TTAA 2EGGA 3IP1A 4E12A 1IEXA 4JUIA 4DPKA 3M7IA 1JOSA 4RQTA 2I33A 1Y9DA 4R01A 4ENWA 2XVZA 2IXAA 3K16A 1KHTA 4Y0AA 1S2OA 2P4UA 4YJGA 4DIEA 2ZJZA 1WCV1 2V6IA 3Q9UA 1K3UB 1Y1TA 3EW9A 5KIAA 2FR8C 2H5JA 4ZVKA 5JOQA 5B3JC 4GT1A 5HGLA 1TM5E 4CZ2A 1L6IA 2W6QA 1RW4A 3DYVA 3K9WA 1E3JA 3HCAA 4IZ6A 4CKEB 1SB9A 4E11A 2IHYA 3T1HB 2JGKA 4ZAYA 4WE3A 1WVIA 1UEXC 1V95A 3PJRA 3UFXB 4MO2A 4RAOA 3Q15C 1II8B 1JL3A 3QU4A 1R15A 3PPIA 3OF5A 2ZJ2A 2ZWPA 4QHTA 3MGBA 3QH4A 4A8JA 3RTAA 4D0SA 1Z7GA 3A6ZA 4QDUA 1LPAB 1P3Y1 2ZR9A 3EQ8A 4NBWA 1SUCA 2GVNA 3NKFA 4HYTA 3R7NA 1M34B 1JG3A 4L9WA 4NNJA 4WOKA 4Q0MA 2C0QA 4H7IA 1TKRA 1YCFA 1GQFA 4U0CA 3HJAA 3B3JA 5DGCA 1I4TD 3VPDA 2W6PA 4JODA 2DNWA 4CDNA 1SCAA 4LC0A 3DHYA 2G28A 3IVMA 2AQ8A 4FLMA 1BKSB 3UJPA 4IYJA 1T9BA 4EY4A 2OG1A 3UW1A 3CCLP 2PWBA 2I6XA 2PUJA 2UUCB 5CZDB 5D3QA 4R05A 4GS5A 1P9LA 2VDUE 2VF2A 2VJKA 1Z5VA 1PHPA 4TZ0A 1FRQA 2DPXA 2FQYA 1U1IA 4EGSA 1LX7A 2J31A 4L7QA 1KDYA 3IL2A 3JVVA 2Q0QA 3HEAA 1RBZA 2VHYA 5T4BA 2I6SA 3TR3A 5K0GA 1MO4A 4HG2A 1VQ6P 1GGEA 4IIXA 4TRRA 1P62B 2F1JA 4JK3A 2BR4A 5I7HA 2WPDA 5CX1A 4LYFA 3LG2A 2O6LA 3ZJYA 1TU0A 1C1YA 4EGJA 2GFIA 3SGLA 4UTOA 3MLAA 1XZKA 4NFYA 4AJEA 1SUWA 2IP2A 4DG9A 1T35A 2CFIA 2HMWA 3QFFA 4BSZA 2H1CA 3I28A 3U26A 2SBTA 3WBHA 3MRVA 3PZBA 5AM1A 5B2ZA 2OQRA 2XMGA 2QRKA 3T4UA 1BX1A 1EVYA 1OTHA 2QB5A 2UUPA 4B8YA 5B58C 3OU6A 4E2XA 4TLDA 2RGXA 4FM9A 4ENPA 2G72A 2C95A 4X44A 2R4TA 4QOFA 1QUFA 2VVTA 2B1GA 3E58A 1V37A 4RS4A 3C7TA 4Q1EA 2QRLA 5JG7A 4G0UA 1ABBA 3QUAA 1DIGA 1DJLA 2P77A 3PFGA 2QRUA 2Z4SA 4HKGA 2GLXA 1EUDB 4HXEB 4V03A 1NU8A 3F6BX 4TV8F 2GZSA 3ZWKA 2JNWA 4EMSA 1TUBB 3DQZA 3II6X 4RIHA 1LLFA 3A11A 2AMYA 2YUIA 2BKVA 3RV3A 1TCCA 1K8ZB 3EA0A 3VJRA 3NX4A 4NZMA 4WNAA 4MV5A 2WUVA 4ENTA 2PX0A 3NTEA 4ZTZB 3QLVA 1WZEA 2W6IA 4Y9TA 3IP6A 3FNQA 2CXOA 1NGSA 1F6WA 5H68A 1JA1A 1XRCA 4EA6A 3WV5A 4OLHA 4KXNA 3BFPA 1FU4A 2RMKA 4ACAA 2ZJ3A 3F8SA 1UJBA 3N0RA 4AQYB 3UT0A 4K7JA 2L2QA 4GL4A 4BP1A 2WD8A 3UJCA 3UA3A 3E7DA 1NP3A 1MRNA 3UWDA 2VYVD 5JZSA 5DFAA 1ZQ1A 2BUBA 2I55A 1YB6A 4P36A 4C0KA 3U44B 4PAOA 3PQFA 3EGWA 1SVIA 3PXAA 3TB4A 4PO8A 3H83A 3G8CA 3RS8A 4CG1A 4P3KA 2CSUA 3BDIA 1FP6A 3MJHA 3VDNB 4DB4A 5A3QA 1O90A 5FB3A 4BMOB 3L6BA 2QUKA 3DXFA 5KINB 2HKIA 1JIIA 1NW8A 3GGOA 3Q7PA 4PLWA 1G3RA 4J29A 1T3ZA 3T15A 2J07A 3AHDA 3D6FA 5TB5A 3C7KA 3DONA 1CJMA 3LA8A 3RVJA 3QUQA 5E6RA 2H4HA 3PB3A 5AI9A 4ND7A 4R8SA 1DKPA 1UMBB 2P3SA 4PROC 4B2PA 5HKAA 3A2LA 2RHJA 4JQYA 2OEPA 1WL8A 4OVKA 3DMRA 3P9QA 1F51E 1A9PA 4PR3A 5BUSA 3GHHA 2Y9PB 4O4HB 3P0HA 1M7BA 4Q4AA 3ESRA 1GVNB 1ZGCA 3DFFA 2JIZD 4YV2A 3PROC 2VXYA 4D98A 1S8AA 5DNDA 1LBTA 4YROA 2JFNA 4XFXA 5BOSB 4MHSA 3MCWA 1VE1A 3ZXUB 4GP6A 4ZV7A 3QVTA 2ZYAA 1MO5A 2I62A 2H7YA 1MTZA 3OCVA 1FYEA 2CVQA 2PMFA 3UX2A 1A8HA 3AT1A 1VPEA 4HFMA 1SG9A 4U2KA 1WDKA 3ME5A 1NPYA 4BFYA 2N1BA 4U0JA 4QJIA 1VYTA 3X3HA 4Y2QA 3R6GA 5TMBA 3AERB 3PDWA 4AKHA 4FUQA 2CL0X 1QHYA 4C0WA 1BKDR 1RYFA 1PQ4A 2X58A 3ZHOA 4WCFA 2APJA 4HWOA 1RKQA 4I6EA 4U00A 1KMMA 1THTA 8MHTA 1J5PA 2IHNA 5DXFA 2OUKA 3ZHRA 3FYUB 4J7XA 5ULLA 3QMVA 2CNOA 3IIKA 1EOQA 1X13A 3AWIA 4UW9A 3IUBA 1QQ7A 4B4KA 3U4GA 4C3OB 5BV8A 1OFTA 2C78A 5K51A 3UW3A 3CRNA 4CMIA 5TV2A 3ZVMA 2YYAA 1EX9A 4QVIA 1HUQA 1QLHA 2H31A 3CM0A 5FAKA 1OR5A 3G4SP 4PX5A 1TT5A 4EPWA 2YBEA 3V33A 4OHBA 4Q4HB 2VP9A 3DTVA 3AR8A 5HJEA 1Y7PA 1MN6A 1P7PA 3RUDA 3TCKA 2PX2A 4R1TA 4K0RA 4JUFA 4YTEA 1IDN1 2Z4TA 1G8PA 4B46A 2H1LA 2BFPA 2GPWA 3W34A 4DCPA 3M4JA 4HDKB 3ZH2A 1HQDA 5FWDA 2G1JA 2CK3D 4WEQA 1YRWA 3SXUB 1LVUA 1QSGA 3F98A 3FDJA 3AJEA 5DCYA 5HW0A 1SY7A 1Y6JA 4NXMB 4DSNA 3A31A 4A0FA 2E1RA 1P0CA 5BPHA 3C2QA 4EYSA 3D7KA 3COZA 4NR0A 2PYDA 5ES4B 4LNUB 3EZ9A 3EDQA 3CMEP 1JQBA 1UZUA 2GRJA 1YBMA 2GJ9A 3GEMA 2AG5A 1A95A 3KZCA 4DY6A 1U8AA 5L9AA 3IRVA 2GXUA 1KSHA 1J2YA 1UZLA 3EGXB 2AYYA 1AURA 3GJ8A 3A26A 4NATA 5ELLA 2IHVA 3E82A 1YQXA 4RE6A 3COSA 4MRMB 3KCQA 2IVZA 3TX2A 1UDBA 4DSAA 4DS3A 1W6RA 1P31A 2QQFA 4HNQA 1FLAA 1GR0A 5A7HA 1OH7A 5ENVA 5FH9A 3EAFA 3AETB 3HKEA 1YZVA 2XITA 5CYFA 3GOHA 4E14A 1DAOA 5FHQA 2QAGA 4B7CA 1ZN2A 3W8RA 3KQYA 1UMCA 1SJ9A 3RSLA 4UUQA 2HW8A 4BX2A 3EXEB 4MLZA 3ZHYA 3GNQA 3HCFA 1R3UA 1O7JA 1V16B 4Q4DA 1X86B 1ELOA 2Y76A 1H9AA 4EOGA 5EKUA 5A5EA 2GN8A 5L45A 5DM70 2OXCA 4DFDA 2H5LA 1JG6A 3EQ7A 2C99A 3CZCA 2XDWA 2PUVA 5ANRB 2JLUA 4CEJB 3RU3A 7REQA 5F5NA 3QFSA 3MSXA 2YZ2A 3AOEA 3USES 3FIJA 1TJPB 2QM8A 3AM1A 1G4HA 4R69A 3NGLA 1E2NA 5GINE 4JFRA 4UXHA 2Q3HA 1U4OA 4J49A 3DH0A 5EZQA 3QWFA 4MPDA 3NJRA 2I2CA 5ALKA 1QRRA 3H5AA 4BQFA 5HIJA 3DWGA 1V11B 4EKEA 5LDGA 1P6QA 3I04A 2E4ZA 1H23A 2BRUC 2RSLA 4Y2PA 4ZVMA 4PO1A 2YXEA 1OV6A 4L7IA 1TZ2A 1XF1A 2PXAA 2NSYA 5FYQA 4FDUA 4LJLA 5A6VA 5TGDA 1P7CA 6REQB 3BHIA 3TFOA 5JS8A 3AUAA 2FZWA 3QELB 4M49A 2QW1A 3NY7B 5AT1A 1RLIA 1OX4A 2JAQA 1XKQA 4D79A 4EHFA 3UH0A 2YFQA 2YQ5A 5TT0A 2PWZA 3HBFA 4EQ6B 1M9NA 1OI7A 4JR2A 221PA 3ZU4A 3KPVA 4HVAA 4ZOAA 1ODSA 3SMVA 3K9NA 4UZEA 2Z44A 5CU7A 2CXXA 3LECA 3LT1A 2I4RA 4OJKA 3QENA 4WJLA 3FWKA 4HX2A 1YBFA 5ECDA 3ILVA 3CCSP 3EBOA 3HUEA 3LYHA 1V4BA 4FZ5A 1N6HA 5A04A 1JZQA 4YRDA 3MT9A 1N2HA 4KLAA 4JI1B 2Y1DA 1KYVA 2X8BA 3LLSA 4IDHA 2VP3A 1M1YB 3L8CA 1Q0RA 3WNVA 2OO7A 5DLYA 3WMRA 1E66A 2NAPA 4LF7C 2VPIA 1UT8A 4XW2A 3MTJA 2PUFA 1E98A 4RD6A 4WECA 5KNBH 3PSAA 4YAGA 3CURA 1IK6A 3LUSA 1U8CB 4NOZA 4D8UA 2DUWA 1M2KA 5FOQA 1HFKA 3H5NA 1QYIA 5DGIA 1GUAA 4HPWA 2D0IA 5HR5A 1ZNVA 3COYA 3AEUA 2ZJ4A 4MB6A 2EHTA 4ZZ0A 4DCJA 2N5HA 3TUIC 1GCOA 3MJSA 4JSRA 4JC5A 4HXGA 3T1YC 2RBKA 4HFRA 1FSGA 1JLSA 3I0MA 2J32A 4DIBA 2IYAA 3G88A 4MCIA 5FPKA 3KOYA 1O54A 2D54A 1YQTA 2RGCA 2VHCA 1W9MA 4R1PA 4OTZA 5AVXA 1TQ2A 3CUEF 3IDQA 1TLLA 5K0TA 4CQMB 1IHUA 2I67A 2NZ2A 1RU3A 1DC7A 1J8VA 5AW1A 1U3CA 4MLCA 4TWIA 2C92A 1HFJA 3DOFA 4ZEOA 4MA5A 4Q3LA 2ZIVB 2FX3A 5GZ1A 5ISMA 4EYGA 3DCJA 2IYLD 3G8BA 3EZYA 2CNRA 3ZS9A 1V71A 5LFAA 1Q15A 3IE2A 2O0JA 2PX3A 3A0UA 2XKJE 3MJCA 3TQCA 3KM0A 1GA6A 3VU8A 1YE5A 4EZBA 4M1TA 5HOQA 1RAFA 3EEOA 4ETMA 4CI0B 4TZ6A 4HAUA 1DRJA 2WT4A 5JALA 4QTYA 3GR1A 3E5NA 3K8YA 1MH9A 3DKRA 5JDCA 3WQSB 1OKKA 1V1RA 4QLBA 1NI5A 1SUPA 2O3SA 1LDGA 3PRKE 4II7A 3ZU3A 5HP4A 2H4YA 3DL4A 2Z9CA 5M29A 3AP2A 5CFQA 3L0DA 3MT8A 5EXPA 3TW6A 5A4AA 3L8ZA 1P73A 1T3SA 3KT3A 5CDUA 4N5LA 3PQ3A 3O92A 4H3KB 2V98A 1U65A 5HILA 4KFRA 1CZUA 2A5LA 2WM2A 3FN4A 4UUMA 5F2NA 2I1QA 3OLXA 3JYHA 2OCYC 4F4CA 4PM4A 1UMDA 1B26A 4MRRA 1B0PA 1ZK1A 4QNMA 4BO5A 4XFZA 3KX2A 1LJ8A 1FSSA 4D44A 3FTQA 3AJ8A 3ZZUA 3KZKA 3R0ZA 4IIBA 3C7CB 3N05A 4OXNA 1DBIA 4LQ4A 4PPGA 4V3CA 1TYEB 2A59A 1ENYA 3LS2A 2R8OA 3RC8A 1TQ6A 1O95A 1KNQA 2FWAA 1YZFA 5BNIA 2HJHA 5IG2A 5KCZA 2X0IA 1V35A 4UREA 3SPXA 1IATA 1GZDA 3ZDZB 3JCZA 5K01A 1GAXA 4KR0A 4QOGA 4U7TB 1USGA 3W8DA 3C74A 1PG0A 3PDIB 3SQOA 4MDYA 3RGGA 2AJCA 5EPUA 4Z4HA 2ZTSA 2ENWA 1N2ZA 4QDOA 3EVGA 4NFHA 5A9SB 1QKJA 4V38A 2ATVA 2O7NA 3FOEC 2ZG6A 1GUDA 3A37A 3N2NA 4GPD1 1VQOP 1DV5A 4C4AA 1EJ0A 4LXTA 2VT2A 3FMOB 4V0MA 4NV0A 4A2WA 3VC1A 1J2EA 3AUSA 5TEWA 1NBIA 2HIAA 1GV1A 3T7IA 1E79D 1VCMA 2ATCA 4U8HA 3I9OA 5CLJA 5I9LA 2GQ0A 2OESA 3LK7A 1M8GA 3KJFA 3ZLTA 3W79A 2YZMA 3DDWA 1Z25A 4GBMA 1UPTA 3I58A 3B1FA 4DVGA 4B3MC 3WRXC 1P1IA 4ZCQA 3BFVA 1E4EB 2WWVD 3BWVA 5D5PA 1PR4A 1NVKA 4MJ3A 1FYWA 4DXDA 2JAOA 3DTYA 3HB1A 1DCTA 4NH4A 3OEHD 4KACA 4ZN6A 4CTOA 3KT0A 3H6GA 1W4ZA 2CMDA 1CR4A 3ABSB 2YN4A 2AXPA 3LPAA 4R4JA 2PBRA 1XZQA 1GPDG 5CVUA 3HN6A 2MSWA 1FUUA 2ZS8A 4M8NE 1PAUA 3U3XA 2O8BB 1WU7A 3KTFA 1RVDA 3NRBA 2Q5HA 2H65A 3KE9A 2ZJ8A 1HZJA 1PYOA 2Q2NA 1TRKA 1DRVA 3RNLA 3QJYA 3EXFB 4RTPA 2J7KA 2YWHA 2GKSA 2XMQA 4JC4A 3D43A 5KSPA 3LTNC 2R6R1 1D4FA 3PSHA 3RRNA 3QMMA 3V48A 1FU8A 4MV3A 3N0VA 1VLJA 1H2HA 2Z58A 4W8OA 1Q0SA 3I9FA 1VLZA 4GBJA 1XZFA 1YE8A 2YHIB 1OI2A 3QF4A 3U3KA 1X7ZB 4ZT3A 5L4NA 2HLHA 1QFZA 3L7IA 5K03A 2YXLA 2Z8YM 2JHPA 3JQPA 1OWOA 3S55A 2W70A 1T4BA 3DL7A 4FD2A 4LXQA 4IUYA 2O5RA 4UMDA 5T4FA 3WDSA 5KTYA 1VHWA 4NK4A 3KQQA 1WMSA 5G53C 1RP7A 2C2KA 4TQ9A 3UC5A 4UNSA 1SULA 2YVKA 2FR8A 4EGFA 4CPDA 4BCBA 3HMKA 5JV5A 1Q82Q 1YIAA 3W5CA 2GJ4A 4MQFA 4DEXA 4FDLA 1E1MA 1C9NA 5JROA 2L6EA 4PRYA 4GVPA 4OU4A 1SC4A 1YFKA 3OOHA 3I9MA 2CNBA 2HGSA 2X2PA 3LQQA 3QNMA 3V8RA 1X1EA 2HQOA 3UGKA 1FNNA 2Z1MA 2A0WA 2VZLA 3GARA 2I03A 3HB5X 2F1RA 4Q4CA 5DI3A 4D0LB 5BPFA 3IUQA 3PLAE 4FN5A 2ZQZA 3H8WA 3RIXA 4LTDA 3TMYA 3OP4A 4RK4A 1PFYA 4EHDA 1GNQA 5DK6A 1ZO8A 3ENZA 2I80A 3QWHA 8GPBA 2ZR8A 2Z0MA 1EUCA 3L95X 2ZITA 4CT5A 1SA0B 1QIFA 1T5TA 4J75A 4C7OA 1QIJA 4CV2A 4OQQA 1V47A 5E4JA 1F2VA 3A3YA 2DCUA 4CLDA 5A4JA 1USKA 3KZVA 5C4MA 3LXMA 5J47A 4O5AA 2EKPA 1VG1A 4PQRA 5JSHA 2QTLA 2IYQA 4QPZA 3FDZA 2ZT6A 2F17A 5CEFA 1VQNP 3IGFA 3KTOA