4TPSB

Sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
AMENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation inhibitor of replication protein SirA
publication title Structure and interactions of the Bacillus subtilis sporulation inhibitor of DNA replication, SirA, with domain I of DnaA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication
total genus 24
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.180 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4tpsB00
2E0GA 2WP0C 4TPSB
chains in the Genus database with same CATH superfamily
4FUQA 3TR3A 2MCQA 4PHTA 5ADZA 4LE5A 4GKKC 3AF5A 4BC9A 1PG3A 2QW0X 2E0GA 2E5LC 4I9FA 2KDNA 1UWDA 1XHJA 1T5DX 1KKGA 1IBKC 3R44A 5BURA 4BSZA 3UOWA 1O93A 1V60A 2YCBA 2AYAA 2JMPA 2NCLA 4GXRA 1HH2P 3A25A 3KXWA 4NOZA 4DUZC 4JM1A 4IZ6A 2KZ0A 3LGXA 4RLFA 2ZZMA 3TUFA 4FUTA 2MM9A 4BC7A 2QL8A 4I9GA 4R0MA 4PZPA 4LF9C 5T8SA 3H2TA 2HHHC 4B3SC 2CY1A 3DLPX 1P4EA 3RV2A 4JI4C 1PU1A 4XX2A 5K85A 4D4IA 4DG8A 4DR1C 3CQ3A 3UZ0A 2D1SA 5BSMA 2UUCC 1N36C 3LAXA 3J81D 3K6RA 4DCUA 1I94C 1P4EC 1XS3A 5AE2A 2E8FA 3O2EA 3VNSA 2D28C 2E8CA 1J5EC 3N2QA 3I07A 1N33C 5BUSA 3AF6A 1ZB8A 5BUQA 4GKJC 3FCCA 2OPLA 3LNOA 2UXDC 4KHPC 1VEHA 1XNQC 4B3TC 5FLXD 4TPSB 4DR3C 3GR0A 4KTTA 1ML8A 2CU6A 4MTNA 4DR7C 4HPVA 4DV3C 2Z51A 5IT9D 3ETOA 4GXQA 2OBVA 4KTVA 1RY2A 2YWCA 2UU9C 3AY0A 1MDBA 5A1GA 1FJGC 1ZB9A 2YWBA 3A9UA 4OX9C 3IMLA 1MD9A 4RVOA 1HR0C 1O9TA 4DR2C 3LNVA 2DPLA 3R9XA 2OO4A 4RLQA 3L95X 2WP0C 2YX1A 3ETCA 4JI7C 1M6XA 4LFAC 5AE1A 4RMNA 1PG4A 4OXIA 2ASBA 1MXCA 1VLAA 2DHMA 5LMNC 1GPMA 1USPA 4PUHA 2HJGA 2BH1X 1XNRC 4LF6C 4FTFA 1AMUA 3VNRA 3GR1A 4JYAC 4JI2C 2D27A 2VQEC 2D1RA 1M6XC 4OYCA 3GPCA 3G7SA 4DV6C 3UEBA 3SO4A 1BA3A 4GS5A 4DV5C 3RG2A 3C5EA 1HNWC 4YHHC 2Y4OA 4BBYA 4G1IA 1MDFA 5JRHA 2E8EA 2QVXX 5BSWA 5CZXA 4L7IA 4IR7A 1UKKA 3B7WA 1V25A 1PA4A 5IFIA 3JAMD 4D56A 1ULTA 4RVNA 5BSRA 3R9WA 4LF4C 3CQ2A 1O92A 1HNXC 2D1TA 4WS9A 5H9UA 4X62C 4RM3A 4DCTA 2ATWA 2XR1A 4D4GA 2Y4NA 2KZFA 3DHVA 2VZEA 3PESA 2P20A 5IWAC 3GKUA 3OTOC 5GTDA 1O90A 1RG9A 4X66C 5AE3A 3J80D 4JI3C 3A26A 3UX2A 4JV5C 3VNQA 5KYVA 4L2ZA 4DV2C 1IBLC 3NPDA 2ZZNA 1P7LA 2MMAB 3NI2A 1MXAA 4B3MC 4ZJZA 1LCIA 1V26A 4RM2A 2D1QA 3E7XA 1N2FA 4MH4A 4ISBA 4AQYC 1MKYA 5BSUA 4JI0C 3UX3A 4X65C 4LF7C 4JI8C 4ZLPA 4R1LA 1EGAA 4DR5C 5LMUC 1LQLA 4L4QA 3IEVA 1N34C 4DR4C 3LUSA 1TH5A 1N32C 2P2JA 2DYJA 5A2QD 4LFCC 4PUIA 4DR6C 1HNZC 4NXNC 1WF3A 3T1HC 4DCSA 3TDEA 4JI5C 1IB8A 5A19A 4JI1C 4U5YD 2WD9A 2P2MA 4PUGA 4DV0C 4NDNA 4EATA 3CJEA 4DG9A 1WH9A 2V7BA 4R1MA 5T8TA 1QWIA 4LF8C 4ODJA 3S82A 1XMOC 2CXCA 2M5HA 2P2BA 3T1YC 4NXMC 4K0KC 4D57A 5BR8C 4YY3C 5KEIA 2VSQA 1K0RA 3EQ6A 1IBMC 3DAYA 1XRBA 4G36A 3N54B 3TQIA 5KYTA 1YJ7A 4DUYC 3EERA 3PBKA 1QM4A 2QVYX 4DV4C 4DV7C 2JNVA 4LF5C 2UXCC 2D7VA 3IEUA 1NY8A 3L8CA 5E7QA 3NYQA 1L2FA 2ONFA 2OPLB 2EGTA 1NYEA 1XRCA 3A9VA 5BSVA 2F4VC 2P02A 1FUGA 2P2QA 4WV3A 3NYRA 3A4IA 5BSTA 3CW9A 3CQ1A 2E7GA 5A1IA 2P2FA 2UUAC 4JI6C 4DCVA 2ZM6C 4LFBC 4X64C 1JOSA 3E7WA 2M5OA 1WCJA 3IPLA 2UXBC 2UUBC 2PT7G 2VQFC 3PROC 4B3RC 2PROA 1FLOA 5LCIA 2BJOA 2Y27A 3I08A 4K0BA 5CZVA 1XMQC 4PROC 1XRAA 2QVZX 1USPB 5K8FA 4BCAA 2PN2A 4DV1C 5DV9A 1T5HX 3CW8X 1MXBA 4G37A 3FCEA
chains in the Genus database with same CATH topology
4FUQA 4PHTA 5ADZA 4LE5A 4GKKC 3AF5A 4BC9A 1PG3A 2QW0X 2E0GA 2E5LC 4I9FA 1T5DX 1KKGA 1IBKC 3R44A 5BURA 4BSZA 3UOWA 1O93A 2YCBA 2AYAA 2JMPA 4GXRA 1HH2P 3KXWA 4NOZA 4DUZC 4JM1A 4IZ6A 3LGXA 4RLFA 3TUFA 4FUTA 4BC7A 2QL8A 4I9GA 4R0MA 4PZPA 4LF9C 5T8SA 3H2TA 2HHHC 4B3SC 2CY1A 3DLPX 3RV2A 4JI4C 4XX2A 5K85A 4D4IA 4DG8A 4DR1C 3UZ0A 2D1SA 5BSMA 2UUCC 1N36C 3LAXA 3J81D 4DCUA 1I94C 5AE2A 2E8FA 3VNSA 2D28C 2E8CA 1J5EC 3N2QA 3I07A 1N33C 5BUSA 3AF6A 1ZB8A 5BUQA 4GKJC 3FCCA 2OPLA 2UXDC 4KHPC 1XNQC 4B3TC 5FLXD 4TPSB 4DR3C 3GR0A 4KTTA 1ML8A 4MTNA 4DR7C 4HPVA 4DV3C 5IT9D 3ETOA 4GXQA 2OBVA 4KTVA 1RY2A 2YWCA 2UU9C 1MDBA 5A1GA 1FJGC 1ZB9A 2YWBA 3A9UA 4OX9C 3IMLA 1MD9A 4RVOA 1HR0C 1O9TA 4DR2C 3LNVA 2DPLA 3R9XA 2OO4A 4RLQA 3L95X 2WP0C 3ETCA 4JI7C 4LFAC 5AE1A 4RMNA 1PG4A 4OXIA 2ASBA 1MXCA 1VLAA 5LMNC 1GPMA 1USPA 2HJGA 2BH1X 1XNRC 4LF6C 4FTFA 1AMUA 3VNRA 3GR1A 4JYAC 4JI2C 2D27A 2VQEC 2D1RA 4OYCA 3GPCA 3G7SA 4DV6C 3SO4A 1BA3A 4GS5A 4DV5C 3RG2A 3C5EA 1HNWC 4YHHC 2Y4OA 4BBYA 4G1IA 1MDFA 5JRHA 2E8EA 2QVXX 5BSWA 5CZXA 4L7IA 4IR7A 1UKKA 3B7WA 1V25A 1PA4A 5IFIA 3JAMD 4D56A 1ULTA 4RVNA 5BSRA 3R9WA 4LF4C 1O92A 1HNXC 2D1TA 4WS9A 5H9UA 4X62C 4RM3A 4DCTA 2ATWA 2XR1A 4D4GA 2Y4NA 2KZFA 3DHVA 2VZEA 3PESA 2P20A 5IWAC 3GKUA 3OTOC 5GTDA 1O90A 1RG9A 4X66C 5AE3A 3J80D 4JI3C 4JV5C 3VNQA 5KYVA 4L2ZA 4DV2C 1IBLC 3NPDA 1P7LA 3NI2A 1MXAA 4B3MC 4ZJZA 1LCIA 1V26A 4RM2A 2D1QA 3E7XA 1N2FA 4MH4A 4ISBA 4AQYC 1MKYA 5BSUA 4JI0C 4X65C 4LF7C 4JI8C 4ZLPA 4R1LA 1EGAA 4DR5C 5LMUC 1LQLA 4L4QA 3IEVA 1N34C 4DR4C 3LUSA 1N32C 2P2JA 2DYJA 5A2QD 4LFCC 4DR6C 1HNZC 4NXNC 1WF3A 3T1HC 4DCSA 3TDEA 4JI5C 5A19A 4JI1C 4U5YD 2WD9A 2P2MA 4DV0C 4NDNA 4EATA 3CJEA 4DG9A 1WH9A 2V7BA 4R1MA 5T8TA 1QWIA 4LF8C 4ODJA 3S82A 1XMOC 2CXCA 2P2BA 3T1YC 4NXMC 4K0KC 4D57A 5BR8C 4YY3C 5KEIA 2VSQA 1K0RA 3EQ6A 1IBMC 3DAYA 1XRBA 4G36A 3N54B 3TQIA 5KYTA 1YJ7A 4DUYC 3EERA 3PBKA 1QM4A 2QVYX 4DV4C 4DV7C 4LF5C 2UXCC 2D7VA 3IEUA 3L8CA 5E7QA 3NYQA 1L2FA 2ONFA 2OPLB 2EGTA 1NYEA 1XRCA 3A9VA 5BSVA 2F4VC 2P02A 1FUGA 2P2QA 4WV3A 3NYRA 3A4IA 5BSTA 3CW9A 2E7GA 5A1IA 2P2FA 2UUAC 4JI6C 4DCVA 2ZM6C 4LFBC 4X64C 1JOSA 3E7WA 3IPLA 2UXBC 2UUBC 2PT7G 2VQFC 3PROC 4B3RC 2PROA 2BJOA 2Y27A 3I08A 4K0BA 5CZVA 1XMQC 4PROC 1XRAA 2QVZX 1USPB 5K8FA 4BCAA 4DV1C 2PN2A 5DV9A 1T5HX 3CW8X 1MXBA 4G37A 3FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E0G A;  2WP0 C;  4TPS B; 
#chains in the Genus database with same CATH topology
 4FUQ A;  3TR3 A;  2MCQ A;  4PHT A;  5ADZ A;  4LE5 A;  4GKK C;  3AF5 A;  4BC9 A;  1PG3 A;  2QW0 X;  2E0G A;  2E5L C;  4I9F A;  2KDN A;  1UWD A;  1XHJ A;  1T5D X;  1KKG A;  1IBK C;  3R44 A;  5BUR A;  4BSZ A;  3UOW A;  1O93 A;  1V60 A;  2YCB A;  2AYA A;  2JMP A;  2NCL A;  4GXR A;  1HH2 P;  3A25 A;  3KXW A;  4NOZ A;  4DUZ C;  4JM1 A;  4IZ6 A;  2KZ0 A;  3LGX A;  4RLF A;  2ZZM A;  3TUF A;  4FUT A;  2MM9 A;  4BC7 A;  2QL8 A;  4I9G A;  4R0M A;  4PZP A;  4LF9 C;  5T8S A;  3H2T A;  2HHH C;  4B3S C;  2CY1 A;  3DLP X;  1P4E A;  3RV2 A;  4JI4 C;  1PU1 A;  4XX2 A;  5K85 A;  4D4I A;  4DG8 A;  4DR1 C;  3CQ3 A;  3UZ0 A;  2D1S A;  5BSM A;  2UUC C;  1N36 C;  3LAX A;  3J81 D;  3K6R A;  4DCU A;  1I94 C;  1P4E C;  1XS3 A;  5AE2 A;  2E8F A;  3O2E A;  3VNS A;  2D28 C;  2E8C A;  1J5E C;  3N2Q A;  3I07 A;  1N33 C;  5BUS A;  3AF6 A;  1ZB8 A;  5BUQ A;  4GKJ C;  3FCC A;  2OPL A;  3LNO A;  2UXD C;  4KHP C;  1VEH A;  1XNQ C;  4B3T C;  5FLX D;  4TPS B;  4DR3 C;  3GR0 A;  4KTT A;  1ML8 A;  2CU6 A;  4MTN A;  4DR7 C;  4HPV A;  4DV3 C;  2Z51 A;  5IT9 D;  3ETO A;  4GXQ A;  2OBV A;  4KTV A;  1RY2 A;  2YWC A;  2UU9 C;  3AY0 A;  1MDB A;  5A1G A;  1FJG C;  1ZB9 A;  2YWB A;  3A9U A;  4OX9 C;  3IML A;  1MD9 A;  4RVO A;  1HR0 C;  1O9T A;  4DR2 C;  3LNV A;  2DPL A;  3R9X A;  2OO4 A;  4RLQ A;  3L95 X;  2WP0 C;  2YX1 A;  3ETC A;  4JI7 C;  1M6X A;  4LFA C;  5AE1 A;  4RMN A;  1PG4 A;  4OXI A;  2ASB A;  1MXC A;  1VLA A;  2DHM A;  5LMN C;  1GPM A;  1USP A;  4PUH A;  2HJG A;  2BH1 X;  1XNR C;  4LF6 C;  4FTF A;  1AMU A;  3VNR A;  3GR1 A;  4JYA C;  4JI2 C;  2D27 A;  2VQE C;  2D1R A;  1M6X C;  4OYC A;  3GPC A;  3G7S A;  4DV6 C;  3UEB A;  3SO4 A;  1BA3 A;  4GS5 A;  4DV5 C;  3RG2 A;  3C5E A;  1HNW C;  4YHH C;  2Y4O A;  4BBY A;  4G1I A;  1MDF A;  5JRH A;  2E8E A;  2QVX X;  5BSW A;  5CZX A;  4L7I A;  4IR7 A;  1UKK A;  3B7W A;  1V25 A;  1PA4 A;  5IFI A;  3JAM D;  4D56 A;  1ULT A;  4RVN A;  5BSR A;  3R9W A;  4LF4 C;  3CQ2 A;  1O92 A;  1HNX C;  2D1T A;  4WS9 A;  5H9U A;  4X62 C;  4RM3 A;  4DCT A;  2ATW A;  2XR1 A;  4D4G A;  2Y4N A;  2KZF A;  3DHV A;  2VZE A;  3PES A;  2P20 A;  5IWA C;  3GKU A;  3OTO C;  5GTD A;  1O90 A;  1RG9 A;  4X66 C;  5AE3 A;  3J80 D;  4JI3 C;  3A26 A;  3UX2 A;  4JV5 C;  3VNQ A;  5KYV A;  4L2Z A;  4DV2 C;  1IBL C;  3NPD A;  2ZZN A;  1P7L A;  2MMA B;  3NI2 A;  1MXA A;  4B3M C;  4ZJZ A;  1LCI A;  1V26 A;  4RM2 A;  2D1Q A;  3E7X A;  1N2F A;  4MH4 A;  4ISB A;  4AQY C;  1MKY A;  5BSU A;  4JI0 C;  3UX3 A;  4X65 C;  4LF7 C;  4JI8 C;  4ZLP A;  4R1L A;  1EGA A;  4DR5 C;  5LMU C;  1LQL A;  4L4Q A;  3IEV A;  1N34 C;  4DR4 C;  3LUS A;  1TH5 A;  1N32 C;  2P2J A;  2DYJ A;  5A2Q D;  4LFC C;  4PUI A;  4DR6 C;  1HNZ C;  4NXN C;  1WF3 A;  3T1H C;  4DCS A;  3TDE A;  4JI5 C;  1IB8 A;  5A19 A;  4JI1 C;  4U5Y D;  2WD9 A;  2P2M A;  4PUG A;  4DV0 C;  4NDN A;  4EAT A;  3CJE A;  4DG9 A;  1WH9 A;  2V7B A;  4R1M A;  5T8T A;  1QWI A;  4LF8 C;  4ODJ A;  3S82 A;  1XMO C;  2CXC A;  2M5H A;  2P2B A;  3T1Y C;  4NXM C;  4K0K C;  4D57 A;  5BR8 C;  4YY3 C;  5KEI A;  2VSQ A;  1K0R A;  3EQ6 A;  1IBM C;  3DAY A;  1XRB A;  4G36 A;  3N54 B;  3TQI A;  5KYT A;  1YJ7 A;  4DUY C;  3EER A;  3PBK A;  1QM4 A;  2QVY X;  4DV4 C;  4DV7 C;  2JNV A;  4LF5 C;  2UXC C;  2D7V A;  3IEU A;  1NY8 A;  3L8C A;  5E7Q A;  3NYQ A;  1L2F A;  2ONF A;  2OPL B;  2EGT A;  1NYE A;  1XRC A;  3A9V A;  5BSV A;  2F4V C;  2P02 A;  1FUG A;  2P2Q A;  4WV3 A;  3NYR A;  3A4I A;  5BST A;  3CW9 A;  3CQ1 A;  2E7G A;  5A1I A;  2P2F A;  2UUA C;  4JI6 C;  4DCV A;  2ZM6 C;  4LFB C;  4X64 C;  1JOS A;  3E7W A;  2M5O A;  1WCJ A;  3IPL A;  2UXB C;  2UUB C;  2PT7 G;  2VQF C;  3PRO C;  4B3R C;  2PRO A;  1FLO A;  5LCI A;  2BJO A;  2Y27 A;  3I08 A;  4K0B A;  5CZV A;  1XMQ C;  4PRO C;  1XRA A;  2QVZ X;  1USP B;  5K8F A;  4BCA A;  2PN2 A;  4DV1 C;  5DV9 A;  1T5H X;  3CW8 X;  1MXB A;  4G37 A;  3FCE A; 
#chains in the Genus database with same CATH homology
 4FUQ A;  4PHT A;  5ADZ A;  4LE5 A;  4GKK C;  3AF5 A;  4BC9 A;  1PG3 A;  2QW0 X;  2E0G A;  2E5L C;  4I9F A;  1T5D X;  1KKG A;  1IBK C;  3R44 A;  5BUR A;  4BSZ A;  3UOW A;  1O93 A;  2YCB A;  2AYA A;  2JMP A;  4GXR A;  1HH2 P;  3KXW A;  4NOZ A;  4DUZ C;  4JM1 A;  4IZ6 A;  3LGX A;  4RLF A;  3TUF A;  4FUT A;  4BC7 A;  2QL8 A;  4I9G A;  4R0M A;  4PZP A;  4LF9 C;  5T8S A;  3H2T A;  2HHH C;  4B3S C;  2CY1 A;  3DLP X;  3RV2 A;  4JI4 C;  4XX2 A;  5K85 A;  4D4I A;  4DG8 A;  4DR1 C;  3UZ0 A;  2D1S A;  5BSM A;  2UUC C;  1N36 C;  3LAX A;  3J81 D;  4DCU A;  1I94 C;  5AE2 A;  2E8F A;  3VNS A;  2D28 C;  2E8C A;  1J5E C;  3N2Q A;  3I07 A;  1N33 C;  5BUS A;  3AF6 A;  1ZB8 A;  5BUQ A;  4GKJ C;  3FCC A;  2OPL A;  2UXD C;  4KHP C;  1XNQ C;  4B3T C;  5FLX D;  4TPS B;  4DR3 C;  3GR0 A;  4KTT A;  1ML8 A;  4MTN A;  4DR7 C;  4HPV A;  4DV3 C;  5IT9 D;  3ETO A;  4GXQ A;  2OBV A;  4KTV A;  1RY2 A;  2YWC A;  2UU9 C;  1MDB A;  5A1G A;  1FJG C;  1ZB9 A;  2YWB A;  3A9U A;  4OX9 C;  3IML A;  1MD9 A;  4RVO A;  1HR0 C;  1O9T A;  4DR2 C;  3LNV A;  2DPL A;  3R9X A;  2OO4 A;  4RLQ A;  3L95 X;  2WP0 C;  3ETC A;  4JI7 C;  4LFA C;  5AE1 A;  4RMN A;  1PG4 A;  4OXI A;  2ASB A;  1MXC A;  1VLA A;  5LMN C;  1GPM A;  1USP A;  2HJG A;  2BH1 X;  1XNR C;  4LF6 C;  4FTF A;  1AMU A;  3VNR A;  3GR1 A;  4JYA C;  4JI2 C;  2D27 A;  2VQE C;  2D1R A;  4OYC A;  3GPC A;  3G7S A;  4DV6 C;  3SO4 A;  1BA3 A;  4GS5 A;  4DV5 C;  3RG2 A;  3C5E A;  1HNW C;  4YHH C;  2Y4O A;  4BBY A;  4G1I A;  1MDF A;  5JRH A;  2E8E A;  2QVX X;  5BSW A;  5CZX A;  4L7I A;  4IR7 A;  1UKK A;  3B7W A;  1V25 A;  1PA4 A;  5IFI A;  3JAM D;  4D56 A;  1ULT A;  4RVN A;  5BSR A;  3R9W A;  4LF4 C;  1O92 A;  1HNX C;  2D1T A;  4WS9 A;  5H9U A;  4X62 C;  4RM3 A;  4DCT A;  2ATW A;  2XR1 A;  4D4G A;  2Y4N A;  2KZF A;  3DHV A;  2VZE A;  3PES A;  2P20 A;  5IWA C;  3GKU A;  3OTO C;  5GTD A;  1O90 A;  1RG9 A;  4X66 C;  5AE3 A;  3J80 D;  4JI3 C;  4JV5 C;  3VNQ A;  5KYV A;  4L2Z A;  4DV2 C;  1IBL C;  3NPD A;  1P7L A;  3NI2 A;  1MXA A;  4B3M C;  4ZJZ A;  1LCI A;  1V26 A;  4RM2 A;  2D1Q A;  3E7X A;  1N2F A;  4MH4 A;  4ISB A;  4AQY C;  1MKY A;  5BSU A;  4JI0 C;  4X65 C;  4LF7 C;  4JI8 C;  4ZLP A;  4R1L A;  1EGA A;  4DR5 C;  5LMU C;  1LQL A;  4L4Q A;  3IEV A;  1N34 C;  4DR4 C;  3LUS A;  1N32 C;  2P2J A;  2DYJ A;  5A2Q D;  4LFC C;  4DR6 C;  1HNZ C;  4NXN C;  1WF3 A;  3T1H C;  4DCS A;  3TDE A;  4JI5 C;  5A19 A;  4JI1 C;  4U5Y D;  2WD9 A;  2P2M A;  4DV0 C;  4NDN A;  4EAT A;  3CJE A;  4DG9 A;  1WH9 A;  2V7B A;  4R1M A;  5T8T A;  1QWI A;  4LF8 C;  4ODJ A;  3S82 A;  1XMO C;  2CXC A;  2P2B A;  3T1Y C;  4NXM C;  4K0K C;  4D57 A;  5BR8 C;  4YY3 C;  5KEI A;  2VSQ A;  1K0R A;  3EQ6 A;  1IBM C;  3DAY A;  1XRB A;  4G36 A;  3N54 B;  3TQI A;  5KYT A;  1YJ7 A;  4DUY C;  3EER A;  3PBK A;  1QM4 A;  2QVY X;  4DV4 C;  4DV7 C;  4LF5 C;  2UXC C;  2D7V A;  3IEU A;  3L8C A;  5E7Q A;  3NYQ A;  1L2F A;  2ONF A;  2OPL B;  2EGT A;  1NYE A;  1XRC A;  3A9V A;  5BSV A;  2F4V C;  2P02 A;  1FUG A;  2P2Q A;  4WV3 A;  3NYR A;  3A4I A;  5BST A;  3CW9 A;  2E7G A;  5A1I A;  2P2F A;  2UUA C;  4JI6 C;  4DCV A;  2ZM6 C;  4LFB C;  4X64 C;  1JOS A;  3E7W A;  3IPL A;  2UXB C;  2UUB C;  2PT7 G;  2VQF C;  3PRO C;  4B3R C;  2PRO A;  2BJO A;  2Y27 A;  3I08 A;  4K0B A;  5CZV A;  1XMQ C;  4PRO C;  1XRA A;  2QVZ X;  1USP B;  5K8F A;  4BCA A;  4DV1 C;  2PN2 A;  5DV9 A;  1T5H X;  3CW8 X;  1MXB A;  4G37 A;  3FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...