1ML8A

Structural genomics
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERRERLFTHINLHFIVTGRDLKDAAVARAVDLSAEKYCSVALMLEKAVNITHSYEVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein (crp region)
total genus 35
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2002-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ml8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ml8A02
5IT9D 3CJEA 1PFTA 2K5RA 2R92I 4A3MI 3S14I 2HJGA 1RO4A 2NVTI 4DCTA 2DYJA 2JMPA 3VMHA 2NVQI 4X66C 4JYAC 4NBEA 1MKYA 1IBLC 1K0RA 3HOWI 2PN2A 1TFIA 4LFCC 1TWFI 4DV2C 4A3II 1N2FA 4NBFA 2ONFA 2UXDC 3GTLI 4JV5C 2OPLA 1R9TI 4GKJC 3T1YC 3RZDI 4LFBC 4DR6C 2YCBA 3K7AI 5C4JI 4A3BI 4Y52I 4NOZA 4LF9C 3H3VJ 2KZFA 5IP9I 2VQFC 4LF5C 2DE6A 4NBBA 3AF5A 4DUZC 4NXMC 3I4NI 2ASBA 1NUIA 2UUCC 1FJGC 1Y1VI 4XX2A 3GTPI 3RZOI 3PO3S 2OPLB 3HOUI 4DCVA 1ZB8A 1VLAA 3Q87A 2JNYA 4A93I 4DR3C 4B3MC 4DR1C 4BY7I 5FLMI 1L2FA 4DV7C 3VB9A 4NBDA 2JA5I 1QWIA 4DV0C 2UUBC 2RBLA 3S1QI 4X6AI 3GTGI 2D7VA 3S15I 4YHHC 4B3SC 4DR7C 3GTMI 3GKUA 5C44I 1HNZC 2PK7A 2HHHC 4DV4C 2BJOA 1IBMC 4BY1I 5LMUC 2ZM6C 3M3YI 4A3DI 4LFAC 4B3RC 2AKLA 1XMQC 4JI0C 4DCUA 2E2II 5IP7I 4MTNA 4JI7C 4QTTA 4A3KI 3J81D 4JI2C 4LF8C 1XNRC 4K0KC 3GTKI 4BXXI 2J6AA 2R93I 4NB8A 5C3EI 2YU9I 4DUYC 2E8FA 2NVXI 3R9WA 1USPB 4A3EI 4NB9A 5FLXD 2CY1A 4BBRI 1EGAA 1HNXC 4JI6C 2DE5A 2JR6A 3FKII 4LF7C 2ATWA 3AF6A 3S16I 3S1MI 2E8EA 2VQEC 4MH4A 1X3WA 4LF4C 1I3QI 2UU9C 5CM2M 4JI8C 3D6WA 2E2JI 4A3GI 3T1HC 4NXNC 3ESWA 4Y7NI 3S17I 3GTOI 1L1OC 2UUAC 1ML8A 5BR8C 2EGTA 1UKKA 3HOZI 1YUAA 1XMOC 1HNWC 4NBAA 3VMGA 2HF1A 2E8CA 2JA8I 3GTQI 3U50C 1USPA 3HOVI 3S1RI 1N32C 1DL6A 3PO2I 1WH9A 1HH2P 1N33C 1WW9A 4X64C 2UXBC 3CQZI 3HOYI 3OTOC 4DR2C 4NBHA 1QYPA 4A3LI 1Y1VS 3PO3I 4DV5C 1TWGI 2JS4A 3S1NI 2F4OA 1TWAI 4QTUA 4DR5C 1WF3A 2QL8A 4X62C 2VUMI 1N34C 2UXCC 1J5EC 4DV1C 3IEVA 2F4VC 5IWAC 5C4XI 4DV3C 2DE7A 3R9XA 3LUSA 1N36C 3H0GI 1I50I 4BBSI 1TWHI 1WCMI 4KHPC 4X65C 3J80D 4NBCA 3GKQA 4OX9C 3I4MI 2E2HI 1IBKC 4JI3C 3GCFA 1RLYA 2JA6I 3I07A 4JI5C 4A3CI 4YY3C 4NBGA 2CXCA 1I94C 4B3TC 1PA4A 4A3JI 2KPIA 2PT7G 2NVYI 4JI4C 3VMIA 3JAMD 3HOXI 1I6HI 2JA7I 3S2DI 4LF6C 1KKGA 4DR4C 3IEUA 3M4OI 3S2HI 4GKKC 3GTMS 1HR0C 1ZB9A 5A2QD 4DV6C 1XNQC 1TWCI 1LQLA 1JOSA 4AQYC 2R7ZI 3GTJI 2E7GA 2F4MA 1NYEA 4JI1C 2XR1A 4A3FI 1K83I 3EERA 1X3ZA 5LMNC 4BSZA 4DCSA 2P3YA 1Y1WI 2B63I 1SFOI 2E5LC
chains in the Genus database with same CATH superfamily
4A3MI 3NH5A 3G71Z 2D1QA 3CC4Z 2DYJA 5T67A 2NVQI 3RG2A 4JYAC 2O4HA 3CCUZ 1TWFI 3KIHA 3NH4A 3T4NB 4NBFA 1S72Z 3T1YC 3RZDI 1VQL1 4LFBC 3CME1 1QVGZ 3CPWY 3A9UA 2KZFA 1VQ4Z 1QVGY 1XHJA 3NYRA 4LF5C 1Q862 1VQ9Z 3AF5A 5CZXA 3E7XA 4NXMC 2UUCC 4G37A 2W04A 3FCCA 4U5YD 2M48A 4DV0C 2RBLA 3CCR1 3A9VA 3CCEZ 3PROC 3S15I 4IR7A 4RM2A 4B3SC 1JJ2Y 2E9HA 3CC41 4I9FA 4BBYA 2WAQA 2LEXA 4RVNA 4BY1I 2ZM6C 1M902 3M3YI 3EQ6A 4RVFA 1WJ2A 3J81b 4JI0C 2VPWA 2LFUA 2OOYB 4BC7A 4JI7C 5D1OB 4A3KI 1MXAA 1V26A 2JIPA 1XNRC 3GTKI 4BXXI 3DAYA 5DV9A 4NB8A 2PMZA 5C3EI 4DUYC 1O93A 4EWCA 2NVXI 3BG1B 4A3EI 1Q861 2CY1A 4BBRI 1EGAA 3NPDA 4JI6C 3J81f 5D1OA 1RO2A 1MD9A 3AF6A 4LF4C 2VQEC 3UEBA 2UU9C 5IT9b 3I551 3CCQ1 3D6WA 2E2JI 3J7A4 4NXNC 5BSMA 2E7ZA 3GTOI 1VQ8Z 2Z51A 1VQMZ 3L95X 3I08A 4WV3A 4HGZA 3CCJ1 3ETCA 4LE5A 1YUAA 1XMOC 2QA4Z 3F3PC 2HF1A 3VMGA 2R6MA 2JA8I 2E8CA 3U50C 3LGXA 3HOVI 3CC21 1HH2P 4X64C 3HOYI 4DR2C 2WB1A 3G711 3PO3I 2P2JA 4DV5C 1FJGC 1FUGA 4DR5C 4X62C 4D56A 3CMA1 5BUSA 4E2YA 1J5EC 3UZ0A 4E30A 2D27A 2OO4A 2IZ4A 4S1TA 3LUSA 1XRBA 4BBSI 3VNSA 1TWHI 1VQ71 3CMEZ 4OX9C 3OW2Y 5ADZA 3I4MI 2JIMA 2QVYX 1RLYA 1VQ81 4BC9A 2GU2A 3D9XA 4YY3C 3CXCY 1W2BZ 2VPYA 3TR3A 2NVYI 1N8R1 1I6HI 2JA7I 1WIIA 2VPXA 3CCL1 1XRCA 1MXBA 2QVZX 3O2EA 2RHBA 1ZB9A 1MDFA 1QVFZ 4DV6C 1LQLA 1BA3A 2RPRA 1VQO1 1P4EC 2QA41 4A3FI 5T6BA 1X3ZA 4BSZA 2OTJZ 4RS4A 1PFTA 2K5RA 2R92I 3S14I 3VTNA 1RO4A 3UX2A 2ZZMA 2QLVB 1YHQ1 3VMHA 4X66C 1KD12 1Q821 3P5JB 4GS5A 1K732 1IBLC 3CW9A 2BH1X 4MONA 4E32A 3HKZA 4A3II 4EATA 1N2FA 1Q822 4FTFA 4JV5C 2JIQA 4MRIA 4GKJC 4IZ6A 3CCLZ 4E31A 2HU9A 4G1IA 4DR6C 4A3BI 3F3FC 4NOZA 3H3VJ 3IMLA 3TQIA 2LIYA 1FDOA 5BSRA 4DUZC 2ASBA 1NUIA 2QVXX 1Y1VI 1NJI2 3GTPI 3RZOI 3HOUI 2Y27A 1VQM1 4DG8A 4KTVA 4DR3C 2O53A 4B3MC 3RV2A 5BUQA 5FLMI 4DV7C 1NJI1 4NBDA 2JA5I 2WP0C 1NY8A 2UUBC 2JIOA 4E2WA 1YJN1 4D4GA 4YHHC 5K85A 5A1IA 2G2KA 4DR7C 3NYQA 3NDJA 1YHQZ 5C44I 2HHHC 2Y4NA 2BJOA 1MXCA 1IBMC 3CQ1A 3S82A 1VQ51 3PBKA 3NFZA 2OTJ1 3CMAZ 4MTNA 2NAPA 2OBVA 1VQ7Z 2R93I 1P4EA 2OZKA 5AE3A 3TDEA 1HNXC 4DG9A 3FKII 3CC7Z 3D2LA 2ATWA 3S1MI 2W03A 5T8TA 2QRCB 4TPSB 1QF8A 2PROA 3CCE1 3T1HC 2OTLZ 1PG4A 3IR7A 4Y7NI 3S17I 4OYCA 2D1RA 1WCJA 3ETOA 2EGTA 2VF1A 3QWUA 1VQOZ 4RVGA 4NBAA 4RVDA 1USPA 3JAMb 3LNOA 3S1RI 1N32C 5A19A 1VQKZ 1WW9A 1JJ2Z 3OTOC 2QEXZ 2MMAB 5AE1A 1QYPA 4A3LI 2Q51A 2JS4A 3N2QA 5A1GA 1WF3A 2QL8A 3KXWA 4MD9A 2NCLA 4L4QA 4ISBA 4DV1C 1V60A 3CC71 1Q16A 5LL6f 5C4XI 2KZ0A 5IWAC 2P2FA 4DV3C 3R9XA 4DQYB 3I55Z 2AYDA 3CCQZ 1N8R2 1WCMI 2DPLA 5KYTA 2YADA 3G4SZ 3I561 2P2QA 4JI3C 4GXQA 1T5HX 3FQMA 5BSWA 1YI2Z 3A4IA 1KKGA 1YITZ 4LF6C 1NP6A 3IEUA 2K3RA 3MZKB 3M4OI 2OTL1 5IFIA 1KC82 1RQFA 4R0MA 1YJNZ 1Y8CA 4AQYC 5LCIA 3GTJI 2E7GA 4JI1C 2XR1A 1GPMA 1M6XC 2YWCA 1SFOI 2KI7B 4K0BA 1XS3A 1VQ5Z 4DCSA 2P3YA 1Y1WI 3L8CA 2M6NA 2MM9A 2QEX1 4OXIA 1LCIA 3CCSZ 1O92A 2V8KA 4NBEA 4PUGA 3G6E1 2PN2A 1S7MA 5D1PA 2ONFA 2UXDC 1R9TI 1YIT1 5JRHA 2YCBA 4RVOA 3K7AI 4Y52I 4MD8A 4E2ZA 5IP9I 1P7LA 4ZJZA 3UOWA 3CPWZ 4NBBA 3I4NI 2Y0SA 1Q812 3NH8A 1K8A1 3PESA 3FQQA 2V45A 1YI21 1ZB8A 4NFRA 4A93I 2M5OA 3DHVA 4DCVA 1YJWZ 2ZAEB 3H2TA 1K8A2 2D1TA 3VB9A 1RG9A 1Q811 1QXFA 3S1QI 4X6AI 1PG3A 1AMUA 2Y4OA 1X0TA 1VQK1 3GTMI 3CCS1 3GKUA 2PK7A 4PROC 4DV4C 3CCVZ 5LMUC 4A3DI 1KD11 1KQSZ 4L2ZA 4PZPA 2Q4ZA 1KQSY 2VPZA 2E0GA 4DCUA 2E2II 5IP7I 3CCMZ 1YIJZ 4LF8C 4K0KC 1O9TA 4I9GA 2E8FA 2ZZNA 3G4S1 3R9WA 1USPB 3EEDA 4RV9A 3I56Z 5FLXD 4PHTA 2DE5A 2JR6A 1YJW1 4MH4A 1X3WA 5IT9f 2M5HA 5CM2M 1O90A 3CD6Z 1YJ91 1FDIA 1UWDA 3ESWA 3AY0A 4R1LA 3BG0B 1JWHC 2JUBA 1HNWC 4BCAA 4L7IA 3LNVA 3GTQI 1T5DX 4NDNA 2QRDB 2YWBA 1VQN1 1P9NA 3CCM1 4FUQA 4RVHA 4NBHA 5FLXf 1Y1VS 1TWGI 2WD9A 2F4OA 2RT9A 2UXCC 2RIQA 5KYVA 2VUMI 3GPCA 2AYAA 1VQ6Z 4TNUA 3IEVA 1Z02A 1KC81 2P28A 2DE7A 2VUGA 1MDBA 2VSQA 1QM4A 1N36C 1I50I 1Q7Y2 3CD61 4KHPC 3J80D 1YJ9Z 4ZLPA 2E2HI 3GCFA 4RLQA 2JA6I 2KDNA 3UX3A 4A3CI 1WZNA 4NBGA 2QKDA 3MZLB 1K9M1 2PT7G 3GR0A 4B3TC 4WS9A 4AYBA 1VEHA 4NH1C 3HOXI 3JAMD 1VQLZ 1M901 2V3VA 3S2HI 3GTMS 1IB8A 5A2QD 4DGLA 4PUHA 5BSVA 1JOSA 2P02A 1PU1A 3LAXA 2R7ZI 1NYEA 2GTHA 3TE5B 5AE2A 1VQP1 4D4IA 1K83I 3EERA 1XRAA 5LMNC 2B63I 2YU9I 2UUAC 5T64A 5IT9D 3CJEA 2QR1B 3JAMf 2HJGA 2QW0X 4PUIA 2NVTI 4DCTA 1YJ7A 2JMPA 4JM1A 1Z03A 1MKYA 3OW2Z 1K0RA 3HOWI 1TFIA 4RM3A 4LFCC 4DV2C 1K731 3GTLI 2V8IA 2OPLA 5C4JI 4LF9C 5H9UA 2QREB 2VQFC 2DE6A 1QVFY 4D57A 3IFUA 3DLPX 3PO3S 4XX2A 2OPLB 1RY2A 1VLAA 3Q87A 2JNYA 4DR1C 2P20A 4BY7I 1L2FA 3IF8A 3B7WA 1QWIA 3GTGI 2D7VA 3SO4A 5BSTA 4HGYA 2VZEA 1HNZC 1VQPZ 3CCJZ 3G7SA 4LFAC 3G6EZ 2IZ3A 4B3RC 3GR1A 2AKLA 5A2Qf 1XMQC 2JNVA 2MCQA 1VQ61 3CC2Z 4KTTA 1ZH1A 2OOXB 2GTIA 1FLOA 4GXRA 4QTTA 4ODJA 3J81D 4JI2C 4R1MA 2J6AA 5T8SA 2V8JA 4HPVA 1M1K2 4NB9A 1W2BY 2DHMA 5K8FA 2JMOA 4LF7C 3S16I 2E8EA 3CQ3A 1I3QI 4JI8C 4A3GI 2I3CA 4G36A 1ULTA 2CU6A 2D28C 2V7BA 3TUFA 1L1OC 3CW8X 3MONA 1ML8A 5BR8C 3CCV1 1UKKA 1AA6A 3IPLA 3IX0A 3HOZI 2IV2X 1TH5A 4MD7A 1SIWA 3CXCZ 5BSUA 3CCRZ 4FUTA 5BURA 4MXUA 1M6XA 2P2BA 1DL6A 3E7WA 3PO2I 1WH9A 3NDIA 5KEIA 3VNQA 5E7QA 1N33C 2UXBC 3CQZI 1YIJ1 1RNIA 5GTDA 1Z01A 4RLFA 4DK1A 5FLXb 3A25A 3S1NI 4QTUA 1TWAI 1YUKA 5CZVA 1N34C 4RMNA 2F4VC 4HH4A 3TDHB 4E33A 3J80b 2D1SA 3K6RA 3VNRA 3H0GI 1S721 3R44A 1M1K1 4X65C 4NBCA 3GKQA 1RO0A 3KIFA 1IBKC 1VQ41 3CCU1 1VQ91 3I07A 4JI5C 1I94C 3CQ2A 2CXCA 3NI2A 3J80f 4A3JI 2KPIA 1PA4A 4JI4C 3VMIA 5A2Qb 3S2DI 4DR4C 4GKKC 4CL1A 1VQNZ 2YX1A 1HR0C 1XNQC 1V25A 1TWCI 1K9M2 3N54B 2P2MA 1KRLA 2F4MA 2JIRA 4E2XA 2H85A 3A26A 3FCEA 1Q7Y1 3C5EA 5AN9F 2PM9A 2E5LC
chains in the Genus database with same CATH topology
4A3MI 3NH5A 3G71Z 2D1QA 3CC4Z 2DYJA 5T67A 2NVQI 3RG2A 4JYAC 2O4HA 3CCUZ 1TWFI 3KIHA 3NH4A 3T4NB 4NBFA 1S72Z 3T1YC 3RZDI 1VQL1 4LFBC 3CME1 1QVGZ 3CPWY 3A9UA 2KZFA 1VQ4Z 1QVGY 4LF5C 3NYRA 1Q862 1VQ9Z 3AF5A 5CZXA 3E7XA 4NXMC 2UUCC 4G37A 2W04A 3FCCA 4U5YD 2M48A 4DV0C 2RBLA 3CCR1 3A9VA 3CCEZ 3PROC 3S15I 4IR7A 4RM2A 4B3SC 1JJ2Y 2E9HA 3CC41 4I9FA 4BBYA 2WAQA 4RVNA 4BY1I 2ZM6C 1M902 3M3YI 3EQ6A 4RVFA 3J81b 4JI0C 2LFUA 2OOYB 4BC7A 4JI7C 5D1OB 4A3KI 1MXAA 1V26A 1XNRC 3GTKI 4BXXI 3DAYA 5DV9A 4NB8A 2PMZA 5C3EI 4DUYC 1O93A 4EWCA 2NVXI 3BG1B 4A3EI 1Q861 2CY1A 4BBRI 1EGAA 3NPDA 4JI6C 3J81f 5D1OA 1RO2A 1MD9A 3AF6A 4LF4C 2VQEC 2UU9C 5IT9b 3I551 3CCQ1 3D6WA 2E2JI 3J7A4 4NXNC 5BSMA 3GTOI 1VQ8Z 1VQMZ 3L95X 3I08A 4WV3A 4HGZA 3CCJ1 3ETCA 4LE5A 1YUAA 1XMOC 2QA4Z 3F3PC 2HF1A 3VMGA 2R6MA 2JA8I 2E8CA 3U50C 3LGXA 3HOVI 3CC21 1HH2P 4X64C 3HOYI 4DR2C 2WB1A 3G711 3PO3I 2P2JA 4DV5C 1FJGC 1FUGA 4DR5C 4X62C 4D56A 3CMA1 5BUSA 4E2YA 1J5EC 3UZ0A 4E30A 2D27A 2OO4A 2IZ4A 4S1TA 3LUSA 1XRBA 4BBSI 3VNSA 1TWHI 1VQ71 3CMEZ 4OX9C 3OW2Y 5ADZA 3I4MI 2QVYX 1RLYA 1VQ81 4BC9A 2GU2A 3D9XA 4YY3C 3CXCY 1W2BZ 2NVYI 1N8R1 1I6HI 2JA7I 1WIIA 3CCL1 2QVZX 1XRCA 1MXBA 2RHBA 1ZB9A 1MDFA 1QVFZ 4DV6C 1LQLA 1BA3A 2RPRA 1VQO1 2QA41 4A3FI 5T6BA 1X3ZA 4BSZA 2OTJZ 4RS4A 1PFTA 2K5RA 2R92I 3S14I 3VTNA 1RO4A 2QLVB 1YHQ1 3VMHA 4X66C 1KD12 1Q821 3P5JB 4GS5A 1K732 1IBLC 3CW9A 2BH1X 4MONA 4E32A 3HKZA 4A3II 4EATA 1N2FA 1Q822 4FTFA 4JV5C 4MRIA 4GKJC 4IZ6A 3CCLZ 4E31A 2HU9A 4G1IA 4DR6C 4A3BI 3F3FC 4NOZA 3H3VJ 3IMLA 3TQIA 2LIYA 5BSRA 4DUZC 2ASBA 1NUIA 2QVXX 1Y1VI 1NJI2 3GTPI 3RZOI 3HOUI 2Y27A 1VQM1 4DG8A 4KTVA 4DR3C 2O53A 4B3MC 3RV2A 5BUQA 5FLMI 4DV7C 1NJI1 4NBDA 2JA5I 2WP0C 2UUBC 4E2WA 1YJN1 4D4GA 4YHHC 5K85A 5A1IA 2G2KA 4DR7C 3NYQA 3NDJA 1YHQZ 5C44I 2HHHC 2Y4NA 2BJOA 1MXCA 1IBMC 3S82A 1VQ51 3PBKA 3NFZA 2OTJ1 3CMAZ 4MTNA 2OBVA 1VQ7Z 2R93I 2OZKA 5AE3A 3TDEA 1HNXC 4DG9A 3FKII 3CC7Z 2ATWA 3S1MI 2W03A 5T8TA 2QRCB 4TPSB 1QF8A 2PROA 3CCE1 3T1HC 2OTLZ 1PG4A 4Y7NI 3S17I 4OYCA 2D1RA 3ETOA 2EGTA 2VF1A 3QWUA 4RVGA 1VQOZ 4NBAA 4RVDA 1USPA 3JAMb 3S1RI 1N32C 5A19A 1VQKZ 1WW9A 1JJ2Z 3OTOC 2QEXZ 5AE1A 1QYPA 4A3LI 2Q51A 2JS4A 3N2QA 5A1GA 1WF3A 2QL8A 3KXWA 4MD9A 4L4QA 4ISBA 4DV1C 5IWAC 3CC71 5LL6f 5C4XI 4DV3C 2P2FA 3R9XA 4DQYB 3I55Z 3CCQZ 1N8R2 1WCMI 2DPLA 5KYTA 2YADA 3G4SZ 3I561 2P2QA 4JI3C 4GXQA 1T5HX 3FQMA 5BSWA 1YI2Z 3A4IA 1KKGA 1YITZ 4LF6C 1NP6A 3IEUA 2K3RA 3MZKB 3M4OI 2OTL1 5IFIA 1KC82 1RQFA 4R0MA 1YJNZ 4AQYC 3GTJI 2E7GA 4JI1C 2XR1A 1GPMA 2YWCA 1SFOI 2KI7B 4K0BA 1VQ5Z 4DCSA 2P3YA 1Y1WI 3L8CA 2M6NA 2QEX1 4OXIA 1LCIA 3CCSZ 1O92A 2V8KA 4NBEA 3G6E1 2PN2A 1S7MA 5D1PA 2ONFA 2UXDC 1R9TI 1YIT1 5JRHA 2YCBA 4RVOA 3K7AI 4Y52I 4MD8A 4E2ZA 5IP9I 1P7LA 4ZJZA 3UOWA 3CPWZ 4NBBA 3I4NI 2Y0SA 1Q812 3NH8A 1K8A1 3PESA 3FQQA 3DHVA 1YI21 1ZB8A 4NFRA 4A93I 4DCVA 1YJWZ 2ZAEB 3H2TA 1K8A2 2D1TA 3VB9A 1RG9A 1Q811 3S1QI 4X6AI 1PG3A 1AMUA 2Y4OA 1X0TA 1VQK1 3GTMI 3CCS1 3GKUA 2PK7A 4PROC 4DV4C 3CCVZ 5LMUC 4A3DI 1KD11 1KQSZ 4L2ZA 4PZPA 2Q4ZA 1KQSY 2E0GA 4DCUA 2E2II 5IP7I 3CCMZ 1YIJZ 4LF8C 4K0KC 1O9TA 4I9GA 2E8FA 3G4S1 3R9WA 1USPB 3EEDA 4RV9A 3I56Z 5FLXD 4PHTA 2DE5A 2JR6A 1YJW1 4MH4A 1X3WA 5IT9f 5CM2M 1O90A 3CD6Z 1YJ91 3ESWA 4R1LA 3BG0B 1JWHC 2JUBA 1HNWC 4BCAA 4L7IA 3LNVA 3GTQI 1T5DX 4NDNA 2QRDB 2YWBA 1VQN1 1P9NA 3CCM1 4FUQA 4RVHA 4NBHA 5FLXf 1Y1VS 1TWGI 2WD9A 2F4OA 2RT9A 2UXCC 2RIQA 5KYVA 2VUMI 3GPCA 2AYAA 1VQ6Z 4TNUA 3IEVA 1Z02A 1KC81 2P28A 2DE7A 2VUGA 1MDBA 2VSQA 1QM4A 1N36C 1I50I 1Q7Y2 3CD61 4KHPC 3J80D 1YJ9Z 4ZLPA 2E2HI 3GCFA 4RLQA 2JA6I 4A3CI 4NBGA 2QKDA 3MZLB 1K9M1 2PT7G 3GR0A 4B3TC 4WS9A 4AYBA 3JAMD 4NH1C 3HOXI 1VQLZ 1M901 3S2HI 3GTMS 5A2QD 4DGLA 5BSVA 1JOSA 2P02A 3LAXA 2R7ZI 1NYEA 2GTHA 3TE5B 5AE2A 1VQP1 4D4IA 1K83I 3EERA 1XRAA 5LMNC 2B63I 2YU9I 2UUAC 5T64A 5IT9D 3CJEA 2QR1B 3JAMf 2HJGA 2QW0X 2NVTI 4DCTA 1YJ7A 2JMPA 4JM1A 1Z03A 1MKYA 3OW2Z 1K0RA 3HOWI 1TFIA 4RM3A 4LFCC 4DV2C 1K731 3GTLI 2V8IA 2OPLA 5C4JI 4LF9C 5H9UA 2QREB 2VQFC 2DE6A 1QVFY 4D57A 3IFUA 3DLPX 3PO3S 4XX2A 2OPLB 1RY2A 1VLAA 3Q87A 2JNYA 4DR1C 2P20A 4BY7I 1L2FA 3IF8A 3B7WA 1QWIA 3GTGI 2D7VA 3SO4A 5BSTA 4HGYA 2VZEA 1HNZC 1VQPZ 3CCJZ 3G7SA 4LFAC 3G6EZ 2IZ3A 4B3RC 3GR1A 2AKLA 5A2Qf 1XMQC 1VQ61 3CC2Z 4KTTA 1ZH1A 2OOXB 2GTIA 4GXRA 4QTTA 4ODJA 3J81D 4JI2C 4R1MA 2J6AA 5T8SA 2V8JA 4HPVA 1M1K2 4NB9A 1W2BY 5K8FA 2JMOA 4LF7C 3S16I 2E8EA 1I3QI 4JI8C 4A3GI 2I3CA 4G36A 1ULTA 2D28C 2V7BA 3TUFA 1L1OC 3CW8X 3MONA 1ML8A 5BR8C 3CCV1 1UKKA 3IPLA 3IX0A 3HOZI 4MD7A 3CXCZ 5BSUA 3CCRZ 4FUTA 5BURA 4MXUA 2P2BA 1DL6A 3E7WA 3PO2I 1WH9A 3NDIA 5KEIA 3VNQA 5E7QA 1N33C 2UXBC 3CQZI 1YIJ1 1RNIA 5GTDA 1Z01A 4RLFA 4DK1A 5FLXb 5CZVA 3S1NI 4QTUA 1TWAI 1YUKA 1N34C 4RMNA 2F4VC 4HH4A 3TDHB 4E33A 3J80b 2D1SA 3VNRA 3H0GI 1S721 3R44A 1M1K1 4X65C 4NBCA 3GKQA 1RO0A 3KIFA 1IBKC 1VQ41 3CCU1 1VQ91 3I07A 4JI5C 1I94C 2CXCA 3NI2A 3J80f 4A3JI 2KPIA 1PA4A 4JI4C 3VMIA 5A2Qb 3S2DI 4DR4C 4GKKC 4CL1A 1VQNZ 1HR0C 1XNQC 1V25A 1TWCI 1K9M2 3N54B 2P2MA 1KRLA 2F4MA 4E2XA 2H85A 3FCEA 1Q7Y1 3C5EA 5AN9F 2PM9A 2E5LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 D;  3CJE A;  1PFT A;  2K5R A;  2R92 I;  4A3M I;  3S14 I;  2HJG A;  1RO4 A;  2NVT I;  4DCT A;  2DYJ A;  2JMP A;  3VMH A;  2NVQ I;  4X66 C;  4JYA C;  4NBE A;  1MKY A;  1IBL C;  1K0R A;  3HOW I;  2PN2 A;  1TFI A;  4LFC C;  1TWF I;  4DV2 C;  4A3I I;  1N2F A;  4NBF A;  2ONF A;  2UXD C;  3GTL I;  4JV5 C;  2OPL A;  1R9T I;  4GKJ C;  3T1Y C;  3RZD I;  4LFB C;  4DR6 C;  2YCB A;  3K7A I;  5C4J I;  4A3B I;  4Y52 I;  4NOZ A;  4LF9 C;  3H3V J;  2KZF A;  5IP9 I;  2VQF C;  4LF5 C;  2DE6 A;  4NBB A;  3AF5 A;  4DUZ C;  4NXM C;  3I4N I;  2ASB A;  1NUI A;  2UUC C;  1FJG C;  1Y1V I;  4XX2 A;  3GTP I;  3RZO I;  3PO3 S;  2OPL B;  3HOU I;  4DCV A;  1ZB8 A;  1VLA A;  3Q87 A;  2JNY A;  4A93 I;  4DR3 C;  4B3M C;  4DR1 C;  4BY7 I;  5FLM I;  1L2F A;  4DV7 C;  3VB9 A;  4NBD A;  2JA5 I;  1QWI A;  4DV0 C;  2UUB C;  2RBL A;  3S1Q I;  4X6A I;  3GTG I;  2D7V A;  3S15 I;  4YHH C;  4B3S C;  4DR7 C;  3GTM I;  3GKU A;  5C44 I;  1HNZ C;  2PK7 A;  2HHH C;  4DV4 C;  2BJO A;  1IBM C;  4BY1 I;  5LMU C;  2ZM6 C;  3M3Y I;  4A3D I;  4LFA C;  4B3R C;  2AKL A;  1XMQ C;  4JI0 C;  4DCU A;  2E2I I;  5IP7 I;  4MTN A;  4JI7 C;  4QTT A;  4A3K I;  3J81 D;  4JI2 C;  4LF8 C;  1XNR C;  4K0K C;  3GTK I;  4BXX I;  2J6A A;  2R93 I;  4NB8 A;  5C3E I;  2YU9 I;  4DUY C;  2E8F A;  2NVX I;  3R9W A;  1USP B;  4A3E I;  4NB9 A;  5FLX D;  2CY1 A;  4BBR I;  1EGA A;  1HNX C;  4JI6 C;  2DE5 A;  2JR6 A;  3FKI I;  4LF7 C;  2ATW A;  3AF6 A;  3S16 I;  3S1M I;  2E8E A;  2VQE C;  4MH4 A;  1X3W A;  4LF4 C;  1I3Q I;  2UU9 C;  5CM2 M;  4JI8 C;  3D6W A;  2E2J I;  4A3G I;  3T1H C;  4NXN C;  3ESW A;  4Y7N I;  3S17 I;  3GTO I;  1L1O C;  2UUA C;  1ML8 A;  5BR8 C;  2EGT A;  1UKK A;  3HOZ I;  1YUA A;  1XMO C;  1HNW C;  4NBA A;  3VMG A;  2HF1 A;  2E8C A;  2JA8 I;  3GTQ I;  3U50 C;  1USP A;  3HOV I;  3S1R I;  1N32 C;  1DL6 A;  3PO2 I;  1WH9 A;  1HH2 P;  1N33 C;  1WW9 A;  4X64 C;  2UXB C;  3CQZ I;  3HOY I;  3OTO C;  4DR2 C;  4NBH A;  1QYP A;  4A3L I;  1Y1V S;  3PO3 I;  4DV5 C;  1TWG I;  2JS4 A;  3S1N I;  2F4O A;  1TWA I;  4QTU A;  4DR5 C;  1WF3 A;  2QL8 A;  4X62 C;  2VUM I;  1N34 C;  2UXC C;  1J5E C;  4DV1 C;  3IEV A;  2F4V C;  5IWA C;  5C4X I;  4DV3 C;  2DE7 A;  3R9X A;  3LUS A;  1N36 C;  3H0G I;  1I50 I;  4BBS I;  1TWH I;  1WCM I;  4KHP C;  4X65 C;  3J80 D;  4NBC A;  3GKQ A;  4OX9 C;  3I4M I;  2E2H I;  1IBK C;  4JI3 C;  3GCF A;  1RLY A;  2JA6 I;  3I07 A;  4JI5 C;  4A3C I;  4YY3 C;  4NBG A;  2CXC A;  1I94 C;  4B3T C;  1PA4 A;  4A3J I;  2KPI A;  2PT7 G;  2NVY I;  4JI4 C;  3VMI A;  3JAM D;  3HOX I;  1I6H I;  2JA7 I;  3S2D I;  4LF6 C;  1KKG A;  4DR4 C;  3IEU A;  3M4O I;  3S2H I;  4GKK C;  3GTM S;  1HR0 C;  1ZB9 A;  5A2Q D;  4DV6 C;  1XNQ C;  1TWC I;  1LQL A;  1JOS A;  4AQY C;  2R7Z I;  3GTJ I;  2E7G A;  2F4M A;  1NYE A;  4JI1 C;  2XR1 A;  4A3F I;  1K83 I;  3EER A;  1X3Z A;  5LMN C;  4BSZ A;  4DCS A;  2P3Y A;  1Y1W I;  2B63 I;  1SFO I;  2E5L C; 
#chains in the Genus database with same CATH topology
 4A3M I;  3NH5 A;  3G71 Z;  2D1Q A;  3CC4 Z;  2DYJ A;  5T67 A;  2NVQ I;  3RG2 A;  4JYA C;  2O4H A;  3CCU Z;  1TWF I;  3KIH A;  3NH4 A;  3T4N B;  4NBF A;  1S72 Z;  3T1Y C;  3RZD I;  1VQL 1;  4LFB C;  3CME 1;  1QVG Z;  3CPW Y;  3A9U A;  2KZF A;  1VQ4 Z;  1QVG Y;  1XHJ A;  3NYR A;  4LF5 C;  1Q86 2;  1VQ9 Z;  3AF5 A;  5CZX A;  3E7X A;  4NXM C;  2UUC C;  4G37 A;  2W04 A;  3FCC A;  4U5Y D;  2M48 A;  4DV0 C;  2RBL A;  3CCR 1;  3A9V A;  3CCE Z;  3PRO C;  3S15 I;  4IR7 A;  4RM2 A;  4B3S C;  1JJ2 Y;  2E9H A;  3CC4 1;  4I9F A;  4BBY A;  2WAQ A;  2LEX A;  4RVN A;  4BY1 I;  2ZM6 C;  1M90 2;  3M3Y I;  3EQ6 A;  4RVF A;  1WJ2 A;  3J81 b;  4JI0 C;  2VPW A;  2LFU A;  2OOY B;  4BC7 A;  4JI7 C;  5D1O B;  4A3K I;  1MXA A;  1V26 A;  2JIP A;  1XNR C;  3GTK I;  4BXX I;  3DAY A;  5DV9 A;  4NB8 A;  2PMZ A;  5C3E I;  4DUY C;  1O93 A;  4EWC A;  2NVX I;  3BG1 B;  4A3E I;  1Q86 1;  2CY1 A;  4BBR I;  1EGA A;  3NPD A;  4JI6 C;  3J81 f;  5D1O A;  1RO2 A;  1MD9 A;  3AF6 A;  4LF4 C;  2VQE C;  3UEB A;  2UU9 C;  5IT9 b;  3I55 1;  3CCQ 1;  3D6W A;  2E2J I;  3J7A 4;  4NXN C;  5BSM A;  2E7Z A;  3GTO I;  1VQ8 Z;  2Z51 A;  1VQM Z;  3L95 X;  3I08 A;  4WV3 A;  4HGZ A;  3CCJ 1;  3ETC A;  4LE5 A;  1YUA A;  1XMO C;  2QA4 Z;  3F3P C;  2HF1 A;  3VMG A;  2R6M A;  2JA8 I;  2E8C A;  3U50 C;  3LGX A;  3HOV I;  3CC2 1;  1HH2 P;  4X64 C;  3HOY I;  4DR2 C;  2WB1 A;  3G71 1;  3PO3 I;  2P2J A;  4DV5 C;  1FJG C;  1FUG A;  4DR5 C;  4X62 C;  4D56 A;  3CMA 1;  5BUS A;  4E2Y A;  1J5E C;  3UZ0 A;  4E30 A;  2D27 A;  2OO4 A;  2IZ4 A;  4S1T A;  3LUS A;  1XRB A;  4BBS I;  3VNS A;  1TWH I;  1VQ7 1;  3CME Z;  4OX9 C;  3OW2 Y;  5ADZ A;  3I4M I;  2JIM A;  2QVY X;  1RLY A;  1VQ8 1;  4BC9 A;  2GU2 A;  3D9X A;  4YY3 C;  3CXC Y;  1W2B Z;  2VPY A;  3TR3 A;  2NVY I;  1N8R 1;  1I6H I;  2JA7 I;  1WII A;  2VPX A;  3CCL 1;  1XRC A;  1MXB A;  2QVZ X;  3O2E A;  2RHB A;  1ZB9 A;  1MDF A;  1QVF Z;  4DV6 C;  1LQL A;  1BA3 A;  2RPR A;  1VQO 1;  1P4E C;  2QA4 1;  4A3F I;  5T6B A;  1X3Z A;  4BSZ A;  2OTJ Z;  4RS4 A;  1PFT A;  2K5R A;  2R92 I;  3S14 I;  3VTN A;  1RO4 A;  3UX2 A;  2ZZM A;  2QLV B;  1YHQ 1;  3VMH A;  4X66 C;  1KD1 2;  1Q82 1;  3P5J B;  4GS5 A;  1K73 2;  1IBL C;  3CW9 A;  2BH1 X;  4MON A;  4E32 A;  3HKZ A;  4A3I I;  4EAT A;  1N2F A;  1Q82 2;  4FTF A;  4JV5 C;  2JIQ A;  4MRI A;  4GKJ C;  4IZ6 A;  3CCL Z;  4E31 A;  2HU9 A;  4G1I A;  4DR6 C;  4A3B I;  3F3F C;  4NOZ A;  3H3V J;  3IML A;  3TQI A;  2LIY A;  1FDO A;  5BSR A;  4DUZ C;  2ASB A;  1NUI A;  2QVX X;  1Y1V I;  1NJI 2;  3GTP I;  3RZO I;  3HOU I;  2Y27 A;  1VQM 1;  4DG8 A;  4KTV A;  4DR3 C;  2O53 A;  4B3M C;  3RV2 A;  5BUQ A;  5FLM I;  4DV7 C;  1NJI 1;  4NBD A;  2JA5 I;  2WP0 C;  1NY8 A;  2UUB C;  2JIO A;  4E2W A;  1YJN 1;  4D4G A;  4YHH C;  5K85 A;  5A1I A;  2G2K A;  4DR7 C;  3NYQ A;  3NDJ A;  1YHQ Z;  5C44 I;  2HHH C;  2Y4N A;  2BJO A;  1MXC A;  1IBM C;  3CQ1 A;  3S82 A;  1VQ5 1;  3PBK A;  3NFZ A;  2OTJ 1;  3CMA Z;  4MTN A;  2NAP A;  2OBV A;  1VQ7 Z;  2R93 I;  1P4E A;  2OZK A;  5AE3 A;  3TDE A;  1HNX C;  4DG9 A;  3FKI I;  3CC7 Z;  3D2L A;  2ATW A;  3S1M I;  2W03 A;  5T8T A;  2QRC B;  4TPS B;  1QF8 A;  2PRO A;  3CCE 1;  3T1H C;  2OTL Z;  1PG4 A;  3IR7 A;  4Y7N I;  3S17 I;  4OYC A;  2D1R A;  1WCJ A;  3ETO A;  2EGT A;  2VF1 A;  3QWU A;  1VQO Z;  4RVG A;  4NBA A;  4RVD A;  1USP A;  3JAM b;  3LNO A;  3S1R I;  1N32 C;  5A19 A;  1VQK Z;  1WW9 A;  1JJ2 Z;  3OTO C;  2QEX Z;  2MMA B;  5AE1 A;  1QYP A;  4A3L I;  2Q51 A;  2JS4 A;  3N2Q A;  5A1G A;  1WF3 A;  2QL8 A;  3KXW A;  4MD9 A;  2NCL A;  4L4Q A;  4ISB A;  4DV1 C;  1V60 A;  3CC7 1;  1Q16 A;  5LL6 f;  5C4X I;  2KZ0 A;  5IWA C;  2P2F A;  4DV3 C;  3R9X A;  4DQY B;  3I55 Z;  2AYD A;  3CCQ Z;  1N8R 2;  1WCM I;  2DPL A;  5KYT A;  2YAD A;  3G4S Z;  3I56 1;  2P2Q A;  4JI3 C;  4GXQ A;  1T5H X;  3FQM A;  5BSW A;  1YI2 Z;  3A4I A;  1KKG A;  1YIT Z;  4LF6 C;  1NP6 A;  3IEU A;  2K3R A;  3MZK B;  3M4O I;  2OTL 1;  5IFI A;  1KC8 2;  1RQF A;  4R0M A;  1YJN Z;  1Y8C A;  4AQY C;  5LCI A;  3GTJ I;  2E7G A;  4JI1 C;  2XR1 A;  1GPM A;  1M6X C;  2YWC A;  1SFO I;  2KI7 B;  4K0B A;  1XS3 A;  1VQ5 Z;  4DCS A;  2P3Y A;  1Y1W I;  3L8C A;  2M6N A;  2MM9 A;  2QEX 1;  4OXI A;  1LCI A;  3CCS Z;  1O92 A;  2V8K A;  4NBE A;  4PUG A;  3G6E 1;  2PN2 A;  1S7M A;  5D1P A;  2ONF A;  2UXD C;  1R9T I;  1YIT 1;  5JRH A;  2YCB A;  4RVO A;  3K7A I;  4Y52 I;  4MD8 A;  4E2Z A;  5IP9 I;  1P7L A;  4ZJZ A;  3UOW A;  3CPW Z;  4NBB A;  3I4N I;  2Y0S A;  1Q81 2;  3NH8 A;  1K8A 1;  3PES A;  3FQQ A;  2V45 A;  1YI2 1;  1ZB8 A;  4NFR A;  4A93 I;  2M5O A;  3DHV A;  4DCV A;  1YJW Z;  2ZAE B;  3H2T A;  1K8A 2;  2D1T A;  3VB9 A;  1RG9 A;  1Q81 1;  1QXF A;  3S1Q I;  4X6A I;  1PG3 A;  1AMU A;  2Y4O A;  1X0T A;  1VQK 1;  3GTM I;  3CCS 1;  3GKU A;  2PK7 A;  4PRO C;  4DV4 C;  3CCV Z;  5LMU C;  4A3D I;  1KD1 1;  1KQS Z;  4L2Z A;  4PZP A;  2Q4Z A;  1KQS Y;  2VPZ A;  2E0G A;  4DCU A;  2E2I I;  5IP7 I;  3CCM Z;  1YIJ Z;  4LF8 C;  4K0K C;  1O9T A;  4I9G A;  2E8F A;  2ZZN A;  3G4S 1;  3R9W A;  1USP B;  3EED A;  4RV9 A;  3I56 Z;  5FLX D;  4PHT A;  2DE5 A;  2JR6 A;  1YJW 1;  4MH4 A;  1X3W A;  5IT9 f;  2M5H A;  5CM2 M;  1O90 A;  3CD6 Z;  1YJ9 1;  1FDI A;  1UWD A;  3ESW A;  3AY0 A;  4R1L A;  3BG0 B;  1JWH C;  2JUB A;  1HNW C;  4BCA A;  4L7I A;  3LNV A;  3GTQ I;  1T5D X;  4NDN A;  2QRD B;  2YWB A;  1VQN 1;  1P9N A;  3CCM 1;  4FUQ A;  4RVH A;  4NBH A;  5FLX f;  1Y1V S;  1TWG I;  2WD9 A;  2F4O A;  2RT9 A;  2UXC C;  2RIQ A;  5KYV A;  2VUM I;  3GPC A;  2AYA A;  1VQ6 Z;  4TNU A;  3IEV A;  1Z02 A;  1KC8 1;  2P28 A;  2DE7 A;  2VUG A;  1MDB A;  2VSQ A;  1QM4 A;  1N36 C;  1I50 I;  1Q7Y 2;  3CD6 1;  4KHP C;  3J80 D;  1YJ9 Z;  4ZLP A;  2E2H I;  3GCF A;  4RLQ A;  2JA6 I;  2KDN A;  3UX3 A;  4A3C I;  1WZN A;  4NBG A;  2QKD A;  3MZL B;  1K9M 1;  2PT7 G;  3GR0 A;  4B3T C;  4WS9 A;  4AYB A;  1VEH A;  4NH1 C;  3HOX I;  3JAM D;  1VQL Z;  1M90 1;  2V3V A;  3S2H I;  3GTM S;  1IB8 A;  5A2Q D;  4DGL A;  4PUH A;  5BSV A;  1JOS A;  2P02 A;  1PU1 A;  3LAX A;  2R7Z I;  1NYE A;  2GTH A;  3TE5 B;  5AE2 A;  1VQP 1;  4D4I A;  1K83 I;  3EER A;  1XRA A;  5LMN C;  2B63 I;  2YU9 I;  2UUA C;  5T64 A;  5IT9 D;  3CJE A;  2QR1 B;  3JAM f;  2HJG A;  2QW0 X;  4PUI A;  2NVT I;  4DCT A;  1YJ7 A;  2JMP A;  4JM1 A;  1Z03 A;  1MKY A;  3OW2 Z;  1K0R A;  3HOW I;  1TFI A;  4RM3 A;  4LFC C;  4DV2 C;  1K73 1;  3GTL I;  2V8I A;  2OPL A;  5C4J I;  4LF9 C;  5H9U A;  2QRE B;  2VQF C;  2DE6 A;  1QVF Y;  4D57 A;  3IFU A;  3DLP X;  3PO3 S;  4XX2 A;  2OPL B;  1RY2 A;  1VLA A;  3Q87 A;  2JNY A;  4DR1 C;  2P20 A;  4BY7 I;  1L2F A;  3IF8 A;  3B7W A;  1QWI A;  3GTG I;  2D7V A;  3SO4 A;  5BST A;  4HGY A;  2VZE A;  1HNZ C;  1VQP Z;  3CCJ Z;  3G7S A;  4LFA C;  3G6E Z;  2IZ3 A;  4B3R C;  3GR1 A;  2AKL A;  5A2Q f;  1XMQ C;  2JNV A;  2MCQ A;  1VQ6 1;  3CC2 Z;  4KTT A;  1ZH1 A;  2OOX B;  2GTI A;  1FLO A;  4GXR A;  4QTT A;  4ODJ A;  3J81 D;  4JI2 C;  4R1M A;  2J6A A;  5T8S A;  2V8J A;  4HPV A;  1M1K 2;  4NB9 A;  1W2B Y;  2DHM A;  5K8F A;  2JMO A;  4LF7 C;  3S16 I;  2E8E A;  3CQ3 A;  1I3Q I;  4JI8 C;  4A3G I;  2I3C A;  4G36 A;  1ULT A;  2CU6 A;  2D28 C;  2V7B A;  3TUF A;  1L1O C;  3CW8 X;  3MON A;  1ML8 A;  5BR8 C;  3CCV 1;  1UKK A;  1AA6 A;  3IPL A;  3IX0 A;  3HOZ I;  2IV2 X;  1TH5 A;  4MD7 A;  1SIW A;  3CXC Z;  5BSU A;  3CCR Z;  4FUT A;  5BUR A;  4MXU A;  1M6X A;  2P2B A;  1DL6 A;  3E7W A;  3PO2 I;  1WH9 A;  3NDI A;  5KEI A;  3VNQ A;  5E7Q A;  1N33 C;  2UXB C;  3CQZ I;  1YIJ 1;  1RNI A;  5GTD A;  1Z01 A;  4RLF A;  4DK1 A;  5FLX b;  3A25 A;  3S1N I;  4QTU A;  1TWA I;  1YUK A;  5CZV A;  1N34 C;  4RMN A;  2F4V C;  4HH4 A;  3TDH B;  4E33 A;  3J80 b;  2D1S A;  3K6R A;  3VNR A;  3H0G I;  1S72 1;  3R44 A;  1M1K 1;  4X65 C;  4NBC A;  3GKQ A;  1RO0 A;  3KIF A;  1IBK C;  1VQ4 1;  3CCU 1;  1VQ9 1;  3I07 A;  4JI5 C;  1I94 C;  3CQ2 A;  2CXC A;  3NI2 A;  3J80 f;  4A3J I;  2KPI A;  1PA4 A;  4JI4 C;  3VMI A;  5A2Q b;  3S2D I;  4DR4 C;  4GKK C;  4CL1 A;  1VQN Z;  2YX1 A;  1HR0 C;  1XNQ C;  1V25 A;  1TWC I;  1K9M 2;  3N54 B;  2P2M A;  1KRL A;  2F4M A;  2JIR A;  4E2X A;  2H85 A;  3A26 A;  3FCE A;  1Q7Y 1;  3C5E A;  5AN9 F;  2PM9 A;  2E5L C; 
#chains in the Genus database with same CATH homology
 4A3M I;  3NH5 A;  3G71 Z;  2D1Q A;  3CC4 Z;  2DYJ A;  5T67 A;  2NVQ I;  3RG2 A;  4JYA C;  2O4H A;  3CCU Z;  1TWF I;  3KIH A;  3NH4 A;  3T4N B;  4NBF A;  1S72 Z;  3T1Y C;  3RZD I;  1VQL 1;  4LFB C;  3CME 1;  1QVG Z;  3CPW Y;  3A9U A;  2KZF A;  1VQ4 Z;  1QVG Y;  4LF5 C;  3NYR A;  1Q86 2;  1VQ9 Z;  3AF5 A;  5CZX A;  3E7X A;  4NXM C;  2UUC C;  4G37 A;  2W04 A;  3FCC A;  4U5Y D;  2M48 A;  4DV0 C;  2RBL A;  3CCR 1;  3A9V A;  3CCE Z;  3PRO C;  3S15 I;  4IR7 A;  4RM2 A;  4B3S C;  1JJ2 Y;  2E9H A;  3CC4 1;  4I9F A;  4BBY A;  2WAQ A;  4RVN A;  4BY1 I;  2ZM6 C;  1M90 2;  3M3Y I;  3EQ6 A;  4RVF A;  3J81 b;  4JI0 C;  2LFU A;  2OOY B;  4BC7 A;  4JI7 C;  5D1O B;  4A3K I;  1MXA A;  1V26 A;  1XNR C;  3GTK I;  4BXX I;  3DAY A;  5DV9 A;  4NB8 A;  2PMZ A;  5C3E I;  4DUY C;  1O93 A;  4EWC A;  2NVX I;  3BG1 B;  4A3E I;  1Q86 1;  2CY1 A;  4BBR I;  1EGA A;  3NPD A;  4JI6 C;  3J81 f;  5D1O A;  1RO2 A;  1MD9 A;  3AF6 A;  4LF4 C;  2VQE C;  2UU9 C;  5IT9 b;  3I55 1;  3CCQ 1;  3D6W A;  2E2J I;  3J7A 4;  4NXN C;  5BSM A;  3GTO I;  1VQ8 Z;  1VQM Z;  3L95 X;  3I08 A;  4WV3 A;  4HGZ A;  3CCJ 1;  3ETC A;  4LE5 A;  1YUA A;  1XMO C;  2QA4 Z;  3F3P C;  2HF1 A;  3VMG A;  2R6M A;  2JA8 I;  2E8C A;  3U50 C;  3LGX A;  3HOV I;  3CC2 1;  1HH2 P;  4X64 C;  3HOY I;  4DR2 C;  2WB1 A;  3G71 1;  3PO3 I;  2P2J A;  4DV5 C;  1FJG C;  1FUG A;  4DR5 C;  4X62 C;  4D56 A;  3CMA 1;  5BUS A;  4E2Y A;  1J5E C;  3UZ0 A;  4E30 A;  2D27 A;  2OO4 A;  2IZ4 A;  4S1T A;  3LUS A;  1XRB A;  4BBS I;  3VNS A;  1TWH I;  1VQ7 1;  3CME Z;  4OX9 C;  3OW2 Y;  5ADZ A;  3I4M I;  2QVY X;  1RLY A;  1VQ8 1;  4BC9 A;  2GU2 A;  3D9X A;  4YY3 C;  3CXC Y;  1W2B Z;  2NVY I;  1N8R 1;  1I6H I;  2JA7 I;  1WII A;  3CCL 1;  2QVZ X;  1XRC A;  1MXB A;  2RHB A;  1ZB9 A;  1MDF A;  1QVF Z;  4DV6 C;  1LQL A;  1BA3 A;  2RPR A;  1VQO 1;  2QA4 1;  4A3F I;  5T6B A;  1X3Z A;  4BSZ A;  2OTJ Z;  4RS4 A;  1PFT A;  2K5R A;  2R92 I;  3S14 I;  3VTN A;  1RO4 A;  2QLV B;  1YHQ 1;  3VMH A;  4X66 C;  1KD1 2;  1Q82 1;  3P5J B;  4GS5 A;  1K73 2;  1IBL C;  3CW9 A;  2BH1 X;  4MON A;  4E32 A;  3HKZ A;  4A3I I;  4EAT A;  1N2F A;  1Q82 2;  4FTF A;  4JV5 C;  4MRI A;  4GKJ C;  4IZ6 A;  3CCL Z;  4E31 A;  2HU9 A;  4G1I A;  4DR6 C;  4A3B I;  3F3F C;  4NOZ A;  3H3V J;  3IML A;  3TQI A;  2LIY A;  5BSR A;  4DUZ C;  2ASB A;  1NUI A;  2QVX X;  1Y1V I;  1NJI 2;  3GTP I;  3RZO I;  3HOU I;  2Y27 A;  1VQM 1;  4DG8 A;  4KTV A;  4DR3 C;  2O53 A;  4B3M C;  3RV2 A;  5BUQ A;  5FLM I;  4DV7 C;  1NJI 1;  4NBD A;  2JA5 I;  2WP0 C;  2UUB C;  4E2W A;  1YJN 1;  4D4G A;  4YHH C;  5K85 A;  5A1I A;  2G2K A;  4DR7 C;  3NYQ A;  3NDJ A;  1YHQ Z;  5C44 I;  2HHH C;  2Y4N A;  2BJO A;  1MXC A;  1IBM C;  3S82 A;  1VQ5 1;  3PBK A;  3NFZ A;  2OTJ 1;  3CMA Z;  4MTN A;  2OBV A;  1VQ7 Z;  2R93 I;  2OZK A;  5AE3 A;  3TDE A;  1HNX C;  4DG9 A;  3FKI I;  3CC7 Z;  2ATW A;  3S1M I;  2W03 A;  5T8T A;  2QRC B;  4TPS B;  1QF8 A;  2PRO A;  3CCE 1;  3T1H C;  2OTL Z;  1PG4 A;  4Y7N I;  3S17 I;  4OYC A;  2D1R A;  3ETO A;  2EGT A;  2VF1 A;  3QWU A;  4RVG A;  1VQO Z;  4NBA A;  4RVD A;  1USP A;  3JAM b;  3S1R I;  1N32 C;  5A19 A;  1VQK Z;  1WW9 A;  1JJ2 Z;  3OTO C;  2QEX Z;  5AE1 A;  1QYP A;  4A3L I;  2Q51 A;  2JS4 A;  3N2Q A;  5A1G A;  1WF3 A;  2QL8 A;  3KXW A;  4MD9 A;  4L4Q A;  4ISB A;  4DV1 C;  5IWA C;  3CC7 1;  5LL6 f;  5C4X I;  4DV3 C;  2P2F A;  3R9X A;  4DQY B;  3I55 Z;  3CCQ Z;  1N8R 2;  1WCM I;  2DPL A;  5KYT A;  2YAD A;  3G4S Z;  3I56 1;  2P2Q A;  4JI3 C;  4GXQ A;  1T5H X;  3FQM A;  5BSW A;  1YI2 Z;  3A4I A;  1KKG A;  1YIT Z;  4LF6 C;  1NP6 A;  3IEU A;  2K3R A;  3MZK B;  3M4O I;  2OTL 1;  5IFI A;  1KC8 2;  1RQF A;  4R0M A;  1YJN Z;  4AQY C;  3GTJ I;  2E7G A;  4JI1 C;  2XR1 A;  1GPM A;  2YWC A;  1SFO I;  2KI7 B;  4K0B A;  1VQ5 Z;  4DCS A;  2P3Y A;  1Y1W I;  3L8C A;  2M6N A;  2QEX 1;  4OXI A;  1LCI A;  3CCS Z;  1O92 A;  2V8K A;  4NBE A;  3G6E 1;  2PN2 A;  1S7M A;  5D1P A;  2ONF A;  2UXD C;  1R9T I;  1YIT 1;  5JRH A;  2YCB A;  4RVO A;  3K7A I;  4Y52 I;  4MD8 A;  4E2Z A;  5IP9 I;  1P7L A;  4ZJZ A;  3UOW A;  3CPW Z;  4NBB A;  3I4N I;  2Y0S A;  1Q81 2;  3NH8 A;  1K8A 1;  3PES A;  3FQQ A;  3DHV A;  1YI2 1;  1ZB8 A;  4NFR A;  4A93 I;  4DCV A;  1YJW Z;  2ZAE B;  3H2T A;  1K8A 2;  2D1T A;  3VB9 A;  1RG9 A;  1Q81 1;  3S1Q I;  4X6A I;  1PG3 A;  1AMU A;  2Y4O A;  1X0T A;  1VQK 1;  3GTM I;  3CCS 1;  3GKU A;  2PK7 A;  4PRO C;  4DV4 C;  3CCV Z;  5LMU C;  4A3D I;  1KD1 1;  1KQS Z;  4L2Z A;  4PZP A;  2Q4Z A;  1KQS Y;  2E0G A;  4DCU A;  2E2I I;  5IP7 I;  3CCM Z;  1YIJ Z;  4LF8 C;  4K0K C;  1O9T A;  4I9G A;  2E8F A;  3G4S 1;  3R9W A;  1USP B;  3EED A;  4RV9 A;  3I56 Z;  5FLX D;  4PHT A;  2DE5 A;  2JR6 A;  1YJW 1;  4MH4 A;  1X3W A;  5IT9 f;  5CM2 M;  1O90 A;  3CD6 Z;  1YJ9 1;  3ESW A;  4R1L A;  3BG0 B;  1JWH C;  2JUB A;  1HNW C;  4BCA A;  4L7I A;  3LNV A;  3GTQ I;  1T5D X;  4NDN A;  2QRD B;  2YWB A;  1VQN 1;  1P9N A;  3CCM 1;  4FUQ A;  4RVH A;  4NBH A;  5FLX f;  1Y1V S;  1TWG I;  2WD9 A;  2F4O A;  2RT9 A;  2UXC C;  2RIQ A;  5KYV A;  2VUM I;  3GPC A;  2AYA A;  1VQ6 Z;  4TNU A;  3IEV A;  1Z02 A;  1KC8 1;  2P28 A;  2DE7 A;  2VUG A;  1MDB A;  2VSQ A;  1QM4 A;  1N36 C;  1I50 I;  1Q7Y 2;  3CD6 1;  4KHP C;  3J80 D;  1YJ9 Z;  4ZLP A;  2E2H I;  3GCF A;  4RLQ A;  2JA6 I;  4A3C I;  4NBG A;  2QKD A;  3MZL B;  1K9M 1;  2PT7 G;  3GR0 A;  4B3T C;  4WS9 A;  4AYB A;  3JAM D;  4NH1 C;  3HOX I;  1VQL Z;  1M90 1;  3S2H I;  3GTM S;  5A2Q D;  4DGL A;  5BSV A;  1JOS A;  2P02 A;  3LAX A;  2R7Z I;  1NYE A;  2GTH A;  3TE5 B;  5AE2 A;  1VQP 1;  4D4I A;  1K83 I;  3EER A;  1XRA A;  5LMN C;  2B63 I;  2YU9 I;  2UUA C;  5T64 A;  5IT9 D;  3CJE A;  2QR1 B;  3JAM f;  2HJG A;  2QW0 X;  2NVT I;  4DCT A;  1YJ7 A;  2JMP A;  4JM1 A;  1Z03 A;  1MKY A;  3OW2 Z;  1K0R A;  3HOW I;  1TFI A;  4RM3 A;  4LFC C;  4DV2 C;  1K73 1;  3GTL I;  2V8I A;  2OPL A;  5C4J I;  4LF9 C;  5H9U A;  2QRE B;  2VQF C;  2DE6 A;  1QVF Y;  4D57 A;  3IFU A;  3DLP X;  3PO3 S;  4XX2 A;  2OPL B;  1RY2 A;  1VLA A;  3Q87 A;  2JNY A;  4DR1 C;  2P20 A;  4BY7 I;  1L2F A;  3IF8 A;  3B7W A;  1QWI A;  3GTG I;  2D7V A;  3SO4 A;  5BST A;  4HGY A;  2VZE A;  1HNZ C;  1VQP Z;  3CCJ Z;  3G7S A;  4LFA C;  3G6E Z;  2IZ3 A;  4B3R C;  3GR1 A;  2AKL A;  5A2Q f;  1XMQ C;  1VQ6 1;  3CC2 Z;  4KTT A;  1ZH1 A;  2OOX B;  2GTI A;  4GXR A;  4QTT A;  4ODJ A;  3J81 D;  4JI2 C;  4R1M A;  2J6A A;  5T8S A;  2V8J A;  4HPV A;  1M1K 2;  4NB9 A;  1W2B Y;  5K8F A;  2JMO A;  4LF7 C;  3S16 I;  2E8E A;  1I3Q I;  4JI8 C;  4A3G I;  2I3C A;  4G36 A;  1ULT A;  2D28 C;  2V7B A;  3TUF A;  1L1O C;  3CW8 X;  3MON A;  1ML8 A;  5BR8 C;  3CCV 1;  1UKK A;  3IPL A;  3IX0 A;  3HOZ I;  4MD7 A;  3CXC Z;  5BSU A;  3CCR Z;  4FUT A;  5BUR A;  4MXU A;  2P2B A;  1DL6 A;  3E7W A;  3PO2 I;  1WH9 A;  3NDI A;  5KEI A;  3VNQ A;  5E7Q A;  1N33 C;  2UXB C;  3CQZ I;  1YIJ 1;  1RNI A;  5GTD A;  1Z01 A;  4RLF A;  4DK1 A;  5FLX b;  5CZV A;  3S1N I;  4QTU A;  1TWA I;  1YUK A;  1N34 C;  4RMN A;  2F4V C;  4HH4 A;  3TDH B;  4E33 A;  3J80 b;  2D1S A;  3VNR A;  3H0G I;  1S72 1;  3R44 A;  1M1K 1;  4X65 C;  4NBC A;  3GKQ A;  1RO0 A;  3KIF A;  1IBK C;  1VQ4 1;  3CCU 1;  1VQ9 1;  3I07 A;  4JI5 C;  1I94 C;  2CXC A;  3NI2 A;  3J80 f;  4A3J I;  2KPI A;  1PA4 A;  4JI4 C;  3VMI A;  5A2Q b;  3S2D I;  4DR4 C;  4GKK C;  4CL1 A;  1VQN Z;  1HR0 C;  1XNQ C;  1V25 A;  1TWC I;  1K9M 2;  3N54 B;  2P2M A;  1KRL A;  2F4M A;  4E2X A;  2H85 A;  3FCE A;  1Q7Y 1;  3C5E A;  5AN9 F;  2PM9 A;  2E5L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...