4TPSB

Sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
AMENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation inhibitor of replication protein SirA
publication title Structure and interactions of the Bacillus subtilis sporulation inhibitor of DNA replication, SirA, with domain I of DnaA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication
total genus 24
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.180 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4tpsB00
4TPSB 2E0GA 2WP0C
chains in the Genus database with same CATH superfamily
4DR4C 1T5HX 1N2FA 1V60A 3SO4A 5BUQA 2F4VC 2E7GA 4GKKC 4B3MC 1L2FA 3B7WA 2ZM6C 1WH9A 1LQLA 3A25A 3PROC 2ZZNA 2HHHC 1K0RA 3R9WA 4B3SC 1FLOA 4ODJA 2MM9A 4IR7A 1RY2A 3UX2A 5FLXD 2OBVA 3GR0A 5LCIA 1V26A 2UXDC 3CW9A 3K6RA 4K0BA 3I07A 2JMPA 1J5EC 4DCTA 1PG3A 4G36A 3TR3A 2OPLA 5BURA 1WCJA 2BJOA 2E5LC 2ATWA 4JYAC 1O9TA 4GS5A 2E8FA 2D1QA 4DV1C 5CZXA 5LMNC 4DR5C 4I9FA 5GTDA 4OXIA 2BH1X 3J80D 4BC9A 5BSMA 1XNQC 1FUGA 2KZFA 3CW8X 3VNRA 3CQ3A 3PBKA 4LFAC 2YWCA 5ADZA 4JI3C 2P2QA 1IB8A 5DV9A 3H2TA 1O92A 2CY1A 2VQFC 2MCQA 5AE1A 2UUAC 4WV3A 4D4IA 4DV6C 3UOWA 1WF3A 4DV7C 1N36C 4BC7A 5K8FA 4DUZC 5BSRA 1USPA 4IZ6A 2CXCA 4KTTA 4AQYC 3S82A 5KYVA 5A1IA 4NXNC 4X66C 2UUBC 1P4EC 4LF6C 3CQ2A 3R9XA 2OPLB 1VEHA 3AF5A 2Y4OA 2QW0X 4GXRA 1XMQC 1EGAA 4GXQA 5IT9D 4LFBC 2E0GA 3DHVA 4PUGA 3JAMD 1V25A 2P20A 5T8SA 2QVZX 1XRBA 1PU1A 5BSWA 5BSTA 4DR7C 4LF8C 4BSZA 1HH2P 1MXCA 4NXMC 3FCCA 5T8TA 4D56A 4X62C 1XMOC 3LGXA 2PT7G 3GKUA 3PESA 4DCUA 4B3TC 4LE5A 1HR0C 4R1MA 1O90A 2D1TA 2D7VA 5AE2A 2VQEC 4JI7C 1XS3A 4DCVA 2D27A 4LF7C 4JI4C 1IBLC 3C5EA 1ULTA 1PA4A 2UU9C 3IEUA 1USPB 2QVYX 1IBKC 4RVOA 2HJGA 1BA3A 4L7IA 4PUIA 2VSQA 1AMUA 1UKKA 3AF6A 3J81D 4L4QA 2UXBC 3FCEA 4U5YD 3ETCA 3RV2A 1GPMA 4JI2C 4DV0C 1NYEA 1MXBA 3N2QA 4EATA 4WS9A 4NDNA 2V7BA 5K85A 1YJ7A 3A26A 5BR8C 2P2MA 2CU6A 4GKJC 4DG9A 2M5OA 3NPDA 1P7LA 1IBMC 1PG4A 3EERA 4FUTA 5H9UA 4K0KC 2M5HA 3RG2A 2DHMA 4X65C 4JM1A 4DV4C 2Z51A 2NCLA 1QM4A 4LF4C 1P4EA 4FTFA 4I9GA 3IPLA 3TDEA 3EQ6A 3I08A 4D4GA 1XNRC 2YWBA 1I94C 2QVXX 2D1SA 5BUSA 2OO4A 2PROA 3GR1A 4JI1C 4YHHC 3R44A 4PHTA 4DCSA 5KEIA 3VNQA 4R0MA 3IMLA 2P2JA 4RMNA 4BCAA 4DV3C 1N34C 5IWAC 2DPLA 5A2QD 4RLQA 2JNVA 3L95X 2UUCC 1XRAA 2D28C 3A9VA 1XHJA 1QWIA 3UEBA 4TPSB 4LFCC 4NOZA 2WP0C 1M6XC 1MKYA 4DR1C 4JV5C 4ZJZA 4G37A 3A4IA 1JOSA 4RM2A 3IEVA 1MD9A 2P02A 2KDNA 4KTVA 1KKGA 4LF9C 2MMAB 3E7XA 4RLFA 2KZ0A 5JRHA 2DYJA 2AYAA 1TH5A 1MXAA 2D1RA 4PROC 3GPCA 5KYTA 3LUSA 4OX9C 1UWDA 3VNSA 5BSUA 3TQIA 4ZLPA 2Y27A 2VZEA 4DG8A 4DV5C 3UX3A 4ISBA 2YCBA 4L2ZA 4X64C 1N32C 3NI2A 4KHPC 3DAYA 1MDFA 4JI6C 1ML8A 4DR3C 1ZB8A 3LAXA 3T1HC 5E7QA 5IFIA 4MTNA 1VLAA 4B3RC 3TUFA 5A19A 1HNZC 4DUYC 3OTOC 3NYQA 3UZ0A 1XRCA 2E8EA 2YX1A 4JI0C 2UXCC 3N54B 5BSVA 3LNVA 4BBYA 1NY8A 4JI8C 2ONFA 4LF5C 4DV2C 3CJEA 3G7SA 5AE3A 2QL8A 1HNXC 3KXWA 2E8CA 2PN2A 3A9UA 3NYRA 1N33C 1M6XA 2ASBA 2EGTA 2XR1A 1RG9A 4PZPA 4PUHA 4YY3C 1FJGC 1O93A 1HNWC 3AY0A 5A1GA 4HPVA 1LCIA 2WD9A 3LNOA 5LMUC 3DLPX 5CZVA 4OYCA 4XX2A 3CQ1A 3L8CA 4D57A 2Y4NA 4RM3A 4DR2C 2P2FA 4R1LA 2ZZMA 3ETOA 4RVNA 3T1YC 4MH4A 3O2EA 4G1IA 1ZB9A 1T5DX 4JI5C 2P2BA 4DR6C 3E7WA 1MDBA 4FUQA
chains in the Genus database with same CATH topology
4DR4C 1T5HX 1N2FA 3SO4A 5BUQA 2F4VC 2E7GA 4GKKC 4B3MC 1L2FA 3B7WA 2ZM6C 1WH9A 1LQLA 3PROC 2HHHC 1K0RA 3R9WA 4B3SC 4ODJA 4IR7A 1RY2A 5FLXD 2OBVA 3GR0A 1V26A 2UXDC 3CW9A 4K0BA 3I07A 2JMPA 1J5EC 4DCTA 1PG3A 4G36A 2OPLA 5BURA 2BJOA 2E5LC 2ATWA 4JYAC 1O9TA 4GS5A 2E8FA 2D1QA 4DV1C 5CZXA 5LMNC 4DR5C 4I9FA 5GTDA 4OXIA 2BH1X 3J80D 4BC9A 5BSMA 1XNQC 1FUGA 2KZFA 3CW8X 3VNRA 3PBKA 4LFAC 2YWCA 5ADZA 4JI3C 2P2QA 5DV9A 3H2TA 1O92A 2CY1A 2VQFC 5AE1A 2UUAC 4WV3A 4D4IA 4DV6C 3UOWA 1WF3A 4DV7C 1N36C 4BC7A 5K8FA 4DUZC 5BSRA 1USPA 4IZ6A 2CXCA 4KTTA 4AQYC 3S82A 5KYVA 5A1IA 4NXNC 4X66C 2UUBC 4LF6C 3R9XA 2OPLB 3AF5A 2Y4OA 2QW0X 4GXRA 1XMQC 1EGAA 4GXQA 5IT9D 4LFBC 2E0GA 3DHVA 3JAMD 1V25A 2P20A 5T8SA 2QVZX 1XRBA 5BSWA 5BSTA 4DR7C 4LF8C 4BSZA 1HH2P 1MXCA 4NXMC 3FCCA 5T8TA 4D56A 4X62C 1XMOC 3LGXA 2PT7G 3GKUA 3PESA 4DCUA 4B3TC 4LE5A 1HR0C 4R1MA 1O90A 2D1TA 2D7VA 5AE2A 2VQEC 4JI7C 4DCVA 2D27A 4LF7C 4JI4C 1IBLC 3C5EA 1ULTA 1PA4A 2UU9C 3IEUA 1USPB 2QVYX 1IBKC 4RVOA 2HJGA 1BA3A 4L7IA 2VSQA 1AMUA 1UKKA 3AF6A 3J81D 4L4QA 2UXBC 3FCEA 4U5YD 3ETCA 3RV2A 1GPMA 4JI2C 4DV0C 1NYEA 1MXBA 3N2QA 4EATA 4WS9A 4NDNA 2V7BA 5K85A 1YJ7A 5BR8C 2P2MA 4GKJC 4DG9A 3NPDA 1P7LA 1IBMC 1PG4A 3EERA 4FUTA 5H9UA 4K0KC 3RG2A 4X65C 4JM1A 4DV4C 1QM4A 4LF4C 4FTFA 4I9GA 3IPLA 3TDEA 3EQ6A 3I08A 4D4GA 1XNRC 2YWBA 1I94C 2QVXX 2D1SA 5BUSA 2OO4A 2PROA 3GR1A 4JI1C 4YHHC 3R44A 4PHTA 4DCSA 5KEIA 3VNQA 4R0MA 3IMLA 2P2JA 4RMNA 4BCAA 4DV3C 1N34C 5IWAC 2DPLA 5A2QD 4RLQA 3L95X 2UUCC 1XRAA 2D28C 3A9VA 1QWIA 4TPSB 4LFCC 4NOZA 2WP0C 1MKYA 4DR1C 4JV5C 4ZJZA 4G37A 3A4IA 1JOSA 4RM2A 3IEVA 1MD9A 2P02A 4KTVA 1KKGA 4LF9C 3E7XA 4RLFA 5JRHA 2DYJA 2AYAA 1MXAA 2D1RA 4PROC 3GPCA 5KYTA 3LUSA 4OX9C 3VNSA 5BSUA 3TQIA 4ZLPA 2Y27A 2VZEA 4DG8A 4DV5C 4ISBA 2YCBA 4L2ZA 4X64C 1N32C 3NI2A 4KHPC 3DAYA 1MDFA 4JI6C 1ML8A 4DR3C 1ZB8A 3LAXA 3T1HC 5E7QA 5IFIA 4MTNA 1VLAA 4B3RC 3TUFA 5A19A 1HNZC 4DUYC 3OTOC 3NYQA 3UZ0A 1XRCA 2E8EA 4JI0C 2UXCC 3N54B 5BSVA 3LNVA 4BBYA 4JI8C 2ONFA 4LF5C 4DV2C 3CJEA 3G7SA 5AE3A 2QL8A 1HNXC 3KXWA 2E8CA 2PN2A 3A9UA 3NYRA 1N33C 2ASBA 2EGTA 2XR1A 1RG9A 4PZPA 4YY3C 1FJGC 1O93A 1HNWC 5A1GA 4HPVA 1LCIA 2WD9A 5LMUC 3DLPX 5CZVA 4OYCA 4XX2A 4D57A 3L8CA 2Y4NA 4RM3A 4DR2C 2P2FA 4R1LA 3ETOA 4RVNA 3T1YC 4MH4A 4G1IA 1ZB9A 1T5DX 4JI5C 2P2BA 4DR6C 3E7WA 1MDBA 4FUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TPS B;  2E0G A;  2WP0 C; 
#chains in the Genus database with same CATH topology
 4DR4 C;  1T5H X;  1N2F A;  1V60 A;  3SO4 A;  5BUQ A;  2F4V C;  2E7G A;  4GKK C;  4B3M C;  1L2F A;  3B7W A;  2ZM6 C;  1WH9 A;  1LQL A;  3A25 A;  3PRO C;  2ZZN A;  2HHH C;  1K0R A;  3R9W A;  4B3S C;  1FLO A;  4ODJ A;  2MM9 A;  4IR7 A;  1RY2 A;  3UX2 A;  5FLX D;  2OBV A;  3GR0 A;  5LCI A;  1V26 A;  2UXD C;  3CW9 A;  3K6R A;  4K0B A;  3I07 A;  2JMP A;  1J5E C;  4DCT A;  1PG3 A;  4G36 A;  3TR3 A;  2OPL A;  5BUR A;  1WCJ A;  2BJO A;  2E5L C;  2ATW A;  4JYA C;  1O9T A;  4GS5 A;  2E8F A;  2D1Q A;  4DV1 C;  5CZX A;  5LMN C;  4DR5 C;  4I9F A;  5GTD A;  4OXI A;  2BH1 X;  3J80 D;  4BC9 A;  5BSM A;  1XNQ C;  1FUG A;  2KZF A;  3CW8 X;  3VNR A;  3CQ3 A;  3PBK A;  4LFA C;  2YWC A;  5ADZ A;  4JI3 C;  2P2Q A;  1IB8 A;  5DV9 A;  3H2T A;  1O92 A;  2CY1 A;  2VQF C;  2MCQ A;  5AE1 A;  2UUA C;  4WV3 A;  4D4I A;  4DV6 C;  3UOW A;  1WF3 A;  4DV7 C;  1N36 C;  4BC7 A;  5K8F A;  4DUZ C;  5BSR A;  1USP A;  4IZ6 A;  2CXC A;  4KTT A;  4AQY C;  3S82 A;  5KYV A;  5A1I A;  4NXN C;  4X66 C;  2UUB C;  1P4E C;  4LF6 C;  3CQ2 A;  3R9X A;  2OPL B;  1VEH A;  3AF5 A;  2Y4O A;  2QW0 X;  4GXR A;  1XMQ C;  1EGA A;  4GXQ A;  5IT9 D;  4LFB C;  2E0G A;  3DHV A;  4PUG A;  3JAM D;  1V25 A;  2P20 A;  5T8S A;  2QVZ X;  1XRB A;  1PU1 A;  5BSW A;  5BST A;  4DR7 C;  4LF8 C;  4BSZ A;  1HH2 P;  1MXC A;  4NXM C;  3FCC A;  5T8T A;  4D56 A;  4X62 C;  1XMO C;  3LGX A;  2PT7 G;  3GKU A;  3PES A;  4DCU A;  4B3T C;  4LE5 A;  1HR0 C;  4R1M A;  1O90 A;  2D1T A;  2D7V A;  5AE2 A;  2VQE C;  4JI7 C;  1XS3 A;  4DCV A;  2D27 A;  4LF7 C;  4JI4 C;  1IBL C;  3C5E A;  1ULT A;  1PA4 A;  2UU9 C;  3IEU A;  1USP B;  2QVY X;  1IBK C;  4RVO A;  2HJG A;  1BA3 A;  4L7I A;  4PUI A;  2VSQ A;  1AMU A;  1UKK A;  3AF6 A;  3J81 D;  4L4Q A;  2UXB C;  3FCE A;  4U5Y D;  3ETC A;  3RV2 A;  1GPM A;  4JI2 C;  4DV0 C;  1NYE A;  1MXB A;  3N2Q A;  4EAT A;  4WS9 A;  4NDN A;  2V7B A;  5K85 A;  1YJ7 A;  3A26 A;  5BR8 C;  2P2M A;  2CU6 A;  4GKJ C;  4DG9 A;  2M5O A;  3NPD A;  1P7L A;  1IBM C;  1PG4 A;  3EER A;  4FUT A;  5H9U A;  4K0K C;  2M5H A;  3RG2 A;  2DHM A;  4X65 C;  4JM1 A;  4DV4 C;  2Z51 A;  2NCL A;  1QM4 A;  4LF4 C;  1P4E A;  4FTF A;  4I9G A;  3IPL A;  3TDE A;  3EQ6 A;  3I08 A;  4D4G A;  1XNR C;  2YWB A;  1I94 C;  2QVX X;  2D1S A;  5BUS A;  2OO4 A;  2PRO A;  3GR1 A;  4JI1 C;  4YHH C;  3R44 A;  4PHT A;  4DCS A;  5KEI A;  3VNQ A;  4R0M A;  3IML A;  2P2J A;  4RMN A;  4BCA A;  4DV3 C;  1N34 C;  5IWA C;  2DPL A;  5A2Q D;  4RLQ A;  2JNV A;  3L95 X;  2UUC C;  1XRA A;  2D28 C;  3A9V A;  1XHJ A;  1QWI A;  3UEB A;  4TPS B;  4LFC C;  4NOZ A;  2WP0 C;  1M6X C;  1MKY A;  4DR1 C;  4JV5 C;  4ZJZ A;  4G37 A;  3A4I A;  1JOS A;  4RM2 A;  3IEV A;  1MD9 A;  2P02 A;  2KDN A;  4KTV A;  1KKG A;  4LF9 C;  2MMA B;  3E7X A;  4RLF A;  2KZ0 A;  5JRH A;  2DYJ A;  2AYA A;  1TH5 A;  1MXA A;  2D1R A;  4PRO C;  3GPC A;  5KYT A;  3LUS A;  4OX9 C;  1UWD A;  3VNS A;  5BSU A;  3TQI A;  4ZLP A;  2Y27 A;  2VZE A;  4DG8 A;  4DV5 C;  3UX3 A;  4ISB A;  2YCB A;  4L2Z A;  4X64 C;  1N32 C;  3NI2 A;  4KHP C;  3DAY A;  1MDF A;  4JI6 C;  1ML8 A;  4DR3 C;  1ZB8 A;  3LAX A;  3T1H C;  5E7Q A;  5IFI A;  4MTN A;  1VLA A;  4B3R C;  3TUF A;  5A19 A;  1HNZ C;  4DUY C;  3OTO C;  3NYQ A;  3UZ0 A;  1XRC A;  2E8E A;  2YX1 A;  4JI0 C;  2UXC C;  3N54 B;  5BSV A;  3LNV A;  4BBY A;  1NY8 A;  4JI8 C;  2ONF A;  4LF5 C;  4DV2 C;  3CJE A;  3G7S A;  5AE3 A;  2QL8 A;  1HNX C;  3KXW A;  2E8C A;  2PN2 A;  3A9U A;  3NYR A;  1N33 C;  1M6X A;  2ASB A;  2EGT A;  2XR1 A;  1RG9 A;  4PZP A;  4PUH A;  4YY3 C;  1FJG C;  1O93 A;  1HNW C;  3AY0 A;  5A1G A;  4HPV A;  1LCI A;  2WD9 A;  3LNO A;  5LMU C;  3DLP X;  5CZV A;  4OYC A;  4XX2 A;  3CQ1 A;  3L8C A;  4D57 A;  2Y4N A;  4RM3 A;  4DR2 C;  2P2F A;  4R1L A;  2ZZM A;  3ETO A;  4RVN A;  3T1Y C;  4MH4 A;  3O2E A;  4G1I A;  1ZB9 A;  1T5D X;  4JI5 C;  2P2B A;  4DR6 C;  3E7W A;  1MDB A;  4FUQ A; 
#chains in the Genus database with same CATH homology
 4DR4 C;  1T5H X;  1N2F A;  3SO4 A;  5BUQ A;  2F4V C;  2E7G A;  4GKK C;  4B3M C;  1L2F A;  3B7W A;  2ZM6 C;  1WH9 A;  1LQL A;  3PRO C;  2HHH C;  1K0R A;  3R9W A;  4B3S C;  4ODJ A;  4IR7 A;  1RY2 A;  5FLX D;  2OBV A;  3GR0 A;  1V26 A;  2UXD C;  3CW9 A;  4K0B A;  3I07 A;  2JMP A;  1J5E C;  4DCT A;  1PG3 A;  4G36 A;  2OPL A;  5BUR A;  2BJO A;  2E5L C;  2ATW A;  4JYA C;  1O9T A;  4GS5 A;  2E8F A;  2D1Q A;  4DV1 C;  5CZX A;  5LMN C;  4DR5 C;  4I9F A;  5GTD A;  4OXI A;  2BH1 X;  3J80 D;  4BC9 A;  5BSM A;  1XNQ C;  1FUG A;  2KZF A;  3CW8 X;  3VNR A;  3PBK A;  4LFA C;  2YWC A;  5ADZ A;  4JI3 C;  2P2Q A;  5DV9 A;  3H2T A;  1O92 A;  2CY1 A;  2VQF C;  5AE1 A;  2UUA C;  4WV3 A;  4D4I A;  4DV6 C;  3UOW A;  1WF3 A;  4DV7 C;  1N36 C;  4BC7 A;  5K8F A;  4DUZ C;  5BSR A;  1USP A;  4IZ6 A;  2CXC A;  4KTT A;  4AQY C;  3S82 A;  5KYV A;  5A1I A;  4NXN C;  4X66 C;  2UUB C;  4LF6 C;  3R9X A;  2OPL B;  3AF5 A;  2Y4O A;  2QW0 X;  4GXR A;  1XMQ C;  1EGA A;  4GXQ A;  5IT9 D;  4LFB C;  2E0G A;  3DHV A;  3JAM D;  1V25 A;  2P20 A;  5T8S A;  2QVZ X;  1XRB A;  5BSW A;  5BST A;  4DR7 C;  4LF8 C;  4BSZ A;  1HH2 P;  1MXC A;  4NXM C;  3FCC A;  5T8T A;  4D56 A;  4X62 C;  1XMO C;  3LGX A;  2PT7 G;  3GKU A;  3PES A;  4DCU A;  4B3T C;  4LE5 A;  1HR0 C;  4R1M A;  1O90 A;  2D1T A;  2D7V A;  5AE2 A;  2VQE C;  4JI7 C;  4DCV A;  2D27 A;  4LF7 C;  4JI4 C;  1IBL C;  3C5E A;  1ULT A;  1PA4 A;  2UU9 C;  3IEU A;  1USP B;  2QVY X;  1IBK C;  4RVO A;  2HJG A;  1BA3 A;  4L7I A;  2VSQ A;  1AMU A;  1UKK A;  3AF6 A;  3J81 D;  4L4Q A;  2UXB C;  3FCE A;  4U5Y D;  3ETC A;  3RV2 A;  1GPM A;  4JI2 C;  4DV0 C;  1NYE A;  1MXB A;  3N2Q A;  4EAT A;  4WS9 A;  4NDN A;  2V7B A;  5K85 A;  1YJ7 A;  5BR8 C;  2P2M A;  4GKJ C;  4DG9 A;  3NPD A;  1P7L A;  1IBM C;  1PG4 A;  3EER A;  4FUT A;  5H9U A;  4K0K C;  3RG2 A;  4X65 C;  4JM1 A;  4DV4 C;  1QM4 A;  4LF4 C;  4FTF A;  4I9G A;  3IPL A;  3TDE A;  3EQ6 A;  3I08 A;  4D4G A;  1XNR C;  2YWB A;  1I94 C;  2QVX X;  2D1S A;  5BUS A;  2OO4 A;  2PRO A;  3GR1 A;  4JI1 C;  4YHH C;  3R44 A;  4PHT A;  4DCS A;  5KEI A;  3VNQ A;  4R0M A;  3IML A;  2P2J A;  4RMN A;  4BCA A;  4DV3 C;  1N34 C;  5IWA C;  2DPL A;  5A2Q D;  4RLQ A;  3L95 X;  2UUC C;  1XRA A;  2D28 C;  3A9V A;  1QWI A;  4TPS B;  4LFC C;  4NOZ A;  2WP0 C;  1MKY A;  4DR1 C;  4JV5 C;  4ZJZ A;  4G37 A;  3A4I A;  1JOS A;  4RM2 A;  3IEV A;  1MD9 A;  2P02 A;  4KTV A;  1KKG A;  4LF9 C;  3E7X A;  4RLF A;  5JRH A;  2DYJ A;  2AYA A;  1MXA A;  2D1R A;  4PRO C;  3GPC A;  5KYT A;  3LUS A;  4OX9 C;  3VNS A;  5BSU A;  3TQI A;  4ZLP A;  2Y27 A;  2VZE A;  4DG8 A;  4DV5 C;  4ISB A;  2YCB A;  4L2Z A;  4X64 C;  1N32 C;  3NI2 A;  4KHP C;  3DAY A;  1MDF A;  4JI6 C;  1ML8 A;  4DR3 C;  1ZB8 A;  3LAX A;  3T1H C;  5E7Q A;  5IFI A;  4MTN A;  1VLA A;  4B3R C;  3TUF A;  5A19 A;  1HNZ C;  4DUY C;  3OTO C;  3NYQ A;  3UZ0 A;  1XRC A;  2E8E A;  4JI0 C;  2UXC C;  3N54 B;  5BSV A;  3LNV A;  4BBY A;  4JI8 C;  2ONF A;  4LF5 C;  4DV2 C;  3CJE A;  3G7S A;  5AE3 A;  2QL8 A;  1HNX C;  3KXW A;  2E8C A;  2PN2 A;  3A9U A;  3NYR A;  1N33 C;  2ASB A;  2EGT A;  2XR1 A;  1RG9 A;  4PZP A;  4YY3 C;  1FJG C;  1O93 A;  1HNW C;  5A1G A;  4HPV A;  1LCI A;  2WD9 A;  5LMU C;  3DLP X;  5CZV A;  4OYC A;  4XX2 A;  4D57 A;  3L8C A;  2Y4N A;  4RM3 A;  4DR2 C;  2P2F A;  4R1L A;  3ETO A;  4RVN A;  3T1Y C;  4MH4 A;  4G1I A;  1ZB9 A;  1T5D X;  4JI5 C;  2P2B A;  4DR6 C;  3E7W A;  1MDB A;  4FUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...