1UKKA

Structure of osmotically inducible protein c from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
140
Chain Sequence
b'PVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osmotically Inducible Protein C
publication title Crystallographic Structure and Biochemical Analysis of the Thermus thermophilus Osmotically Inducible Protein C
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 31
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ukkA00
3R9XA 4B3SC 3GKUA 4AQYC 4GKJC 2OPLA 1N32C 1XNQC 4X66C 1KKGA 1NYEA 1XMQC 1VLAA 3EERA 1N36C 3J80D 1ZB8A 4X62C 2UXDC 2ZM6C 1HR0C 2EGTA 4JI2C 1N2FA 1HH2P 1LQLA 4DR5C 4DV2C 4DUZC 1N33C 4DUYC 4LF6C 3OTOC 2ASBA 4NOZA 4DCVA 2PT7G 4MTNA 4DR3C 4JI0C 2E8EA 2ONFA 1USPB 4NXMC 4DCSA 2UUCC 4JV5C 5BR8C 2D7VA 1JOSA 1K0RA 4JI5C 1ZB9A 2UU9C 4XX2A 4K0KC 2E5LC 4DV7C 3J81D 4LF5C 4LFAC 4LF7C 2UUBC 1EGAA 4DR1C 4JI1C 1WF3A 5FLXD 3T1HC 4GKKC 4LF4C 1PA4A 3CJEA 4OX9C 4DCTA 4NXNC 4DV3C 4LFCC 2E8FA 4DV4C 2BJOA 2CY1A 1HNZC 4LF8C 1ML8A 4JI4C 1IBLC 1UKKA 1IBMC 4B3MC 4DV5C 2VQEC 2VQFC 4DV6C 4JI7C 1FJGC 3T1YC 5IT9D 1HNWC 4MH4A 2OPLB 2DYJA 4DCUA 1XMOC 2JMPA 4JI8C 2HHHC 3AF6A 3IEVA 4X65C 3AF5A 4YHHC 4DV1C 1USPA 4DR2C 4DR4C 2PN2A 3I07A 2E7GA 4B3RC 3IEUA 4X64C 3R9WA 4LFBC 1L2FA 5IWAC 1I94C 1N34C 5LMNC 4B3TC 1J5EC 1MKYA 4DV0C 2QL8A 4JYAC 4JI3C 4YY3C 2UUAC 3LUSA 2HJGA 2XR1A 2ATWA 2E8CA 4LF9C 4BSZA 2F4VC 2KZFA 4DR7C 4KHPC 5LMUC 1XNRC 1HNXC 4DR6C 1WH9A 2CXCA 2YCBA 3JAMD 1QWIA 4JI6C 2UXBC 2UXCC 1IBKC 5A2QD
chains in the Genus database with same CATH superfamily
2P20A 2KDNA 4PHTA 4RMNA 4X66C 1VLAA 3CQ2A 5H9UA 1ZB8A 4X62C 2ZM6C 1HR0C 3IPLA 1VEHA 1HH2P 2M5OA 5T8TA 4DR5C 2QVZX 5GTDA 1N33C 2OBVA 4NOZA 4DCVA 4MTNA 2QVYX 2E8EA 1PU1A 1USPB 2ZZMA 5K8FA 5BR8C 1K0RA 1ZB9A 1QM4A 4IZ6A 4FUTA 3PBKA 5BSWA 4LFAC 3EQ6A 4PUIA 1EGAA 3UX2A 4NXNC 1GPMA 1FUGA 4LF8C 1ML8A 2Y4OA 4JI4C 1IBLC 1IBMC 4B3MC 3R44A 3G7SA 2VQFC 4DV6C 5BUSA 4JI7C 3T1YC 2P2FA 4DG8A 2DYJA 1XMOC 3UEBA 3LAXA 3IEVA 1P4EA 4X65C 4YHHC 4DG9A 4DR4C 3I07A 2E7GA 4B3RC 3A25A 1L2FA 5KEIA 1I94C 4ODJA 4L7IA 1MKYA 4DV0C 1WCJA 2QL8A 4PZPA 4TPSB 2E8CA 2V7BA 2P2QA 4OXIA 4LF9C 2KZFA 5BUQA 1UWDA 4PROC 3A9UA 4DR6C 4D56A 1BA3A 3CW9A 4JI6C 2UXBC 2UXCC 1XS3A 5CZVA 3L8CA 1P7LA 2YWBA 4AQYC 3NPDA 2OPLA 1N32C 5A1GA 1XNQC 4KTTA 1MXCA 2WD9A 1KKGA 1XMQC 4RM3A 2JNVA 2P02A 1O92A 1T5HX 5DV9A 3DAYA 1MDBA 3J80D 4I9GA 2UXDC 4JI2C 4GXRA 1FLOA 2OO4A 4LF6C 2D1TA 5ADZA 3UOWA 2PT7G 4JI0C 3SO4A 4NXMC 3B7WA 3E7XA 1JOSA 3LGXA 2UU9C 1NY8A 1AMUA 2P2MA 4D57A 2E0GA 1RY2A 4JI1C 2P2BA 4LF4C 4OX9C 4LFCC 2E8FA 3A9VA 4IR7A 2BJOA 1T5DX 1TH5A 3DLPX 4K0BA 5BSVA 1M6XC 5BSUA 2Z51A 4GS5A 1MDFA 5IT9D 2P2JA 4DCUA 2M5HA 2YWCA 1MXBA 2DHMA 3AF5A 5AE1A 1USPA 4DR2C 2ZZNA 2VSQA 3IEUA 4WV3A 5E7QA 2DPLA 5LMNC 4G36A 2WP0C 1YJ7A 2NCLA 4EATA 2F4VC 4DR7C 3KXWA 5BSRA 3A4IA 5A19A 3VNSA 4WS9A 3RG2A 1QWIA 4R0MA 1IBKC 3NYRA 5AE3A 3AY0A 4B3SC 4GKJC 2QVXX 4ISBA 2QW0X 4D4IA 1O9TA 3IMLA 4R1LA 3EERA 4RLFA 4NDNA 3E7WA 2EGTA 4RLQA 3K6RA 3UX3A 3LNOA 3UZ0A 1XRAA 3GR1A 3NYQA 3CW8X 4DV2C 4KTVA 4DUYC 4BBYA 4DR3C 3GR0A 2VZEA 3PROC 2D1RA 3L95X 4BC9A 4JV5C 4JI5C 4XX2A 3VNRA 2E5LC 4DV7C 3J81D 4LF5C 4LF7C 1PG4A 2UUBC 4DR1C 4GKKC 3T1HC 3H2TA 4DCTA 4DV3C 4DV4C 2CY1A 3GPCA 3FCCA 3ETCA 2D27A 3VNQA 3CQ1A 4PUHA 3S82A 2Y4NA 1MD9A 1FJGC 2MCQA 1MXAA 5JRHA 1HNWC 4MH4A 4PUGA 4R1MA 3O2EA 3FCEA 2JMPA 4DV1C 4FUQA 2PN2A 4X64C 5A1IA 3R9WA 5BSTA 4B3TC 1XRBA 4L4QA 4YY3C 2UUAC 3LUSA 2HJGA 2XR1A 5LCIA 5BSMA 2CU6A 2ATWA 2PROA 1P4EC 5IFIA 1V60A 3PESA 5LMUC 5KYTA 2CXCA 2YCBA 3JAMD 4I9FA 1O93A 1RG9A 1IB8A 5A2QD 3R9XA 3N54B 3GKUA 1O90A 3N2QA 1NYEA 4LE5A 1N36C 2AYAA 2KZ0A 4D4GA 4RVOA 4L2ZA 3LNVA 1N2FA 1LQLA 1V25A 4DUZC 2ASBA 3OTOC 3A26A 2ONFA 4ZLPA 3TQIA 2MM9A 4DCSA 2UUCC 5CZXA 3C5EA 5K85A 2D7VA 1M6XA 3TUFA 2D28C 5T8SA 1XRCA 4K0KC 4ZJZA 3DHVA 1WF3A 5FLXD 1PA4A 3TDEA 2Y27A 3CJEA 1XHJA 4U5YD 2D1QA 1HNZC 1V26A 4GXQA 4OYCA 1PG3A 5BURA 1UKKA 3ETOA 4DV5C 2VQEC 4G1IA 3NI2A 2YX1A 2OPLB 4JI8C 2HHHC 4FTFA 3AF6A 1LCIA 1ULTA 4BC7A 5AE2A 4JM1A 4BCAA 4LFBC 5IWAC 1N34C 1J5EC 5KYVA 4JYAC 4JI3C 2D1SA 4RVNA 3TR3A 4HPVA 4BSZA 4KHPC 4RM2A 4G37A 1XNRC 2MMAB 3CQ3A 1HNXC 3I08A 1WH9A 2BH1X 3RV2A
chains in the Genus database with same CATH topology
2P20A 4PHTA 4RMNA 4X66C 1VLAA 5H9UA 1ZB8A 4X62C 2ZM6C 1HR0C 3IPLA 1HH2P 5T8TA 4DR5C 2QVZX 5GTDA 1N33C 2OBVA 4NOZA 4DCVA 4MTNA 2QVYX 2E8EA 1USPB 5K8FA 5BR8C 1K0RA 1ZB9A 1QM4A 4IZ6A 4FUTA 3PBKA 5BSWA 4LFAC 3EQ6A 1EGAA 4NXNC 1GPMA 1FUGA 4LF8C 1ML8A 2Y4OA 4JI4C 1IBLC 1IBMC 4B3MC 3R44A 3G7SA 2VQFC 4DV6C 5BUSA 4JI7C 3T1YC 2P2FA 4DG8A 2DYJA 1XMOC 3LAXA 3IEVA 4X65C 4YHHC 4DG9A 4DR4C 3I07A 2E7GA 4B3RC 1L2FA 5KEIA 1I94C 4ODJA 4L7IA 1MKYA 4DV0C 2QL8A 4PZPA 4TPSB 2E8CA 2V7BA 2P2QA 4OXIA 4LF9C 2KZFA 5BUQA 4PROC 3A9UA 4DR6C 4D56A 1BA3A 3CW9A 4JI6C 2UXBC 2UXCC 5CZVA 3L8CA 1P7LA 2YWBA 4AQYC 3NPDA 2OPLA 1N32C 5A1GA 1XNQC 4KTTA 1MXCA 2WD9A 1KKGA 1XMQC 4RM3A 2P02A 1O92A 1T5HX 5DV9A 3DAYA 1MDBA 3J80D 4I9GA 2UXDC 4JI2C 4GXRA 2OO4A 4LF6C 2D1TA 5ADZA 3UOWA 2PT7G 4JI0C 3SO4A 4NXMC 3B7WA 3E7XA 1JOSA 3LGXA 2UU9C 1AMUA 2P2MA 4D57A 2E0GA 1RY2A 4JI1C 2P2BA 4LF4C 4OX9C 4LFCC 2E8FA 3A9VA 4IR7A 2BJOA 1T5DX 3DLPX 5BSVA 4K0BA 5BSUA 4GS5A 1MDFA 5IT9D 2P2JA 4DCUA 2YWCA 1MXBA 3AF5A 5AE1A 1USPA 4DR2C 2VSQA 3IEUA 4WV3A 5E7QA 2DPLA 5LMNC 4G36A 2WP0C 1YJ7A 4EATA 2F4VC 4DR7C 3KXWA 5BSRA 3A4IA 5A19A 3VNSA 4WS9A 3RG2A 1QWIA 4R0MA 1IBKC 3NYRA 5AE3A 4B3SC 4GKJC 2QVXX 4ISBA 2QW0X 4D4IA 1O9TA 3IMLA 4R1LA 3EERA 4RLFA 4NDNA 3E7WA 2EGTA 4RLQA 3UZ0A 1XRAA 3GR1A 3NYQA 3CW8X 4DV2C 4KTVA 4DUYC 4BBYA 4DR3C 3GR0A 2VZEA 3PROC 2D1RA 3L95X 4BC9A 4JV5C 4JI5C 4XX2A 3VNRA 2E5LC 4DV7C 3J81D 4LF5C 4LF7C 1PG4A 2UUBC 4DR1C 4GKKC 3T1HC 3H2TA 4DCTA 4DV3C 4DV4C 2CY1A 3GPCA 3FCCA 3ETCA 2D27A 3VNQA 3S82A 2Y4NA 1MD9A 1FJGC 5JRHA 1MXAA 1HNWC 4MH4A 4R1MA 3FCEA 2JMPA 4DV1C 4FUQA 2PN2A 4X64C 5A1IA 3R9WA 5BSTA 4B3TC 1XRBA 4L4QA 4YY3C 2UUAC 3LUSA 2HJGA 2XR1A 5BSMA 2ATWA 2PROA 5IFIA 3PESA 5LMUC 5KYTA 2CXCA 2YCBA 3JAMD 4I9FA 1O93A 1RG9A 5A2QD 3R9XA 3N54B 3GKUA 1O90A 3N2QA 1NYEA 4LE5A 1N36C 2AYAA 4D4GA 4RVOA 4L2ZA 3LNVA 1N2FA 1LQLA 1V25A 4DUZC 2ASBA 3OTOC 2ONFA 4ZLPA 3TQIA 4DCSA 2UUCC 5CZXA 3C5EA 5K85A 2D7VA 3TUFA 2D28C 5T8SA 1XRCA 4K0KC 4ZJZA 3DHVA 1WF3A 5FLXD 1PA4A 3TDEA 2Y27A 3CJEA 4U5YD 2D1QA 1HNZC 1V26A 4GXQA 4OYCA 1PG3A 5BURA 1UKKA 3ETOA 4DV5C 2VQEC 4G1IA 3NI2A 2OPLB 4JI8C 2HHHC 4FTFA 3AF6A 1LCIA 1ULTA 4BC7A 5AE2A 4JM1A 4BCAA 4LFBC 5IWAC 1N34C 1J5EC 5KYVA 4JYAC 4JI3C 2D1SA 4RVNA 4HPVA 4BSZA 4KHPC 4RM2A 4G37A 1XNRC 1HNXC 3I08A 1WH9A 2BH1X 3RV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R9X A;  4B3S C;  3GKU A;  4AQY C;  4GKJ C;  2OPL A;  1N32 C;  1XNQ C;  4X66 C;  1KKG A;  1NYE A;  1XMQ C;  1VLA A;  3EER A;  1N36 C;  3J80 D;  1ZB8 A;  4X62 C;  2UXD C;  2ZM6 C;  1HR0 C;  2EGT A;  4JI2 C;  1N2F A;  1HH2 P;  1LQL A;  4DR5 C;  4DV2 C;  4DUZ C;  1N33 C;  4DUY C;  4LF6 C;  3OTO C;  2ASB A;  4NOZ A;  4DCV A;  2PT7 G;  4MTN A;  4DR3 C;  4JI0 C;  2E8E A;  2ONF A;  1USP B;  4NXM C;  4DCS A;  2UUC C;  4JV5 C;  5BR8 C;  2D7V A;  1JOS A;  1K0R A;  4JI5 C;  1ZB9 A;  2UU9 C;  4XX2 A;  4K0K C;  2E5L C;  4DV7 C;  3J81 D;  4LF5 C;  4LFA C;  4LF7 C;  2UUB C;  1EGA A;  4DR1 C;  4JI1 C;  1WF3 A;  5FLX D;  3T1H C;  4GKK C;  4LF4 C;  1PA4 A;  3CJE A;  4OX9 C;  4DCT A;  4NXN C;  4DV3 C;  4LFC C;  2E8F A;  4DV4 C;  2BJO A;  2CY1 A;  1HNZ C;  4LF8 C;  1ML8 A;  4JI4 C;  1IBL C;  1UKK A;  1IBM C;  4B3M C;  4DV5 C;  2VQE C;  2VQF C;  4DV6 C;  4JI7 C;  1FJG C;  3T1Y C;  5IT9 D;  1HNW C;  4MH4 A;  2OPL B;  2DYJ A;  4DCU A;  1XMO C;  2JMP A;  4JI8 C;  2HHH C;  3AF6 A;  3IEV A;  4X65 C;  3AF5 A;  4YHH C;  4DV1 C;  1USP A;  4DR2 C;  4DR4 C;  2PN2 A;  3I07 A;  2E7G A;  4B3R C;  3IEU A;  4X64 C;  3R9W A;  4LFB C;  1L2F A;  5IWA C;  1I94 C;  1N34 C;  5LMN C;  4B3T C;  1J5E C;  1MKY A;  4DV0 C;  2QL8 A;  4JYA C;  4JI3 C;  4YY3 C;  2UUA C;  3LUS A;  2HJG A;  2XR1 A;  2ATW A;  2E8C A;  4LF9 C;  4BSZ A;  2F4V C;  2KZF A;  4DR7 C;  4KHP C;  5LMU C;  1XNR C;  1HNX C;  4DR6 C;  1WH9 A;  2CXC A;  2YCB A;  3JAM D;  1QWI A;  4JI6 C;  2UXB C;  2UXC C;  1IBK C;  5A2Q D; 
#chains in the Genus database with same CATH topology
 2P20 A;  2KDN A;  4PHT A;  4RMN A;  4X66 C;  1VLA A;  3CQ2 A;  5H9U A;  1ZB8 A;  4X62 C;  2ZM6 C;  1HR0 C;  3IPL A;  1VEH A;  1HH2 P;  2M5O A;  5T8T A;  4DR5 C;  2QVZ X;  5GTD A;  1N33 C;  2OBV A;  4NOZ A;  4DCV A;  4MTN A;  2QVY X;  2E8E A;  1PU1 A;  1USP B;  2ZZM A;  5K8F A;  5BR8 C;  1K0R A;  1ZB9 A;  1QM4 A;  4IZ6 A;  4FUT A;  3PBK A;  5BSW A;  4LFA C;  3EQ6 A;  4PUI A;  1EGA A;  3UX2 A;  4NXN C;  1GPM A;  1FUG A;  4LF8 C;  1ML8 A;  2Y4O A;  4JI4 C;  1IBL C;  1IBM C;  4B3M C;  3R44 A;  3G7S A;  2VQF C;  4DV6 C;  5BUS A;  4JI7 C;  3T1Y C;  2P2F A;  4DG8 A;  2DYJ A;  1XMO C;  3UEB A;  3LAX A;  3IEV A;  1P4E A;  4X65 C;  4YHH C;  4DG9 A;  4DR4 C;  3I07 A;  2E7G A;  4B3R C;  3A25 A;  1L2F A;  5KEI A;  1I94 C;  4ODJ A;  4L7I A;  1MKY A;  4DV0 C;  1WCJ A;  2QL8 A;  4PZP A;  4TPS B;  2E8C A;  2V7B A;  2P2Q A;  4OXI A;  4LF9 C;  2KZF A;  5BUQ A;  1UWD A;  4PRO C;  3A9U A;  4DR6 C;  4D56 A;  1BA3 A;  3CW9 A;  4JI6 C;  2UXB C;  2UXC C;  1XS3 A;  5CZV A;  3L8C A;  1P7L A;  2YWB A;  4AQY C;  3NPD A;  2OPL A;  1N32 C;  5A1G A;  1XNQ C;  4KTT A;  1MXC A;  2WD9 A;  1KKG A;  1XMQ C;  4RM3 A;  2JNV A;  2P02 A;  1O92 A;  1T5H X;  5DV9 A;  3DAY A;  1MDB A;  3J80 D;  4I9G A;  2UXD C;  4JI2 C;  4GXR A;  1FLO A;  2OO4 A;  4LF6 C;  2D1T A;  5ADZ A;  3UOW A;  2PT7 G;  4JI0 C;  3SO4 A;  4NXM C;  3B7W A;  3E7X A;  1JOS A;  3LGX A;  2UU9 C;  1NY8 A;  1AMU A;  2P2M A;  4D57 A;  2E0G A;  1RY2 A;  4JI1 C;  2P2B A;  4LF4 C;  4OX9 C;  4LFC C;  2E8F A;  3A9V A;  4IR7 A;  2BJO A;  1T5D X;  1TH5 A;  3DLP X;  4K0B A;  5BSV A;  1M6X C;  5BSU A;  2Z51 A;  4GS5 A;  1MDF A;  5IT9 D;  2P2J A;  4DCU A;  2M5H A;  2YWC A;  1MXB A;  2DHM A;  3AF5 A;  5AE1 A;  1USP A;  4DR2 C;  2ZZN A;  2VSQ A;  3IEU A;  4WV3 A;  5E7Q A;  2DPL A;  5LMN C;  4G36 A;  2WP0 C;  1YJ7 A;  2NCL A;  4EAT A;  2F4V C;  4DR7 C;  3KXW A;  5BSR A;  3A4I A;  5A19 A;  3VNS A;  4WS9 A;  3RG2 A;  1QWI A;  4R0M A;  1IBK C;  3NYR A;  5AE3 A;  3AY0 A;  4B3S C;  4GKJ C;  2QVX X;  4ISB A;  2QW0 X;  4D4I A;  1O9T A;  3IML A;  4R1L A;  3EER A;  4RLF A;  4NDN A;  3E7W A;  2EGT A;  4RLQ A;  3K6R A;  3UX3 A;  3LNO A;  3UZ0 A;  1XRA A;  3GR1 A;  3NYQ A;  3CW8 X;  4DV2 C;  4KTV A;  4DUY C;  4BBY A;  4DR3 C;  3GR0 A;  2VZE A;  3PRO C;  2D1R A;  3L95 X;  4BC9 A;  4JV5 C;  4JI5 C;  4XX2 A;  3VNR A;  2E5L C;  4DV7 C;  3J81 D;  4LF5 C;  4LF7 C;  1PG4 A;  2UUB C;  4DR1 C;  4GKK C;  3T1H C;  3H2T A;  4DCT A;  4DV3 C;  4DV4 C;  2CY1 A;  3GPC A;  3FCC A;  3ETC A;  2D27 A;  3VNQ A;  3CQ1 A;  4PUH A;  3S82 A;  2Y4N A;  1MD9 A;  1FJG C;  2MCQ A;  1MXA A;  5JRH A;  1HNW C;  4MH4 A;  4PUG A;  4R1M A;  3O2E A;  3FCE A;  2JMP A;  4DV1 C;  4FUQ A;  2PN2 A;  4X64 C;  5A1I A;  3R9W A;  5BST A;  4B3T C;  1XRB A;  4L4Q A;  4YY3 C;  2UUA C;  3LUS A;  2HJG A;  2XR1 A;  5LCI A;  5BSM A;  2CU6 A;  2ATW A;  2PRO A;  1P4E C;  5IFI A;  1V60 A;  3PES A;  5LMU C;  5KYT A;  2CXC A;  2YCB A;  3JAM D;  4I9F A;  1O93 A;  1RG9 A;  1IB8 A;  5A2Q D;  3R9X A;  3N54 B;  3GKU A;  1O90 A;  3N2Q A;  1NYE A;  4LE5 A;  1N36 C;  2AYA A;  2KZ0 A;  4D4G A;  4RVO A;  4L2Z A;  3LNV A;  1N2F A;  1LQL A;  1V25 A;  4DUZ C;  2ASB A;  3OTO C;  3A26 A;  2ONF A;  4ZLP A;  3TQI A;  2MM9 A;  4DCS A;  2UUC C;  5CZX A;  3C5E A;  5K85 A;  2D7V A;  1M6X A;  3TUF A;  2D28 C;  5T8S A;  1XRC A;  4K0K C;  4ZJZ A;  3DHV A;  1WF3 A;  5FLX D;  1PA4 A;  3TDE A;  2Y27 A;  3CJE A;  1XHJ A;  4U5Y D;  2D1Q A;  1HNZ C;  1V26 A;  4GXQ A;  4OYC A;  1PG3 A;  5BUR A;  1UKK A;  3ETO A;  4DV5 C;  2VQE C;  4G1I A;  3NI2 A;  2YX1 A;  2OPL B;  4JI8 C;  2HHH C;  4FTF A;  3AF6 A;  1LCI A;  1ULT A;  4BC7 A;  5AE2 A;  4JM1 A;  4BCA A;  4LFB C;  5IWA C;  1N34 C;  1J5E C;  5KYV A;  4JYA C;  4JI3 C;  2D1S A;  4RVN A;  3TR3 A;  4HPV A;  4BSZ A;  4KHP C;  4RM2 A;  4G37 A;  1XNR C;  2MMA B;  3CQ3 A;  1HNX C;  3I08 A;  1WH9 A;  2BH1 X;  3RV2 A; 
#chains in the Genus database with same CATH homology
 2P20 A;  4PHT A;  4RMN A;  4X66 C;  1VLA A;  5H9U A;  1ZB8 A;  4X62 C;  2ZM6 C;  1HR0 C;  3IPL A;  1HH2 P;  5T8T A;  4DR5 C;  2QVZ X;  5GTD A;  1N33 C;  2OBV A;  4NOZ A;  4DCV A;  4MTN A;  2QVY X;  2E8E A;  1USP B;  5K8F A;  5BR8 C;  1K0R A;  1ZB9 A;  1QM4 A;  4IZ6 A;  4FUT A;  3PBK A;  5BSW A;  4LFA C;  3EQ6 A;  1EGA A;  4NXN C;  1GPM A;  1FUG A;  4LF8 C;  1ML8 A;  2Y4O A;  4JI4 C;  1IBL C;  1IBM C;  4B3M C;  3R44 A;  3G7S A;  2VQF C;  4DV6 C;  5BUS A;  4JI7 C;  3T1Y C;  2P2F A;  4DG8 A;  2DYJ A;  1XMO C;  3LAX A;  3IEV A;  4X65 C;  4YHH C;  4DG9 A;  4DR4 C;  3I07 A;  2E7G A;  4B3R C;  1L2F A;  5KEI A;  1I94 C;  4ODJ A;  4L7I A;  1MKY A;  4DV0 C;  2QL8 A;  4PZP A;  4TPS B;  2E8C A;  2V7B A;  2P2Q A;  4OXI A;  4LF9 C;  2KZF A;  5BUQ A;  4PRO C;  3A9U A;  4DR6 C;  4D56 A;  1BA3 A;  3CW9 A;  4JI6 C;  2UXB C;  2UXC C;  5CZV A;  3L8C A;  1P7L A;  2YWB A;  4AQY C;  3NPD A;  2OPL A;  1N32 C;  5A1G A;  1XNQ C;  4KTT A;  1MXC A;  2WD9 A;  1KKG A;  1XMQ C;  4RM3 A;  2P02 A;  1O92 A;  1T5H X;  5DV9 A;  3DAY A;  1MDB A;  3J80 D;  4I9G A;  2UXD C;  4JI2 C;  4GXR A;  2OO4 A;  4LF6 C;  2D1T A;  5ADZ A;  3UOW A;  2PT7 G;  4JI0 C;  3SO4 A;  4NXM C;  3B7W A;  3E7X A;  1JOS A;  3LGX A;  2UU9 C;  1AMU A;  2P2M A;  4D57 A;  2E0G A;  1RY2 A;  4JI1 C;  2P2B A;  4LF4 C;  4OX9 C;  4LFC C;  2E8F A;  3A9V A;  4IR7 A;  2BJO A;  1T5D X;  3DLP X;  5BSV A;  4K0B A;  5BSU A;  4GS5 A;  1MDF A;  5IT9 D;  2P2J A;  4DCU A;  2YWC A;  1MXB A;  3AF5 A;  5AE1 A;  1USP A;  4DR2 C;  2VSQ A;  3IEU A;  4WV3 A;  5E7Q A;  2DPL A;  5LMN C;  4G36 A;  2WP0 C;  1YJ7 A;  4EAT A;  2F4V C;  4DR7 C;  3KXW A;  5BSR A;  3A4I A;  5A19 A;  3VNS A;  4WS9 A;  3RG2 A;  1QWI A;  4R0M A;  1IBK C;  3NYR A;  5AE3 A;  4B3S C;  4GKJ C;  2QVX X;  4ISB A;  2QW0 X;  4D4I A;  1O9T A;  3IML A;  4R1L A;  3EER A;  4RLF A;  4NDN A;  3E7W A;  2EGT A;  4RLQ A;  3UZ0 A;  1XRA A;  3GR1 A;  3NYQ A;  3CW8 X;  4DV2 C;  4KTV A;  4DUY C;  4BBY A;  4DR3 C;  3GR0 A;  2VZE A;  3PRO C;  2D1R A;  3L95 X;  4BC9 A;  4JV5 C;  4JI5 C;  4XX2 A;  3VNR A;  2E5L C;  4DV7 C;  3J81 D;  4LF5 C;  4LF7 C;  1PG4 A;  2UUB C;  4DR1 C;  4GKK C;  3T1H C;  3H2T A;  4DCT A;  4DV3 C;  4DV4 C;  2CY1 A;  3GPC A;  3FCC A;  3ETC A;  2D27 A;  3VNQ A;  3S82 A;  2Y4N A;  1MD9 A;  1FJG C;  5JRH A;  1MXA A;  1HNW C;  4MH4 A;  4R1M A;  3FCE A;  2JMP A;  4DV1 C;  4FUQ A;  2PN2 A;  4X64 C;  5A1I A;  3R9W A;  5BST A;  4B3T C;  1XRB A;  4L4Q A;  4YY3 C;  2UUA C;  3LUS A;  2HJG A;  2XR1 A;  5BSM A;  2ATW A;  2PRO A;  5IFI A;  3PES A;  5LMU C;  5KYT A;  2CXC A;  2YCB A;  3JAM D;  4I9F A;  1O93 A;  1RG9 A;  5A2Q D;  3R9X A;  3N54 B;  3GKU A;  1O90 A;  3N2Q A;  1NYE A;  4LE5 A;  1N36 C;  2AYA A;  4D4G A;  4RVO A;  4L2Z A;  3LNV A;  1N2F A;  1LQL A;  1V25 A;  4DUZ C;  2ASB A;  3OTO C;  2ONF A;  4ZLP A;  3TQI A;  4DCS A;  2UUC C;  5CZX A;  3C5E A;  5K85 A;  2D7V A;  3TUF A;  2D28 C;  5T8S A;  1XRC A;  4K0K C;  4ZJZ A;  3DHV A;  1WF3 A;  5FLX D;  1PA4 A;  3TDE A;  2Y27 A;  3CJE A;  4U5Y D;  2D1Q A;  1HNZ C;  1V26 A;  4GXQ A;  4OYC A;  1PG3 A;  5BUR A;  1UKK A;  3ETO A;  4DV5 C;  2VQE C;  4G1I A;  3NI2 A;  2OPL B;  4JI8 C;  2HHH C;  4FTF A;  3AF6 A;  1LCI A;  1ULT A;  4BC7 A;  5AE2 A;  4JM1 A;  4BCA A;  4LFB C;  5IWA C;  1N34 C;  1J5E C;  5KYV A;  4JYA C;  4JI3 C;  2D1S A;  4RVN A;  4HPV A;  4BSZ A;  4KHP C;  4RM2 A;  4G37 A;  1XNR C;  1HNX C;  3I08 A;  1WH9 A;  2BH1 X;  3RV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...