1ML8A

Structural genomics
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
b'MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERRERLFTHINLHFIVTGRDLKDAAVARAVDLSAEKYCSVALMLEKAVNITHSYEVVAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein (crp region)
publication title Structural genomics
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 35
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2002-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ml8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ml8A02
4DR5C 3T1HC 2VUMI 4JI5C 1WH9A 3GCFA 2R92I 1TWHI 2JMPA 2ATWA 4DCVA 5IP7I 2R93I 1IBKC 2HHHC 4LF4C 2QL8A 1KKGA 1UKKA 2R7ZI 4B3MC 4Y52I 2OPLB 4JI0C 3JAMD 3S16I 2KPIA 3GKUA 4BXXI 2D7VA 3VMHA 4A3GI 3CJEA 2E2JI 1N36C 3J81D 4JI7C 1K0RA 2E8FA 3GTMI 1USPB 1PA4A 3RZDI 1K83I 4DV5C 1J5EC 3S17I 2KZFA 5C4XI 1RO4A 3S2DI 2F4MA 2JA8I 2DYJA 1IBMC 4B3RC 5IT9D 3Q87A 2ONFA 4B3SC 4DUZC 4BBRI 3M3YI 1Y1WI 2AKLA 2YU9I 4KHPC 1XNQC 2HF1A 4A3KI 3LUSA 4DV7C 3ESWA 2ZM6C 3EERA 1X3WA 1L2FA 3H0GI 3FKII 4DR6C 4X65C 3HOZI 2VQEC 2JA5I 2PN2A 1XNRC 1USPA 5CM2M 3S1MI 4DV6C 2UXDC 4DV0C 3HOXI 3S14I 4NXNC 4XX2A 3GTGI 4LF5C 1ML8A 4JYAC 1TWGI 1Y1VS 4NBFA 1TWAI 4X66C 2UUAC 1VLAA 2P3YA 3HOUI 4GKJC 1QWIA 4X6AI 3VMGA 2JA7I 3OTOC 3S1NI 1TFIA 4A3FI 2UU9C 1NYEA 4BY7I 1TWFI 4NOZA 1WW9A 2PK7A 1WF3A 4DR7C 1ZB8A 3S1QI 4A3EI 2JA6I 1JOSA 1I50I 4JI2C 2XR1A 3D6WA 1X3ZA 5BR8C 4LFAC 5A2QD 2PT7G 3GTJI 4JI1C 3PO3S 1TWCI 2E2HI 3M4OI 4DR1C 4MH4A 4LFBC 3GTLI 2E8CA 4JI3C 1N34C 3R9XA 3AF5A 4Y7NI 1L1OC 3VMIA 5IP9I 1I6HI 3U50C 4NBDA 1XMQC 4NBHA 4DR3C 4LF9C 3I4NI 4A93I 5FLMI 1R9TI 3R9WA 1HNWC 3GTQI 4NBGA 3S15I 2CY1A 3K7AI 2NVYI 4DV4C 4GKKC 4A3BI 2CXCA 4JI4C 3S2HI 4DR2C 2E2II 5IWAC 4A3JI 2VQFC 4AQYC 4BY1I 5LMUC 4DV3C 2EGTA 2UUCC 4LF7C 2JR6A 4LF6C 3CQZI 2JS4A 3GKQA 2NVXI 3HOYI 3H3VJ 2HJGA 4JI8C 1ZB9A 4A3MI 2JNYA 4BBSI 3PO2I 4JI6C 1FJGC 1I3QI 1N32C 2J6AA 4DUYC 4NBEA 1RLYA 2YCBA 4JV5C 4YHHC 3S1RI 1Y1VI 4LF8C 3GTMS 4DV1C 1WCMI 3IEVA 1QYPA 1YUAA 3AF6A 1XMOC 4DCTA 1NUIA 1LQLA 4OX9C 3I07A 1MKYA 4A3CI 4DCSA 4QTTA 1I94C 4A3LI 2DE7A 3RZOI 1DL6A 2E8EA 4X64C 2BJOA 4MTNA 1N33C 4BSZA 4NBBA 4DCUA 2K5RA 1IBLC 3PO3I 1HNXC 1HNZC 4A3DI 4YY3C 2DE5A 2ASBA 3GTPI 2F4OA 3IEUA 4K0KC 5C44I 4LFCC 2F4VC 2UUBC 3GTOI 1PFTA 4A3II 2E5LC 2UXBC 1EGAA 4X62C 4QTUA 3HOWI 5LMNC 2OPLA 4B3TC 5C4JI 4NB9A 2DE6A 4DR4C 1N2FA 3GTKI 3T1YC 4NB8A 2E7GA 5FLXD 4DV2C 3J80D 3VB9A 2UXCC 4NXMC 1HR0C 2NVTI 4NBAA 3I4MI 3HOVI 1SFOI 5C3EI 2NVQI 1HH2P 2B63I 2RBLA 4NBCA
chains in the Genus database with same CATH superfamily
3GPCA 4DR5C 3CCL1 3T1HC 3QWUA 2VUMI 3KIHA 4JI5C 3NH8A 1WH9A 2NCLA 1ZH1A 2R6MA 3ETOA 5D1OA 3CCUZ 3GCFA 2R92I 1TWHI 2JMPA 2QA41 4RVNA 2ATWA 4DCVA 2ZZNA 5ADZA 1TH5A 5IP7I 1RY2A 2QEXZ 2R93I 5IT9b 1WCJA 1WJ2A 1IBKC 2HHHC 4LF4C 3TR3A 2QL8A 2ZZMA 1KKGA 3A9VA 3F3FC 1UKKA 1V26A 3O2EA 2R7ZI 2P28A 3NH5A 4MRIA 1S721 4Y52I 1MXCA 2VPYA 3CCR1 5AN9F 2OPLB 4JI0C 3CD61 3JAMD 4FTFA 3S16I 3CCLZ 1KC82 2KPIA 3GKUA 2Q4ZA 4BXXI 1SIWA 2D7VA 3VMHA 4A3GI 3CJEA 2E2JI 1YUKA 3CPWZ 3J81D 1N36C 4JI7C 3TDHB 2VZEA 2M48A 2PROA 2VF1A 1K0RA 4MD7A 2E8FA 3NYRA 1P7LA 3GTMI 1USPB 1PA4A 2OOXB 1Q862 4I9GA 3CMA1 2OTLZ 4PZPA 2QW0X 3RZDI 3I551 3CCE1 1S72Z 2MCQA 3CCRZ 3CD6Z 1Z02A 2RT9A 1VQP1 2GTIA 2I3CA 1K83I 3A4IA 3S82A 4DV5C 1J5EC 3S17I 2KZFA 5C4XI 1RO4A 3S2DI 2F4MA 2JA8I 1VEHA 2DYJA 3DLPX 3L95X 3CCV1 5AE3A 5IT9D 4RS4A 4B3RC 3Q87A 2E0GA 2ONFA 1V25A 2ZAEB 5BSWA 4B3SC 5D1OB 5K8FA 3UX3A 4ODJA 2Y27A 5KYTA 1N8R2 3CMAZ 1O90A 1M6XA 4DUZC 2M6NA 4BBRI 3I55Z 3CCEZ 2IZ4A 4PHTA 3M3YI 2DHMA 3LGXA 4LE5A 4TNUA 3NPDA 5CZXA 1Z03A 2LEXA 1Y1WI 1VQPZ 1YI21 2P2MA 3CCJ1 1QVFZ 3A26A 2QREB 4RM2A 5KEIA 2AKLA 2YU9I 3CCVZ 4ZLPA 2P2QA 4KHPC 1WIIA 4RLFA 1XNQC 2QKDA 3CW9A 4HH4A 2HF1A 4A3KI 5A2Qf 3LUSA 2QRDB 3KIFA 1VQ81 1IB8A 5D1PA 2V7BA 1M901 3ESWA 4DV7C 4D4IA 2ZM6C 1K9M2 1AA6A 2VPZA 4G37A 5LL6f 1VQ51 3TQIA 1YI2Z 3IPLA 3CCJZ 4OYCA 2H85A 5BSTA 3EERA 4PUGA 4DK1A 1X3WA 3IF8A 1O9TA 3GR0A 2QVZX 1QXFA 4G36A 1T5DX 4RVFA 3MZKB 1WZNA 1L2FA 3H0GI 2IV2X 3R44A 1RO0A 3PESA 4PROC 1VQK1 3FKII 4DR6C 2QRCB 1VQ8Z 4X65C 3HOZI 2VQEC 4DG8A 3FCCA 2JA5I 2PN2A 3I561 1XNRC 1USPA 5CM2M 5CZVA 1K731 1NJI1 3S1MI 5AE2A 4DV6C 2LIYA 2OTJ1 3E7XA 2UXDC 3CCQ1 1JWHC 3NYQA 4DV0C 3HOXI 3S14I 1VQKZ 2YX1A 4NXNC 4GXQA 4XX2A 3GTGI 4LF5C 1W2BZ 3I56Z 1ML8A 4IZ6A 2OBVA 3UOWA 5AE1A 2NAPA 4JYAC 2O53A 1TWGI 3CME1 1FDOA 1P9NA 1Y1VS 3CQ3A 4NBFA 4RV9A 1TWAI 2OOYB 2VUGA 2OTJZ 2RPRA 1PG3A 3PBKA 1KQSZ 4X66C 4E2ZA 4JM1A 3CXCZ 1FUGA 3TUFA 2UUAC 3CCQZ 2D1TA 2Y4OA 1VLAA 4GXRA 2WP0C 2P3YA 3HOUI 5A2Qb 1Q7Y2 4GKJC 3IFUA 3NDIA 1QWIA 4X6AI 3UX2A 3SO4A 3VMGA 2QA4Z 2WD9A 2VPWA 1M1K2 3E7WA 4RVGA 2JA7I 2D27A 2Y4NA 3OTOC 3S1NI 1TFIA 3CMEZ 3K6RA 4A3FI 3CCM1 1K8A2 2UU9C 1NYEA 2JUBA 1FLOA 4BY7I 1P4EA 1TWFI 4WS9A 3CQ1A 4NOZA 1N8R1 3DHVA 4KTVA 1WW9A 3H2TA 2PK7A 1VQO1 5H9UA 3D2LA 3D9XA 1WF3A 4DR7C 1ZB8A 5BSVA 3S1QI 2E9HA 3EQ6A 4RVHA 4A3EI 5JRHA 4K0BA 2JIOA 2WAQA 1UWDA 2JA6I 1VQ71 1YJ91 1JOSA 2KDNA 1I50I 4BC7A 1X0TA 4JI2C 2XR1A 3CCMZ 1XRCA 3D6WA 1X3ZA 5BR8C 4LFAC 4IR7A 5IFIA 4E2YA 4RM3A 2KI7B 2V3VA 5A2QD 2PT7G 3GTJI 4JI1C 1RG9A 1VQOZ 3PO3S 2LFUA 1TWCI 4D56A 2E2HI 3M4OI 4DR1C 1Q811 4MH4A 1VQN1 3OW2Y 4LFBC 3GTLI 1JJ2Y 2E8CA 3LNOA 4JI3C 1Q16A 1N34C 3R9XA 3AF5A 3TDEA 3I08A 2QVXX 4OXIA 2BH1X 4Y7NI 1VQ7Z 1YJ9Z 1L1OC 4HPVA 4E2WA 3VMIA 5IP9I 1I6HI 3UEBA 4FUTA 3TE5B 4NBDA 3U50C 1XMQC 1QF8A 4NBHA 4E30A 1MXAA 1T5HX 4DR3C 3UZ0A 2HU9A 3N2QA 1IBMC 4RMNA 4LF9C 3I4NI 1FDIA 1VQNZ 4A93I 5FLMI 1YIJ1 3FQQA 1ULTA 4KTTA 1RO2A 4E32A 2G2KA 1R9TI 3R9WA 3G711 1HNWC 1QM4A 2OO4A 3CC21 4NBGA 3GTQI 1Y8CA 3CQ2A 3EEDA 1RQFA 5LCIA 3S15I 2CY1A 3K7AI 3HKZA 2NVYI 4DV4C 4GKKC 4A3BI 1QVGY 1KD11 1KC81 2CXCA 4JI4C 4DG9A 3S2HI 5E7QA 4DR2C 1VQ5Z 3NDJA 2E2II 5IWAC 2O4HA 2P2JA 5BSRA 2RIQA 4GS5A 1YIJZ 4A3JI 1S7MA 1VQ91 2VPXA 4BY1I 2VQFC 5LMUC 4DV3C 4AQYC 2EGTA 3NH4A 1VQ61 3G71Z 2UUCC 3CC2Z 4LF7C 1Q861 2QR1B 2MM9A 4RVOA 5GTDA 2JR6A 3RG2A 4LF6C 3NFZA 3CQZI 2JS4A 2AYAA 4EATA 3GKQA 3VTNA 2NVXI 3LNVA 3HOYI 4HGYA 1XS3A 4R1LA 1YJW1 3H3VJ 2HJGA 4JI8C 5T6BA 1ZB9A 4A3MI 4NH1C 4AYBA 2Z51A 4U5YD 1XHJA 3LAXA 1VQ9Z 2JNYA 1VQ6Z 5FLXf 4BBSI 3PO2I 4JI6C 1FJGC 3J80f 1I3QI 2E7ZA 4ISBA 1M902 3VNQA 1N32C 3CPWY 2J6AA 1O93A 1VQL1 4ZJZA 4DUYC 1XRAA 4NBEA 1RLYA 1MDFA 3FCEA 2YADA 2D1SA 2YCBA 4WV3A 1YJWZ 4JV5C 4YHHC 1YHQ1 3S1RI 1Y1VI 2QLVB 4LF8C 3T4NB 2OTL1 3GTMS 3BG1B 4DV1C 2KZ0A 2M5HA 5A1IA 5BUQA 1WCMI 3IX0A 3G7SA 5T8TA 3IEVA 3BG0B 4MD9A 2W04A 4RVDA 2JIMA 1KD12 3G4S1 1VQLZ 2V45A 4MD8A 4MXUA 5BURA 1K9M1 2WB1A 1QYPA 4L4QA 1YUAA 2AYDA 1K732 1NJI2 2P2FA 3N54B 5DV9A 3AF6A 4DCTA 1XMOC 1Z01A 3DAYA 1NUIA 1VQM1 4G1IA 1LQLA 3ETCA 3L8CA 4OX9C 1YHQZ 4E33A 3I07A 3CCS1 4TPSB 1LCIA 2Y0SA 3AY0A 2YWBA 3J7A4 1MKYA 3JAMf 4A3CI 2YWCA 3A25A 3CC71 4PUIA 4L7IA 3IR7A 1QVFY 1Q821 4DCSA 4QTTA 2DPLA 4R0MA 4EWCA 3C5EA 5KYVA 1XRBA 1I94C 2CU6A 4A3LI 2P2BA 4CL1A 4D57A 2DE7A 3G4SZ 3J81f 5A19A 3RZOI 1DL6A 5T67A 2E8EA 2V8IA 4MONA 1RNIA 2PM9A 1AMUA 4X64C 1VQMZ 2IZ3A 2BJOA 3B7WA 4MTNA 3CCSZ 4RLQA 2MMAB 2K3RA 3IMLA 4R1MA 5A1GA 1BA3A 1N33C 3CC7Z 2JNVA 4NBBA 4BSZA 4DCUA 3CC41 2K5RA 1PG4A 2M5OA 3MZLB 1V60A 5FLXb 5BUSA 1VQ41 1KRLA 1IBLC 2JIQA 3J80b 3PO3I 1MD9A 2P20A 4A3DI 1HNZC 1HNXC 3GR1A 4YY3C 4D4GA 5IT9f 2VSQA 4BC9A 2DE5A 2QVYX 4L2ZA 1NP6A 3VNRA 3GTPI 2GTHA 2F4OA 2ASBA 3IEUA 3KXWA 4K0KC 5C44I 3F3PC 2P02A 5BSMA 2UUBC 4LFCC 2F4VC 4S1TA 2V8KA 3NI2A 2GU2A 3CW8X 2JMOA 3OW2Z 2D1QA 4NFRA 1JJ2Z 1GPMA 1YJN1 3GTOI 2W03A 1PFTA 4A3II 3CC4Z 2E5LC 1YJ7A 2UXBC 3MONA 4DGLA 1VQ4Z 1EGAA 4X62C 4DQYB 1Q7Y1 4QTUA 4HGZA 4E31A 3HOWI 2RHBA 4B3MC 5LMNC 3G6E1 4NDNA 3P5JB 1M1K1 2OPLA 1YIT1 4B3TC 1O92A 2Q51A 5C4JI 4NB9A 1P4EC 2DE6A 4DR4C 3PROC 1Q822 1PU1A 3VNSA 1K8A1 3A9UA 5T8SA 1W2BY 1YJNZ 1N2FA 3FQMA 3JAMb 3GTKI 4BCAA 3T1YC 4NB8A 2E7GA 5BSUA 1MDBA 1MXBA 4E2XA 5FLXD 4DV2C 3J80D 3VB9A 2D1RA 2PMZA 4NXMC 1HR0C 3CCU1 1Q812 2NVTI 2UXCC 2JIPA 4NBAA 3I4MI 2V8JA 1KQSY 3CXCY 2D28C 2QEX1 3J81b 4I9FA 2JIRA 3G6EZ 5T64A 1SFOI 3HOVI 1QVGZ 3RV2A 1YITZ 5C3EI 1M6XC 4PUHA 5K85A 4FUQA 2NVQI 1HH2P 2B63I 1NY8A 2RBLA 2OZKA 4NBCA 4BBYA
chains in the Genus database with same CATH topology
3GPCA 4DR5C 3CCL1 3T1HC 3QWUA 2VUMI 3KIHA 4JI5C 3NH8A 1WH9A 1ZH1A 2R6MA 3ETOA 5D1OA 3CCUZ 3GCFA 2R92I 1TWHI 2JMPA 2QA41 4RVNA 2ATWA 4DCVA 5ADZA 5IP7I 1RY2A 2QEXZ 2R93I 5IT9b 1IBKC 2HHHC 4LF4C 2QL8A 1KKGA 3A9VA 3F3FC 1UKKA 1V26A 2R7ZI 2P28A 3NH5A 4MRIA 1S721 4Y52I 1MXCA 3CCR1 2OPLB 5AN9F 4JI0C 3CD61 3JAMD 4FTFA 3S16I 3CCLZ 1KC82 2KPIA 3GKUA 2Q4ZA 4BXXI 2D7VA 3VMHA 4A3GI 3CJEA 2E2JI 1YUKA 3CPWZ 3J81D 1N36C 4JI7C 3TDHB 2VZEA 2M48A 2PROA 2VF1A 1K0RA 4MD7A 2E8FA 3NYRA 1P7LA 3GTMI 1USPB 1PA4A 2OOXB 1Q862 4I9GA 3CMA1 2OTLZ 4PZPA 2QW0X 3RZDI 3I551 3CCE1 1S72Z 3CCRZ 3CD6Z 1Z02A 2RT9A 1VQP1 2GTIA 2I3CA 1K83I 3A4IA 3S82A 4DV5C 1J5EC 3S17I 2KZFA 5C4XI 1RO4A 3S2DI 2F4MA 2JA8I 2DYJA 3DLPX 3L95X 1IBMC 3CCV1 5AE3A 5IT9D 4RS4A 4B3RC 3Q87A 2E0GA 2ONFA 1V25A 2ZAEB 5BSWA 4B3SC 5D1OB 5K8FA 4ODJA 2Y27A 5KYTA 1N8R2 3CMAZ 1O90A 4DUZC 2M6NA 4BBRI 3I55Z 3CCEZ 2IZ4A 4PHTA 3M3YI 3LGXA 4LE5A 4TNUA 3NPDA 5CZXA 1Z03A 1Y1WI 1YI21 1VQPZ 2P2MA 3CCJ1 1QVFZ 2QREB 4RM2A 5KEIA 2AKLA 2YU9I 3CCVZ 4ZLPA 2P2QA 4KHPC 1WIIA 4RLFA 1XNQC 2QKDA 3CW9A 4HH4A 2HF1A 4A3KI 5A2Qf 3LUSA 2QRDB 3KIFA 1VQ81 2V7BA 5D1PA 4DV7C 1M901 3ESWA 4D4IA 2ZM6C 1K9M2 4G37A 5LL6f 1VQ51 3TQIA 1YI2Z 3IPLA 3CCJZ 4OYCA 2H85A 5BSTA 3EERA 4DK1A 1X3WA 3IF8A 1O9TA 3GR0A 2QVZX 4G36A 1T5DX 4RVFA 3MZKB 1L2FA 3H0GI 3R44A 1RO0A 3PESA 4PROC 1VQK1 3FKII 4DR6C 2QRCB 1VQ8Z 4X65C 3HOZI 2VQEC 4DG8A 3FCCA 2JA5I 2PN2A 3I561 1XNRC 1USPA 5CM2M 5CZVA 1K731 1NJI1 3S1MI 5AE2A 4DV6C 2LIYA 2OTJ1 3E7XA 2UXDC 3CCQ1 1JWHC 3NYQA 4DV0C 3HOXI 3S14I 1VQKZ 4NXNC 4GXQA 4XX2A 3GTGI 4LF5C 1W2BZ 3I56Z 1ML8A 4IZ6A 2OBVA 3UOWA 5AE1A 4JYAC 2O53A 1TWGI 3CME1 1P9NA 1Y1VS 4NBFA 4RV9A 1TWAI 2OOYB 2VUGA 2OTJZ 2RPRA 1PG3A 3PBKA 1KQSZ 4X66C 4E2ZA 4JM1A 3CXCZ 1FUGA 3TUFA 2UUAC 3CCQZ 2D1TA 2Y4OA 1VLAA 4GXRA 2WP0C 2P3YA 3HOUI 5A2Qb 1Q7Y2 4GKJC 3IFUA 3NDIA 1QWIA 4X6AI 3SO4A 3VMGA 2QA4Z 2WD9A 1M1K2 3E7WA 4RVGA 2JA7I 2D27A 2Y4NA 3OTOC 3S1NI 1TFIA 3CMEZ 4A3FI 3CCM1 1K8A2 2UU9C 1NYEA 2JUBA 4BY7I 1TWFI 4WS9A 4NOZA 1N8R1 3DHVA 4KTVA 1WW9A 3H2TA 2PK7A 1VQO1 5H9UA 3D9XA 1WF3A 4DR7C 1ZB8A 5BSVA 3S1QI 2E9HA 3EQ6A 4RVHA 4A3EI 5JRHA 4K0BA 2WAQA 2JA6I 1VQ71 1YJ91 1JOSA 1I50I 4BC7A 1X0TA 4JI2C 2XR1A 3CCMZ 1XRCA 3D6WA 1X3ZA 5BR8C 4LFAC 4IR7A 5IFIA 4E2YA 4RM3A 2KI7B 5A2QD 2PT7G 3GTJI 4JI1C 1RG9A 1VQOZ 3PO3S 2LFUA 1TWCI 4D56A 2E2HI 3M4OI 4DR1C 1Q811 4MH4A 1VQN1 3OW2Y 4LFBC 3GTLI 1JJ2Y 2E8CA 4JI3C 1N34C 3R9XA 3AF5A 3TDEA 3I08A 2QVXX 4OXIA 2BH1X 4Y7NI 1VQ7Z 1YJ9Z 1L1OC 4HPVA 4E2WA 3VMIA 5IP9I 1I6HI 4FUTA 3TE5B 4NBDA 3U50C 1XMQC 1QF8A 4NBHA 4E30A 1MXAA 1T5HX 4DR3C 3UZ0A 2HU9A 3N2QA 4RMNA 4LF9C 3I4NI 1VQNZ 4A93I 5FLMI 1YIJ1 3FQQA 1ULTA 4KTTA 1RO2A 4E32A 2G2KA 1R9TI 3R9WA 3G711 1HNWC 1QM4A 2OO4A 3CC21 4NBGA 3GTQI 3EEDA 1RQFA 3S15I 2CY1A 3K7AI 3HKZA 2NVYI 4DV4C 4GKKC 4A3BI 1QVGY 1KD11 1KC81 2CXCA 4JI4C 4DG9A 3S2HI 5E7QA 4DR2C 1VQ5Z 3NDJA 2E2II 5IWAC 2O4HA 2P2JA 5BSRA 2RIQA 4GS5A 1YIJZ 4A3JI 1S7MA 1VQ91 2VQFC 4BY1I 5LMUC 4AQYC 4DV3C 2EGTA 3NH4A 1VQ61 3G71Z 2UUCC 3CC2Z 4LF7C 1Q861 2QR1B 4RVOA 5GTDA 2JR6A 3RG2A 4LF6C 3NFZA 3CQZI 2JS4A 2AYAA 4EATA 3GKQA 3VTNA 2NVXI 3LNVA 3HOYI 4HGYA 4R1LA 1YJW1 3H3VJ 2HJGA 4JI8C 5T6BA 1ZB9A 4A3MI 4NH1C 4AYBA 4U5YD 3LAXA 1VQ9Z 2JNYA 1VQ6Z 5FLXf 4BBSI 3PO2I 4JI6C 1FJGC 3J80f 1I3QI 3VNQA 4ISBA 1M902 1N32C 3CPWY 2J6AA 1O93A 1VQL1 4ZJZA 4DUYC 1XRAA 4NBEA 1RLYA 1MDFA 3FCEA 2YADA 2D1SA 2YCBA 4WV3A 1YJWZ 4JV5C 4YHHC 1YHQ1 3S1RI 1Y1VI 2QLVB 4LF8C 3T4NB 2OTL1 3GTMS 3BG1B 4DV1C 5A1IA 5BUQA 1WCMI 3IX0A 3G7SA 5T8TA 3IEVA 3BG0B 4MD9A 2W04A 4RVDA 1KD12 3G4S1 1VQLZ 4MD8A 4MXUA 5BURA 1K9M1 2WB1A 1QYPA 4L4QA 1YUAA 1K732 1NJI2 2P2FA 3N54B 5DV9A 3AF6A 1XMOC 4DCTA 1Z01A 3DAYA 1NUIA 1VQM1 4G1IA 1LQLA 3ETCA 3L8CA 4OX9C 1YHQZ 4E33A 3I07A 3CCS1 4TPSB 1LCIA 2Y0SA 2YWBA 3J7A4 1MKYA 3JAMf 4A3CI 2YWCA 3CC71 4L7IA 1QVFY 1Q821 4DCSA 4QTTA 2DPLA 4R0MA 4EWCA 3C5EA 5KYVA 1XRBA 1I94C 4A3LI 2P2BA 4CL1A 4D57A 2DE7A 3G4SZ 3J81f 5A19A 3RZOI 1DL6A 5T67A 2E8EA 2V8IA 4MONA 1RNIA 2PM9A 1AMUA 4X64C 1VQMZ 2IZ3A 2BJOA 3B7WA 4MTNA 3CCSZ 4RLQA 2K3RA 3IMLA 4R1MA 5A1GA 1BA3A 1N33C 3CC7Z 4BSZA 4NBBA 4DCUA 3CC41 2K5RA 1PG4A 3MZLB 5FLXb 5BUSA 1VQ41 1KRLA 1IBLC 3J80b 3PO3I 1MD9A 2P20A 4A3DI 1HNZC 1HNXC 3GR1A 4YY3C 4D4GA 5IT9f 2VSQA 4BC9A 2DE5A 2QVYX 4L2ZA 1NP6A 3VNRA 3GTPI 2GTHA 2F4OA 2ASBA 3IEUA 3KXWA 4K0KC 5C44I 3F3PC 2P02A 5BSMA 2UUBC 4LFCC 2F4VC 4S1TA 2V8KA 3NI2A 2GU2A 3CW8X 2JMOA 3OW2Z 2D1QA 4NFRA 1JJ2Z 1GPMA 1YJN1 3GTOI 2W03A 1PFTA 4A3II 3CC4Z 2E5LC 1YJ7A 2UXBC 3MONA 4DGLA 1VQ4Z 1EGAA 4X62C 4DQYB 1Q7Y1 4QTUA 4HGZA 4E31A 3HOWI 2RHBA 4B3MC 5LMNC 3G6E1 4NDNA 3P5JB 1M1K1 2OPLA 1YIT1 4B3TC 1O92A 2Q51A 5C4JI 4NB9A 2DE6A 4DR4C 3PROC 1Q822 3VNSA 1K8A1 3A9UA 5T8SA 1W2BY 1YJNZ 1N2FA 3FQMA 3JAMb 3GTKI 4BCAA 3T1YC 4NB8A 2E7GA 5BSUA 1MDBA 1MXBA 4E2XA 5FLXD 4DV2C 3J80D 3VB9A 2D1RA 2PMZA 4NXMC 1HR0C 3CCU1 1Q812 2NVTI 2UXCC 4NBAA 3I4MI 2V8JA 1KQSY 3CXCY 2D28C 2QEX1 3J81b 4I9FA 3HOVI 3G6EZ 5T64A 1SFOI 1QVGZ 3RV2A 1YITZ 5C3EI 5K85A 4FUQA 2NVQI 1HH2P 2B63I 2RBLA 2OZKA 4NBCA 4BBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 C;  3T1H C;  2VUM I;  4JI5 C;  1WH9 A;  3GCF A;  2R92 I;  1TWH I;  2JMP A;  2ATW A;  4DCV A;  5IP7 I;  2R93 I;  1IBK C;  2HHH C;  4LF4 C;  2QL8 A;  1KKG A;  1UKK A;  2R7Z I;  4B3M C;  4Y52 I;  2OPL B;  4JI0 C;  3JAM D;  3S16 I;  2KPI A;  3GKU A;  4BXX I;  2D7V A;  3VMH A;  4A3G I;  3CJE A;  2E2J I;  1N36 C;  3J81 D;  4JI7 C;  1K0R A;  2E8F A;  3GTM I;  1USP B;  1PA4 A;  3RZD I;  1K83 I;  4DV5 C;  1J5E C;  3S17 I;  2KZF A;  5C4X I;  1RO4 A;  3S2D I;  2F4M A;  2JA8 I;  2DYJ A;  1IBM C;  4B3R C;  5IT9 D;  3Q87 A;  2ONF A;  4B3S C;  4DUZ C;  4BBR I;  3M3Y I;  1Y1W I;  2AKL A;  2YU9 I;  4KHP C;  1XNQ C;  2HF1 A;  4A3K I;  3LUS A;  4DV7 C;  3ESW A;  2ZM6 C;  3EER A;  1X3W A;  1L2F A;  3H0G I;  3FKI I;  4DR6 C;  4X65 C;  3HOZ I;  2VQE C;  2JA5 I;  2PN2 A;  1XNR C;  1USP A;  5CM2 M;  3S1M I;  4DV6 C;  2UXD C;  4DV0 C;  3HOX I;  3S14 I;  4NXN C;  4XX2 A;  3GTG I;  4LF5 C;  1ML8 A;  4JYA C;  1TWG I;  1Y1V S;  4NBF A;  1TWA I;  4X66 C;  2UUA C;  1VLA A;  2P3Y A;  3HOU I;  4GKJ C;  1QWI A;  4X6A I;  3VMG A;  2JA7 I;  3OTO C;  3S1N I;  1TFI A;  4A3F I;  2UU9 C;  1NYE A;  4BY7 I;  1TWF I;  4NOZ A;  1WW9 A;  2PK7 A;  1WF3 A;  4DR7 C;  1ZB8 A;  3S1Q I;  4A3E I;  2JA6 I;  1JOS A;  1I50 I;  4JI2 C;  2XR1 A;  3D6W A;  1X3Z A;  5BR8 C;  4LFA C;  5A2Q D;  2PT7 G;  3GTJ I;  4JI1 C;  3PO3 S;  1TWC I;  2E2H I;  3M4O I;  4DR1 C;  4MH4 A;  4LFB C;  3GTL I;  2E8C A;  4JI3 C;  1N34 C;  3R9X A;  3AF5 A;  4Y7N I;  1L1O C;  3VMI A;  5IP9 I;  1I6H I;  3U50 C;  4NBD A;  1XMQ C;  4NBH A;  4DR3 C;  4LF9 C;  3I4N I;  4A93 I;  5FLM I;  1R9T I;  3R9W A;  1HNW C;  3GTQ I;  4NBG A;  3S15 I;  2CY1 A;  3K7A I;  2NVY I;  4DV4 C;  4GKK C;  4A3B I;  2CXC A;  4JI4 C;  3S2H I;  4DR2 C;  2E2I I;  5IWA C;  4A3J I;  2VQF C;  4AQY C;  4BY1 I;  5LMU C;  4DV3 C;  2EGT A;  2UUC C;  4LF7 C;  2JR6 A;  4LF6 C;  3CQZ I;  2JS4 A;  3GKQ A;  2NVX I;  3HOY I;  3H3V J;  2HJG A;  4JI8 C;  1ZB9 A;  4A3M I;  2JNY A;  4BBS I;  3PO2 I;  4JI6 C;  1FJG C;  1I3Q I;  1N32 C;  2J6A A;  4DUY C;  4NBE A;  1RLY A;  2YCB A;  4JV5 C;  4YHH C;  3S1R I;  1Y1V I;  4LF8 C;  3GTM S;  4DV1 C;  1WCM I;  3IEV A;  1QYP A;  1YUA A;  3AF6 A;  1XMO C;  4DCT A;  1NUI A;  1LQL A;  4OX9 C;  3I07 A;  1MKY A;  4A3C I;  4DCS A;  4QTT A;  1I94 C;  4A3L I;  2DE7 A;  3RZO I;  1DL6 A;  2E8E A;  4X64 C;  2BJO A;  4MTN A;  1N33 C;  4BSZ A;  4NBB A;  4DCU A;  2K5R A;  1IBL C;  3PO3 I;  1HNX C;  1HNZ C;  4A3D I;  4YY3 C;  2DE5 A;  2ASB A;  3GTP I;  2F4O A;  3IEU A;  4K0K C;  5C44 I;  4LFC C;  2F4V C;  2UUB C;  3GTO I;  1PFT A;  4A3I I;  2E5L C;  2UXB C;  1EGA A;  4X62 C;  4QTU A;  3HOW I;  5LMN C;  2OPL A;  4B3T C;  5C4J I;  4NB9 A;  2DE6 A;  4DR4 C;  1N2F A;  3GTK I;  3T1Y C;  4NB8 A;  2E7G A;  5FLX D;  4DV2 C;  3J80 D;  3VB9 A;  2UXC C;  4NXM C;  1HR0 C;  2NVT I;  4NBA A;  3I4M I;  3HOV I;  1SFO I;  5C3E I;  2NVQ I;  1HH2 P;  2B63 I;  2RBL A;  4NBC A; 
#chains in the Genus database with same CATH topology
 3GPC A;  4DR5 C;  3CCL 1;  3T1H C;  3QWU A;  2VUM I;  3KIH A;  4JI5 C;  3NH8 A;  1WH9 A;  2NCL A;  1ZH1 A;  2R6M A;  3ETO A;  5D1O A;  3CCU Z;  3GCF A;  2R92 I;  1TWH I;  2JMP A;  2QA4 1;  4RVN A;  2ATW A;  4DCV A;  2ZZN A;  5ADZ A;  1TH5 A;  5IP7 I;  1RY2 A;  2QEX Z;  2R93 I;  5IT9 b;  1WCJ A;  1WJ2 A;  1IBK C;  2HHH C;  4LF4 C;  3TR3 A;  2QL8 A;  2ZZM A;  1KKG A;  3A9V A;  3F3F C;  1UKK A;  1V26 A;  3O2E A;  2R7Z I;  2P28 A;  3NH5 A;  4MRI A;  1S72 1;  4Y52 I;  1MXC A;  2VPY A;  3CCR 1;  5AN9 F;  2OPL B;  4JI0 C;  3CD6 1;  3JAM D;  4FTF A;  3S16 I;  3CCL Z;  1KC8 2;  2KPI A;  3GKU A;  2Q4Z A;  4BXX I;  1SIW A;  2D7V A;  3VMH A;  4A3G I;  3CJE A;  2E2J I;  1YUK A;  3CPW Z;  3J81 D;  1N36 C;  4JI7 C;  3TDH B;  2VZE A;  2M48 A;  2PRO A;  2VF1 A;  1K0R A;  4MD7 A;  2E8F A;  3NYR A;  1P7L A;  3GTM I;  1USP B;  1PA4 A;  2OOX B;  1Q86 2;  4I9G A;  3CMA 1;  2OTL Z;  4PZP A;  2QW0 X;  3RZD I;  3I55 1;  3CCE 1;  1S72 Z;  2MCQ A;  3CCR Z;  3CD6 Z;  1Z02 A;  2RT9 A;  1VQP 1;  2GTI A;  2I3C A;  1K83 I;  3A4I A;  3S82 A;  4DV5 C;  1J5E C;  3S17 I;  2KZF A;  5C4X I;  1RO4 A;  3S2D I;  2F4M A;  2JA8 I;  1VEH A;  2DYJ A;  3DLP X;  3L95 X;  3CCV 1;  5AE3 A;  5IT9 D;  4RS4 A;  4B3R C;  3Q87 A;  2E0G A;  2ONF A;  1V25 A;  2ZAE B;  5BSW A;  4B3S C;  5D1O B;  5K8F A;  3UX3 A;  4ODJ A;  2Y27 A;  5KYT A;  1N8R 2;  3CMA Z;  1O90 A;  1M6X A;  4DUZ C;  2M6N A;  4BBR I;  3I55 Z;  3CCE Z;  2IZ4 A;  4PHT A;  3M3Y I;  2DHM A;  3LGX A;  4LE5 A;  4TNU A;  3NPD A;  5CZX A;  1Z03 A;  2LEX A;  1Y1W I;  1VQP Z;  1YI2 1;  2P2M A;  3CCJ 1;  1QVF Z;  3A26 A;  2QRE B;  4RM2 A;  5KEI A;  2AKL A;  2YU9 I;  3CCV Z;  4ZLP A;  2P2Q A;  4KHP C;  1WII A;  4RLF A;  1XNQ C;  2QKD A;  3CW9 A;  4HH4 A;  2HF1 A;  4A3K I;  5A2Q f;  3LUS A;  2QRD B;  3KIF A;  1VQ8 1;  1IB8 A;  5D1P A;  2V7B A;  1M90 1;  3ESW A;  4DV7 C;  4D4I A;  2ZM6 C;  1K9M 2;  1AA6 A;  2VPZ A;  4G37 A;  5LL6 f;  1VQ5 1;  3TQI A;  1YI2 Z;  3IPL A;  3CCJ Z;  4OYC A;  2H85 A;  5BST A;  3EER A;  4PUG A;  4DK1 A;  1X3W A;  3IF8 A;  1O9T A;  3GR0 A;  2QVZ X;  1QXF A;  4G36 A;  1T5D X;  4RVF A;  3MZK B;  1WZN A;  1L2F A;  3H0G I;  2IV2 X;  3R44 A;  1RO0 A;  3PES A;  4PRO C;  1VQK 1;  3FKI I;  4DR6 C;  2QRC B;  1VQ8 Z;  4X65 C;  3HOZ I;  2VQE C;  4DG8 A;  3FCC A;  2JA5 I;  2PN2 A;  3I56 1;  1XNR C;  1USP A;  5CM2 M;  5CZV A;  1K73 1;  1NJI 1;  3S1M I;  5AE2 A;  4DV6 C;  2LIY A;  2OTJ 1;  3E7X A;  2UXD C;  3CCQ 1;  1JWH C;  3NYQ A;  4DV0 C;  3HOX I;  3S14 I;  1VQK Z;  2YX1 A;  4NXN C;  4GXQ A;  4XX2 A;  3GTG I;  4LF5 C;  1W2B Z;  3I56 Z;  1ML8 A;  4IZ6 A;  2OBV A;  3UOW A;  5AE1 A;  2NAP A;  4JYA C;  2O53 A;  1TWG I;  3CME 1;  1FDO A;  1P9N A;  1Y1V S;  3CQ3 A;  4NBF A;  4RV9 A;  1TWA I;  2OOY B;  2VUG A;  2OTJ Z;  2RPR A;  1PG3 A;  3PBK A;  1KQS Z;  4X66 C;  4E2Z A;  4JM1 A;  3CXC Z;  1FUG A;  3TUF A;  2UUA C;  3CCQ Z;  2D1T A;  2Y4O A;  1VLA A;  4GXR A;  2WP0 C;  2P3Y A;  3HOU I;  5A2Q b;  1Q7Y 2;  4GKJ C;  3IFU A;  3NDI A;  1QWI A;  4X6A I;  3UX2 A;  3SO4 A;  3VMG A;  2QA4 Z;  2WD9 A;  2VPW A;  1M1K 2;  3E7W A;  4RVG A;  2JA7 I;  2D27 A;  2Y4N A;  3OTO C;  3S1N I;  1TFI A;  3CME Z;  3K6R A;  4A3F I;  3CCM 1;  1K8A 2;  2UU9 C;  1NYE A;  2JUB A;  1FLO A;  4BY7 I;  1P4E A;  1TWF I;  4WS9 A;  3CQ1 A;  4NOZ A;  1N8R 1;  3DHV A;  4KTV A;  1WW9 A;  3H2T A;  2PK7 A;  1VQO 1;  5H9U A;  3D2L A;  3D9X A;  1WF3 A;  4DR7 C;  1ZB8 A;  5BSV A;  3S1Q I;  2E9H A;  3EQ6 A;  4RVH A;  4A3E I;  5JRH A;  4K0B A;  2JIO A;  2WAQ A;  1UWD A;  2JA6 I;  1VQ7 1;  1YJ9 1;  1JOS A;  2KDN A;  1I50 I;  4BC7 A;  1X0T A;  4JI2 C;  2XR1 A;  3CCM Z;  1XRC A;  3D6W A;  1X3Z A;  5BR8 C;  4LFA C;  4IR7 A;  5IFI A;  4E2Y A;  4RM3 A;  2KI7 B;  2V3V A;  5A2Q D;  2PT7 G;  3GTJ I;  4JI1 C;  1RG9 A;  1VQO Z;  3PO3 S;  2LFU A;  1TWC I;  4D56 A;  2E2H I;  3M4O I;  4DR1 C;  1Q81 1;  4MH4 A;  1VQN 1;  3OW2 Y;  4LFB C;  3GTL I;  1JJ2 Y;  2E8C A;  3LNO A;  4JI3 C;  1Q16 A;  1N34 C;  3R9X A;  3AF5 A;  3TDE A;  3I08 A;  2QVX X;  4OXI A;  2BH1 X;  4Y7N I;  1VQ7 Z;  1YJ9 Z;  1L1O C;  4HPV A;  4E2W A;  3VMI A;  5IP9 I;  1I6H I;  3UEB A;  4FUT A;  3TE5 B;  4NBD A;  3U50 C;  1XMQ C;  1QF8 A;  4NBH A;  4E30 A;  1MXA A;  1T5H X;  4DR3 C;  3UZ0 A;  2HU9 A;  3N2Q A;  1IBM C;  4RMN A;  4LF9 C;  3I4N I;  1FDI A;  1VQN Z;  4A93 I;  5FLM I;  1YIJ 1;  3FQQ A;  1ULT A;  4KTT A;  1RO2 A;  4E32 A;  2G2K A;  1R9T I;  3R9W A;  3G71 1;  1HNW C;  1QM4 A;  2OO4 A;  3CC2 1;  4NBG A;  3GTQ I;  1Y8C A;  3CQ2 A;  3EED A;  1RQF A;  5LCI A;  3S15 I;  2CY1 A;  3K7A I;  3HKZ A;  2NVY I;  4DV4 C;  4GKK C;  4A3B I;  1QVG Y;  1KD1 1;  1KC8 1;  2CXC A;  4JI4 C;  4DG9 A;  3S2H I;  5E7Q A;  4DR2 C;  1VQ5 Z;  3NDJ A;  2E2I I;  5IWA C;  2O4H A;  2P2J A;  5BSR A;  2RIQ A;  4GS5 A;  1YIJ Z;  4A3J I;  1S7M A;  1VQ9 1;  2VPX A;  4BY1 I;  2VQF C;  5LMU C;  4DV3 C;  4AQY C;  2EGT A;  3NH4 A;  1VQ6 1;  3G71 Z;  2UUC C;  3CC2 Z;  4LF7 C;  1Q86 1;  2QR1 B;  2MM9 A;  4RVO A;  5GTD A;  2JR6 A;  3RG2 A;  4LF6 C;  3NFZ A;  3CQZ I;  2JS4 A;  2AYA A;  4EAT A;  3GKQ A;  3VTN A;  2NVX I;  3LNV A;  3HOY I;  4HGY A;  1XS3 A;  4R1L A;  1YJW 1;  3H3V J;  2HJG A;  4JI8 C;  5T6B A;  1ZB9 A;  4A3M I;  4NH1 C;  4AYB A;  2Z51 A;  4U5Y D;  1XHJ A;  3LAX A;  1VQ9 Z;  2JNY A;  1VQ6 Z;  5FLX f;  4BBS I;  3PO2 I;  4JI6 C;  1FJG C;  3J80 f;  1I3Q I;  2E7Z A;  4ISB A;  1M90 2;  3VNQ A;  1N32 C;  3CPW Y;  2J6A A;  1O93 A;  1VQL 1;  4ZJZ A;  4DUY C;  1XRA A;  4NBE A;  1RLY A;  1MDF A;  3FCE A;  2YAD A;  2D1S A;  2YCB A;  4WV3 A;  1YJW Z;  4JV5 C;  4YHH C;  1YHQ 1;  3S1R I;  1Y1V I;  2QLV B;  4LF8 C;  3T4N B;  2OTL 1;  3GTM S;  3BG1 B;  4DV1 C;  2KZ0 A;  2M5H A;  5A1I A;  5BUQ A;  1WCM I;  3IX0 A;  3G7S A;  5T8T A;  3IEV A;  3BG0 B;  4MD9 A;  2W04 A;  4RVD A;  2JIM A;  1KD1 2;  3G4S 1;  1VQL Z;  2V45 A;  4MD8 A;  4MXU A;  5BUR A;  1K9M 1;  2WB1 A;  1QYP A;  4L4Q A;  1YUA A;  2AYD A;  1K73 2;  1NJI 2;  2P2F A;  3N54 B;  5DV9 A;  3AF6 A;  4DCT A;  1XMO C;  1Z01 A;  3DAY A;  1NUI A;  1VQM 1;  4G1I A;  1LQL A;  3ETC A;  3L8C A;  4OX9 C;  1YHQ Z;  4E33 A;  3I07 A;  3CCS 1;  4TPS B;  1LCI A;  2Y0S A;  3AY0 A;  2YWB A;  3J7A 4;  1MKY A;  3JAM f;  4A3C I;  2YWC A;  3A25 A;  3CC7 1;  4PUI A;  4L7I A;  3IR7 A;  1QVF Y;  1Q82 1;  4DCS A;  4QTT A;  2DPL A;  4R0M A;  4EWC A;  3C5E A;  5KYV A;  1XRB A;  1I94 C;  2CU6 A;  4A3L I;  2P2B A;  4CL1 A;  4D57 A;  2DE7 A;  3G4S Z;  3J81 f;  5A19 A;  3RZO I;  1DL6 A;  5T67 A;  2E8E A;  2V8I A;  4MON A;  1RNI A;  2PM9 A;  1AMU A;  4X64 C;  1VQM Z;  2IZ3 A;  2BJO A;  3B7W A;  4MTN A;  3CCS Z;  4RLQ A;  2MMA B;  2K3R A;  3IML A;  4R1M A;  5A1G A;  1BA3 A;  1N33 C;  3CC7 Z;  2JNV A;  4NBB A;  4BSZ A;  4DCU A;  3CC4 1;  2K5R A;  1PG4 A;  2M5O A;  3MZL B;  1V60 A;  5FLX b;  5BUS A;  1VQ4 1;  1KRL A;  1IBL C;  2JIQ A;  3J80 b;  3PO3 I;  1MD9 A;  2P20 A;  4A3D I;  1HNZ C;  1HNX C;  3GR1 A;  4YY3 C;  4D4G A;  5IT9 f;  2VSQ A;  4BC9 A;  2DE5 A;  2QVY X;  4L2Z A;  1NP6 A;  3VNR A;  3GTP I;  2GTH A;  2F4O A;  2ASB A;  3IEU A;  3KXW A;  4K0K C;  5C44 I;  3F3P C;  2P02 A;  5BSM A;  2UUB C;  4LFC C;  2F4V C;  4S1T A;  2V8K A;  3NI2 A;  2GU2 A;  3CW8 X;  2JMO A;  3OW2 Z;  2D1Q A;  4NFR A;  1JJ2 Z;  1GPM A;  1YJN 1;  3GTO I;  2W03 A;  1PFT A;  4A3I I;  3CC4 Z;  2E5L C;  1YJ7 A;  2UXB C;  3MON A;  4DGL A;  1VQ4 Z;  1EGA A;  4X62 C;  4DQY B;  1Q7Y 1;  4QTU A;  4HGZ A;  4E31 A;  3HOW I;  2RHB A;  4B3M C;  5LMN C;  3G6E 1;  4NDN A;  3P5J B;  1M1K 1;  2OPL A;  1YIT 1;  4B3T C;  1O92 A;  2Q51 A;  5C4J I;  4NB9 A;  1P4E C;  2DE6 A;  4DR4 C;  3PRO C;  1Q82 2;  1PU1 A;  3VNS A;  1K8A 1;  3A9U A;  5T8S A;  1W2B Y;  1YJN Z;  1N2F A;  3FQM A;  3JAM b;  3GTK I;  4BCA A;  3T1Y C;  4NB8 A;  2E7G A;  5BSU A;  1MDB A;  1MXB A;  4E2X A;  5FLX D;  4DV2 C;  3J80 D;  3VB9 A;  2D1R A;  2PMZ A;  4NXM C;  1HR0 C;  3CCU 1;  1Q81 2;  2NVT I;  2UXC C;  2JIP A;  4NBA A;  3I4M I;  2V8J A;  1KQS Y;  3CXC Y;  2D28 C;  2QEX 1;  3J81 b;  4I9F A;  2JIR A;  3G6E Z;  5T64 A;  1SFO I;  3HOV I;  1QVG Z;  3RV2 A;  1YIT Z;  5C3E I;  1M6X C;  4PUH A;  5K85 A;  4FUQ A;  2NVQ I;  1HH2 P;  2B63 I;  1NY8 A;  2RBL A;  2OZK A;  4NBC A;  4BBY A; 
#chains in the Genus database with same CATH homology
 3GPC A;  4DR5 C;  3CCL 1;  3T1H C;  3QWU A;  2VUM I;  3KIH A;  4JI5 C;  3NH8 A;  1WH9 A;  1ZH1 A;  2R6M A;  3ETO A;  5D1O A;  3CCU Z;  3GCF A;  2R92 I;  1TWH I;  2JMP A;  2QA4 1;  4RVN A;  2ATW A;  4DCV A;  5ADZ A;  5IP7 I;  1RY2 A;  2QEX Z;  2R93 I;  5IT9 b;  1IBK C;  2HHH C;  4LF4 C;  2QL8 A;  1KKG A;  3A9V A;  3F3F C;  1UKK A;  1V26 A;  2R7Z I;  2P28 A;  3NH5 A;  4MRI A;  1S72 1;  4Y52 I;  1MXC A;  3CCR 1;  2OPL B;  5AN9 F;  4JI0 C;  3CD6 1;  3JAM D;  4FTF A;  3S16 I;  3CCL Z;  1KC8 2;  2KPI A;  3GKU A;  2Q4Z A;  4BXX I;  2D7V A;  3VMH A;  4A3G I;  3CJE A;  2E2J I;  1YUK A;  3CPW Z;  3J81 D;  1N36 C;  4JI7 C;  3TDH B;  2VZE A;  2M48 A;  2PRO A;  2VF1 A;  1K0R A;  4MD7 A;  2E8F A;  3NYR A;  1P7L A;  3GTM I;  1USP B;  1PA4 A;  2OOX B;  1Q86 2;  4I9G A;  3CMA 1;  2OTL Z;  4PZP A;  2QW0 X;  3RZD I;  3I55 1;  3CCE 1;  1S72 Z;  3CCR Z;  3CD6 Z;  1Z02 A;  2RT9 A;  1VQP 1;  2GTI A;  2I3C A;  1K83 I;  3A4I A;  3S82 A;  4DV5 C;  1J5E C;  3S17 I;  2KZF A;  5C4X I;  1RO4 A;  3S2D I;  2F4M A;  2JA8 I;  2DYJ A;  3DLP X;  3L95 X;  1IBM C;  3CCV 1;  5AE3 A;  5IT9 D;  4RS4 A;  4B3R C;  3Q87 A;  2E0G A;  2ONF A;  1V25 A;  2ZAE B;  5BSW A;  4B3S C;  5D1O B;  5K8F A;  4ODJ A;  2Y27 A;  5KYT A;  1N8R 2;  3CMA Z;  1O90 A;  4DUZ C;  2M6N A;  4BBR I;  3I55 Z;  3CCE Z;  2IZ4 A;  4PHT A;  3M3Y I;  3LGX A;  4LE5 A;  4TNU A;  3NPD A;  5CZX A;  1Z03 A;  1Y1W I;  1YI2 1;  1VQP Z;  2P2M A;  3CCJ 1;  1QVF Z;  2QRE B;  4RM2 A;  5KEI A;  2AKL A;  2YU9 I;  3CCV Z;  4ZLP A;  2P2Q A;  4KHP C;  1WII A;  4RLF A;  1XNQ C;  2QKD A;  3CW9 A;  4HH4 A;  2HF1 A;  4A3K I;  5A2Q f;  3LUS A;  2QRD B;  3KIF A;  1VQ8 1;  2V7B A;  5D1P A;  4DV7 C;  1M90 1;  3ESW A;  4D4I A;  2ZM6 C;  1K9M 2;  4G37 A;  5LL6 f;  1VQ5 1;  3TQI A;  1YI2 Z;  3IPL A;  3CCJ Z;  4OYC A;  2H85 A;  5BST A;  3EER A;  4DK1 A;  1X3W A;  3IF8 A;  1O9T A;  3GR0 A;  2QVZ X;  4G36 A;  1T5D X;  4RVF A;  3MZK B;  1L2F A;  3H0G I;  3R44 A;  1RO0 A;  3PES A;  4PRO C;  1VQK 1;  3FKI I;  4DR6 C;  2QRC B;  1VQ8 Z;  4X65 C;  3HOZ I;  2VQE C;  4DG8 A;  3FCC A;  2JA5 I;  2PN2 A;  3I56 1;  1XNR C;  1USP A;  5CM2 M;  5CZV A;  1K73 1;  1NJI 1;  3S1M I;  5AE2 A;  4DV6 C;  2LIY A;  2OTJ 1;  3E7X A;  2UXD C;  3CCQ 1;  1JWH C;  3NYQ A;  4DV0 C;  3HOX I;  3S14 I;  1VQK Z;  4NXN C;  4GXQ A;  4XX2 A;  3GTG I;  4LF5 C;  1W2B Z;  3I56 Z;  1ML8 A;  4IZ6 A;  2OBV A;  3UOW A;  5AE1 A;  4JYA C;  2O53 A;  1TWG I;  3CME 1;  1P9N A;  1Y1V S;  4NBF A;  4RV9 A;  1TWA I;  2OOY B;  2VUG A;  2OTJ Z;  2RPR A;  1PG3 A;  3PBK A;  1KQS Z;  4X66 C;  4E2Z A;  4JM1 A;  3CXC Z;  1FUG A;  3TUF A;  2UUA C;  3CCQ Z;  2D1T A;  2Y4O A;  1VLA A;  4GXR A;  2WP0 C;  2P3Y A;  3HOU I;  5A2Q b;  1Q7Y 2;  4GKJ C;  3IFU A;  3NDI A;  1QWI A;  4X6A I;  3SO4 A;  3VMG A;  2QA4 Z;  2WD9 A;  1M1K 2;  3E7W A;  4RVG A;  2JA7 I;  2D27 A;  2Y4N A;  3OTO C;  3S1N I;  1TFI A;  3CME Z;  4A3F I;  3CCM 1;  1K8A 2;  2UU9 C;  1NYE A;  2JUB A;  4BY7 I;  1TWF I;  4WS9 A;  4NOZ A;  1N8R 1;  3DHV A;  4KTV A;  1WW9 A;  3H2T A;  2PK7 A;  1VQO 1;  5H9U A;  3D9X A;  1WF3 A;  4DR7 C;  1ZB8 A;  5BSV A;  3S1Q I;  2E9H A;  3EQ6 A;  4RVH A;  4A3E I;  5JRH A;  4K0B A;  2WAQ A;  2JA6 I;  1VQ7 1;  1YJ9 1;  1JOS A;  1I50 I;  4BC7 A;  1X0T A;  4JI2 C;  2XR1 A;  3CCM Z;  1XRC A;  3D6W A;  1X3Z A;  5BR8 C;  4LFA C;  4IR7 A;  5IFI A;  4E2Y A;  4RM3 A;  2KI7 B;  5A2Q D;  2PT7 G;  3GTJ I;  4JI1 C;  1RG9 A;  1VQO Z;  3PO3 S;  2LFU A;  1TWC I;  4D56 A;  2E2H I;  3M4O I;  4DR1 C;  1Q81 1;  4MH4 A;  1VQN 1;  3OW2 Y;  4LFB C;  3GTL I;  1JJ2 Y;  2E8C A;  4JI3 C;  1N34 C;  3R9X A;  3AF5 A;  3TDE A;  3I08 A;  2QVX X;  4OXI A;  2BH1 X;  4Y7N I;  1VQ7 Z;  1YJ9 Z;  1L1O C;  4HPV A;  4E2W A;  3VMI A;  5IP9 I;  1I6H I;  4FUT A;  3TE5 B;  4NBD A;  3U50 C;  1XMQ C;  1QF8 A;  4NBH A;  4E30 A;  1MXA A;  1T5H X;  4DR3 C;  3UZ0 A;  2HU9 A;  3N2Q A;  4RMN A;  4LF9 C;  3I4N I;  1VQN Z;  4A93 I;  5FLM I;  1YIJ 1;  3FQQ A;  1ULT A;  4KTT A;  1RO2 A;  4E32 A;  2G2K A;  1R9T I;  3R9W A;  3G71 1;  1HNW C;  1QM4 A;  2OO4 A;  3CC2 1;  4NBG A;  3GTQ I;  3EED A;  1RQF A;  3S15 I;  2CY1 A;  3K7A I;  3HKZ A;  2NVY I;  4DV4 C;  4GKK C;  4A3B I;  1QVG Y;  1KD1 1;  1KC8 1;  2CXC A;  4JI4 C;  4DG9 A;  3S2H I;  5E7Q A;  4DR2 C;  1VQ5 Z;  3NDJ A;  2E2I I;  5IWA C;  2O4H A;  2P2J A;  5BSR A;  2RIQ A;  4GS5 A;  1YIJ Z;  4A3J I;  1S7M A;  1VQ9 1;  2VQF C;  4BY1 I;  5LMU C;  4AQY C;  4DV3 C;  2EGT A;  3NH4 A;  1VQ6 1;  3G71 Z;  2UUC C;  3CC2 Z;  4LF7 C;  1Q86 1;  2QR1 B;  4RVO A;  5GTD A;  2JR6 A;  3RG2 A;  4LF6 C;  3NFZ A;  3CQZ I;  2JS4 A;  2AYA A;  4EAT A;  3GKQ A;  3VTN A;  2NVX I;  3LNV A;  3HOY I;  4HGY A;  4R1L A;  1YJW 1;  3H3V J;  2HJG A;  4JI8 C;  5T6B A;  1ZB9 A;  4A3M I;  4NH1 C;  4AYB A;  4U5Y D;  3LAX A;  1VQ9 Z;  2JNY A;  1VQ6 Z;  5FLX f;  4BBS I;  3PO2 I;  4JI6 C;  1FJG C;  3J80 f;  1I3Q I;  3VNQ A;  4ISB A;  1M90 2;  1N32 C;  3CPW Y;  2J6A A;  1O93 A;  1VQL 1;  4ZJZ A;  4DUY C;  1XRA A;  4NBE A;  1RLY A;  1MDF A;  3FCE A;  2YAD A;  2D1S A;  2YCB A;  4WV3 A;  1YJW Z;  4JV5 C;  4YHH C;  1YHQ 1;  3S1R I;  1Y1V I;  2QLV B;  4LF8 C;  3T4N B;  2OTL 1;  3GTM S;  3BG1 B;  4DV1 C;  5A1I A;  5BUQ A;  1WCM I;  3IX0 A;  3G7S A;  5T8T A;  3IEV A;  3BG0 B;  4MD9 A;  2W04 A;  4RVD A;  1KD1 2;  3G4S 1;  1VQL Z;  4MD8 A;  4MXU A;  5BUR A;  1K9M 1;  2WB1 A;  1QYP A;  4L4Q A;  1YUA A;  1K73 2;  1NJI 2;  2P2F A;  3N54 B;  5DV9 A;  3AF6 A;  1XMO C;  4DCT A;  1Z01 A;  3DAY A;  1NUI A;  1VQM 1;  4G1I A;  1LQL A;  3ETC A;  3L8C A;  4OX9 C;  1YHQ Z;  4E33 A;  3I07 A;  3CCS 1;  4TPS B;  1LCI A;  2Y0S A;  2YWB A;  3J7A 4;  1MKY A;  3JAM f;  4A3C I;  2YWC A;  3CC7 1;  4L7I A;  1QVF Y;  1Q82 1;  4DCS A;  4QTT A;  2DPL A;  4R0M A;  4EWC A;  3C5E A;  5KYV A;  1XRB A;  1I94 C;  4A3L I;  2P2B A;  4CL1 A;  4D57 A;  2DE7 A;  3G4S Z;  3J81 f;  5A19 A;  3RZO I;  1DL6 A;  5T67 A;  2E8E A;  2V8I A;  4MON A;  1RNI A;  2PM9 A;  1AMU A;  4X64 C;  1VQM Z;  2IZ3 A;  2BJO A;  3B7W A;  4MTN A;  3CCS Z;  4RLQ A;  2K3R A;  3IML A;  4R1M A;  5A1G A;  1BA3 A;  1N33 C;  3CC7 Z;  4BSZ A;  4NBB A;  4DCU A;  3CC4 1;  2K5R A;  1PG4 A;  3MZL B;  5FLX b;  5BUS A;  1VQ4 1;  1KRL A;  1IBL C;  3J80 b;  3PO3 I;  1MD9 A;  2P20 A;  4A3D I;  1HNZ C;  1HNX C;  3GR1 A;  4YY3 C;  4D4G A;  5IT9 f;  2VSQ A;  4BC9 A;  2DE5 A;  2QVY X;  4L2Z A;  1NP6 A;  3VNR A;  3GTP I;  2GTH A;  2F4O A;  2ASB A;  3IEU A;  3KXW A;  4K0K C;  5C44 I;  3F3P C;  2P02 A;  5BSM A;  2UUB C;  4LFC C;  2F4V C;  4S1T A;  2V8K A;  3NI2 A;  2GU2 A;  3CW8 X;  2JMO A;  3OW2 Z;  2D1Q A;  4NFR A;  1JJ2 Z;  1GPM A;  1YJN 1;  3GTO I;  2W03 A;  1PFT A;  4A3I I;  3CC4 Z;  2E5L C;  1YJ7 A;  2UXB C;  3MON A;  4DGL A;  1VQ4 Z;  1EGA A;  4X62 C;  4DQY B;  1Q7Y 1;  4QTU A;  4HGZ A;  4E31 A;  3HOW I;  2RHB A;  4B3M C;  5LMN C;  3G6E 1;  4NDN A;  3P5J B;  1M1K 1;  2OPL A;  1YIT 1;  4B3T C;  1O92 A;  2Q51 A;  5C4J I;  4NB9 A;  2DE6 A;  4DR4 C;  3PRO C;  1Q82 2;  3VNS A;  1K8A 1;  3A9U A;  5T8S A;  1W2B Y;  1YJN Z;  1N2F A;  3FQM A;  3JAM b;  3GTK I;  4BCA A;  3T1Y C;  4NB8 A;  2E7G A;  5BSU A;  1MDB A;  1MXB A;  4E2X A;  5FLX D;  4DV2 C;  3J80 D;  3VB9 A;  2D1R A;  2PMZ A;  4NXM C;  1HR0 C;  3CCU 1;  1Q81 2;  2NVT I;  2UXC C;  4NBA A;  3I4M I;  2V8J A;  1KQS Y;  3CXC Y;  2D28 C;  2QEX 1;  3J81 b;  4I9F A;  3HOV I;  3G6E Z;  5T64 A;  1SFO I;  1QVG Z;  3RV2 A;  1YIT Z;  5C3E I;  5K85 A;  4FUQ A;  2NVQ I;  1HH2 P;  2B63 I;  2RBL A;  2OZK A;  4NBC A;  4BBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...