1UKKA

Structure of osmotically inducible protein c from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
140
Chain Sequence
PVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osmotically Inducible Protein C
publication title Crystallographic Structure and Biochemical Analysis of the Thermus thermophilus Osmotically Inducible Protein C
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 31
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ukkA00
4LF4C 3GKUA 1KKGA 2EGTA 3AF5A 2UU9C 4JI2C 4NXMC 4DUYC 2D7VA 2KZFA 2E8CA 4DR3C 3JAMD 4DV4C 4LF8C 4B3TC 1N33C 4X62C 4JV5C 4LFCC 1EGAA 2E5LC 4DCSA 4B3RC 4JI8C 4GKJC 1PA4A 2UUAC 3T1YC 1I94C 2BJOA 4NOZA 4DR4C 2ATWA 1FJGC 1WF3A 4K0KC 5FLXD 4AQYC 2UXBC 4DCUA 4B3MC 4X64C 4DV2C 4JYAC 4YY3C 4X66C 4LF5C 2YCBA 3IEVA 4JI3C 3R9WA 1USPB 2HHHC 4JI7C 3EERA 2OPLA 1HNZC 3OTOC 4DR1C 4OX9C 1UKKA 3J81D 1HNXC 4XX2A 1N34C 5IWAC 1ZB8A 2HJGA 4DV0C 4DV6C 4JI0C 4DUZC 4LF7C 1L2FA 2XR1A 4JI6C 2JMPA 4DCTA 1K0RA 2E8EA 3T1HC 1WH9A 4LF9C 4DR2C 2UXCC 5LMNC 1LQLA 3CJEA 1HH2P 4YHHC 4KHPC 2E8FA 4DV5C 1IBKC 4LFAC 4DR7C 4LFBC 1HNWC 1N36C 2PT7G 2UUBC 5IT9D 4MTNA 4DR5C 4BSZA 1MKYA 1N2FA 2QL8A 1USPA 4NXNC 4DV3C 2F4VC 4JI4C 4DV7C 1XNRC 1XMOC 1IBLC 4B3SC 4GKKC 2ASBA 4DCVA 5A2QD 1ZB9A 2VQEC 2DYJA 1XNQC 1QWIA 4JI5C 1ML8A 1HR0C 3IEUA 1XMQC 3LUSA 1N32C 1JOSA 2PN2A 2CXCA 2VQFC 1NYEA 4DV1C 2UXDC 4DR6C 3I07A 3R9XA 4MH4A 4JI1C 2ONFA 1J5EC 5LMUC 5BR8C 3J80D 2UUCC 4X65C 2CY1A 4LF6C 2OPLB 1IBMC 1VLAA 2ZM6C 2E7GA 3AF6A
chains in the Genus database with same CATH superfamily
4BC7A 4D56A 1LCIA 4NXMC 4PROC 2D1SA 2QVYX 2KZFA 3A4IA 4DR3C 3AY0A 1PA4A 2UUAC 2D1TA 3KXWA 4DR4C 3VNRA 1WF3A 4K0KC 4ODJA 4DCUA 4DV2C 3CW9A 4R0MA 3CQ1A 3EERA 4D4GA 1UKKA 1YJ7A 3J81D 4TPSB 4FUQA 1BA3A 4U5YD 4RLQA 3R44A 4LF7C 3RV2A 4JI6C 5DV9A 2MCQA 2JMPA 4DCTA 3E7XA 2E0GA 5LCIA 1V25A 4DR2C 1LQLA 2DHMA 3ETOA 2D27A 2QVZX 1P7LA 4DV5C 3LGXA 1N36C 4MTNA 4PUIA 4I9GA 5IFIA 4DV3C 5A1GA 4JI4C 4DV7C 1XNRC 1O93A 4RVNA 4GKKC 5A1IA 1O9TA 3G7SA 3LNOA 1ZB9A 2NCLA 2P02A 3CQ3A 1QWIA 4L2ZA 4JI5C 1ULTA 5BSVA 1ML8A 1HR0C 3A26A 1XMQC 3LUSA 2KDNA 4OYCA 2CXCA 4KTTA 4G1IA 2CU6A 2JNVA 3A25A 2UXDC 4BCAA 3PBKA 5LMUC 3VNQA 5BR8C 4ISBA 5E7QA 3J80D 2UUCC 4LF6C 1IBMC 4PUGA 4LF4C 3AF5A 4JI2C 1WCJA 1MXBA 4DUYC 2QW0X 3GPCA 1T5DX 1FUGA 4WV3A 3K6RA 4X62C 4LFCC 4BBYA 3A9UA 4IZ6A 3A9VA 5BSWA 1I94C 2BJOA 4B3MC 4LF5C 4X66C 2YCBA 1MXAA 4JI3C 4GXRA 2HHHC 1M6XA 4DR1C 4EATA 2M5HA 3GR0A 1V60A 1N34C 1MDFA 5IWAC 2V7BA 1L2FA 2OBVA 1UWDA 1K0RA 2E8EA 4FUTA 3T1HC 2MMAB 5BSRA 2YWBA 1WH9A 3FCCA 3E7WA 4RM3A 5LMNC 5T8TA 3UX2A 2YWCA 1IBKC 5CZVA 4LFBC 4WS9A 1HNWC 3ETCA 3C5EA 2ZZMA 4DR5C 3IPLA 1MKYA 1USPA 1IB8A 2F4VC 1PG3A 4DG8A 2Y27A 1XMOC 2Y4NA 4DCVA 5BSTA 3CW8X 1P4EA 4IR7A 3PESA 1XS3A 4DR6C 4L7IA 2P2QA 3I07A 5AE2A 4GS5A 1J5EC 1VEHA 2PROA 2VSQA 3VNSA 4JM1A 3GKUA 2EGTA 4I9FA 3UX3A 5KYVA 2D7VA 1PG4A 4LF8C 3TDEA 4NDNA 2E5LC 2D28C 4DCSA 4B3RC 4ZLPA 3FCEA 4GKJC 3T1YC 4OXIA 3EQ6A 3CQ2A 3L95X 4JYAC 4X64C 4YY3C 5K85A 3IEVA 3R9WA 1USPB 4L4QA 3O2EA 2OPLA 3OTOC 1HNXC 1M6XC 3H2TA 5KYTA 3I08A 4XX2A 2YX1A 3TUFA 5BSUA 1ZB8A 3UOWA 4DV6C 2P2JA 1V26A 4D57A 5K8FA 1TH5A 1MXCA 1RY2A 5BUSA 2E8FA 2OO4A 4LFAC 4DR7C 2PT7G 2UUBC 4RVOA 5IT9D 3N2QA 3NI2A 3UZ0A 2Z51A 1IBLC 3SO4A 4DG9A 4B3SC 5A2QD 3DAYA 3TQIA 4G36A 5BURA 3UEBA 3S82A 1XRBA 2AYAA 4RM2A 1FLOA 3LAXA 2PN2A 1PU1A 1GPMA 1NYEA 3GR1A 4DV1C 3R9XA 4MH4A 1P4EC 4JI1C 1O90A 5ADZA 4PUHA 4RLFA 3NPDA 2P2MA 1MDBA 2OPLB 1VLAA 3RG2A 1XHJA 1KKGA 2UU9C 2Y4OA 4FTFA 4G37A 2E8CA 2P2FA 5CZXA 3JAMD 4DV4C 4LE5A 3DLPX 4B3TC 1N33C 4JV5C 4GXQA 5BSMA 1EGAA 5KEIA 2M5OA 2VZEA 3PROC 4JI8C 4R1LA 2ZZNA 3IMLA 2BH1X 4K0BA 4NOZA 2ATWA 1FJGC 5FLXD 4AQYC 4ZJZA 4D4IA 2UXBC 2P20A 3NYRA 5JRHA 4JI7C 5T8SA 1HNZC 4OX9C 2KZ0A 1RG9A 3AF6A 5A19A 1XRAA 3LNVA 2WD9A 4BC9A 4RMNA 2HJGA 4DV0C 4JI0C 3NYQA 4DUZC 3B7WA 2XR1A 4HPVA 1XRCA 1T5HX 2DPLA 3DHVA 4PHTA 4LF9C 2WP0C 2UXCC 5AE3A 3CJEA 4KHPC 1HH2P 4YHHC 4KTVA 1QM4A 1O92A 5BUQA 2D1QA 2MM9A 4BSZA 1N2FA 2QL8A 2P2BA 4NXNC 3N54B 3TR3A 3L8CA 2ASBA 2D1RA 4PZPA 2VQEC 2DYJA 1XNQC 5GTDA 3IEUA 1N32C 1JOSA 1NY8A 5AE1A 2VQFC 2ONFA 5H9UA 4R1MA 1MD9A 1AMUA 4X65C 2CY1A 2ZM6C 2E7GA 2QVXX
chains in the Genus database with same CATH topology
4BC7A 4D56A 1LCIA 4NXMC 4PROC 2D1SA 2QVYX 2KZFA 3A4IA 4DR3C 1PA4A 2UUAC 2D1TA 3KXWA 4DR4C 3VNRA 1WF3A 4K0KC 4ODJA 4DCUA 4DV2C 3CW9A 4R0MA 3EERA 4D4GA 1UKKA 1YJ7A 3J81D 4TPSB 4FUQA 1BA3A 4U5YD 4RLQA 3R44A 4LF7C 3RV2A 4JI6C 5DV9A 2JMPA 4DCTA 3E7XA 2E0GA 1V25A 4DR2C 1LQLA 3ETOA 2D27A 2QVZX 1P7LA 4DV5C 3LGXA 1N36C 4MTNA 4I9GA 5IFIA 4DV3C 5A1GA 4JI4C 4DV7C 1XNRC 1O93A 4RVNA 4GKKC 5A1IA 1O9TA 3G7SA 1ZB9A 2P02A 1QWIA 4L2ZA 4JI5C 1ULTA 5BSVA 1ML8A 1HR0C 1XMQC 3LUSA 4OYCA 2CXCA 4KTTA 4G1IA 2UXDC 4BCAA 3PBKA 5LMUC 3VNQA 5BR8C 4ISBA 5E7QA 3J80D 2UUCC 4LF6C 1IBMC 4LF4C 3AF5A 4JI2C 1MXBA 4DUYC 2QW0X 3GPCA 1T5DX 1FUGA 4WV3A 4X62C 4LFCC 4BBYA 3A9UA 4IZ6A 3A9VA 5BSWA 1I94C 2BJOA 4B3MC 4LF5C 4X66C 2YCBA 1MXAA 4JI3C 4GXRA 2HHHC 4DR1C 4EATA 3GR0A 1N34C 1MDFA 5IWAC 2V7BA 1L2FA 2OBVA 1K0RA 2E8EA 4FUTA 3T1HC 5BSRA 2YWBA 1WH9A 3FCCA 3E7WA 5LMNC 4RM3A 5T8TA 2YWCA 1IBKC 5CZVA 4LFBC 4WS9A 1HNWC 3ETCA 3C5EA 4DR5C 3IPLA 1MKYA 1USPA 2F4VC 1PG3A 4DG8A 2Y27A 1XMOC 2Y4NA 4DCVA 5BSTA 3CW8X 4IR7A 3PESA 4DR6C 4L7IA 2P2QA 3I07A 5AE2A 4GS5A 1J5EC 2PROA 2QVXX 2VSQA 3VNSA 4JM1A 3GKUA 2EGTA 4I9FA 5KYVA 2D7VA 1PG4A 4LF8C 3TDEA 4NDNA 2E5LC 2D28C 4DCSA 4B3RC 4ZLPA 3FCEA 4GKJC 3T1YC 4OXIA 3EQ6A 3L95X 4JYAC 4X64C 4YY3C 5K85A 3IEVA 3R9WA 1USPB 4L4QA 2OPLA 3OTOC 1HNXC 3H2TA 5KYTA 3I08A 4XX2A 3TUFA 5BSUA 1ZB8A 3UOWA 4DV6C 2P2JA 1V26A 4D57A 5K8FA 1MXCA 1RY2A 5BUSA 2E8FA 2OO4A 4LFAC 4DR7C 2PT7G 2UUBC 4RVOA 5IT9D 3N2QA 3NI2A 3UZ0A 1IBLC 3SO4A 4DG9A 4B3SC 5A2QD 3DAYA 3TQIA 4G36A 5BURA 3S82A 1XRBA 2AYAA 4RM2A 3LAXA 2PN2A 1GPMA 1NYEA 3GR1A 4DV1C 3R9XA 4MH4A 4JI1C 1O90A 5ADZA 4RLFA 3NPDA 2P2MA 1MDBA 2OPLB 1VLAA 3RG2A 1KKGA 2UU9C 2Y4OA 4FTFA 4G37A 2E8CA 2P2FA 5CZXA 3JAMD 4DV4C 4LE5A 3DLPX 4B3TC 1N33C 4JV5C 4GXQA 5BSMA 1EGAA 5KEIA 2VZEA 3PROC 4JI8C 4R1LA 3IMLA 2BH1X 4K0BA 4NOZA 2ATWA 1FJGC 5FLXD 4AQYC 4ZJZA 4D4IA 2UXBC 2P20A 3NYRA 5JRHA 4JI7C 5T8SA 1HNZC 4OX9C 1RG9A 5A19A 1XRAA 3LNVA 2WD9A 4BC9A 4RMNA 2HJGA 4DV0C 4JI0C 3NYQA 4DUZC 3B7WA 2XR1A 4HPVA 1XRCA 1T5HX 2DPLA 3DHVA 4PHTA 4LF9C 2WP0C 2UXCC 5AE3A 3CJEA 4KHPC 1HH2P 4YHHC 4KTVA 1QM4A 1O92A 5BUQA 2D1QA 4BSZA 1N2FA 2QL8A 2P2BA 4NXNC 3N54B 3L8CA 2ASBA 2D1RA 4PZPA 2VQEC 2DYJA 1XNQC 5GTDA 3IEUA 1N32C 1JOSA 5AE1A 2VQFC 2ONFA 5H9UA 4R1MA 1MD9A 1AMUA 4X65C 2CY1A 2ZM6C 2E7GA 3AF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 C;  3GKU A;  1KKG A;  2EGT A;  3AF5 A;  2UU9 C;  4JI2 C;  4NXM C;  4DUY C;  2D7V A;  2KZF A;  2E8C A;  4DR3 C;  3JAM D;  4DV4 C;  4LF8 C;  4B3T C;  1N33 C;  4X62 C;  4JV5 C;  4LFC C;  1EGA A;  2E5L C;  4DCS A;  4B3R C;  4JI8 C;  4GKJ C;  1PA4 A;  2UUA C;  3T1Y C;  1I94 C;  2BJO A;  4NOZ A;  4DR4 C;  2ATW A;  1FJG C;  1WF3 A;  4K0K C;  5FLX D;  4AQY C;  2UXB C;  4DCU A;  4B3M C;  4X64 C;  4DV2 C;  4JYA C;  4YY3 C;  4X66 C;  4LF5 C;  2YCB A;  3IEV A;  4JI3 C;  3R9W A;  1USP B;  2HHH C;  4JI7 C;  3EER A;  2OPL A;  1HNZ C;  3OTO C;  4DR1 C;  4OX9 C;  1UKK A;  3J81 D;  1HNX C;  4XX2 A;  1N34 C;  5IWA C;  1ZB8 A;  2HJG A;  4DV0 C;  4DV6 C;  4JI0 C;  4DUZ C;  4LF7 C;  1L2F A;  2XR1 A;  4JI6 C;  2JMP A;  4DCT A;  1K0R A;  2E8E A;  3T1H C;  1WH9 A;  4LF9 C;  4DR2 C;  2UXC C;  5LMN C;  1LQL A;  3CJE A;  1HH2 P;  4YHH C;  4KHP C;  2E8F A;  4DV5 C;  1IBK C;  4LFA C;  4DR7 C;  4LFB C;  1HNW C;  1N36 C;  2PT7 G;  2UUB C;  5IT9 D;  4MTN A;  4DR5 C;  4BSZ A;  1MKY A;  1N2F A;  2QL8 A;  1USP A;  4NXN C;  4DV3 C;  2F4V C;  4JI4 C;  4DV7 C;  1XNR C;  1XMO C;  1IBL C;  4B3S C;  4GKK C;  2ASB A;  4DCV A;  5A2Q D;  1ZB9 A;  2VQE C;  2DYJ A;  1XNQ C;  1QWI A;  4JI5 C;  1ML8 A;  1HR0 C;  3IEU A;  1XMQ C;  3LUS A;  1N32 C;  1JOS A;  2PN2 A;  2CXC A;  2VQF C;  1NYE A;  4DV1 C;  2UXD C;  4DR6 C;  3I07 A;  3R9X A;  4MH4 A;  4JI1 C;  2ONF A;  1J5E C;  5LMU C;  5BR8 C;  3J80 D;  2UUC C;  4X65 C;  2CY1 A;  4LF6 C;  2OPL B;  1IBM C;  1VLA A;  2ZM6 C;  2E7G A;  3AF6 A; 
#chains in the Genus database with same CATH topology
 4BC7 A;  4D56 A;  1LCI A;  4NXM C;  4PRO C;  2D1S A;  2QVY X;  2KZF A;  3A4I A;  4DR3 C;  3AY0 A;  1PA4 A;  2UUA C;  2D1T A;  3KXW A;  4DR4 C;  3VNR A;  1WF3 A;  4K0K C;  4ODJ A;  4DCU A;  4DV2 C;  3CW9 A;  4R0M A;  3CQ1 A;  3EER A;  4D4G A;  1UKK A;  1YJ7 A;  3J81 D;  4TPS B;  4FUQ A;  1BA3 A;  4U5Y D;  4RLQ A;  3R44 A;  4LF7 C;  3RV2 A;  4JI6 C;  5DV9 A;  2MCQ A;  2JMP A;  4DCT A;  3E7X A;  2E0G A;  5LCI A;  1V25 A;  4DR2 C;  1LQL A;  2DHM A;  3ETO A;  2D27 A;  2QVZ X;  1P7L A;  4DV5 C;  3LGX A;  1N36 C;  4MTN A;  4PUI A;  4I9G A;  5IFI A;  4DV3 C;  5A1G A;  4JI4 C;  4DV7 C;  1XNR C;  1O93 A;  4RVN A;  4GKK C;  5A1I A;  1O9T A;  3G7S A;  3LNO A;  1ZB9 A;  2NCL A;  2P02 A;  3CQ3 A;  1QWI A;  4L2Z A;  4JI5 C;  1ULT A;  5BSV A;  1ML8 A;  1HR0 C;  3A26 A;  1XMQ C;  3LUS A;  2KDN A;  4OYC A;  2CXC A;  4KTT A;  4G1I A;  2CU6 A;  2JNV A;  3A25 A;  2UXD C;  4BCA A;  3PBK A;  5LMU C;  3VNQ A;  5BR8 C;  4ISB A;  5E7Q A;  3J80 D;  2UUC C;  4LF6 C;  1IBM C;  4PUG A;  4LF4 C;  3AF5 A;  4JI2 C;  1WCJ A;  1MXB A;  4DUY C;  2QW0 X;  3GPC A;  1T5D X;  1FUG A;  4WV3 A;  3K6R A;  4X62 C;  4LFC C;  4BBY A;  3A9U A;  4IZ6 A;  3A9V A;  5BSW A;  1I94 C;  2BJO A;  4B3M C;  4LF5 C;  4X66 C;  2YCB A;  1MXA A;  4JI3 C;  4GXR A;  2HHH C;  1M6X A;  4DR1 C;  4EAT A;  2M5H A;  3GR0 A;  1V60 A;  1N34 C;  1MDF A;  5IWA C;  2V7B A;  1L2F A;  2OBV A;  1UWD A;  1K0R A;  2E8E A;  4FUT A;  3T1H C;  2MMA B;  5BSR A;  2YWB A;  1WH9 A;  3FCC A;  3E7W A;  4RM3 A;  5LMN C;  5T8T A;  3UX2 A;  2YWC A;  1IBK C;  5CZV A;  4LFB C;  4WS9 A;  1HNW C;  3ETC A;  3C5E A;  2ZZM A;  4DR5 C;  3IPL A;  1MKY A;  1USP A;  1IB8 A;  2F4V C;  1PG3 A;  4DG8 A;  2Y27 A;  1XMO C;  2Y4N A;  4DCV A;  5BST A;  3CW8 X;  1P4E A;  4IR7 A;  3PES A;  1XS3 A;  4DR6 C;  4L7I A;  2P2Q A;  3I07 A;  5AE2 A;  4GS5 A;  1J5E C;  1VEH A;  2PRO A;  2VSQ A;  3VNS A;  4JM1 A;  3GKU A;  2EGT A;  4I9F A;  3UX3 A;  5KYV A;  2D7V A;  1PG4 A;  4LF8 C;  3TDE A;  4NDN A;  2E5L C;  2D28 C;  4DCS A;  4B3R C;  4ZLP A;  3FCE A;  4GKJ C;  3T1Y C;  4OXI A;  3EQ6 A;  3CQ2 A;  3L95 X;  4JYA C;  4X64 C;  4YY3 C;  5K85 A;  3IEV A;  3R9W A;  1USP B;  4L4Q A;  3O2E A;  2OPL A;  3OTO C;  1HNX C;  1M6X C;  3H2T A;  5KYT A;  3I08 A;  4XX2 A;  2YX1 A;  3TUF A;  5BSU A;  1ZB8 A;  3UOW A;  4DV6 C;  2P2J A;  1V26 A;  4D57 A;  5K8F A;  1TH5 A;  1MXC A;  1RY2 A;  5BUS A;  2E8F A;  2OO4 A;  4LFA C;  4DR7 C;  2PT7 G;  2UUB C;  4RVO A;  5IT9 D;  3N2Q A;  3NI2 A;  3UZ0 A;  2Z51 A;  1IBL C;  3SO4 A;  4DG9 A;  4B3S C;  5A2Q D;  3DAY A;  3TQI A;  4G36 A;  5BUR A;  3UEB A;  3S82 A;  1XRB A;  2AYA A;  4RM2 A;  1FLO A;  3LAX A;  2PN2 A;  1PU1 A;  1GPM A;  1NYE A;  3GR1 A;  4DV1 C;  3R9X A;  4MH4 A;  1P4E C;  4JI1 C;  1O90 A;  5ADZ A;  4PUH A;  4RLF A;  3NPD A;  2P2M A;  1MDB A;  2OPL B;  1VLA A;  3RG2 A;  1XHJ A;  1KKG A;  2UU9 C;  2Y4O A;  4FTF A;  4G37 A;  2E8C A;  2P2F A;  5CZX A;  3JAM D;  4DV4 C;  4LE5 A;  3DLP X;  4B3T C;  1N33 C;  4JV5 C;  4GXQ A;  5BSM A;  1EGA A;  5KEI A;  2M5O A;  2VZE A;  3PRO C;  4JI8 C;  4R1L A;  2ZZN A;  3IML A;  2BH1 X;  4K0B A;  4NOZ A;  2ATW A;  1FJG C;  5FLX D;  4AQY C;  4ZJZ A;  4D4I A;  2UXB C;  2P20 A;  3NYR A;  5JRH A;  4JI7 C;  5T8S A;  1HNZ C;  4OX9 C;  2KZ0 A;  1RG9 A;  3AF6 A;  5A19 A;  1XRA A;  3LNV A;  2WD9 A;  4BC9 A;  4RMN A;  2HJG A;  4DV0 C;  4JI0 C;  3NYQ A;  4DUZ C;  3B7W A;  2XR1 A;  4HPV A;  1XRC A;  1T5H X;  2DPL A;  3DHV A;  4PHT A;  4LF9 C;  2WP0 C;  2UXC C;  5AE3 A;  3CJE A;  4KHP C;  1HH2 P;  4YHH C;  4KTV A;  1QM4 A;  1O92 A;  5BUQ A;  2D1Q A;  2MM9 A;  4BSZ A;  1N2F A;  2QL8 A;  2P2B A;  4NXN C;  3N54 B;  3TR3 A;  3L8C A;  2ASB A;  2D1R A;  4PZP A;  2VQE C;  2DYJ A;  1XNQ C;  5GTD A;  3IEU A;  1N32 C;  1JOS A;  1NY8 A;  5AE1 A;  2VQF C;  2ONF A;  5H9U A;  4R1M A;  1MD9 A;  1AMU A;  4X65 C;  2CY1 A;  2ZM6 C;  2E7G A;  2QVX X; 
#chains in the Genus database with same CATH homology
 4BC7 A;  4D56 A;  1LCI A;  4NXM C;  4PRO C;  2D1S A;  2QVY X;  2KZF A;  3A4I A;  4DR3 C;  1PA4 A;  2UUA C;  2D1T A;  3KXW A;  4DR4 C;  3VNR A;  1WF3 A;  4K0K C;  4ODJ A;  4DCU A;  4DV2 C;  3CW9 A;  4R0M A;  3EER A;  4D4G A;  1UKK A;  1YJ7 A;  3J81 D;  4TPS B;  4FUQ A;  1BA3 A;  4U5Y D;  4RLQ A;  3R44 A;  4LF7 C;  3RV2 A;  4JI6 C;  5DV9 A;  2JMP A;  4DCT A;  3E7X A;  2E0G A;  1V25 A;  4DR2 C;  1LQL A;  3ETO A;  2D27 A;  2QVZ X;  1P7L A;  4DV5 C;  3LGX A;  1N36 C;  4MTN A;  4I9G A;  5IFI A;  4DV3 C;  5A1G A;  4JI4 C;  4DV7 C;  1XNR C;  1O93 A;  4RVN A;  4GKK C;  5A1I A;  1O9T A;  3G7S A;  1ZB9 A;  2P02 A;  1QWI A;  4L2Z A;  4JI5 C;  1ULT A;  5BSV A;  1ML8 A;  1HR0 C;  1XMQ C;  3LUS A;  4OYC A;  2CXC A;  4KTT A;  4G1I A;  2UXD C;  4BCA A;  3PBK A;  5LMU C;  3VNQ A;  5BR8 C;  4ISB A;  5E7Q A;  3J80 D;  2UUC C;  4LF6 C;  1IBM C;  4LF4 C;  3AF5 A;  4JI2 C;  1MXB A;  4DUY C;  2QW0 X;  3GPC A;  1T5D X;  1FUG A;  4WV3 A;  4X62 C;  4LFC C;  4BBY A;  3A9U A;  4IZ6 A;  3A9V A;  5BSW A;  1I94 C;  2BJO A;  4B3M C;  4LF5 C;  4X66 C;  2YCB A;  1MXA A;  4JI3 C;  4GXR A;  2HHH C;  4DR1 C;  4EAT A;  3GR0 A;  1N34 C;  1MDF A;  5IWA C;  2V7B A;  1L2F A;  2OBV A;  1K0R A;  2E8E A;  4FUT A;  3T1H C;  5BSR A;  2YWB A;  1WH9 A;  3FCC A;  3E7W A;  5LMN C;  4RM3 A;  5T8T A;  2YWC A;  1IBK C;  5CZV A;  4LFB C;  4WS9 A;  1HNW C;  3ETC A;  3C5E A;  4DR5 C;  3IPL A;  1MKY A;  1USP A;  2F4V C;  1PG3 A;  4DG8 A;  2Y27 A;  1XMO C;  2Y4N A;  4DCV A;  5BST A;  3CW8 X;  4IR7 A;  3PES A;  4DR6 C;  4L7I A;  2P2Q A;  3I07 A;  5AE2 A;  4GS5 A;  1J5E C;  2PRO A;  2QVX X;  2VSQ A;  3VNS A;  4JM1 A;  3GKU A;  2EGT A;  4I9F A;  5KYV A;  2D7V A;  1PG4 A;  4LF8 C;  3TDE A;  4NDN A;  2E5L C;  2D28 C;  4DCS A;  4B3R C;  4ZLP A;  3FCE A;  4GKJ C;  3T1Y C;  4OXI A;  3EQ6 A;  3L95 X;  4JYA C;  4X64 C;  4YY3 C;  5K85 A;  3IEV A;  3R9W A;  1USP B;  4L4Q A;  2OPL A;  3OTO C;  1HNX C;  3H2T A;  5KYT A;  3I08 A;  4XX2 A;  3TUF A;  5BSU A;  1ZB8 A;  3UOW A;  4DV6 C;  2P2J A;  1V26 A;  4D57 A;  5K8F A;  1MXC A;  1RY2 A;  5BUS A;  2E8F A;  2OO4 A;  4LFA C;  4DR7 C;  2PT7 G;  2UUB C;  4RVO A;  5IT9 D;  3N2Q A;  3NI2 A;  3UZ0 A;  1IBL C;  3SO4 A;  4DG9 A;  4B3S C;  5A2Q D;  3DAY A;  3TQI A;  4G36 A;  5BUR A;  3S82 A;  1XRB A;  2AYA A;  4RM2 A;  3LAX A;  2PN2 A;  1GPM A;  1NYE A;  3GR1 A;  4DV1 C;  3R9X A;  4MH4 A;  4JI1 C;  1O90 A;  5ADZ A;  4RLF A;  3NPD A;  2P2M A;  1MDB A;  2OPL B;  1VLA A;  3RG2 A;  1KKG A;  2UU9 C;  2Y4O A;  4FTF A;  4G37 A;  2E8C A;  2P2F A;  5CZX A;  3JAM D;  4DV4 C;  4LE5 A;  3DLP X;  4B3T C;  1N33 C;  4JV5 C;  4GXQ A;  5BSM A;  1EGA A;  5KEI A;  2VZE A;  3PRO C;  4JI8 C;  4R1L A;  3IML A;  2BH1 X;  4K0B A;  4NOZ A;  2ATW A;  1FJG C;  5FLX D;  4AQY C;  4ZJZ A;  4D4I A;  2UXB C;  2P20 A;  3NYR A;  5JRH A;  4JI7 C;  5T8S A;  1HNZ C;  4OX9 C;  1RG9 A;  5A19 A;  1XRA A;  3LNV A;  2WD9 A;  4BC9 A;  4RMN A;  2HJG A;  4DV0 C;  4JI0 C;  3NYQ A;  4DUZ C;  3B7W A;  2XR1 A;  4HPV A;  1XRC A;  1T5H X;  2DPL A;  3DHV A;  4PHT A;  4LF9 C;  2WP0 C;  2UXC C;  5AE3 A;  3CJE A;  4KHP C;  1HH2 P;  4YHH C;  4KTV A;  1QM4 A;  1O92 A;  5BUQ A;  2D1Q A;  4BSZ A;  1N2F A;  2QL8 A;  2P2B A;  4NXN C;  3N54 B;  3L8C A;  2ASB A;  2D1R A;  4PZP A;  2VQE C;  2DYJ A;  1XNQ C;  5GTD A;  3IEU A;  1N32 C;  1JOS A;  5AE1 A;  2VQF C;  2ONF A;  5H9U A;  4R1M A;  1MD9 A;  1AMU A;  4X65 C;  2CY1 A;  2ZM6 C;  2E7G A;  3AF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...