2CU6A

Crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
PLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords dTDP-4-keto-L-rhamnose reductase-related Protein
total genus 19
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2cu6A00
2JNVA 2M5OA 1WCJA 3CQ1A 1VEHA 2Z51A 1UWDA 2CU6A 2M5HA 3UX3A 3CQ2A 3LNOA 1XHJA 3UX2A 1TH5A 3CQ3A
chains in the Genus database with same CATH superfamily
4L4QA 1MXBA 5AE2A 3AF5A 4K0BA 2QVYX 5A1GA 1HNZC 2UUBC 3G7SA 2DYJA 3A9VA 3UX2A 3I08A 1LQLA 3EERA 2OPLA 4L7IA 4DCSA 4KHPC 1T5HX 4RVNA 1L2FA 4B3TC 2Y4OA 3J80D 1JOSA 4OX9C 4D57A 1PU1A 1MXAA 2AYAA 3KXWA 5BSMA 3CW9A 4R0MA 1HNWC 4PUHA 5A2QD 1MXCA 4LF5C 1N32C 3A9UA 4DV7C 5BSTA 4X65C 2NCLA 4NOZA 5K8FA 4DUZC 3NYQA 4DV3C 2P2FA 1HH2P 3FCEA 2HHHC 4G37A 3UX3A 3O2EA 4JYAC 5BUQA 4JV5C 3L95X 3JAMD 1N33C 3T1HC 4G1IA 4JI3C 1EGAA 4DV5C 2BH1X 4IZ6A 3H2TA 4DV4C 3PESA 1T5DX 2D28C 2UXDC 1QWIA 4MTNA 2M5HA 5E7QA 4I9GA 2YX1A 1YJ7A 3FCCA 3TDEA 4GKJC 4DV2C 2MMAB 1WH9A 4BCAA 4JI5C 1RY2A 2XR1A 1ULTA 2KZ0A 3PBKA 1KKGA 5H9UA 5BSRA 4DUYC 2YWCA 1MD9A 2CY1A 3SO4A 3I07A 2VZEA 3A25A 4ZLPA 4L2ZA 1GPMA 4FUTA 4B3RC 2P2MA 4RLFA 3LAXA 5IWAC 3DAYA 1K0RA 4JI6C 2JNVA 2UUCC 2P02A 3ETCA 4RM2A 4DR5C 3GKUA 3VNRA 5BUSA 4FUQA 1V25A 3CQ2A 1O93A 1QM4A 1IBKC 2WD9A 2OO4A 1ML8A 2ONFA 2F4VC 2QVZX 2Y4NA 5KYVA 1PG3A 4OXIA 2JMPA 3R44A 2D1RA 4NDNA 4X66C 5AE1A 2MCQA 4LFCC 3K6RA 1UKKA 1J5EC 2HJGA 1MKYA 3S82A 3CQ3A 4RLQA 3L8CA 3NI2A 5CZXA 1XHJA 4PHTA 4BSZA 2KZFA 2D1SA 4D56A 2PN2A 5ADZA 3VNSA 2ZM6C 1FLOA 2UXBC 4D4GA 3IEUA 4XX2A 2OBVA 4B3SC 1FJGC 3IMLA 3LNOA 3NPDA 4NXMC 3A4IA 3GPCA 4R1LA 4LE5A 2CU6A 3TR3A 2D27A 5BR8C 2P2BA 1UWDA 1XRAA 2CXCA 2ZZMA 4JI1C 1N36C 3E7XA 1VEHA 4IR7A 1RG9A 3T1YC 1O90A 3RG2A 4DR3C 4BC7A 4GKKC 2QL8A 4OYCA 2EGTA 3GR0A 4B3MC 3E7WA 3LUSA 4LF9C 2MM9A 4PROC 4HPVA 2ATWA 1O92A 4JM1A 3J81D 4LF7C 3TQIA 4YHHC 2BJOA 5K85A 4BC9A 2DPLA 3DLPX 4JI7C 1BA3A 1NYEA 1WF3A 4ISBA 2KDNA 1V26A 4MH4A 2QW0X 1XNRC 3AF6A 2M5OA 2PROA 4RM3A 4YY3C 3EQ6A 3UOWA 2UXCC 3OTOC 3R9XA 2E8FA 1FUGA 4LF8C 1XRCA 1LCIA 4DCVA 2D7VA 3VNQA 4WV3A 5A1IA 3LNVA 5BSVA 1P4EC 4PZPA 4RVOA 4ODJA 2D1QA 4GXRA 4X64C 4JI2C 2ASBA 5KEIA 5GTDA 5IFIA 4LFAC 1XNQC 5LCIA 4RMNA 3IEVA 2WP0C 5KYTA 2VSQA 4PUIA 3RV2A 3C5EA 5LMUC 2VQEC 5FLXD 4KTTA 4DG8A 1IBLC 1ZB9A 5BURA 1IB8A 3TUFA 1AMUA 2UU9C 4DCUA 1TH5A 4LF6C 5AE3A 4EATA 1IBMC 4KTVA 1USPA 4G36A 1P4EA 4I9FA 4DR7C 4DCTA 1XRBA 3R9WA 5BSWA 4U5YD 3N2QA 1I94C 3LGXA 1N34C 4AQYC 2UUAC 4D4IA 4TPSB 4DV6C 2E0GA 5DV9A 3B7WA 4JI4C 3GR1A 3AY0A 2P2QA 2D1TA 4JI0C 4DR4C 4GXQA 4K0KC 3N54B 4GS5A 2P20A 5BSUA 4ZJZA 1XMOC 2Y27A 2ZZNA 5CZVA 3CW8X 5T8SA 4FTFA 1PG4A 2YWBA 5LMNC 1M6XC 2E5LC 2P2JA 1O9TA 2QVXX 4DG9A 4LF4C 5A19A 1MDFA 2E7GA 3IPLA 4X62C 1WCJA 4LFBC 1V60A 4NXNC 2DHMA 2E8CA 3UEBA 1P7LA 1VLAA 4DR6C 1ZB8A 2V7BA 1XS3A 2Z51A 4DV0C 2E8EA 1HR0C 3DHVA 1MDBA 4JI8C 5IT9D 2OPLB 3UZ0A 3NYRA 4DV1C 2YCBA 4PUGA 4DR2C 3CQ1A 1XMQC 1N2FA 2PT7G 4R1MA 4WS9A 3CJEA 4BBYA 5T8TA 5JRHA 1USPB 1PA4A 4DR1C 1HNXC 1M6XA 3A26A 3ETOA 1NY8A 3PROC 2VQFC
chains in the Genus database with same CATH topology
2JNVA 2M5OA 1WCJA 3CQ1A 1VEHA 2Z51A 1UWDA 2CU6A 2M5HA 3UX3A 3CQ2A 3LNOA 1XHJA 3UX2A 1TH5A 3CQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNV A;  2M5O A;  1WCJ A;  3CQ1 A;  1VEH A;  2Z51 A;  1UWD A;  2CU6 A;  2M5H A;  3UX3 A;  3CQ2 A;  3LNO A;  1XHJ A;  3UX2 A;  1TH5 A;  3CQ3 A; 
#chains in the Genus database with same CATH topology
 4L4Q A;  1MXB A;  5AE2 A;  3AF5 A;  4K0B A;  2QVY X;  5A1G A;  1HNZ C;  2UUB C;  3G7S A;  2DYJ A;  3A9V A;  3UX2 A;  3I08 A;  1LQL A;  3EER A;  2OPL A;  4L7I A;  4DCS A;  4KHP C;  1T5H X;  4RVN A;  1L2F A;  4B3T C;  2Y4O A;  3J80 D;  1JOS A;  4OX9 C;  4D57 A;  1PU1 A;  1MXA A;  2AYA A;  3KXW A;  5BSM A;  3CW9 A;  4R0M A;  1HNW C;  4PUH A;  5A2Q D;  1MXC A;  4LF5 C;  1N32 C;  3A9U A;  4DV7 C;  5BST A;  4X65 C;  2NCL A;  4NOZ A;  5K8F A;  4DUZ C;  3NYQ A;  4DV3 C;  2P2F A;  1HH2 P;  3FCE A;  2HHH C;  4G37 A;  3UX3 A;  3O2E A;  4JYA C;  5BUQ A;  4JV5 C;  3L95 X;  3JAM D;  1N33 C;  3T1H C;  4G1I A;  4JI3 C;  1EGA A;  4DV5 C;  2BH1 X;  4IZ6 A;  3H2T A;  4DV4 C;  3PES A;  1T5D X;  2D28 C;  2UXD C;  1QWI A;  4MTN A;  2M5H A;  5E7Q A;  4I9G A;  2YX1 A;  1YJ7 A;  3FCC A;  3TDE A;  4GKJ C;  4DV2 C;  2MMA B;  1WH9 A;  4BCA A;  4JI5 C;  1RY2 A;  2XR1 A;  1ULT A;  2KZ0 A;  3PBK A;  1KKG A;  5H9U A;  5BSR A;  4DUY C;  2YWC A;  1MD9 A;  2CY1 A;  3SO4 A;  3I07 A;  2VZE A;  3A25 A;  4ZLP A;  4L2Z A;  1GPM A;  4FUT A;  4B3R C;  2P2M A;  4RLF A;  3LAX A;  5IWA C;  3DAY A;  1K0R A;  4JI6 C;  2JNV A;  2UUC C;  2P02 A;  3ETC A;  4RM2 A;  4DR5 C;  3GKU A;  3VNR A;  5BUS A;  4FUQ A;  1V25 A;  3CQ2 A;  1O93 A;  1QM4 A;  1IBK C;  2WD9 A;  2OO4 A;  1ML8 A;  2ONF A;  2F4V C;  2QVZ X;  2Y4N A;  5KYV A;  1PG3 A;  4OXI A;  2JMP A;  3R44 A;  2D1R A;  4NDN A;  4X66 C;  5AE1 A;  2MCQ A;  4LFC C;  3K6R A;  1UKK A;  1J5E C;  2HJG A;  1MKY A;  3S82 A;  3CQ3 A;  4RLQ A;  3L8C A;  3NI2 A;  5CZX A;  1XHJ A;  4PHT A;  4BSZ A;  2KZF A;  2D1S A;  4D56 A;  2PN2 A;  5ADZ A;  3VNS A;  2ZM6 C;  1FLO A;  2UXB C;  4D4G A;  3IEU A;  4XX2 A;  2OBV A;  4B3S C;  1FJG C;  3IML A;  3LNO A;  3NPD A;  4NXM C;  3A4I A;  3GPC A;  4R1L A;  4LE5 A;  2CU6 A;  3TR3 A;  2D27 A;  5BR8 C;  2P2B A;  1UWD A;  1XRA A;  2CXC A;  2ZZM A;  4JI1 C;  1N36 C;  3E7X A;  1VEH A;  4IR7 A;  1RG9 A;  3T1Y C;  1O90 A;  3RG2 A;  4DR3 C;  4BC7 A;  4GKK C;  2QL8 A;  4OYC A;  2EGT A;  3GR0 A;  4B3M C;  3E7W A;  3LUS A;  4LF9 C;  2MM9 A;  4PRO C;  4HPV A;  2ATW A;  1O92 A;  4JM1 A;  3J81 D;  4LF7 C;  3TQI A;  4YHH C;  2BJO A;  5K85 A;  4BC9 A;  2DPL A;  3DLP X;  4JI7 C;  1BA3 A;  1NYE A;  1WF3 A;  4ISB A;  2KDN A;  1V26 A;  4MH4 A;  2QW0 X;  1XNR C;  3AF6 A;  2M5O A;  2PRO A;  4RM3 A;  4YY3 C;  3EQ6 A;  3UOW A;  2UXC C;  3OTO C;  3R9X A;  2E8F A;  1FUG A;  4LF8 C;  1XRC A;  1LCI A;  4DCV A;  2D7V A;  3VNQ A;  4WV3 A;  5A1I A;  3LNV A;  5BSV A;  1P4E C;  4PZP A;  4RVO A;  4ODJ A;  2D1Q A;  4GXR A;  4X64 C;  4JI2 C;  2ASB A;  5KEI A;  5GTD A;  5IFI A;  4LFA C;  1XNQ C;  5LCI A;  4RMN A;  3IEV A;  2WP0 C;  5KYT A;  2VSQ A;  4PUI A;  3RV2 A;  3C5E A;  5LMU C;  2VQE C;  5FLX D;  4KTT A;  4DG8 A;  1IBL C;  1ZB9 A;  5BUR A;  1IB8 A;  3TUF A;  1AMU A;  2UU9 C;  4DCU A;  1TH5 A;  4LF6 C;  5AE3 A;  4EAT A;  1IBM C;  4KTV A;  1USP A;  4G36 A;  1P4E A;  4I9F A;  4DR7 C;  4DCT A;  1XRB A;  3R9W A;  5BSW A;  4U5Y D;  3N2Q A;  1I94 C;  3LGX A;  1N34 C;  4AQY C;  2UUA C;  4D4I A;  4TPS B;  4DV6 C;  2E0G A;  5DV9 A;  3B7W A;  4JI4 C;  3GR1 A;  3AY0 A;  2P2Q A;  2D1T A;  4JI0 C;  4DR4 C;  4GXQ A;  4K0K C;  3N54 B;  4GS5 A;  2P20 A;  5BSU A;  4ZJZ A;  1XMO C;  2Y27 A;  2ZZN A;  5CZV A;  3CW8 X;  5T8S A;  4FTF A;  1PG4 A;  2YWB A;  5LMN C;  1M6X C;  2E5L C;  2P2J A;  1O9T A;  2QVX X;  4DG9 A;  4LF4 C;  5A19 A;  1MDF A;  2E7G A;  3IPL A;  4X62 C;  1WCJ A;  4LFB C;  1V60 A;  4NXN C;  2DHM A;  2E8C A;  3UEB A;  1P7L A;  1VLA A;  4DR6 C;  1ZB8 A;  2V7B A;  1XS3 A;  2Z51 A;  4DV0 C;  2E8E A;  1HR0 C;  3DHV A;  1MDB A;  4JI8 C;  5IT9 D;  2OPL B;  3UZ0 A;  3NYR A;  4DV1 C;  2YCB A;  4PUG A;  4DR2 C;  3CQ1 A;  1XMQ C;  1N2F A;  2PT7 G;  4R1M A;  4WS9 A;  3CJE A;  4BBY A;  5T8T A;  5JRH A;  1USP B;  1PA4 A;  4DR1 C;  1HNX C;  1M6X A;  3A26 A;  3ETO A;  1NY8 A;  3PRO C;  2VQF C; 
#chains in the Genus database with same CATH homology
 2JNV A;  2M5O A;  1WCJ A;  3CQ1 A;  1VEH A;  2Z51 A;  1UWD A;  2CU6 A;  2M5H A;  3UX3 A;  3CQ2 A;  3LNO A;  1XHJ A;  3UX2 A;  1TH5 A;  3CQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...