1UKKA

Structure of osmotically inducible protein c from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
140
Chain Sequence
PVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Structure and Biochemical Analysis of the Thermus thermophilus Osmotically Inducible Protein C
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Osmotically Inducible Protein C
total genus 31
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1ukkA00
1XMQC 4LFCC 3R9WA 1PA4A 4JI7C 4DR5C 1HNZC 2DYJA 1J5EC 3LUSA 4DV1C 1LQLA 5IT9D 1USPB 4DV6C 4DR7C 4DCTA 1N36C 1NYEA 1ZB9A 2XR1A 4DR1C 4B3SC 2UUBC 2CY1A 5BR8C 4DUZC 5IWAC 4DV2C 2VQFC 2QL8A 4DV7C 2UU9C 4GKKC 4JV5C 4DR3C 4LF6C 2F4VC 4X64C 5LMUC 4YHHC 3J81D 4LFAC 2ATWA 1HR0C 1IBMC 4OX9C 2PN2A 4JI4C 1FJGC 3J80D 4LF8C 4JYAC 1N2FA 2UXDC 1WF3A 2EGTA 4JI1C 2KZFA 3OTOC 1UKKA 4MH4A 1L2FA 3T1YC 2D7VA 4DR6C 2HJGA 2UUAC 2OPLB 1IBLC 4LF5C 4JI5C 2E5LC 5LMNC 3T1HC 1HH2P 4JI2C 4NOZA 4K0KC 1QWIA 4DR2C 4DV3C 2BJOA 1ML8A 4JI0C 3I07A 4X65C 3R9XA 4NXNC 4XX2A 4NXMC 1K0RA 1WH9A 4DCVA 4JI6C 4X66C 1IBKC 1USPA 2CXCA 4LF7C 2ASBA 4JI3C 4DCUA 1EGAA 1MKYA 2E8CA 3AF6A 4B3TC 1JOSA 4YY3C 2HHHC 3CJEA 4LF4C 2PT7G 3EERA 1KKGA 1HNXC 2YCBA 4DCSA 2VQEC 4LF9C 3JAMD 2E7GA 1ZB8A 1N32C 2UXBC 2JMPA 4DUYC 5FLXD 4B3RC 2UUCC 4X62C 1XNQC 4LFBC 4B3MC 2ZM6C 3IEVA 3IEUA 4DV0C 4DV5C 2UXCC 4AQYC 4GKJC 5A2QD 2OPLA 2ONFA 1VLAA 2E8EA 1N34C 3AF5A 1XMOC 2E8FA 4MTNA 3GKUA 4BSZA 4DV4C 1N33C 4DR4C 1I94C 4KHPC 1HNWC 4JI8C 1XNRC
chains in the Genus database with same CATH superfamily
3UX3A 4LFCC 5KEIA 4HPVA 5AE1A 5H9UA 4JI7C 3LNVA 3UEBA 1XHJA 5IT9D 4DV6C 1XRAA 3A9UA 3DAYA 1FUGA 4PUGA 1FLOA 4BBYA 2YWCA 2VSQA 4DV2C 3TUFA 4TPSB 3R44A 1MDFA 4OYCA 2MMAB 5A19A 3CQ3A 4IZ6A 4FUTA 2ATWA 4RLFA 2D28C 1HR0C 5BSMA 3I08A 3J80D 5AE3A 2EGTA 4JI1C 3OTOC 5T8SA 3T1YC 2OPLB 4RM2A 5BURA 4FUQA 1PU1A 1RG9A 2YX1A 4PROC 4NOZA 3UX2A 4K0KC 4DV3C 2PROA 4G37A 2YWBA 2JNVA 2ASBA 1USPA 3NYRA 4NDNA 4RVOA 1V60A 3AF6A 1O92A 4WS9A 4YY3C 3IPLA 3CJEA 2PT7G 1KKGA 3ETOA 1ULTA 2YCBA 4DCSA 2P2QA 1MXAA 2E7GA 2P02A 2UXBC 1BA3A 4RLQA 4B3RC 4DG8A 3E7XA 5BUQA 2UXCC 4AQYC 2ONFA 1VLAA 1N34C 4MTNA 3FCEA 3LAXA 2VZEA 1IB8A 1QM4A 4KHPC 1P7LA 3A26A 5CZXA 2QW0X 1XNRC 2DHMA 2P20A 5ADZA 4DR7C 1MD9A 3EQ6A 1ZB9A 2XR1A 4DR1C 3RG2A 2QVXX 5BR8C 4BCAA 4L7IA 2P2MA 2D27A 1MXCA 4JV5C 3PROC 3GR0A 4PHTA 2D1QA 1T5DX 4X64C 1UWDA 4L4QA 4YHHC 3VNQA 3PESA 4ZLPA 1V25A 3S82A 1IBMC 5CZVA 4OX9C 1FJGC 1O93A 4ODJA 4D56A 5BSRA 1L2FA 3AY0A 2HJGA 2KDNA 4GS5A 3TQIA 4LF5C 4I9FA 2MCQA 3T1HC 3CQ2A 4DR2C 3DHVA 3I07A 3R9XA 5JRHA 4NXMC 4GXQA 1WH9A 2ZZNA 1RY2A 4LF7C 4LE5A 3B7WA 5KYVA 2ZZMA 1MKYA 1EGAA 3CW9A 5AE2A 2Z51A 1GPMA 1HNXC 1O90A 2P2FA 2M5HA 4DUYC 4L2ZA 5FLXD 4G1IA 3NYQA 4D57A 4B3MC 5T8TA 1PG4A 3LNOA 1XS3A 3A25A 3GR1A 5BSUA 5A2QD 3UZ0A 3VNRA 2E8FA 4BSZA 4KTTA 4DV4C 1N33C 2V7BA 3VNSA 4DR4C 4PUHA 3CW8X 4FTFA 1P4EC 4OXIA 4JM1A 1HNZC 1J5EC 1USPB 4R1LA 4DCTA 1N36C 1NYEA 4B3SC 4U5YD 2CY1A 2P2BA 4DUZC 4R1MA 4DV7C 1MDBA 2UU9C 4RM3A 4DR3C 4LF6C 1LCIA 3A9VA 1M6XC 3NPDA 4LFAC 4JYAC 2UXDC 2KZFA 3CQ1A 4RVNA 4DR6C 3TR3A 1IBLC 3L8CA 4JI5C 2BH1X 4BC9A 5LMNC 1HH2P 4JI2C 1ML8A 5BSWA 4X65C 1TH5A 4EATA 5BUSA 4NXNC 4XX2A 1YJ7A 3IMLA 1T5HX 4X66C 1IBKC 4JI3C 3RV2A 2NCLA 2QVZX 2E8CA 1NY8A 1V26A 1JOSA 4PZPA 2HHHC 3H2TA 1M6XA 3EERA 3G7SA 4WV3A 2VQEC 3JAMD 1ZB8A 3FCCA 2JMPA 4R0MA 2UUCC 4X62C 1XNQC 4LFBC 5IFIA 2ZM6C 2D1RA 1O9TA 4DV0C 4DV5C 2QVYX 4GKJC 3NI2A 3AF5A 1XMOC 3SO4A 3GPCA 3GKUA 2Y4NA 4ZJZA 5A1IA 4I9GA 1WCJA 4JI8C 1XRCA 2Y27A 1XMQC 2AYAA 3R9WA 1PA4A 3L95X 4PUIA 4DR5C 2DYJA 3LUSA 4DV1C 1LQLA 4IR7A 5GTDA 1VEHA 4DG9A 3O2EA 2UUBC 2KZ0A 2P2JA 5IWAC 1AMUA 2VQFC 1MXBA 2QL8A 4K0BA 4GKKC 2Y4OA 3TDEA 3DLPX 5LMUC 2WD9A 1P4EA 1XRBA 4KTVA 3J81D 5E7QA 2PN2A 4JI4C 3N2QA 2OBVA 4LF8C 1N2FA 3LGXA 1WF3A 3KXWA 1UKKA 5DV9A 3A4IA 4MH4A 2D7VA 2E0GA 3ETCA 4BC7A 2UUAC 2MM9A 2E5LC 5LCIA 2DPLA 3PBKA 5K8FA 5K85A 3UOWA 3C5EA 1QWIA 2BJOA 4JI0C 2WP0C 2D1SA 2OO4A 1K0RA 4D4GA 4DCVA 4JI6C 3K6RA 2CXCA 2M5OA 4GXRA 4DCUA 5BSTA 4B3TC 4LF4C 5A1GA 2CU6A 3E7WA 4ISBA 4LF9C 4G36A 1PG3A 1N32C 4RMNA 2D1TA 3IEVA 3N54B 3IEUA 2OPLA 2E8EA 5BSVA 1I94C 5KYTA 1HNWC 4D4IA 2F4VC
chains in the Genus database with same CATH topology
4LFCC 5KEIA 4HPVA 5AE1A 5H9UA 4JI7C 3LNVA 5IT9D 4DV6C 1XRAA 3A9UA 3DAYA 1FUGA 4BBYA 2YWCA 2VSQA 4DV2C 3TUFA 4TPSB 3R44A 1MDFA 4OYCA 5A19A 4IZ6A 4FUTA 2ATWA 4RLFA 2D28C 1HR0C 5BSMA 3I08A 3J80D 5AE3A 2EGTA 4JI1C 3OTOC 5T8SA 3T1YC 2OPLB 4RM2A 5BURA 4FUQA 1RG9A 4PROC 4NOZA 4K0KC 4DV3C 2PROA 4G37A 2YWBA 2ASBA 1USPA 3NYRA 4NDNA 4RVOA 3AF6A 1O92A 4WS9A 4YY3C 3IPLA 3CJEA 2PT7G 1KKGA 3ETOA 1ULTA 2YCBA 4DCSA 2P2QA 1MXAA 2E7GA 2P02A 2UXBC 1BA3A 4RLQA 4B3RC 4DG8A 3E7XA 5BUQA 2UXCC 4AQYC 2ONFA 1VLAA 1N34C 4MTNA 3FCEA 3LAXA 2VZEA 1QM4A 4KHPC 1P7LA 5CZXA 2QW0X 1XNRC 2P20A 5ADZA 4DR7C 1MD9A 3EQ6A 1ZB9A 2XR1A 4DR1C 3RG2A 2QVXX 5BR8C 4BCAA 4L7IA 2P2MA 2D27A 1MXCA 4JV5C 3PROC 3GR0A 4PHTA 2D1QA 1T5DX 4X64C 4L4QA 4YHHC 3VNQA 3PESA 4ZLPA 1V25A 3S82A 1IBMC 5CZVA 4OX9C 1FJGC 1O93A 4ODJA 4D56A 5BSRA 1L2FA 2HJGA 4GS5A 3TQIA 4LF5C 4I9FA 3T1HC 4DR2C 3DHVA 3I07A 3R9XA 5JRHA 4NXMC 4GXQA 1WH9A 1RY2A 4LF7C 4LE5A 3B7WA 5KYVA 1MKYA 1EGAA 3CW9A 5AE2A 1GPMA 1HNXC 1O90A 2P2FA 4DUYC 4L2ZA 5FLXD 4G1IA 3NYQA 4D57A 4B3MC 5T8TA 1PG4A 3GR1A 5BSUA 5A2QD 3UZ0A 3VNRA 2E8FA 4BSZA 4KTTA 4DV4C 1N33C 2V7BA 3VNSA 4DR4C 3CW8X 4FTFA 4OXIA 4JM1A 1HNZC 1J5EC 1USPB 4R1LA 4DCTA 1N36C 1NYEA 4B3SC 4U5YD 2CY1A 2P2BA 4DUZC 4R1MA 4DV7C 1MDBA 2UU9C 4RM3A 4DR3C 4LF6C 1LCIA 3A9VA 3NPDA 4LFAC 4JYAC 2UXDC 2KZFA 4RVNA 4DR6C 1IBLC 3L8CA 4JI5C 2BH1X 4BC9A 5LMNC 1HH2P 4JI2C 1ML8A 5BSWA 4X65C 4EATA 5BUSA 4NXNC 4XX2A 1YJ7A 3IMLA 1T5HX 4X66C 1IBKC 4JI3C 3RV2A 2QVZX 2E8CA 1V26A 1JOSA 4PZPA 2HHHC 3H2TA 3EERA 3G7SA 4WV3A 2VQEC 3JAMD 1ZB8A 3FCCA 2JMPA 4R0MA 2UUCC 4X62C 1XNQC 4LFBC 5IFIA 2ZM6C 2D1RA 1O9TA 4DV0C 4DV5C 2QVYX 4GKJC 3NI2A 3AF5A 1XMOC 3SO4A 3GPCA 3GKUA 2Y4NA 4ZJZA 5A1IA 4I9GA 4JI8C 1XRCA 2Y27A 1XMQC 2AYAA 3R9WA 1PA4A 3L95X 4DR5C 2DYJA 3LUSA 4DV1C 1LQLA 4IR7A 5GTDA 4DG9A 2UUBC 2P2JA 5IWAC 1AMUA 2VQFC 1MXBA 2QL8A 4K0BA 4GKKC 2Y4OA 3TDEA 3DLPX 5LMUC 2WD9A 1XRBA 4KTVA 3J81D 5E7QA 2PN2A 4JI4C 3N2QA 2OBVA 4LF8C 1N2FA 3LGXA 1WF3A 3KXWA 1UKKA 5DV9A 3A4IA 4MH4A 2D7VA 2E0GA 3ETCA 4BC7A 2UUAC 2E5LC 2DPLA 3PBKA 5K8FA 5K85A 3UOWA 3C5EA 1QWIA 2BJOA 4JI0C 2WP0C 2D1SA 2OO4A 1K0RA 4D4GA 4DCVA 4JI6C 2CXCA 4GXRA 4DCUA 5BSTA 4B3TC 4LF4C 5A1GA 3E7WA 4ISBA 4LF9C 4G36A 1PG3A 1N32C 4RMNA 2D1TA 3IEVA 3N54B 3IEUA 2OPLA 2E8EA 5BSVA 1I94C 5KYTA 1HNWC 4D4IA 2F4VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ C;  4LFC C;  3R9W A;  1PA4 A;  4JI7 C;  4DR5 C;  1HNZ C;  2DYJ A;  1J5E C;  3LUS A;  4DV1 C;  1LQL A;  5IT9 D;  1USP B;  4DV6 C;  4DR7 C;  4DCT A;  1N36 C;  1NYE A;  1ZB9 A;  2XR1 A;  4DR1 C;  4B3S C;  2UUB C;  2CY1 A;  5BR8 C;  4DUZ C;  5IWA C;  4DV2 C;  2VQF C;  2QL8 A;  4DV7 C;  2UU9 C;  4GKK C;  4JV5 C;  4DR3 C;  4LF6 C;  2F4V C;  4X64 C;  5LMU C;  4YHH C;  3J81 D;  4LFA C;  2ATW A;  1HR0 C;  1IBM C;  4OX9 C;  2PN2 A;  4JI4 C;  1FJG C;  3J80 D;  4LF8 C;  4JYA C;  1N2F A;  2UXD C;  1WF3 A;  2EGT A;  4JI1 C;  2KZF A;  3OTO C;  1UKK A;  4MH4 A;  1L2F A;  3T1Y C;  2D7V A;  4DR6 C;  2HJG A;  2UUA C;  2OPL B;  1IBL C;  4LF5 C;  4JI5 C;  2E5L C;  5LMN C;  3T1H C;  1HH2 P;  4JI2 C;  4NOZ A;  4K0K C;  1QWI A;  4DR2 C;  4DV3 C;  2BJO A;  1ML8 A;  4JI0 C;  3I07 A;  4X65 C;  3R9X A;  4NXN C;  4XX2 A;  4NXM C;  1K0R A;  1WH9 A;  4DCV A;  4JI6 C;  4X66 C;  1IBK C;  1USP A;  2CXC A;  4LF7 C;  2ASB A;  4JI3 C;  4DCU A;  1EGA A;  1MKY A;  2E8C A;  3AF6 A;  4B3T C;  1JOS A;  4YY3 C;  2HHH C;  3CJE A;  4LF4 C;  2PT7 G;  3EER A;  1KKG A;  1HNX C;  2YCB A;  4DCS A;  2VQE C;  4LF9 C;  3JAM D;  2E7G A;  1ZB8 A;  1N32 C;  2UXB C;  2JMP A;  4DUY C;  5FLX D;  4B3R C;  2UUC C;  4X62 C;  1XNQ C;  4LFB C;  4B3M C;  2ZM6 C;  3IEV A;  3IEU A;  4DV0 C;  4DV5 C;  2UXC C;  4AQY C;  4GKJ C;  5A2Q D;  2OPL A;  2ONF A;  1VLA A;  2E8E A;  1N34 C;  3AF5 A;  1XMO C;  2E8F A;  4MTN A;  3GKU A;  4BSZ A;  4DV4 C;  1N33 C;  4DR4 C;  1I94 C;  4KHP C;  1HNW C;  4JI8 C;  1XNR C; 
#chains in the Genus database with same CATH topology
 3UX3 A;  4LFC C;  5KEI A;  4HPV A;  5AE1 A;  5H9U A;  4JI7 C;  3LNV A;  3UEB A;  1XHJ A;  5IT9 D;  4DV6 C;  1XRA A;  3A9U A;  3DAY A;  1FUG A;  4PUG A;  1FLO A;  4BBY A;  2YWC A;  2VSQ A;  4DV2 C;  3TUF A;  4TPS B;  3R44 A;  1MDF A;  4OYC A;  2MMA B;  5A19 A;  3CQ3 A;  4IZ6 A;  4FUT A;  2ATW A;  4RLF A;  2D28 C;  1HR0 C;  5BSM A;  3I08 A;  3J80 D;  5AE3 A;  2EGT A;  4JI1 C;  3OTO C;  5T8S A;  3T1Y C;  2OPL B;  4RM2 A;  5BUR A;  4FUQ A;  1PU1 A;  1RG9 A;  2YX1 A;  4PRO C;  4NOZ A;  3UX2 A;  4K0K C;  4DV3 C;  2PRO A;  4G37 A;  2YWB A;  2JNV A;  2ASB A;  1USP A;  3NYR A;  4NDN A;  4RVO A;  1V60 A;  3AF6 A;  1O92 A;  4WS9 A;  4YY3 C;  3IPL A;  3CJE A;  2PT7 G;  1KKG A;  3ETO A;  1ULT A;  2YCB A;  4DCS A;  2P2Q A;  1MXA A;  2E7G A;  2P02 A;  2UXB C;  1BA3 A;  4RLQ A;  4B3R C;  4DG8 A;  3E7X A;  5BUQ A;  2UXC C;  4AQY C;  2ONF A;  1VLA A;  1N34 C;  4MTN A;  3FCE A;  3LAX A;  2VZE A;  1IB8 A;  1QM4 A;  4KHP C;  1P7L A;  3A26 A;  5CZX A;  2QW0 X;  1XNR C;  2DHM A;  2P20 A;  5ADZ A;  4DR7 C;  1MD9 A;  3EQ6 A;  1ZB9 A;  2XR1 A;  4DR1 C;  3RG2 A;  2QVX X;  5BR8 C;  4BCA A;  4L7I A;  2P2M A;  2D27 A;  1MXC A;  4JV5 C;  3PRO C;  3GR0 A;  4PHT A;  2D1Q A;  1T5D X;  4X64 C;  1UWD A;  4L4Q A;  4YHH C;  3VNQ A;  3PES A;  4ZLP A;  1V25 A;  3S82 A;  1IBM C;  5CZV A;  4OX9 C;  1FJG C;  1O93 A;  4ODJ A;  4D56 A;  5BSR A;  1L2F A;  3AY0 A;  2HJG A;  2KDN A;  4GS5 A;  3TQI A;  4LF5 C;  4I9F A;  2MCQ A;  3T1H C;  3CQ2 A;  4DR2 C;  3DHV A;  3I07 A;  3R9X A;  5JRH A;  4NXM C;  4GXQ A;  1WH9 A;  2ZZN A;  1RY2 A;  4LF7 C;  4LE5 A;  3B7W A;  5KYV A;  2ZZM A;  1MKY A;  1EGA A;  3CW9 A;  5AE2 A;  2Z51 A;  1GPM A;  1HNX C;  1O90 A;  2P2F A;  2M5H A;  4DUY C;  4L2Z A;  5FLX D;  4G1I A;  3NYQ A;  4D57 A;  4B3M C;  5T8T A;  1PG4 A;  3LNO A;  1XS3 A;  3A25 A;  3GR1 A;  5BSU A;  5A2Q D;  3UZ0 A;  3VNR A;  2E8F A;  4BSZ A;  4KTT A;  4DV4 C;  1N33 C;  2V7B A;  3VNS A;  4DR4 C;  4PUH A;  3CW8 X;  4FTF A;  1P4E C;  4OXI A;  4JM1 A;  1HNZ C;  1J5E C;  1USP B;  4R1L A;  4DCT A;  1N36 C;  1NYE A;  4B3S C;  4U5Y D;  2CY1 A;  2P2B A;  4DUZ C;  4R1M A;  4DV7 C;  1MDB A;  2UU9 C;  4RM3 A;  4DR3 C;  4LF6 C;  1LCI A;  3A9V A;  1M6X C;  3NPD A;  4LFA C;  4JYA C;  2UXD C;  2KZF A;  3CQ1 A;  4RVN A;  4DR6 C;  3TR3 A;  1IBL C;  3L8C A;  4JI5 C;  2BH1 X;  4BC9 A;  5LMN C;  1HH2 P;  4JI2 C;  1ML8 A;  5BSW A;  4X65 C;  1TH5 A;  4EAT A;  5BUS A;  4NXN C;  4XX2 A;  1YJ7 A;  3IML A;  1T5H X;  4X66 C;  1IBK C;  4JI3 C;  3RV2 A;  2NCL A;  2QVZ X;  2E8C A;  1NY8 A;  1V26 A;  1JOS A;  4PZP A;  2HHH C;  3H2T A;  1M6X A;  3EER A;  3G7S A;  4WV3 A;  2VQE C;  3JAM D;  1ZB8 A;  3FCC A;  2JMP A;  4R0M A;  2UUC C;  4X62 C;  1XNQ C;  4LFB C;  5IFI A;  2ZM6 C;  2D1R A;  1O9T A;  4DV0 C;  4DV5 C;  2QVY X;  4GKJ C;  3NI2 A;  3AF5 A;  1XMO C;  3SO4 A;  3GPC A;  3GKU A;  2Y4N A;  4ZJZ A;  5A1I A;  4I9G A;  1WCJ A;  4JI8 C;  1XRC A;  2Y27 A;  1XMQ C;  2AYA A;  3R9W A;  1PA4 A;  3L95 X;  4PUI A;  4DR5 C;  2DYJ A;  3LUS A;  4DV1 C;  1LQL A;  4IR7 A;  5GTD A;  1VEH A;  4DG9 A;  3O2E A;  2UUB C;  2KZ0 A;  2P2J A;  5IWA C;  1AMU A;  2VQF C;  1MXB A;  2QL8 A;  4K0B A;  4GKK C;  2Y4O A;  3TDE A;  3DLP X;  5LMU C;  2WD9 A;  1P4E A;  1XRB A;  4KTV A;  3J81 D;  5E7Q A;  2PN2 A;  4JI4 C;  3N2Q A;  2OBV A;  4LF8 C;  1N2F A;  3LGX A;  1WF3 A;  3KXW A;  1UKK A;  5DV9 A;  3A4I A;  4MH4 A;  2D7V A;  2E0G A;  3ETC A;  4BC7 A;  2UUA C;  2MM9 A;  2E5L C;  5LCI A;  2DPL A;  3PBK A;  5K8F A;  5K85 A;  3UOW A;  3C5E A;  1QWI A;  2BJO A;  4JI0 C;  2WP0 C;  2D1S A;  2OO4 A;  1K0R A;  4D4G A;  4DCV A;  4JI6 C;  3K6R A;  2CXC A;  2M5O A;  4GXR A;  4DCU A;  5BST A;  4B3T C;  4LF4 C;  5A1G A;  2CU6 A;  3E7W A;  4ISB A;  4LF9 C;  4G36 A;  1PG3 A;  1N32 C;  4RMN A;  2D1T A;  3IEV A;  3N54 B;  3IEU A;  2OPL A;  2E8E A;  5BSV A;  1I94 C;  5KYT A;  1HNW C;  4D4I A;  2F4V C; 
#chains in the Genus database with same CATH homology
 4LFC C;  5KEI A;  4HPV A;  5AE1 A;  5H9U A;  4JI7 C;  3LNV A;  5IT9 D;  4DV6 C;  1XRA A;  3A9U A;  3DAY A;  1FUG A;  4BBY A;  2YWC A;  2VSQ A;  4DV2 C;  3TUF A;  4TPS B;  3R44 A;  1MDF A;  4OYC A;  5A19 A;  4IZ6 A;  4FUT A;  2ATW A;  4RLF A;  2D28 C;  1HR0 C;  5BSM A;  3I08 A;  3J80 D;  5AE3 A;  2EGT A;  4JI1 C;  3OTO C;  5T8S A;  3T1Y C;  2OPL B;  4RM2 A;  5BUR A;  4FUQ A;  1RG9 A;  4PRO C;  4NOZ A;  4K0K C;  4DV3 C;  2PRO A;  4G37 A;  2YWB A;  2ASB A;  1USP A;  3NYR A;  4NDN A;  4RVO A;  3AF6 A;  1O92 A;  4WS9 A;  4YY3 C;  3IPL A;  3CJE A;  2PT7 G;  1KKG A;  3ETO A;  1ULT A;  2YCB A;  4DCS A;  2P2Q A;  1MXA A;  2E7G A;  2P02 A;  2UXB C;  1BA3 A;  4RLQ A;  4B3R C;  4DG8 A;  3E7X A;  5BUQ A;  2UXC C;  4AQY C;  2ONF A;  1VLA A;  1N34 C;  4MTN A;  3FCE A;  3LAX A;  2VZE A;  1QM4 A;  4KHP C;  1P7L A;  5CZX A;  2QW0 X;  1XNR C;  2P20 A;  5ADZ A;  4DR7 C;  1MD9 A;  3EQ6 A;  1ZB9 A;  2XR1 A;  4DR1 C;  3RG2 A;  2QVX X;  5BR8 C;  4BCA A;  4L7I A;  2P2M A;  2D27 A;  1MXC A;  4JV5 C;  3PRO C;  3GR0 A;  4PHT A;  2D1Q A;  1T5D X;  4X64 C;  4L4Q A;  4YHH C;  3VNQ A;  3PES A;  4ZLP A;  1V25 A;  3S82 A;  1IBM C;  5CZV A;  4OX9 C;  1FJG C;  1O93 A;  4ODJ A;  4D56 A;  5BSR A;  1L2F A;  2HJG A;  4GS5 A;  3TQI A;  4LF5 C;  4I9F A;  3T1H C;  4DR2 C;  3DHV A;  3I07 A;  3R9X A;  5JRH A;  4NXM C;  4GXQ A;  1WH9 A;  1RY2 A;  4LF7 C;  4LE5 A;  3B7W A;  5KYV A;  1MKY A;  1EGA A;  3CW9 A;  5AE2 A;  1GPM A;  1HNX C;  1O90 A;  2P2F A;  4DUY C;  4L2Z A;  5FLX D;  4G1I A;  3NYQ A;  4D57 A;  4B3M C;  5T8T A;  1PG4 A;  3GR1 A;  5BSU A;  5A2Q D;  3UZ0 A;  3VNR A;  2E8F A;  4BSZ A;  4KTT A;  4DV4 C;  1N33 C;  2V7B A;  3VNS A;  4DR4 C;  3CW8 X;  4FTF A;  4OXI A;  4JM1 A;  1HNZ C;  1J5E C;  1USP B;  4R1L A;  4DCT A;  1N36 C;  1NYE A;  4B3S C;  4U5Y D;  2CY1 A;  2P2B A;  4DUZ C;  4R1M A;  4DV7 C;  1MDB A;  2UU9 C;  4RM3 A;  4DR3 C;  4LF6 C;  1LCI A;  3A9V A;  3NPD A;  4LFA C;  4JYA C;  2UXD C;  2KZF A;  4RVN A;  4DR6 C;  1IBL C;  3L8C A;  4JI5 C;  2BH1 X;  4BC9 A;  5LMN C;  1HH2 P;  4JI2 C;  1ML8 A;  5BSW A;  4X65 C;  4EAT A;  5BUS A;  4NXN C;  4XX2 A;  1YJ7 A;  3IML A;  1T5H X;  4X66 C;  1IBK C;  4JI3 C;  3RV2 A;  2QVZ X;  2E8C A;  1V26 A;  1JOS A;  4PZP A;  2HHH C;  3H2T A;  3EER A;  3G7S A;  4WV3 A;  2VQE C;  3JAM D;  1ZB8 A;  3FCC A;  2JMP A;  4R0M A;  2UUC C;  4X62 C;  1XNQ C;  4LFB C;  5IFI A;  2ZM6 C;  2D1R A;  1O9T A;  4DV0 C;  4DV5 C;  2QVY X;  4GKJ C;  3NI2 A;  3AF5 A;  1XMO C;  3SO4 A;  3GPC A;  3GKU A;  2Y4N A;  4ZJZ A;  5A1I A;  4I9G A;  4JI8 C;  1XRC A;  2Y27 A;  1XMQ C;  2AYA A;  3R9W A;  1PA4 A;  3L95 X;  4DR5 C;  2DYJ A;  3LUS A;  4DV1 C;  1LQL A;  4IR7 A;  5GTD A;  4DG9 A;  2UUB C;  2P2J A;  5IWA C;  1AMU A;  2VQF C;  1MXB A;  2QL8 A;  4K0B A;  4GKK C;  2Y4O A;  3TDE A;  3DLP X;  5LMU C;  2WD9 A;  1XRB A;  4KTV A;  3J81 D;  5E7Q A;  2PN2 A;  4JI4 C;  3N2Q A;  2OBV A;  4LF8 C;  1N2F A;  3LGX A;  1WF3 A;  3KXW A;  1UKK A;  5DV9 A;  3A4I A;  4MH4 A;  2D7V A;  2E0G A;  3ETC A;  4BC7 A;  2UUA C;  2E5L C;  2DPL A;  3PBK A;  5K8F A;  5K85 A;  3UOW A;  3C5E A;  1QWI A;  2BJO A;  4JI0 C;  2WP0 C;  2D1S A;  2OO4 A;  1K0R A;  4D4G A;  4DCV A;  4JI6 C;  2CXC A;  4GXR A;  4DCU A;  5BST A;  4B3T C;  4LF4 C;  5A1G A;  3E7W A;  4ISB A;  4LF9 C;  4G36 A;  1PG3 A;  1N32 C;  4RMN A;  2D1T A;  3IEV A;  3N54 B;  3IEU A;  2OPL A;  2E8E A;  5BSV A;  1I94 C;  5KYT A;  1HNW C;  4D4I A;  2F4V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...