1ML8A

Structural genomics
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERRERLFTHINLHFIVTGRDLKDAAVARAVDLSAEKYCSVALMLEKAVNITHSYEVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein (crp region)
publication title Structural genomics
rcsb
source organism Escherichia coli
total genus 35
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2002-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ml8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ml8A02
5A2QD 3K7AI 4BXXI 3J81D 4BBSI 2R7ZI 2RBLA 3PO3I 2UUBC 2F4MA 3R9XA 4DV4C 1USPB 4MTNA 3S1NI 4DV0C 2DE5A 3HOWI 1YUAA 2UXBC 4DV7C 1MKYA 4NBBA 2E8FA 3Q87A 4DR6C 1Y1VI 4DV5C 4YY3C 2ASBA 4DCUA 4Y52I 3GTPI 2AKLA 5IP7I 3AF5A 2F4VC 3R9WA 3T1HC 2EGTA 2UXCC 5C44I 2BJOA 5IT9D 4JI5C 4OX9C 3S2HI 4DUYC 4Y7NI 1QWIA 4DV1C 3OTOC 1IBKC 2UU9C 3GKUA 4JI3C 1XNQC 3VMHA 1XMQC 1ML8A 4DV6C 2F4OA 2UUCC 1I94C 3HOZI 3S1MI 3GTMS 4LFCC 2K5RA 4A3II 2DYJA 3GTKI 5FLMI 3GTOI 2VUMI 4B3RC 4NXNC 3I4NI 4JI7C 1L1OC 4X62C 1ZB8A 3T1YC 4QTUA 1XNRC 4A3BI 1NUIA 4NB9A 2HF1A 4AQYC 1USPA 2VQEC 4B3TC 3H3VJ 4XX2A 2B63I 2P3YA 1I3QI 4NB8A 4YHHC 4QTTA 4DR1C 2HJGA 2OPLB 5LMUC 2JMPA 3S16I 5IWAC 3VB9A 2JA5I 4A93I 4BY7I 3RZOI 5FLXD 4LF7C 4JI0C 4X66C 1TWAI 1HH2P 2QL8A 2NVQI 3RZDI 2JNYA 3S2DI 4DR4C 4DCTA 2XR1A 1TWCI 1TWHI 4BY1I 1HR0C 1UKKA 4NBAA 2E7GA 4LF8C 2CXCA 1RO4A 4LF4C 2E5LC 4JI1C 4NOZA 3GTJI 3PO3S 4X65C 5C3EI 1EGAA 1WF3A 2YU9I 2UUAC 1Y1WI 1X3ZA 3GCFA 1RLYA 4DR5C 3S15I 1HNXC 3FKII 3GKQA 3GTQI 4DV2C 3AF6A 2E2HI 3LUSA 4NBGA 2R93I 3I07A 5C4XI 3HOYI 3H0GI 2DE6A 3VMGA 4JI6C 1NYEA 3I4MI 2YCBA 2KPIA 1TFIA 4BSZA 1ZB9A 5LMNC 1KKGA 2UXDC 4JI2C 4JI4C 1HNZC 1FJGC 1J5EC 2ATWA 4NBEA 3GTGI 1PA4A 4JV5C 3U50C 4LF5C 1L2FA 5C4JI 4A3KI 5IP9I 2D7VA 3CQZI 1TWGI 3PO2I 3ESWA 1X3WA 4X6AI 2E8CA 4LF9C 1QYPA 3IEUA 2NVYI 4A3CI 4DR7C 4B3SC 2E2II 1I50I 1IBMC 1WW9A 1R9TI 3HOXI 4JI8C 3HOVI 1LQLA 2E2JI 1XMOC 4DR2C 4BBRI 2E8EA 4A3EI 4NXMC 2ONFA 4A3MI 1WCMI 1WH9A 3M3YI 1SFOI 4GKJC 3GTLI 3HOUI 4DUZC 4A3LI 4A3GI 2KZFA 1K0RA 2PK7A 3IEVA 3S17I 1N36C 2HHHC 2VQFC 1Y1VS 2CY1A 3S14I 4A3JI 3JAMD 4A3DI 4DCVA 1N2FA 3S1RI 1N33C 2PN2A 2JA6I 3M4OI 3CJEA 3GTMI 4KHPC 4MH4A 1IBLC 2JA8I 2NVTI 4DCSA 2NVXI 4LF6C 4NBHA 1JOSA 1PFTA 2ZM6C 4B3MC 4LFBC 2PT7G 4X64C 4A3FI 5CM2M 4NBFA 4GKKC 2OPLA 2J6AA 1TWFI 1N32C 1I6HI 4K0KC 2DE7A 1VLAA 1DL6A 2JA7I 4LFAC 1N34C 1HNWC 3S1QI 3D6WA 4NBDA 1K83I 4DR3C 2JS4A 4NBCA 4DV3C 4JYAC 3VMIA 2R92I 3EERA 3J80D 2JR6A 5BR8C
chains in the Genus database with same CATH superfamily
1M6XC 5A2QD 1Y8CA 3CQ2A 1YIT1 3K7AI 1WCJA 3I08A 4U5YD 1V60A 2LEXA 4GXRA 4BXXI 4PZPA 3J81D 4BBSI 3IPLA 3LGXA 4BBYA 2R7ZI 1K9M1 2RBLA 4L4QA 2PM9A 3PO3I 1T5DX 1UWDA 3JAMf 3A9UA 2UUBC 2F4MA 3R9XA 4DV4C 4NDNA 4EWCA 3QWUA 2RT9A 4HPVA 1USPB 1VQPZ 5D1OB 1XRCA 2QLVB 4MTNA 3S1NI 4DV0C 1P7LA 2DE5A 1RO0A 3NH8A 1YUAA 3HOWI 1TH5A 2UXBC 2OO4A 4DV7C 1MKYA 1S7MA 4NBBA 4KTTA 2E8FA 4L7IA 3Q87A 2LIYA 5BURA 2VSQA 1VQNZ 3R44A 4DR6C 3F3PC 1Y1VI 1KD11 4E2ZA 5LCIA 4DV5C 3RG2A 1XHJA 4HGYA 4YY3C 1KQSY 3DAYA 3VNSA 5K8FA 3T4NB 2Z51A 2ASBA 2OTLZ 1V25A 4EATA 4DCUA 4Y52I 3GTPI 4PUIA 1MD9A 2AKLA 1AMUA 1VQM1 1Q821 1IB8A 3MZLB 2WD9A 2ZAEB 4JM1A 2H85A 2OOYB 1Z01A 5IP7I 3G711 3AF5A 2F4VC 3I551 1YIJ1 3R9WA 3IX0A 3T1HC 1KQSZ 1YHQ1 2EGTA 4RS4A 2D1QA 5E7QA 2UXCC 4E32A 1K731 5C44I 2BJOA 3CMAZ 3J80b 1V26A 3S2HI 4D56A 4DUYC 5IT9D 4JI5C 4OX9C 4Y7NI 2DHMA 1QWIA 4DV1C 2JMOA 1FDOA 4E2YA 4TNUA 3OTOC 1IBKC 2UU9C 5A2Qb 3GKUA 1RG9A 2WP0C 2JIQA 1MXAA 2G2KA 4RLFA 1N8R1 3J81b 2VPXA 4JI3C 1XNQC 2V8JA 3RV2A 3VMHA 3TR3A 1Q7Y1 3VNRA 4ZJZA 2VPYA 2OZKA 1XMQC 1ML8A 1O92A 2F4OA 4DV6C 3A9VA 4DK1A 1LCIA 2K3RA 5T8TA 1QXFA 3CC2Z 3GR1A 1VQKZ 1VQP1 2UUCC 1I94C 3CMEZ 4D4GA 1RQFA 4RVDA 3HOZI 2LFUA 3S1MI 1K8A2 3GTMS 3ETOA 4BC7A 2O53A 3IR7A 1Q811 3EQ6A 4LFCC 3PESA 1VQN1 5T67A 1WZNA 4G1IA 2K5RA 3CW8X 1M1K2 4A3II 1Q861 2DYJA 3GTKI 5FLMI 3IFUA 3GTOI 2E0GA 1YUKA 3TDHB 2VUMI 4DQYB 4B3RC 3CCL1 4NH1C 3E7XA 4NXNC 3I4NI 2MMAB 4DG9A 3NPDA 4JI7C 3FCCA 1L1OC 4X62C 1ZB8A 3T1YC 2PMZA 4QTUA 2QRCB 1XNRC 1MXCA 3IF8A 4NFRA 5BSMA 3NH4A 1SIWA 4RVFA 1YJ91 3G71Z 4A3BI 2PROA 3CXCZ 1MDBA 3LAXA 1NUIA 4NB9A 2HF1A 1YHQZ 3CMA1 1USPA 3CCVZ 2VQEC 4AQYC 4B3TC 4R1MA 3H3VJ 4XX2A 2B63I 1P9NA 1I3QI 2P3YA 5IT9b 1XRAA 4NB8A 3UEBA 5ADZA 1RO2A 4QTTA 4YHHC 1YI2Z 4DR1C 2HJGA 2IV2X 2OPLB 2RHBA 5LMUC 2JMPA 3VTNA 3S16I 4PHTA 5IWAC 2VZEA 3CQ3A 3DLPX 5BSRA 3VB9A 2JA5I 3CPWY 4A93I 1X0TA 4KTVA 3CQ1A 5BUSA 2JIRA 4BY7I 3CC21 1VQK1 3RZOI 3CME1 5FLXD 2Y4OA 3I56Z 2QEX1 3O2EA 4LF7C 2KDNA 2Y4NA 4JI0C 3CCJ1 4X66C 3CCMZ 5BSWA 1TWAI 2R6MA 1HH2P 2QL8A 1YJW1 5K85A 2NVQI 2OOXB 4G37A 3RZDI 3CD6Z 3HKZA 4MD7A 2JNYA 1ULTA 3S2DI 4DR4C 2I3CA 5IT9f 2IZ4A 1VQ61 1TWCI 2XR1A 4DCTA 1TWHI 3D2LA 2P28A 4BY1I 3UX3A 1HR0C 1VQ9Z 1VQ5Z 1UKKA 1QF8A 1VQ8Z 5BUQA 4NBAA 4I9FA 3TE5B 5JRHA 2E9HA 2E7GA 4ODJA 4LF8C 4MD9A 2CXCA 1RO4A 4HH4A 4LF4C 2E5LC 4JI1C 1QM4A 4NOZA 3GTJI 3CCLZ 3PO3S 1KC82 2V8IA 1YJ7A 4X65C 1NJI2 3CCQZ 2YWCA 3A26A 2KZ0A 4BSZA 4MXUA 5C3EI 3CCR1 1EGAA 1WF3A 2YU9I 2UUAC 1Y1WI 5A1IA 4ZLPA 2GU2A 1FDIA 3BG0B 1YJ9Z 1X3ZA 3NI2A 1FUGA 3CCV1 3GCFA 1RLYA 3IMLA 4RVNA 4DR5C 1P4EA 3S15I 4MD8A 3CC7Z 1HNXC 3FKII 3GKQA 1JJ2Y 3PROC 3GTQI 3L95X 3CC4Z 1M902 1YI21 4DV2C 2VPWA 3AF6A 3CW9A 2M48A 2MCQA 2E2HI 2W04A 3LUSA 1PG4A 2JUBA 2QW0X 1XS3A 5T8SA 4NBGA 3GPCA 2GTIA 1Q16A 1NY8A 2R93I 1ZH1A 2D1RA 3I07A 5BSTA 4HGZA 5C4XI 2DPLA 3HOYI 4RVHA 1O90A 3H0GI 4RVGA 2DE6A 1JJ2Z 1QVFY 3VMGA 3I561 4JI6C 1NYEA 3I4MI 2Y0SA 2QKDA 2YCBA 2KPIA 1TFIA 3CCM1 1ZB9A 2QEXZ 1QVGY 3GR0A 2Q4ZA 5FLXb 5DV9A 3CCJZ 1KKGA 3J7A4 2QVZX 4TPSB 3NDIA 3CD61 2UXDC 1YJWZ 4JI2C 5CZXA 4JI4C 4CL1A 3BG1B 3NDJA 4I9GA 1VQ6Z 3L8CA 1VQ91 1VQ51 2VUGA 2MM9A 3DHVA 1VQ81 3K6RA 2E7ZA 4RLQA 3FQMA 1HNZC 1K8A1 1VQO1 1YJNZ 1FJGC 1J5EC 2P2FA 2IZ3A 4E31A 2JNVA 2YX1A 4K0BA 4NBEA 2ATWA 3GTGI 1JWHC 2JIOA 1PA4A 2P20A 4JV5C 4RVOA 1Z02A 5T6BA 3U50C 1VQ7Z 3CCQ1 1M1K1 2D27A 4LF5C 1L2FA 5C4JI 2ZZNA 4A3KI 5IP9I 5FLXf 3CCRZ 3PBKA 2D7VA 3SO4A 2M5OA 1P4EC 3CQZI 1S721 1TWGI 4S1TA 3CC71 2WB1A 2V7BA 3PO2I 3ESWA 1X3WA 5D1OA 4X6AI 3FQQA 4RMNA 2QRDB 2HU9A 3CC41 2D1TA 2E8CA 2RIQA 4LF9C 4GS5A 1QYPA 3D9XA 1MDFA 3IEUA 2NVYI 2QREB 4A3CI 4DR7C 4B3SC 5IFIA 3AY0A 2D28C 2E2II 3CCE1 1I50I 1IBMC 2V3VA 4PUHA 1WW9A 1R9TI 3HOXI 3MONA 4RV9A 4JI8C 4D57A 3HOVI 1LQLA 1AA6A 2AYAA 5BSUA 1PU1A 1K9M2 1KRLA 4GXQA 2E2JI 3S82A 1VQLZ 1XMOC 4DR2C 4BBRI 3C5EA 5KEIA 2E8EA 4A3EI 4NXMC 3NYQA 2ONFA 2Y27A 3CPWZ 4FUTA 1GPMA 3KIHA 4A3MI 5AN9F 1WCMI 4E33A 3B7WA 1YJN1 3EEDA 2W03A 1WH9A 5AE1A 2P2BA 1Z03A 3M3YI 5A19A 1SFOI 1VQOZ 4OYCA 4GKJC 4MONA 4E2XA 2GTHA 3GTLI 3HOUI 5KYTA 1KD12 4DUZC 2M6NA 3CCUZ 1VQ71 3NH5A 3G7SA 5BSVA 4R1LA 4RM2A 3N2QA 2QVXX 1WIIA 1PG3A 5D1PA 4A3LI 3NYRA 4A3GI 3UZ0A 2KZFA 4PROC 4OXIA 4L2ZA 1K0RA 5AE2A 2PK7A 1Q822 4PUGA 2Q51A 4MRIA 2AYDA 4BCAA 1KC81 4LE5A 5LL6f 3S17I 4DG8A 1S72Z 1N36C 3IEVA 2OTJ1 2RPRA 1T5HX 2HHHC 1NJI1 2VQFC 5LMNC 3G4S1 1Y1VS 2YWBA 5KYVA 1WJ2A 3UOWA 2CY1A 2NAPA 3S14I 2V45A 3NFZA 1K732 4A3JI 3JAMD 3N54B 4A3DI 4DCVA 1N2FA 3G6EZ 1VQ4Z 2BH1X 3S1RI 3TQIA 2CU6A 1XRBA 3KXWA 2VF1A 2PN2A 2P2JA 3CCEZ 1M901 3CCSZ 4IZ6A 1N33C 2KI7B 2JA6I 5GTDA 3M4OI 3CJEA 3GTMI 2NCLA 4KHPC 4IR7A 2P2QA 4MH4A 5A1GA 4ISBA 1IBLC 3MZKB 1N8R2 2P2MA 2QA4Z 2JA8I 3LNVA 2NVTI 4DCSA 1VQL1 5T64A 1Q7Y2 2NVXI 4LF6C 4NBHA 4DGLA 1YITZ 1JOSA 2VPZA 4R0MA 1M6XA 2M5HA 1PFTA 2ZM6C 4B3MC 2WAQA 4E2WA 1MXBA 1Q812 1QVFZ 4LFBC 2PT7G 4X64C 3E7WA 1RNIA 4A3FI 3F3FC 4RM3A 2ZZMA 4FTFA 5CM2M 1RY2A 1QVGZ 4NBFA 3CCU1 1FLOA 2OBVA 3H2TA 1Q862 3FCEA 5H9UA 4GKKC 2OPLA 1NP6A 3OW2Y 2D1SA 2J6AA 3J80f 1TWFI 3ETCA 1N32C 1I6HI 4K0KC 2DE7A 1VLAA 1DL6A 2JA7I 4LFAC 3UX2A 4E30A 1N34C 2O4HA 2QR1B 1HNWC 5A2Qf 3S1QI 1VEHA 2OTL1 3LNOA 2OTJZ 3CXCY 3OW2Z 3J81f 3G4SZ 1W2BY 3D6WA 2P02A 4NBDA 1K83I 4DR3C 2JS4A 4NBCA 3G6E1 1VQMZ 1VQ41 4DV3C 1O9TA 4WV3A 4JYAC 4BC9A 5CZVA 3TDEA 3JAMb 1O93A 4AYBA 3KIFA 3P5JB 3VMIA 4D4IA 2R92I 3A25A 3EERA 2YADA 3CCS1 3I55Z 5AE3A 2QVYX 3J80D 1YIJZ 2JIPA 1W2BZ 2V8KA 3TUFA 4G36A 2QA41 2JR6A 3A4IA 3VNQA 2JIMA 4WS9A 5BR8C 4FUQA 1BA3A
chains in the Genus database with same CATH topology
5A2QD 1YIT1 3K7AI 3I08A 4U5YD 4GXRA 4PZPA 4BXXI 3J81D 4BBSI 3IPLA 3LGXA 4BBYA 2R7ZI 1K9M1 2RBLA 4L4QA 2PM9A 3PO3I 1T5DX 3JAMf 3A9UA 2UUBC 2F4MA 3R9XA 4DV4C 4NDNA 4EWCA 3QWUA 2RT9A 4HPVA 1USPB 1VQPZ 5D1OB 1XRCA 2QLVB 4MTNA 3S1NI 4DV0C 1P7LA 2DE5A 1RO0A 3NH8A 1YUAA 3HOWI 2UXBC 2OO4A 4DV7C 1MKYA 1S7MA 4NBBA 4KTTA 2E8FA 4L7IA 3Q87A 2LIYA 5BURA 2VSQA 1VQNZ 3R44A 4DR6C 3F3PC 1Y1VI 1KD11 4E2ZA 4DV5C 3RG2A 4HGYA 4YY3C 1KQSY 3DAYA 3VNSA 5K8FA 3T4NB 2ASBA 2OTLZ 1V25A 4EATA 4DCUA 4Y52I 3GTPI 1MD9A 2AKLA 1AMUA 1VQM1 1Q821 3MZLB 2WD9A 2ZAEB 4JM1A 2H85A 2OOYB 1Z01A 5IP7I 3G711 3AF5A 2F4VC 3I551 1YIJ1 3R9WA 3IX0A 3T1HC 1KQSZ 1YHQ1 2EGTA 4RS4A 2D1QA 5E7QA 2UXCC 4E32A 1K731 5C44I 2BJOA 3CMAZ 3J80b 1V26A 3S2HI 4D56A 4DUYC 5IT9D 4JI5C 4OX9C 4Y7NI 1QWIA 4DV1C 2JMOA 4E2YA 4TNUA 3OTOC 1IBKC 2UU9C 5A2Qb 3GKUA 1RG9A 2WP0C 1MXAA 2G2KA 4RLFA 1N8R1 3J81b 4JI3C 1XNQC 2V8JA 3RV2A 3VMHA 1Q7Y1 3VNRA 4ZJZA 2OZKA 1XMQC 1ML8A 1O92A 2F4OA 4DV6C 3A9VA 4DK1A 1LCIA 2K3RA 5T8TA 3CC2Z 3GR1A 2UUCC 1VQKZ 1VQP1 1I94C 3CMEZ 4D4GA 1RQFA 4RVDA 3HOZI 2LFUA 3S1MI 1K8A2 3GTMS 3ETOA 4BC7A 2O53A 1Q811 3EQ6A 4LFCC 3PESA 1VQN1 5T67A 4G1IA 2K5RA 3CW8X 1M1K2 4A3II 1Q861 2DYJA 3GTKI 5FLMI 3IFUA 3GTOI 2E0GA 1YUKA 3TDHB 2VUMI 4DQYB 4B3RC 3CCL1 4NH1C 3E7XA 4NXNC 3I4NI 4DG9A 3NPDA 4JI7C 3FCCA 1L1OC 4X62C 1ZB8A 3T1YC 2PMZA 4QTUA 2QRCB 1XNRC 1MXCA 3IF8A 4NFRA 5BSMA 3NH4A 4RVFA 1YJ91 3G71Z 4A3BI 2PROA 3CXCZ 1MDBA 3LAXA 1NUIA 4NB9A 2HF1A 1YHQZ 3CMA1 1USPA 3CCVZ 2VQEC 4AQYC 4B3TC 4R1MA 3H3VJ 4XX2A 2B63I 1P9NA 1I3QI 2P3YA 5IT9b 1XRAA 4NB8A 5ADZA 1RO2A 4QTTA 4YHHC 1YI2Z 4DR1C 2HJGA 2OPLB 2RHBA 5LMUC 2JMPA 3VTNA 3S16I 4PHTA 5IWAC 2VZEA 3DLPX 5BSRA 3VB9A 2JA5I 3CPWY 4A93I 1X0TA 4KTVA 5BUSA 4BY7I 3CC21 1VQK1 3RZOI 3CME1 5FLXD 2Y4OA 3I56Z 2QEX1 4LF7C 2Y4NA 4JI0C 3CCJ1 4X66C 3CCMZ 5BSWA 1TWAI 2R6MA 1HH2P 2QL8A 1YJW1 5K85A 2NVQI 2OOXB 4G37A 3RZDI 3CD6Z 3HKZA 4MD7A 2JNYA 1ULTA 3S2DI 4DR4C 2I3CA 5IT9f 2IZ4A 1VQ61 1TWCI 2XR1A 4DCTA 1TWHI 2P28A 4BY1I 1HR0C 1VQ9Z 1VQ5Z 1UKKA 1QF8A 1VQ8Z 5BUQA 4NBAA 4I9FA 3TE5B 5JRHA 2E9HA 2E7GA 4ODJA 4LF8C 4MD9A 2CXCA 1RO4A 4HH4A 4LF4C 2E5LC 4JI1C 1QM4A 4NOZA 3GTJI 3CCLZ 3PO3S 1KC82 2V8IA 1YJ7A 4X65C 1NJI2 3CCQZ 2YWCA 4BSZA 4MXUA 5C3EI 3CCR1 1EGAA 1WF3A 2YU9I 2UUAC 1Y1WI 5A1IA 4ZLPA 2GU2A 3BG0B 1YJ9Z 1X3ZA 3NI2A 1FUGA 3CCV1 3GCFA 1RLYA 3IMLA 4RVNA 4DR5C 3S15I 4MD8A 3CC7Z 1HNXC 3FKII 3GKQA 1JJ2Y 3PROC 3GTQI 3L95X 3CC4Z 1M902 1YI21 4DV2C 3AF6A 3CW9A 2M48A 2E2HI 2W04A 3LUSA 1PG4A 2JUBA 2QW0X 5T8SA 4NBGA 3GPCA 2GTIA 2R93I 1ZH1A 2D1RA 3I07A 5BSTA 4HGZA 5C4XI 2DPLA 3HOYI 4RVHA 1O90A 3H0GI 4RVGA 2DE6A 1JJ2Z 1QVFY 3VMGA 3I561 4JI6C 1NYEA 3I4MI 2Y0SA 2QKDA 2YCBA 2KPIA 1TFIA 3CCM1 1ZB9A 2QEXZ 1QVGY 3GR0A 2Q4ZA 5FLXb 5DV9A 3CCJZ 1KKGA 3J7A4 2QVZX 4TPSB 3NDIA 3CD61 2UXDC 1YJWZ 4JI2C 5CZXA 4JI4C 4CL1A 3BG1B 3NDJA 4I9GA 1VQ6Z 3L8CA 1VQ91 1VQ51 2VUGA 3DHVA 1VQ81 4RLQA 1HNZC 3FQMA 1K8A1 1VQO1 1YJNZ 1FJGC 1J5EC 2P2FA 2IZ3A 4E31A 2ATWA 4K0BA 4NBEA 3GTGI 1JWHC 1PA4A 2P20A 4JV5C 4RVOA 1Z02A 5T6BA 3U50C 1VQ7Z 3CCQ1 1M1K1 2D27A 4LF5C 1L2FA 5C4JI 4A3KI 5IP9I 5FLXf 3CCRZ 3PBKA 2D7VA 3SO4A 3CQZI 1S721 1TWGI 4S1TA 3CC71 2WB1A 2V7BA 3PO2I 3ESWA 1X3WA 5D1OA 4X6AI 3FQQA 4RMNA 2QRDB 2HU9A 3CC41 2D1TA 2E8CA 2RIQA 4LF9C 4GS5A 1QYPA 3D9XA 1MDFA 3IEUA 2NVYI 2QREB 4A3CI 4DR7C 4B3SC 5IFIA 2D28C 2E2II 3CCE1 1I50I 1IBMC 1WW9A 1R9TI 3HOXI 3MONA 4RV9A 4JI8C 4D57A 3HOVI 1LQLA 2AYAA 5BSUA 1K9M2 1KRLA 4GXQA 2E2JI 3S82A 1VQLZ 1XMOC 4DR2C 4BBRI 3C5EA 5KEIA 2E8EA 4A3EI 4NXMC 3NYQA 2ONFA 2Y27A 3CPWZ 4FUTA 1GPMA 3KIHA 4A3MI 5AN9F 1WCMI 4E33A 3B7WA 1YJN1 3EEDA 2W03A 1WH9A 5AE1A 2P2BA 1Z03A 3M3YI 5A19A 1SFOI 1VQOZ 4OYCA 4GKJC 4MONA 4E2XA 2GTHA 3GTLI 3HOUI 5KYTA 1KD12 4DUZC 2M6NA 3CCUZ 1VQ71 3NH5A 3G7SA 5BSVA 4R1LA 4RM2A 3N2QA 2QVXX 1WIIA 1PG3A 5D1PA 4A3LI 3NYRA 4A3GI 3UZ0A 2KZFA 4PROC 4OXIA 4L2ZA 1K0RA 5AE2A 2PK7A 1Q822 2Q51A 4MRIA 4BCAA 1KC81 4LE5A 5LL6f 3S17I 4DG8A 1S72Z 1N36C 3IEVA 2OTJ1 2RPRA 1T5HX 2HHHC 1NJI1 2VQFC 5LMNC 3G4S1 1Y1VS 2YWBA 5KYVA 3UOWA 2CY1A 3S14I 3NFZA 1K732 4A3JI 3JAMD 3N54B 4A3DI 4DCVA 1N2FA 3G6EZ 1VQ4Z 2BH1X 3S1RI 3TQIA 1XRBA 3KXWA 2VF1A 2PN2A 2P2JA 3CCEZ 1M901 3CCSZ 4IZ6A 1N33C 2KI7B 2JA6I 5GTDA 3M4OI 3CJEA 3GTMI 4KHPC 4IR7A 2P2QA 4MH4A 5A1GA 4ISBA 1IBLC 3MZKB 1N8R2 2P2MA 2QA4Z 2JA8I 3LNVA 2NVTI 4DCSA 1VQL1 5T64A 1Q7Y2 2NVXI 4LF6C 4NBHA 4DGLA 1YITZ 1JOSA 4R0MA 1PFTA 2ZM6C 4B3MC 2WAQA 4E2WA 1MXBA 1Q812 1QVFZ 4LFBC 2PT7G 4X64C 3E7WA 1RNIA 4A3FI 3F3FC 4RM3A 4FTFA 5CM2M 1RY2A 1QVGZ 4NBFA 3CCU1 2OBVA 3H2TA 1Q862 3FCEA 5H9UA 4GKKC 2OPLA 1NP6A 3OW2Y 2D1SA 2J6AA 3J80f 1TWFI 3ETCA 1N32C 1I6HI 4K0KC 2DE7A 1VLAA 1DL6A 2JA7I 4LFAC 4E30A 1N34C 2O4HA 2QR1B 1HNWC 5A2Qf 3S1QI 2OTL1 2OTJZ 3CXCY 3OW2Z 3J81f 3G4SZ 1W2BY 3D6WA 2P02A 4NBDA 1K83I 4DR3C 2JS4A 4NBCA 3G6E1 1VQMZ 1VQ41 4DV3C 1O9TA 4WV3A 4JYAC 4BC9A 5CZVA 3TDEA 3JAMb 1O93A 4AYBA 3KIFA 3P5JB 3VMIA 4D4IA 2R92I 3EERA 2YADA 3CCS1 3I55Z 5AE3A 2QVYX 3J80D 1YIJZ 1W2BZ 2V8KA 3TUFA 4G36A 2QA41 2JR6A 3A4IA 3VNQA 4WS9A 5BR8C 4FUQA 1BA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q D;  3K7A I;  4BXX I;  3J81 D;  4BBS I;  2R7Z I;  2RBL A;  3PO3 I;  2UUB C;  2F4M A;  3R9X A;  4DV4 C;  1USP B;  4MTN A;  3S1N I;  4DV0 C;  2DE5 A;  3HOW I;  1YUA A;  2UXB C;  4DV7 C;  1MKY A;  4NBB A;  2E8F A;  3Q87 A;  4DR6 C;  1Y1V I;  4DV5 C;  4YY3 C;  2ASB A;  4DCU A;  4Y52 I;  3GTP I;  2AKL A;  5IP7 I;  3AF5 A;  2F4V C;  3R9W A;  3T1H C;  2EGT A;  2UXC C;  5C44 I;  2BJO A;  5IT9 D;  4JI5 C;  4OX9 C;  3S2H I;  4DUY C;  4Y7N I;  1QWI A;  4DV1 C;  3OTO C;  1IBK C;  2UU9 C;  3GKU A;  4JI3 C;  1XNQ C;  3VMH A;  1XMQ C;  1ML8 A;  4DV6 C;  2F4O A;  2UUC C;  1I94 C;  3HOZ I;  3S1M I;  3GTM S;  4LFC C;  2K5R A;  4A3I I;  2DYJ A;  3GTK I;  5FLM I;  3GTO I;  2VUM I;  4B3R C;  4NXN C;  3I4N I;  4JI7 C;  1L1O C;  4X62 C;  1ZB8 A;  3T1Y C;  4QTU A;  1XNR C;  4A3B I;  1NUI A;  4NB9 A;  2HF1 A;  4AQY C;  1USP A;  2VQE C;  4B3T C;  3H3V J;  4XX2 A;  2B63 I;  2P3Y A;  1I3Q I;  4NB8 A;  4YHH C;  4QTT A;  4DR1 C;  2HJG A;  2OPL B;  5LMU C;  2JMP A;  3S16 I;  5IWA C;  3VB9 A;  2JA5 I;  4A93 I;  4BY7 I;  3RZO I;  5FLX D;  4LF7 C;  4JI0 C;  4X66 C;  1TWA I;  1HH2 P;  2QL8 A;  2NVQ I;  3RZD I;  2JNY A;  3S2D I;  4DR4 C;  4DCT A;  2XR1 A;  1TWC I;  1TWH I;  4BY1 I;  1HR0 C;  1UKK A;  4NBA A;  2E7G A;  4LF8 C;  2CXC A;  1RO4 A;  4LF4 C;  2E5L C;  4JI1 C;  4NOZ A;  3GTJ I;  3PO3 S;  4X65 C;  5C3E I;  1EGA A;  1WF3 A;  2YU9 I;  2UUA C;  1Y1W I;  1X3Z A;  3GCF A;  1RLY A;  4DR5 C;  3S15 I;  1HNX C;  3FKI I;  3GKQ A;  3GTQ I;  4DV2 C;  3AF6 A;  2E2H I;  3LUS A;  4NBG A;  2R93 I;  3I07 A;  5C4X I;  3HOY I;  3H0G I;  2DE6 A;  3VMG A;  4JI6 C;  1NYE A;  3I4M I;  2YCB A;  2KPI A;  1TFI A;  4BSZ A;  1ZB9 A;  5LMN C;  1KKG A;  2UXD C;  4JI2 C;  4JI4 C;  1HNZ C;  1FJG C;  1J5E C;  2ATW A;  4NBE A;  3GTG I;  1PA4 A;  4JV5 C;  3U50 C;  4LF5 C;  1L2F A;  5C4J I;  4A3K I;  5IP9 I;  2D7V A;  3CQZ I;  1TWG I;  3PO2 I;  3ESW A;  1X3W A;  4X6A I;  2E8C A;  4LF9 C;  1QYP A;  3IEU A;  2NVY I;  4A3C I;  4DR7 C;  4B3S C;  2E2I I;  1I50 I;  1IBM C;  1WW9 A;  1R9T I;  3HOX I;  4JI8 C;  3HOV I;  1LQL A;  2E2J I;  1XMO C;  4DR2 C;  4BBR I;  2E8E A;  4A3E I;  4NXM C;  2ONF A;  4A3M I;  1WCM I;  1WH9 A;  3M3Y I;  1SFO I;  4GKJ C;  3GTL I;  3HOU I;  4DUZ C;  4A3L I;  4A3G I;  2KZF A;  1K0R A;  2PK7 A;  3IEV A;  3S17 I;  1N36 C;  2HHH C;  2VQF C;  1Y1V S;  2CY1 A;  3S14 I;  4A3J I;  3JAM D;  4A3D I;  4DCV A;  1N2F A;  3S1R I;  1N33 C;  2PN2 A;  2JA6 I;  3M4O I;  3CJE A;  3GTM I;  4KHP C;  4MH4 A;  1IBL C;  2JA8 I;  2NVT I;  4DCS A;  2NVX I;  4LF6 C;  4NBH A;  1JOS A;  1PFT A;  2ZM6 C;  4B3M C;  4LFB C;  2PT7 G;  4X64 C;  4A3F I;  5CM2 M;  4NBF A;  4GKK C;  2OPL A;  2J6A A;  1TWF I;  1N32 C;  1I6H I;  4K0K C;  2DE7 A;  1VLA A;  1DL6 A;  2JA7 I;  4LFA C;  1N34 C;  1HNW C;  3S1Q I;  3D6W A;  4NBD A;  1K83 I;  4DR3 C;  2JS4 A;  4NBC A;  4DV3 C;  4JYA C;  3VMI A;  2R92 I;  3EER A;  3J80 D;  2JR6 A;  5BR8 C; 
#chains in the Genus database with same CATH topology
 1M6X C;  5A2Q D;  1Y8C A;  3CQ2 A;  1YIT 1;  3K7A I;  1WCJ A;  3I08 A;  4U5Y D;  1V60 A;  2LEX A;  4GXR A;  4BXX I;  4PZP A;  3J81 D;  4BBS I;  3IPL A;  3LGX A;  4BBY A;  2R7Z I;  1K9M 1;  2RBL A;  4L4Q A;  2PM9 A;  3PO3 I;  1T5D X;  1UWD A;  3JAM f;  3A9U A;  2UUB C;  2F4M A;  3R9X A;  4DV4 C;  4NDN A;  4EWC A;  3QWU A;  2RT9 A;  4HPV A;  1USP B;  1VQP Z;  5D1O B;  1XRC A;  2QLV B;  4MTN A;  3S1N I;  4DV0 C;  1P7L A;  2DE5 A;  1RO0 A;  3NH8 A;  1YUA A;  3HOW I;  1TH5 A;  2UXB C;  2OO4 A;  4DV7 C;  1MKY A;  1S7M A;  4NBB A;  4KTT A;  2E8F A;  4L7I A;  3Q87 A;  2LIY A;  5BUR A;  2VSQ A;  1VQN Z;  3R44 A;  4DR6 C;  3F3P C;  1Y1V I;  1KD1 1;  4E2Z A;  5LCI A;  4DV5 C;  3RG2 A;  1XHJ A;  4HGY A;  4YY3 C;  1KQS Y;  3DAY A;  3VNS A;  5K8F A;  3T4N B;  2Z51 A;  2ASB A;  2OTL Z;  1V25 A;  4EAT A;  4DCU A;  4Y52 I;  3GTP I;  4PUI A;  1MD9 A;  2AKL A;  1AMU A;  1VQM 1;  1Q82 1;  1IB8 A;  3MZL B;  2WD9 A;  2ZAE B;  4JM1 A;  2H85 A;  2OOY B;  1Z01 A;  5IP7 I;  3G71 1;  3AF5 A;  2F4V C;  3I55 1;  1YIJ 1;  3R9W A;  3IX0 A;  3T1H C;  1KQS Z;  1YHQ 1;  2EGT A;  4RS4 A;  2D1Q A;  5E7Q A;  2UXC C;  4E32 A;  1K73 1;  5C44 I;  2BJO A;  3CMA Z;  3J80 b;  1V26 A;  3S2H I;  4D56 A;  4DUY C;  5IT9 D;  4JI5 C;  4OX9 C;  4Y7N I;  2DHM A;  1QWI A;  4DV1 C;  2JMO A;  1FDO A;  4E2Y A;  4TNU A;  3OTO C;  1IBK C;  2UU9 C;  5A2Q b;  3GKU A;  1RG9 A;  2WP0 C;  2JIQ A;  1MXA A;  2G2K A;  4RLF A;  1N8R 1;  3J81 b;  2VPX A;  4JI3 C;  1XNQ C;  2V8J A;  3RV2 A;  3VMH A;  3TR3 A;  1Q7Y 1;  3VNR A;  4ZJZ A;  2VPY A;  2OZK A;  1XMQ C;  1ML8 A;  1O92 A;  2F4O A;  4DV6 C;  3A9V A;  4DK1 A;  1LCI A;  2K3R A;  5T8T A;  1QXF A;  3CC2 Z;  3GR1 A;  1VQK Z;  1VQP 1;  2UUC C;  1I94 C;  3CME Z;  4D4G A;  1RQF A;  4RVD A;  3HOZ I;  2LFU A;  3S1M I;  1K8A 2;  3GTM S;  3ETO A;  4BC7 A;  2O53 A;  3IR7 A;  1Q81 1;  3EQ6 A;  4LFC C;  3PES A;  1VQN 1;  5T67 A;  1WZN A;  4G1I A;  2K5R A;  3CW8 X;  1M1K 2;  4A3I I;  1Q86 1;  2DYJ A;  3GTK I;  5FLM I;  3IFU A;  3GTO I;  2E0G A;  1YUK A;  3TDH B;  2VUM I;  4DQY B;  4B3R C;  3CCL 1;  4NH1 C;  3E7X A;  4NXN C;  3I4N I;  2MMA B;  4DG9 A;  3NPD A;  4JI7 C;  3FCC A;  1L1O C;  4X62 C;  1ZB8 A;  3T1Y C;  2PMZ A;  4QTU A;  2QRC B;  1XNR C;  1MXC A;  3IF8 A;  4NFR A;  5BSM A;  3NH4 A;  1SIW A;  4RVF A;  1YJ9 1;  3G71 Z;  4A3B I;  2PRO A;  3CXC Z;  1MDB A;  3LAX A;  1NUI A;  4NB9 A;  2HF1 A;  1YHQ Z;  3CMA 1;  1USP A;  3CCV Z;  2VQE C;  4AQY C;  4B3T C;  4R1M A;  3H3V J;  4XX2 A;  2B63 I;  1P9N A;  1I3Q I;  2P3Y A;  5IT9 b;  1XRA A;  4NB8 A;  3UEB A;  5ADZ A;  1RO2 A;  4QTT A;  4YHH C;  1YI2 Z;  4DR1 C;  2HJG A;  2IV2 X;  2OPL B;  2RHB A;  5LMU C;  2JMP A;  3VTN A;  3S16 I;  4PHT A;  5IWA C;  2VZE A;  3CQ3 A;  3DLP X;  5BSR A;  3VB9 A;  2JA5 I;  3CPW Y;  4A93 I;  1X0T A;  4KTV A;  3CQ1 A;  5BUS A;  2JIR A;  4BY7 I;  3CC2 1;  1VQK 1;  3RZO I;  3CME 1;  5FLX D;  2Y4O A;  3I56 Z;  2QEX 1;  3O2E A;  4LF7 C;  2KDN A;  2Y4N A;  4JI0 C;  3CCJ 1;  4X66 C;  3CCM Z;  5BSW A;  1TWA I;  2R6M A;  1HH2 P;  2QL8 A;  1YJW 1;  5K85 A;  2NVQ I;  2OOX B;  4G37 A;  3RZD I;  3CD6 Z;  3HKZ A;  4MD7 A;  2JNY A;  1ULT A;  3S2D I;  4DR4 C;  2I3C A;  5IT9 f;  2IZ4 A;  1VQ6 1;  1TWC I;  2XR1 A;  4DCT A;  1TWH I;  3D2L A;  2P28 A;  4BY1 I;  3UX3 A;  1HR0 C;  1VQ9 Z;  1VQ5 Z;  1UKK A;  1QF8 A;  1VQ8 Z;  5BUQ A;  4NBA A;  4I9F A;  3TE5 B;  5JRH A;  2E9H A;  2E7G A;  4ODJ A;  4LF8 C;  4MD9 A;  2CXC A;  1RO4 A;  4HH4 A;  4LF4 C;  2E5L C;  4JI1 C;  1QM4 A;  4NOZ A;  3GTJ I;  3CCL Z;  3PO3 S;  1KC8 2;  2V8I A;  1YJ7 A;  4X65 C;  1NJI 2;  3CCQ Z;  2YWC A;  3A26 A;  2KZ0 A;  4BSZ A;  4MXU A;  5C3E I;  3CCR 1;  1EGA A;  1WF3 A;  2YU9 I;  2UUA C;  1Y1W I;  5A1I A;  4ZLP A;  2GU2 A;  1FDI A;  3BG0 B;  1YJ9 Z;  1X3Z A;  3NI2 A;  1FUG A;  3CCV 1;  3GCF A;  1RLY A;  3IML A;  4RVN A;  4DR5 C;  1P4E A;  3S15 I;  4MD8 A;  3CC7 Z;  1HNX C;  3FKI I;  3GKQ A;  1JJ2 Y;  3PRO C;  3GTQ I;  3L95 X;  3CC4 Z;  1M90 2;  1YI2 1;  4DV2 C;  2VPW A;  3AF6 A;  3CW9 A;  2M48 A;  2MCQ A;  2E2H I;  2W04 A;  3LUS A;  1PG4 A;  2JUB A;  2QW0 X;  1XS3 A;  5T8S A;  4NBG A;  3GPC A;  2GTI A;  1Q16 A;  1NY8 A;  2R93 I;  1ZH1 A;  2D1R A;  3I07 A;  5BST A;  4HGZ A;  5C4X I;  2DPL A;  3HOY I;  4RVH A;  1O90 A;  3H0G I;  4RVG A;  2DE6 A;  1JJ2 Z;  1QVF Y;  3VMG A;  3I56 1;  4JI6 C;  1NYE A;  3I4M I;  2Y0S A;  2QKD A;  2YCB A;  2KPI A;  1TFI A;  3CCM 1;  1ZB9 A;  2QEX Z;  1QVG Y;  3GR0 A;  2Q4Z A;  5FLX b;  5DV9 A;  3CCJ Z;  1KKG A;  3J7A 4;  2QVZ X;  4TPS B;  3NDI A;  3CD6 1;  2UXD C;  1YJW Z;  4JI2 C;  5CZX A;  4JI4 C;  4CL1 A;  3BG1 B;  3NDJ A;  4I9G A;  1VQ6 Z;  3L8C A;  1VQ9 1;  1VQ5 1;  2VUG A;  2MM9 A;  3DHV A;  1VQ8 1;  3K6R A;  2E7Z A;  4RLQ A;  3FQM A;  1HNZ C;  1K8A 1;  1VQO 1;  1YJN Z;  1FJG C;  1J5E C;  2P2F A;  2IZ3 A;  4E31 A;  2JNV A;  2YX1 A;  4K0B A;  4NBE A;  2ATW A;  3GTG I;  1JWH C;  2JIO A;  1PA4 A;  2P20 A;  4JV5 C;  4RVO A;  1Z02 A;  5T6B A;  3U50 C;  1VQ7 Z;  3CCQ 1;  1M1K 1;  2D27 A;  4LF5 C;  1L2F A;  5C4J I;  2ZZN A;  4A3K I;  5IP9 I;  5FLX f;  3CCR Z;  3PBK A;  2D7V A;  3SO4 A;  2M5O A;  1P4E C;  3CQZ I;  1S72 1;  1TWG I;  4S1T A;  3CC7 1;  2WB1 A;  2V7B A;  3PO2 I;  3ESW A;  1X3W A;  5D1O A;  4X6A I;  3FQQ A;  4RMN A;  2QRD B;  2HU9 A;  3CC4 1;  2D1T A;  2E8C A;  2RIQ A;  4LF9 C;  4GS5 A;  1QYP A;  3D9X A;  1MDF A;  3IEU A;  2NVY I;  2QRE B;  4A3C I;  4DR7 C;  4B3S C;  5IFI A;  3AY0 A;  2D28 C;  2E2I I;  3CCE 1;  1I50 I;  1IBM C;  2V3V A;  4PUH A;  1WW9 A;  1R9T I;  3HOX I;  3MON A;  4RV9 A;  4JI8 C;  4D57 A;  3HOV I;  1LQL A;  1AA6 A;  2AYA A;  5BSU A;  1PU1 A;  1K9M 2;  1KRL A;  4GXQ A;  2E2J I;  3S82 A;  1VQL Z;  1XMO C;  4DR2 C;  4BBR I;  3C5E A;  5KEI A;  2E8E A;  4A3E I;  4NXM C;  3NYQ A;  2ONF A;  2Y27 A;  3CPW Z;  4FUT A;  1GPM A;  3KIH A;  4A3M I;  5AN9 F;  1WCM I;  4E33 A;  3B7W A;  1YJN 1;  3EED A;  2W03 A;  1WH9 A;  5AE1 A;  2P2B A;  1Z03 A;  3M3Y I;  5A19 A;  1SFO I;  1VQO Z;  4OYC A;  4GKJ C;  4MON A;  4E2X A;  2GTH A;  3GTL I;  3HOU I;  5KYT A;  1KD1 2;  4DUZ C;  2M6N A;  3CCU Z;  1VQ7 1;  3NH5 A;  3G7S A;  5BSV A;  4R1L A;  4RM2 A;  3N2Q A;  2QVX X;  1WII A;  1PG3 A;  5D1P A;  4A3L I;  3NYR A;  4A3G I;  3UZ0 A;  2KZF A;  4PRO C;  4OXI A;  4L2Z A;  1K0R A;  5AE2 A;  2PK7 A;  1Q82 2;  4PUG A;  2Q51 A;  4MRI A;  2AYD A;  4BCA A;  1KC8 1;  4LE5 A;  5LL6 f;  3S17 I;  4DG8 A;  1S72 Z;  1N36 C;  3IEV A;  2OTJ 1;  2RPR A;  1T5H X;  2HHH C;  1NJI 1;  2VQF C;  5LMN C;  3G4S 1;  1Y1V S;  2YWB A;  5KYV A;  1WJ2 A;  3UOW A;  2CY1 A;  2NAP A;  3S14 I;  2V45 A;  3NFZ A;  1K73 2;  4A3J I;  3JAM D;  3N54 B;  4A3D I;  4DCV A;  1N2F A;  3G6E Z;  1VQ4 Z;  2BH1 X;  3S1R I;  3TQI A;  2CU6 A;  1XRB A;  3KXW A;  2VF1 A;  2PN2 A;  2P2J A;  3CCE Z;  1M90 1;  3CCS Z;  4IZ6 A;  1N33 C;  2KI7 B;  2JA6 I;  5GTD A;  3M4O I;  3CJE A;  3GTM I;  2NCL A;  4KHP C;  4IR7 A;  2P2Q A;  4MH4 A;  5A1G A;  4ISB A;  1IBL C;  3MZK B;  1N8R 2;  2P2M A;  2QA4 Z;  2JA8 I;  3LNV A;  2NVT I;  4DCS A;  1VQL 1;  5T64 A;  1Q7Y 2;  2NVX I;  4LF6 C;  4NBH A;  4DGL A;  1YIT Z;  1JOS A;  2VPZ A;  4R0M A;  1M6X A;  2M5H A;  1PFT A;  2ZM6 C;  4B3M C;  2WAQ A;  4E2W A;  1MXB A;  1Q81 2;  1QVF Z;  4LFB C;  2PT7 G;  4X64 C;  3E7W A;  1RNI A;  4A3F I;  3F3F C;  4RM3 A;  2ZZM A;  4FTF A;  5CM2 M;  1RY2 A;  1QVG Z;  4NBF A;  3CCU 1;  1FLO A;  2OBV A;  3H2T A;  1Q86 2;  3FCE A;  5H9U A;  4GKK C;  2OPL A;  1NP6 A;  3OW2 Y;  2D1S A;  2J6A A;  3J80 f;  1TWF I;  3ETC A;  1N32 C;  1I6H I;  4K0K C;  2DE7 A;  1VLA A;  1DL6 A;  2JA7 I;  4LFA C;  3UX2 A;  4E30 A;  1N34 C;  2O4H A;  2QR1 B;  1HNW C;  5A2Q f;  3S1Q I;  1VEH A;  2OTL 1;  3LNO A;  2OTJ Z;  3CXC Y;  3OW2 Z;  3J81 f;  3G4S Z;  1W2B Y;  3D6W A;  2P02 A;  4NBD A;  1K83 I;  4DR3 C;  2JS4 A;  4NBC A;  3G6E 1;  1VQM Z;  1VQ4 1;  4DV3 C;  1O9T A;  4WV3 A;  4JYA C;  4BC9 A;  5CZV A;  3TDE A;  3JAM b;  1O93 A;  4AYB A;  3KIF A;  3P5J B;  3VMI A;  4D4I A;  2R92 I;  3A25 A;  3EER A;  2YAD A;  3CCS 1;  3I55 Z;  5AE3 A;  2QVY X;  3J80 D;  1YIJ Z;  2JIP A;  1W2B Z;  2V8K A;  3TUF A;  4G36 A;  2QA4 1;  2JR6 A;  3A4I A;  3VNQ A;  2JIM A;  4WS9 A;  5BR8 C;  4FUQ A;  1BA3 A; 
#chains in the Genus database with same CATH homology
 5A2Q D;  1YIT 1;  3K7A I;  3I08 A;  4U5Y D;  4GXR A;  4PZP A;  4BXX I;  3J81 D;  4BBS I;  3IPL A;  3LGX A;  4BBY A;  2R7Z I;  1K9M 1;  2RBL A;  4L4Q A;  2PM9 A;  3PO3 I;  1T5D X;  3JAM f;  3A9U A;  2UUB C;  2F4M A;  3R9X A;  4DV4 C;  4NDN A;  4EWC A;  3QWU A;  2RT9 A;  4HPV A;  1USP B;  1VQP Z;  5D1O B;  1XRC A;  2QLV B;  4MTN A;  3S1N I;  4DV0 C;  1P7L A;  2DE5 A;  1RO0 A;  3NH8 A;  1YUA A;  3HOW I;  2UXB C;  2OO4 A;  4DV7 C;  1MKY A;  1S7M A;  4NBB A;  4KTT A;  2E8F A;  4L7I A;  3Q87 A;  2LIY A;  5BUR A;  2VSQ A;  1VQN Z;  3R44 A;  4DR6 C;  3F3P C;  1Y1V I;  1KD1 1;  4E2Z A;  4DV5 C;  3RG2 A;  4HGY A;  4YY3 C;  1KQS Y;  3DAY A;  3VNS A;  5K8F A;  3T4N B;  2ASB A;  2OTL Z;  1V25 A;  4EAT A;  4DCU A;  4Y52 I;  3GTP I;  1MD9 A;  2AKL A;  1AMU A;  1VQM 1;  1Q82 1;  3MZL B;  2WD9 A;  2ZAE B;  4JM1 A;  2H85 A;  2OOY B;  1Z01 A;  5IP7 I;  3G71 1;  3AF5 A;  2F4V C;  3I55 1;  1YIJ 1;  3R9W A;  3IX0 A;  3T1H C;  1KQS Z;  1YHQ 1;  2EGT A;  4RS4 A;  2D1Q A;  5E7Q A;  2UXC C;  4E32 A;  1K73 1;  5C44 I;  2BJO A;  3CMA Z;  3J80 b;  1V26 A;  3S2H I;  4D56 A;  4DUY C;  5IT9 D;  4JI5 C;  4OX9 C;  4Y7N I;  1QWI A;  4DV1 C;  2JMO A;  4E2Y A;  4TNU A;  3OTO C;  1IBK C;  2UU9 C;  5A2Q b;  3GKU A;  1RG9 A;  2WP0 C;  1MXA A;  2G2K A;  4RLF A;  1N8R 1;  3J81 b;  4JI3 C;  1XNQ C;  2V8J A;  3RV2 A;  3VMH A;  1Q7Y 1;  3VNR A;  4ZJZ A;  2OZK A;  1XMQ C;  1ML8 A;  1O92 A;  2F4O A;  4DV6 C;  3A9V A;  4DK1 A;  1LCI A;  2K3R A;  5T8T A;  3CC2 Z;  3GR1 A;  2UUC C;  1VQK Z;  1VQP 1;  1I94 C;  3CME Z;  4D4G A;  1RQF A;  4RVD A;  3HOZ I;  2LFU A;  3S1M I;  1K8A 2;  3GTM S;  3ETO A;  4BC7 A;  2O53 A;  1Q81 1;  3EQ6 A;  4LFC C;  3PES A;  1VQN 1;  5T67 A;  4G1I A;  2K5R A;  3CW8 X;  1M1K 2;  4A3I I;  1Q86 1;  2DYJ A;  3GTK I;  5FLM I;  3IFU A;  3GTO I;  2E0G A;  1YUK A;  3TDH B;  2VUM I;  4DQY B;  4B3R C;  3CCL 1;  4NH1 C;  3E7X A;  4NXN C;  3I4N I;  4DG9 A;  3NPD A;  4JI7 C;  3FCC A;  1L1O C;  4X62 C;  1ZB8 A;  3T1Y C;  2PMZ A;  4QTU A;  2QRC B;  1XNR C;  1MXC A;  3IF8 A;  4NFR A;  5BSM A;  3NH4 A;  4RVF A;  1YJ9 1;  3G71 Z;  4A3B I;  2PRO A;  3CXC Z;  1MDB A;  3LAX A;  1NUI A;  4NB9 A;  2HF1 A;  1YHQ Z;  3CMA 1;  1USP A;  3CCV Z;  2VQE C;  4AQY C;  4B3T C;  4R1M A;  3H3V J;  4XX2 A;  2B63 I;  1P9N A;  1I3Q I;  2P3Y A;  5IT9 b;  1XRA A;  4NB8 A;  5ADZ A;  1RO2 A;  4QTT A;  4YHH C;  1YI2 Z;  4DR1 C;  2HJG A;  2OPL B;  2RHB A;  5LMU C;  2JMP A;  3VTN A;  3S16 I;  4PHT A;  5IWA C;  2VZE A;  3DLP X;  5BSR A;  3VB9 A;  2JA5 I;  3CPW Y;  4A93 I;  1X0T A;  4KTV A;  5BUS A;  4BY7 I;  3CC2 1;  1VQK 1;  3RZO I;  3CME 1;  5FLX D;  2Y4O A;  3I56 Z;  2QEX 1;  4LF7 C;  2Y4N A;  4JI0 C;  3CCJ 1;  4X66 C;  3CCM Z;  5BSW A;  1TWA I;  2R6M A;  1HH2 P;  2QL8 A;  1YJW 1;  5K85 A;  2NVQ I;  2OOX B;  4G37 A;  3RZD I;  3CD6 Z;  3HKZ A;  4MD7 A;  2JNY A;  1ULT A;  3S2D I;  4DR4 C;  2I3C A;  5IT9 f;  2IZ4 A;  1VQ6 1;  1TWC I;  2XR1 A;  4DCT A;  1TWH I;  2P28 A;  4BY1 I;  1HR0 C;  1VQ9 Z;  1VQ5 Z;  1UKK A;  1QF8 A;  1VQ8 Z;  5BUQ A;  4NBA A;  4I9F A;  3TE5 B;  5JRH A;  2E9H A;  2E7G A;  4ODJ A;  4LF8 C;  4MD9 A;  2CXC A;  1RO4 A;  4HH4 A;  4LF4 C;  2E5L C;  4JI1 C;  1QM4 A;  4NOZ A;  3GTJ I;  3CCL Z;  3PO3 S;  1KC8 2;  2V8I A;  1YJ7 A;  4X65 C;  1NJI 2;  3CCQ Z;  2YWC A;  4BSZ A;  4MXU A;  5C3E I;  3CCR 1;  1EGA A;  1WF3 A;  2YU9 I;  2UUA C;  1Y1W I;  5A1I A;  4ZLP A;  2GU2 A;  3BG0 B;  1YJ9 Z;  1X3Z A;  3NI2 A;  1FUG A;  3CCV 1;  3GCF A;  1RLY A;  3IML A;  4RVN A;  4DR5 C;  3S15 I;  4MD8 A;  3CC7 Z;  1HNX C;  3FKI I;  3GKQ A;  1JJ2 Y;  3PRO C;  3GTQ I;  3L95 X;  3CC4 Z;  1M90 2;  1YI2 1;  4DV2 C;  3AF6 A;  3CW9 A;  2M48 A;  2E2H I;  2W04 A;  3LUS A;  1PG4 A;  2JUB A;  2QW0 X;  5T8S A;  4NBG A;  3GPC A;  2GTI A;  2R93 I;  1ZH1 A;  2D1R A;  3I07 A;  5BST A;  4HGZ A;  5C4X I;  2DPL A;  3HOY I;  4RVH A;  1O90 A;  3H0G I;  4RVG A;  2DE6 A;  1JJ2 Z;  1QVF Y;  3VMG A;  3I56 1;  4JI6 C;  1NYE A;  3I4M I;  2Y0S A;  2QKD A;  2YCB A;  2KPI A;  1TFI A;  3CCM 1;  1ZB9 A;  2QEX Z;  1QVG Y;  3GR0 A;  2Q4Z A;  5FLX b;  5DV9 A;  3CCJ Z;  1KKG A;  3J7A 4;  2QVZ X;  4TPS B;  3NDI A;  3CD6 1;  2UXD C;  1YJW Z;  4JI2 C;  5CZX A;  4JI4 C;  4CL1 A;  3BG1 B;  3NDJ A;  4I9G A;  1VQ6 Z;  3L8C A;  1VQ9 1;  1VQ5 1;  2VUG A;  3DHV A;  1VQ8 1;  4RLQ A;  1HNZ C;  3FQM A;  1K8A 1;  1VQO 1;  1YJN Z;  1FJG C;  1J5E C;  2P2F A;  2IZ3 A;  4E31 A;  2ATW A;  4K0B A;  4NBE A;  3GTG I;  1JWH C;  1PA4 A;  2P20 A;  4JV5 C;  4RVO A;  1Z02 A;  5T6B A;  3U50 C;  1VQ7 Z;  3CCQ 1;  1M1K 1;  2D27 A;  4LF5 C;  1L2F A;  5C4J I;  4A3K I;  5IP9 I;  5FLX f;  3CCR Z;  3PBK A;  2D7V A;  3SO4 A;  3CQZ I;  1S72 1;  1TWG I;  4S1T A;  3CC7 1;  2WB1 A;  2V7B A;  3PO2 I;  3ESW A;  1X3W A;  5D1O A;  4X6A I;  3FQQ A;  4RMN A;  2QRD B;  2HU9 A;  3CC4 1;  2D1T A;  2E8C A;  2RIQ A;  4LF9 C;  4GS5 A;  1QYP A;  3D9X A;  1MDF A;  3IEU A;  2NVY I;  2QRE B;  4A3C I;  4DR7 C;  4B3S C;  5IFI A;  2D28 C;  2E2I I;  3CCE 1;  1I50 I;  1IBM C;  1WW9 A;  1R9T I;  3HOX I;  3MON A;  4RV9 A;  4JI8 C;  4D57 A;  3HOV I;  1LQL A;  2AYA A;  5BSU A;  1K9M 2;  1KRL A;  4GXQ A;  2E2J I;  3S82 A;  1VQL Z;  1XMO C;  4DR2 C;  4BBR I;  3C5E A;  5KEI A;  2E8E A;  4A3E I;  4NXM C;  3NYQ A;  2ONF A;  2Y27 A;  3CPW Z;  4FUT A;  1GPM A;  3KIH A;  4A3M I;  5AN9 F;  1WCM I;  4E33 A;  3B7W A;  1YJN 1;  3EED A;  2W03 A;  1WH9 A;  5AE1 A;  2P2B A;  1Z03 A;  3M3Y I;  5A19 A;  1SFO I;  1VQO Z;  4OYC A;  4GKJ C;  4MON A;  4E2X A;  2GTH A;  3GTL I;  3HOU I;  5KYT A;  1KD1 2;  4DUZ C;  2M6N A;  3CCU Z;  1VQ7 1;  3NH5 A;  3G7S A;  5BSV A;  4R1L A;  4RM2 A;  3N2Q A;  2QVX X;  1WII A;  1PG3 A;  5D1P A;  4A3L I;  3NYR A;  4A3G I;  3UZ0 A;  2KZF A;  4PRO C;  4OXI A;  4L2Z A;  1K0R A;  5AE2 A;  2PK7 A;  1Q82 2;  2Q51 A;  4MRI A;  4BCA A;  1KC8 1;  4LE5 A;  5LL6 f;  3S17 I;  4DG8 A;  1S72 Z;  1N36 C;  3IEV A;  2OTJ 1;  2RPR A;  1T5H X;  2HHH C;  1NJI 1;  2VQF C;  5LMN C;  3G4S 1;  1Y1V S;  2YWB A;  5KYV A;  3UOW A;  2CY1 A;  3S14 I;  3NFZ A;  1K73 2;  4A3J I;  3JAM D;  3N54 B;  4A3D I;  4DCV A;  1N2F A;  3G6E Z;  1VQ4 Z;  2BH1 X;  3S1R I;  3TQI A;  1XRB A;  3KXW A;  2VF1 A;  2PN2 A;  2P2J A;  3CCE Z;  1M90 1;  3CCS Z;  4IZ6 A;  1N33 C;  2KI7 B;  2JA6 I;  5GTD A;  3M4O I;  3CJE A;  3GTM I;  4KHP C;  4IR7 A;  2P2Q A;  4MH4 A;  5A1G A;  4ISB A;  1IBL C;  3MZK B;  1N8R 2;  2P2M A;  2QA4 Z;  2JA8 I;  3LNV A;  2NVT I;  4DCS A;  1VQL 1;  5T64 A;  1Q7Y 2;  2NVX I;  4LF6 C;  4NBH A;  4DGL A;  1YIT Z;  1JOS A;  4R0M A;  1PFT A;  2ZM6 C;  4B3M C;  2WAQ A;  4E2W A;  1MXB A;  1Q81 2;  1QVF Z;  4LFB C;  2PT7 G;  4X64 C;  3E7W A;  1RNI A;  4A3F I;  3F3F C;  4RM3 A;  4FTF A;  5CM2 M;  1RY2 A;  1QVG Z;  4NBF A;  3CCU 1;  2OBV A;  3H2T A;  1Q86 2;  3FCE A;  5H9U A;  4GKK C;  2OPL A;  1NP6 A;  3OW2 Y;  2D1S A;  2J6A A;  3J80 f;  1TWF I;  3ETC A;  1N32 C;  1I6H I;  4K0K C;  2DE7 A;  1VLA A;  1DL6 A;  2JA7 I;  4LFA C;  4E30 A;  1N34 C;  2O4H A;  2QR1 B;  1HNW C;  5A2Q f;  3S1Q I;  2OTL 1;  2OTJ Z;  3CXC Y;  3OW2 Z;  3J81 f;  3G4S Z;  1W2B Y;  3D6W A;  2P02 A;  4NBD A;  1K83 I;  4DR3 C;  2JS4 A;  4NBC A;  3G6E 1;  1VQM Z;  1VQ4 1;  4DV3 C;  1O9T A;  4WV3 A;  4JYA C;  4BC9 A;  5CZV A;  3TDE A;  3JAM b;  1O93 A;  4AYB A;  3KIF A;  3P5J B;  3VMI A;  4D4I A;  2R92 I;  3EER A;  2YAD A;  3CCS 1;  3I55 Z;  5AE3 A;  2QVY X;  3J80 D;  1YIJ Z;  1W2B Z;  2V8K A;  3TUF A;  4G36 A;  2QA4 1;  2JR6 A;  3A4I A;  3VNQ A;  4WS9 A;  5BR8 C;  4FUQ A;  1BA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...