4TPSB

Sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
AMENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Sporulation inhibitor of replication protein SirA
publication title Structure and interactions of the Bacillus subtilis sporulation inhibitor of DNA replication, SirA, with domain I of DnaA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 24
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.180 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4tpsB00
4TPSB 2WP0C 2E0GA
chains in the Genus database with same CATH superfamily
4DG8A 4DR1C 5A19A 2BJOA 2JNVA 4DCSA 2P20A 2MM9A 3A4IA 3C5EA 3VNQA 1QM4A 4PUHA 4LFCC 4DR6C 4JI4C 5AE1A 4B3MC 5BSMA 1WF3A 4IR7A 2NCLA 3H2TA 5A1GA 3PBKA 3A26A 1N2FA 2UUCC 4G1IA 4LF5C 2VQFC 4U5YD 3LNVA 5DV9A 3KXWA 4FTFA 2D1QA 2P2FA 5BSTA 4D56A 2WD9A 1TH5A 4DUYC 2E8FA 4PZPA 4PHTA 2D1RA 4RMNA 4DCUA 1N33C 1XNRC 1USPA 4FUTA 1FUGA 1MXCA 1QWIA 3IPLA 3GR0A 4DR4C 4DCTA 2F4VC 4LF8C 2PROA 3TR3A 1XMOC 2VZEA 2QW0X 3NYQA 2QL8A 4FUQA 1AMUA 3L8CA 2Y27A 2ZM6C 5JRHA 3FCEA 4L2ZA 5BSUA 3CQ1A 2YX1A 4LE5A 1MDBA 3PESA 5BSRA 2P02A 3CJEA 4JI5C 3R9WA 1I94C 4B3SC 3LGXA 3T1YC 4NDNA 1IBKC 1LQLA 1VEHA 4JI6C 4BCAA 5BURA 1XNQC 1V26A 2VSQA 3DHVA 4RLFA 5BUSA 2ATWA 4D57A 3CW8X 1XRCA 4G36A 5AE3A 2CU6A 4ODJA 4EATA 1NY8A 4GS5A 4HPVA 1ZB9A 4DR5C 3GR1A 1JOSA 4ZLPA 4DR3C 1MXAA 3VNSA 1N36C 5E7QA 3NI2A 5IWAC 2QVYX 3RG2A 4K0KC 3UZ0A 5IFIA 4BBYA 5KYTA 3IEUA 4RVNA 4BC9A 4PUIA 4DUZC 4DV2C 1PA4A 4D4IA 4XX2A 1PG3A 5K8FA 2DPLA 1V25A 1MD9A 5LCIA 2Z51A 2KZ0A 4B3RC 4I9FA 4X64C 4RM3A 2OO4A 2MMAB 4R1LA 3S82A 1XHJA 4JYAC 1N32C 1WH9A 3GPCA 4R0MA 1O90A 1J5EC 3J80D 2ZZMA 4WV3A 1IB8A 5H9UA 4K0BA 4R1MA 4DG9A 4GXRA 4DV3C 1T5DX 2JMPA 3L95X 4JI0C 4ZJZA 1HNXC 2YWCA 3LNOA 1YJ7A 3N2QA 1GPMA 4G37A 3T1HC 4KTVA 1HR0C 2D1SA 1UKKA 3JAMD 2YWBA 2YCBA 3SO4A 2BH1X 4RM2A 5LMUC 3O2EA 1IBMC 4LFAC 3G7SA 5K85A 1IBLC 4PUGA 3TUFA 1M6XC 5ADZA 2XR1A 2ASBA 1FLOA 1RG9A 4B3TC 3DAYA 4PROC 4NOZA 4X65C 5CZXA 1L2FA 3GKUA 1K0RA 3A9UA 3AF5A 4WS9A 2P2QA 2D28C 4JI2C 2QVZX 3LAXA 5FLXD 2VQEC 1WCJA 4IZ6A 4TPSB 3RV2A 4RLQA 3VNRA 1M6XA 1XRBA 4YY3C 4DV1C 2HJGA 4GKKC 3N54B 2ONFA 1KKGA 4JI1C 4JI3C 2E7GA 2DYJA 3UOWA 3PROC 2D27A 1T5HX 2Y4NA 3UX2A 5BSVA 1MXBA 4LFBC 5IT9D 3OTOC 1P4EC 4YHHC 1HNZC 4JM1A 3R44A 4MH4A 2UXCC 1P7LA 2P2MA 4GKJC 5AE2A 2E8EA 3IMLA 4OYCA 2OPLB 3B7WA 1VLAA 1XS3A 2AYAA 3UEBA 1O92A 3I08A 4DV6C 4JI7C 5KEIA 2E0GA 3E7XA 1O9TA 3FCCA 3NPDA 2V7BA 5T8SA 4DV0C 2HHHC 1XRAA 2UUAC 1PG4A 3I07A 5LMNC 2M5OA 1P4EA 5A1IA 1XMQC 4I9GA 1MDFA 3DLPX 4DV7C 5BUQA 4DR2C 2MCQA 2Y4OA 4NXNC 2E5LC 3CW9A 5A2QD 3AY0A 2KDNA 3CQ2A 5GTDA 4DV4C 4KTTA 1ML8A 4L7IA 4OXIA 2M5HA 1FJGC 2OBVA 1HH2P 2PN2A 3K6RA 2E8CA 3EQ6A 4NXMC 4MTNA 3CQ3A 3UX3A 2CY1A 1O93A 2UU9C 2P2BA 4D4GA 1LCIA 1PU1A 3ETCA 4LF4C 1N34C 1MKYA 2ZZNA 5BSWA 2UXDC 4BC7A 5BR8C 3ETOA 1EGAA 2QVXX 3TQIA 3A9VA 4LF9C 3EERA 4DCVA 1BA3A 2P2JA 3E7WA 3AF6A 4AQYC 4BSZA 3TDEA 1USPB 1RY2A 4X66C 3A25A 4RVOA 4L4QA 1ULTA 2UXBC 1V60A 4DV5C 4DR7C 1NYEA 2DHMA 5T8TA 2EGTA 4GXQA 4JV5C 4KHPC 4JI8C 5CZVA 1HNWC 2OPLA 1UWDA 4LF7C 3J81D 4OX9C 3IEVA 1ZB8A 2D7VA 4LF6C 5KYVA 2D1TA 2UUBC 3R9XA 2KZFA 4ISBA 2PT7G 3LUSA 2WP0C 4X62C 2CXCA 3NYRA
chains in the Genus database with same CATH topology
4DG8A 4DR1C 5A19A 2BJOA 4DCSA 2P20A 3A4IA 3C5EA 3VNQA 1QM4A 4LFCC 4DR6C 4JI4C 5AE1A 4B3MC 5BSMA 1WF3A 4IR7A 3H2TA 5A1GA 3PBKA 1N2FA 2UUCC 4G1IA 4LF5C 2VQFC 4U5YD 3LNVA 5DV9A 3KXWA 4FTFA 2D1QA 2P2FA 5BSTA 4D56A 2WD9A 4DUYC 2E8FA 4PZPA 4PHTA 2D1RA 4RMNA 4DCUA 1N33C 1XNRC 1USPA 4FUTA 1FUGA 1MXCA 1QWIA 3IPLA 3GR0A 4DR4C 4DCTA 2F4VC 4LF8C 2PROA 1XMOC 2VZEA 2QW0X 3NYQA 2QL8A 4FUQA 1AMUA 3L8CA 2Y27A 2ZM6C 3FCEA 5JRHA 4L2ZA 5BSUA 4LE5A 1MDBA 3PESA 5BSRA 2P02A 3CJEA 4JI5C 3R9WA 1I94C 4B3SC 3LGXA 3T1YC 4NDNA 1IBKC 1LQLA 4JI6C 4BCAA 5BURA 1XNQC 1V26A 2VSQA 3DHVA 4RLFA 5BUSA 2ATWA 4D57A 3CW8X 1XRCA 4G36A 5AE3A 4ODJA 4EATA 4GS5A 4HPVA 1ZB9A 4DR5C 3GR1A 1JOSA 4ZLPA 4DR3C 1MXAA 3VNSA 1N36C 5E7QA 3NI2A 5IWAC 2QVYX 3RG2A 4K0KC 3UZ0A 5IFIA 4BBYA 5KYTA 3IEUA 4RVNA 4BC9A 4DUZC 4DV2C 1PA4A 4D4IA 4XX2A 1PG3A 5K8FA 2DPLA 1V25A 1MD9A 4B3RC 4I9FA 4X64C 4RM3A 2OO4A 4R1LA 3S82A 4JYAC 1N32C 1WH9A 3GPCA 4R0MA 1O90A 1J5EC 3J80D 4WV3A 5H9UA 4K0BA 4R1MA 4DG9A 4GXRA 4DV3C 1T5DX 2JMPA 3L95X 4JI0C 4ZJZA 1HNXC 2YWCA 3N2QA 1YJ7A 1GPMA 4G37A 3T1HC 4KTVA 1HR0C 2D1SA 1UKKA 3JAMD 2YWBA 2YCBA 3SO4A 2BH1X 4RM2A 5LMUC 1IBMC 4LFAC 3G7SA 5K85A 1IBLC 3TUFA 5ADZA 2XR1A 2ASBA 1RG9A 4B3TC 3DAYA 4PROC 4NOZA 4X65C 5CZXA 1L2FA 3GKUA 1K0RA 3A9UA 3AF5A 4WS9A 2P2QA 2D28C 4JI2C 2QVZX 3LAXA 5FLXD 2VQEC 4IZ6A 4TPSB 3RV2A 4RLQA 3VNRA 1XRBA 4YY3C 4DV1C 2HJGA 4GKKC 3N54B 2ONFA 1KKGA 4JI1C 4JI3C 2E7GA 2DYJA 3UOWA 3PROC 2D27A 1T5HX 2Y4NA 5BSVA 1MXBA 4LFBC 5IT9D 3OTOC 4YHHC 1HNZC 4JM1A 3R44A 4MH4A 2UXCC 1P7LA 2P2MA 4GKJC 5AE2A 2E8EA 3IMLA 4OYCA 2OPLB 3B7WA 1VLAA 2AYAA 1O92A 3I08A 4DV6C 4JI7C 5KEIA 2E0GA 3E7XA 1O9TA 3FCCA 3NPDA 2V7BA 5T8SA 4DV0C 2HHHC 1XRAA 2UUAC 1PG4A 3I07A 5LMNC 5A1IA 1XMQC 4I9GA 1MDFA 3DLPX 4DV7C 5BUQA 4DR2C 2Y4OA 4NXNC 2E5LC 3CW9A 5A2QD 5GTDA 4DV4C 4KTTA 1ML8A 4L7IA 4OXIA 1FJGC 2OBVA 1HH2P 2PN2A 2E8CA 3EQ6A 4NXMC 4MTNA 2CY1A 1O93A 2UU9C 2P2BA 4D4GA 1LCIA 3ETCA 4LF4C 1N34C 1MKYA 5BSWA 2UXDC 4BC7A 5BR8C 3ETOA 1EGAA 2QVXX 3TQIA 3A9VA 4LF9C 3EERA 4DCVA 1BA3A 2P2JA 3E7WA 3AF6A 4AQYC 4BSZA 3TDEA 1USPB 1RY2A 4X66C 4RVOA 4L4QA 1ULTA 2UXBC 4DV5C 4DR7C 1NYEA 5T8TA 2EGTA 4GXQA 4JV5C 4KHPC 4JI8C 5CZVA 1HNWC 2OPLA 4LF7C 3J81D 4OX9C 3IEVA 1ZB8A 2D7VA 4LF6C 5KYVA 2D1TA 2UUBC 3R9XA 2KZFA 4ISBA 2PT7G 3LUSA 2WP0C 4X62C 2CXCA 3NYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TPS B;  2WP0 C;  2E0G A; 
#chains in the Genus database with same CATH topology
 4DG8 A;  4DR1 C;  5A19 A;  2BJO A;  2JNV A;  4DCS A;  2P20 A;  2MM9 A;  3A4I A;  3C5E A;  3VNQ A;  1QM4 A;  4PUH A;  4LFC C;  4DR6 C;  4JI4 C;  5AE1 A;  4B3M C;  5BSM A;  1WF3 A;  4IR7 A;  2NCL A;  3H2T A;  5A1G A;  3PBK A;  3A26 A;  1N2F A;  2UUC C;  4G1I A;  4LF5 C;  2VQF C;  4U5Y D;  3LNV A;  5DV9 A;  3KXW A;  4FTF A;  2D1Q A;  2P2F A;  5BST A;  4D56 A;  2WD9 A;  1TH5 A;  4DUY C;  2E8F A;  4PZP A;  4PHT A;  2D1R A;  4RMN A;  4DCU A;  1N33 C;  1XNR C;  1USP A;  4FUT A;  1FUG A;  1MXC A;  1QWI A;  3IPL A;  3GR0 A;  4DR4 C;  4DCT A;  2F4V C;  4LF8 C;  2PRO A;  3TR3 A;  1XMO C;  2VZE A;  2QW0 X;  3NYQ A;  2QL8 A;  4FUQ A;  1AMU A;  3L8C A;  2Y27 A;  2ZM6 C;  5JRH A;  3FCE A;  4L2Z A;  5BSU A;  3CQ1 A;  2YX1 A;  4LE5 A;  1MDB A;  3PES A;  5BSR A;  2P02 A;  3CJE A;  4JI5 C;  3R9W A;  1I94 C;  4B3S C;  3LGX A;  3T1Y C;  4NDN A;  1IBK C;  1LQL A;  1VEH A;  4JI6 C;  4BCA A;  5BUR A;  1XNQ C;  1V26 A;  2VSQ A;  3DHV A;  4RLF A;  5BUS A;  2ATW A;  4D57 A;  3CW8 X;  1XRC A;  4G36 A;  5AE3 A;  2CU6 A;  4ODJ A;  4EAT A;  1NY8 A;  4GS5 A;  4HPV A;  1ZB9 A;  4DR5 C;  3GR1 A;  1JOS A;  4ZLP A;  4DR3 C;  1MXA A;  3VNS A;  1N36 C;  5E7Q A;  3NI2 A;  5IWA C;  2QVY X;  3RG2 A;  4K0K C;  3UZ0 A;  5IFI A;  4BBY A;  5KYT A;  3IEU A;  4RVN A;  4BC9 A;  4PUI A;  4DUZ C;  4DV2 C;  1PA4 A;  4D4I A;  4XX2 A;  1PG3 A;  5K8F A;  2DPL A;  1V25 A;  1MD9 A;  5LCI A;  2Z51 A;  2KZ0 A;  4B3R C;  4I9F A;  4X64 C;  4RM3 A;  2OO4 A;  2MMA B;  4R1L A;  3S82 A;  1XHJ A;  4JYA C;  1N32 C;  1WH9 A;  3GPC A;  4R0M A;  1O90 A;  1J5E C;  3J80 D;  2ZZM A;  4WV3 A;  1IB8 A;  5H9U A;  4K0B A;  4R1M A;  4DG9 A;  4GXR A;  4DV3 C;  1T5D X;  2JMP A;  3L95 X;  4JI0 C;  4ZJZ A;  1HNX C;  2YWC A;  3LNO A;  1YJ7 A;  3N2Q A;  1GPM A;  4G37 A;  3T1H C;  4KTV A;  1HR0 C;  2D1S A;  1UKK A;  3JAM D;  2YWB A;  2YCB A;  3SO4 A;  2BH1 X;  4RM2 A;  5LMU C;  3O2E A;  1IBM C;  4LFA C;  3G7S A;  5K85 A;  1IBL C;  4PUG A;  3TUF A;  1M6X C;  5ADZ A;  2XR1 A;  2ASB A;  1FLO A;  1RG9 A;  4B3T C;  3DAY A;  4PRO C;  4NOZ A;  4X65 C;  5CZX A;  1L2F A;  3GKU A;  1K0R A;  3A9U A;  3AF5 A;  4WS9 A;  2P2Q A;  2D28 C;  4JI2 C;  2QVZ X;  3LAX A;  5FLX D;  2VQE C;  1WCJ A;  4IZ6 A;  4TPS B;  3RV2 A;  4RLQ A;  3VNR A;  1M6X A;  1XRB A;  4YY3 C;  4DV1 C;  2HJG A;  4GKK C;  3N54 B;  2ONF A;  1KKG A;  4JI1 C;  4JI3 C;  2E7G A;  2DYJ A;  3UOW A;  3PRO C;  2D27 A;  1T5H X;  2Y4N A;  3UX2 A;  5BSV A;  1MXB A;  4LFB C;  5IT9 D;  3OTO C;  1P4E C;  4YHH C;  1HNZ C;  4JM1 A;  3R44 A;  4MH4 A;  2UXC C;  1P7L A;  2P2M A;  4GKJ C;  5AE2 A;  2E8E A;  3IML A;  4OYC A;  2OPL B;  3B7W A;  1VLA A;  1XS3 A;  2AYA A;  3UEB A;  1O92 A;  3I08 A;  4DV6 C;  4JI7 C;  5KEI A;  2E0G A;  3E7X A;  1O9T A;  3FCC A;  3NPD A;  2V7B A;  5T8S A;  4DV0 C;  2HHH C;  1XRA A;  2UUA C;  1PG4 A;  3I07 A;  5LMN C;  2M5O A;  1P4E A;  5A1I A;  1XMQ C;  4I9G A;  1MDF A;  3DLP X;  4DV7 C;  5BUQ A;  4DR2 C;  2MCQ A;  2Y4O A;  4NXN C;  2E5L C;  3CW9 A;  5A2Q D;  3AY0 A;  2KDN A;  3CQ2 A;  5GTD A;  4DV4 C;  4KTT A;  1ML8 A;  4L7I A;  4OXI A;  2M5H A;  1FJG C;  2OBV A;  1HH2 P;  2PN2 A;  3K6R A;  2E8C A;  3EQ6 A;  4NXM C;  4MTN A;  3CQ3 A;  3UX3 A;  2CY1 A;  1O93 A;  2UU9 C;  2P2B A;  4D4G A;  1LCI A;  1PU1 A;  3ETC A;  4LF4 C;  1N34 C;  1MKY A;  2ZZN A;  5BSW A;  2UXD C;  4BC7 A;  5BR8 C;  3ETO A;  1EGA A;  2QVX X;  3TQI A;  3A9V A;  4LF9 C;  3EER A;  4DCV A;  1BA3 A;  2P2J A;  3E7W A;  3AF6 A;  4AQY C;  4BSZ A;  3TDE A;  1USP B;  1RY2 A;  4X66 C;  3A25 A;  4RVO A;  4L4Q A;  1ULT A;  2UXB C;  1V60 A;  4DV5 C;  4DR7 C;  1NYE A;  2DHM A;  5T8T A;  2EGT A;  4GXQ A;  4JV5 C;  4KHP C;  4JI8 C;  5CZV A;  1HNW C;  2OPL A;  1UWD A;  4LF7 C;  3J81 D;  4OX9 C;  3IEV A;  1ZB8 A;  2D7V A;  4LF6 C;  5KYV A;  2D1T A;  2UUB C;  3R9X A;  2KZF A;  4ISB A;  2PT7 G;  3LUS A;  2WP0 C;  4X62 C;  2CXC A;  3NYR A; 
#chains in the Genus database with same CATH homology
 4DG8 A;  4DR1 C;  5A19 A;  2BJO A;  4DCS A;  2P20 A;  3A4I A;  3C5E A;  3VNQ A;  1QM4 A;  4LFC C;  4DR6 C;  4JI4 C;  5AE1 A;  4B3M C;  5BSM A;  1WF3 A;  4IR7 A;  3H2T A;  5A1G A;  3PBK A;  1N2F A;  2UUC C;  4G1I A;  4LF5 C;  2VQF C;  4U5Y D;  3LNV A;  5DV9 A;  3KXW A;  4FTF A;  2D1Q A;  2P2F A;  5BST A;  4D56 A;  2WD9 A;  4DUY C;  2E8F A;  4PZP A;  4PHT A;  2D1R A;  4RMN A;  4DCU A;  1N33 C;  1XNR C;  1USP A;  4FUT A;  1FUG A;  1MXC A;  1QWI A;  3IPL A;  3GR0 A;  4DR4 C;  4DCT A;  2F4V C;  4LF8 C;  2PRO A;  1XMO C;  2VZE A;  2QW0 X;  3NYQ A;  2QL8 A;  4FUQ A;  1AMU A;  3L8C A;  2Y27 A;  2ZM6 C;  3FCE A;  5JRH A;  4L2Z A;  5BSU A;  4LE5 A;  1MDB A;  3PES A;  5BSR A;  2P02 A;  3CJE A;  4JI5 C;  3R9W A;  1I94 C;  4B3S C;  3LGX A;  3T1Y C;  4NDN A;  1IBK C;  1LQL A;  4JI6 C;  4BCA A;  5BUR A;  1XNQ C;  1V26 A;  2VSQ A;  3DHV A;  4RLF A;  5BUS A;  2ATW A;  4D57 A;  3CW8 X;  1XRC A;  4G36 A;  5AE3 A;  4ODJ A;  4EAT A;  4GS5 A;  4HPV A;  1ZB9 A;  4DR5 C;  3GR1 A;  1JOS A;  4ZLP A;  4DR3 C;  1MXA A;  3VNS A;  1N36 C;  5E7Q A;  3NI2 A;  5IWA C;  2QVY X;  3RG2 A;  4K0K C;  3UZ0 A;  5IFI A;  4BBY A;  5KYT A;  3IEU A;  4RVN A;  4BC9 A;  4DUZ C;  4DV2 C;  1PA4 A;  4D4I A;  4XX2 A;  1PG3 A;  5K8F A;  2DPL A;  1V25 A;  1MD9 A;  4B3R C;  4I9F A;  4X64 C;  4RM3 A;  2OO4 A;  4R1L A;  3S82 A;  4JYA C;  1N32 C;  1WH9 A;  3GPC A;  4R0M A;  1O90 A;  1J5E C;  3J80 D;  4WV3 A;  5H9U A;  4K0B A;  4R1M A;  4DG9 A;  4GXR A;  4DV3 C;  1T5D X;  2JMP A;  3L95 X;  4JI0 C;  4ZJZ A;  1HNX C;  2YWC A;  3N2Q A;  1YJ7 A;  1GPM A;  4G37 A;  3T1H C;  4KTV A;  1HR0 C;  2D1S A;  1UKK A;  3JAM D;  2YWB A;  2YCB A;  3SO4 A;  2BH1 X;  4RM2 A;  5LMU C;  1IBM C;  4LFA C;  3G7S A;  5K85 A;  1IBL C;  3TUF A;  5ADZ A;  2XR1 A;  2ASB A;  1RG9 A;  4B3T C;  3DAY A;  4PRO C;  4NOZ A;  4X65 C;  5CZX A;  1L2F A;  3GKU A;  1K0R A;  3A9U A;  3AF5 A;  4WS9 A;  2P2Q A;  2D28 C;  4JI2 C;  2QVZ X;  3LAX A;  5FLX D;  2VQE C;  4IZ6 A;  4TPS B;  3RV2 A;  4RLQ A;  3VNR A;  1XRB A;  4YY3 C;  4DV1 C;  2HJG A;  4GKK C;  3N54 B;  2ONF A;  1KKG A;  4JI1 C;  4JI3 C;  2E7G A;  2DYJ A;  3UOW A;  3PRO C;  2D27 A;  1T5H X;  2Y4N A;  5BSV A;  1MXB A;  4LFB C;  5IT9 D;  3OTO C;  4YHH C;  1HNZ C;  4JM1 A;  3R44 A;  4MH4 A;  2UXC C;  1P7L A;  2P2M A;  4GKJ C;  5AE2 A;  2E8E A;  3IML A;  4OYC A;  2OPL B;  3B7W A;  1VLA A;  2AYA A;  1O92 A;  3I08 A;  4DV6 C;  4JI7 C;  5KEI A;  2E0G A;  3E7X A;  1O9T A;  3FCC A;  3NPD A;  2V7B A;  5T8S A;  4DV0 C;  2HHH C;  1XRA A;  2UUA C;  1PG4 A;  3I07 A;  5LMN C;  5A1I A;  1XMQ C;  4I9G A;  1MDF A;  3DLP X;  4DV7 C;  5BUQ A;  4DR2 C;  2Y4O A;  4NXN C;  2E5L C;  3CW9 A;  5A2Q D;  5GTD A;  4DV4 C;  4KTT A;  1ML8 A;  4L7I A;  4OXI A;  1FJG C;  2OBV A;  1HH2 P;  2PN2 A;  2E8C A;  3EQ6 A;  4NXM C;  4MTN A;  2CY1 A;  1O93 A;  2UU9 C;  2P2B A;  4D4G A;  1LCI A;  3ETC A;  4LF4 C;  1N34 C;  1MKY A;  5BSW A;  2UXD C;  4BC7 A;  5BR8 C;  3ETO A;  1EGA A;  2QVX X;  3TQI A;  3A9V A;  4LF9 C;  3EER A;  4DCV A;  1BA3 A;  2P2J A;  3E7W A;  3AF6 A;  4AQY C;  4BSZ A;  3TDE A;  1USP B;  1RY2 A;  4X66 C;  4RVO A;  4L4Q A;  1ULT A;  2UXB C;  4DV5 C;  4DR7 C;  1NYE A;  5T8T A;  2EGT A;  4GXQ A;  4JV5 C;  4KHP C;  4JI8 C;  5CZV A;  1HNW C;  2OPL A;  4LF7 C;  3J81 D;  4OX9 C;  3IEV A;  1ZB8 A;  2D7V A;  4LF6 C;  5KYV A;  2D1T A;  2UUB C;  3R9X A;  2KZF A;  4ISB A;  2PT7 G;  3LUS A;  2WP0 C;  4X62 C;  2CXC A;  3NYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...