1ML8A

Structural genomics
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERRERLFTHINLHFIVTGRDLKDAAVARAVDLSAEKYCSVALMLEKAVNITHSYEVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein (crp region)
publication title Structural genomics
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 35
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2002-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ml8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ml8A02
4NXNC 4X62C 4DR5C 1IBLC 4JI7C 3CJEA 4Y52I 2NVYI 1KKGA 3J80D 2DE6A 4DV2C 3GKUA 3S1NI 5C44I 3ESWA 3R9XA 4DCVA 5FLXD 1HNWC 4NBGA 2ZM6C 1L1OC 4A3DI 4B3SC 4NBEA 3IEVA 3S17I 2VQEC 4JI8C 1WH9A 2PT7G 2JS4A 2KZFA 4A3II 5IP9I 4GKJC 3T1YC 2UXCC 5FLMI 5IWAC 1IBMC 4K0KC 3S14I 4LF7C 4B3TC 5IT9D 1PA4A 1I50I 4OX9C 1TWAI 1TWGI 3S2DI 1L2FA 3M3YI 1QWIA 2E5LC 3RZOI 2EGTA 2R93I 3VMGA 1UKKA 4NOZA 2E2HI 1K0RA 2BJOA 1XMOC 3HOUI 2E2JI 2F4MA 4DV0C 5IP7I 4B3MC 1WF3A 3S1MI 4JYAC 4NBBA 4LF6C 4GKKC 4LF8C 2K5RA 3VMIA 2JMPA 4NBCA 2P3YA 4B3RC 4DR7C 3JAMD 1YUAA 2UXDC 5A2QD 4XX2A 1PFTA 2NVQI 4DCUA 1ML8A 1N34C 1VLAA 3GKQA 2HHHC 2CY1A 2F4OA 2OPLB 3M4OI 4LF9C 4JV5C 1K83I 4LF5C 2ONFA 3R9WA 3HOVI 4JI2C 2OPLA 4DR4C 1NUIA 4DR2C 1N2FA 2AKLA 1N33C 4MTNA 3S1RI 2UUCC 1IBKC 2KPIA 3HOXI 1NYEA 2NVTI 4YHHC 4DR1C 5C4JI 2QL8A 2J6AA 2JA5I 4AQYC 4LFBC 4DV4C 5C3EI 1SFOI 1FJGC 3U50C 1WW9A 4NBDA 4YY3C 3T1HC 1TWFI 3GTQI 3I07A 1TWHI 2HJGA 4LFAC 1JOSA 4JI6C 1X3ZA 3I4MI 4JI0C 4BXXI 1XNRC 1I3QI 3PO2I 1TWCI 4JI1C 2VQFC 1MKYA 4JI4C 3D6WA 3GTGI 3S2HI 1XMQC 2CXCA 1WCMI 3HOWI 1USPB 4DV7C 3GTPI 3J81D 2RBLA 3I4NI 1R9TI 5C4XI 4A3GI 4Y7NI 4NB9A 4A3LI 1LQLA 1USPA 4LF4C 2PK7A 2JA8I 2E8FA 2VUMI 1HNZC 1HNXC 1TFIA 1X3WA 4NBHA 4NB8A 1Y1VS 1J5EC 3S15I 1RO4A 1I94C 2JR6A 4A3EI 4DUYC 1ZB9A 1HR0C 3GTLI 4QTUA 4A3BI 4DCTA 4A3MI 4X64C 4DV3C 3VMHA 2YU9I 2DYJA 4KHPC 5LMUC 4DR6C 3S1QI 3VB9A 3RZDI 1QYPA 2YCBA 3PO3S 2JA6I 4BSZA 4DV5C 1Y1VI 4DV6C 3K7AI 4BBRI 5LMNC 4NXMC 4A3FI 1EGAA 4A93I 3S16I 2JNYA 3LUSA 2UUBC 2DE5A 2JA7I 3AF5A 2R7ZI 4DR3C 1N36C 3OTOC 2F4VC 4JI5C 4QTTA 2R92I 4X65C 4MH4A 2NVXI 3GTMS 3PO3I 4BBSI 2UUAC 1Y1WI 1N32C 4A3CI 1ZB8A 4X6AI 3H3VJ 3GCFA 3GTKI 3FKII 1DL6A 4DCSA 4X66C 4A3KI 4LFCC 3Q87A 2ASBA 3IEUA 3CQZI 3GTOI 2UU9C 3HOZI 1I6HI 3HOYI 1HH2P 3GTMI 4NBAA 2XR1A 4DUZC 2B63I 3AF6A 5CM2M 1XNQC 1RLYA 4A3JI 2HF1A 2DE7A 2UXBC 3GTJI 4BY7I 5BR8C 2E8EA 4JI3C 2ATWA 2PN2A 2E7GA 2E8CA 3EERA 4DV1C 2D7VA 4BY1I 2E2II 3H0GI 4NBFA
chains in the Genus database with same CATH superfamily
1V25A 4NXNC 2V7BA 1MXBA 3CCUZ 4L2ZA 4X62C 4DR5C 1K8A2 1IBLC 4JI7C 1KD11 3TDHB 2OOXB 1YJWZ 1YI21 4HPVA 3CJEA 2GU2A 4Y52I 1VQ9Z 2NVYI 1KKGA 3J80D 2DE6A 3PBKA 4DV2C 3GKUA 1O90A 5BSVA 3S1NI 5C44I 2CU6A 2VSQA 1FDIA 1VEHA 3ESWA 3R9XA 1MXAA 3I08A 4DCVA 5FLXD 1HNWC 1SIWA 4NBGA 4HGZA 1VQPZ 2KI7B 2QVYX 1VQ61 4MONA 1PU1A 2ZM6C 4RVDA 1L1OC 4A3DI 4B3SC 4NBEA 3IEVA 3MZLB 3S17I 2E9HA 2DPLA 2VQEC 4E30A 4PROC 4JI8C 1WH9A 1YHQZ 3BG0B 2IV2X 3A9UA 2PT7G 3B7WA 5KYTA 5BSTA 1YHQ1 2VF1A 1V60A 3IFUA 4ODJA 3UX2A 2WB1A 1VQ4Z 2QW0X 2GTIA 4RVGA 1N8R2 3A26A 3EQ6A 1VQ41 1RNIA 4G1IA 1NP6A 2JS4A 2KZFA 5A19A 3UEBA 2LFUA 3I561 4A3II 1M901 1XS3A 1TH5A 1M1K2 2OO4A 5IP9I 1MXCA 4GKJC 2P2MA 3FQMA 2Z51A 3T1YC 2LEXA 1QF8A 2UXCC 3TE5B 5FLMI 5IWAC 1IBMC 3TDEA 1YIJZ 3NYRA 4K0KC 3S14I 2BH1X 3PROC 4LF7C 4B3TC 3OW2Z 2P02A 1T5HX 1PA4A 1UWDA 5IT9D 1QVGZ 1I50I 4OX9C 2MMAB 3J80f 1TWAI 1TWGI 2PM9A 2P28A 2V8IA 3S2DI 5IFIA 1L2FA 3KXWA 1RQFA 3M3YI 5CZXA 5KEIA 5FLXf 2R6MA 3NPDA 1QWIA 4TNUA 3VNRA 3SO4A 2E5LC 5BUQA 3G6EZ 5GTDA 1Q822 3RZOI 2EGTA 2R93I 3UOWA 3TR3A 1RO2A 3NH4A 3VMGA 1UKKA 4NOZA 1XHJA 3L8CA 4JM1A 2ZZMA 2E2HI 1K0RA 2QEX1 5KYVA 2BJOA 2K3RA 1NY8A 1QVFY 1JJ2Y 4RM3A 3A25A 2QR1B 4DK1A 4R1MA 4BC9A 1XMOC 2V3VA 3HOUI 2E2JI 4I9GA 3DAYA 2QA4Z 2F4MA 2JMOA 1VQK1 4DV0C 1FUGA 5IP7I 3G711 2QA41 1WF3A 4B3MC 3S1MI 1VQO1 4DG8A 1Q16A 4JYAC 4NBBA 4EATA 2P2JA 4LF6C 1QM4A 1Y8CA 1KRLA 1YJ7A 4GKKC 2AYDA 4LF8C 2ZZNA 2K5RA 3DHVA 3VMIA 2JMPA 2PROA 1O92A 4S1TA 2LIYA 3CMA1 3CCQZ 2DHMA 4KTTA 1YJNZ 4D57A 2GTHA 1VQL1 3E7WA 3CCQ1 1LCIA 1RG9A 4NBCA 5A1GA 2P3YA 4B3RC 3CCVZ 4DR7C 4E2ZA 4E2XA 3JAMD 1YUAA 4AYBA 2UXDC 3CCV1 1YIT1 5A2QD 3VTNA 3LNVA 3MZKB 4XX2A 1PFTA 3CCJZ 3J80b 2NVQI 4I9FA 4DCUA 3CCEZ 1ML8A 4TPSB 3CCJ1 2Q4ZA 5IT9f 1O93A 1VLAA 3GKQA 1Q7Y2 1N34C 1P9NA 2O53A 2HHHC 2CY1A 2F4OA 2YADA 2WAQA 5FLXb 2OPLB 1YI2Z 2Y4NA 5DV9A 4U5YD 3M4OI 4LF9C 2V45A 4JV5C 1K9M2 1K83I 4LF5C 4G36A 5K8FA 2ONFA 3R9WA 3HOVI 4JI2C 4RV9A 4RVFA 2P20A 2VPYA 2OPLA 4K0BA 1NUIA 4DR4C 3CC41 4E2WA 1VQ6Z 1KC82 4DR2C 2V8KA 3CXCZ 4OXIA 4D4GA 3CCM1 1N2FA 4HGYA 2AKLA 1N33C 2P2FA 3A9VA 3IPLA 3CW9A 4GXRA 4BCAA 3LAXA 1VQ51 3TUFA 1V26A 4KTVA 4RVOA 4MTNA 5BURA 2G2KA 5T64A 5AE2A 3S1RI 3CPWY 4PZPA 1XRAA 2VPWA 3NYQA 3D9XA 3O2EA 2UUCC 1P7LA 3I56Z 2KPIA 3HOXI 1NYEA 1IBKC 2NVTI 4D56A 4YHHC 1YUKA 4DR1C 2JIQA 5C4JI 2QL8A 2QVZX 3JAMf 1Q811 5IT9b 2J6AA 3F3PC 5A2Qf 2JA5I 1KQSZ 4AQYC 2JIRA 4LFBC 3NI2A 2VPXA 1Q861 3K6RA 2AYAA 5C3EI 4DV4C 1SFOI 4RVNA 2OOYB 4E2YA 1FJGC 5H9UA 4NFRA 4BC7A 2D27A 4FTFA 5BSUA 2RIQA 1WIIA 1K731 1NJI1 2M6NA 3U50C 3G7SA 1WW9A 1QVFZ 2IZ3A 4NBDA 5ADZA 4YY3C 1MDBA 1PG3A 3T1HC 1TWFI 4ISBA 5K85A 3UZ0A 3GTQI 1ULTA 4R1LA 2WD9A 2M48A 1KD12 3I07A 1TWHI 2JUBA 2M5HA 1K8A1 2HJGA 4IR7A 4LFAC 5BUSA 3FCEA 1JOSA 3GR0A 3GR1A 1VQ71 4JI6C 1X3ZA 2QEXZ 1WJ2A 1VQM1 3CCRZ 3CW8X 3I4MI 2P2QA 4JI0C 4BXXI 1XNRC 3CCR1 4ZLPA 4MD8A 1I3QI 3PO2I 2D1TA 1VQKZ 3N2QA 3VNSA 3D2LA 1S721 3G71Z 3QWUA 1TWCI 1Z02A 4JI1C 2JIPA 2VQFC 1VQOZ 1MKYA 4PUHA 2HU9A 4JI4C 3D6WA 1FLOA 3NH5A 3J7A4 2OTL1 1VQN1 3GTGI 3JAMb 3S2HI 4PHTA 2OBVA 5T8TA 1XMQC 2CXCA 4E31A 3MONA 5A2Qb 1WCMI 2E0GA 3CMAZ 3HOWI 1MDFA 3PESA 1USPB 4E32A 2OTJZ 3OW2Y 3R44A 4DV7C 1VQLZ 1QVGY 3GTPI 2RBLA 3J81D 1M6XA 2OTJ1 3I4NI 4RLFA 3DLPX 2VPZA 1R9TI 1W2BY 1YITZ 5C4XI 4A3GI 1N8R1 3UX3A 4Y7NI 4NB9A 4A3LI 1LQLA 1M902 2RT9A 2YWCA 1USPA 1WZNA 4LF4C 2PK7A 2JA8I 1M1K1 1JWHC 5BSRA 3CC2Z 1YJ91 2E8FA 1AMUA 2VUMI 3CC21 1HNZC 3S82A 1HNXC 4GXQA 2QREB 3NH8A 1RY2A 1VQ8Z 2VZEA 2NCLA 1TFIA 3N54B 1VQ81 3NDJA 1X3WA 4NBHA 4NB8A 3CC4Z 1Y1VS 1J5EC 3S15I 1RO4A 1I94C 3GPCA 2JR6A 3C5EA 4A3EI 2KZ0A 2Q51A 4DUYC 3CCMZ 1P4EA 1ZB9A 3CQ2A 1HR0C 1GPMA 3GTLI 4QTUA 4A3BI 2JNVA 2Y4OA 3FCCA 3CCU1 2D28C 2Y27A 1XRBA 5D1OB 3T4NB 1VQ5Z 3CCLZ 2NAPA 1YJW1 1Q821 1WCJA 3CCL1 2WP0C 4DCTA 2E7ZA 1VQ91 5BSMA 4A3MI 3H2TA 4X64C 3RG2A 4DV3C 4ZJZA 5AE3A 3VMHA 2YU9I 2DYJA 4KHPC 5D1OA 4FUTA 5LMUC 3P5JB 4BBYA 5JRHA 4DR6C 3J81f 3S1QI 3VB9A 3G4SZ 1QYPA 3RZDI 2YCBA 3PO3S 2JA6I 4BSZA 1S7MA 1VQP1 3TQIA 1Z01A 1XRCA 3G4S1 2RHBA 5T8SA 4DV5C 1AA6A 2QVXX 2QRDB 4RMNA 1Y1VI 5AE1A 1P4EC 2ZAEB 3LNOA 3EEDA 4EWCA 4DV6C 3K7AI 4L7IA 4BBRI 2MCQA 3IR7A 5LMNC 4RVHA 1O9TA 3ETOA 4NXMC 4A3FI 1EGAA 4A93I 3S16I 2JNYA 3BG1B 3A4IA 1T5DX 3LUSA 2UUBC 2DE5A 3CD6Z 2JA7I 2D1RA 3AF5A 2R7ZI 4DR3C 1JJ2Z 3CXCY 1N36C 3CD61 2M5OA 3OTOC 3LGXA 4FUQA 4L4QA 2F4VC 4JI5C 4QTTA 2R92I 3CQ1A 5A1IA 3KIFA 4MD9A 3CMEZ 5BSWA 4X65C 1Q7Y1 1MD9A 4MH4A 3CME1 2NVXI 2W03A 2JIOA 4CL1A 4HH4A 3GTMS 3PO3I 4BBSI 2PMZA 1VQ7Z 2VUGA 2UUAC 5LL6f 3ETCA 1Y1WI 1N32C 1VQMZ 1K9M1 3IMLA 3E7XA 4RS4A 1YIJ1 4A3CI 1ZB8A 4X6AI 4WS9A 3H3VJ 1X0TA 1FDOA 3GCFA 4IZ6A 2JIMA 3GTKI 4WV3A 4MRIA 4R0MA 1S72Z 3FKII 1W2BZ 2QKDA 1DL6A 2W04A 3IF8A 4DCSA 3J81b 1KC81 1KQSY 4X66C 3NDIA 5E7QA 4G37A 4A3KI 2OTLZ 1VQNZ 4OYCA 2I3CA 2QRCB 4RM2A 2YX1A 4LFCC 5D1PA 1Z03A 3KIHA 3Q87A 2ASBA 3IEUA 3CQZI 4DGLA 3GTOI 1IB8A 2UU9C 3G6E1 1BA3A 4PUIA 3I55Z 1I6HI 3HOZI 3F3FC 4PUGA 2Y0SA 4NH1C 3FQQA 3I551 4DQYB 3HOYI 1PG4A 3CQ3A 1HH2P 3IX0A 3GTMI 3CCSZ 4NBAA 2XR1A 4DUZC 2D1SA 4LE5A 2V8JA 3CCS1 2YWBA 5CZVA 2IZ4A 2H85A 3CC7Z 2B63I 2MM9A 3VNQA 3AF6A 4DG9A 3CC71 5T6BA 1QXFA 1YJ9Z 4NDNA 5CM2M 1Q812 4MD7A 1XNQC 2P2BA 2KDNA 1RLYA 2QLVB 4E33A 1Q862 4A3JI 2HF1A 2RPRA 4D4IA 2DE7A 2UXBC 2OZKA 3RV2A 3GTJI 4BY7I 5BR8C 2E8EA 4RLQA 4JI3C 2D1QA 2ATWA 1K732 3L95X 1YJN1 2PN2A 1NJI2 1ZH1A 5AN9F 2E7GA 4MXUA 2E8CA 3HKZA 3EERA 3AY0A 4DV1C 1RO0A 1M6XC 3NFZA 5LCIA 2D7VA 4BY1I 2E2II 2O4HA 3CPWZ 4GS5A 3H0GI 5T67A 4NBFA 3CCE1
chains in the Genus database with same CATH topology
1V25A 4NXNC 2V7BA 1MXBA 3CCUZ 4L2ZA 4X62C 4DR5C 1K8A2 1IBLC 4JI7C 1KD11 3TDHB 2OOXB 1YJWZ 1YI21 4HPVA 3CJEA 2GU2A 4Y52I 1VQ9Z 2NVYI 1KKGA 3J80D 2DE6A 3PBKA 4DV2C 3GKUA 1O90A 5BSVA 3S1NI 5C44I 2VSQA 3ESWA 3R9XA 1MXAA 3I08A 4DCVA 5FLXD 1HNWC 4NBGA 4HGZA 1VQPZ 2KI7B 2QVYX 1VQ61 4MONA 2ZM6C 4RVDA 1L1OC 4A3DI 4B3SC 4NBEA 3IEVA 3MZLB 3S17I 2E9HA 2DPLA 2VQEC 4E30A 4PROC 4JI8C 1WH9A 1YHQZ 3BG0B 3A9UA 2PT7G 3B7WA 5KYTA 5BSTA 1YHQ1 2VF1A 3IFUA 4ODJA 2WB1A 1VQ4Z 2QW0X 2GTIA 4RVGA 1N8R2 3EQ6A 1VQ41 1RNIA 4G1IA 2JS4A 1NP6A 2KZFA 5A19A 2LFUA 3I561 4A3II 1M901 1M1K2 2OO4A 5IP9I 1MXCA 4GKJC 2P2MA 3FQMA 3T1YC 1QF8A 2UXCC 3TE5B 5FLMI 5IWAC 1IBMC 3TDEA 1YIJZ 3NYRA 4K0KC 3S14I 2BH1X 3PROC 4LF7C 4B3TC 3OW2Z 2P02A 1T5HX 1PA4A 5IT9D 1QVGZ 1I50I 4OX9C 3J80f 1TWAI 1TWGI 2PM9A 2P28A 2V8IA 3S2DI 5IFIA 1L2FA 3KXWA 1RQFA 3M3YI 5CZXA 5KEIA 5FLXf 2R6MA 3NPDA 1QWIA 4TNUA 3VNRA 3SO4A 2E5LC 5BUQA 3G6EZ 5GTDA 1Q822 3RZOI 2EGTA 2R93I 3UOWA 1RO2A 3NH4A 3VMGA 1UKKA 4NOZA 3L8CA 4JM1A 2E2HI 1K0RA 2QEX1 5KYVA 2BJOA 2K3RA 1QVFY 1JJ2Y 4RM3A 2QR1B 4DK1A 4R1MA 4BC9A 1XMOC 4I9GA 3HOUI 2E2JI 3DAYA 2QA4Z 2F4MA 2JMOA 1VQK1 4DV0C 1FUGA 5IP7I 3G711 2QA41 1WF3A 4B3MC 3S1MI 1VQO1 4DG8A 4JYAC 4NBBA 4EATA 2P2JA 4LF6C 1QM4A 1KRLA 1YJ7A 4GKKC 4LF8C 2K5RA 3DHVA 3VMIA 2JMPA 2PROA 1O92A 4S1TA 2LIYA 3CMA1 3CCQZ 4KTTA 1YJNZ 4D57A 2GTHA 1VQL1 3E7WA 3CCQ1 1LCIA 1RG9A 4NBCA 5A1GA 2P3YA 4B3RC 3CCVZ 4DR7C 4E2ZA 4E2XA 3JAMD 1YUAA 4AYBA 2UXDC 3CCV1 1YIT1 5A2QD 3VTNA 3LNVA 3MZKB 4XX2A 1PFTA 3CCJZ 3J80b 2NVQI 4I9FA 4DCUA 3CCEZ 1ML8A 4TPSB 3CCJ1 2Q4ZA 5IT9f 1O93A 1VLAA 3GKQA 1Q7Y2 1N34C 1P9NA 2O53A 2HHHC 2CY1A 2F4OA 2YADA 2WAQA 5FLXb 2OPLB 1YI2Z 2Y4NA 5DV9A 4U5YD 3M4OI 4LF9C 4JV5C 1K9M2 1K83I 4LF5C 4G36A 5K8FA 2ONFA 3R9WA 3HOVI 4JI2C 4RV9A 4RVFA 2P20A 2OPLA 4K0BA 1NUIA 4DR4C 3CC41 4E2WA 1VQ6Z 1KC82 4DR2C 2V8KA 3CXCZ 4OXIA 4D4GA 3CCM1 1N2FA 4HGYA 2AKLA 1N33C 2P2FA 3A9VA 3IPLA 3CW9A 4GXRA 4BCAA 3LAXA 1VQ51 3TUFA 1V26A 4KTVA 4RVOA 4MTNA 5BURA 2G2KA 5T64A 5AE2A 3S1RI 3CPWY 4PZPA 1XRAA 2UUCC 3NYQA 3D9XA 1P7LA 3I56Z 2KPIA 3HOXI 1NYEA 1IBKC 2NVTI 4D56A 4YHHC 1YUKA 4DR1C 5C4JI 2QL8A 2QVZX 3JAMf 1Q811 5IT9b 2J6AA 3F3PC 5A2Qf 2JA5I 1KQSZ 4AQYC 4LFBC 3NI2A 1Q861 4DV4C 2AYAA 5C3EI 1SFOI 4RVNA 2OOYB 4E2YA 1FJGC 5H9UA 4NFRA 4BC7A 2D27A 4FTFA 5BSUA 2RIQA 1WIIA 1K731 1NJI1 2M6NA 3U50C 3G7SA 1WW9A 1QVFZ 2IZ3A 4NBDA 5ADZA 4YY3C 1MDBA 1PG3A 3T1HC 1TWFI 4ISBA 5K85A 3UZ0A 3GTQI 1ULTA 4R1LA 2WD9A 2M48A 1KD12 3I07A 1TWHI 2JUBA 1K8A1 2HJGA 4IR7A 4LFAC 5BUSA 3FCEA 1JOSA 3GR0A 3GR1A 1VQ71 4JI6C 1X3ZA 2QEXZ 1VQM1 3CCRZ 3CW8X 3I4MI 2P2QA 4JI0C 4BXXI 1XNRC 3CCR1 4ZLPA 4MD8A 1I3QI 3PO2I 2D1TA 1VQKZ 3N2QA 3VNSA 1S721 3G71Z 3QWUA 1TWCI 1Z02A 4JI1C 2VQFC 1VQOZ 1MKYA 2HU9A 4JI4C 3D6WA 3NH5A 3J7A4 2OTL1 1VQN1 3GTGI 3JAMb 3S2HI 4PHTA 2OBVA 5T8TA 1XMQC 2CXCA 4E31A 3MONA 5A2Qb 1WCMI 2E0GA 3CMAZ 3HOWI 1MDFA 3PESA 1USPB 4E32A 2OTJZ 3OW2Y 3R44A 4DV7C 1VQLZ 1QVGY 3GTPI 2RBLA 3J81D 2OTJ1 3I4NI 4RLFA 3DLPX 1R9TI 1W2BY 1YITZ 5C4XI 4A3GI 1N8R1 4Y7NI 4NB9A 4A3LI 1LQLA 1M902 2RT9A 2YWCA 1USPA 4LF4C 2PK7A 2JA8I 1M1K1 1JWHC 5BSRA 3CC2Z 1YJ91 2E8FA 1AMUA 2VUMI 3CC21 1HNZC 3S82A 1HNXC 4GXQA 2QREB 3NH8A 1RY2A 1VQ8Z 2VZEA 1TFIA 3N54B 1VQ81 3NDJA 1X3WA 4NBHA 4NB8A 3CC4Z 1Y1VS 1J5EC 3S15I 1RO4A 1I94C 3GPCA 2JR6A 3C5EA 4A3EI 2Q51A 4DUYC 3CCMZ 1ZB9A 1HR0C 1GPMA 3GTLI 4QTUA 4A3BI 2Y4OA 3FCCA 3CCU1 2D28C 2Y27A 1XRBA 5D1OB 3T4NB 1VQ5Z 3CCLZ 1YJW1 1Q821 3CCL1 2WP0C 4DCTA 1VQ91 5BSMA 4A3MI 3H2TA 4X64C 3RG2A 4DV3C 4ZJZA 5AE3A 3VMHA 2YU9I 2DYJA 4KHPC 5D1OA 4FUTA 5LMUC 3P5JB 4BBYA 5JRHA 4DR6C 3J81f 3S1QI 3VB9A 3G4SZ 1QYPA 3RZDI 2YCBA 3PO3S 2JA6I 4BSZA 1S7MA 1VQP1 3TQIA 1Z01A 1XRCA 3G4S1 2RHBA 5T8SA 4DV5C 2QVXX 2QRDB 4RMNA 1Y1VI 5AE1A 2ZAEB 3EEDA 4EWCA 4DV6C 3K7AI 4L7IA 4BBRI 5LMNC 4RVHA 1O9TA 3ETOA 4NXMC 4A3FI 1EGAA 4A93I 3S16I 2JNYA 3BG1B 3A4IA 1T5DX 3LUSA 2UUBC 2DE5A 3CD6Z 2JA7I 2D1RA 3AF5A 2R7ZI 4DR3C 1JJ2Z 3CXCY 1N36C 3CD61 3OTOC 3LGXA 4FUQA 4L4QA 2F4VC 4JI5C 4QTTA 2R92I 5A1IA 5BSWA 3KIFA 4MD9A 3CMEZ 4X65C 1Q7Y1 1MD9A 4MH4A 3CME1 2NVXI 2W03A 4CL1A 4HH4A 3GTMS 3PO3I 4BBSI 2PMZA 1VQ7Z 2VUGA 2UUAC 5LL6f 3ETCA 1Y1WI 1N32C 1VQMZ 1K9M1 3IMLA 3E7XA 4RS4A 1YIJ1 4A3CI 1ZB8A 4X6AI 4WS9A 3H3VJ 1X0TA 3GCFA 4IZ6A 3GTKI 4WV3A 4MRIA 4R0MA 1S72Z 3FKII 1W2BZ 2QKDA 1DL6A 2W04A 3IF8A 4DCSA 3J81b 1KC81 1KQSY 4X66C 3NDIA 5E7QA 4G37A 4A3KI 2OTLZ 1VQNZ 4OYCA 2I3CA 2QRCB 4RM2A 4LFCC 5D1PA 1Z03A 3KIHA 3Q87A 2ASBA 3IEUA 3CQZI 4DGLA 3GTOI 2UU9C 3G6E1 1BA3A 3I55Z 1I6HI 3HOZI 3F3FC 2Y0SA 4NH1C 3FQQA 3I551 4DQYB 3HOYI 1PG4A 1HH2P 3IX0A 3GTMI 3CCSZ 4NBAA 2XR1A 4DUZC 2D1SA 4LE5A 2V8JA 3CCS1 2YWBA 5CZVA 2IZ4A 2H85A 3CC7Z 2B63I 3VNQA 3AF6A 4DG9A 3CC71 5T6BA 1YJ9Z 4NDNA 5CM2M 1Q812 4MD7A 1XNQC 2P2BA 1RLYA 2QLVB 4E33A 1Q862 4A3JI 2HF1A 2RPRA 4D4IA 2DE7A 2UXBC 2OZKA 3RV2A 3GTJI 4BY7I 5BR8C 2E8EA 4RLQA 4JI3C 2D1QA 2ATWA 1K732 3L95X 1YJN1 2PN2A 1NJI2 1ZH1A 5AN9F 2E7GA 4MXUA 2E8CA 3HKZA 3EERA 4DV1C 1RO0A 3NFZA 2D7VA 4BY1I 2E2II 2O4HA 3CPWZ 4GS5A 3H0GI 5T67A 4NBFA 3CCE1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN C;  4X62 C;  4DR5 C;  1IBL C;  4JI7 C;  3CJE A;  4Y52 I;  2NVY I;  1KKG A;  3J80 D;  2DE6 A;  4DV2 C;  3GKU A;  3S1N I;  5C44 I;  3ESW A;  3R9X A;  4DCV A;  5FLX D;  1HNW C;  4NBG A;  2ZM6 C;  1L1O C;  4A3D I;  4B3S C;  4NBE A;  3IEV A;  3S17 I;  2VQE C;  4JI8 C;  1WH9 A;  2PT7 G;  2JS4 A;  2KZF A;  4A3I I;  5IP9 I;  4GKJ C;  3T1Y C;  2UXC C;  5FLM I;  5IWA C;  1IBM C;  4K0K C;  3S14 I;  4LF7 C;  4B3T C;  5IT9 D;  1PA4 A;  1I50 I;  4OX9 C;  1TWA I;  1TWG I;  3S2D I;  1L2F A;  3M3Y I;  1QWI A;  2E5L C;  3RZO I;  2EGT A;  2R93 I;  3VMG A;  1UKK A;  4NOZ A;  2E2H I;  1K0R A;  2BJO A;  1XMO C;  3HOU I;  2E2J I;  2F4M A;  4DV0 C;  5IP7 I;  4B3M C;  1WF3 A;  3S1M I;  4JYA C;  4NBB A;  4LF6 C;  4GKK C;  4LF8 C;  2K5R A;  3VMI A;  2JMP A;  4NBC A;  2P3Y A;  4B3R C;  4DR7 C;  3JAM D;  1YUA A;  2UXD C;  5A2Q D;  4XX2 A;  1PFT A;  2NVQ I;  4DCU A;  1ML8 A;  1N34 C;  1VLA A;  3GKQ A;  2HHH C;  2CY1 A;  2F4O A;  2OPL B;  3M4O I;  4LF9 C;  4JV5 C;  1K83 I;  4LF5 C;  2ONF A;  3R9W A;  3HOV I;  4JI2 C;  2OPL A;  4DR4 C;  1NUI A;  4DR2 C;  1N2F A;  2AKL A;  1N33 C;  4MTN A;  3S1R I;  2UUC C;  1IBK C;  2KPI A;  3HOX I;  1NYE A;  2NVT I;  4YHH C;  4DR1 C;  5C4J I;  2QL8 A;  2J6A A;  2JA5 I;  4AQY C;  4LFB C;  4DV4 C;  5C3E I;  1SFO I;  1FJG C;  3U50 C;  1WW9 A;  4NBD A;  4YY3 C;  3T1H C;  1TWF I;  3GTQ I;  3I07 A;  1TWH I;  2HJG A;  4LFA C;  1JOS A;  4JI6 C;  1X3Z A;  3I4M I;  4JI0 C;  4BXX I;  1XNR C;  1I3Q I;  3PO2 I;  1TWC I;  4JI1 C;  2VQF C;  1MKY A;  4JI4 C;  3D6W A;  3GTG I;  3S2H I;  1XMQ C;  2CXC A;  1WCM I;  3HOW I;  1USP B;  4DV7 C;  3GTP I;  3J81 D;  2RBL A;  3I4N I;  1R9T I;  5C4X I;  4A3G I;  4Y7N I;  4NB9 A;  4A3L I;  1LQL A;  1USP A;  4LF4 C;  2PK7 A;  2JA8 I;  2E8F A;  2VUM I;  1HNZ C;  1HNX C;  1TFI A;  1X3W A;  4NBH A;  4NB8 A;  1Y1V S;  1J5E C;  3S15 I;  1RO4 A;  1I94 C;  2JR6 A;  4A3E I;  4DUY C;  1ZB9 A;  1HR0 C;  3GTL I;  4QTU A;  4A3B I;  4DCT A;  4A3M I;  4X64 C;  4DV3 C;  3VMH A;  2YU9 I;  2DYJ A;  4KHP C;  5LMU C;  4DR6 C;  3S1Q I;  3VB9 A;  3RZD I;  1QYP A;  2YCB A;  3PO3 S;  2JA6 I;  4BSZ A;  4DV5 C;  1Y1V I;  4DV6 C;  3K7A I;  4BBR I;  5LMN C;  4NXM C;  4A3F I;  1EGA A;  4A93 I;  3S16 I;  2JNY A;  3LUS A;  2UUB C;  2DE5 A;  2JA7 I;  3AF5 A;  2R7Z I;  4DR3 C;  1N36 C;  3OTO C;  2F4V C;  4JI5 C;  4QTT A;  2R92 I;  4X65 C;  4MH4 A;  2NVX I;  3GTM S;  3PO3 I;  4BBS I;  2UUA C;  1Y1W I;  1N32 C;  4A3C I;  1ZB8 A;  4X6A I;  3H3V J;  3GCF A;  3GTK I;  3FKI I;  1DL6 A;  4DCS A;  4X66 C;  4A3K I;  4LFC C;  3Q87 A;  2ASB A;  3IEU A;  3CQZ I;  3GTO I;  2UU9 C;  3HOZ I;  1I6H I;  3HOY I;  1HH2 P;  3GTM I;  4NBA A;  2XR1 A;  4DUZ C;  2B63 I;  3AF6 A;  5CM2 M;  1XNQ C;  1RLY A;  4A3J I;  2HF1 A;  2DE7 A;  2UXB C;  3GTJ I;  4BY7 I;  5BR8 C;  2E8E A;  4JI3 C;  2ATW A;  2PN2 A;  2E7G A;  2E8C A;  3EER A;  4DV1 C;  2D7V A;  4BY1 I;  2E2I I;  3H0G I;  4NBF A; 
#chains in the Genus database with same CATH topology
 1V25 A;  4NXN C;  2V7B A;  1MXB A;  3CCU Z;  4L2Z A;  4X62 C;  4DR5 C;  1K8A 2;  1IBL C;  4JI7 C;  1KD1 1;  3TDH B;  2OOX B;  1YJW Z;  1YI2 1;  4HPV A;  3CJE A;  2GU2 A;  4Y52 I;  1VQ9 Z;  2NVY I;  1KKG A;  3J80 D;  2DE6 A;  3PBK A;  4DV2 C;  3GKU A;  1O90 A;  5BSV A;  3S1N I;  5C44 I;  2CU6 A;  2VSQ A;  1FDI A;  1VEH A;  3ESW A;  3R9X A;  1MXA A;  3I08 A;  4DCV A;  5FLX D;  1HNW C;  1SIW A;  4NBG A;  4HGZ A;  1VQP Z;  2KI7 B;  2QVY X;  1VQ6 1;  4MON A;  1PU1 A;  2ZM6 C;  4RVD A;  1L1O C;  4A3D I;  4B3S C;  4NBE A;  3IEV A;  3MZL B;  3S17 I;  2E9H A;  2DPL A;  2VQE C;  4E30 A;  4PRO C;  4JI8 C;  1WH9 A;  1YHQ Z;  3BG0 B;  2IV2 X;  3A9U A;  2PT7 G;  3B7W A;  5KYT A;  5BST A;  1YHQ 1;  2VF1 A;  1V60 A;  3IFU A;  4ODJ A;  3UX2 A;  2WB1 A;  1VQ4 Z;  2QW0 X;  2GTI A;  4RVG A;  1N8R 2;  3A26 A;  3EQ6 A;  1VQ4 1;  1RNI A;  4G1I A;  1NP6 A;  2JS4 A;  2KZF A;  5A19 A;  3UEB A;  2LFU A;  3I56 1;  4A3I I;  1M90 1;  1XS3 A;  1TH5 A;  1M1K 2;  2OO4 A;  5IP9 I;  1MXC A;  4GKJ C;  2P2M A;  3FQM A;  2Z51 A;  3T1Y C;  2LEX A;  1QF8 A;  2UXC C;  3TE5 B;  5FLM I;  5IWA C;  1IBM C;  3TDE A;  1YIJ Z;  3NYR A;  4K0K C;  3S14 I;  2BH1 X;  3PRO C;  4LF7 C;  4B3T C;  3OW2 Z;  2P02 A;  1T5H X;  1PA4 A;  1UWD A;  5IT9 D;  1QVG Z;  1I50 I;  4OX9 C;  2MMA B;  3J80 f;  1TWA I;  1TWG I;  2PM9 A;  2P28 A;  2V8I A;  3S2D I;  5IFI A;  1L2F A;  3KXW A;  1RQF A;  3M3Y I;  5CZX A;  5KEI A;  5FLX f;  2R6M A;  3NPD A;  1QWI A;  4TNU A;  3VNR A;  3SO4 A;  2E5L C;  5BUQ A;  3G6E Z;  5GTD A;  1Q82 2;  3RZO I;  2EGT A;  2R93 I;  3UOW A;  3TR3 A;  1RO2 A;  3NH4 A;  3VMG A;  1UKK A;  4NOZ A;  1XHJ A;  3L8C A;  4JM1 A;  2ZZM A;  2E2H I;  1K0R A;  2QEX 1;  5KYV A;  2BJO A;  2K3R A;  1NY8 A;  1QVF Y;  1JJ2 Y;  4RM3 A;  3A25 A;  2QR1 B;  4DK1 A;  4R1M A;  4BC9 A;  1XMO C;  2V3V A;  3HOU I;  2E2J I;  4I9G A;  3DAY A;  2QA4 Z;  2F4M A;  2JMO A;  1VQK 1;  4DV0 C;  1FUG A;  5IP7 I;  3G71 1;  2QA4 1;  1WF3 A;  4B3M C;  3S1M I;  1VQO 1;  4DG8 A;  1Q16 A;  4JYA C;  4NBB A;  4EAT A;  2P2J A;  4LF6 C;  1QM4 A;  1Y8C A;  1KRL A;  1YJ7 A;  4GKK C;  2AYD A;  4LF8 C;  2ZZN A;  2K5R A;  3DHV A;  3VMI A;  2JMP A;  2PRO A;  1O92 A;  4S1T A;  2LIY A;  3CMA 1;  3CCQ Z;  2DHM A;  4KTT A;  1YJN Z;  4D57 A;  2GTH A;  1VQL 1;  3E7W A;  3CCQ 1;  1LCI A;  1RG9 A;  4NBC A;  5A1G A;  2P3Y A;  4B3R C;  3CCV Z;  4DR7 C;  4E2Z A;  4E2X A;  3JAM D;  1YUA A;  4AYB A;  2UXD C;  3CCV 1;  1YIT 1;  5A2Q D;  3VTN A;  3LNV A;  3MZK B;  4XX2 A;  1PFT A;  3CCJ Z;  3J80 b;  2NVQ I;  4I9F A;  4DCU A;  3CCE Z;  1ML8 A;  4TPS B;  3CCJ 1;  2Q4Z A;  5IT9 f;  1O93 A;  1VLA A;  3GKQ A;  1Q7Y 2;  1N34 C;  1P9N A;  2O53 A;  2HHH C;  2CY1 A;  2F4O A;  2YAD A;  2WAQ A;  5FLX b;  2OPL B;  1YI2 Z;  2Y4N A;  5DV9 A;  4U5Y D;  3M4O I;  4LF9 C;  2V45 A;  4JV5 C;  1K9M 2;  1K83 I;  4LF5 C;  4G36 A;  5K8F A;  2ONF A;  3R9W A;  3HOV I;  4JI2 C;  4RV9 A;  4RVF A;  2P20 A;  2VPY A;  2OPL A;  4K0B A;  1NUI A;  4DR4 C;  3CC4 1;  4E2W A;  1VQ6 Z;  1KC8 2;  4DR2 C;  2V8K A;  3CXC Z;  4OXI A;  4D4G A;  3CCM 1;  1N2F A;  4HGY A;  2AKL A;  1N33 C;  2P2F A;  3A9V A;  3IPL A;  3CW9 A;  4GXR A;  4BCA A;  3LAX A;  1VQ5 1;  3TUF A;  1V26 A;  4KTV A;  4RVO A;  4MTN A;  5BUR A;  2G2K A;  5T64 A;  5AE2 A;  3S1R I;  3CPW Y;  4PZP A;  1XRA A;  2VPW A;  3NYQ A;  3D9X A;  3O2E A;  2UUC C;  1P7L A;  3I56 Z;  2KPI A;  3HOX I;  1NYE A;  1IBK C;  2NVT I;  4D56 A;  4YHH C;  1YUK A;  4DR1 C;  2JIQ A;  5C4J I;  2QL8 A;  2QVZ X;  3JAM f;  1Q81 1;  5IT9 b;  2J6A A;  3F3P C;  5A2Q f;  2JA5 I;  1KQS Z;  4AQY C;  2JIR A;  4LFB C;  3NI2 A;  2VPX A;  1Q86 1;  3K6R A;  2AYA A;  5C3E I;  4DV4 C;  1SFO I;  4RVN A;  2OOY B;  4E2Y A;  1FJG C;  5H9U A;  4NFR A;  4BC7 A;  2D27 A;  4FTF A;  5BSU A;  2RIQ A;  1WII A;  1K73 1;  1NJI 1;  2M6N A;  3U50 C;  3G7S A;  1WW9 A;  1QVF Z;  2IZ3 A;  4NBD A;  5ADZ A;  4YY3 C;  1MDB A;  1PG3 A;  3T1H C;  1TWF I;  4ISB A;  5K85 A;  3UZ0 A;  3GTQ I;  1ULT A;  4R1L A;  2WD9 A;  2M48 A;  1KD1 2;  3I07 A;  1TWH I;  2JUB A;  2M5H A;  1K8A 1;  2HJG A;  4IR7 A;  4LFA C;  5BUS A;  3FCE A;  1JOS A;  3GR0 A;  3GR1 A;  1VQ7 1;  4JI6 C;  1X3Z A;  2QEX Z;  1WJ2 A;  1VQM 1;  3CCR Z;  3CW8 X;  3I4M I;  2P2Q A;  4JI0 C;  4BXX I;  1XNR C;  3CCR 1;  4ZLP A;  4MD8 A;  1I3Q I;  3PO2 I;  2D1T A;  1VQK Z;  3N2Q A;  3VNS A;  3D2L A;  1S72 1;  3G71 Z;  3QWU A;  1TWC I;  1Z02 A;  4JI1 C;  2JIP A;  2VQF C;  1VQO Z;  1MKY A;  4PUH A;  2HU9 A;  4JI4 C;  3D6W A;  1FLO A;  3NH5 A;  3J7A 4;  2OTL 1;  1VQN 1;  3GTG I;  3JAM b;  3S2H I;  4PHT A;  2OBV A;  5T8T A;  1XMQ C;  2CXC A;  4E31 A;  3MON A;  5A2Q b;  1WCM I;  2E0G A;  3CMA Z;  3HOW I;  1MDF A;  3PES A;  1USP B;  4E32 A;  2OTJ Z;  3OW2 Y;  3R44 A;  4DV7 C;  1VQL Z;  1QVG Y;  3GTP I;  2RBL A;  3J81 D;  1M6X A;  2OTJ 1;  3I4N I;  4RLF A;  3DLP X;  2VPZ A;  1R9T I;  1W2B Y;  1YIT Z;  5C4X I;  4A3G I;  1N8R 1;  3UX3 A;  4Y7N I;  4NB9 A;  4A3L I;  1LQL A;  1M90 2;  2RT9 A;  2YWC A;  1USP A;  1WZN A;  4LF4 C;  2PK7 A;  2JA8 I;  1M1K 1;  1JWH C;  5BSR A;  3CC2 Z;  1YJ9 1;  2E8F A;  1AMU A;  2VUM I;  3CC2 1;  1HNZ C;  3S82 A;  1HNX C;  4GXQ A;  2QRE B;  3NH8 A;  1RY2 A;  1VQ8 Z;  2VZE A;  2NCL A;  1TFI A;  3N54 B;  1VQ8 1;  3NDJ A;  1X3W A;  4NBH A;  4NB8 A;  3CC4 Z;  1Y1V S;  1J5E C;  3S15 I;  1RO4 A;  1I94 C;  3GPC A;  2JR6 A;  3C5E A;  4A3E I;  2KZ0 A;  2Q51 A;  4DUY C;  3CCM Z;  1P4E A;  1ZB9 A;  3CQ2 A;  1HR0 C;  1GPM A;  3GTL I;  4QTU A;  4A3B I;  2JNV A;  2Y4O A;  3FCC A;  3CCU 1;  2D28 C;  2Y27 A;  1XRB A;  5D1O B;  3T4N B;  1VQ5 Z;  3CCL Z;  2NAP A;  1YJW 1;  1Q82 1;  1WCJ A;  3CCL 1;  2WP0 C;  4DCT A;  2E7Z A;  1VQ9 1;  5BSM A;  4A3M I;  3H2T A;  4X64 C;  3RG2 A;  4DV3 C;  4ZJZ A;  5AE3 A;  3VMH A;  2YU9 I;  2DYJ A;  4KHP C;  5D1O A;  4FUT A;  5LMU C;  3P5J B;  4BBY A;  5JRH A;  4DR6 C;  3J81 f;  3S1Q I;  3VB9 A;  3G4S Z;  1QYP A;  3RZD I;  2YCB A;  3PO3 S;  2JA6 I;  4BSZ A;  1S7M A;  1VQP 1;  3TQI A;  1Z01 A;  1XRC A;  3G4S 1;  2RHB A;  5T8S A;  4DV5 C;  1AA6 A;  2QVX X;  2QRD B;  4RMN A;  1Y1V I;  5AE1 A;  1P4E C;  2ZAE B;  3LNO A;  3EED A;  4EWC A;  4DV6 C;  3K7A I;  4L7I A;  4BBR I;  2MCQ A;  3IR7 A;  5LMN C;  4RVH A;  1O9T A;  3ETO A;  4NXM C;  4A3F I;  1EGA A;  4A93 I;  3S16 I;  2JNY A;  3BG1 B;  3A4I A;  1T5D X;  3LUS A;  2UUB C;  2DE5 A;  3CD6 Z;  2JA7 I;  2D1R A;  3AF5 A;  2R7Z I;  4DR3 C;  1JJ2 Z;  3CXC Y;  1N36 C;  3CD6 1;  2M5O A;  3OTO C;  3LGX A;  4FUQ A;  4L4Q A;  2F4V C;  4JI5 C;  4QTT A;  2R92 I;  3CQ1 A;  5A1I A;  3KIF A;  4MD9 A;  3CME Z;  5BSW A;  4X65 C;  1Q7Y 1;  1MD9 A;  4MH4 A;  3CME 1;  2NVX I;  2W03 A;  2JIO A;  4CL1 A;  4HH4 A;  3GTM S;  3PO3 I;  4BBS I;  2PMZ A;  1VQ7 Z;  2VUG A;  2UUA C;  5LL6 f;  3ETC A;  1Y1W I;  1N32 C;  1VQM Z;  1K9M 1;  3IML A;  3E7X A;  4RS4 A;  1YIJ 1;  4A3C I;  1ZB8 A;  4X6A I;  4WS9 A;  3H3V J;  1X0T A;  1FDO A;  3GCF A;  4IZ6 A;  2JIM A;  3GTK I;  4WV3 A;  4MRI A;  4R0M A;  1S72 Z;  3FKI I;  1W2B Z;  2QKD A;  1DL6 A;  2W04 A;  3IF8 A;  4DCS A;  3J81 b;  1KC8 1;  1KQS Y;  4X66 C;  3NDI A;  5E7Q A;  4G37 A;  4A3K I;  2OTL Z;  1VQN Z;  4OYC A;  2I3C A;  2QRC B;  4RM2 A;  2YX1 A;  4LFC C;  5D1P A;  1Z03 A;  3KIH A;  3Q87 A;  2ASB A;  3IEU A;  3CQZ I;  4DGL A;  3GTO I;  1IB8 A;  2UU9 C;  3G6E 1;  1BA3 A;  4PUI A;  3I55 Z;  1I6H I;  3HOZ I;  3F3F C;  4PUG A;  2Y0S A;  4NH1 C;  3FQQ A;  3I55 1;  4DQY B;  3HOY I;  1PG4 A;  3CQ3 A;  1HH2 P;  3IX0 A;  3GTM I;  3CCS Z;  4NBA A;  2XR1 A;  4DUZ C;  2D1S A;  4LE5 A;  2V8J A;  3CCS 1;  2YWB A;  5CZV A;  2IZ4 A;  2H85 A;  3CC7 Z;  2B63 I;  2MM9 A;  3VNQ A;  3AF6 A;  4DG9 A;  3CC7 1;  5T6B A;  1QXF A;  1YJ9 Z;  4NDN A;  5CM2 M;  1Q81 2;  4MD7 A;  1XNQ C;  2P2B A;  2KDN A;  1RLY A;  2QLV B;  4E33 A;  1Q86 2;  4A3J I;  2HF1 A;  2RPR A;  4D4I A;  2DE7 A;  2UXB C;  2OZK A;  3RV2 A;  3GTJ I;  4BY7 I;  5BR8 C;  2E8E A;  4RLQ A;  4JI3 C;  2D1Q A;  2ATW A;  1K73 2;  3L95 X;  1YJN 1;  2PN2 A;  1NJI 2;  1ZH1 A;  5AN9 F;  2E7G A;  4MXU A;  2E8C A;  3HKZ A;  3EER A;  3AY0 A;  4DV1 C;  1RO0 A;  1M6X C;  3NFZ A;  5LCI A;  2D7V A;  4BY1 I;  2E2I I;  2O4H A;  3CPW Z;  4GS5 A;  3H0G I;  5T67 A;  4NBF A;  3CCE 1; 
#chains in the Genus database with same CATH homology
 1V25 A;  4NXN C;  2V7B A;  1MXB A;  3CCU Z;  4L2Z A;  4X62 C;  4DR5 C;  1K8A 2;  1IBL C;  4JI7 C;  1KD1 1;  3TDH B;  2OOX B;  1YJW Z;  1YI2 1;  4HPV A;  3CJE A;  2GU2 A;  4Y52 I;  1VQ9 Z;  2NVY I;  1KKG A;  3J80 D;  2DE6 A;  3PBK A;  4DV2 C;  3GKU A;  1O90 A;  5BSV A;  3S1N I;  5C44 I;  2VSQ A;  3ESW A;  3R9X A;  1MXA A;  3I08 A;  4DCV A;  5FLX D;  1HNW C;  4NBG A;  4HGZ A;  1VQP Z;  2KI7 B;  2QVY X;  1VQ6 1;  4MON A;  2ZM6 C;  4RVD A;  1L1O C;  4A3D I;  4B3S C;  4NBE A;  3IEV A;  3MZL B;  3S17 I;  2E9H A;  2DPL A;  2VQE C;  4E30 A;  4PRO C;  4JI8 C;  1WH9 A;  1YHQ Z;  3BG0 B;  3A9U A;  2PT7 G;  3B7W A;  5KYT A;  5BST A;  1YHQ 1;  2VF1 A;  3IFU A;  4ODJ A;  2WB1 A;  1VQ4 Z;  2QW0 X;  2GTI A;  4RVG A;  1N8R 2;  3EQ6 A;  1VQ4 1;  1RNI A;  4G1I A;  2JS4 A;  1NP6 A;  2KZF A;  5A19 A;  2LFU A;  3I56 1;  4A3I I;  1M90 1;  1M1K 2;  2OO4 A;  5IP9 I;  1MXC A;  4GKJ C;  2P2M A;  3FQM A;  3T1Y C;  1QF8 A;  2UXC C;  3TE5 B;  5FLM I;  5IWA C;  1IBM C;  3TDE A;  1YIJ Z;  3NYR A;  4K0K C;  3S14 I;  2BH1 X;  3PRO C;  4LF7 C;  4B3T C;  3OW2 Z;  2P02 A;  1T5H X;  1PA4 A;  5IT9 D;  1QVG Z;  1I50 I;  4OX9 C;  3J80 f;  1TWA I;  1TWG I;  2PM9 A;  2P28 A;  2V8I A;  3S2D I;  5IFI A;  1L2F A;  3KXW A;  1RQF A;  3M3Y I;  5CZX A;  5KEI A;  5FLX f;  2R6M A;  3NPD A;  1QWI A;  4TNU A;  3VNR A;  3SO4 A;  2E5L C;  5BUQ A;  3G6E Z;  5GTD A;  1Q82 2;  3RZO I;  2EGT A;  2R93 I;  3UOW A;  1RO2 A;  3NH4 A;  3VMG A;  1UKK A;  4NOZ A;  3L8C A;  4JM1 A;  2E2H I;  1K0R A;  2QEX 1;  5KYV A;  2BJO A;  2K3R A;  1QVF Y;  1JJ2 Y;  4RM3 A;  2QR1 B;  4DK1 A;  4R1M A;  4BC9 A;  1XMO C;  4I9G A;  3HOU I;  2E2J I;  3DAY A;  2QA4 Z;  2F4M A;  2JMO A;  1VQK 1;  4DV0 C;  1FUG A;  5IP7 I;  3G71 1;  2QA4 1;  1WF3 A;  4B3M C;  3S1M I;  1VQO 1;  4DG8 A;  4JYA C;  4NBB A;  4EAT A;  2P2J A;  4LF6 C;  1QM4 A;  1KRL A;  1YJ7 A;  4GKK C;  4LF8 C;  2K5R A;  3DHV A;  3VMI A;  2JMP A;  2PRO A;  1O92 A;  4S1T A;  2LIY A;  3CMA 1;  3CCQ Z;  4KTT A;  1YJN Z;  4D57 A;  2GTH A;  1VQL 1;  3E7W A;  3CCQ 1;  1LCI A;  1RG9 A;  4NBC A;  5A1G A;  2P3Y A;  4B3R C;  3CCV Z;  4DR7 C;  4E2Z A;  4E2X A;  3JAM D;  1YUA A;  4AYB A;  2UXD C;  3CCV 1;  1YIT 1;  5A2Q D;  3VTN A;  3LNV A;  3MZK B;  4XX2 A;  1PFT A;  3CCJ Z;  3J80 b;  2NVQ I;  4I9F A;  4DCU A;  3CCE Z;  1ML8 A;  4TPS B;  3CCJ 1;  2Q4Z A;  5IT9 f;  1O93 A;  1VLA A;  3GKQ A;  1Q7Y 2;  1N34 C;  1P9N A;  2O53 A;  2HHH C;  2CY1 A;  2F4O A;  2YAD A;  2WAQ A;  5FLX b;  2OPL B;  1YI2 Z;  2Y4N A;  5DV9 A;  4U5Y D;  3M4O I;  4LF9 C;  4JV5 C;  1K9M 2;  1K83 I;  4LF5 C;  4G36 A;  5K8F A;  2ONF A;  3R9W A;  3HOV I;  4JI2 C;  4RV9 A;  4RVF A;  2P20 A;  2OPL A;  4K0B A;  1NUI A;  4DR4 C;  3CC4 1;  4E2W A;  1VQ6 Z;  1KC8 2;  4DR2 C;  2V8K A;  3CXC Z;  4OXI A;  4D4G A;  3CCM 1;  1N2F A;  4HGY A;  2AKL A;  1N33 C;  2P2F A;  3A9V A;  3IPL A;  3CW9 A;  4GXR A;  4BCA A;  3LAX A;  1VQ5 1;  3TUF A;  1V26 A;  4KTV A;  4RVO A;  4MTN A;  5BUR A;  2G2K A;  5T64 A;  5AE2 A;  3S1R I;  3CPW Y;  4PZP A;  1XRA A;  2UUC C;  3NYQ A;  3D9X A;  1P7L A;  3I56 Z;  2KPI A;  3HOX I;  1NYE A;  1IBK C;  2NVT I;  4D56 A;  4YHH C;  1YUK A;  4DR1 C;  5C4J I;  2QL8 A;  2QVZ X;  3JAM f;  1Q81 1;  5IT9 b;  2J6A A;  3F3P C;  5A2Q f;  2JA5 I;  1KQS Z;  4AQY C;  4LFB C;  3NI2 A;  1Q86 1;  4DV4 C;  2AYA A;  5C3E I;  1SFO I;  4RVN A;  2OOY B;  4E2Y A;  1FJG C;  5H9U A;  4NFR A;  4BC7 A;  2D27 A;  4FTF A;  5BSU A;  2RIQ A;  1WII A;  1K73 1;  1NJI 1;  2M6N A;  3U50 C;  3G7S A;  1WW9 A;  1QVF Z;  2IZ3 A;  4NBD A;  5ADZ A;  4YY3 C;  1MDB A;  1PG3 A;  3T1H C;  1TWF I;  4ISB A;  5K85 A;  3UZ0 A;  3GTQ I;  1ULT A;  4R1L A;  2WD9 A;  2M48 A;  1KD1 2;  3I07 A;  1TWH I;  2JUB A;  1K8A 1;  2HJG A;  4IR7 A;  4LFA C;  5BUS A;  3FCE A;  1JOS A;  3GR0 A;  3GR1 A;  1VQ7 1;  4JI6 C;  1X3Z A;  2QEX Z;  1VQM 1;  3CCR Z;  3CW8 X;  3I4M I;  2P2Q A;  4JI0 C;  4BXX I;  1XNR C;  3CCR 1;  4ZLP A;  4MD8 A;  1I3Q I;  3PO2 I;  2D1T A;  1VQK Z;  3N2Q A;  3VNS A;  1S72 1;  3G71 Z;  3QWU A;  1TWC I;  1Z02 A;  4JI1 C;  2VQF C;  1VQO Z;  1MKY A;  2HU9 A;  4JI4 C;  3D6W A;  3NH5 A;  3J7A 4;  2OTL 1;  1VQN 1;  3GTG I;  3JAM b;  3S2H I;  4PHT A;  2OBV A;  5T8T A;  1XMQ C;  2CXC A;  4E31 A;  3MON A;  5A2Q b;  1WCM I;  2E0G A;  3CMA Z;  3HOW I;  1MDF A;  3PES A;  1USP B;  4E32 A;  2OTJ Z;  3OW2 Y;  3R44 A;  4DV7 C;  1VQL Z;  1QVG Y;  3GTP I;  2RBL A;  3J81 D;  2OTJ 1;  3I4N I;  4RLF A;  3DLP X;  1R9T I;  1W2B Y;  1YIT Z;  5C4X I;  4A3G I;  1N8R 1;  4Y7N I;  4NB9 A;  4A3L I;  1LQL A;  1M90 2;  2RT9 A;  2YWC A;  1USP A;  4LF4 C;  2PK7 A;  2JA8 I;  1M1K 1;  1JWH C;  5BSR A;  3CC2 Z;  1YJ9 1;  2E8F A;  1AMU A;  2VUM I;  3CC2 1;  1HNZ C;  3S82 A;  1HNX C;  4GXQ A;  2QRE B;  3NH8 A;  1RY2 A;  1VQ8 Z;  2VZE A;  1TFI A;  3N54 B;  1VQ8 1;  3NDJ A;  1X3W A;  4NBH A;  4NB8 A;  3CC4 Z;  1Y1V S;  1J5E C;  3S15 I;  1RO4 A;  1I94 C;  3GPC A;  2JR6 A;  3C5E A;  4A3E I;  2Q51 A;  4DUY C;  3CCM Z;  1ZB9 A;  1HR0 C;  1GPM A;  3GTL I;  4QTU A;  4A3B I;  2Y4O A;  3FCC A;  3CCU 1;  2D28 C;  2Y27 A;  1XRB A;  5D1O B;  3T4N B;  1VQ5 Z;  3CCL Z;  1YJW 1;  1Q82 1;  3CCL 1;  2WP0 C;  4DCT A;  1VQ9 1;  5BSM A;  4A3M I;  3H2T A;  4X64 C;  3RG2 A;  4DV3 C;  4ZJZ A;  5AE3 A;  3VMH A;  2YU9 I;  2DYJ A;  4KHP C;  5D1O A;  4FUT A;  5LMU C;  3P5J B;  4BBY A;  5JRH A;  4DR6 C;  3J81 f;  3S1Q I;  3VB9 A;  3G4S Z;  1QYP A;  3RZD I;  2YCB A;  3PO3 S;  2JA6 I;  4BSZ A;  1S7M A;  1VQP 1;  3TQI A;  1Z01 A;  1XRC A;  3G4S 1;  2RHB A;  5T8S A;  4DV5 C;  2QVX X;  2QRD B;  4RMN A;  1Y1V I;  5AE1 A;  2ZAE B;  3EED A;  4EWC A;  4DV6 C;  3K7A I;  4L7I A;  4BBR I;  5LMN C;  4RVH A;  1O9T A;  3ETO A;  4NXM C;  4A3F I;  1EGA A;  4A93 I;  3S16 I;  2JNY A;  3BG1 B;  3A4I A;  1T5D X;  3LUS A;  2UUB C;  2DE5 A;  3CD6 Z;  2JA7 I;  2D1R A;  3AF5 A;  2R7Z I;  4DR3 C;  1JJ2 Z;  3CXC Y;  1N36 C;  3CD6 1;  3OTO C;  3LGX A;  4FUQ A;  4L4Q A;  2F4V C;  4JI5 C;  4QTT A;  2R92 I;  5A1I A;  5BSW A;  3KIF A;  4MD9 A;  3CME Z;  4X65 C;  1Q7Y 1;  1MD9 A;  4MH4 A;  3CME 1;  2NVX I;  2W03 A;  4CL1 A;  4HH4 A;  3GTM S;  3PO3 I;  4BBS I;  2PMZ A;  1VQ7 Z;  2VUG A;  2UUA C;  5LL6 f;  3ETC A;  1Y1W I;  1N32 C;  1VQM Z;  1K9M 1;  3IML A;  3E7X A;  4RS4 A;  1YIJ 1;  4A3C I;  1ZB8 A;  4X6A I;  4WS9 A;  3H3V J;  1X0T A;  3GCF A;  4IZ6 A;  3GTK I;  4WV3 A;  4MRI A;  4R0M A;  1S72 Z;  3FKI I;  1W2B Z;  2QKD A;  1DL6 A;  2W04 A;  3IF8 A;  4DCS A;  3J81 b;  1KC8 1;  1KQS Y;  4X66 C;  3NDI A;  5E7Q A;  4G37 A;  4A3K I;  2OTL Z;  1VQN Z;  4OYC A;  2I3C A;  2QRC B;  4RM2 A;  4LFC C;  5D1P A;  1Z03 A;  3KIH A;  3Q87 A;  2ASB A;  3IEU A;  3CQZ I;  4DGL A;  3GTO I;  2UU9 C;  3G6E 1;  1BA3 A;  3I55 Z;  1I6H I;  3HOZ I;  3F3F C;  2Y0S A;  4NH1 C;  3FQQ A;  3I55 1;  4DQY B;  3HOY I;  1PG4 A;  1HH2 P;  3IX0 A;  3GTM I;  3CCS Z;  4NBA A;  2XR1 A;  4DUZ C;  2D1S A;  4LE5 A;  2V8J A;  3CCS 1;  2YWB A;  5CZV A;  2IZ4 A;  2H85 A;  3CC7 Z;  2B63 I;  3VNQ A;  3AF6 A;  4DG9 A;  3CC7 1;  5T6B A;  1YJ9 Z;  4NDN A;  5CM2 M;  1Q81 2;  4MD7 A;  1XNQ C;  2P2B A;  1RLY A;  2QLV B;  4E33 A;  1Q86 2;  4A3J I;  2HF1 A;  2RPR A;  4D4I A;  2DE7 A;  2UXB C;  2OZK A;  3RV2 A;  3GTJ I;  4BY7 I;  5BR8 C;  2E8E A;  4RLQ A;  4JI3 C;  2D1Q A;  2ATW A;  1K73 2;  3L95 X;  1YJN 1;  2PN2 A;  1NJI 2;  1ZH1 A;  5AN9 F;  2E7G A;  4MXU A;  2E8C A;  3HKZ A;  3EER A;  4DV1 C;  1RO0 A;  3NFZ A;  2D7V A;  4BY1 I;  2E2I I;  2O4H A;  3CPW Z;  4GS5 A;  3H0G I;  5T67 A;  4NBF A;  3CCE 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...