1ML8A

Structural genomics
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERRERLFTHINLHFIVTGRDLKDAAVARAVDLSAEKYCSVALMLEKAVNITHSYEVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein (crp region)
total genus 35
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2002-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ml8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ml8A02
2E2HI 4LF5C 2JNYA 3VMGA 4DUZC 1K0RA 4BBSI 5IP7I 2VUMI 4X6AI 1J5EC 4A3FI 4JI5C 1TWAI 3GCFA 3IEUA 4JI7C 4NXNC 1RLYA 1WW9A 4XX2A 5C44I 2R92I 4DV4C 1IBKC 4NBCA 3J80D 4DUYC 3VMHA 5CM2M 2NVQI 3PO3I 2JA7I 4A3BI 4JV5C 4NBFA 1FJGC 3S1QI 1Y1VI 1N33C 2E8EA 4BSZA 2PT7G 2UXDC 3IEVA 3H0GI 4A3EI 2JS4A 2E2II 2UUBC 3R9XA 1Y1WI 1QWIA 3HOZI 3U50C 2CXCA 4JI3C 1I6HI 4X62C 1NUIA 2EGTA 3LUSA 3HOUI 4DV6C 4DR1C 2RBLA 1MKYA 4DV1C 4X65C 3JAMD 1X3ZA 2F4OA 4NBDA 1I50I 2PN2A 4DCVA 3R9WA 2K5RA 1K83I 4QTUA 4A3JI 2JA8I 3S15I 2OPLB 3GTLI 4NXMC 5LMNC 3CQZI 1KKGA 1ZB9A 2R93I 2CY1A 4JI4C 4B3SC 3Q87A 3GTKI 3AF6A 1NYEA 4NBBA 4A93I 5C3EI 3S2HI 3CJEA 4LF9C 3HOWI 4JI1C 2HHHC 3GTPI 2UXCC 2R7ZI 1X3WA 1Y1VS 1R9TI 4MH4A 4DV2C 1UKKA 4NBGA 5BR8C 4YY3C 4BY1I 1WH9A 3GTMI 3J81D 1XMQC 4NB9A 1L1OC 4DCTA 4LFAC 2QL8A 4B3TC 2ONFA 4JI6C 1N32C 1USPA 4X66C 4LF7C 2PK7A 2E8CA 1VLAA 2YCBA 3HOYI 4JI0C 4A3LI 3GKUA 4KHPC 5A2QD 2DYJA 3T1YC 2DE5A 2NVTI 2KZFA 1N36C 1LQLA 2BJOA 5IWAC 4AQYC 4GKKC 1EGAA 2NVXI 5FLXD 2E7GA 1TWGI 5IP9I 2JA6I 3GTJI 3GTQI 2KPIA 1DL6A 2F4VC 3S1NI 1ML8A 4B3RC 4DR7C 2DE6A 1HNWC 4X64C 4A3MI 4YHHC 1WCMI 1TWCI 1YUAA 3GTOI 1IBMC 4GKJC 4DV5C 3RZDI 2DE7A 2B63I 3GKQA 4MTNA 3I4NI 3ESWA 2VQEC 4NOZA 4NB8A 4OX9C 3H3VJ 2HF1A 4NBAA 3OTOC 3T1HC 2UU9C 4DR2C 4A3GI 4Y7NI 2D7VA 3HOVI 1XNQC 1QYPA 3S17I 3S1MI 4A3DI 5IT9D 1I94C 4DV3C 4NBEA 4JI2C 4JI8C 4BXXI 4DR4C 2YU9I 1PA4A 1XMOC 2J6AA 1TFIA 3PO2I 3S16I 5FLMI 2JR6A 4A3CI 4Y52I 2HJGA 2JMPA 4DCUA 2ZM6C 1PFTA 4DR5C 1HNZC 5C4XI 2F4MA 1N34C 3RZOI 2ATWA 1I3QI 4DV0C 2E2JI 1USPB 4LF8C 3S14I 3EERA 1SFOI 2UXBC 4LFBC 3PO3S 4DR6C 2E5LC 4A3II 2UUAC 4DCSA 3GTMS 4DR3C 4JYAC 4NBHA 3D6WA 1IBLC 2XR1A 4B3MC 2ASBA 1N2FA 4LF4C 4LFCC 5C4JI 4BBRI 1HNXC 1HR0C 2E8FA 2AKLA 3GTGI 3FKII 3VB9A 4DV7C 1TWFI 1TWHI 2OPLA 4K0KC 2VQFC 3HOXI 3M4OI 4BY7I 3AF5A 5LMUC 2UUCC 3I07A 2P3YA 3S1RI 3I4MI 3S2DI 4LF6C 3VMIA 3M3YI 1XNRC 1JOSA 1ZB8A 3K7AI 1HH2P 1WF3A 1L2FA 1RO4A 2NVYI 4A3KI 2JA5I 4QTTA
chains in the Genus database with same CATH superfamily
2O4HA 2VPZA 3CME1 3P5JB 2IZ3A 1RO2A 2YADA 1J5EC 4JI7C 2Q51A 1WW9A 2CU6A 3IFUA 5AE2A 1VQ5Z 3J80D 4DUYC 3VMHA 2NVQI 4MRIA 5BSTA 4A3BI 4NBFA 1FJGC 3CQ3A 3S1QI 1VQ9Z 5A2Qf 2E8EA 2PT7G 3G6E1 3H0GI 3CC21 1QWIA 3CD61 2JUBA 3HOZI 4L7IA 3S82A 4X62C 4DV6C 3CMEZ 2ZAEB 3J80b 3HOUI 3NI2A 5JRHA 2RBLA 1XRBA 4X65C 3CCUZ 1JJ2Z 3CCV1 2GU2A 1NP6A 2M5OA 2P2BA 3KIFA 2K5RA 1K83I 4NXMC 3IMLA 4DCVA 3CC41 1VQ6Z 3GTLI 1KQSY 1P4EA 2CY1A 4RM2A 4PUHA 3JAMf 3GTKI 3AF6A 3CJEA 4NBBA 4LF9C 4JI1C 2QKDA 3T4NB 2HHHC 2UXCC 2QA41 3KXWA 1R9TI 4MH4A 1K731 1UKKA 4PUIA 3CCRZ 2OOYB 2ZZMA 5BR8C 1KC82 1MDBA 5T8SA 2QREB 2DPLA 1YI2Z 3J7A4 2M48A 1W2BZ 4PZPA 4YY3C 1VQP1 5IT9b 1XMQC 5IT9f 2QVXX 3LGXA 2LEXA 2E8CA 1VLAA 3J81f 5D1PA 3R44A 4A3LI 4RLQA 2DE5A 1N36C 1Z01A 2Q4ZA 1QM4A 5AE1A 4AQYC 4BCAA 3E7XA 1EGAA 2WD9A 1QXFA 2JA6I 3SO4A 2F4VC 2HU9A 5H9UA 1WJ2A 2DE6A 3E7WA 4JM1A 3TUFA 2VPWA 3UOWA 1TWCI 1Q821 4U5YD 3D2LA 3ETCA 3CC4Z 2P2MA 3FCEA 3UEBA 2WAQA 2BH1X 4RLFA 3GKQA 3CCVZ 1RY2A 1QF8A 4NOZA 1MXCA 3OTOC 4CL1A 4E2WA 3A9UA 2UU9C 3CCJZ 2QVYX 3HOVI 2E9HA 3CXCZ 1XNQC 4EATA 4A3DI 5IT9D 3DLPX 2YU9I 2D1RA 2J6AA 1VQLZ 3S16I 4A3CI 1VQO1 2D1TA 1PFTA 4AYBA 3RZOI 3TE5B 3I551 3TDEA 2ATWA 3CCS1 2E2JI 1USPB 2Y27A 2I3CA 3G711 1Z02A 3GPCA 2GTIA 2WB1A 4ZJZA 1YJ91 2JNVA 2UUAC 2QA4Z 4BC7A 2VF1A 3RV2A 1VQ7Z 5BURA 2ASBA 1N2FA 5BUSA 4LF4C 4LFCC 4D57A 3NYRA 1HR0C 1XRAA 3FKII 3VB9A 2MCQA 1M6XA 5A1IA 2KZ0A 4BY7I 2DHMA 2UUCC 1O93A 3I4MI 3NYQA 3S2DI 4LF6C 1O9TA 4BC9A 1ZB8A 3EEDA 2NAPA 1RO4A 5D1OB 5GTDA 5DV9A 4QTTA 2VPXA 2E2HI 3C5EA 2JNYA 4MD9A 3VNSA 2VUMI 4HPVA 1FLOA 3L95X 4JI5C 3GCFA 3JAMb 4XX2A 4DV4C 5C44I 1GPMA 4DG9A 5CM2M 3PO3I 4JV5C 1YJ7A 2P20A 4ODJA 4L4QA 3R9XA 3OW2Z 3U50C 4JI3C 2JIPA 3CCMZ 5BSWA 2IZ4A 2W03A 3IX0A 1NUIA 4DR1C 1YIJZ 3I56Z 1VEHA 1MKYA 4E2XA 2PROA 4E2ZA 4MD7A 2KDNA 4RVOA 4A3JI 1ZB9A 3CMAZ 3CW9A 1NYEA 5C3EI 3KIHA 4R1MA 3GTPI 2W04A 1MD9A 2GTHA 2P2FA 2M5HA 3PROC 4BY1I 4DG8A 1VQNZ 3J81D 1L1OC 2QL8A 3AY0A 3CCEZ 2ONFA 1USPA 4LF7C 4GXRA 1Q862 3HOYI 3GKUA 2V8IA 2NCLA 5KYVA 4KHPC 2KZFA 1LQLA 1VQ81 4GKKC 3G7SA 3LAXA 3GTQI 3N54B 1ML8A 4DR7C 4I9GA 4A3MI 4YHHC 4R1LA 1S721 1VQ4Z 4DV5C 2P28A 5ADZA 3NH5A 4MTNA 3I4NI 3ETOA 4HGZA 2V7BA 1M1K2 3FCCA 3H3VJ 1VQK1 2HF1A 2QVZX 4G1IA 4OX9C 1YJ9Z 5AN9F 4A3GI 1RO0A 2YX1A 5A19A 1PG4A 3J81b 4NBEA 2P2JA 1XMOC 1K732 1TFIA 4PUGA 4DCUA 5FLMI 5A1GA 4DR2C 2MM9A 4DR5C 2AYAA 2OZKA 2ZM6C 2Y4OA 1N34C 1I3QI 2QR1B 2LIYA 1RNIA 4LF8C 3EERA 3A26A 1X0TA 1TH5A 2OO4A 2WP0C 3H2TA 1VQM1 2UXBC 2VPYA 1N8R2 1V60A 2QLVB 3I561 4A3II 2E5LC 4DR3C 3CXCY 2H85A 3CCU1 3D6WA 1QVGY 2VSQA 3DHVA 3CPWY 5C4JI 4BBRI 1HNXC 4G37A 2OOXB 2QRCB 3CD6Z 1ULTA 1N8R1 4DV7C 4RVFA 1TWHI 1WCJA 1Q861 3HOXI 2VZEA 2QW0X 3CW8X 5LMUC 5CZVA 3VNQA 3M3YI 1FDIA 3PBKA 1XNRC 3K7AI 2G2KA 1YHQ1 4HH4A 3MZLB 2NVYI 1SIWA 1M902 4RS4A 1AMUA 4OXIA 3CPWZ 3NDJA 3VMGA 2D27A 3I08A 4RM3A 3HKZA 2RPRA 1K0RA 4BBSI 5IP7I 2V8KA 4X6AI 4DQYB 4GS5A 1TWAI 4D4GA 1M1K1 5LCIA 5CZXA 1YJNZ 3VTNA 4FTFA 1Q7Y1 1FDOA 1NJI2 1KD11 2JA7I 2RHBA 5T8TA 2UXDC 4BSZA 4ZLPA 4NFRA 2ZZNA 3IEVA 2RT9A 2E2II 2JIMA 1Y1WI 4RVDA 1VQ71 3BG0B 2CXCA 4RVHA 2PM9A 2M6NA 3CC2Z 4PHTA 3LUSA 3CC7Z 1W2BY 2AYDA 1NJI1 1VQN1 4NBDA 1I50I 2PN2A 1VQ51 3R9WA 2JA8I 4QTUA 2OPLB 1KKGA 1VQL1 3CCSZ 3CQZI 2R93I 1V25A 3NPDA 4JI4C 3Q87A 4RV9A 4DK1A 3IPLA 3S2HI 4A93I 1VQKZ 4E2YA 3HOWI 2D1SA 3CMA1 5AE3A 1XS3A 2R6MA 3IR7A 1T5DX 1WH9A 4E30A 4NB9A 4TPSB 3CQ1A 1YJW1 2KI7B 2OTJZ 3N2QA 4JI6C 3F3PC 1QVFY 2PK7A 4JI0C 1YJN1 4OYCA 5A2QD 2NVTI 4E31A 5IWAC 3B7WA 3CCQZ 3NH8A 5FLXD 3QWUA 1TWGI 4WV3A 3F3FC 3GTJI 1DL6A 2O53A 1FUGA 2P2QA 3S1NI 4B3RC 1HNWC 5BSVA 4BBYA 4X64C 3UX3A 1K8A1 3O2EA 1IBMC 4GKJC 3D9XA 3RZDI 2DE7A 1YITZ 3FQQA 4R0MA 3GR1A 5D1OA 1P9NA 2JMOA 5FLXb 4NB8A 2VQEC 5FLXf 4NBAA 1QVFZ 1VQPZ 3T1HC 3NH4A 1QVGZ 3CCQ1 2D7VA 3CCR1 3S1MI 1V26A 1N32C 4DV3C 2Y0SA 1PA4A 3LNVA 2HJGA 4JYAC 4Y52I 5C4XI 2V3VA 4D4IA 1M6XC 1ZH1A 1Z03A 3EQ6A 4E33A 3S14I 5LL6f 4GXQA 5KYTA 4PROC 2JIOA 4DGLA 5T67A 2YWCA 3GTMS 4DCSA 4NBHA 2Z51A 2OBVA 1IBLC 2XR1A 1Q822 2RIQA 3A25A 3MONA 1YIT1 3TQIA 2AKLA 3GTGI 3K6RA 3L8CA 3CQ2A 3CC71 3M4OI 2JIRA 3VNRA 3I07A 2P3YA 2PMZA 5T6BA 3S1RI 3PESA 5BSUA 4L2ZA 4KTTA 1K9M2 3VMIA 5K8FA 1JOSA 1HH2P 4TNUA 4RVGA 1L2FA 3NFZA 4HGYA 1YIJ1 4LF5C 1P7LA 1XHJA 3MZKB 4DUZC 3RG2A 1RG9A 1BA3A 3LNOA 4A3FI 4ISBA 1VQ8Z 3IEUA 4NXNC 1RLYA 3G4S1 2R92I 5BSRA 1IBKC 2QEX1 4NBCA 2E0GA 2D1QA 4FUQA 5E7QA 1Y1VI 2D28C 1N33C 1RQFA 4A3EI 2JS4A 2UUBC 3UZ0A 3I55Z 1I6HI 4LE5A 2EGTA 4NDNA 2JIQA 5BUQA 2YWBA 4K0BA 1KQSZ 3GR0A 4DV1C 2Y4NA 3JAMD 1X3ZA 2F4OA 1O90A 4IR7A 1YUKA 1XRCA 1PU1A 3DAYA 4MD8A 1S7MA 3S15I 2QRDB 3A4IA 5LMNC 3G4SZ 2P02A 4B3SC 3OW2Y 1YJWZ 2OTJ1 1Q16A 2OTL1 2R7ZI 1X3WA 1Y1VS 3CCM1 1VQMZ 1KRLA 1VQ61 1NY8A 4NBGA 1O92A 4DV2C 1P4EC 5A2Qb 3GTMI 4KTVA 4LFAC 4DCTA 4FUTA 2K3RA 4B3TC 4X66C 2V45A 1MDFA 2YCBA 1K9M1 3J80f 2DYJA 3NDIA 4IZ6A 2V8JA 4EWCA 1T5HX 5IFIA 2BJOA 3T1YC 1WIIA 3G71Z 2NVXI 3G6EZ 3TR3A 5IP9I 2KPIA 1JWHC 1WCMI 3TDHB 1VQOZ 1YUAA 3GTOI 4D56A 2B63I 1AA6A 1S72Z 4MXUA 1VQ41 4WS9A 3IF8A 3ESWA 4S1TA 3A9VA 3CCL1 3FQMA 1MXBA 4Y7NI 1QYPA 3S17I 1I94C 1Q812 4JI2C 4JI8C 2OTLZ 4BXXI 4DR4C 4RVNA 3PO2I 2IV2X 1M901 2JR6A 3CCLZ 3CCE1 2JMPA 1HNZC 2F4MA 4DV0C 1SFOI 2MMAB 4LFBC 1YHQZ 3PO3S 1Q811 2E7ZA 2LFUA 3UX2A 1VQ91 4RMNA 4DR6C 5BSMA 1Y8CA 1Q7Y2 1KD12 5KEIA 4G36A 4B3MC 1YI21 1JJ2Y 2E8FA 4NH1C 2QEXZ 1K8A2 1IB8A 5T64A 4MONA 1TWFI 1KC81 2OPLA 1LCIA 4K0KC 3CCJ1 2VQFC 3AF5A 2VUGA 1MXAA 5K85A 4I9FA 1PG3A 1WF3A 1WZNA 3BG1B 4E32A 4A3KI 2JA5I 2E7GA 1UWDA
chains in the Genus database with same CATH topology
2O4HA 3CME1 3P5JB 2IZ3A 1RO2A 2YADA 1J5EC 4JI7C 2Q51A 1WW9A 3IFUA 5AE2A 1VQ5Z 3J80D 4DUYC 3VMHA 2NVQI 4MRIA 5BSTA 4A3BI 4NBFA 1FJGC 3S1QI 1VQ9Z 5A2Qf 2E8EA 2PT7G 3G6E1 3H0GI 3CC21 1QWIA 3CD61 2JUBA 3HOZI 4L7IA 3S82A 4X62C 4DV6C 3CMEZ 2ZAEB 3J80b 3HOUI 3NI2A 5JRHA 2RBLA 1XRBA 4X65C 3CCUZ 1JJ2Z 3CCV1 2GU2A 1NP6A 4DCVA 2P2BA 3KIFA 2K5RA 1K83I 4NXMC 3IMLA 3CC41 1VQ6Z 3GTLI 1KQSY 2CY1A 4RM2A 3JAMf 3GTKI 3AF6A 3CJEA 4NBBA 4LF9C 4JI1C 2QKDA 3T4NB 2HHHC 2UXCC 2QA41 3KXWA 1R9TI 4MH4A 1K731 1UKKA 3CCRZ 2OOYB 5BR8C 1KC82 1MDBA 5T8SA 2QREB 2DPLA 1YI2Z 3J7A4 2M48A 1W2BZ 4PZPA 4YY3C 1VQP1 5IT9b 1XMQC 5IT9f 2QVXX 3LGXA 2E8CA 1VLAA 3J81f 5D1PA 3R44A 4A3LI 4RLQA 2DE5A 1N36C 1Z01A 2Q4ZA 1QM4A 5AE1A 4AQYC 4BCAA 3E7XA 1EGAA 2WD9A 2JA6I 3SO4A 2F4VC 2HU9A 5H9UA 2DE6A 3E7WA 4JM1A 3TUFA 3UOWA 1TWCI 1Q821 4U5YD 3ETCA 3CC4Z 2P2MA 3FCEA 2WAQA 2BH1X 4RLFA 3GKQA 3CCVZ 1RY2A 1QF8A 4NOZA 1MXCA 3OTOC 4CL1A 4E2WA 3A9UA 2UU9C 3CCJZ 2QVYX 3HOVI 2E9HA 3CXCZ 1XNQC 4EATA 4A3DI 5IT9D 3DLPX 2YU9I 2D1RA 2J6AA 1VQLZ 3S16I 4A3CI 1VQO1 2D1TA 1PFTA 4AYBA 3RZOI 3TE5B 3I551 3TDEA 2ATWA 3CCS1 2E2JI 1USPB 2Y27A 2I3CA 3G711 1Z02A 3GPCA 2GTIA 2WB1A 4ZJZA 1YJ91 2UUAC 2QA4Z 4BC7A 2VF1A 3RV2A 1VQ7Z 5BURA 2ASBA 1N2FA 5BUSA 4LF4C 4LFCC 4D57A 3NYRA 1HR0C 1XRAA 3FKII 3VB9A 5A1IA 4BY7I 2UUCC 1O93A 3I4MI 3NYQA 3S2DI 4LF6C 1O9TA 4BC9A 1ZB8A 3EEDA 1RO4A 5D1OB 5GTDA 5DV9A 4QTTA 2E2HI 3C5EA 2JNYA 4MD9A 3VNSA 2VUMI 4HPVA 3L95X 4JI5C 3GCFA 3JAMb 4XX2A 4DV4C 5C44I 1GPMA 4DG9A 5CM2M 3PO3I 4JV5C 1YJ7A 2P20A 4ODJA 4L4QA 3R9XA 3OW2Z 3U50C 4JI3C 3CCMZ 5BSWA 2IZ4A 2W03A 3IX0A 1NUIA 4DR1C 1YIJZ 3I56Z 1MKYA 4E2XA 2PROA 4E2ZA 4MD7A 4RVOA 4A3JI 1ZB9A 3CMAZ 3CW9A 1NYEA 5C3EI 3KIHA 4R1MA 3GTPI 2W04A 1MD9A 2GTHA 2P2FA 3PROC 4BY1I 4DG8A 1VQNZ 3J81D 1L1OC 2QL8A 3CCEZ 2ONFA 1USPA 4LF7C 4GXRA 1Q862 3HOYI 3GKUA 2V8IA 4KHPC 5KYVA 2KZFA 1LQLA 1VQ81 4GKKC 3G7SA 3LAXA 3GTQI 3N54B 1ML8A 4DR7C 4I9GA 4A3MI 4YHHC 4R1LA 1S721 1VQ4Z 4DV5C 2P28A 5ADZA 3NH5A 4MTNA 3I4NI 3ETOA 4HGZA 2V7BA 1M1K2 3FCCA 3H3VJ 1VQK1 2HF1A 2QVZX 4G1IA 4OX9C 1YJ9Z 5AN9F 4A3GI 1RO0A 5A19A 1PG4A 3J81b 4NBEA 2P2JA 1XMOC 1K732 1TFIA 4DCUA 5A1GA 5FLMI 4DR2C 4DR5C 2AYAA 2OZKA 2ZM6C 2Y4OA 1N34C 1I3QI 2QR1B 2LIYA 1RNIA 4LF8C 3EERA 2UXBC 1X0TA 2OO4A 2WP0C 3H2TA 1VQM1 1N8R2 2QLVB 3I561 4A3II 2E5LC 4DR3C 3CXCY 2H85A 3CCU1 3D6WA 1QVGY 2VSQA 3DHVA 3CPWY 5C4JI 4BBRI 1HNXC 4G37A 2OOXB 2QRCB 3CD6Z 1ULTA 1N8R1 4DV7C 4RVFA 1TWHI 1Q861 3HOXI 2VZEA 2QW0X 3CW8X 5LMUC 5CZVA 3VNQA 3M3YI 1XNRC 3PBKA 3K7AI 2G2KA 1YHQ1 4HH4A 3MZLB 2NVYI 1M902 4RS4A 1AMUA 4OXIA 3CPWZ 3NDJA 3VMGA 2D27A 3I08A 4RM3A 3HKZA 2RPRA 1K0RA 4BBSI 5IP7I 2V8KA 4X6AI 4DQYB 4GS5A 1TWAI 4D4GA 1M1K1 5CZXA 1YJNZ 3VTNA 4FTFA 1Q7Y1 1KD11 1NJI2 2JA7I 2RHBA 5T8TA 2UXDC 4BSZA 4ZLPA 4NFRA 3IEVA 2RT9A 2E2II 1Y1WI 4RVDA 1VQ71 3BG0B 2CXCA 4RVHA 2PM9A 2M6NA 3CC2Z 4PHTA 3LUSA 3CC7Z 1W2BY 1NJI1 1VQN1 4NBDA 1I50I 2PN2A 1VQ51 3R9WA 2JA8I 4QTUA 2OPLB 1KKGA 1VQL1 3CCSZ 3CQZI 2R93I 1V25A 3NPDA 4JI4C 3Q87A 4RV9A 4DK1A 3IPLA 3S2HI 4A93I 1VQKZ 4E2YA 3HOWI 2D1SA 3CMA1 5AE3A 2R6MA 1T5DX 1WH9A 4E30A 4NB9A 4TPSB 1YJW1 2KI7B 2OTJZ 3N2QA 4JI6C 3F3PC 1QVFY 2PK7A 4JI0C 1YJN1 4OYCA 5A2QD 2NVTI 4E31A 5IWAC 3B7WA 3CCQZ 3NH8A 5FLXD 3QWUA 1TWGI 4WV3A 3F3FC 3GTJI 1DL6A 2O53A 1FUGA 2P2QA 3S1NI 4B3RC 1HNWC 5BSVA 4BBYA 4X64C 1K8A1 1IBMC 4GKJC 3D9XA 3RZDI 2DE7A 1YITZ 3FQQA 4R0MA 3GR1A 5D1OA 1P9NA 2JMOA 5FLXb 4NB8A 2VQEC 5FLXf 4NBAA 1QVFZ 1VQPZ 3T1HC 3NH4A 1QVGZ 3CCQ1 2D7VA 3CCR1 3S1MI 1V26A 1N32C 4DV3C 2Y0SA 1PA4A 3LNVA 2HJGA 4JYAC 4Y52I 5C4XI 4D4IA 1ZH1A 1Z03A 3EQ6A 4E33A 3S14I 5LL6f 4GXQA 5KYTA 4PROC 4DGLA 5T67A 2YWCA 3GTMS 4DCSA 4NBHA 2OBVA 1IBLC 2XR1A 1Q822 2RIQA 3MONA 1YIT1 3TQIA 2AKLA 3GTGI 3L8CA 3CC71 3M4OI 3VNRA 3I07A 2P3YA 2PMZA 5T6BA 3S1RI 3PESA 5BSUA 4L2ZA 4KTTA 1K9M2 3VMIA 5K8FA 1JOSA 1HH2P 4TNUA 4RVGA 1L2FA 3NFZA 4HGYA 1YIJ1 4LF5C 1P7LA 3MZKB 4DUZC 3RG2A 1RG9A 1BA3A 4A3FI 4ISBA 1VQ8Z 3IEUA 4NXNC 1RLYA 3G4S1 2R92I 5BSRA 1IBKC 2QEX1 4NBCA 2E0GA 2D1QA 4FUQA 5E7QA 1Y1VI 2D28C 1N33C 1RQFA 4A3EI 2JS4A 2UUBC 3UZ0A 3I55Z 1I6HI 4LE5A 2EGTA 4NDNA 5BUQA 2YWBA 4K0BA 1KQSZ 3GR0A 4DV1C 2Y4NA 3JAMD 1X3ZA 2F4OA 1O90A 4IR7A 1YUKA 1XRCA 3DAYA 4MD8A 1S7MA 3S15I 2QRDB 3A4IA 5LMNC 3G4SZ 2P02A 4B3SC 3OW2Y 1YJWZ 2OTJ1 2OTL1 2R7ZI 1X3WA 1Y1VS 3CCM1 1VQMZ 1KRLA 1VQ61 1O92A 4NBGA 4DV2C 5A2Qb 3GTMI 4KTVA 4LFAC 4DCTA 4FUTA 2K3RA 4B3TC 4X66C 1MDFA 2YCBA 1K9M1 3J80f 2DYJA 3NDIA 4IZ6A 2V8JA 4EWCA 1T5HX 5IFIA 2BJOA 3T1YC 1WIIA 3G71Z 2NVXI 3G6EZ 5IP9I 2KPIA 1JWHC 1WCMI 3TDHB 1VQOZ 1YUAA 3GTOI 4D56A 2B63I 1S72Z 4MXUA 1VQ41 4WS9A 3IF8A 3ESWA 4S1TA 3A9VA 3CCL1 3FQMA 1MXBA 4Y7NI 1QYPA 3S17I 1I94C 1Q812 4JI2C 4JI8C 2OTLZ 4BXXI 4DR4C 4RVNA 3PO2I 1M901 2JR6A 3CCLZ 3CCE1 2JMPA 1HNZC 2F4MA 4DV0C 1SFOI 4LFBC 1YHQZ 3PO3S 1Q811 2LFUA 1VQ91 4RMNA 4DR6C 5BSMA 1Q7Y2 1KD12 5KEIA 4G36A 4B3MC 1YI21 1JJ2Y 2E8FA 4NH1C 2QEXZ 1K8A2 5T64A 4MONA 1TWFI 1KC81 2OPLA 1LCIA 4K0KC 3CCJ1 2VQFC 3AF5A 2VUGA 1MXAA 5K85A 4I9FA 1PG3A 1WF3A 3BG1B 4E32A 4A3KI 2JA5I 2E7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H I;  4LF5 C;  2JNY A;  3VMG A;  4DUZ C;  1K0R A;  4BBS I;  5IP7 I;  2VUM I;  4X6A I;  1J5E C;  4A3F I;  4JI5 C;  1TWA I;  3GCF A;  3IEU A;  4JI7 C;  4NXN C;  1RLY A;  1WW9 A;  4XX2 A;  5C44 I;  2R92 I;  4DV4 C;  1IBK C;  4NBC A;  3J80 D;  4DUY C;  3VMH A;  5CM2 M;  2NVQ I;  3PO3 I;  2JA7 I;  4A3B I;  4JV5 C;  4NBF A;  1FJG C;  3S1Q I;  1Y1V I;  1N33 C;  2E8E A;  4BSZ A;  2PT7 G;  2UXD C;  3IEV A;  3H0G I;  4A3E I;  2JS4 A;  2E2I I;  2UUB C;  3R9X A;  1Y1W I;  1QWI A;  3HOZ I;  3U50 C;  2CXC A;  4JI3 C;  1I6H I;  4X62 C;  1NUI A;  2EGT A;  3LUS A;  3HOU I;  4DV6 C;  4DR1 C;  2RBL A;  1MKY A;  4DV1 C;  4X65 C;  3JAM D;  1X3Z A;  2F4O A;  4NBD A;  1I50 I;  2PN2 A;  4DCV A;  3R9W A;  2K5R A;  1K83 I;  4QTU A;  4A3J I;  2JA8 I;  3S15 I;  2OPL B;  3GTL I;  4NXM C;  5LMN C;  3CQZ I;  1KKG A;  1ZB9 A;  2R93 I;  2CY1 A;  4JI4 C;  4B3S C;  3Q87 A;  3GTK I;  3AF6 A;  1NYE A;  4NBB A;  4A93 I;  5C3E I;  3S2H I;  3CJE A;  4LF9 C;  3HOW I;  4JI1 C;  2HHH C;  3GTP I;  2UXC C;  2R7Z I;  1X3W A;  1Y1V S;  1R9T I;  4MH4 A;  4DV2 C;  1UKK A;  4NBG A;  5BR8 C;  4YY3 C;  4BY1 I;  1WH9 A;  3GTM I;  3J81 D;  1XMQ C;  4NB9 A;  1L1O C;  4DCT A;  4LFA C;  2QL8 A;  4B3T C;  2ONF A;  4JI6 C;  1N32 C;  1USP A;  4X66 C;  4LF7 C;  2PK7 A;  2E8C A;  1VLA A;  2YCB A;  3HOY I;  4JI0 C;  4A3L I;  3GKU A;  4KHP C;  5A2Q D;  2DYJ A;  3T1Y C;  2DE5 A;  2NVT I;  2KZF A;  1N36 C;  1LQL A;  2BJO A;  5IWA C;  4AQY C;  4GKK C;  1EGA A;  2NVX I;  5FLX D;  2E7G A;  1TWG I;  5IP9 I;  2JA6 I;  3GTJ I;  3GTQ I;  2KPI A;  1DL6 A;  2F4V C;  3S1N I;  1ML8 A;  4B3R C;  4DR7 C;  2DE6 A;  1HNW C;  4X64 C;  4A3M I;  4YHH C;  1WCM I;  1TWC I;  1YUA A;  3GTO I;  1IBM C;  4GKJ C;  4DV5 C;  3RZD I;  2DE7 A;  2B63 I;  3GKQ A;  4MTN A;  3I4N I;  3ESW A;  2VQE C;  4NOZ A;  4NB8 A;  4OX9 C;  3H3V J;  2HF1 A;  4NBA A;  3OTO C;  3T1H C;  2UU9 C;  4DR2 C;  4A3G I;  4Y7N I;  2D7V A;  3HOV I;  1XNQ C;  1QYP A;  3S17 I;  3S1M I;  4A3D I;  5IT9 D;  1I94 C;  4DV3 C;  4NBE A;  4JI2 C;  4JI8 C;  4BXX I;  4DR4 C;  2YU9 I;  1PA4 A;  1XMO C;  2J6A A;  1TFI A;  3PO2 I;  3S16 I;  5FLM I;  2JR6 A;  4A3C I;  4Y52 I;  2HJG A;  2JMP A;  4DCU A;  2ZM6 C;  1PFT A;  4DR5 C;  1HNZ C;  5C4X I;  2F4M A;  1N34 C;  3RZO I;  2ATW A;  1I3Q I;  4DV0 C;  2E2J I;  1USP B;  4LF8 C;  3S14 I;  3EER A;  1SFO I;  2UXB C;  4LFB C;  3PO3 S;  4DR6 C;  2E5L C;  4A3I I;  2UUA C;  4DCS A;  3GTM S;  4DR3 C;  4JYA C;  4NBH A;  3D6W A;  1IBL C;  2XR1 A;  4B3M C;  2ASB A;  1N2F A;  4LF4 C;  4LFC C;  5C4J I;  4BBR I;  1HNX C;  1HR0 C;  2E8F A;  2AKL A;  3GTG I;  3FKI I;  3VB9 A;  4DV7 C;  1TWF I;  1TWH I;  2OPL A;  4K0K C;  2VQF C;  3HOX I;  3M4O I;  4BY7 I;  3AF5 A;  5LMU C;  2UUC C;  3I07 A;  2P3Y A;  3S1R I;  3I4M I;  3S2D I;  4LF6 C;  3VMI A;  3M3Y I;  1XNR C;  1JOS A;  1ZB8 A;  3K7A I;  1HH2 P;  1WF3 A;  1L2F A;  1RO4 A;  2NVY I;  4A3K I;  2JA5 I;  4QTT A; 
#chains in the Genus database with same CATH topology
 2O4H A;  2VPZ A;  3CME 1;  3P5J B;  2IZ3 A;  1RO2 A;  2YAD A;  1J5E C;  4JI7 C;  2Q51 A;  1WW9 A;  2CU6 A;  3IFU A;  5AE2 A;  1VQ5 Z;  3J80 D;  4DUY C;  3VMH A;  2NVQ I;  4MRI A;  5BST A;  4A3B I;  4NBF A;  1FJG C;  3CQ3 A;  3S1Q I;  1VQ9 Z;  5A2Q f;  2E8E A;  2PT7 G;  3G6E 1;  3H0G I;  3CC2 1;  1QWI A;  3CD6 1;  2JUB A;  3HOZ I;  4L7I A;  3S82 A;  4X62 C;  4DV6 C;  3CME Z;  2ZAE B;  3J80 b;  3HOU I;  3NI2 A;  5JRH A;  2RBL A;  1XRB A;  4X65 C;  3CCU Z;  1JJ2 Z;  3CCV 1;  2GU2 A;  1NP6 A;  2M5O A;  2P2B A;  3KIF A;  2K5R A;  1K83 I;  4NXM C;  3IML A;  4DCV A;  3CC4 1;  1VQ6 Z;  3GTL I;  1KQS Y;  1P4E A;  2CY1 A;  4RM2 A;  4PUH A;  3JAM f;  3GTK I;  3AF6 A;  3CJE A;  4NBB A;  4LF9 C;  4JI1 C;  2QKD A;  3T4N B;  2HHH C;  2UXC C;  2QA4 1;  3KXW A;  1R9T I;  4MH4 A;  1K73 1;  1UKK A;  4PUI A;  3CCR Z;  2OOY B;  2ZZM A;  5BR8 C;  1KC8 2;  1MDB A;  5T8S A;  2QRE B;  2DPL A;  1YI2 Z;  3J7A 4;  2M48 A;  1W2B Z;  4PZP A;  4YY3 C;  1VQP 1;  5IT9 b;  1XMQ C;  5IT9 f;  2QVX X;  3LGX A;  2LEX A;  2E8C A;  1VLA A;  3J81 f;  5D1P A;  3R44 A;  4A3L I;  4RLQ A;  2DE5 A;  1N36 C;  1Z01 A;  2Q4Z A;  1QM4 A;  5AE1 A;  4AQY C;  4BCA A;  3E7X A;  1EGA A;  2WD9 A;  1QXF A;  2JA6 I;  3SO4 A;  2F4V C;  2HU9 A;  5H9U A;  1WJ2 A;  2DE6 A;  3E7W A;  4JM1 A;  3TUF A;  2VPW A;  3UOW A;  1TWC I;  1Q82 1;  4U5Y D;  3D2L A;  3ETC A;  3CC4 Z;  2P2M A;  3FCE A;  3UEB A;  2WAQ A;  2BH1 X;  4RLF A;  3GKQ A;  3CCV Z;  1RY2 A;  1QF8 A;  4NOZ A;  1MXC A;  3OTO C;  4CL1 A;  4E2W A;  3A9U A;  2UU9 C;  3CCJ Z;  2QVY X;  3HOV I;  2E9H A;  3CXC Z;  1XNQ C;  4EAT A;  4A3D I;  5IT9 D;  3DLP X;  2YU9 I;  2D1R A;  2J6A A;  1VQL Z;  3S16 I;  4A3C I;  1VQO 1;  2D1T A;  1PFT A;  4AYB A;  3RZO I;  3TE5 B;  3I55 1;  3TDE A;  2ATW A;  3CCS 1;  2E2J I;  1USP B;  2Y27 A;  2I3C A;  3G71 1;  1Z02 A;  3GPC A;  2GTI A;  2WB1 A;  4ZJZ A;  1YJ9 1;  2JNV A;  2UUA C;  2QA4 Z;  4BC7 A;  2VF1 A;  3RV2 A;  1VQ7 Z;  5BUR A;  2ASB A;  1N2F A;  5BUS A;  4LF4 C;  4LFC C;  4D57 A;  3NYR A;  1HR0 C;  1XRA A;  3FKI I;  3VB9 A;  2MCQ A;  1M6X A;  5A1I A;  2KZ0 A;  4BY7 I;  2DHM A;  2UUC C;  1O93 A;  3I4M I;  3NYQ A;  3S2D I;  4LF6 C;  1O9T A;  4BC9 A;  1ZB8 A;  3EED A;  2NAP A;  1RO4 A;  5D1O B;  5GTD A;  5DV9 A;  4QTT A;  2VPX A;  2E2H I;  3C5E A;  2JNY A;  4MD9 A;  3VNS A;  2VUM I;  4HPV A;  1FLO A;  3L95 X;  4JI5 C;  3GCF A;  3JAM b;  4XX2 A;  4DV4 C;  5C44 I;  1GPM A;  4DG9 A;  5CM2 M;  3PO3 I;  4JV5 C;  1YJ7 A;  2P20 A;  4ODJ A;  4L4Q A;  3R9X A;  3OW2 Z;  3U50 C;  4JI3 C;  2JIP A;  3CCM Z;  5BSW A;  2IZ4 A;  2W03 A;  3IX0 A;  1NUI A;  4DR1 C;  1YIJ Z;  3I56 Z;  1VEH A;  1MKY A;  4E2X A;  2PRO A;  4E2Z A;  4MD7 A;  2KDN A;  4RVO A;  4A3J I;  1ZB9 A;  3CMA Z;  3CW9 A;  1NYE A;  5C3E I;  3KIH A;  4R1M A;  3GTP I;  2W04 A;  1MD9 A;  2GTH A;  2P2F A;  2M5H A;  3PRO C;  4BY1 I;  4DG8 A;  1VQN Z;  3J81 D;  1L1O C;  2QL8 A;  3AY0 A;  3CCE Z;  2ONF A;  1USP A;  4LF7 C;  4GXR A;  1Q86 2;  3HOY I;  3GKU A;  2V8I A;  2NCL A;  5KYV A;  4KHP C;  2KZF A;  1LQL A;  1VQ8 1;  4GKK C;  3G7S A;  3LAX A;  3GTQ I;  3N54 B;  1ML8 A;  4DR7 C;  4I9G A;  4A3M I;  4YHH C;  4R1L A;  1S72 1;  1VQ4 Z;  4DV5 C;  2P28 A;  5ADZ A;  3NH5 A;  4MTN A;  3I4N I;  3ETO A;  4HGZ A;  2V7B A;  1M1K 2;  3FCC A;  3H3V J;  1VQK 1;  2HF1 A;  2QVZ X;  4G1I A;  4OX9 C;  1YJ9 Z;  5AN9 F;  4A3G I;  1RO0 A;  2YX1 A;  5A19 A;  1PG4 A;  3J81 b;  4NBE A;  2P2J A;  1XMO C;  1K73 2;  1TFI A;  4PUG A;  4DCU A;  5FLM I;  5A1G A;  4DR2 C;  2MM9 A;  4DR5 C;  2AYA A;  2OZK A;  2ZM6 C;  2Y4O A;  1N34 C;  1I3Q I;  2QR1 B;  2LIY A;  1RNI A;  4LF8 C;  3EER A;  3A26 A;  1X0T A;  1TH5 A;  2OO4 A;  2WP0 C;  3H2T A;  1VQM 1;  2UXB C;  2VPY A;  1N8R 2;  1V60 A;  2QLV B;  3I56 1;  4A3I I;  2E5L C;  4DR3 C;  3CXC Y;  2H85 A;  3CCU 1;  3D6W A;  1QVG Y;  2VSQ A;  3DHV A;  3CPW Y;  5C4J I;  4BBR I;  1HNX C;  4G37 A;  2OOX B;  2QRC B;  3CD6 Z;  1ULT A;  1N8R 1;  4DV7 C;  4RVF A;  1TWH I;  1WCJ A;  1Q86 1;  3HOX I;  2VZE A;  2QW0 X;  3CW8 X;  5LMU C;  5CZV A;  3VNQ A;  3M3Y I;  1FDI A;  3PBK A;  1XNR C;  3K7A I;  2G2K A;  1YHQ 1;  4HH4 A;  3MZL B;  2NVY I;  1SIW A;  1M90 2;  4RS4 A;  1AMU A;  4OXI A;  3CPW Z;  3NDJ A;  3VMG A;  2D27 A;  3I08 A;  4RM3 A;  3HKZ A;  2RPR A;  1K0R A;  4BBS I;  5IP7 I;  2V8K A;  4X6A I;  4DQY B;  4GS5 A;  1TWA I;  4D4G A;  1M1K 1;  5LCI A;  5CZX A;  1YJN Z;  3VTN A;  4FTF A;  1Q7Y 1;  1FDO A;  1NJI 2;  1KD1 1;  2JA7 I;  2RHB A;  5T8T A;  2UXD C;  4BSZ A;  4ZLP A;  4NFR A;  2ZZN A;  3IEV A;  2RT9 A;  2E2I I;  2JIM A;  1Y1W I;  4RVD A;  1VQ7 1;  3BG0 B;  2CXC A;  4RVH A;  2PM9 A;  2M6N A;  3CC2 Z;  4PHT A;  3LUS A;  3CC7 Z;  1W2B Y;  2AYD A;  1NJI 1;  1VQN 1;  4NBD A;  1I50 I;  2PN2 A;  1VQ5 1;  3R9W A;  2JA8 I;  4QTU A;  2OPL B;  1KKG A;  1VQL 1;  3CCS Z;  3CQZ I;  2R93 I;  1V25 A;  3NPD A;  4JI4 C;  3Q87 A;  4RV9 A;  4DK1 A;  3IPL A;  3S2H I;  4A93 I;  1VQK Z;  4E2Y A;  3HOW I;  2D1S A;  3CMA 1;  5AE3 A;  1XS3 A;  2R6M A;  3IR7 A;  1T5D X;  1WH9 A;  4E30 A;  4NB9 A;  4TPS B;  3CQ1 A;  1YJW 1;  2KI7 B;  2OTJ Z;  3N2Q A;  4JI6 C;  3F3P C;  1QVF Y;  2PK7 A;  4JI0 C;  1YJN 1;  4OYC A;  5A2Q D;  2NVT I;  4E31 A;  5IWA C;  3B7W A;  3CCQ Z;  3NH8 A;  5FLX D;  3QWU A;  1TWG I;  4WV3 A;  3F3F C;  3GTJ I;  1DL6 A;  2O53 A;  1FUG A;  2P2Q A;  3S1N I;  4B3R C;  1HNW C;  5BSV A;  4BBY A;  4X64 C;  3UX3 A;  1K8A 1;  3O2E A;  1IBM C;  4GKJ C;  3D9X A;  3RZD I;  2DE7 A;  1YIT Z;  3FQQ A;  4R0M A;  3GR1 A;  5D1O A;  1P9N A;  2JMO A;  5FLX b;  4NB8 A;  2VQE C;  5FLX f;  4NBA A;  1QVF Z;  1VQP Z;  3T1H C;  3NH4 A;  1QVG Z;  3CCQ 1;  2D7V A;  3CCR 1;  3S1M I;  1V26 A;  1N32 C;  4DV3 C;  2Y0S A;  1PA4 A;  3LNV A;  2HJG A;  4JYA C;  4Y52 I;  5C4X I;  2V3V A;  4D4I A;  1M6X C;  1ZH1 A;  1Z03 A;  3EQ6 A;  4E33 A;  3S14 I;  5LL6 f;  4GXQ A;  5KYT A;  4PRO C;  2JIO A;  4DGL A;  5T67 A;  2YWC A;  3GTM S;  4DCS A;  4NBH A;  2Z51 A;  2OBV A;  1IBL C;  2XR1 A;  1Q82 2;  2RIQ A;  3A25 A;  3MON A;  1YIT 1;  3TQI A;  2AKL A;  3GTG I;  3K6R A;  3L8C A;  3CQ2 A;  3CC7 1;  3M4O I;  2JIR A;  3VNR A;  3I07 A;  2P3Y A;  2PMZ A;  5T6B A;  3S1R I;  3PES A;  5BSU A;  4L2Z A;  4KTT A;  1K9M 2;  3VMI A;  5K8F A;  1JOS A;  1HH2 P;  4TNU A;  4RVG A;  1L2F A;  3NFZ A;  4HGY A;  1YIJ 1;  4LF5 C;  1P7L A;  1XHJ A;  3MZK B;  4DUZ C;  3RG2 A;  1RG9 A;  1BA3 A;  3LNO A;  4A3F I;  4ISB A;  1VQ8 Z;  3IEU A;  4NXN C;  1RLY A;  3G4S 1;  2R92 I;  5BSR A;  1IBK C;  2QEX 1;  4NBC A;  2E0G A;  2D1Q A;  4FUQ A;  5E7Q A;  1Y1V I;  2D28 C;  1N33 C;  1RQF A;  4A3E I;  2JS4 A;  2UUB C;  3UZ0 A;  3I55 Z;  1I6H I;  4LE5 A;  2EGT A;  4NDN A;  2JIQ A;  5BUQ A;  2YWB A;  4K0B A;  1KQS Z;  3GR0 A;  4DV1 C;  2Y4N A;  3JAM D;  1X3Z A;  2F4O A;  1O90 A;  4IR7 A;  1YUK A;  1XRC A;  1PU1 A;  3DAY A;  4MD8 A;  1S7M A;  3S15 I;  2QRD B;  3A4I A;  5LMN C;  3G4S Z;  2P02 A;  4B3S C;  3OW2 Y;  1YJW Z;  2OTJ 1;  1Q16 A;  2OTL 1;  2R7Z I;  1X3W A;  1Y1V S;  3CCM 1;  1VQM Z;  1KRL A;  1VQ6 1;  1NY8 A;  4NBG A;  1O92 A;  4DV2 C;  1P4E C;  5A2Q b;  3GTM I;  4KTV A;  4LFA C;  4DCT A;  4FUT A;  2K3R A;  4B3T C;  4X66 C;  2V45 A;  1MDF A;  2YCB A;  1K9M 1;  3J80 f;  2DYJ A;  3NDI A;  4IZ6 A;  2V8J A;  4EWC A;  1T5H X;  5IFI A;  2BJO A;  3T1Y C;  1WII A;  3G71 Z;  2NVX I;  3G6E Z;  3TR3 A;  5IP9 I;  2KPI A;  1JWH C;  1WCM I;  3TDH B;  1VQO Z;  1YUA A;  3GTO I;  4D56 A;  2B63 I;  1AA6 A;  1S72 Z;  4MXU A;  1VQ4 1;  4WS9 A;  3IF8 A;  3ESW A;  4S1T A;  3A9V A;  3CCL 1;  3FQM A;  1MXB A;  4Y7N I;  1QYP A;  3S17 I;  1I94 C;  1Q81 2;  4JI2 C;  4JI8 C;  2OTL Z;  4BXX I;  4DR4 C;  4RVN A;  3PO2 I;  2IV2 X;  1M90 1;  2JR6 A;  3CCL Z;  3CCE 1;  2JMP A;  1HNZ C;  2F4M A;  4DV0 C;  1SFO I;  2MMA B;  4LFB C;  1YHQ Z;  3PO3 S;  1Q81 1;  2E7Z A;  2LFU A;  3UX2 A;  1VQ9 1;  4RMN A;  4DR6 C;  5BSM A;  1Y8C A;  1Q7Y 2;  1KD1 2;  5KEI A;  4G36 A;  4B3M C;  1YI2 1;  1JJ2 Y;  2E8F A;  4NH1 C;  2QEX Z;  1K8A 2;  1IB8 A;  5T64 A;  4MON A;  1TWF I;  1KC8 1;  2OPL A;  1LCI A;  4K0K C;  3CCJ 1;  2VQF C;  3AF5 A;  2VUG A;  1MXA A;  5K85 A;  4I9F A;  1PG3 A;  1WF3 A;  1WZN A;  3BG1 B;  4E32 A;  4A3K I;  2JA5 I;  2E7G A;  1UWD A; 
#chains in the Genus database with same CATH homology
 2O4H A;  3CME 1;  3P5J B;  2IZ3 A;  1RO2 A;  2YAD A;  1J5E C;  4JI7 C;  2Q51 A;  1WW9 A;  3IFU A;  5AE2 A;  1VQ5 Z;  3J80 D;  4DUY C;  3VMH A;  2NVQ I;  4MRI A;  5BST A;  4A3B I;  4NBF A;  1FJG C;  3S1Q I;  1VQ9 Z;  5A2Q f;  2E8E A;  2PT7 G;  3G6E 1;  3H0G I;  3CC2 1;  1QWI A;  3CD6 1;  2JUB A;  3HOZ I;  4L7I A;  3S82 A;  4X62 C;  4DV6 C;  3CME Z;  2ZAE B;  3J80 b;  3HOU I;  3NI2 A;  5JRH A;  2RBL A;  1XRB A;  4X65 C;  3CCU Z;  1JJ2 Z;  3CCV 1;  2GU2 A;  1NP6 A;  4DCV A;  2P2B A;  3KIF A;  2K5R A;  1K83 I;  4NXM C;  3IML A;  3CC4 1;  1VQ6 Z;  3GTL I;  1KQS Y;  2CY1 A;  4RM2 A;  3JAM f;  3GTK I;  3AF6 A;  3CJE A;  4NBB A;  4LF9 C;  4JI1 C;  2QKD A;  3T4N B;  2HHH C;  2UXC C;  2QA4 1;  3KXW A;  1R9T I;  4MH4 A;  1K73 1;  1UKK A;  3CCR Z;  2OOY B;  5BR8 C;  1KC8 2;  1MDB A;  5T8S A;  2QRE B;  2DPL A;  1YI2 Z;  3J7A 4;  2M48 A;  1W2B Z;  4PZP A;  4YY3 C;  1VQP 1;  5IT9 b;  1XMQ C;  5IT9 f;  2QVX X;  3LGX A;  2E8C A;  1VLA A;  3J81 f;  5D1P A;  3R44 A;  4A3L I;  4RLQ A;  2DE5 A;  1N36 C;  1Z01 A;  2Q4Z A;  1QM4 A;  5AE1 A;  4AQY C;  4BCA A;  3E7X A;  1EGA A;  2WD9 A;  2JA6 I;  3SO4 A;  2F4V C;  2HU9 A;  5H9U A;  2DE6 A;  3E7W A;  4JM1 A;  3TUF A;  3UOW A;  1TWC I;  1Q82 1;  4U5Y D;  3ETC A;  3CC4 Z;  2P2M A;  3FCE A;  2WAQ A;  2BH1 X;  4RLF A;  3GKQ A;  3CCV Z;  1RY2 A;  1QF8 A;  4NOZ A;  1MXC A;  3OTO C;  4CL1 A;  4E2W A;  3A9U A;  2UU9 C;  3CCJ Z;  2QVY X;  3HOV I;  2E9H A;  3CXC Z;  1XNQ C;  4EAT A;  4A3D I;  5IT9 D;  3DLP X;  2YU9 I;  2D1R A;  2J6A A;  1VQL Z;  3S16 I;  4A3C I;  1VQO 1;  2D1T A;  1PFT A;  4AYB A;  3RZO I;  3TE5 B;  3I55 1;  3TDE A;  2ATW A;  3CCS 1;  2E2J I;  1USP B;  2Y27 A;  2I3C A;  3G71 1;  1Z02 A;  3GPC A;  2GTI A;  2WB1 A;  4ZJZ A;  1YJ9 1;  2UUA C;  2QA4 Z;  4BC7 A;  2VF1 A;  3RV2 A;  1VQ7 Z;  5BUR A;  2ASB A;  1N2F A;  5BUS A;  4LF4 C;  4LFC C;  4D57 A;  3NYR A;  1HR0 C;  1XRA A;  3FKI I;  3VB9 A;  5A1I A;  4BY7 I;  2UUC C;  1O93 A;  3I4M I;  3NYQ A;  3S2D I;  4LF6 C;  1O9T A;  4BC9 A;  1ZB8 A;  3EED A;  1RO4 A;  5D1O B;  5GTD A;  5DV9 A;  4QTT A;  2E2H I;  3C5E A;  2JNY A;  4MD9 A;  3VNS A;  2VUM I;  4HPV A;  3L95 X;  4JI5 C;  3GCF A;  3JAM b;  4XX2 A;  4DV4 C;  5C44 I;  1GPM A;  4DG9 A;  5CM2 M;  3PO3 I;  4JV5 C;  1YJ7 A;  2P20 A;  4ODJ A;  4L4Q A;  3R9X A;  3OW2 Z;  3U50 C;  4JI3 C;  3CCM Z;  5BSW A;  2IZ4 A;  2W03 A;  3IX0 A;  1NUI A;  4DR1 C;  1YIJ Z;  3I56 Z;  1MKY A;  4E2X A;  2PRO A;  4E2Z A;  4MD7 A;  4RVO A;  4A3J I;  1ZB9 A;  3CMA Z;  3CW9 A;  1NYE A;  5C3E I;  3KIH A;  4R1M A;  3GTP I;  2W04 A;  1MD9 A;  2GTH A;  2P2F A;  3PRO C;  4BY1 I;  4DG8 A;  1VQN Z;  3J81 D;  1L1O C;  2QL8 A;  3CCE Z;  2ONF A;  1USP A;  4LF7 C;  4GXR A;  1Q86 2;  3HOY I;  3GKU A;  2V8I A;  4KHP C;  5KYV A;  2KZF A;  1LQL A;  1VQ8 1;  4GKK C;  3G7S A;  3LAX A;  3GTQ I;  3N54 B;  1ML8 A;  4DR7 C;  4I9G A;  4A3M I;  4YHH C;  4R1L A;  1S72 1;  1VQ4 Z;  4DV5 C;  2P28 A;  5ADZ A;  3NH5 A;  4MTN A;  3I4N I;  3ETO A;  4HGZ A;  2V7B A;  1M1K 2;  3FCC A;  3H3V J;  1VQK 1;  2HF1 A;  2QVZ X;  4G1I A;  4OX9 C;  1YJ9 Z;  5AN9 F;  4A3G I;  1RO0 A;  5A19 A;  1PG4 A;  3J81 b;  4NBE A;  2P2J A;  1XMO C;  1K73 2;  1TFI A;  4DCU A;  5A1G A;  5FLM I;  4DR2 C;  4DR5 C;  2AYA A;  2OZK A;  2ZM6 C;  2Y4O A;  1N34 C;  1I3Q I;  2QR1 B;  2LIY A;  1RNI A;  4LF8 C;  3EER A;  2UXB C;  1X0T A;  2OO4 A;  2WP0 C;  3H2T A;  1VQM 1;  1N8R 2;  2QLV B;  3I56 1;  4A3I I;  2E5L C;  4DR3 C;  3CXC Y;  2H85 A;  3CCU 1;  3D6W A;  1QVG Y;  2VSQ A;  3DHV A;  3CPW Y;  5C4J I;  4BBR I;  1HNX C;  4G37 A;  2OOX B;  2QRC B;  3CD6 Z;  1ULT A;  1N8R 1;  4DV7 C;  4RVF A;  1TWH I;  1Q86 1;  3HOX I;  2VZE A;  2QW0 X;  3CW8 X;  5LMU C;  5CZV A;  3VNQ A;  3M3Y I;  1XNR C;  3PBK A;  3K7A I;  2G2K A;  1YHQ 1;  4HH4 A;  3MZL B;  2NVY I;  1M90 2;  4RS4 A;  1AMU A;  4OXI A;  3CPW Z;  3NDJ A;  3VMG A;  2D27 A;  3I08 A;  4RM3 A;  3HKZ A;  2RPR A;  1K0R A;  4BBS I;  5IP7 I;  2V8K A;  4X6A I;  4DQY B;  4GS5 A;  1TWA I;  4D4G A;  1M1K 1;  5CZX A;  1YJN Z;  3VTN A;  4FTF A;  1Q7Y 1;  1KD1 1;  1NJI 2;  2JA7 I;  2RHB A;  5T8T A;  2UXD C;  4BSZ A;  4ZLP A;  4NFR A;  3IEV A;  2RT9 A;  2E2I I;  1Y1W I;  4RVD A;  1VQ7 1;  3BG0 B;  2CXC A;  4RVH A;  2PM9 A;  2M6N A;  3CC2 Z;  4PHT A;  3LUS A;  3CC7 Z;  1W2B Y;  1NJI 1;  1VQN 1;  4NBD A;  1I50 I;  2PN2 A;  1VQ5 1;  3R9W A;  2JA8 I;  4QTU A;  2OPL B;  1KKG A;  1VQL 1;  3CCS Z;  3CQZ I;  2R93 I;  1V25 A;  3NPD A;  4JI4 C;  3Q87 A;  4RV9 A;  4DK1 A;  3IPL A;  3S2H I;  4A93 I;  1VQK Z;  4E2Y A;  3HOW I;  2D1S A;  3CMA 1;  5AE3 A;  2R6M A;  1T5D X;  1WH9 A;  4E30 A;  4NB9 A;  4TPS B;  1YJW 1;  2KI7 B;  2OTJ Z;  3N2Q A;  4JI6 C;  3F3P C;  1QVF Y;  2PK7 A;  4JI0 C;  1YJN 1;  4OYC A;  5A2Q D;  2NVT I;  4E31 A;  5IWA C;  3B7W A;  3CCQ Z;  3NH8 A;  5FLX D;  3QWU A;  1TWG I;  4WV3 A;  3F3F C;  3GTJ I;  1DL6 A;  2O53 A;  1FUG A;  2P2Q A;  3S1N I;  4B3R C;  1HNW C;  5BSV A;  4BBY A;  4X64 C;  1K8A 1;  1IBM C;  4GKJ C;  3D9X A;  3RZD I;  2DE7 A;  1YIT Z;  3FQQ A;  4R0M A;  3GR1 A;  5D1O A;  1P9N A;  2JMO A;  5FLX b;  4NB8 A;  2VQE C;  5FLX f;  4NBA A;  1QVF Z;  1VQP Z;  3T1H C;  3NH4 A;  1QVG Z;  3CCQ 1;  2D7V A;  3CCR 1;  3S1M I;  1V26 A;  1N32 C;  4DV3 C;  2Y0S A;  1PA4 A;  3LNV A;  2HJG A;  4JYA C;  4Y52 I;  5C4X I;  4D4I A;  1ZH1 A;  1Z03 A;  3EQ6 A;  4E33 A;  3S14 I;  5LL6 f;  4GXQ A;  5KYT A;  4PRO C;  4DGL A;  5T67 A;  2YWC A;  3GTM S;  4DCS A;  4NBH A;  2OBV A;  1IBL C;  2XR1 A;  1Q82 2;  2RIQ A;  3MON A;  1YIT 1;  3TQI A;  2AKL A;  3GTG I;  3L8C A;  3CC7 1;  3M4O I;  3VNR A;  3I07 A;  2P3Y A;  2PMZ A;  5T6B A;  3S1R I;  3PES A;  5BSU A;  4L2Z A;  4KTT A;  1K9M 2;  3VMI A;  5K8F A;  1JOS A;  1HH2 P;  4TNU A;  4RVG A;  1L2F A;  3NFZ A;  4HGY A;  1YIJ 1;  4LF5 C;  1P7L A;  3MZK B;  4DUZ C;  3RG2 A;  1RG9 A;  1BA3 A;  4A3F I;  4ISB A;  1VQ8 Z;  3IEU A;  4NXN C;  1RLY A;  3G4S 1;  2R92 I;  5BSR A;  1IBK C;  2QEX 1;  4NBC A;  2E0G A;  2D1Q A;  4FUQ A;  5E7Q A;  1Y1V I;  2D28 C;  1N33 C;  1RQF A;  4A3E I;  2JS4 A;  2UUB C;  3UZ0 A;  3I55 Z;  1I6H I;  4LE5 A;  2EGT A;  4NDN A;  5BUQ A;  2YWB A;  4K0B A;  1KQS Z;  3GR0 A;  4DV1 C;  2Y4N A;  3JAM D;  1X3Z A;  2F4O A;  1O90 A;  4IR7 A;  1YUK A;  1XRC A;  3DAY A;  4MD8 A;  1S7M A;  3S15 I;  2QRD B;  3A4I A;  5LMN C;  3G4S Z;  2P02 A;  4B3S C;  3OW2 Y;  1YJW Z;  2OTJ 1;  2OTL 1;  2R7Z I;  1X3W A;  1Y1V S;  3CCM 1;  1VQM Z;  1KRL A;  1VQ6 1;  1O92 A;  4NBG A;  4DV2 C;  5A2Q b;  3GTM I;  4KTV A;  4LFA C;  4DCT A;  4FUT A;  2K3R A;  4B3T C;  4X66 C;  1MDF A;  2YCB A;  1K9M 1;  3J80 f;  2DYJ A;  3NDI A;  4IZ6 A;  2V8J A;  4EWC A;  1T5H X;  5IFI A;  2BJO A;  3T1Y C;  1WII A;  3G71 Z;  2NVX I;  3G6E Z;  5IP9 I;  2KPI A;  1JWH C;  1WCM I;  3TDH B;  1VQO Z;  1YUA A;  3GTO I;  4D56 A;  2B63 I;  1S72 Z;  4MXU A;  1VQ4 1;  4WS9 A;  3IF8 A;  3ESW A;  4S1T A;  3A9V A;  3CCL 1;  3FQM A;  1MXB A;  4Y7N I;  1QYP A;  3S17 I;  1I94 C;  1Q81 2;  4JI2 C;  4JI8 C;  2OTL Z;  4BXX I;  4DR4 C;  4RVN A;  3PO2 I;  1M90 1;  2JR6 A;  3CCL Z;  3CCE 1;  2JMP A;  1HNZ C;  2F4M A;  4DV0 C;  1SFO I;  4LFB C;  1YHQ Z;  3PO3 S;  1Q81 1;  2LFU A;  1VQ9 1;  4RMN A;  4DR6 C;  5BSM A;  1Q7Y 2;  1KD1 2;  5KEI A;  4G36 A;  4B3M C;  1YI2 1;  1JJ2 Y;  2E8F A;  4NH1 C;  2QEX Z;  1K8A 2;  5T64 A;  4MON A;  1TWF I;  1KC8 1;  2OPL A;  1LCI A;  4K0K C;  3CCJ 1;  2VQF C;  3AF5 A;  2VUG A;  1MXA A;  5K85 A;  4I9F A;  1PG3 A;  1WF3 A;  3BG1 B;  4E32 A;  4A3K I;  2JA5 I;  2E7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...