2CU6A

Crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
PLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords dTDP-4-keto-L-rhamnose reductase-related Protein
total genus 19
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2cu6A00
2Z51A 1VEHA 3CQ2A 3LNOA 2JNVA 1WCJA 1XHJA 3CQ3A 2M5HA 2CU6A 3CQ1A 2M5OA 3UX3A 3UX2A 1UWDA 1TH5A
chains in the Genus database with same CATH superfamily
3G7SA 4NOZA 5BR8C 4D4IA 5K8FA 4OYCA 3J80D 1RG9A 3VNSA 3NYQA 3RV2A 4LFAC 2Z51A 2OPLB 3J81D 1MDBA 2P02A 2MM9A 3H2TA 3AF6A 3CW8X 4NXMC 3KXWA 4YHHC 1P4EA 2E7GA 4JI5C 2CU6A 2P2BA 1MDFA 1P7LA 2P20A 4DV7C 5BURA 4WV3A 4KTVA 3R44A 4D56A 2Y4OA 2ZZMA 3IEVA 3GPCA 2YX1A 4PUHA 3O2EA 4DCSA 4G37A 4BC7A 4JYAC 1FLOA 2WP0C 4R1MA 3FCCA 2P2MA 2QVZX 3L8CA 3EERA 3E7WA 3IEUA 4FUQA 1VLAA 2ZM6C 4D4GA 4ODJA 4IZ6A 1ML8A 3GR0A 4K0BA 1P4EC 4PROC 3GR1A 2E8FA 3DAYA 4BCAA 5FLXD 1V60A 4DUYC 5AE2A 3CQ2A 1O93A 4DR2C 1XMOC 1L2FA 2PT7G 4MH4A 2KDNA 3A4IA 2OO4A 2VZEA 4ISBA 2D1RA 2JMPA 1TH5A 2XR1A 2QL8A 2D27A 4DG9A 2D28C 3EQ6A 2BH1X 3A9VA 1O9TA 1BA3A 1JOSA 4X64C 1N33C 1MKYA 4DUZC 1ZB8A 4B3TC 5BSTA 4JI1C 5H9UA 2YWCA 2HJGA 2QVXX 1HNZC 2HHHC 2UXCC 4R1LA 5BUQA 4G1IA 3RG2A 1N34C 3ETCA 4DCTA 2MCQA 4LFCC 2E0GA 2WD9A 3FCEA 3T1HC 5LMUC 5A1GA 1HH2P 1XHJA 4JM1A 3R9XA 5LCIA 4RVOA 3CJEA 1MXBA 3UX3A 4LF5C 1M6XA 1USPB 1XRAA 4GXRA 3TDEA 1ZB9A 2OPLA 2D1TA 1XNQC 4YY3C 5T8TA 3IPLA 4AQYC 4DV6C 2YWBA 3C5EA 4GKKC 1IBMC 3K6RA 2E8CA 4JI3C 2PN2A 5E7QA 1I94C 3LUSA 4DV2C 4K0KC 2D7VA 3DLPX 2DHMA 1ULTA 4OX9C 3JAMD 1XMQC 3UOWA 4RMNA 5AE3A 2P2JA 4NDNA 1PA4A 5A19A 1VEHA 3UZ0A 5A1IA 3LGXA 1NY8A 3DHVA 2KZFA 2VQFC 4JI4C 4NXNC 4RVNA 4LF4C 3NI2A 4JI0C 1J5EC 4LE5A 1AMUA 3VNRA 3I08A 3L95X 3NPDA 1PG3A 1UWDA 3UX2A 4R0MA 4DCUA 5IT9D 3VNQA 1UKKA 5BSVA 4JI6C 4I9GA 5BSRA 3A26A 4ZLPA 4BC9A 4L4QA 2KZ0A 3UEBA 3S82A 1KKGA 1XRBA 4LF7C 1PG4A 2ATWA 1LQLA 3TQIA 4BSZA 1PU1A 2ONFA 4LF8C 4B3RC 3E7XA 1WH9A 2NCLA 2UXBC 4FTFA 4DV4C 2P2FA 1T5DX 1N32C 4DR4C 4X66C 1NYEA 1EGAA 4PUIA 1O92A 4MTNA 1MXCA 2QVYX 1USPA 3OTOC 4PUGA 4B3MC 2CXCA 5KYTA 5ADZA 4JI8C 3T1YC 1XNRC 3PROC 1WF3A 5A2QD 1QWIA 5KEIA 2UU9C 4DV1C 3ETOA 4L2ZA 4DG8A 3CQ1A 5IFIA 2D1QA 3LNOA 4FUTA 2JNVA 1IBLC 1XRCA 2E8EA 4B3SC 3N2QA 5GTDA 4I9FA 4DV3C 4RM2A 1HR0C 1N36C 4GS5A 5LMNC 3TR3A 5CZXA 3GKUA 4XX2A 4D57A 4EATA 2DYJA 2YCBA 4KHPC 3I07A 2UUAC 2PROA 4LFBC 4DR5C 4PZPA 4U5YD 4JI7C 3CQ3A 4OXIA 2M5OA 4PHTA 2CY1A 1V26A 2BJOA 2D1SA 4TPSB 3IMLA 4LF6C 5IWAC 1MD9A 4JV5C 4IR7A 2V7BA 1YJ7A 1HNXC 5BUSA 1RY2A 1N2FA 4HPVA 1O90A 2AYAA 1QM4A 2P2QA 1GPMA 4G36A 4X62C 3PBKA 2M5HA 2UXDC 2E5LC 2DPLA 4X65C 4L7IA 5CZVA 3R9WA 2ASBA 2Y4NA 4DR3C 1MXAA 2EGTA 1FUGA 5T8SA 4LF9C 4DV5C 3LAXA 3LNVA 2UUCC 5BSUA 3B7WA 4BBYA 1IBKC 4GKJC 1V25A 4DR7C 3SO4A 3NYRA 5JRHA 2OBVA 3CW9A 2F4VC 1HNWC 4DV0C 4GXQA 1FJGC 3N54B 4JI2C 1LCIA 1XS3A 4ZJZA 1T5HX 4DCVA 2UUBC 1M6XC 3AY0A 3A9UA 5AE1A 2QW0X 4RLFA 4WS9A 5BSWA 3A25A 2VQEC 4DR1C 1WCJA 4RLQA 4DR6C 1IB8A 1K0RA 2VSQA 2Y27A 2ZZNA 2MMAB 3AF5A 4KTTA 4RM3A 3PESA 5DV9A 5BSMA 5KYVA 3TUFA 5K85A
chains in the Genus database with same CATH topology
2Z51A 1VEHA 3CQ2A 3LNOA 2JNVA 1WCJA 1XHJA 3CQ3A 2M5HA 2CU6A 3CQ1A 2M5OA 3UX3A 3UX2A 1UWDA 1TH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z51 A;  1VEH A;  3CQ2 A;  3LNO A;  2JNV A;  1WCJ A;  1XHJ A;  3CQ3 A;  2M5H A;  2CU6 A;  3CQ1 A;  2M5O A;  3UX3 A;  3UX2 A;  1UWD A;  1TH5 A; 
#chains in the Genus database with same CATH topology
 3G7S A;  4NOZ A;  5BR8 C;  4D4I A;  5K8F A;  4OYC A;  3J80 D;  1RG9 A;  3VNS A;  3NYQ A;  3RV2 A;  4LFA C;  2Z51 A;  2OPL B;  3J81 D;  1MDB A;  2P02 A;  2MM9 A;  3H2T A;  3AF6 A;  3CW8 X;  4NXM C;  3KXW A;  4YHH C;  1P4E A;  2E7G A;  4JI5 C;  2CU6 A;  2P2B A;  1MDF A;  1P7L A;  2P20 A;  4DV7 C;  5BUR A;  4WV3 A;  4KTV A;  3R44 A;  4D56 A;  2Y4O A;  2ZZM A;  3IEV A;  3GPC A;  2YX1 A;  4PUH A;  3O2E A;  4DCS A;  4G37 A;  4BC7 A;  4JYA C;  1FLO A;  2WP0 C;  4R1M A;  3FCC A;  2P2M A;  2QVZ X;  3L8C A;  3EER A;  3E7W A;  3IEU A;  4FUQ A;  1VLA A;  2ZM6 C;  4D4G A;  4ODJ A;  4IZ6 A;  1ML8 A;  3GR0 A;  4K0B A;  1P4E C;  4PRO C;  3GR1 A;  2E8F A;  3DAY A;  4BCA A;  5FLX D;  1V60 A;  4DUY C;  5AE2 A;  3CQ2 A;  1O93 A;  4DR2 C;  1XMO C;  1L2F A;  2PT7 G;  4MH4 A;  2KDN A;  3A4I A;  2OO4 A;  2VZE A;  4ISB A;  2D1R A;  2JMP A;  1TH5 A;  2XR1 A;  2QL8 A;  2D27 A;  4DG9 A;  2D28 C;  3EQ6 A;  2BH1 X;  3A9V A;  1O9T A;  1BA3 A;  1JOS A;  4X64 C;  1N33 C;  1MKY A;  4DUZ C;  1ZB8 A;  4B3T C;  5BST A;  4JI1 C;  5H9U A;  2YWC A;  2HJG A;  2QVX X;  1HNZ C;  2HHH C;  2UXC C;  4R1L A;  5BUQ A;  4G1I A;  3RG2 A;  1N34 C;  3ETC A;  4DCT A;  2MCQ A;  4LFC C;  2E0G A;  2WD9 A;  3FCE A;  3T1H C;  5LMU C;  5A1G A;  1HH2 P;  1XHJ A;  4JM1 A;  3R9X A;  5LCI A;  4RVO A;  3CJE A;  1MXB A;  3UX3 A;  4LF5 C;  1M6X A;  1USP B;  1XRA A;  4GXR A;  3TDE A;  1ZB9 A;  2OPL A;  2D1T A;  1XNQ C;  4YY3 C;  5T8T A;  3IPL A;  4AQY C;  4DV6 C;  2YWB A;  3C5E A;  4GKK C;  1IBM C;  3K6R A;  2E8C A;  4JI3 C;  2PN2 A;  5E7Q A;  1I94 C;  3LUS A;  4DV2 C;  4K0K C;  2D7V A;  3DLP X;  2DHM A;  1ULT A;  4OX9 C;  3JAM D;  1XMQ C;  3UOW A;  4RMN A;  5AE3 A;  2P2J A;  4NDN A;  1PA4 A;  5A19 A;  1VEH A;  3UZ0 A;  5A1I A;  3LGX A;  1NY8 A;  3DHV A;  2KZF A;  2VQF C;  4JI4 C;  4NXN C;  4RVN A;  4LF4 C;  3NI2 A;  4JI0 C;  1J5E C;  4LE5 A;  1AMU A;  3VNR A;  3I08 A;  3L95 X;  3NPD A;  1PG3 A;  1UWD A;  3UX2 A;  4R0M A;  4DCU A;  5IT9 D;  3VNQ A;  1UKK A;  5BSV A;  4JI6 C;  4I9G A;  5BSR A;  3A26 A;  4ZLP A;  4BC9 A;  4L4Q A;  2KZ0 A;  3UEB A;  3S82 A;  1KKG A;  1XRB A;  4LF7 C;  1PG4 A;  2ATW A;  1LQL A;  3TQI A;  4BSZ A;  1PU1 A;  2ONF A;  4LF8 C;  4B3R C;  3E7X A;  1WH9 A;  2NCL A;  2UXB C;  4FTF A;  4DV4 C;  2P2F A;  1T5D X;  1N32 C;  4DR4 C;  4X66 C;  1NYE A;  1EGA A;  4PUI A;  1O92 A;  4MTN A;  1MXC A;  2QVY X;  1USP A;  3OTO C;  4PUG A;  4B3M C;  2CXC A;  5KYT A;  5ADZ A;  4JI8 C;  3T1Y C;  1XNR C;  3PRO C;  1WF3 A;  5A2Q D;  1QWI A;  5KEI A;  2UU9 C;  4DV1 C;  3ETO A;  4L2Z A;  4DG8 A;  3CQ1 A;  5IFI A;  2D1Q A;  3LNO A;  4FUT A;  2JNV A;  1IBL C;  1XRC A;  2E8E A;  4B3S C;  3N2Q A;  5GTD A;  4I9F A;  4DV3 C;  4RM2 A;  1HR0 C;  1N36 C;  4GS5 A;  5LMN C;  3TR3 A;  5CZX A;  3GKU A;  4XX2 A;  4D57 A;  4EAT A;  2DYJ A;  2YCB A;  4KHP C;  3I07 A;  2UUA C;  2PRO A;  4LFB C;  4DR5 C;  4PZP A;  4U5Y D;  4JI7 C;  3CQ3 A;  4OXI A;  2M5O A;  4PHT A;  2CY1 A;  1V26 A;  2BJO A;  2D1S A;  4TPS B;  3IML A;  4LF6 C;  5IWA C;  1MD9 A;  4JV5 C;  4IR7 A;  2V7B A;  1YJ7 A;  1HNX C;  5BUS A;  1RY2 A;  1N2F A;  4HPV A;  1O90 A;  2AYA A;  1QM4 A;  2P2Q A;  1GPM A;  4G36 A;  4X62 C;  3PBK A;  2M5H A;  2UXD C;  2E5L C;  2DPL A;  4X65 C;  4L7I A;  5CZV A;  3R9W A;  2ASB A;  2Y4N A;  4DR3 C;  1MXA A;  2EGT A;  1FUG A;  5T8S A;  4LF9 C;  4DV5 C;  3LAX A;  3LNV A;  2UUC C;  5BSU A;  3B7W A;  4BBY A;  1IBK C;  4GKJ C;  1V25 A;  4DR7 C;  3SO4 A;  3NYR A;  5JRH A;  2OBV A;  3CW9 A;  2F4V C;  1HNW C;  4DV0 C;  4GXQ A;  1FJG C;  3N54 B;  4JI2 C;  1LCI A;  1XS3 A;  4ZJZ A;  1T5H X;  4DCV A;  2UUB C;  1M6X C;  3AY0 A;  3A9U A;  5AE1 A;  2QW0 X;  4RLF A;  4WS9 A;  5BSW A;  3A25 A;  2VQE C;  4DR1 C;  1WCJ A;  4RLQ A;  4DR6 C;  1IB8 A;  1K0R A;  2VSQ A;  2Y27 A;  2ZZN A;  2MMA B;  3AF5 A;  4KTT A;  4RM3 A;  3PES A;  5DV9 A;  5BSM A;  5KYV A;  3TUF A;  5K85 A; 
#chains in the Genus database with same CATH homology
 2Z51 A;  1VEH A;  3CQ2 A;  3LNO A;  2JNV A;  1WCJ A;  1XHJ A;  3CQ3 A;  2M5H A;  2CU6 A;  3CQ1 A;  2M5O A;  3UX3 A;  3UX2 A;  1UWD A;  1TH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...