2CU6A

Crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
PLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords dTDP-4-keto-L-rhamnose reductase-related Protein
publication title Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 19
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2cu6A00
2M5HA 3UX3A 3UX2A 1XHJA 1VEHA 2M5OA 1UWDA 2CU6A 3CQ1A 3LNOA 3CQ2A 2JNVA 1WCJA 2Z51A 1TH5A 3CQ3A
chains in the Genus database with same CATH superfamily
4LF8C 2E0GA 1FLOA 1GPMA 2OO4A 1TH5A 1RG9A 3LNOA 5BSTA 3CQ1A 4B3MC 3KXWA 3NYQA 5BSUA 5KYTA 3I08A 4ZLPA 3I07A 3NPDA 4GKKC 1MXAA 2OPLB 2QW0X 1HH2P 3IMLA 4DR3C 2M5HA 3A9UA 2VSQA 4JI1C 4PZPA 3UOWA 4OX9C 3DLPX 5CZXA 2E8CA 4BSZA 1RY2A 5A1GA 4EATA 4LFBC 2QVYX 3CW8X 2VQFC 1AMUA 4JI2C 4I9FA 3AF5A 1P4EC 4D4IA 4G1IA 1IBKC 1HR0C 5IT9D 5ADZA 1QWIA 4K0KC 4LF6C 3J81D 4DV1C 4XX2A 4NDNA 3RG2A 5IFIA 4IZ6A 2WP0C 5K85A 4BC9A 4DV0C 3A26A 4DV2C 4B3TC 2MM9A 4GKJC 3T1HC 2UUCC 2P02A 2BJOA 1YJ7A 5BUQA 5A1IA 3NYRA 3CW9A 1MXBA 1P4EA 2ZZNA 4OYCA 4L2ZA 3VNRA 1HNXC 3R9XA 4JM1A 5BURA 1T5HX 4LFAC 3TDEA 4RLQA 1XRCA 4RMNA 3IPLA 5BSMA 3LAXA 2UUAC 1O92A 1I94C 4OXIA 2E8FA 3OTOC 4DV6C 2D7VA 2P20A 2KZFA 4BBYA 1T5DX 3G7SA 4R0MA 4X62C 2UXCC 1J5EC 2JMPA 1VLAA 3UX3A 2HHHC 4LF5C 1IB8A 3FCEA 1JOSA 4MTNA 3AF6A 4JV5C 3B7WA 4JI8C 2ZM6C 2KDNA 1K0RA 4DR4C 2PT7G 1MKYA 2ONFA 2YCBA 1PG4A 4KHPC 2ASBA 4LF9C 2EGTA 2UU9C 4WS9A 3LUSA 2QL8A 1N34C 2DHMA 3GPCA 4DR6C 2Y4OA 3A4IA 3GR1A 4X64C 1UKKA 5BSWA 1O9TA 3UX2A 3TQIA 3CQ2A 3DAYA 5BSRA 1XHJA 1BA3A 2D28C 4ZJZA 2E8EA 4ISBA 3FCCA 1L2FA 2P2JA 4RM2A 5AE3A 4PUIA 2M5OA 4JI0C 4B3SC 4KTTA 3TR3A 4TPSB 2BH1X 1MDFA 3DHVA 4ODJA 1FUGA 5E7QA 4DV7C 2YWBA 2CXCA 4GS5A 1XNQC 5JRHA 1XRBA 1IBMC 3IEVA 4DUYC 4FUQA 5H9UA 2CY1A 3NI2A 2QVZX 3GR0A 4FUTA 4X66C 4R1LA 4JI6C 1N2FA 4WV3A 3J80D 1WCJA 4X65C 5A19A 2D1TA 3E7XA 4LFCC 3TUFA 3EQ6A 2F4VC 1ULTA 2OPLA 5LMUC 4KTVA 2V7BA 2MMAB 4DR2C 4NXMC 4RLFA 4DV5C 2UXDC 2P2FA 4DG9A 3AY0A 1EGAA 4YY3C 2VZEA 5K8FA 3LGXA 1WF3A 3R44A 1MD9A 4PROC 4YHHC 1VEHA 1NYEA 5CZVA 4PHTA 4JI4C 1NY8A 3R9WA 1USPA 3O2EA 4DCTA 3GKUA 3H2TA 1XRAA 5T8TA 3L8CA 2P2BA 1XMQC 4DUZC 4LE5A 3PESA 3T1YC 1ML8A 2D1QA 2D27A 4JI3C 4IR7A 3ETCA 4L4QA 2XR1A 4DR5C 2KZ0A 5A2QD 2Y4NA 2E5LC 2E7GA 2P2MA 3CQ3A 1UWDA 4GXQA 4DCUA 4HPVA 2UUBC 4NXNC 2Y27A 3A25A 1XMOC 3UEBA 3PROC 5DV9A 4U5YD 4JYAC 4B3RC 2VQEC 3IEUA 1ZB8A 1V26A 4RM3A 4D57A 3C5EA 2D1SA 1N32C 3JAMD 3N54B 1V60A 4DR7C 1MXCA 4DCSA 5BR8C 2WD9A 2QVXX 2D1RA 3S82A 1P7LA 1N33C 1XNRC 1XS3A 5GTDA 1M6XC 2DYJA 2DPLA 3SO4A 1LCIA 4DV4C 4G36A 1KKGA 2AYAA 1O93A 2UXBC 2JNVA 5IWAC 1LQLA 3N2QA 4AQYC 5BSVA 1USPB 4FTFA 1WH9A 2NCLA 3PBKA 4GXRA 3VNQA 3E7WA 3EERA 4I9GA 4G37A 4D56A 1M6XA 2PN2A 2ZZMA 5BUSA 5FLXD 5AE1A 2ATWA 3UZ0A 2P2QA 4DR1C 3CJEA 4DG8A 5LCIA 4PUGA 1PU1A 1HNZC 3A9VA 5KYVA 5AE2A 4L7IA 4PUHA 1HNWC 3VNSA 2PROA 4NOZA 4DCVA 1MDBA 1QM4A 3K6RA 5LMNC 1FJGC 1PG3A 3RV2A 4R1MA 1PA4A 1V25A 2Z51A 4BC7A 2YWCA 4LF7C 3LNVA 2YX1A 2CU6A 4RVOA 4JI7C 4JI5C 4DV3C 2HJGA 3L95X 3ETOA 2MCQA 4LF4C 2OBVA 4K0BA 4MH4A 1IBLC 5T8SA 1O90A 4D4GA 1ZB9A 4RVNA 5KEIA 1N36C 4BCAA
chains in the Genus database with same CATH topology
2M5HA 3UX3A 3UX2A 1XHJA 1VEHA 2M5OA 1UWDA 2CU6A 3CQ1A 3LNOA 3CQ2A 2JNVA 1WCJA 2Z51A 1TH5A 3CQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5H A;  3UX3 A;  3UX2 A;  1XHJ A;  1VEH A;  2M5O A;  1UWD A;  2CU6 A;  3CQ1 A;  3LNO A;  3CQ2 A;  2JNV A;  1WCJ A;  2Z51 A;  1TH5 A;  3CQ3 A; 
#chains in the Genus database with same CATH topology
 4LF8 C;  2E0G A;  1FLO A;  1GPM A;  2OO4 A;  1TH5 A;  1RG9 A;  3LNO A;  5BST A;  3CQ1 A;  4B3M C;  3KXW A;  3NYQ A;  5BSU A;  5KYT A;  3I08 A;  4ZLP A;  3I07 A;  3NPD A;  4GKK C;  1MXA A;  2OPL B;  2QW0 X;  1HH2 P;  3IML A;  4DR3 C;  2M5H A;  3A9U A;  2VSQ A;  4JI1 C;  4PZP A;  3UOW A;  4OX9 C;  3DLP X;  5CZX A;  2E8C A;  4BSZ A;  1RY2 A;  5A1G A;  4EAT A;  4LFB C;  2QVY X;  3CW8 X;  2VQF C;  1AMU A;  4JI2 C;  4I9F A;  3AF5 A;  1P4E C;  4D4I A;  4G1I A;  1IBK C;  1HR0 C;  5IT9 D;  5ADZ A;  1QWI A;  4K0K C;  4LF6 C;  3J81 D;  4DV1 C;  4XX2 A;  4NDN A;  3RG2 A;  5IFI A;  4IZ6 A;  2WP0 C;  5K85 A;  4BC9 A;  4DV0 C;  3A26 A;  4DV2 C;  4B3T C;  2MM9 A;  4GKJ C;  3T1H C;  2UUC C;  2P02 A;  2BJO A;  1YJ7 A;  5BUQ A;  5A1I A;  3NYR A;  3CW9 A;  1MXB A;  1P4E A;  2ZZN A;  4OYC A;  4L2Z A;  3VNR A;  1HNX C;  3R9X A;  4JM1 A;  5BUR A;  1T5H X;  4LFA C;  3TDE A;  4RLQ A;  1XRC A;  4RMN A;  3IPL A;  5BSM A;  3LAX A;  2UUA C;  1O92 A;  1I94 C;  4OXI A;  2E8F A;  3OTO C;  4DV6 C;  2D7V A;  2P20 A;  2KZF A;  4BBY A;  1T5D X;  3G7S A;  4R0M A;  4X62 C;  2UXC C;  1J5E C;  2JMP A;  1VLA A;  3UX3 A;  2HHH C;  4LF5 C;  1IB8 A;  3FCE A;  1JOS A;  4MTN A;  3AF6 A;  4JV5 C;  3B7W A;  4JI8 C;  2ZM6 C;  2KDN A;  1K0R A;  4DR4 C;  2PT7 G;  1MKY A;  2ONF A;  2YCB A;  1PG4 A;  4KHP C;  2ASB A;  4LF9 C;  2EGT A;  2UU9 C;  4WS9 A;  3LUS A;  2QL8 A;  1N34 C;  2DHM A;  3GPC A;  4DR6 C;  2Y4O A;  3A4I A;  3GR1 A;  4X64 C;  1UKK A;  5BSW A;  1O9T A;  3UX2 A;  3TQI A;  3CQ2 A;  3DAY A;  5BSR A;  1XHJ A;  1BA3 A;  2D28 C;  4ZJZ A;  2E8E A;  4ISB A;  3FCC A;  1L2F A;  2P2J A;  4RM2 A;  5AE3 A;  4PUI A;  2M5O A;  4JI0 C;  4B3S C;  4KTT A;  3TR3 A;  4TPS B;  2BH1 X;  1MDF A;  3DHV A;  4ODJ A;  1FUG A;  5E7Q A;  4DV7 C;  2YWB A;  2CXC A;  4GS5 A;  1XNQ C;  5JRH A;  1XRB A;  1IBM C;  3IEV A;  4DUY C;  4FUQ A;  5H9U A;  2CY1 A;  3NI2 A;  2QVZ X;  3GR0 A;  4FUT A;  4X66 C;  4R1L A;  4JI6 C;  1N2F A;  4WV3 A;  3J80 D;  1WCJ A;  4X65 C;  5A19 A;  2D1T A;  3E7X A;  4LFC C;  3TUF A;  3EQ6 A;  2F4V C;  1ULT A;  2OPL A;  5LMU C;  4KTV A;  2V7B A;  2MMA B;  4DR2 C;  4NXM C;  4RLF A;  4DV5 C;  2UXD C;  2P2F A;  4DG9 A;  3AY0 A;  1EGA A;  4YY3 C;  2VZE A;  5K8F A;  3LGX A;  1WF3 A;  3R44 A;  1MD9 A;  4PRO C;  4YHH C;  1VEH A;  1NYE A;  5CZV A;  4PHT A;  4JI4 C;  1NY8 A;  3R9W A;  1USP A;  3O2E A;  4DCT A;  3GKU A;  3H2T A;  1XRA A;  5T8T A;  3L8C A;  2P2B A;  1XMQ C;  4DUZ C;  4LE5 A;  3PES A;  3T1Y C;  1ML8 A;  2D1Q A;  2D27 A;  4JI3 C;  4IR7 A;  3ETC A;  4L4Q A;  2XR1 A;  4DR5 C;  2KZ0 A;  5A2Q D;  2Y4N A;  2E5L C;  2E7G A;  2P2M A;  3CQ3 A;  1UWD A;  4GXQ A;  4DCU A;  4HPV A;  2UUB C;  4NXN C;  2Y27 A;  3A25 A;  1XMO C;  3UEB A;  3PRO C;  5DV9 A;  4U5Y D;  4JYA C;  4B3R C;  2VQE C;  3IEU A;  1ZB8 A;  1V26 A;  4RM3 A;  4D57 A;  3C5E A;  2D1S A;  1N32 C;  3JAM D;  3N54 B;  1V60 A;  4DR7 C;  1MXC A;  4DCS A;  5BR8 C;  2WD9 A;  2QVX X;  2D1R A;  3S82 A;  1P7L A;  1N33 C;  1XNR C;  1XS3 A;  5GTD A;  1M6X C;  2DYJ A;  2DPL A;  3SO4 A;  1LCI A;  4DV4 C;  4G36 A;  1KKG A;  2AYA A;  1O93 A;  2UXB C;  2JNV A;  5IWA C;  1LQL A;  3N2Q A;  4AQY C;  5BSV A;  1USP B;  4FTF A;  1WH9 A;  2NCL A;  3PBK A;  4GXR A;  3VNQ A;  3E7W A;  3EER A;  4I9G A;  4G37 A;  4D56 A;  1M6X A;  2PN2 A;  2ZZM A;  5BUS A;  5FLX D;  5AE1 A;  2ATW A;  3UZ0 A;  2P2Q A;  4DR1 C;  3CJE A;  4DG8 A;  5LCI A;  4PUG A;  1PU1 A;  1HNZ C;  3A9V A;  5KYV A;  5AE2 A;  4L7I A;  4PUH A;  1HNW C;  3VNS A;  2PRO A;  4NOZ A;  4DCV A;  1MDB A;  1QM4 A;  3K6R A;  5LMN C;  1FJG C;  1PG3 A;  3RV2 A;  4R1M A;  1PA4 A;  1V25 A;  2Z51 A;  4BC7 A;  2YWC A;  4LF7 C;  3LNV A;  2YX1 A;  2CU6 A;  4RVO A;  4JI7 C;  4JI5 C;  4DV3 C;  2HJG A;  3L95 X;  3ETO A;  2MCQ A;  4LF4 C;  2OBV A;  4K0B A;  4MH4 A;  1IBL C;  5T8S A;  1O90 A;  4D4G A;  1ZB9 A;  4RVN A;  5KEI A;  1N36 C;  4BCA A; 
#chains in the Genus database with same CATH homology
 2M5H A;  3UX3 A;  3UX2 A;  1XHJ A;  1VEH A;  2M5O A;  1UWD A;  2CU6 A;  3CQ1 A;  3LNO A;  3CQ2 A;  2JNV A;  1WCJ A;  2Z51 A;  1TH5 A;  3CQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...