4DCSA

Crystal structure of b. subtilis enga in complex with sulfate ion and gdp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
433
structure length
406
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
total genus 131
structure length 406
sequence length 433
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcsA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA01
2F6RA 2D7CA 2VO1A 1ZD9A 4URWR 4JYCA 1T5LA 4HAZA 1WXQA 1E79A 5JI3E 1NF3A 4K0KC 1CP2A 2ZE6A 5DYIA 1G1MA 621PA 5DH9A 4JIMA 5DYGA 4A36A 2OLKA 4PPGA 4GMXA 2FJUA 3K0CC 3Q85A 1CJMA 2DFTA 3VKWA 2VQSA 3VFDA 2NO9A 5CIQA 5EQTA 2GZHA 4LZZA 1D9ZA 4JLPA 1M7GA 1GWNA 1U8YA 4HDQB 5DN6D 4BASA 2EYUA 2F3RA 2NO0A 3P26A 5EP2A 4AYWA 1PJRA 3NWJA 3AP3A 1T0HB 2G0TA 2QGZA 4GZMA 1ZUHA 1Q21A 1FUKA 5LB4A 3PR1A 3DHWC 4B33A 3C41J 4JLOA 1WF3A 3JZMA 4I99A 4B71A 1II9A 1MO3A 1XMOC 3BIFA 2DFKB 1GOTA 4BFUA 2CCJA 4GT1A 3I62A 3MFYA 2HLDA 1G3UA 4DR6C 1LS6A 1OXTA 5G40A 1EX6A 1RRCA 3PCRB 5EP1A 1KI8A 2QRZA 4TL7A 4CDGA 3A36A 1VIYA 1TAGA 2NO1A 3ZZUA 1ZM7A 2JCSA 4JT2A 3K0FB 4JLNA 5KSYA 4LWZA 2W6JD 3TIFA 1JPNA 4OHXA 4KITB 2IYXA 3MJRA 1YU9A 3FYHA 1VTKA 1OHHD 2D7VA 5CJPA 4CEJB 4HATA 4PAMA 4KBGA 5JSZB 1N5LA 3PITA 3IO5A 3GMTA 4JSYA 2JJ8A 4NKRA 3F0TA 1QZXA 1P72A 4UNNA 4M1MA 1SXJA 2J7PD 5DN6A 3X2SA 2AXPA 4M8NE 2FSGA 3IQXA 4JKYA 4B2LA 4D82A 4CEHB 2OG2A 1SKYE 4K81B 3T5GA 1W36C 5FOXA 2BJOA 1E2NA 3E5HA 3VTKA 4B43A 1TL7C 3RSOA 4ZI3A 2QI9C 1M1YE 1P73A 2YHSA 4NYJR 1R0YA 3RS2A 4QJ5A 1DADA 2EWVA 3SJBA 2KJQA 2NZ8A 1HR0C 3ND8A 4HAWA 1LW7A 4PFSA 4YONB 3VX4A 1E2LA 1U98A 1UJ2A 4JLDA 4GOXA 3GLIE 1KYIA 1SVKA 1NY5A 3HDTA 1MO6A 5GVRA 2Z4SA 2V3CC 5DI3A 4AI6A 2JIZD 4Q9LA 1MRSA 4B2PA 1XD2B 3K9NA 4X8OA 2EFDB 4B3GA 4Q5IA 2IT1A 3QJYA 1OSNA 3ZS8A 2ZJ5A 1NY6A 2V9PA 4Q9JA 4BZPA 3SN6A 4V0NA 4C0AC 5J40A 2E5LC 4KHPC 4B35A 1XPUA 3W8NA 2V4ZA 2MMGA 3WP1B 4E07A 5AUOB 2H7VA 2G3YA 3BOSA 1E6CA 2ONKA 3KQNA 1QHSA 1XD9A 2L0XA 2GF0A 2YNMA 4V0OA 4C9BA 4TWZA 3E2IA 2ZE7A 3W5JA 2ZSBA 3U7GA 3ADBA 2AK3A 2CMKA 4AYTA 1XXHB 1OJLA 1G4UR 2GXUA 3VQTA 2J0QA 1AQUA 2CL7X 3C15C 3SJAA 4QJ4A 1V5WA 1WMSA 2UKDA 1L2TA 2ZU0C 3U7HB 1G17A 2QN6A 4B34A 1OIXA 3KJGA 1KJYA 2EFGA 1L4UA 1G7RA 1FP6A 4EPVA 4LC0A 1E79D 3CR7A 1DS6A 1OE0A 3TUJC 2EWWA 1XEXB 1HNZC 2ATXA 4Q47A 4URXR 1GAJA 3EWAA 4L15A 2N1BA 2ZRFA 3RNLA 1AQYA 2I1QA 1TMKA 4TMTA 3KUCA 1NYEA 2W00A 2DBYA 5C4GB 5C46F 3UKDA 3BFXA 2GHIA 3CF0A 3IPYA 4B47A 4PAQA 4WAUA 3R9WA 1RYFA 1ZVQA 3FMOB 4YMSA 2H16A 1UBGA 2I1VB 1E9AA 3CX6A 3KKMA 3NEJA 3AKCA 4O2LA 4DR4C 4OQFA 1NMYA 3OE7A 3Q9LA 4LF6C 4K46A 1FFHA 1XTJA 2FFHA 2IS4A 4PZLA 4NXNC 1LS1A 4EPRA 1KAOA 4JBXA 1SGWA 2IXFA 2BJVA 3FMFA 5CIWA 2ORIA 1E9DA 4IFEA 2PJRA 3AF6A 3BGWA 1P60A 2G77B 4PC7A 4GP6A 2QBYB 2D3WA 3B1ZA 1UPTA 3R20A 1E2IA 1U2RA 1FQKA 2O0JA 4XVQA 5A0FA 3ZYCA 1JEEA 1KI3A 2QMOA 4OHYA 5EP4A 3SQXA 2HCBA 2VP2A 4DCUA 3RYTC 3T1QA 1PUJA 1YR9A 2RMKA 3NHBA 3N5CA 2ZRPA 1Z0KA 5FR2A 521PA 3BB4A 1S4QA 2WJYA 2BMDA 3WXMA 5JEDA 3KJHA 4XSGA 1OHHA 4A9AA 1Z07A 1M8PA 5CYPA 1HH2P 2E7GA 1NG1A 2IYZA 3MG9A 5CK4A 2V1UA 3DM9B 1RIFA 1WH9A 3E70C 4LBYA 3IPXA 1OB5A 3PJRA 2IS6A 1GFIA 1IBLC 1YRBA 4MH4A 2F1RA 1U94A 3THXA 4EPXA 1TQDA 4RD2A 1OF1A 4A2WA 3I92A 1E9CA 1YRAA 1DAIA 4M1YA 1HT1E 1SZPA 4M1WA 3TSZA 1D6JA 5B58C 4JI7C 4AG5A 4R71A 4KFRA 4MKHA 4NYMQ 4DC9A 2YWEA 3DPUA 4LJ9A 3DMNA 2P5TB 2XEXA 4R98A 3RAPR 1ZC4A 5L8VA 3LWNA 5DE3A 1IY2A 2FDCA 2B8WA 1AS0A 4M4SA 2D62A 3LBIA 1T3LA 5EXPA 2JIZA 1N3BA 3D7MA 1W4RA 4HB3A 3IGFA 5DNYB 4DUGD 4YXWD 2FZ4A 4KI0A 2ZUBA 3MAAC 3EA5A 4TZ0A 2YVUA 4GP7A 4IVPA 4BECA 1OV4A 3NIBA 4A6PA 4JL8A 1IOZA 2WWXA 3SOPA 2ZM5A 5HZHA 1P2VA 1W44A 3FMIA 4Q4JB 1ZRHA 1XNRC 5FUYA 5FPSA 5LD2C 3KQLA 1BYIA 1E0KA 2MSEB 2DWQA 2CVFA 2VF8A 3FB4A 5KO2A 1EFUA 3BFVA 1TNDA 3WYAA 1SXJD 4NH0A 4PR0A 5BW8A 2FWRA 5H8WA 1W0KA 4KAXA 3ADKA 2C99A 2JJ2D 4AKHA 4S2EA 1S8FA 4AG6A 1S3SA 4QC2A 4ESVA 2YWFA 2JDID 2QAGC 4Q1BA 3VKGA 2WICA 4KBFA 2XNDA 1I2MA 4U00A 2WWYA 2O8DB 2VQEC 3GLGB 3GLHE 2PZEA 3FDIA 2W6JA 3FGNA 1UKYA 3AM1A 4PHFA 1SVLA 2DPXA 1NJGA 1G19A 2IK8A 2ZSFA 4RZ3A 1N5JA 5CYOA 4M22A 2DR3A 2V55B 2O52A 4A6XA 2LCFA 2IA5A 3GEEA 4R2HA 5EXXA 3FWYA 2OILA 3TR5A 2CJWB 3VNVA 2C95A 1U9IC 1XD8A 2A5FA 4DLXA 3IO3A 4Z8XA 4G5OA 1ESNA 1JEDA 1OXSC 1ZNYA 4JVNA 4AY2A 1NKSA 1VCIA 2FPLA 4E03A 3V00A 3H4MA 2ZU6A 4LHYA 3RS7A 2EFEB 4PO1A 2GILA 3SQWA 1H8EA 1WP9A 3LX5A 4DCVA 4JJKA 3CRQA 1G7CA 5KPDA 2D74A 1TX4B 3I5XA 2QAJA 4I4LA 1NN1A 1KI9A 4CEIB 2CCKA 4AD8A 5JMTA 4C0JA 1TF5A 1NI3A 1EG7A 5KDDA 1MV5A 2P5SA 3WHLA 4QNMA 1BS1A 3LBNA 5LD2B 3BBPA 1XF9A 1JR3A 1FUUA 5EZ5A 2IWRA 1OFHA 2QNRA 4EFMA 2YYZA 3DZ8A 2AWOA 4HAYA 3K1JA 5JJIA 2WHXA 4Q7MB 1XZPA 2V8OA 3QXXA 2OBMA 2CCGA 4L5BA 4RKEA 3GLFB 4O3MA 2ZE8A 1II8A 3DZDA 4EPTA 2ZVQX 4XTRA 4IW3B 2HT6A 3DKVA 3MUFA 3NBXX 3P1JA 2ZJAA 2NTYC 4LV5B 3EW9A 4RD0A 2W0MA 1P6XA 3GLHA 3RC3A 4LV6A 1DARA 2OCAA 1XTKA 4ZIRB 3AF2A 4DJTA 3TUIC 4LJ8A 2J0UA 4FMBB 1Q12A 4NYMR 3ZZ0A 3KTAA 2WVJA 4Z51A 4DV2C 3AKEA 3KTAB 3K8YA 2GCPA 4GKKC 1F2UA 1IJFA 2PEYA 2BVNA 1T9HA 2KE5A 3KXLA 2JLYA 5K8TA 4GL2A 4AKIA 3Q7QA 5JFGA 3WNDA 1SHZA 3LDAA 3LW8A 2YOFA 4DBLC 1XNJA 3X1DA 4YXWA 1AKEA 4DUGA 2TMKA 2ZREA 4EJSC 5HZKA 1KDPA 3K0AA 1VIAA 2KZFA 3HJNA 4TLEA 2GJAA 3K0AB 2ZVPX 2R6FA 1UADA 2OXRA 3PG5A 4ESHA 2RAPA 4PQFA 1N6LA 5LB2A 2XGJA 3K0FA 5FOVA 2D4HA 1PA4A 1IXRC 3ZQ6A 1F3OA 1M6NA 3R9XA 4P4TA 1XU4A 2ZRNA 3R8FA 5JJKA 2WZQA 4US2R 2ZSDA 4ITRC 3SC3A 2WMOB 2QTHA 2JA1A 2RGBA 4LY6A 1USPB 2RB4A 4A15A 1LTQA 1RRGA 4MRNA 1S96A 5DISB 4EFLA 4ERNA 5A5GA 1KSFX 1AGRA 4Y0AA 2PH1A 1W0JA 4IOKA 2J7KA 2CE7A 3AVQA 2C77A 4LYAA 3VR5A 1XEWY 2C98A 3NH9A 2UU9C 2ZSEA 4EPWA 3S1AA 3A37A 4LBZA 2HXYA 4A8JA 5FOWA 3LY5A 3UMRA 4JLVA 4TMVA 3B1XA 1NVWQ 1XCGB 2JMPA 1NMXA 2FSIA 2GF9A 4JI3C 3I8SA 5AJXA 3VR3A 3B2EA 3ZLJA 3UXMA 2XZLA 3LH5A 4FWIB 4KO8A 3U6BA 4CGZA 1T3HA 2IEYA 2I4IA 5KTYA 4IHQA 4PC6A 1OLOA 2BMJA 4DLVA 1RKBA 1E1RD 3LUSA 1LNZA 1UKZA 2QG6A 4ZKEA 4YMVA 1OH5A 2V6IA 3O47A 2REOA 1UKEA 3EWSA 2YWGA 3OIUA 5KDOA 5KNBA 4UNSA 4DV6C 2BOVA 1OKKD 8OHMA 4BZQA 1GKUB 5AJVB 3CLVA 4FCWA 4E5UA 4QL3A 5H68A 1G18A 2WJHA 4JLBA 4UNPA 3SU8A 3QBTA 1DBSA 4FMCF 4LBVA 4OX9C 1ESMA 1S1CA 2IBMA 4UNRA 3AKDA 2ERXA 1CXZA 4QGGA 2H1LA 4ZDWA 1QHXA 3K9HA 1QRAA 4OI4A 3AB3A 2WTUA 3JAMD 3TMKA 1KO4A 1ZYUA 2XSZA 2ZXUA 4HYYA 5B2ZA 4MDFA 4LJ6A 1NIJA 4BFYA 1IBMC 4AWXA 4IDHA 3IIKA 2G88A 3B82A 4Q1FA 5DHFA 3TSWA 2UXCC 2ZYWX 3GJ0A 3KFVA 3PVSA 4RSGA 2VPPA 1W5SA 2CXXA 2WJGA 4NP6A 2H8KA 4U02A 5CLLA 3VX3A 2QU8A 4DRZA 4B3FX 3NBYC 2OBNA 1FNNA 2J1LA 1H65A 4AYXA 3BORA 2HCJB 1Z6AA 4HB2A 3UK6A 2VLIA 1IY1A 3K9LA 2F7SA 4S35A 2ANCA 4GI7A 1HNXC 2WWHA 1PUIA 1YKSA 1ETUA 1YZNA 4BLOA 5FFMA 3GLFE 1U8AA 5K8IA 4OQMA 1ELOA 4DT1B 4V0KA 4YDHB 5KYKA 2R8RA 1R5BA 2N42A 4D80A 3F3YA 2O8CB 5G3ZA 4GZLA 1CBUA 3CNNA 3OESA 1S9DA 1XMVA 3QQ5A 2ZE5A 2ZI7A 4W5WA 4LRWA 1N32C 3EG5A 3C7KA 2BEJA 3KKOA 2FGJA 1XWIA 2OAP1 3QENA 5CB6A 3AVXA 2O8BA 4ZPXA 5KNCA 1P9RA 2HUPA 2X19A 4IDPA 4PO9A 4DXAA 3HWSA 3ZIAA 4O25A 5K8LA 1MKYA 1Q44A 2Q3MA 3QXSA 4Q19A 1KK0A 3A1TA 1E1RA 2GVDC 1NNEA 1IQPA 2QPAA 1KKGA 3GFOA 1JR3E 3MD0A 4XD7A 3RHFA 2AD1A 3CH4B 2GK7A 4JI1C 1UEJA 2GZDA 4URYR 1XD2A 4WZBE 5FBLB 1VG0B 2WIBA 2VP9A 3PEYA 1ZIOA 1Q1ZA 1Z0IA 3TJZA 221PA 4LHXA 1JQJC 5AUNB 1N6RA 1E9RA 2DYKA 1XCPA 5AUPB 3CIOA 2HF9A 3AVUA 4BE7B 4OHZA 1ZB9A 3MWKA 1OXXK 2V7QA 3OEED 4OK3A 3SYNA 1GNQA 3IHWA 5F3WB 2C2HA 4O2RA 3TH5A 3TGPA 4ARZA 1JAHA 4DCTA 3FVQA 1TUIA 3EZ2A 1J99A 1NP6A 2QMEA 4LPSA 4OL0A 1AS3A 4RCZA 4XJXA 3U3OA 4PHGA 4DWJA 1G6OA 2ZR9A 3K9GA 1N0WA 1NLZA 1YR8A 3N70A 3BFKA 4OBEA 3AQ4A 1CIPA 4LJ7A 4X65C 3GLIA 3AP2A 4LDJA 4TLAA 4TL6A 1KI1A 2IYYA 1JNYA 3ICQB 3ZS9A 1K8RA 2EFHB 3TAUA 4OQNA 4Q9HA 1KI6A 4JKIA 4D4KA 3OEHD 1EFHA 2JLSA 2BIFA 3M6AA 3QBVA 5JS8A 4Q48A 1ZM3A 1AGPA 2B6HA 4MYCA 4DLRA 3T5DA 4BLRA 1TQ2A 4BFVA 4IJMA 3WYFA 2DYJA 1KJWA 1SXJE 1A4RA 2OPLB 1YR6A 3C4JA 1WBDA 3AVTA 1CS4C 2GRJA 4KFTA 4PQYA 5JLJA 4BEJA 1U81A 1IY0A 2IEZA 4DR1C 3LXXA 2Q6TA 1G8YA 3QPWA 4P32A 4MDEA 5LMUC 2ODNA 1R10A 1OIWA 1P3JA 4L16A 1T8UA 2PN2A 2PZFA 1G3QA 4B44A 2WMNB 1E1QD 4NHOA 2GCOA 4C0KA 1VECA 1TU3A 1UAAA 3U60B 1XTIA 2CE2X 2CHGA 1DAFA 2GZAA 1JB1A 3ZDQA 2ZS8A 2CK3D 3PEUA 1KO5A 3GJXC 1CJUC 2E1RA 2Q0HA 4F38A 4IEEA 2ASBA 1E0JA 4M9SA 1Z83A 3GJ5A 5JWOA 5JBQA 1ZNZA 4C0BA 1GRRA 5D3QA 1XEWX 3NDPA 2FSFA 4OQXA 5J47A 4TZ6A 3C8UA 3GJ8A 5JRZA 3O8CA 2KB0A 5L3VA 4WXPA 4NDZA 2YCBA 4NOZA 2QRNA 1S1MA 3W6NA 3AF3A 4MYTA 1KO7A 1K0RA 4NL4H 4BRWA 1LF5A 1E9FA 1J8YF 1IN7A 1CLUA 2HDNB 3H2YA 3UATA 1J5EC 2A3RA 4LHWA 1RZ3A 5CDFA 1S2MA 2EW1A 2GAOA 1TF7A 3QKRB 4IDNA 3OTOC 1M2OB 2GBLA 1KY2A 3L43A 3CBQA 5J4VA 3SDZA 2DY1A 1GNRA 4RJLA 1FMLA 1P2TA 1ZBDA 2IYLD 1FPMA 1MR3F 2YKGA 3SBEA 1QG2A 4EJSB 1O87A 1YQTA 1KK2A 1T0JB 1Q3TA 4OQLA 3O8RA 2BKEA 5BQ5A 4MYHA 3EPHA 2GEVA 2VHQA 4Q9KA 1KK3A 1EFRD 3EPJA 1RRFA 5ANRB 3UG7A 3KQHA 3ZQJA 4A2PA 3GJ7A 4RCYA 1VPLA 2ORVA 1KMQA 3VR4A 2OFXA 2VSXA 3LFUA 3RC8A 1TUEA 3EARA 4HLUA 1AS2A 1RJ9A 4PPQA 3WHKA 2CNWD 2JLXA 1G8FA 1DPFA 1G8GA 3HPQA 1E2EA 1LY1A 1FJGC 4DR5C 2VH5R 4A0RA 4LJ5A 3W9YA 4LFBC 4LGMA 4JI5C 4GBMA 1UKKA 4RY2A 5DGXA 2WPDA 1IN5A 1US8A 1NVVR 3CRRA 3DO6A 4PANA 3B5JA 2ZRKA 4DVGA 1P9NA 4I1VA 1IN6A 5CB8A 5J4YA 5KOYA 2QT1A 4DLYA 1H8HD 4WW0A 1NBMA 5IK2A 2XTMA 4HZUB 1PVOA 3QF4A 5SZIA 1XTRA 3THYA 2QSYA 4LYJA 2JJ2A 2KSQA 4DR3C 2E8FA 3P27A 5GJWC 3Q8XB 4BEBA 5BWMA 5JZVA 4Q02A 2QORA 2QROA 5HPYB 2OUKA 3R9IA 4D2IA 4U7DA 2P0EA 1OYYA 1OFIA 1PLLA 2H92A 1RC8A 4BQSA 4NYIR 1XTSA 3QPVA 2A5JA 4MRRA 3TW8B 3UMSA 4ZDIA 3I61A 4H1VA 2VQFC 2ONJA 3RDPA 4X8MA 3LA6A 1CR0A 4R9UC 3GLFA 2OO7A 1IBKC 3RWOA 4NXMC 3BH7A 2IX3A 5F9FA 2BDTA 1AA9A 1EK0A 2OV2A 1N0VC 4FIDA 3T34A 5DHAA 1LVGA 1VCNA 4DV5C 3EPKA 3MSXA 1T5IA 1DAGA 1U0HC 3I32A 3Q7PA 4TYPA 4HAXA 4US1R 3KUDA 2QY9A 3QVVA 4IKEA 2VL7A 3EIHA 1BOFA 5FBVB 4TMWA 2OFWA 4DIEA 3I72A 1PLJA 1L4YA 4Q7LA 2Z43A 4HI0E 4FINA 4JI8C 3GP8A 1E4VA 5DO9A 1F2TB 1U0LA 4BLQA 2C03A 2NPFA 1HUQA 4E09A 1AZTA 1J70A 4HDOB 1P75A 1RRPA 4Q1DA 1W47A 1CRQA 1N0UA 2R9VA 2BKUA 4CEJA 3CF2A 5FUXA 3R7WB 3D8BA 2JLVA 3THOA 3IBGA 3KKNA 4CEIA 4XTCS 3OZXA 1NMZA 2B7CA 1Q22A 2LWIA 3IUYA 1N36C 1KMHA 3PUZA 4KFUA 3KQKA 1DE0A 1Z2AA 3SFZA 3SEAA 3IEVA 1P9WA 1YZQA 4P0TA 2UXBC 2QPTA 1D5CA 3A58B 2AL7A 3SBDA 4W7SA 2JDIA 1GG2A 4XH9B 3SFVA 4IDOA 5EUQB 3VHXA 2XB4A 2ZJBA 4FI3C 4NCNA 2C9CA 1KAGA 2E8EA 3HR7A 4OJKA 2J3EA 3LNCA 4JLJA 2E87A 3CNLA 1VDZA 1IXZA 1W5TA 2BJWA 3IQWA 1D2MA 4HUQB 2W6ID 3IKJA 5H70A 2RGAA 2PT7A 2HV8A 4NCKA 1M7HA 1II0A 1II8B 4JL5A 4DV4C 1FP7A 4D0GA 1I4TD 2E8CA 3RABA 2H5EA 2O0KA 1BMFA 1QHNA 1G9XA 3RRYA 3VNUA 4XVRA 3FOZA 3O8DA 2OLJA 5CJ2A 4M9XA 2WAYA 3W34A 1N6IA 1UBCA 4AURA 1LQLA 4B3RC 5L3QA 3EPLA 4TYQA 3UIEA 2EFCB 2CY1A 1G8HA 4GOKA 3KZ1E 4C0HA 2YOGA 1MABA 4YMTA 3T1VA 2PEZA 1MH1A 4NTZA 4BRUA 4DB4A 4Q4HA 3F8TA 4LJAA 1CJTC 2PX3A 1Z08A 2A30A 2IHBA 5FBQB 1GM5A 3U3RA 4TMKA 4XSHA 1R0ZA 3A6PC 4WA7A 1N6NA 2XITA 1P2UA 1Q0UA 1E2QA 4IOMA 4P33A 1G3IA 3FFBA 4OHVA 4NPHA 1P5ZB 3AP1A 1TQ4A 2Q9BA 2VHTA 2Q9CA 2NO7A 1N5IA 4I81A 2JAQA 1SHKA 3IIMA 2VTKA 4HB0A 3VAAA 3WMGA 4B75A 1G5RA 3AVOA 2QGNA 4NBSA 2X1VA 2WIAA 5FTLA 2QE7D 2OESA 3PIRA 1N5KA 4TQ9A 4JV5C 1IM2A 1X8KA 4DSTA 2ZANA 1U99A 2AXNA 3NBZC 2WJJA 4OI2A 3W5IA 4LSGA 3B85A 1R5OA 4D26A 4LBWA 3BH6A 1QVRA 4B2IA 3ND9A 3NTUA 1LV7A 3TSOA 1CJVC 3UANA 1IONA 4BSZA 1Z8FA 1ZNWA 4LF5C 3C5CA 3DMDA 1GKYA 1XPRA 1GKIA 1NIPA 3FKSD 4UJ5A 5C18A 2GDJA 3CUEF 3NXSA 3OHMA 4Q4AB 1Q1BA 1SXJB 4Q4AA 2VP0A 2P2LA 3H86A 5A4JA 2RKOA 2ZRJA 4FW9A 2LKCA 5AUQA 3B7GA 3REGA 2R65A 4QM7A 4JVLA 3KFXA 2ZJZA 3FE2A 4OK6A 2XXAB 4RKFA 2NPIA 2FGKA 1HH4A 5KNDA 1SKQA 3L0OA 1QG4A 2CL0X 4G3XA 2FFBA 2FPMA 3TBKA 2GJSA 2ZS7A 3MWYW 2P67A 1J90A 4ACBA 1VHLA 3K70C 3GQBA 3ONWA 4HUTA 5KHOC 1H8HA 4MKGA 5IK2D 4WVFA 3HR8A 1GDDA 2A5DA 3BK7A 3NH6A 4QRHA 5JEEA 3WP0A 4JBWA 1RE0A 3X1WA 3B60A 2WSSA 1KJZA 3SYKA 2N46A 5CITA 1PLKA 2AKYA 3RLFA 4US0R 2GXSA 4KJZA 1SVMA 3BXZA 1DVRA 5FTKA 2NZJA 1A7JA 2IUUA 2BCGY 4JLAA 1F48A 2ZETA 2P6NA 4QBFA 3W6OA 5FTNA 4G5RA 2ZRAA 2RCNA 3ZVLA 2OCYC 4C30A 4PAOA 4B6EA 4Q18A 3NBFA 4C7OA 1CR4A 2QAGA 1EXMA 1OIVA 2J45A 2DWPA 2QP3A 4KFSA 2KBEA 3B1VA 1LB1B 4KYIB 2JJ1D 1UF9A 1OPXA 2X77A 2GKSA 4GPTA 2OBLA 4A2QA 2BBSA 1GTVA 3BRWD 4AIIA 1A5TA 3AV0B 5CM8B 3GJ3A 2IYUA 1ZCAA 3WBJA 2HJVA 3B78A 4NYIQ 3BD9A 3QXHA 2XZOA 1XJCA 1SVSA 2V1XA 3T06B 1JJVA 1LF0A 1Z0JA 1U9IA 5TVKA 2BBTA 4NONA 3VR2A 4E22A 2J87A 1P2SA 5TDHA 4ZKDA 4ZI2A 1E9BA 4B3DA 4DHEA 1DTSA 4JS0A 2FMXA 2Q9AA 1VG1A 1PZNA 1OH8A 1QHYA 3NC1C 1TPZA 4WXRA 3N2EA 3H1TA 1Z6GA 5HCNA 2PBRA 4II7A 4NU0A 4DV3C 3SHWA 4AC9A 4QJ3A 2Q21A 3QXCA 4GNKA 4D81A 2D2FA 3AVPA 3ZJYA 2ECKA 2EVWX 1VMAA 3MLEA 4LX0A 1Q3HA 3WMEA 1FZQA 3IIJA 4TT3A 5CDFE 2H17A 3A4LA 3LVRE 2D06A 3ZGXA 1WCV1 2F1JA 3T1OA 1JR6A 4LF7C 3B13B 1KI6B 1NRJB 2F43B 2KI5A 3U3JA 1OKKA 2AWNA 2FZLA 2PZGA 1ZNXA 3PEWA 4DB2A 2X2EA 5FPHA 1HE8B 1E69A 4FMDB 4DLWA 4BZXA 2OCBA 3QF7A 1K6MA 1BYUA 1ML8A 5JJLA 2A78A 2ZITA 3KJEA 1GL9B 3EASA 4OYHA 4P4UA 4DCNA 3LX8A 1QF9A 2BMEA 5IT5A 2ZR0A 1XB2A 3OAAA 1I4DD 3NEYA 4KCGA 5JI2E 3J81D 2X8AA 2ZPTX 5FPTA 4GOJA 2F55A 1HE1C 2JLWA 3RS5A 2IF0A 1JXOA 1ZB8A 1XBTA 1NN5A 1KKLA 1MO4A 2WKPA 3OFNA 4F93B 1NLFA 3ZH9B 4HEJA 3ICEA 3A8TA 1Z5ZA 2G1KA 4URVR 2JGNA 3QOFA 1EFRA 2LKDA 4Q66C 4OK5A 1E98A 4B48A 2EYQA 2XR1A 1YZKA 2RGNA 1TF2A 3QUSA 3CPJB 2WJIA 4TMXA 2QP9X 4UQOA 1XPOA 5JCPA 5J5CA 4YMWA 3TKLA 3JVUA 1FMJA 4IVRA 4YC7A 2ASEA 4W5JA 1DOAA 1MT0A 2UZIR 4FMCB 4OKSA 2CJWA 5KDLA 5FUVA 3VR6A 2O8DA 2FEOA 1BO6A 2CLDX 3I4LA 2ZI6A 2O0HA 2R6AA 4ILEA 4Q01A 3ZVNA 1L2FA 4EDHA 3AUYA 5DIFA 1XDBA 1E3MA 2GEUA 2ZRGA 1ZU5A 3IILA 2BWJA 1ZW6A 1YE8A 2Y8EA 1YZUA 4UJ3A 2PT7G 1R8QA 1IAQA 3PFIA 2IWHA 3KL4A 2HXSA 1KIMA 2G1JA 3C14C 4EQ6A 1IJEA 1Q1EA 1JAIA 1W1WA 4NZYA 5DSZA 1RJ9B 3ADDA 1NSTA 4MKFA 2AFHE 2C96A 1Q20A 3CPEA 1N6OA 3FFAA 5AJYA 3CM0A 1Z0AA 2RGXA 2ZI5A 3A1VA 1OT3A 4TSFA 2ODBA 2CK3A 2XTNA 1QVAA 2IL1A 2OSBA 3DOFA 3OFND 4MGIR 1DEKA 4HB4A 4JVMA 5JS7A 3JVVA 3BERA 1VCMA 4N0DA 2HYIC 4TTPA 3CJEA 1E1QA 4LHVA 2NMVA 4QFMA 1OB2A 1G4AE 4L8GA 2GESA 2CDNA 2WBLC 2ZUCA 4URZR 4YDSA 4ZDKA 1ZM4A 1G291 1I94C 4D4LA 1P61B 4XWAA 3CW2A 1E2DA 5FTMA 3L82B 3SHFA 1ONBA 3F5FA 5KU1A 3BB1A 4PO8A 4BFXA 3U6KA 1YZTA 4KHZA 3CX8A 1COWD 5BN5A 4AKGA 2ZRMA 3TQCA 5FOTA 1KSGA 5FPKA 2ZTSA 1WBBA 2HF8A 1XJQA 4ZCIA 5FL7D 1Z06A 1VG9B 3SI7A 4M1SA 2QMUA 4ZIRA 1W49A 2QTFA 2IC5A 1Z0FA 3W90A 1ZAKA 4CRWB 4HZUA 2FG5A 4M9QA 2XTZA 421PA 2IYSA 1VYTA 1NBMD 5M04A 4TYNA 1ZP6A 2C04A 1RW4A 2FFAA 5EE1A 4CVNA 4EPYA 2QEQA 4X62C 3LO5A 3BAFA 1R6BX 3CRVA 5HKKA 4UKDA 2XB2A 4DDVA 3QE0A 1KDTA 4LCBA 4KSBA 2H18A 4F91B 5SZJA 2J0UB 4XOIA 4IFBA 3FPAA 1AZSC 2GBLC 2JEOA 1EWQA 1YZLA 2CLSA 3J80D 2F9LA 1F2TA 2QA5A 4ZO4A 1TTTA 4WZAE 1XXHE 5CK5A 3K09A 5CLQA 3LW7A 3NC0C 4DLZA 4PX9A 1E2HA 1HEIA 4PPNA 2QE7A 1XJ0A 1A2KC 5JECA 3ETLA 4UXJA 1KOFA 1UEIA 1KSHA 4WZ6A 4JLMA 5EJEA 2GVZC 3ZVRA 1KO8A 4B74A 2CHQA 3L2OB 3SS8A 4DEYA 1GP2A 4QHTA 2ZS9A 4HLCA 1CRPA 2FU5C 4HLUC 2GCNA 4MGZR 1HQCA 1W2HA 5JWRA 4AQYC 3CWZA 4F4JA 3GFPA 4A1FA 4QGFA 5HTKA 1OH6A 4KLNA 2JATA 5KPJA 4V0MA 5F98A 4GRAA 1QHIA 4TL8A 5H1YA 2RGGA 4MRSA 4KVAA 2W2XA 2YINC 1BMFD 1JR3D 1NN0A 4IXNA 4Y0VA 4B3XA 1SKYB 5BXQC 4D25A 2O8EA 4YQFA 1G7SA 3K53A 3BH0A 1T91A 3MMPA 4BUJA 5IHPA 1N25A 3CWQA 3CRMA 4CZ2A 3OAAD 2NGRA 1R2QA 1GRNA 4JZKA 4PPFA 5LPNA 2OEPA 4TSFD 4QXAA 2IS2A 1D9XA 2ZUDA 4PHHA 2AR7A 5E3HA 3CONA 2OXCA 4PSVA 5FOUA 2EU8A 5L3QB 3RRZA 3EC2A 2PX0A 3NKVA 4Q4HB 3QG5A 3J81k 4QHYA 3EERA 5FLXD 1N2FA 3BE4A 5GVSA 1W4BA 1DAMA 2OFOA 4K8OA 4DV1C 721PA 3CKLA 4Q7KA 2R6GA 4TTQA 5J4KA 4TT3D 4M9ZA 1Z3IX 2RGCA 1KI4A 1CR1A 4DSUA 2O8FA 1GSIA 1KGDA 3SE0A 2O8FB 1G16A 1Q1QA 1L7VC 5AJZA 4RD4A 2FSHA 2KWIA 2QL8A 2IS1A 1RPZA 1G5PA 5KSOA 3TNFA 4TMZA 3QI2A 3VHLB 1T3SA 4A0GA 2Q3FA 1SULA 1NVXQ 3MRSA 3EX7C 5TV2A 3LLMA 3UWKA 1XCMA 5IT9D 2W2TA 3N2IA 4W9MC 5D3MB 2QT0A 1HYQA 1EX7A 3PQCA 3IEUA 5FBWB 4Q00A 4B73A 1JOSA 4DR7C 4DT1A 4KV9A 4Q1CA 3HPRA 3S1AB 2CHVA 5FR1A 4QGHA 4PZZA 4V02A 2G83A 4H1UA 3QKSA 3B1YA 4F4CA 4M2LA 2AN9A 2R2AA 1ZD8A 3WMFA 3K70D 1Z22A 3L8ZA 4JBYA 2AX4A 2ERYA 4DUZC 2DWOA 4FWTA 4HSEA 5JSZA 4F7WA 2VF7A 2YOHA 1Z0DA 2HJGA 3NDBB 1EESA 5AK0A 4KSCA 3H84A 5JWHA 4DSOA 5BN4A 2REBA 1OYWA 4XD7D 3LXRA 2ZYUX 4PC1A 3DEFA 2WWWA 1VKJA 4D4JA 4LV8B 5EE5B 4U5XA 1W4AA 1NN3A 1Y3AA 2BCJQ 3WNCA 3UWOA 1VLAA 5HE8A 3U2QA 1KY3A 5IDVA 4Q7JB 1GITA 1QBKC 1K5GA 3K0CA 1FQJA 4KLZA 4PSKA 1NG9A 5TB5A 4C3ZA 1E9SA 2QAGB 2XAUA 5G41A 3SNHA 2BV3A 2DFLA 1IXSB 3CO5A 3WRXC 2RGDA 1NLYA 2WWFA 2QQEA 3QPUA 4QBGB 2OCPA 2F3TA 4R7ZA 2GTPA 1QWIA 3D6TB 3NVAA 4C4PA 5GADl 1MABB 4ARZB 4IOJA 1NSFA 1ZMXA 2PLRA 1ZUNB 2XJ4A 3B8HA 3VU9B 4G5QA 4B76A 2ZM6C 1UBEA 3A4NA 3L8YA 1CULC 4QBIA 1M7BA 3GD7A 2ZSAA 3AVYA 2XX3A 1OW3B 4A4DA 2A2ZA 3FKSA 2PT5A 2F1IA 2CNWA 3U61B 2SHKA 2G9NA 4MRVA 2BM1A 4MKIA 5BN3A 2WOJA 1C1YA 4DDWA 3Q72A 4LYHA 3I8XA 5EE9A 2ATWA 5AJWA 2FH5B 4JL6A 5FPYA 3LBHA 1R0WA 4RFSA 1G3RA 5L3SB 4DLTA 4RZ2A 4YY3C 3GJ6A 3P32A 1GZSA 2BM0A 5K8UA 1CU1A 5HR5A 4ASUA 2XJ9A 2GA8A 3M0EA 3CZPA 3KB1A 1E0AA 4BLPA 2PCLA 5BR8C 1XMSA 1TADA 1SVOA 5KSZA 4PSAA 1IN4A 3Q5EA 3QEOA 5TARA 4RZXA 2XNDD 2IYWA 1JECA 1GILA 2D7DA 3QKTA 2WSSD 1HNWC 2UXDC 4HAUA 1C4OA 2ZRHA 1TEVA 4C2TA 1KZGB 3I73A 4G01B 2ZEJA 3WNBA 2OHFA 4BWYA 4HAVA 1WE2A 3G0HA 3RS3A 1G3MA 2E9SA 1P62B 3DDCA 3KB2A 4RFVA 3FHCB 4LK2A 1FTSA 1G41A 1KKMA 1EFTA 2BEKA 3TAHA 5KUTA 2C8VA 1F60A 4AK9A 2F43A 4PHTA 2J7PA 1D8TA 3X1YA 2IUTA 2V54A 2ZRBA 3BC1A 2HT1A 2ZYVX 4LF8C 4IVQA 3FHTA 2WAXA 4F4IA 1ZD1A 3AF5A 5LDDC 5EP3A 3SR0A 2FEMA 3U3MA 4DCSA 3WY9A 3U44A 1M74A 2QM7A 1UFQA 3REFA 1G20E 3B9QA 5GJVC 4DZZA 2BBWA 4DV0C 4MYUA 4ZDJA 1AM4D 4B3TC 2UUAC 1W4CA 1ZM9A 4HLDA 3RRNA 3GJ4A 3QNUA 3LQQA 5E4FA 4GDFA 4FCVA 1FX0A 1ANKA 3H0KA 121PA 5FH9A 4C0QC 1RVDA 2XZPA 4JVSB 1R4AA 3GLIB 2V6JA 3THWB 2DFNA 4DEXA 1FTNA 1GVNB 2Z4RA 5JCZA 2XOKD 2FN4A 3W6PA 2R6DA 2QP4A 4O0MA 2DHRA 4EQ6B 4G0NA 1T8TA 5IRCD 4ABYA 1A82A 1TEXA 4TL9A 2IYRA 1XZQA 4D0NA 1T4GA 4JI6C 2A5GA 2ATVA 2B21A 3BB3A 2Q3HA 1D2EA 4NYJQ 3SJCA 2VBCA 3RSLA 1GNPA 3B9PA 1YHNA 2IYQA 2VEDA 4DSNA 1XRJA 3EZFA 3C16C 2GETA 1VYUA 3P4XA 4Q1EA 4DUYC 4W5HA 4D0LB 1U8ZA 4QOSA 1P7CA 4HZIA 3HP1A 5LBIA 1F5NA 3LRPA 3HU1A 2UUCC 3SYLA 2FA9A 4QNRA 1AN0A 4KODA 2V7QD 1B0UA 3ZVMA 1S9HA 4TN1A 1UKVY 4C0SA 3AF1A 4ACAA 3PUWA 4Q1AA 4YMUA 3L0SA 1DAKA 2FV8A 2XNSA 1LFDB 1WQ1R 3EXAA 4C0LA 4B3BA 2RHDA 3M1IA 4ZV4A 4Q4LA 1N33C 4I1SA 1V43A 4NCJA 3PENA 2VHJA 4EKDA 2W83A 3TE6A 3WBKA 4RD6A 5B64A 1G64A 3RANA 3ZIAD 5FL7A 4X8HA 3PUYA 5A2QD 1FL9A 4M53A 4TLCA 1KZ7B 4F92B 3OIVA 1C9KA 1XMIA 3TRFA 4M1KA 3RRMA 3LVQE 2BMFA 5J4HA 1OH7A 1OXUA 1UDXA 1FOEB 5EE3A 1UDWA 3T12A 3L0PA 1W48A 4TLDA 2R62A 5FUWA 3HYRA 2IYTA 2K5UA 2Z5FA 3B1WA 3ZD7A 1HV8A 1CEEA 4OJQA 3CH5A 4POAA 4MRPA 6Q21A 2DCUA 4UNQA 1X6VA 4CT5A 1G7TA 3OEEA 2G6BA 4YHHC 3T61A 4JSTA 3GEHA 2O5VA 4L4UA 1D2NA 1OFUX 1UM8A 2VP6A 2A7QA 1E4YA 2ZJ8A 2QQ0A 5FTJA 5C2JB 2WOOA 4MUBA 3DOEA 4N3NA 4LYFA 2PL3A 1X3SA 1RFLA 1XX6A 1Z47A 2P6UA 4JI4C 2HEIA 2J0SA 4G5SA 1DO0A 2J59A 4DLSA 3VKHA 4B3CA 1Z29A 5L3RA 3GFTA 4A92A 3KQUA 1X8LA 1U90A 2IF2A 4D4MA 2UVQA 2UUBC 5JHHB 4J0QA 4KVGA 4RVCA 2BC9A 4JT4A 3EZ9A 1E2PA 5J4LA 2MMCA 1KDOA 3AGPA 3QSYA 4UXHA 5TMPA 3JZAA 1ZJ6A 2JLRA 2R44A 1YR7A 3KX2A 4PTLA 4QHSA 2PJZA 1JXMA 1DG3A 4HLQB 1E32A 1SXJC 4L9WA 4OI0A 5LMNC 5DLQC 4IDQA 3U7EB 1VYVA 2EGTA 4TQUS 2C78A 1JALA 2AFIE 1X86B 2PMKA 4PQRA 2ZI3A 4JYAC 4LHZA 4HUQA 4EUNA 2P3SA 3PXGA 3EIQA 4CEHA 4CT4B 3P20A 2C5LA 4DDTA 2NQ2C 3DL0A 1GRQA 5UKDA 4URUR 3K0SA 3ZD6A 3LV8A 4B32A 2YC2C 4YLGA 2FFQA 1K5DA 3GLHB 2ONFA 3G5UA 2KBFA 5HCIA 3CB4A 1E2JA 1XEFA 4MGKR 3KJIA 3WYGA 3A1UA 2OM2A 5HE9A 3PUXA 1HURA 4V0LA 4Q21A 2GJKA 5DI9A 4TQAA 3NHAA 4GMDA 1R0XA 2ORWA 4DLUA 4B3SC 1KNQA 5F2EA 1DAHA 3HU2A 3T1HC 3CF6R 1W0JD 3TUZC 3AVVA 1J8MF 1HY3A 4B6FA 1HTWA 3U5ZB 3DVLA 4DKXA 2XSZD 1AJEA 4LUCA 5AR1A 4I1UA 1ZUIA 2ZI9A 2C9OA 1NJFA 4LF9C 4IEIA 3FTQA 2QMHA 4DV7C 3Q5DA 3ZZTA 4EIWA 1N2CE 1W2GA 2XOKA 4X66C 3OEHA 1W46A 3LLUA 3W3AA 4G1UC 4UXIA 1MRNA 1WDTA 3BS4A 2A5YB 3CR8A 3AVWA 2VP4A 1Z2CA 3GKUA 2JLZA 3QKUA 2ZR7A 4LC1A 2P6RA 4NCHA 5EE0A 3P4YA 1IBRA 3GPLA 3AKYA 5FI1B 3QKSB 1KI7A 3AF4A 3IDQA 3GCGA 5TY0A 3QIAA 5JHGB 2WWGA 2PCJA 4N1AA 3AF0A 3D3QA 1E2KA 1WA5A 2IXEA 4R2IA 1SVWA 2IUSA 5C1BA 2XXAA 2H57A 1BIFA 4JMPA 2DB3A 2ZJ2A 2J46A 1E9EA 1DG1G 2AHOA 3X1ZA 1OFTA 4FD2A 1Z6XA 2GXQA 2QM8A 2VSFA 2W2VA 2ZRDA 3U3KA 5E7JA 2IYVA 1X8JA 3KKPA 3BJIC 2W6IA 4A8JB 3MWJA 2RHMA 4KXFB 4JI0C 1JQLB 2J41A 3SJZA 1AKYA 1HT2E 4OHWA 3VMFA 3DKPA 4FMDF 3TR0A 1XTQA 1N6KA 2Z0MA 3QVUA 1SVIA 3ASZA 3AUXA 3QEJA 2A9KA 2AK2A 2NIPA 2QL6A 3I3SR 5EXSA 2VP5A 4Z54A 1NL3A 3IHLA 3OE7D 4JLKA 4A0FA 3V4RA 1W36D 1TU4A 2FNAA 4C7OB 4QGAA 4Z1MA 1U0JA 2ANBA 1E96A 2WSMA 3EC1A 2F9MA 1CF4A 4DDUA 3QG1A 1P4SA 5C4MA 4XX2A 5DI3B 4BLSA 1KSJA 1KO1A 1YJ5A 4PC2A 2RGNC 5E95A 1X1RA 4LOAA 4MTNA 1XXHA 5EZ6B 2R6CA 1AK2A 1ZU4A 2WPDD 1DO2A 1Y63A 3LD9A 4FXPA 4WBSA 3THXB 5FOSA 4ON9A 3KXKA 3TQFA 2VHUA 2IHYA 3PV0A 4H9GA 5G53C 4ASUD 4LF4C 1S0UA 4BFWA 4Q03A 2QSZA 1PV4A 1ZC3A 1E94E 3MJHA 3VU9A 2GJ8A 5IF9A 3UG6A 1HA3A 4CW7A 1GUAA 1NVUQ 4DR2C 1XMJA 2GNOA 2YC4C 1IHUA 1YZGA 2OE2A 4MA4A 4EFNA 4M21A 1R7RA 1Z63A 4GKJC 5D3MA 3CX7A 2OZEA 2VA8A 2WM9B 4A0HA 4EAQA 2FPKA 2Z83A 3GLGE 1YVDA 1KNXA 4Q9IA 3UMFA 1NKTA 2GEDA 1BH2A 2RGEA 2QZ4A 1XEXA 2O8CA 5BYJA 4TTRA 2PMDA 3U4QA 1FNMA 4JI2C 5SZKB 4RFSB 3U4QB 3NG1A 4A8JC 2ZRCA 3CPHA 4LI0A 2VYFA 5AWFC 4M1OA 4C2UA 1Q57A 1COWA 1W36B 2O8BB 5P21A 4X8LA 4LJ4A 1F6BA 1MO5A 4P31A 3X1XA 2P65A 4HDCA 1MOZA 3A1SA 3ADCA 3O8BA 2WKRA 4MITA 3LAWA 4FN5A 1ZM2A 4AKEA 1B23P 3T35A 2QBYA 4X64C 2WWIA 3AGQA 1IN8A 2ZIAA 3D31A 2VSOA 2W58A 2NG1A 2IW3A 1QHHA 1CR2A 4ZCLA 1QHHB 4P3YA 2ODEA 5KSPA 2HHHC 4OI1A 2AKAB 2F4VC 5CM9C 1JPJA 2F1HA 1G6HA 4BGDA 3U44B 4BLTA 4TYWA 4IRUB 4NMMA 2PLFA 2ZJOA 3TW4A 1ZINA 3W3ZB 1FX0B 1KDRA 2X2FA 4B3MC 4WOPA 2JLUA 2G0NA 2WV9A 2ZRIA 1RYHA 4PC3A 2ZAMA 3EZ7A 5ELXA 1A1VA 4LFAC 2OT3B 2CL6X 1KTVA 2JASA 4QM6A 4MUAA 2GWHA 3ASYA 3A1WA 3MWLA 5GJCA 2J9RA 5TXGA 1G8PA 1E2FA 3TVTA 4P4SA 1HQYE 4IXMA 2GJ9A 2CEAA 4M1TA 5JRJA 1EGAA 4P4SB 1VG8A 3U7FB 2QPOA 3DM5A 3GEIA 2MSDB 1X1SA 3QKRA 4BPBA 3ECCA 5G3YA 4LFCC 1KHTA 2REXB 4Z8YA 2YJTD 4XVUA 1W7AA 2CXCA 3B6EA 3KKQA 3L0IB 3T1TA 3V4FA 3IBYA 2HLDD 2JLQA 5L3SA 3RS4A 3BWDD 3RS0A 1CKEA 2ZROA 4KU4A 5IWAC 2VRWA 2OPLA 3K09C 1I2DA 4TYYA 4CYMA 3FKQA 2CBZA 4V0ME 5FBRB 3THWA 5B57C 1G21E 3CNOA 4CF7A 1JI0A 5EXTA 2ZYTX 4I1OA 2VHCA 1WRBA 1FW6A 3QXJA 4XWOA 2AD5A 4GFDA 4Q4JA 2YWHA 2IXGA 2GAAA 3M4YA 1GIAA 2GCOB 2JJ1A 4RD3A 3T15A 4JYBA 4QKQA 4PZYA 1L8QA 4MQBA 1KI2A 5FL3A 4BFZA 4DIDA 1ZIPA 3FHOA 3AEZA 1CTQA 1E2MA 3MGCA 3R8CA 1OXVA 1E2GA 3I5YA 1TQ6A 2ZQ5A 1R8SA 1Z28A 1R5NA 1XMQC 4FCTA 2OAQ1 3K70B 2BHRA 4M0LA 3I07A 2CVHA 2B8TA 3PUVA 1N34C 1XP8A 3Q3JB 1VHTA 1J7KA 1XFAA 2B7BA 4WIAA 4ZCMA 1O3YA 2I3BA 1AIPA 1N6PA 4IOLA 1S3GA 4RZUA 5BYKA 1QHGA 1N6HA 2QENA 3G82C 4G5GA 5EUMA 3V9PA 5GJBA 4N0EA 1T6NA 3T1YC 3WRYC 821PA 1E0SA 4JJZA 3I1FA 3HYTA 1A2BA 3A4MA 1Z6TA 2ZAOA 4NE2A 3TK1A 3AH8A 2HYDA 1E99A 2GXAA 3GLGA 4QG7A 2FX3A 3TVDA 3SZRA 5SZHB 4EJSA 1F2UB 5E7IA 3E1SA 5B30A 3UPUA 2CLCX 2C9YA 2BBOA 1M34E 2D2EA 2QTVB 4MH0R 4RD1A 2NO6A 1EFCA 5F9HA 2GK6A 2ZJYA 1H8ED 3C5HA 3QY0A 1SQ5A 2VIIA 3KXIA 3OIWA 3OF5A 4MGYR 4TLBA 3K0EA 4XIGS 2WKQA 1JJ7A 3CRW1 3VR1A 4XWKA 4QBHA 3PEVA 1XNQC 5E7MA 4BFTA 2YZ2A 3LQRA 3W8RA 2B92A 2J5XA 4BFSA 1I4LD 1J2JA 1WB9A 3EIEA 4KYUA 2YV5A 4LPKA 4L9SA 5HKKD 3EA0A 2FE4A 1NBME 4GSYA 4CIDA 4A82A 2ZI4A 3RWMB 1G5TA 3EZ6A 2ODWA 3MCAA 5FI0B 1CJKC 1EWRA 1USPA 3TLXA 1Z6YA 2WJVA 4NCIA 3CZQA 2FF7A 3FMPB 1US8B 4D6PA 1VCOA 2Z6VA 1DELA 3R7WA 1GL7A 1JBKA 2RH5A 4PXAA 2J0VA 4Z1MD 1KMHB 1ODFA 2NOAA 1GL6A 1NVVQ 2EQBA 2FOLA 2UZ3A 2W0SA 1UBFA 3QF4B 2ZRLA 3THYB 1ZCBA 2O8EB 1QDEA 2QUZA 1W0KD 3EAQA 3OIYA 1BKDR 4LJYA 4V03A 3RVBA 3HU3A 3KDSE 1DAEA 1KK1A 2MSCB
chains in the Genus database with same CATH superfamily
3N9IA 4QASA 2F6RA 4Z3KA 2D7CA 2H2WA 9GPBA 1NQVA 3IAAA 2NUTA 1XVTA 3MERA 4FK8A 1T5LA 3WZMA 3MB8A 2AFRA 1E5TA 1WNTA 3PE6A 3MOGA 4H35A 4YA6A 3E9YA 3X44A 1U3GA 1RLIA 1U7XA 3VVBA 1G1MA 5DH9A 4L8LA 2Q6KA 3DZGA 1N9GB 5DYGA 4A36A 4TMYA 4GMXA 3K0CC 1W85B 4ZCQA 1CJMA 2Q1WA 3U1TA 3X43A 2VQSA 5H16A 1CQWA 1ZCZA 1NX9A 1UWCA 4CM4A 1L5KA 4EW6A 1QVZA 4CM4B 1D9ZA 5KYYB 1QC5A 2F1OA 3M4XA 4JLPA 1M7GA 5LQJA 4HDQB 3DXYA 2IOHA 2EYUA 1LJ8A 3JQ8A 3BDVA 3K1TA 2QG9A 4LYDA 2NO0A 4TKUA 1GG9A 3P26A 2F2TA 2PKQP 4NNJA 1W5EA 1FPQA 4UDNA 1Z2PX 3Q3IA 1EE2A 3NWJA 2GK4A 3JARB 1H2YA 1T0HB 2HQOA 2V7EA 2CLMB 1YOVA 3HZHA 3PR1A 2B4RO 1ZBQA 2ZSIA 3RBVA 3HA3A 4B33A 3NHLA 4JLOA 3NT4A 3JZMA 3Q3HA 3A6EA 4I99A 4B71A 4GI2A 3DC2A 5A06A 5M34A 1XMOC 3G8YA 2DFKB 1PTKA 3RUIA 3RUPA 1EZ4A 5CX1A 4GOLD 1KIAA 1OVGA 4AW9A 3KQWA 3PZRA 1HDXA 5G40A 3TNJA 3EDQA 1RRCA 5EP1A 1G8AA 1UDRA 3D7RA 3KPJA 4NAUA 3A36A 1MDFA 4TL7A 5CD9A 2XUJA 2NO1A 2BGMA 2JCSA 1BXKA 4GM4A 4H4DA 1ZY2A 1MC8A 1H5QA 2VPWA 3CF4G 2ECOA 2IYXA 5BN1A 1QONA 4ZOLF 2BI7A 3V2HA 2O1SA 4IJWA 1OHHD 3IP7A 3HYCA 4CIAA 4WGFA 4PAMA 1QGOA 3GRKA 1REQB 5IDXA 3W6UA 5JSZB 5C8DA 1ISPA 1EK5A 1U1GA 1ADCA 1REQA 4JSYA 1G98A 4PQGA 2QXYA 3F0TA 1YCFA 3GG9A 1THMA 3OM9A 3FPJA 2RJNA 4UNNA 3DFZA 1VRCA 3IAUA 3ZEAA 4Z2YA 2R0QC 2J7PD 2H2AA 5EHIA 5F1PA 1UAGA 2YDYA 3TX2A 2P68A 3BMCB 3RO7A 4C2AA 3HC7A 4RK1A 1E2NA 1SUFA 1QQBA 4B43A 2BFFB 2YHSA 3RS2A 3HYNA 4BTEA 4LZNA 1MVNA 2C58A 4N9WA 4CLDA 1DADA 3RE1A 5K5EA 3PHJA 1M73E 5DNDA 4HAWA 4CPDA 1LW7A 4AUNA 4C7JA 4PFSA 1LC0A 2QW0X 1V11B 4ZYUA 3AFGA 4X1OA 1ZG3A 4GOXA 4YRPA 3MLBA 5IUNC 1RWPA 3HDTA 4ND8B 3SX0A 5C1OA 1I6MA 3JR3A 5GVRA 2XYQA 5DI3A 4Y2VA 1T2FA 3FDZA 3CZMA 4XDZA 5EIFA 1SG9A 1XD2B 2BW0A 3K35A 2EFDB 3L7YA 3PRJA 1WZNA 4MR9B 4B3GA 4Q5IA 5JDCA 3MT8A 1IBKB 4B4VA 1PS0A 2MYNA 2J3LA 5BP7A 2QW1A 2YXPX 2ZJ5A 3C1TA 3LVBA 2JAUA 4OAQA 3V3TA 4RVGA 4QLBA 4Q9JA 3MCUA 3O7WA 5J40A 4RLFA 2AC7A 5EGNA 1J22A 2V4ZA 3WP1B 1UK8A 4M1EA 2QVYX 4E07A 2G3YA 3BOSA 1E6CA 1UUFA 1XD9A 5B3KA 2GF0A 1YQEA 3GGPA 4TWZA 5HG0A 1V48A 3E2IA 2TECE 1M6WA 3W5JA 1UBNA 3NAZA 4X6YA 5I7SA 1TU0A 2CMKA 2EP5A 4J0HA 1WHSB 2GM9A 4YUVA 3WFJA 5SY4A 1G4UR 4W63A 2J0QA 3PD7A 1QWSA 2CC2A 4QJ4A 3NHMA 4H6WA 4CMEC 1TM1E 4YJKA 4P35A 2ZU0C 3G8CA 5T8KC 1OIXA 5FWYB 4HT3B 3KJGA 3EVFA 2Q29A 1TCBA 3SLRA 1XHJA 3DT8A 3WTCA 2BGLA 3H5OA 5BWCA 3CR7A 1E1DA 1QIKA 1OE0A 4Q47A 1DKQA 2NU6A 2NSYA 3BKWA 1K97A 2N1BA 2WHYA 4MUMA 3VU1A 3QV2A 4WLVA 3GLRA 2P2SA 2P7HA 3F71A 2DPGA 4EB8A 1AQYA 1V8DA 5EY5B 5JO0A 2UYQA 3M6WA 1UKBA 3AUFA 4HRXA 1XRMA 5C46F 2DBYA 5K0JA 1N8SA 2GHIA 2J33A 3CF0A 4MQ4A 2XKJE 4PAQA 5A2QA 3R9WA 1XTPA 3FMOB 1GAXA 1AC5A 1U5AA 2FPXA 4E31A 3PFHA 5BN4B 2GFIA 3CX6A 5AI5A 3M2PA 1YQUA 2C1EA 5K3DA 3VHRA 3AKCA 4FB5A 3TM4A 5DHTA 3K32A 3V8VA 1FFSA 4J07A 1WOYA 3WL3A 4U0KA 1E6KA 1Z73A 3PFKA 1PL7A 4Y6GB 2RHOA 4LF6C 1SXGA 1FFHA 3JAWB 4K46A 1JFSA 3DR3A 3QA9A 1LS1A 1JVBA 5KOIA 1KZ1A 2BJVA 4LE1A 3ETEA 2Q3CA 2ORIA 2IU0A 2V9ZA 3V7UA 3MHTA 1SBZA 4KPGA 2G77B 3G5MA 4PC7A 4YRMA 4YV2A 4XPZA 3CS3A 3ESQA 1FQKA 1G0NA 2IGTA 2JLAA 4YCMA 2E4VA 5I9NA 4RIFA 4AMZA 5BSGA 2PKQO 5EP4A 4AY4A 3SQXA 2ETXA 3TS1A 2AEJA 1PJ8A 1X7XA 1CZUA 1GYRA 1U0NA 3T7KA 5DM4A 1VSQA 5BR1A 1YR9A 4AJIA 4DXDA 1T3TA 1QX3A 3MTJA 3N5CA 3NHBA 3R3JA 4MV0A 4BVBA 4CIWA 1S4QA 1E1YA 1ZMTA 1RM3A 2POCA 2IZ7A 2ZQYA 3V32A 4XSGA 4YROA 1ZHOA 1IBSA 2VUTA 5INTA 2E7GA 1NG1A 4BO3A 2V1UA 1XS3A 4WJKB 3PJRA 3PDHA 3CLSD 3PQEA 4NEQA 1GFIA 3P97A 5KQMA 2E5LB 3IAM6 1IBLC 1BS2A 3M4ZA 4PZCA 1FRZA 1U94A 4WOKA 2QRVA 1TQDA 4RD2A 2YWXA 4A2WA 3ETNA 2JCVA 4R5MA 4F3YA 1E1CB 1L5HB 4P3KA 1HT1E 3H65A 1MZPA 1D6JA 1E8DA 5HF8A 5JPCA 4GVPA 5B58C 2BELA 1DWOA 4R71A 2P9JA 5B3LA 4TTJA 1GKLA 2YWEA 5JS6A 2P5TB 2XEXA 4WXMA 4OH1A 5L8VA 4ME6A 4L4QA 4LJRA 2DHMA 2GR9A 3FSJX 1N2SA 5AW6A 2PT6A 4WEQA 3VSCA 3LBIA 3TLZA 4QRDA 2Q4RA 2JIZA 3TCKA 2JI4A 4HB3A 3IGFA 1TVKB 3C6ZA 3A70A 4GOOD 5CDUA 5DNYB 4DUGD 3P8ZA 4EJ0A 1QFZA 5IW8A 4R01A 3ASUA 4NENA 1VLZA 3N3BC 4ZO7A 5CZXA 1JHAA 1HM5A 2BTQB 2C8LA 3H6GA 3IJEB 5K3BA 3ZU5A 1OV4A 2RHRA 3LXUX 3NIBA 2FHSA 1T4CA 2J9ZB 3NR2A 3OPMA 1PWEA 4HJRA 1Q91A 4YT2A 1T15A 1NVBA 5HZHA 2CJYA 4QDXA 3H42B 3ZTYA 2D0OB 5DASA 2RH4A 4ECAA 3MILA 5K3FA 2ZPUA 2DWQA 3Q8MA 2IY8A 1WPXA 4JOSA 3FB4A 5KO2A 2BHLA 4WBNF 2VNAA 4NH0A 1UFKA 2XHZA 2BN4A 2FWRA 3AU9A 4WK2B 1FIUA 1Y4ZA 3ADKA 2MR6A 3RGWS 3RSCA 2PRSA 4CIBA 2PAFA 4F9GA 3BHIA 5CVUA 2CN1A 2E89A 5IJAA 1ZEJA 1E8MA 1Y7HA 4OHKA 4AG6A 5BSTA 4E51A 4YX9A 2WM2A 5IPFA 3M6IA 4RTKA 3QM1A 3FYUA 4KBFA 1TECE 5BV2P 2WYIA 1NHGA 3RROA 5LCXA 2GRUA 5ICMA 2O8DB 3GLGB 3O95A 4U8HA 2PZEA 3FDIA 5JXIA 1NJ8A 4FLFA 1UKYA 3VVLA 1FVXA 2O6LA 3D54D 4BMCA 8MHTA 1NJGA 2GN9A 3FNHA 3LYUA 4TKVA 1XNQB 1YI0A 3P2IA 1BVHA 3WRVA 3GLIB 1XLTC 1N5JA 1FK8A 1W34A 2FMUA 1YR2A 1VKZA 5DTRA 1CDZA 4OLHA 1VHDA 4A6XA 2ENUA 2IA5A 3EXEA 5EXXA 3FWYA 3RSSA 4PS1A 3RWBA 1U2EA 3BGSA 2Z3VA 3FGPA 1L4KA 5KHLB 4F5YA 1XD8A 4UEQA 1KPHA 5F3DA 3RSGA 1A5SB 3KBOA 4MVYA 5TF4A 3ZI7A 2RB5A 4G5OA 1ESNA 1XKTA 5DP1A 1OXSC 4AY2A 1MHPA 1VCIA 1SG0A 3G68A 4EF5A 1CUBA 4MQLA 1DHRA 2VHVA 1B6SA 3DJYA 3I9KA 3IA2A 5BVHA 4BNFA 2MYTA 1C1DA 2ZU6A 3G1TA 2XEDA 4LHYA 3P2YA 5AESA 2FR0A 4RTOA 3QZUA 4WZBA 1F6WA 1TJ3A 2AUMA 3LX5A 4JJKA 2XBUA 3WY9A 3GJYA 5KPDA 3AZQA 4R8SA 3FDJA 4CEIB 1NN1A 1PQPA 5FNZA 2GSWA 2D54A 4C0JA 2NZYA 1NI3A 5KDDA 1YBAA 4JYMA 1XALA 3CUKA 4IZ6A 3HS3A 5HS6A 4C3UA 1YMQA 1TYBE 1XTBA 5DBGA 2QRHA 4IQ4A 5FADA 5KJFA 1NF2A 5TQ2B 2WAAA 4E32A 1IHYA 5IZCA 3PS9A 5EZ5A 3Q5GA 5D5HA 3EODA 1LPPA 4EFMA 2YYZA 4HAYA 4A0SA 1MC4A 1K7CA 4HS9A 3RRBA 2IZ5A 3L7MA 1KE1A 2WHXA 2YIJA 2V8OA 3T3PB 2J31A 4I46A 2CCGA 1T10A 3MRVA 3M8KA 3GLFB 1L1RA 2O0LA 3EH1A 4J91A 3ZCUA 4UHJA 2IYOA 3GHHA 1Y42X 5KVQA 2G36A 4YR7A 1HK7A 1Y9JA 2DWUA 2HT6A 3NBXX 4C5AA 2NUBA 1QGDA 3CVOA 4TTAA 4MI6A 3S1SA 2Q2OA 2ZJAA 2IHVA 2OYRA 1UXOA 3WGZA 4TTSA 1FDRA 3BQNB 4KIGA 1QYVA 1JEQA 1R4MA 4P34A 3RC3A 2YHIB 3V4OA 2OCAA 2PU7A 1NTRA 3VOSA 4ZIRB 2WG0A 4LJ8A 4DUPA 1Q12A 1B74A 3KOWA 2WVJA 2Y1XA 4Z51A 3E3NA 3IUJA 4N4AA 4GKKC 2GCPA 2PEYA 3E4CA 3IQIX 3OJEA 3TDEA 4KNYA 3VR5H 4GL2A 4WCFB 2QX9A 1Z5PA 4I8XA 3E22A 1SHZA 1TT5A 3L3BA 1N75A 4HJXA 2NLOA 3IP5A 1MOQA 1XNJA 4XUEA 5DOVA 4YXWA 1UP6A 5HHTA 2TMKA 3I53A 1NUSA 3EE6A 1KDPA 5LP6B 2QRPA 2CY0A 4UZEA 4HQLA 4GXNA 4MICA 2OXRA 2AZ4A 4B7XA 2RBEA 3GLSA 4CI9A 1QK5A 8AT1A 1OA0A 3F7OA 2XGJA 3QOYA 4M9RA 3FZGA 3H1BA 1PA4A 1IXRC 4LZPA 5FDFA 4AY6A 1Y89A 2BGIA 5CFNA 3BGDA 4B3IA 2HO4A 5JJKA 1RQRA 2O23A 1J33A 2WZQA 2ZYIA 4RPLA 5G1OA 2ZSDA 1F2VA 3I9NA 3VOTA 4UFNA 3OVMA 4ITRC 2WMOB 1SG6A 2QTHA 2VJPA 4LY6A 1C7EA 3DZCA 4F5ZA 2OECA 4D0RA 1NVGA 2AUNA 5HIJA 1WMFA 2RB4A 1T0BA 1U9JA 1OROA 1R27A 3CVVA 4A15A 3ESAA 3NOOA 3ZWAA 1KQOA 4D8XA 3PIIA 1WZUA 1W0JA 3LCRA 2CD7A 3VR5A 3NORA 4LYAA 4EBBA 2FPUA 2LDBA 4MIEA 5BR4A 2ZSEA 1FC0A 4YCLA 3LDGA 3JQFC 3PNKA 2HXYA 4OXKA 4A8JA 1HKHA 3HCWA 3UMRA 1NW5A 4JLVA 4DMMA 4TMVA 3B1XA 4ZAYA 3TTXA 1GUFA 2O59A 1A1SA 1XCGB 4JJ6A 3I8SA 4IKOA 3ZJ4A 5IH7A 5JAMA 3L77A 4S05A 5G0WA 3ERCA 4LSZA 5D3KA 5ALGA 4B6JA 3IAS1 3M83A 1Z8HA 3R2JA 1EUCB 4BNTA 1MX1A 1MD9A 1M6VA 1SD5A 5K4GA 1RBQA 1HX7A 4KXMA 1JXAA 1ULBA 4D97A 4IHQA 3RYFB 2BM9A 4QUJA 2JD0A 4DLVA 5JCJD 1ABBA 2DHQA 2BFPA 1E1RD 3HDGA 2F8MA 4R41A 1PR3A 2LXNA 4YMVA 4OG2A 1JQBA 1K68A 1N57A 3CEJA 2XDYA 3E3LA 1UKEA 1IQRA 3EWSA 4Y8VA 2YWGA 3MT0A 1SELA 3O3NB 3Q9NA 3QVLA 3UB4A 3VKUA 8OHMA 2GOYA 5CVVA 3ZDCA 2CSXA 4PBTA 4WESB 2Z6UA 5DLDA 3HUTA 2Q7DA 4CM7A 3C1OA 2QTBA 2GZRA 3IAEA 4DWVA 3LBFA 4RQTA 4YTEA 3W2GA 3OZ7A 4QGSA 2V03A 3Q1KA 4JLBA 1XRRA 2HNKA 1DBSA 3JAKA 4FMCF 2P4HX 5KJCA 4LBVA 3O5AA 1JDSA 2Y05A 1S1CA 4LHSA 3U48A 5EJ6A 4JUAA 2NCLA 1WQ4A 3EEYA 2H1LA 2X5NA 1KIFA 4RA6B 4OUDB 1VP9A 3DLPX 1X94A 1ZKMA 3DLCA 3GUYA 5GTDA 4HEA1 4N3AA 4EEXA 5B55A 4M7OA 2A3NA 2OQRA 4DPKA 2E49A 1XDDA 1NIJA 5DHSA 2FKNA 2OQIA 2C07A 2IPNA 3TSWA 1NMQA 5CA1A 2AEFA 2UXCC 3UMGA 4JOQA 5LN1A 1NAHA 1YACA 3AFMA 2WJ4A 2H8KA 3VX3A 4F60A 1NI4B 2QU8A 2XNKA 3GNLA 1AU9A 2XI4A 2RG7A 3DV0A 1JFFA 3OTGA 2OCXA 3NBYC 4S2UA 4M0MA 1CT9A 2JFHA 4E88A 4LZLA 3M3HA 1H65A 4AYXA 1L5OA 3NVKI 5K51A 5EYPB 2Y1WA 1C3OA 3IV9A 3K9LA 2F7SA 4WKBA 3MQ2A 2WWHA 1SQ0A 1YKSA 1ECLA 1W73A 4D44A 4BLOA 4R8MA 2R751 1SUIA 1U8AA 3HZZA 4DT1B 2YXDA 5HILA 2J4DA 2V7TA 1R5BA 1H94A 3ME5A 5G3ZA 4BX9A 3PPYA 3OESA 1XMVA 3AV3A 3QQ5A 4W5WA 3JCZA 4LRWA 3SZ3A 5IAOA 3C3CA 5K0CA 4RA9B 1RWNA 2Z2XA 1XWIA 2A9OA 2CFSA 1JQDA 1WB4A 3N0TA 4I1IA 4RE6A 4EVIA 3E6AA 4JQZA 5KNCA 3UWMA 2YN4A 3G0GA 4QIHA 2BFAA 2WFMA 4KE8A 3IEPA 4MZXA 4KR9A 3ZIAA 1Q44A 2VCEA 3E2PA 4BX2A 4YUWA 2C1XA 4Q19A 1W6UA 2GVDC 1RWXA 3GFOA 2IDKA 4X7BA 3MD0A 4EVRA 1SCKA 1T5SA 2AD1A 2W6PA 1BGWA 3DXXA 3T3GA 3K6JA 1UEJA 2GZDA 3PYXA 3QIVA 4HWPA 3BMQA 5I4CA 2PS3A 4WZBE 1KFJB 5FBLB 4MUJA 1JL3A 1H9BA 1L4LA 1UXKA 4KAJA 3NBAA 4BVLA 1M8JA 1Q1ZA 1Z0IA 5BMVA 1VPWA 5AUNB 3H9CA 1N6RA 1VSUA 3HY6A 3VYVA 1E9RA 3IMCA 1C7QA 2Z9CA 5AUPB 3S8YA 1YDFA 2HF9A 3CIOA 4K6KA 4HXGA 4QELA 5DHQA 4ENVA 1KH2A 5I01A 3COSA 3AVUA 1AMUA 1RQPA 1ZB9A 3RVSA 1OXXK 4GKBA 1P77A 3IHWA 2C2HA 3TH5A 1H1LB 3ZE6A 3TGPA 2O8VA 5IH3A 5IS2A 2MSLA 2FWBA 3EZ2A 4FKBA 1V6SA 4ID3A 3U3OA 3ZUGA 2Q8PA 4PHGA 1PGNA 3K9GA 1N0WA 2D5AA 1O77A 2PPLA 5JSQA 1JZTA 3BCHA 2JI9A 2GZSA 3N70A 4M9UA 1VBKA 3AQ4A 3S6JA 3UMBA 4MK4A 4B8YA 2PRKA 3JAMA 1X7ZA 2E4YA 2FPIB 2YMPA 1JNYA 2WFLB 4AJEA 2HK7A 4LN1A 4NLLA 4KH1A 3TAUA 2DR2A 3QX3A 1FJXA 3GN1A 4Q9HA 1I32A 5CPBA 3WLNA 4K6GA 2XCUA 3GGGA 1GRVA 4RZQA 4D4KA 1E3SA 3OEHD 1QOPB 4OA5A 5BV8A 1NUQA 2JLSA 3M6AA 3N8NA 4DN6A 5JS8A 1HE4A 1ZM3A 3M82A 4RC9A 4TXNA 5AVKA 3RIXA 4ZFNA 3Q6IA 2YFYA 3DZIA 2HBRA 2PPVA 4D42A 1E66A 2DYJA 1A9QA 3PWKA 2TMDA 2YYYA 2OPLB 1Y0BA 5EWLA 1CS4C 2GRJA 1Q7CA 2COKA 4KFTA 1QIJA 1N2HA 4OJNA 4BRSA 1ZRMA 1M1XB 4CNBA 4WA8A 1IY0A 1KEPA 2WVAA 1TYEB 1O9GA 1HE3A 2H1FA 5LLTA 3NHJA 2H59A 3REOA 4ZQFA 4H3KB 3DBRB 3BCUA 4MDEA 5KJ6A 3DBRA 3UGKA 1R10A 1SC6A 2X1LA 2Z9BA 1T8UA 2PN2A 1EVLA 4L16A 5HIIA 4EG5A 3HBMA 2WMNB 4EG4A 2I66A 3CV3A 1E1QD 4NHOA 3DZJA 2DTXA 4U1RA 2DPHA 5AP9A 4ZAWA 4JJFA 4BQQA 5G0VA 4NZMA 2P9YA 3HKEB 4RLHA 2CHGA 1DAFA 1XQ1A 3PEUA 1CJUC 2Q0HA 4MWOA 4QFCA 3E9ZA 4IEEA 4MIKA 4P9NA 3GVPA 5AKEA 3C2QA 1ZNZA 1SNYA 2M2IA 1BKYA 1XLUA 2ZXEA 3GRFA 1XEWX 3I52A 2FSFA 4ETNA 4TZ6A 2QN8A 3UT6A 4Y6SA 2KB0A 2J3HA 4WXPA 4NDZA 2YCBA 4NOZA 2QRNA 1WX1A 2O7VA 2JG3A 2BE7A 3DUWA 2XDQA 4AN1A 1SIOA 1EB8A 1QIMA 1FQWA 3QWIA 1I7PA 4PZEA 3SQLA 4BRWA 6YASA 3QX9A 5BMVF 1J8YF 2VTDA 1BHJA 1RXYA 4G2TA 3H2YA 3SS9X 4D45A 5J2TF 1VE6A 4A27A 3NNSA 3BSSA 2HSEA 3C3DA 3CTPA 5CDFA 1S2MA 2EW1A 2GAOA 1WSBA 3CSUA 1NP7A 3QKRB 4IDNA 3L43A 2GBLA 3P9PA 3QEMB 5EIEA 3CBQA 2G9ZA 1QE3A 3VZCA 2DY1A 5J4VA 4CQNA 3MTGA 3NUQA 3OMWA 4OHYA 1WULS 3ZGOA 1AK9A 1EJBA 3IDSA 4NC9A 1P2TA 3I6ZA 5EERA 1ZBDA 2IYLD 1K7XB 3SBEA 4TX1A 5BSUA 1E5LA 2XUGA 4OQLA 3ZNOA 2BKEA 5BQ5A 1ESZA 1AQ6A 2B4AA 4YNBA 4HKTA 2PL5A 3MINA 5HXAA 5L6MB 2BH1X 1V1MA 4V3CA 5ALXA 1KOJA 4AFNA 3RKSA 3F3SA 3RT7A 2Y2VA 3UG7A 4PCAA 3TZKA 3ZQJA 4A2PA 1PI3A 1TM7E 4FGWA 3N8GA 3HCRA 5JAOA 9MHTA 2ORVA 3UYLA 4ZAGA 2ZB7A 1DIHA 4HOYA 3IESA 3KHKA 1SOWA 4QXRA 4NCAA 3KO8A 2VDUE 1WZCA 2Y9PB 4OKIA 1YL6A 4Z4FA 3PEYA 5DNVA 4PFQA 5AJUA 1SZCA 1G8GA 3HY3A 2WI8A 3A0UA 1E2EA 1NJSA 2YWCA 4IXTA 4DR5C 5H4HA 2OMEA 4JI2B 1YDEA 3E61A 3B1KA 3L40A 3GF4A 4A0RA 2QX6A 2GBCA 2XZTA 2JI8A 1C8VB 4LFBC 1ORWA 4JI5C 3LC2O 4YRCA 4MP6A 5J23A 1CUCA 1UKKA 3SC6A 2WPDA 2B4TO 3I05A 3WIOA 1NVVR 3DO6A 4PANA 4U9HS 3STHA 3ZHSA 5C4IA 1TC2A 1YWGO 2CLFB 2ZUTA 4MKZA 3K9FC 2UYCA 3KAPA 1O6BA 4BX0A 5J4YA 1YULA 5KOYA 4FU0A 4L0QA 3HVIA 4HZUB 2OB2A 2ZIZA 3ICOA 4NARA 2QSYA 2ZUSA 1RLTA 1ISSA 5SZIA 3T1NA 2E8FA 3P27A 4BEBA 3ET5A 5C8ZA 1XRPA 4Z99A 2QORA 3PESA 3A1CA 1K6JA 3GUCA 3JYPA 4KWCA 4ZYXA 5HPYB 1U1IA 3OP1A 4HF7A 3WIDA 1L4HA 4FDTA 5K2MA 2CF5A 2ONZA 1M2NA 3ZBQA 2OCLA 4Y6QA 2ID9A 2H92A 2YJ3A 5EVCA 1JN0A 3OCZA 4BQSA 1RC8A 2VZ0A 1XTSA 2F4VB 2DSNA 3UMSA 3TQIA 2XE6A 4KUGA 1IHPA 2VQFC 4PF1A 2IIQA 1UPFA 2AEMA 4LRUA 2FMIA 5TEWA 2VC2B 1YC2A 5CAEB 3GLFA 1E60A 4XGNA 1N92A 1RM0A 4NXMC 3C1UA 5JDCC 4ES6A 5F9FA 2P2QA 4IP0A 4I14A 4OM7A 4DV1B 4FIDA 4EA6A 1JLRA 1PV2A 2LCIA 4OYRA 2DUJA 4DV5C 4GPIB 3MGAA 1T5IA 1DAGA 3BBLA 3I32A 3Q7PA 4CQMA 1FY2A 1TGYA 4BO0A 2A9PA 2Y1EA 2IELA 2QY9A 4YV0A 4IKEA 4WHMA 2HCRA 5KEIA 3NBUA 3F6EX 1ST2A 2ETVA 1L4MA 4CI0B 4DIEA 5EKSA 5FOQA 3TD9A 3EUEA 2HFKA 1GTJ1 4Q7LA 2Z43A 4HI0E 1L4EA 1NNUA 1THZA 4PS0A 3NDRA 5ETJA 3KZNA 1G5FA 4QATA 4F21A 3MJDA 5M3BA 4NU5A 1QM4A 4AUKA 3C4QA 1HUQA 2V7VA 3IRUA 2ECPA 5AVJA 2NPFA 4CMEA 3Q8LA 5DGDA 4Q1DA 1K3FA 1EPUA 3QUBA 4AY3A 5FUXA 3FUWA 1Y3IA 2H4ZA 1JDZA 3D8BA 3GA5A 3PL5A 4G5YA 3CNBA 3FAZA 4FFLA 4CM5A 2JLVA 5IJ0A 3L93A 4XTCS 1AQLA 1NMZA 1NV8A 1Q22A 3OZXA 4K3VA 1N36C 1KMHA 4KFUA 4IPTA 4CFYA 1E62A 5AM2A 1YDGA 3DHVA 1OX4B 5MFPA 1DIBA 4R3WA 4PNEA 1O5TA 1NWCA 3IEVA 1P9WA 2WRZA 3W5CA 1VI5A 4HG2A 3TLGB 4E6PA 4K9LA 2VS1A 3TL6A 5A4FS 4ZVRA 2AL7A 2B4QA 4R3UC 3SBDA 1GG2A 2QTTA 5I7RA 5EUQB 1BMTA 3TFQA 4PX2A 3NJ8A 1KAGA 2EWMA 5A5DA 2B83A 4I5IA 3HR7A 4DJAA 4JLJA 5DM2A 1TOAA 1U7OA 3EXHB 1A7UA 3CNLA 3IQGX 3LK6A 3PHGA 2ZTVA 3IQWA 4KIJA 1D2MA 4BKQA 5IKXA 2OXFA 2CUZA 5H70A 3CTMA 3LVFO 4ENUA 4YRIA 1ID1A 4ZQIA 1M7HA 1PF7E 1VPTA 2XA1A 1H22A 1JQ3A 4L73A 2E4XA 4DV4C 4IIEA 4KQWA 5KYUB 3NFYA 5DULA 1QHNA 3RPEA 3SPXA 2IITA 3VNUA 1G4HA 2CJPA 2Q4EA 4M9XA 5AKXA 1YA8A 3HB7A 3W34A 7AT1A 1NUAA 2A1UA 2I6XA 1FDVA 1UBCA 2ZFUA 4DMRA 1Y7PA 3H2BA 5IC5A 2WHEA 2FRVA 2DM6A 4TYQA 4PZDA 1P0QA 3RASA 4RSRA 1MABA 3T7TA 1SUAA 3T1VA 3EQ7A 2RHCA 1MH1A 5LDGA 2P2CA 3T7EA 3GPIA 4Q4HA 3OBBA 4FHEA 4NCBA 3CC8A 2F8TA 1VJTA 2IHBA 1T4DA 3EEFA 3KT0A 4GX2A 1CUHA 3AL2A 4YMHA 2HDOA 5HK9A 1R0ZA 5JANA 1GDTA 1V8FA 1N6NA 2WT4A 5AI6A 4D46A 4P33A 1IATA 4IWXA 1ML3A 2VHTA 4ZREA 4ZCSA 2Q9CA 1PNQA 3E7PA 3KSDO 4M86A 3IIMA 4HB0A 2VTKA 3DVQX 4J7AA 4MQEA 4PIPA 3VAAA 4KQ1A 1ORRA 2FEPA 3NHZA 2P1DA 1UJBA 5FTLA 2WIAA 2OESA 3D2CA 2PE5A 1I7SB 3L5OA 2OYCA 2AXNA 2YS6A 3BG5A 3W5IA 5AHOA 1YBVA 1CY0A 2F59A 2W2OA 3BH6A 4Z0NA 1Q0HA 4B84A 2HV9A 1JA9A 4D26A 4FFSA 3GH1A 4BJ1A 1DBWA 2BEWA 1CJVC 1YB4A 4UBJA 1IONA 4RTPA 1K8ZB 1W93A 2HIHA 1Z8FA 5FWDA 3ZTTA 1MB9A 3QWBA 3SD7A 1XPRA 1GKYA 2FEAA 2FLWA 3FKSD 4UJ5A 4FB4A 4ENPA 5C18A 3NXSA 4Q4AB 2OK7A 5CT8A 3SC4A 1M1ZA 1IPHA 4Q4AA 5FCDA 1S3IA 2VP0A 2P2LA 2R1TA 3H86A 1H4SA 3ORSA 3ZY6A 4Z4HA 3URMA 2HU2A 4JM1A 4BO7A 2LKCA 3LSTA 5AUQA 1KZ4A 2R65A 2XH8A 3PC4A 1D4ZA 3FE2A 1C50A 4BBAA 1M83A 5KYGA 1N78A 1HH4A 4R84A 1PVVA 4O63O 1SKQA 1R1DA 1O6FA 4XGQA 2FPMA 3FTPA 1P7PA 2NUAB 5DM70 2ZS7A 5H59A 3E2MA 1SCBA 1J90A 1Y6ZA 3QYJA 4ANFA 1A2OA 5H4GA 1DPGA 5A2GA 1C0KA 5B37A 3BSFA 2EF0A 4G24A 4B45A 3K2EA 4WLEA 4TVOA 3ZQUA 5JEEA 3IB3A 4PZ9A 1GLGA 1XZAA 3QYAA 3VU0A 1BA2A 2F3UA 5JRDS 1WWKA 4C3VA 2CJFA 1AOXA 1PLKA 4NAVA 4C4ZA 3HJHA 4ZU3A 1GPBA 1SVMA 2PMWB 2XGMA 3JVDA 1V60A 1TKRA 2NZJA 4ZJYA 2W2LA 2IUUA 1F9EA 1QB7A 4L6IA 2ZETA 1T2DA 3VGJA 5FTNA 2WV7A 3IFSA 4J75A 3K92A 1ODJA 3R7FA 3IVRA 3NBFA 1ECGA 5IAAA 2XW6A 2PWAA 4MDYA 3ROEA 5AM4A 1C7IA 5DLYA 4L4RA 3GUUA 1LB1B 1FB5A 1NQOA 1PYGA 1I4OA 4M60A 1OPXA 2X77A 5IDYA 2OBLA 2QUJA 2FMTA 1YHYA 2BBSA 3W4JA 5A1TA 4EF4A 3HXOA 1N8TA 2JKYA 1YS1X 4HNGA 3KBBA 3F9RA 3JYQA 4O33A 2IYUA 3OPVA 4RK5A 4ZCPA 3WBJA 1YAJA 3B78A 4O2AB 2C2GA 5CDSA 3MGGA 2XZOA 3DOUA 4Z0HO 1SVSA 3FPEA 3LS2A 3JQGA 4FNMA 4G23A 3G5TA 5A05A 4ZPJA 1LF0A 4EFDA 1U9CA 2D2XA 2HLHA 2CFOA 4J0FA 1KRWA 2XKAA 2GPTA 4DYVA 2J87A 1P2SA 3DOJA 4PXYA 4C6HA 3SIWA 5HTOA 3G5AA 4UCXA 2GNAA 5K01A 1ZVMA 2B20A 4WUTA 1BEUB 1HFKA 2FMXA 2Q9AA 4ZAZA 1PZNA 2W93A 4AF6A 5LQUA 3Q7RA 1OH8A 4WXRA 3H1TA 4AC9A 1T0UA 2QRQA 3MUOA 1UMBA 3QXCA 4D81A 2GN4A 2PTGA 2QJFA 3VJKA 4AZTA 1ZEMA 3MLEA 3BTVA 3VC2A 1CUFA 1KY5A 5CDFE 1GEGA 2H17A 4FJ1A 2D06A 3G1UA 3OKPA 3ZGXA 4OM8A 1JIIA 1GPWB 1T4CB 1FEZA 2B61A 5FBHA 1K7EB 4WBXC 1NRJB 3HEMA 1RAHA 2KI5A 2IYAA 3D5EA 4WERA 1OKKA 2NYRA 2FZLA 2PZGA 4O4HF 1XZ8A 3A25A 3KU4A 2OV6A 5FPHA 5ADZA 4QDTA 5D2CA 5J5AA 2DEUA 1R0RE 1WEHA 2OCBA 3DEKA 3HV2A 4JFAA 2F64A 2IY7A 1U4NA 1EFAA 4DY6A 2A78A 1RPAA 4J16C 3U17A 4AQ7A 4ZMSA 4GP9A 1N32B 3A2MA 1SU7A 5C8YB 4Z9YA 4EKYA 3WLRA 3LX8A 1QF9A 1PRYA 2BMEA 4DCNA 2ZR0A 5CHYA 5FAKA 1AD2A 5KTMA 1CDDA 3NEYA 4KCGA 1MJGA 4G67A 2X8AA 3S2GA 5JI2E 4JYZA 1MH9A 1U8TA 4AO6A 1VE3A 3C8ZA 1RPNA 4JP8A 2AOWA 2DT8A 5E9WA 4K9SA 4KQ6A 5KYTA 6REQB 4F93B 1CUSA 4HEJA 3A8TA 1G9TA 4BC0A 1O57A 2R7NA 3ILXA 3BIXA 1OFVA 1SB9A 5JTTA 1E98A 1DKOA 1UIMA 2Y0CA 3ZW7A 1RIIA 2WJIA 4C78A 1OR8A 3L0YA 2HA0A 1XPOA 3FX2A 4PNZA 4M7PA 3ITEA 2DKFA 4OHUA 1C8KA 4YC7A 1TMOA 4IINA 4E1BA 2ASEA 3C48A 4FMCB 1Q83A 3DNMA 3HKCA 4ZVTA 2CJWA 5KDLA 4QAJA 3TRJA 2PSDA 1YI1A 5A5VA 5FUVA 3VR6A 2P9QA 2O8DA 3U4HA 1W59A 1ZLXA 1GN8A 2EG5A 5HFJA 2O7NA 2O0HA 2VQ3A 2VYVD 3HO8A 5AE1A 4KWHA 3V8QA 3ZVNA 3D3WB 1K6EA 4LEIA 3GLVA 1CS0A 1IHDA 1OV6A 2GEUA 5B3JA 1ZU5A 3EG9B 3IILA 1RHMA 2DERA 2FLVA 4DR6B 3S44A 1PIWA 3QW2A 2Y8EA 3N7UA 4KQFA 1R8QA 2CF6A 2WKSA 3ITKA 3OQBA 5AVTA