4DCSA

Crystal structure of b. subtilis enga in complex with sulfate ion and gdp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
433
structure length
406
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 131
structure length 406
sequence length 433
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcsA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA01
2PX3A 3K70B 4IEEA 2AWOA 4DV6C 1E2KA 2QSYA 4JL6A 2FPKA 1E0JA 3Q9LA 2ZI3A 1UBEA 3VX3A 2JLXA 1KMQA 2VH5R 2W2TA 1Z0IA 4MYHA 4WZ6A 3EPJA 1NMXA 1J5EC 2FE4A 3K0CA 2XITA 3PFIA 4KO8A 1RJ9B 4Q4JA 5KDLA 4RY2A 3PV0A 1E4YA 1M7HA 2FV8A 5E7MA 2E9SA 3T5DA 3TBKA 4OQFA 1S0UA 1II8B 3WNBA 1D2NA 1CR4A 1E98A 1NBME 5JWOA 2H18A 3AP1A 2CL0X 3OTOC 1ZNYA 2OEPA 1YZNA 4TLAA 2GJ9A 1BO6A 2Q9AA 3PITA 1FOEB 2DB3A 2IS1A 1MRSA 4O0MA 2N42A 1OIVA 2WBLC 5KPJA 1S1CA 3MUFA 4ILEA 4A82A 1QRAA 5DI3B 1JAHA 4FCWA 2ZM6C 1T0HB 4C7OB 3UMSA 2AL7A 4G3XA 4JYCA 1XD9A 2NO1A 1NY5A 4IOLA 2WV9A 1IN4A 5FOUA 1XNRC 2ZUCA 2BWJA 1IXRC 1UM8A 4QGGA 3SQXA 1NVXQ 4QJ4A 1UBGA 4BECA 4OI4A 1SXJC 1JXOA 4CZ2A 3IEUA 4DR1C 1EK0A 5IHPA 2G0NA 1O87A 1P73A 4CGZA 3WYFA 1E0KA 2NIPA 1J99A 1G17A 4MKGA 2H8KA 4C0BA 4TYPA 2IYVA 4X8MA 1ZC3A 3U6KA 1BS1A 1XD2B 2IYYA 3ADKA 1PA4A 2A2ZA 4DV0C 2A9KA 3AH8A 2CXCA 5DYGA 4MTNA 4NDZA 2LKDA 1XEXA 3P1JA 4I1SA 3RS3A 5AJYA 4QNMA 3G82C 2GKSA 2HLDD 1LY1A 2WJIA 4RD2A 1E1QA 1KNQA 2IYZA 2DFLA 2VO1A 2QMHA 3DPUA 2GF9A 1KK1A 3OEED 3QPWA 5CJ2A 3TE6A 2WKPA 3WNDA 5H1YA 5L3SB 4LWZA 2IYLD 5KO2A 2MSCB 2R62A 1ZB9A 2EFHB 2RGNA 4NXNC 2FFQA 3LA6A 3C14C 3TQFA 2QUZA 4NH0A 4ON9A 2H92A 4WBSA 2GRJA 3WMFA 2CLCX 5GJBA 1Q12A 2EWVA 4R7ZA 4AG6A 5BW8A 4H9GA 2P67A 3T1HC 4DDVA 4DV7C 5F3WB 2DCUA 3KQNA 4HLDA 4UXJA 1LF5A 4LV6A 1RKBA 2Z6VA 4N1AA 4M4SA 4URYR 5F9HA 3M0EA 1CRPA 1XMSA 1TU4A 1ZCAA 2PLRA 4LFAC 1N2FA 2ZYTX 4JLMA 4OQLA 4YXWD 2XB2A 2O8EB 2AWNA 2FWRA 2OCAA 2A5FA 2A78A 2BV3A 4MGKR 4YMVA 2AX4A 4EAQA 2IX3A 1FW6A 4XJXA 3WHLA 1FPMA 3C5CA 4EFLA 2CE7A 1DEKA 1YZKA 3TMKA 1NY6A 4LFCC 3RS4A 5DI3A 5LB2A 2PN2A 2ZVQX 2RCNA 2AR7A 3I5XA 4Q48A 4FMCF 3RRMA 4LF9C 2OILA 4Q1CA 3ZQ6A 3F3YA 4HUTA 2PZFA 1OH8A 1XCGB 1WDTA 1NF3A 3CH4B 2VHJA 3RWOA 2EFGA 5FL3A 2ZS9A 3VKHA 2EYQA 2QL6A 1S8FA 3KKOA 4Q7LA 2C9OA 4C2UA 2F9LA 2QI9C 1IJEA 4Q19A 4LX0A 2WSSD 2ZRGA 3BWDD 4M9XA 1NN0A 1TEXA 3B2EA 4EQ6B 2R6DA 4U7DA 3I61A 1E0AA 1E9FA 2JJ1A 2OXRA 5FUXA 4DXAA 4LF8C 1ELOA 4IXMA 5GVSA 2WJGA 1UBFA 3DKPA 1C9KA 1EWRA 1HUQA 2E8FA 2RHDA 2RGNC 3X1ZA 3K70C 2HXYA 3AUYA 1JR6A 4QXAA 1GL9B 2B8TA 1Z0AA 4B3RC 4OBEA 4G5SA 4DSNA 3B78A 2DR3A 5JHHB 1ESNA 5HZKA 5JRZA 3Q3JB 3CRRA 3W8RA 5EZ6B 4P4TA 1GKIA 1T5IA 2RGEA 3AF4A 4JI3C 1GITA 1TQ4A 3TVTA 4IFEA 4Q4LA 4IDHA 2E1RA 4MRRA 2PMDA 2WJVA 4WAUA 3QXSA 3SJCA 5A2QD 1A4RA 3LXRA 4EJSB 2O8EA 1NYEA 2CNWA 2YINC 3PUZA 3WRYC 1SKYB 1P2TA 5IK2A 4PC1A 4D4LA 1GNQA 4G5QA 2CE2X 1G8YA 3SYLA 3VU9B 3CB4A 1TQDA 2QAJA 4TN1A 5DGXA 3VR6A 4BRUA 2LCFA 3FHCB 1E2DA 3A1VA 1JOSA 2WAXA 5FL7D 4B3FX 3QKUA 2V55B 2YWHA 2XB4A 4PHHA 2GK6A 2BKUA 1VDZA 4MUBA 2NQ2C 1OFTA 3OFND 1XXHE 1XB2A 5TVKA 3VKWA 2ZRCA 3EASA 3EIQA 1YQTA 5HZHA 1L2FA 2ZUBA 2CJWA 4WOPA 1UADA 3KFXA 3THOA 2IS6A 2FU5C 2XTZA 3A4NA 5HKKA 4Z8YA 2O8FA 3ETLA 3TGPA 1S4QA 2Y8EA 3CPJB 4JLNA 4DB4A 4DV3C 2P3SA 2OFXA 2RGCA 3HU3A 1UKZA 4HZUA 5GVRA 4BLSA 2Z4SA 3DL0A 4TYQA 1N33C 2LKCA 4DCNA 4EQ6A 1U98A 4GKJC 1FX0B 2ZYVX 1F48A 3ONWA 5JS8A 4LJ6A 3KZ1E 3BH7A 4G5GA 3SR0A 4JLBA 4MQBA 2OFWA 4JLVA 2WM9B 2OBMA 3WMEA 4XTRA 3C41J 1UKVY 3RWMB 4YMTA 2HYIC 4D6PA 2EW1A 5EXTA 4RFSA 3BS4A 2FFBA 2PL3A 521PA 3RVBA 4B2IA 4TLDA 1HH2P 1ZIPA 4HDQB 4QM7A 3CM0A 3ZVMA 4TYYA 2ZR7A 3DOEA 1ETUA 1CP2A 1P9RA 5TDHA 1TQ6A 1OH6A 1G16A 2GA8A 3SI7A 3UK6A 3U61B 3L0SA 1U0LA 4TMXA 2QMEA 1IQPA 1OPXA 1TF2A 2N1BA 4EJSA 1RYFA 2XZPA 1R4AA 4DIDA 2ZAOA 2WWIA 5EXSA 3GLFB 4HAXA 4JKIA 4PQFA 3R8FA 1XTSA 4OK6A 4MKHA 4QFMA 4L5BA 3ICEA 1WP9A 4JI5C 5LB4A 2O8DB 5IF9A 5DO9A 3EARA 3H84A 1E6CA 3QBTA 3I62A 2C9CA 4BSZA 4FWIB 3GEIA 1E9RA 1COWA 2BM1A 4UNSA 1W0KA 1Q1ZA 2HYDA 2JLUA 3BXZA 2HJVA 2PT7G 1CKEA 5L3QA 2B7CA 4PSKA 3H2YA 4M9SA 3PG5A 4CT5A 4ARZB 1WBBA 1COWD 2QTFA 1TNDA 2QTHA 1W0KD 2JMPA 3JVUA 5DHAA 4MA4A 1ZU4A 3A1SA 3AGPA 3LQRA 4HAVA 4AY2A 3VKGA 4IOJA 2JATA 1TPZA 4Q4AB 2CHVA 3I92A 4V03A 2GXSA 3AKCA 3RS0A 2FDCA 1QDEA 4BFWA 2XGJA 1WRBA 2OM2A 2JIZA 121PA 1IJFA 3RRNA 1G8PA 2ODWA 1IN7A 2IF2A 4RKEA 1KI3A 1EGAA 1H8ED 1Z47A 1U81A 1E2IA 4LJ7A 4NPHA 1Z29A 1W36B 1DAFA 4ESHA 1EFRD 1I4TD 1YR6A 2A7QA 2AHOA 4GPTA 2RGAA 4HZIA 4UXIA 1SZPA 3TVDA 1SVMA 4JVMA 2XR1A 3AKYA 3EW9A 5EXXA 4O25A 1N6HA 3LVRE 3THYA 4IDNA 4GNKA 3B1WA 1II9A 4L9WA 4ITRC 4PXAA 3VNUA 3X1WA 3I5YA 2C96A 1II0A 2GXUA 4FD2A 4XTCS 4DSUA 4EJSC 4US1R 5DISB 421PA 5AWFC 2UZIR 1WBDA 1P3JA 3Q72A 1EFHA 2GHIA 1GAJA 2WPDD 2Q3MA 1TMKA 4MGYR 3A36A 1P60A 3REFA 1XZPA 2UVQA 5A4JA 3RS7A 3GLFA 3GCGA 3L0IB 1HE1C 2BOVA 4GRAA 4P0TA 2ZXUA 5KSPA 4KSBA 2WMNB 2F6RA 4TSFD 5FTLA 1XZQA 2YC4C 1OKKA 4JI8C 1VCOA 1T4GA 2R65A 5HE8A 2O8DA 1KI8A 2XEXA 1E9CA 3ASZA 4QC2A 4W5HA 4A0RA 1IBLC 1S9DA 1XU4A 1GVNB 4ZDIA 2Z43A 4XSGA 4ZIRA 5JHGB 4XVQA 2IS2A 1OKKD 4LHWA 2CY1A 2GBLA 5DH9A 4CEJB 3NDBB 5JJKA 2O8BB 1JJVA 3V9PA 3F5FA 1XJCA 1KKGA 2XSZA 5F98A 4JMPA 4BZPA 1F2TA 1MO6A 4RD0A 1I2DA 3NH9A 4KV9A 4AD8A 4DR6C 3IUYA 3KKPA 1RPZA 1QVAA 2ZTSA 2J7PD 3SC3A 1IBMC 5SZKB 4B34A 4ZI3A 2OESA 3GJ0A 3MAAC 2XSZD 3B60A 2EQBA 3CRW1 3IIMA 4LHXA 2ZJ5A 2JDID 3E2IA 3B1ZA 821PA 1KY2A 2NO6A 3R9IA 1KO5A 3IHWA 2ERXA 2ZU0C 3W9YA 5K8UA 1FNMA 1U2RA 2G1JA 4LV8B 5IDVA 4CW7A 4IVPA 3LQQA 4TYNA 1YR8A 4QM6A 1W2HA 1GKYA 3B1YA 1NG9A 2PX0A 5AR1A 1S96A 1Z6YA 3WBJA 1JR3D 2H57A 4JS0A 4MITA 1K6MA 4OK3A 2J46A 4QGAA 3THXB 4URWR 3T1YC 2GAOA 3RRYA 4B3CA 4ZKDA 3AEZA 1BKDR 4Y0AA 3EZ2A 1TUIA 5FUWA 2J5XA 3N2IA 3PENA 4B2PA 5BXQC 1D8TA 2PCLA 3WY9A 2D7DA 3ZGXA 3ZVNA 2BDTA 5H70A 4QKQA 2OPLA 4LFBC 3EIHA 3R7WB 3LW7A 2WWGA 6Q21A 3RANA 4JLKA 4UJ3A 2ZYWX 3GJ3A 5IT5A 4RFVA 2R9VA 5CK5A 4AIIA 1DTSA 1U8AA 4RD3A 1E94E 2KI5A 2IUTA 1J2JA 1C1YA 3IQXA 4POAA 3D8BA 5JCPA 1M7BA 4OL0A 3OAAA 3ZD7A 3CX6A 4PC6A 2F43A 2AD5A 2V8OA 3GLGE 1GZSA 1G7CA 1Z63A 1YHNA 2FSGA 3B85A 4LBWA 1HH4A 1UDWA 4WA7A 1HURA 5JEDA 3NBFA 3GQBA 4IOMA 5D3QA 3I3SR 3U2QA 4Q03A 3FTQA 3RHFA 1W4RA 3J81D 4PC3A 5FBWB 4R71A 1K5DA 3U7FB 5P21A 1TAGA 4PHGA 1R2QA 4BLRA 5JEEA 3MFYA 1NLFA 2GZDA 4TLEA 1IOZA 2PLFA 5J40A 2SHKA 3OIVA 2BMFA 2J87A 1JECA 1ZUNB 3C15C 4PX9A 1AS3A 5CIQA 2FGKA 4CEHA 1SHZA 4HAYA 3WBKA 3QY0A 2R6FA 1WH9A 4DR5C 1I94C 2QQEA 2O8CB 1W36C 1NN5A 3QF4A 2VP0A 2YNMA 4CYMA 5EUMA 3SYKA 3L43A 4U5XA 2QM8A 1XTQA 4PANA 3FWYA 4IDOA 4DV5C 4GDFA 3DKVA 3X2SA 2DBYA 5E3HA 1GWNA 3KJGA 3HWSA 3DOFA 3QXJA 4YMUA 3ZS8A 4F93B 4ZDKA 2OO7A 1JQJC 4XOIA 2UUBC 3THXA 1P9WA 2VHUA 1OE0A 1XNQC 1U8YA 3LAWA 4PHFA 3AQ4A 1R5BA 1SHKA 2ZJYA 1K0RA 2ONJA 2QMUA 1E2JA 2HXSA 3VHLB 1DE0A 4A8JB 2OV2A 2VYFA 3OIYA 4G5OA 1SKQA 5FTKA 3IIJA 4TMKA 1ZCBA 3DHWC 3HU2A 1Q22A 3SOPA 5EP2A 2XX3A 5SZHB 1DAIA 2VQEC 2ZU6A 1H8HA 3VQTA 4MKIA 3QBVA 1Q3TA 2IYSA 4XSHA 4AKHA 1G21E 1ZD9A 1DOAA 1RFLA 2ZRMA 5FOTA 4MKFA 1HQYE 3TK1A 3RC3A 4A2WA 5CB8A 2UXBC 1XXHB 5FTMA 3OF5A 1AQYA 1CIPA 2X77A 3GLIA 4X64C 1VG0B 4BLOA 2QENA 4YY3C 1H8HD 1U99A 3VMFA 2CLDX 4FW9A 1KO4A 1UPTA 4X8HA 1R7RA 4HB4A 4UNQA 1FUKA 2F9MA 2XXAA 1KO8A 3Q7QA 4ACAA 3NHAA 1P62B 4II7A 1G6OA 3AVQA 4TTQA 1TF5A 3FDIA 1KZGB 4DV1C 3I4LA 5JWRA 1UKKA 1KSHA 3T1TA 1TUEA 3SQWA 1ZIOA 3IIKA 4R98A 2G6BA 4H1VA 3QENA 3M6AA 4QGFA 1M2OB 3MSXA 4B35A 3WP0A 4LF7C 4M22A 1OYWA 4KFTA 1R5OA 1G6HA 2E8EA 1USPA 1KNXA 1QBKC 2B92A 2IL1A 4HATA 5J4YA 2QG6A 2DWPA 2ZRLA 2BBTA 4LBVA 4FCTA 2ZI7A 1UF9A 1ZBDA 2BVNA 1D9XA 3KB2A 5JRJA 3L82B 1OXTA 4YONB 4TYWA 4NYIQ 1KI6B 4JI0C 5K8IA 3T5GA 3W34A 1SXJA 1SVIA 4MYCA 1E32A 1TTTA 4GZMA 2OHFA 4I1UA 4DB2A 4ESVA 2GESA 4BGDA 3KQUA 4MYTA 3U4QB 1X3SA 3FVQA 3ZH9B 3AF0A 3G5UA 1E1RD 1KSGA 3OESA 2X1VA 4A8JA 3RC8A 1N36C 1ML8A 2W6JD 2ODNA 4JYBA 4AC9A 4EPVA 5C2JB 3KXIA 3NC1C 4DWJA 1SXJD 1LS1A 1G20E 2C5LA 4XIGS 3P32A 3RYTC 4FI3C 4I81A 4JBXA 2WIAA 3BC1A 3KUDA 4P31A 1W0JA 3IEVA 2ZI5A 1CJKC 3A1UA 4NYJQ 2FPLA 4WZAE 4PPFA 5AJVB 4URVR 4S2EA 2VRWA 3R9WA 2WJHA 3K0FA 3SU8A 3QSYA 3Q85A 2F1JA 4FINA 5AJWA 3DDCA 1AKYA 3NWJA 4MRNA 5F9FA 1DAMA 4QHYA 2J0UB 2RAPA 4QGHA 1ONBA 4O2RA 1HEIA 3W5IA 5BN3A 3PIRA 1JR3E 3A1TA 1F2UA 4DRZA 5JLJA 3VR5A 2ZYUX 2YHSA 2R2AA 4PQYA 2R6CA 4X65C 1ZM7A 1KKMA 3LX8A 4R2HA 1PJRA 1V5WA 3Q8XB 2YZ2A 1N25A 5BYKA 3CRQA 5L3RA 1MABB 1U0HC 1JAIA 3NTUA 1FQJA 2DFTA 4HUQA 1DAEA 4B6EA 2VHQA 1RIFA 1IXZA 2NGRA 3LLUA 3CRMA 5EE5B 2BBSA 2WTUA 3IDQA 1E2MA 2HUPA 2VEDA 2F3RA 3MJRA 1ZM3A 2ZM5A 2MSEB 4M21A 4D80A 2GETA 2C98A 4DKXA 1Z5ZA 1R5NA 4LOAA 2QY9A 1N6IA 1KSFX 1EFTA 1SGWA 5LBIA 1WMSA 1ZD1A 3IPYA 2WKQA 4M8NE 2ZI9A 4NP6A 4FMCB 3FHOA 2YOHA 2GJSA 3T06B 2QPOA 2YYZA 2A30A 4EDHA 1MT0A 4B2LA 1KAOA 1FJGC 3FMFA 3JAMD 2P6NA 3MWJA 4H1UA 5GJCA 5KNCA 4A8JC 2QT1A 5JWHA 1L8QA 3MWLA 1Z6TA 2ONKA 2CHGA 3QXHA 1WA5A 1OIXA 3U44A 4Q4HA 3FE2A 4NCNA 4YC7A 1OSNA 4YDHB 3BRWD 1GL6A 3EIEA 4PPNA 1N6PA 1BYIA 5IWAC 3RAPR 1L7VC 3NEYA 1D6JA 1NVUQ 2GZAA 1W48A 5FFMA 1N6LA 1P5ZB 4LYHA 1E1QD 1GP2A 4GT1A 4KJZA 2J0UA 4UKDA 3AGQA 1NMZA 1Z28A 3FKSA 3SE0A 4EPWA 5BN4A 3VR3A 4QG7A 2KWIA 4RD4A 5CIWA 2PZGA 1RJ9A 2DFKB 3PEYA 1PLKA 4J0QA 1W4BA 3EZ7A 1FP7A 2GCPA 3I32A 1E2EA 1II8A 5DLQC 5HCNA 2J0VA 3AM1A 4QL3A 3VHXA 2FFHA 1OF1A 4V0ME 3RS2A 5LD2B 4PPGA 3FKSD 4Q9KA 4KHPC 3T12A 1AA9A 2HF8A 1MABA 1D2MA 2W6IA 5FBLB 5SZIA 3PJRA 1VIYA 1CRQA 3FFBA 5EZ5A 4DLRA 4Q7KA 3AVYA 4V0LA 4I99A 4C7OA 4M0LA 2OXCA 5GADl 2J3EA 3QEJA 3TRFA 2ZANA 2DWQA 3QXXA 4NE2A 1IXSB 2CVHA 4CDGA 4UNRA 4AI6A 2VP4A 2W6ID 3CO5A 5G3YA 2IXFA 3E70C 4MDFA 2HCJB 4XD7A 3AKEA 2ZJ2A 1DADA 2VSOA 4ZCLA 1JI0A 3L8YA 4HLQB 1JEEA 4YQFA 4LJ4A 1G3QA 4DCVA 1AN0A 3P4XA 2W2XA 4B6FA 5KHOC 3UG6A 2J1LA 1KJZA 2K5UA 2HV8A 1U9IC 3H4MA 5FI1B 3LY5A 4Z1MA 3FYHA 1OXVA 1XD2A 3NG1A 1NLYA 2VP5A 4XX2A 3PEUA 3UG7A 3QKSB 1XPOA 1SVKA 1SVLA 2D2EA 4C3ZA 1PUIA 4DSTA 4IXNA 2XOKA 2H7VA 1KKLA 3UMRA 2W2VA 3AF1A 5CM9C 3BD9A 2Z83A 3ZZUA 1JALA 1HNWC 4Z8XA 1DVRA 3CZPA 2IXEA 4M1YA 2DYKA 2OCYC 5L3SA 2PCJA 2JJ1D 4GSYA 1N5IA 1E9DA 5KDDA 2QGZA 3KKNA 2OZEA 1XX6A 1EX6A 2XOKD 1PV4A 4CEIB 2DPXA 2QN6A 5TARA 1VPLA 221PA 3BORA 2ZE8A 1VYVA 1OB5A 3GLGB 2IEYA 2WKRA 3SBEA 1NIJA 3HDTA 2D7VA 4DR2C 3EPHA 1Q20A 4XWKA 1IY0A 2WWWA 4DLXA 4LF5C 1W4CA 3HR7A 4TTPA 1E96A 2RGBA 4F7WA 1JB1A 1KGDA 2EVWX 2XJ9A 1AKEA 2RKOA 3AVWA 4DUZC 1Z07A 4EPRA 4HSEA 1GNRA 1DAGA 1T91A 1UFQA 2JEOA 2OFOA 2WZQA 3IBGA 4B44A 4B76A 3W3AA 1GG2A 1YZQA 2ZRBA 4KBFA 4TL9A 2QBYB 4DBLC 1E9BA 1OFHA 5B30A 3HP1A 1ZVQA 4IEIA 1EFCA 1DAHA 3AF2A 1Z0DA 1VLAA 5TB5A 2HF9A 2ZEJA 1C4OA 1XMIA 4HEJA 4AYTA 4ZCMA 2YWEA 2CNWD 2VP6A 2V6JA 5G40A 5IK2D 1QZXA 2ZETA 3CNOA 2UXDC 4RZ3A 4WVFA 5DN6A 3KB1A 2WWYA 2ANCA 3LRPA 4Q9JA 4DCSA 3LFUA 3U7EB 4GMXA 1NKTA 1IN6A 1RRPA 2IYXA 3KUCA 4QOSA 3TW4A 3CZQA 5AJZA 1PLLA 3MG9A 5CM8B 4DLVA 4JVLA 1D2EA 2D62A 1X1RA 5J4VA 1ZM2A 3KDSE 3HJNA 1YVDA 2ASEA 3EXAA 2YC2C 5HKKD 5FBQB 3QKSA 3NHBA 1KTVA 1WE2A 4X8LA 3FKQA 3QI2A 2B7BA 4Q9IA 2C04A 1KDPA 1SVWA 4YLGA 2ORIA 4OHZA 3A4MA 2VP9A 4TTRA 2AKYA 3QG1A 3EZFA 4PO8A 1OW3B 1R0WA 4NCKA 1VTKA 1R0ZA 2E8CA 2QPTA 1NL3A 4AKEA 4MH4A 5AUQA 2QNRA 2ATVA 4F4JA 2YOGA 2G88A 2ZSFA 3DZ8A 1P4SA 1OT3A 4G0NA 3P27A 4OI1A 3TR5A 5SZJA 4NKRA 2AXNA 1J90A 5CDFA 1MR3F 1ZU5A 2W58A 4IDQA 1G18A 4PO1A 1H65A 4BFXA 1FTSA 1X8LA 5CK4A 2OT3B 4GP7A 2BEKA 1BH2A 2C9YA 4DSOA 1T9HA 4PR0A 1XEWY 1W49A 3P4YA 3ZYCA 4NYIR 5LD2C 1AJEA 1V43A 3B1VA 1F6BA 3LLMA 3R9XA 2WJJA 4B3GA 4A0FA 3B5JA 4DLYA 2BJWA 4JIMA 1US8B 1Z6XA 3VU9A 1PVOA 1A2BA 3J81k 5LDDC 3PUVA 4UXHA 621PA 2Z0MA 2OSBA 3QQ5A 2GNOA 1J70A 4DT1B 1IN8A 3GJ8A 4IDPA 2IYWA 2ZJZA 1LV7A 3NBXX 4TQUS 3VAAA 2J41A 3IO5A 3CF2A 1A5TA 1CJUC 2XTNA 1DG3A 5B2ZA 1P2SA 3PEVA 2BEJA 2OCBA 4LJYA 1EXMA 3AV0B 3FPAA 1NP6A 2QE7A 2J59A 4NYJR 5KSYA 4MRSA 2GXQA 3GJ5A 1NSTA 4TLCA 5FOWA 4IHQA 1BMFA 4DLSA 5J5CA 3K0AB 4LGMA 5TV2A 2QSZA 1OXUA 4L4UA 1FQKA 3ZIAA 1NN1A 1AGRA 4Q47A 1G19A 1X8KA 2UUAC 3EG5A 2JJ2A 4RVCA 1F60A 2BMJA 2ZRIA 5CLLA 4GOKA 4C0QC 3K9LA 2KSQA 1N3BA 4PTLA 3SFZA 5JSZB 4S35A 1FX0A 4FMDF 1E2LA 2FG5A 2YCBA 2CDNA 3TNFA 3U3RA 3H86A 2NPFA 3ZIAD 2B6HA 4P4SB 3U7GA 3SHFA 1OYYA 1MO4A 2YV5A 4B3DA 3V4RA 3THWB 1ZC4A 2D3WA 5JS7A 5HPYB 5IRCD 2QP9X 2IC5A 3I72A 5E4FA 3FB4A 1QHIA 3WNCA 4DLWA 3RDPA 4K0KC 4HAUA 4JT4A 5L3VA 2XAUA 4LF4C 3NH6A 3OE7A 3VR1A 4KU4A 4A2PA 5FLXD 3BFVA 5CJPA 2JIZD 5HR5A 1W2GA 2XNDA 1HTWA 4P4UA 3OIWA 1AQUA 4PZZA 1OXXK 1ZP6A 2AFIE 1ZUHA 2FZ4A 2GEUA 4DR7C 4JKYA 3N70A 4C30A 1XMOC 2KE5A 3FMOB 4JLJA 2BBWA 5UKDA 4B73A 4BZXA 1IBKC 3O8CA 2P5SA 5FTNA 1X86B 1TADA 2A5JA 3OE7D 3QXCA 4M1MA 2OE2A 4HB2A 3TSWA 3CRVA 4A0GA 4FN5A 2WHXA 1SQ5A 1GRNA 4IKEA 2HDNB 1US8A 4RZXA 3N5CA 4PSAA 2PJZA 2D06A 4B3XA 3BGWA 1VCIA 4TQAA 4R2IA 4A92A 1ZM9A 2QROA 2QZ4A 2O0HA 3SEAA 2CK3A 4WW0A 1A2KC 3B8HA 1XMJA 3HR8A 4LF6C 1Z6GA 2BM0A 2VF7A 1XEFA 3CNLA 3ASYA 3UXMA 5JI3E 1JBKA 1GRRA 2FF7A 4N0DA 2ZI4A 2P6RA 1K5GA 3NC0C 1CJMA 4W5WA 3ZQJA 1KIMA 4OHXA 4JSTA 3C5HA 1XRJA 2WSMA 4X8OA 3LBHA 1XF9A 5TMPA 1S9HA 3GP8A 3QKRB 4KCGA 4UNNA 4EFMA 1IONA 2W00A 1NN3A 4L8GA 4KYUA 4ARZA 1IAQA 1NJFA 2ANBA 2JLQA 2YWGA 2BHRA 2ZRJA 2WIBA 3CIOA 1MRNA 4RCZA 1NKSA 1KYIA 5GJWC 3W6NA 2R8RA 5JSZA 1E9SA 1KDOA 3AKDA 4D26A 4Q1DA 2GZHA 3OZXA 3LD9A 2UKDA 4Q4AA 1PZNA 4TT3A 1LVGA 3B82A 3AUXA 4CIDA 3SN6A 1AM4D 3BBPA 4D0NA 3GFPA 1LF0A 4WZBE 3U3MA 1NJGA 4BRWA 3THWA 2V3CC 2R44A 1XMQC 4JVNA 4KFSA 3IPXA 4DR3C 4LPSA 2CEAA 3EX7C 1YR9A 1NLZA 2J45A 2G77B 1LTQA 4P3YA 4EPYA 2KB0A 4DR4C 3X1XA 1OH5A 2WWFA 4TT3D 3UKDA 1FP6A 4WIAA 2E5LC 1VHTA 4CVNA 2P2LA 4NL4H 4A1FA 3U3JA 1G7TA 1Z08A 2PZEA 1VG8A 2GDJA 2PMKA 2QEQA 4TMVA 1HY3A 5JI2E 4TZ0A 4R9UC 1Z22A 4NCJA 1UEIA 5DHFA 1OIWA 2CVFA 4FXPA 2QGNA 1ZRHA 3NKVA 1NVVQ 4Q1FA 4RSGA 1G7RA 2JLRA 1XNJA 2CHQA 4HB3A 1W36D 1NBMA 2V1XA 2VSFA 3WP1B 2FOLA 3EAQA 3HYTA 1UDXA 3SJZA 3QIAA 5E7JA 2CXXA 5FTJA 3WXMA 1KY3A 3Q5EA 2Z4RA 1G3RA 3TQCA 1I4DD 4NXMC 1IHUA 1VYUA 4OQXA 4PO9A 2O0JA 1NBMD 2FZLA 4WXPA 2ZRHA 1RRFA 2RGXA 3GEEA 4MGIR 4PAOA 1ZJ6A 3NEJA 1DPFA 2W0MA 3KTAB 4ZI2A 2G1KA 2GVDC 3SNHA 4KODA 1LS6A 4PFSA 1XMVA 2J9RA 4OYHA 1S3GA 4CEJA 2O8BA 2GCOB 2VBCA 5LMNC 5EE9A 3PQCA 1WXQA 3OAAD 4BZQA 3BB1A 1N34C 1A1VA 3K9NA 1N6RA 2JCSA 2C78A 3QG5A 3QVUA 4QHTA 4IVQA 5KYKA 2AN9A 5FUYA 3RS5A 3A1WA 4JJKA 1ZYUA 2ZSDA 1E2QA 2ZROA 4LJAA 5BWMA 5KDOA 3D6TB 4OX9C 1E69A 3LV8A 1DS6A 1O3YA 2ZVPX 4IOKA 1XTKA 2PT7A 1N6KA 3EC1A 1T8UA 2QP3A 1M74A 5KPDA 3KQKA 3QPVA 4W7SA 3TSZA 3D31A 4FMBB 3KL4A 5C4MA 1XD8A 3K1JA 4M1OA 4E22A 4GL2A 4GFDA 1P7CA 5CYOA 1G4UR 3KQHA 3IQWA 1N5JA 2ZUDA 3KJHA 3T34A 1JEDA 4GI7A 1JXMA 1TQ2A 5AUPB 1ZMXA 1GUAA 2GJAA 1YE8A 4TLBA 4JV5C 3EZ9A 1AS0A 1EESA 1JQLB 4B71A 2F1IA 1XPRA 4PC7A 2ONFA 2E7GA 3MLEA 5EP4A 1AGPA 3R7WA 3VX4A 2AXPA 2X19A 4MUAA 3WRXC 4IVRA 5TXGA 1N32C 5AJXA 1YZLA 1XTRA 3TIFA 3I1FA 1XP8A 4B32A 1Q1EA 1IY1A 4EKDA 4BLQA 2V7QA 4A9AA 2P0EA 2MMGA 2F1RA 4HLUA 4F91B 2VSXA 4DVGA 1WB9A 3BFKA 4ASUA 5B58C 4DUGA 2RHMA 1XEWX 3GMTA 1G41A 4LJ5A 3RABA 1JJ7A 1Q21A 4Q18A 4QJ5A 3AVVA 1FMJA 3TAHA 3QF7A 4GOJA 2OG2A 4OHWA 2V7QD 5IT9D 3ZD6A 4BASA 3OEHA 1D5CA 2G9NA 3TH5A 2F7SA 3GLHE 3PUYA 2F3TA 4V0OA 2VL7A 4UJ5A 4E09A 4MDEA 3L0PA 3U60B 1E9EA 4QRHA 1ANKA 1P2VA 2PEYA 3I8SA 2F4VC 4JBWA 4TWZA 1GSIA 3CX8A 1B23P 4XVUA 2XTMA 3S1AB 3DMDA 4JVSB 5FUVA 5FOVA 2IBMA 3QPUA 3A8TA 2QMOA 3DVLA 3ADDA 1HT1E 1M6NA 2NZ8A 4Q4JB 3HYRA 4NTZA 3CBQA 1KI1A 4I4LA 4DIEA 2C77A 4DZZA 2JGNA 3CUEF 4Z54A 1I4LD 1N5KA 4K46A 5J4HA 2HT1A 2O8CA 4YDSA 4XWAA 2ZE5A 1Q3HA 1ZAKA 4XWOA 4B43A 2ZJOA 1Z83A 4XVRA 1OHHA 4KSCA 3B9PA 4HLCA 2GJKA 4EFNA 1GDDA 2RH5A 1QG4A 2IEZA 4NZYA 4TQ9A 1IN5A 3SBDA 1R6BX 3AVTA 3H1TA 4OQMA 1GL7A 3DMNA 3CWQA 1LW7A 2WAYA 1KAGA 4HAWA 1AIPA 1J7KA 3UWKA 1XJ0A 2IUSA 1OJLA 1GNPA 2Q3FA 1VCNA 1E9AA 2IYTA 4D0GA 2JLWA 5CITA 4JSYA 5JBQA 4WXRA 1W5SA 1S1MA 5EE3A 1RZ3A 2FN4A 2YOFA 1XJQA 3TKLA 3V4FA 3QUSA 4N3NA 4B47A 2EWWA 3MRSA 1VKJA 1VG9B 2D7CA 4Q1BA 3BJIC 2ZITA 4BFZA 4HLUC 4OJQA 4PPQA 1EFUA 1XBTA 3BE4A 1CBUA 2O0KA 5FPSA 3EPKA 1MV5A 3F0TA 4QJ3A 1VG1A 1XXHA 2BJOA 1M34E 2REBA 2ZQ5A 3LVQE 3TLXA 5B57C 5EP1A 5KSOA 5HE9A 4M1WA 2JAQA 1HA3A 1XEXB 2Q9BA 2I1VB 5E7IA 2QAGB 4D4MA 4OHYA 1W0JD 3ADCA 3FMIA 3ND9A 4LI0A 2GTPA 4AYWA 1G4AE 1W46A 2P5TB 5EE1A 4A2QA 3HPQA 2QM7A 2ZS7A 3FMPB 2C03A 4DDTA 2H16A 2G83A 2ZJBA 4IRUB 5D3MB 4LPKA 2OBLA 1L4YA 1KJWA 2FMXA 1U0JA 1M8PA 3GJ7A 2CCKA 4GBMA 4MRPA 1YRAA 1BYUA 2ZAMA 3LXXA 3S1AA 1GIAA 3B9QA 3WMGA 3B1XA 5JMTA 2ZRPA 4LJ8A 3UATA 4DLTA 3UIEA 3I8XA 4ERNA 3DM5A 3K9HA 3IBYA 2BCJQ 3CPEA 4JI2C 1LQLA 2ZSAA 4KBGA 3GJ4A 1YU9A 4P32A 4X62C 3SYNA 3FGNA 3FFAA 1KI6A 1QVRA 2IYQA 3E1SA 3EC2A 4C0LA 1SULA 3NDPA 4FWTA 1KDRA 2GAAA 3B7GA 721PA 1Z3IX 2P65A 1KSJA 2D74A 1FNNA 3K53A 3U4QA 2JLSA 1EG7A 1DBSA 2FSIA 4JI1C 2OCPA 3A4LA 4KLNA 3ZVLA 4A0HA 1U9IA 4AKGA 4P33A 4D2IA 2JA1A 1N5LA 2OUKA 2KBFA 2MMCA 1MO3A 4DCUA 3KJIA 1KJYA 5FOSA 1LNZA 4Q01A 3LH5A 2EFCB 3KKMA 2ZRNA 1YZTA 4D82A 2HLDA 3VR2A 1MKYA 4LUCA 4KHZA 4PC2A 3QOFA 4LRWA 1NSFA 4X66C 3OEEA 4DV4C 1UKYA 1XCPA 4LZZA 4IFBA 3ADBA 1UJ2A 1DARA 3BK7A 1JPJA 3KJEA 1RE0A 2DHRA 1CXZA 3T1VA 2QAGA 4JLDA 5C46F 2AK2A 4US0R 3K0EA 4JL8A 3AF6A 4B33A 3CX7A 1KI9A 1OV4A 4D4KA 3K70D 1P61B 2UXCC 2N46A 2ORWA 4U00A 4F38A 5A5GA 1UAAA 4M9ZA 1ZNXA 2BBOA 2W83A 4M2LA 1HV8A 3NBYC 3O47A 4C0JA 5D3MA 4V0KA 2ATWA 3X1YA 3RNLA 1IY2A 2WMOB 4DJTA 4GP6A 3P26A 1E2PA 4HYYA 2WVJA 4Q7MB 2GJ8A 3K0CC 4YXWA 1NVVR 3AF3A 1XTIA 3X1DA 5KUTA 2IWHA 4GMDA 3I07A 3RSLA 4C0HA 3GFOA 3LW8A 2IHBA 2V54A 3OHMA 3Q5DA 1QG2A 1Z06A 4B75A 1U8ZA 3C4JA 3QVVA 3LO5A 4JI6C 2Q9CA 4FCVA 2MSDB 1YZGA 1GKUB 2UUCC 1NG1A 3QKTA 1FMLA 2VQSA 3W8NA 1N2CE 4RZUA 4BEJA 2G3YA 2IHYA 3SDZA 1G8FA 4A6XA 2C2HA 4G1UC 4B3SC 2EYUA 1ZINA 4XD7D 5FBVB 4D0LB 4ABYA 2RB4A 1QHYA 3GLIE 4AURA 2WSSA 2CJWB 3WYAA 2O5VA 4M1SA 4KVAA 4Z51A 2REOA 3AP3A 2O8FB 4KITB 3IHLA 5JFGA 4ZDJA 4Z1MD 4QBGB 4PZLA 1U94A 2A5DA 4LHVA 4HZUB 3QJYA 2RMKA 3QNUA 5B64A 4TMTA 4A4DA 4O3MA 2VA8A 1WCV1 1T5LA 1E4VA 2QAGC 4BLPA 1ZD8A 4Q5IA 2QRNA 2UZ3A 2VPPA 1CU1A 4LK2A 1Q1QA 4OI0A 5EXPA 2WOJA 5CLQA 1CJTC 2JASA 3GD7A 3AVXA 4M53A 1GOTA 1KHTA 2B8WA 1OXSC 1UBCA 2GWHA 4NOZA 1KMHB 3JZAA 4HDOB 3AVOA 3SZRA 1Q44A 3OIUA 4I1VA 4RFSB 1WQ1R 3CJEA 1G8GA 5DSZA 4DCTA 2NG1A 3EA0A 3T61A 3ZZ0A 2OAP1 1T3SA 3AVUA 3E5HA 4DV2C 4EIWA 1SXJE 2ODEA 3GFTA 1ZNWA 2O52A 5C1BA 1W7AA 1NRJB 2HCBA 1Z0JA 1E2FA 2ZR9A 5JECA 5FL7A 4AYXA 3BAFA 2F55A 4NYMQ 4Q66C 4D25A 2Q3HA 3BB3A 4QBHA 4W5JA 3KXLA 4OJKA 3OFNA 2CBZA 2DWOA 1KK0A 3B6EA 2FNAA 1CEEA 3ZJYA 2FEMA 4KFRA 4JI7C 3EWAA 3ECCA 4MRVA 2I3BA 1U90A 2IT1A 5BN5A 4NMMA 5FI0B 3AP2A 1CJVC 1G7SA 3CLVA 4YMSA 3TR0A 4NCHA 5DN6D 2OLKA 1R0XA 2PEZA 2NO7A 3NIBA 3C7KA 1X8JA 3MCAA 1I2MA 3ZZTA 3MD0A 3PCRB 1G8HA 1G9XA 2A5YB 1OH7A 4ZDWA 1M7GA 1Z8FA 2FH5B 4Q02A 3T15A 3ZVRA 1G3IA 2AD1A 2GEDA 4GZLA 1GRQA 1N0UA 3REGA 2IWRA 1HE8B 4BLTA 2EGTA 3IGFA 3NBZC 5F2EA 4LHZA 4BFVA 3TW8B 4BWYA 3L2OB 4NU0A 4FMDB 4B3TC 4LYJA 3UMFA 2QORA 4C0AC 3AVPA 5L3QB 1UEJA 3D7MA 2LWIA 2VQFC 4PHTA 4CF7A 1NNEA 4CEIA 1ZNZA 1E79A 1A7JA 2DFNA 1ESMA 2ZPTX 4DUYC 2FFAA 1NMYA 1W44A 1IM2A 1Z2AA 3GLGA 5G3ZA 2DY1A 1QHXA 2ZIAA 2Q21A 1E2NA 3EWSA 5AK0A 5C4GB 1Z2CA 1G3UA 4RZ2A 5FH9A 3CR8A 5JZVA 2ZSEA 2ZE6A 2HT6A 1OFUX 2A5GA 5FPHA 4KYIB 1CR1A 1NVWQ 4OK5A 1KOFA 2ATXA 2V4ZA 3V00A 1KMHA 1E79D 3GLHB 3T1QA 1F5NA 2YWFA 1E99A 1AS2A 2GK7A 3U5ZB 2JLVA 3SHWA 2QBYA 5EQTA 4KXFB 4TZ6A 3LBNA 3O8RA 4KFUA 2RGDA 4B48A 2ZRAA 3P20A 2BMDA 4URUR 5JJLA 1XDBA 2F1HA 1VCMA 2FGJA 2IYRA 3BH6A 2YVUA 3THYB 3CPHA 3B13B 2TMKA 2AKAB 4GOXA 5TY0A 1VECA 2FX3A 3MGCA 1SVSA 1KDTA 5BQ5A 5JCZA 1HT2E 2FJUA 1TF7A 2BC9A 4QNRA 4UNPA 1Z0FA 1K8RA 3FOZA 4US2R 4JYAC 1OFIA 2ODBA 1CR2A 1FZQA 2XNSA 2B21A 2WJYA 4MYUA 1FFHA 3LWNA 5ELXA 3VNVA 3GPLA 1E2HA 4UQOA 4EPXA 5EP3A 3NVAA 5E95A 4F92B 5BYJA 3BIFA 1EWQA 1UKEA 2IXGA 4AK9A 4A36A 4NCIA 1N0VC 2ZJ8A 3ICQB 4PAMA 2QE7D 2REXB 1MO5A 1CLUA 1HNZC 4G5RA 3O8BA 2C99A 2EU8A 1BMFD 4ZIRB 1W47A 3MJHA 1KI7A 1W5TA 4B74A 2ZRDA 4BE7B 5G53C 2NTYC 2QA5A 3KX2A 3MWKA 1QHGA 4TMWA 1E3MA 2JJ2D 1F2TB 1GFIA 2V9PA 1CF4A 3CNNA 2DYJA 1CR0A 1TX4B 1S2MA 2ZRFA 3SFVA 1FTNA 3U3OA 4EUNA 2NO9A 5GJVC 2V1UA 1XPUA 4JL5A 1H8EA 4IW3B 2WICA 5K8TA 2IUUA 8OHMA 1EFRA 5ANRB 3CF0A 1NI3A 5CYPA 3SS8A 4E03A 5J4LA 4C2TA 3T35A 1HNXC 4NONA 3EPLA 1P6XA 1AK2A 1Q1BA 3QE0A 3GLHA 5HTKA 4L16A 3DEFA 1VYTA 1YJ5A 3IKJA 1JPNA 3W90A 4BFYA 2BIFA 4ACBA 2XNDD 3K09A 3PVSA 2IS4A 4M9QA 1R8SA 3CF6R 4KAXA 1G1MA 2WPDA 1PUJA 2CL7X 4LJ9A 4DT1A 2JLYA 2Q0HA 2VHCA 1W4AA 5EUQB 2RGGA 1G3MA 2CCJA 1F3OA 2R6AA 1LFDB 5LPNA 3TUZC 2W0SA 4AG5A 3BERA 3H0KA 4TSFA 5FBRB 4RCYA 3U7HB 4CRWB 3CKLA 4LYFA 1B0UA 2ZREA 2OPLB 1RW4A 2C95A 1W1WA 3KFVA 4MH0R 3TJZA 2CK3D 3ZDQA 3M4YA 4A6PA 2GXAA 2ASBA 2WOOA 3K0AA 4QBIA 5KSZA 4TMZA 1R8QA 4FIDA 4D81A 5FOXA 2OLJA 2JLZA 3A37A 4RJLA 1Y3AA 5DE3A 4DLUA 1HR0C 3ND8A 3PR1A 1AZSC 4Q1AA 3BFXA 1X1SA 1MH1A 2F43B 3A58B 1XFAA 3F8TA 3LBIA 2OAQ1 3IILA 2VIIA 2Q6TA 2GILA 5HCIA 3DO6A 3TSOA 4TL8A 2J7PA 4N0EA 4M1TA 1YRBA 4P4SA 2FEOA 4BFSA 2FPMA 2AK3A 5K8LA 3VTKA 1G5RA 4AKIA 2QQ0A 4AQYC 1CTQA 5J4KA 5BR8C 4ZPXA 4RKFA 1PLJA 4HDCA 4YHHC 3ZLJA 5G41A 4Q7JB 1DAKA 2JDIA 2PH1A 4NHOA 1RVDA 1TL7C 2FA9A 2EFEB 2H1LA 2ZR0A 2PT5A 4URZR 4M1KA 4JJZA 4Y0VA 1EX7A 2JJ8A 4HAZA 4ZO4A 3K8YA 1T6NA 2ZI6A 5AUOB 4ZKEA 4E5UA 1Y63A 3ZS9A 4JZKA 2CL6X 4CEHB 4PSVA 1JR3A 3PUWA 1RC8A 1J8YF 2NMVA 2HEIA 4LSGA 4LC0A 2BCGY 2D4HA 3K09C 3QF4B 3FHTA 4L15A 4W9MC 3TUIC 4YMWA 1L2TA 2CLSA 3DZDA 1G5PA 5KNBA 3R20A 4O2LA 3AB3A 4Q21A 3CR7A 3EZ6A 5EJEA 4QHSA 3K0SA 4IJMA 3JZMA 1J8MF 4Q9HA 2QP4A 1A82A 2AFHE 3WYGA 4RD1A 3UWOA 1Q0UA 4A15A 1P2UA 2FSHA 2C8VA 4Q00A 4TL6A 2UU9C 5FPTA 1QHSA 3RRZA 1RRCA 2WWHA 4Q9LA 1ODFA 1XCMA 3BH0A 1DELA 1OLOA 3K9GA 1M1YE 4JLPA 5DNYB 4KI0A 2X2FA 3GJXC 4NBSA 4OI2A 3GEHA 1RYHA 3T1OA 3PEWA 4U02A 2FSFA 4C0SA 3GJ6A 3QKRA 3GKUA 2ZS8A 2QT0A 4BFTA 2NZJA 1BIFA 1VMAA 2R6GA 2WWXA 3SJBA 1T8TA 3I73A 1HQCA 2CMKA 3IO3A 2GVZC 1T3HA 1GTVA 3RLFA 2VP2A 4BUJA 5AUNB 1QHNA 1CS4C 3GLIB 1MOZA 3CWZA 2XZOA 1S3SA 3SJAA 4KLZA 2GBLC 2QL8A 2E87A 5CDFE 1G64A 1Z0KA 4RD6A 5KOYA 1QHHB 4L9SA 2XXAB 5M04A 4F4CA 2ZSBA 3CH5A 4BFUA 2GF0A 4F4IA 3JVVA 1FUUA 2I1QA 2KZFA 4K8OA 4OKSA 4V02A 4JT2A 5FPYA 5FPKA 2J7KA 2IA5A 2QPAA 3Q7PA 1SKYE 1YR7A 3W5JA 4C4PA 2QTVB 3O8DA 2J0QA 3UANA 4URXR 4DHEA 4ZCIA 4NYMR 4OQNA 3BB4A 4EPTA 2H17A 4DDWA 4JLOA 4LY6A 4BQSA 1BOFA 1USPB 1LB1B 3UPUA 2H5EA 4BPBA 2GCNA 1P75A 3EA5A 4LBYA 3VFDA 3WHKA 1TU3A 2V6IA 2GEVA 2YJTD 4JBYA 4V0MA 4CT4B 2XJ4A 3U6BA 4KVGA 4HB0A 1E2GA 5KTYA 4LHYA 4DEXA 1G291 2X8AA 3HU1A 1SXJB 4MGZR 5LMUC 1RRGA 4BEBA 2L0XA 4LDJA 1FL9A 1HYQA 2KBEA 1DO2A 1JNYA 3KKQA 3MMPA 3CONA 3HPRA 3AF5A 2IF0A 4LBZA 1YZUA 2IYUA 1D9ZA 5DI9A 4AWXA 4D4JA 3C8UA 1YKSA 3KXKA 1VHLA 1N6OA 3RSOA 3KTAA 1KI4A 1KZ7B 2CCGA 3CW2A 1QF9A 2PBRA 3KQLA 3PUXA 4DLZA 5H68A 2GCOA 2QU8A 2D2FA 3TAUA 1E0SA 1IBRA 4ASUD 3VR4A 2XZLA 1ZM4A 4DUGD 4B3BA 3LUSA 1XTJA 2ZRKA 3K0FB 5DIFA 2Z5FA 1T0JB 3W6PA 1R10A 4K81B 1GILA 1T3LA 2HJGA 3MWYW 3LX5A 5DYIA 4DDUA 3OEHD 4PZYA 3L8ZA 5FR1A 1KI2A 2ZE7A 4DC9A 4B3MC 1QHHA 2NOAA 1WF3A 4PAQA 4LYAA 1F2UB 2P6UA 2VHTA 1DG1G 1KO1A 2BMEA 2EFDB 5KU1A 3EERA 1NIPA 4DEYA 4I1OA 3DM9B 2NPIA 3M1IA 1P72A 4G01B 1P9NA 5JJIA 5J47A 4QBFA 5H8WA 3U3KA 3GLFE 4HUQB 1CULC 1QWIA 2YKGA 1Z6AA 2J0SA 1X6VA 3C16C 1AZTA 1VIAA 2BKEA 2I4IA 4C0KA 3G0HA 1Q57A 2X2EA 2ZJAA 3LDAA 3PXGA 4OHVA 1OHHD 2NO0A 1L4UA 1N6NA 2OBNA 2BJVA 3L0OA 2ECKA 2VF8A 1TEVA 4C9BA 1XWIA 1E1RA 3W6OA 2HHHC 2IW3A 2W6JA 1R0YA 3QEOA 4HI0E 3J80D 2VLIA 5FR2A 4TL7A 1OB2A 1G5TA 4V0NA 2ORVA 3TUJC 4E07A 4Q1EA 1KK3A 1ZUIA 4LV5B 3R8CA 4PQRA 5C18A 5KNDA 4JI4C 1GM5A 1ZW6A 3N2EA 4LC1A 4Q4HB 4ZV4A 4LCBA 3U44B 5CB6A 3A6PC 1N0WA 3W3ZB 2QRZA 4JLAA 1SVOA 3LNCA 5EE0A 1KK2A 4XH9B 2KJQA 5A0FA 1DO0A 1KO7A 2IK8A 2A3RA 1ZB8A 4GKKC 2G0TA 3NXSA 2ERYA 2VTKA 3D3QA 2PJRA 5L8VA 3BOSA
chains in the Genus database with same CATH superfamily
1KS9A 1ZH8A 5DBFA 3SXJA 1YS1X 2PX3A 3D8UA 5KAPA 3RYHA 3ETEA 4IYRA 1DI0A 1MHPA 2QSYA 2JVIA 3N2ZB 4UHKA 2EKZA 2B20A 2IU4A 4REMA 5E2IA 1E0JA 3KQSA 4B3RB 3G0IA 4LRYA 1UBEA 4A5OA 4C88A 4Y6SA 3KKKA 1KMQA 3AEXA 3ROXA 4REOA 5HIJA 3DBOB 1J5EC 4QA9A 5BY2A 1JG3A 5CAEA 3TBKA 1JBQA 5E7MA 1XVVA 2E6KA 2EBUA 3OZFA 3T5DA 2IEGA 4PNZA 3NHUA 4S1OA 3WK4A 2IELA 3PC4A 1E98A 1Q83A 4OU4A 2BONA 2PZJA 1YH3A 3OTOC 2Q9AA 1PZEA 2IS1A 4NBWA 1LWNA 4RMHA 2O1XA 4UHBA 2BE7A 2VAMA 1L9KA 1S1CA 3H5LA 1DXOA 2QN1A 4AZSA 4C7JA 1Y5LA 2ZM6C 4MYSA 1YI8A 4H1HA 4Q3LA 3UMSA 2A86A 2AL7A 1U8EA 2A9PA 1RVV1 2VZ8A 2NO1A 1ZK4A 2WW8A 4IOLA 1NHGA 2IDJA 3S0JA 1Y89A 3UGTA 5FOUA 1SIOA 1XNRC 5IN4A 5LNK6 4UEJA 5JZBA 1ULTA 3SQXA 4QJ4A 1AQLA 4P2GA 4YP5A 3TI7A 4BECA 5ES3A 1EGVB 1Z4OA 3LKVA 3A3PA 1LPPA 5CDGA 3IEUA 3SM3A 1RNLA 1TT5B 5THKA 4YS6A 3VZQA 1DRUA 2YV4A 3QM1A 4HJXA 3H2KA 2XRFA 4DV3B 4QSHA 1ZC3A 1PSWA 3JWEA 4IQFA 2GMWA 2FKNA 3ADKA 3R3YA 4AO7A 4EMUA 5AKKA 4FNOA 1B4DA 4DV0C 5DYGA 2NTEA 2CXCA 4FQ5A 4C7VA 4NDZA 2LKDA 1XEXA 3F8WA 3N53A 3P1JA 4DIMA 4QNMA 2W7TA 4R0NA 3AR6A 1LY1A 4RD2A 2W22A 4XLLA 1E1QA 2VO1A 4F1KA 3DPUA 3W7VA 4AECA 1JS1X 1OLUB 1YRQA 3HDQA 4MMZB 5H1YA 1WMFA 1X38A 3WNDA 5L3SB 1XMPA 4LWZA 3PA6A 3PNBA 1ECFA 1W1IA 2DPHA 4L28A 2QSJA 1KBOA 2APJA 2C29D 2QUZA 4HFJA 3UOAB 4AJLA 2GRJA 1PR9A 3DLIA 5JBNA 3QA9A 3DUFA 4H7KA 3DBHA 4GC9A 2SICE 4C3VA 1QQ7A 1JIKA 1LXCA 2H06A 2WP0A 2DCUA 3FOWA 1VB3A 4L74A 3T54A 4BZZA 5AVJA 4Q3CA 1IMJA 1I7NA 3LSTA 4L4RA 2PSSA 1HT3A 4CCYB 1IWPB 4UCFA 5BT9A 3L7MA 3I2YX 1ZSVA 2CV0A 4P3XA 3BL6A 2AJBA 1N2FA 2ZYTX 4JLMA 4OQLA 2CN1A 4NULA 1Y4AE 1V8BA 2AWNA 2OCAA 4OFZA 4YMVA 3IBTA 3UJBA 2HWXA 3I9JA 4XJXA 4BCBA 2ZB8A 3F67A 3F3MA 1FPMA 3C5CA 3QX8A 4EFLA 1EUCB 2AC4A 1FVXA 5A5VA 1ORDA 5DEOA 3TMKA 1BDHA 2E2WA 1N2IA 3O3CA 3JATB 1SCUA 4OXYA 3Q4GA 3RS4A 2Y9MB 4EI2A 4E5SA 1SB9A 2GM4A 4CV3A 3CUWA 3EMDA 4MI3A 3I5XA 2PDAA 1V6SA 3GRKA 4IIJA 4IY1A 4FHFA 2PZFA 3NDRA 4FGLA 4FTFA 4IX9A 3PE6A 4WFKA 2H31A 5ALFA 4FBMA 4WBNA 2I99A 3DTVB 2PU5A 1WUKS 3SF8B 1TCVA 3NETA 5FLYA 1S8FA 2QV7A 3U31A 5SV2A 2C9OA 1ZO8A 2G25A 4C2UA 2FXIA 1IJEA 1KL7A 4RMJA 1XP5A 2GPBA 3SIPA 2B5WA 4M99A 1KYYA 2JH8A 3EFOA 1NN0A 2XAAA 3B2EA 4R31A 4EQ6B 3SQLA 5KOHA 1ZAYA 2PIDA 2IZ0A 2JJ1A 3K1YA 4TSKA 3D4OA 4HDMB 5FUXA 1FXWA 2EEPA 4DQXA 1WETA 1KYQA 4LF8C 1NNSA 3HKEA 5A4AA 3FFWA 2PGOA 5K0JA 2H52A 2OD9A 1AHPA 5AVKA 3NOVA 5EN4A 1AUOA 4TKVA 3HXTA 1C9KA 5DHTA 1EWRA 2OCGA 4YN3A 3ZHZA 1HZZA 2RHDA 2GCGA 2ESRA 3Q3IA 4TXJA 3ZWPA 3VNAA 3PRJA 4R05A 3M3PA 1FYFA 3RVDA 3TRIA 2EZ8A 3TEMA 4B3RC 2YV2A 1L5MA 2RJNA 4NV1A 2UZ1B 2CVOA 1FFGA 3B78A 1CF9A 2DR3A 3DOHA 5AM4A 4OOEA 4JEHA 3VZCA 3WLQA 5HZKA 5JRZA 1Z13A 4PLFA 4Z2YA 1X70A 3S2ZA 4UPEA 1FDUA 1GKIA 1XZNA 2WKWA 1L5GB 3ICPA 5A9SB 1GITA 1TQ4A 1T2FA 3A05A 3CX4A 5IDWA 1QONA 1ZJYA 4CR8A 2HMYB 4C6RA 1INLA 3QUBA 4FHCA 4Z4GA 2PS9A 2WHPA 2ZYGA 1QZ3A 4CN9A 5EIEA 1F4VA 4J7CA 3DL7A 3SZUA 3U17A 4EO7A 3QXSA 3SJCA 2D27A 2I4LA 3A1CA 4ND4A 1V6AA 4N01A 1A4RA 1JYSA 1PI3A 2DM6A 4X00A 1Q0ZA 3RC7A 2I8AA 2IOFA 4PC1A 1MLDA 4KBYA 4GPEA 4KKVA 2QAJA 1M2KA 2EBFX 1E2DA 2JD0A 2LCFA 1J4AA 3A1VA 2NAFA 3G85A 3IV6A 2V55B 2YWHA 4G1CA 4K6KA 4KQFA 5FL7D 5BNTA 2VUSA 1H6CA 1M73E 4EFKA 2BYTA 3U4AA 4UW9A 1OFTA 3OFND 5FBZA 1BOOA 2C1ZA 5TVKA 3VKWA 4YP0A 2NSDA 3EIQA 4B31A 5HQTA 5TRTA 1L2FA 2ZUBA 1J2UA 3DT6A 4HXYA 1XZMA 3UUGA 5HXAA 3DAPA 3KFXA 4CTNA 3Q1KA 3THOA 3P2YA 1I5OA 3UGQA 1OBOA 3EIUA 3U5TA 4IH1A 2XVXA 2O8FA 3VO1A 4E4RA 1FLDA 1EM6A 4BUZA 1SUBA 2ZXFA 5DGHA 2RI6A 3PROC 4DV3C 3PR3A 3ZGVA 1QV6A 2QJTA 5E9WA 3UFBA 3TW6A 2I34A 4L0DA 2X4IA 1Y3DE 2MJLA 5AI0A 3DL0A 3KR1A 4LMRA 4DW8A 1Y8ZA 1SD1A 4A1OA 2VJYA 2LKCA 2NNLD 4EHKA 2C58A 5ICCA 4RHCA 4WASA 2X4DA 4ZVMA 2VQDA 4FFNA 4F60A 8AT1A 1CVIA 2R5FA 2IOFK 5ADUS 4DR6B 1FX0B 1F48A 1KETA 1O5TA 3JARA 2HMVA 3BMOB 5J43A 1U7ZA 4K9MA 2OLEA 4EO9A 1TO2E 4WEQA 4G5GA 3RT1A 1VHJA 2OFWA 2H8GA 4JLVA 1ADCA 2Y92A 3NHPA 2X42A 3C41J 3R5JA 1CIVA 4YMTA 4P22A 3S44A 4F4DA 4HNGA 3OCYA 2FFBA 1HDZA 1GN8A 4YO8A 3E15A 4B2IA 3AHIA 1Z18A 3MW8A 1ZH4A 3IKTA 1ZIPA 3HKCB 3CM0A 3R09A 4U5YD 1KDVA 2ZR7A 1ILWA 1H2HA 4Z49A 4TYYA 4BE4A 3DOUA 3ITKA 4K6GA 2CXOA 4RXUA 1G16A 3ZTWA 1XEAA 2GA8A 4J6FA 1H1LA 3WGMA 1V16B 3REQA 5A4IS 3C48A 2X40A 1O97C 2RGUA 2R8XA 2HADA 3MCVA 4ZQHA 5B1YA 2H07A 2OWEA 3ROTA 5E6SA 4FU0A 1OWMA 1TF2A 3AY3A 4Q3DA 4U2BA 2GD0A 1A9QA 4J1NA 4EJSA 3G59A 3M6UA 1RYFA 5C34B 3WYCA 1R4AA 2X0IA 3FTEA 1Q6ZA 3L1UA 5EXSA 3GLFB 4HAXA 4IWYA 5JUWA 3ZOKA 3R8FA 3IDAA 1P0CA 1D09A 4MKHA 4CM8B 3Q3CA 3BTSA 4KE6A 1M6EX 3H05A 4ERXA 5CFPA 5LB4A 4DIKA 3TQHA 3PVCA 1ZJZA 4DZRA 1LVHA 3MWDB 4ZI5A 2OKGA 3QBTA 2C9CA 5L3ZA 3D3EA 1E9RA 4K87A 1E7QA 4UNSA 5KJ1A 1DTWA 1W0KA 3LUHA 5F3DA 2QLMA 5KWEA 4E5NA 1OFGA 4RVNA 5EHIA 1GNVA 3U62A 1QC5A 1F4PA 3IURA 3SICE 3C97A 1S8NA 4KWIA 3BXZA 5IBRA 1XU9A 1GQOA 5A05A 2EG9A 3LLSA 5CA1A 2FMIA 3INNA 1WDLA 3DYBA 4CM4A 1C29B 4QAQA 4R1LA 2HRDA 2Q2NA 1WBBA 5FUBA 1MENA 1COWD 5CDSA 2QQ5A 3AL2A 4U6SA 3DXZA 2EF1A 4MA4A 4UHFA 5DHAA 3M49A 4Y9TA 3LQRA 1SIUA 1E59A 3LZDA 5FNVA 4AY2A 5L6MB 1Z56C 4A10A 3PJEA 4Q4AB 3MCZA 3HJRA 1ZCFA 5CUQA 3KSAC 2W6OA 2WFZA 1U0NA 2NW6A 3A70A 3KVNA 4OH1A 4AZ3A 2GXSA 1DUVG 1ISIA 2RGWA 3D5QA 2B1GA 3GNLA 3PCXA 4OM7A 1SZCA 4R5MA 2GH1A 2OM2A 4MUXA 1FW8A 4UBJA 1FYDA 5MFPA 4KOAA 2R6ZA 4RNDB 2IF2A 2ZPAA 2C42A 1N2BA 1KI3A 2F64A 1H8ED 1RQ7A 1Z47A 2BFOA 1QBGA 2EQAA 4KQ9A 3W1VA 4LJ7A 2PUFA 2JAXA 3ZJTA 1DAFA 1EFRD 1I4TD 4ZQFA 3VO8A 4AT1A 3TVDA 2RGAA 4HZIA 4KGVA 1SZPA 4GKAA 1EFVB 3ZY6A 2PH5A 3A25A 1F51E 1PR0A 3EW9A 4BNFA 4XZ3A 1LSUA 2C9MA 2ZTVA 3LQYA 1I7LA 2Q3DA 3X1WA 2V0GA 5B58T 2C96A 3B9BA 4OBBA 4XTCS 4DSUA 4KB5A 3LKDA 4US1R 5KVVA 5DISB 2XNJA 5EZQA 4L5CA 1P3JA 2YJ3A 3KJXA 5BN5A 3T3OA 1WNFA 1VE1A 2A1TS 4EFDA 1X7ZB 1R6DA 3A36A 4DPMA 2G1PA 4CL8A 3DZGA 3PWSA 1CZOA 1MNAA 2C2OA 1HE1C 2BOVA 2HLHA 2Z8XA 4WY5A 4NOLA 4B7XA 4ARSA 2YC4C 3TTVA 1VCOA 3I08A 1SU6A 5EIWA 2WD8A 1DRWA 1KI8A 1NOKA 1AGXA 3WIDA 1F4LA 2GEBA 1TMGE 2OGTA 1YIOA 2BRUA 3HWRA 1S9DA 1XU4A 3DDZX 3K0BA 4W8OA 2QL9A 4YUWA 5JAPA 1S7CA 4CI0B 4ZI7F 2VSQA 4YJ2B 1U31A 3FD8A 4LI3X 4W7IA 3N2NA 2I6XA 2FX2A 1OKKD 2ZBPA 3WKCA 2CY1A 2FW8A 5C1PA 2O8BB 5JJKA 1APBA 1XJCA 4RM3A 1TZJA 4A91A 4CIXA 4MB0A 5F98A 3ZOZA 1T25A 3GGPA 3H5OA 2VPYA 3SAJA 1M34A 1XHFA 3Q15C 4DR6C 1DZIA 4RGBA 3WTCA 3IUYA 4AD8A 4U7WA 4RQAA 1QVAA 3FLEA 3BD8A 1IL0A 3JSXA 2HL6A 3UH0A 5A6VA 1D2HA 5DHRA 2FVXA 2WTXA 1T1EA 1J5PA 1V1MA 3GJ0A 2GLXA 2ZUFA 4KACA 2J6CA 4PBTA 1UPUA 1R4ZA 5T3YA 1XZBA 5KAMA 4D9EA 4DJDC 4KRXA 2UXCB 4O1HA 3RHTA 1Z3CA 2X4GA 5AKGA 3SSOA 4WN9B 3IHWA 3HCDA 1CNFA 1FNMA 4BAZA 1LI5A 1V1JA 1Z4KA 2VKTA 3M9XA 5C35A 1GKYA 2BMVA 3B1YA 4OOFA 2PX0A 3WMRA 4BYMA 5ETJA 5AR1A 3NASA 3WBJA 4BO9A 1L3IA 2VPIA 4MX8A 1HYGA 4YAFA 1JU4A 4OK3A 1ZRSA 3A9TA 1GQYA 2Q5HA 4IDDA 1T3TA 2CNNA 2WNIA 2YVQA 4URWR 1IUNA 3ICWA 3QPDA 2EGHA 3BA6A 1YS9A 2AE1A 4XWGA 1J0CA 5EJFA 2ALJA 3EZ2A 4EGAA 1JH8A 4ESEA 1AF4A 3D6FA 3B3FA 4B2PA 4LWPA 4P38A 2K87A 1GUDA 4HVCA 1IVSA 1HE5A 2WSYB 1J9EA 4UAUA 3RU7A 3EIHA 3R7WB 3LW7A 4BNHA 1RWXA 3DBLA 1RXIA 2YWBA 4IRXA 1T6XA 1BXRB 2GEKA 2QL5A 1GA6A 1X0VA 1JR4A 1E7RA 4G86A 1P3DA 3GH3A 2JFPA 2IUTA 1J2JA 4BVKA 3FAKA 3GR1A 4MNTA 2CUNA 2ZUSA 4OL0A 3OAAA 4N5MA 3V42A 4BV8A 3K16A 2X14A 3I6MA 4PC6A 4G6ZA 5JYDA 5AW2A 2PUEA 5AIBA 1GZSA 3GFRA 4DSOA 1O8CA 1UMKA 1DDOA 3LBAA 5L4SA 1EVZA 1UDWA 4WA7A 3UMBA 3V7UA 2O9JA 3W5UA 3E9QA 4QUIA 3NV7A 3D6AA 2VNAA 2ZSJA 3LPCA 3NBFA 4IOMA 5JEDA 4GR4A 3U2QA 4BB5A 4LZAA 1D4FA 3PNOA 1I9CA 3FTQA 4RHFA 1WTCA 3FNBA 1I2CA 3D8SA 4R71A 1K5DA 1YA8A 3U7FB 1PV1A 4PHGA 2P0AA 1KIFA 3A9CA 3L6EA 5KYVA 2COKA 4Y30A 3TVYA 3T95A 5IYZA 2OPHA 1K75A 2RONA 5ITVA 1NZJA 1IOZA 2OHXA 4Q12A 5AM2A 3OIVA 3I04M 4Q3BA 1ZUNB 3C15C 4PX9A 4PZDA 1PT8A 4CNBA 1JKJB 3H5WA 3GQVA 2DAPA 1PSDA 4HAYA 4L8FA 5DP2A 4C04A 3QY0A 1B1AA 2O3RA 2R6FA 1G6Q1 5D6OA 2IZ6A 4WCFA 3RYFB 3ANSA 3QF4A 1BG6A 4NMXB 1ZGBA 2YNMA 4CYMA 2P4UA 3T3IA 2CF6A 4BTLA 4CKYA 2H1VA 1PG5A 1F8UA 3L93A 3NO4A 4OEHA 4R3NA 5A3SA 3CRNA 2BM9A 3X2SA 1WV0A 4M9CA 4RK6A 2DBYA 5DN9A 3FPHA 3BQ9A 1Y9ZA 4RHEA 2B83A 4ZV7A 3DCYA 2JFZA 2H2FA 3B7PA 3PC8A 3WO0A 4ZDKA 2OO7A 2PV0A 3A6JA 2NU7A 4IFIA 1LPAB 2VHUA 5DKFA 4ED9A 1QGYA 2ZB7A 5AP9A 4KI7A 1K0RA 2Q2WA 2QMUA 2HXSA 5GONA 3U7IA 4HQ0A 5EMMA 4MUJA 4XIFA 1Y4DE 2C8KA 1KA9H 3CVJA 4HXFB 4TMKA 1ZCBA 4YRJA 1V4VA 1FEZA 3CWCA 1HDRA 1UK8A 3E7FA 3I12A 3O21A 3AB7A 4MR8A 3SOPA 4B45A 2HCFA 4MKIA 3JQ7B 4CMIB 2IYSA 3JYOA 4B8YA 2V9CA 3D0RA 4AKHA 1C5KA 3H17A 1ZD9A 3QW2A 1N2CA 1RFLA 2ZRMA 3WE7A 5GONF 2Z3ZA 1Q14A 2F1KA 3TK1A 1H2AS 1NQXA 4FN4A 4A2WA 4F0JA 2AYAA 3QLUA 3SO4A 5EMHA 3OF5A 5FTMA 5JH7A 3KKZA 1QM5A 2X77A 1SG9A 2HBZA 3V4OA 4X66B 3EEIA 1H8HD 4BJ1A 4OD0A 3DLAA 4UD2A 4HY3A 4HOYA 3EE6A 2BFNA 2CLDX 1OT5A 1DKNA 3BHIA 4OQQA 9GPBA 2ZQYA 5EJ6A 1Y4SA 3ZWXA 2FSPA 4K9SA 9MHTA 2F9MA 3ER9A 2XXAA 4EY4A 1KO8A 3Q7QA 4B6RA 5EG5A 3ZCRA 3CNEA 1L8AA 5JH7F 2QJRA 1P62B 3AVQA 1JFRA 1KZGB 5GY7A 4LKOA 2YWJA 5JWRA 3OQIA 4OUKX 3SQWA 5DLYA 3ME5A 1UZNA 4HDSA 3PJFA 4GICA 3IIKA 5KQLA 3ETNA 3DMGA 4U9UA 4DGSA 1A7AA 1XVAA 1KAQA 1E92A 2N3ZA 2Z98A 3I9LA 2X6TA 3K9CA 4P7FA 3MTDA 1EWTA 3FZNA 4M22A 1OYWA 1GYQA 2DPMA 4X90A 5CYGA 1CETA 1KNXA 3IMGA 2PWZA 4HATA 2IL1A 3ILHA 3KZNA 2QG6A 3WHIA 2DWPA 3F2IA 4HMPA 1T5BA 1NHWA 4CKBA 4FCTA 4OLHA 3KB2A 4OSEA 3SR3A 4CLXA 1JMVA 2KX7A 3GAFA 1JIIA 3HFGA 4TYWA 4NYIQ 3AONB 5K8IA 4UAJA 3ELBA 3NLLA 3T5GA 3UMMA 4BO6A 3EXEA 3ZEIA 3KPJA 3H9JA 5AVOA 3QUQA 4QQNA 4BC9A 4MYCA 4FSXA 3U4MA 5EKUA 5K3BA 3DPIA 2OYRA 3U1VA 2FW6A 3OWHA 5IKEA 1K9SA 1X3SA 3ZH9B 3BILA 3CW8X 1G2PA 3G5UA 4NE7A 1MC1A 3W4KA 1I4EB 3OESA 2HN9A 2HSWA 1HMYA 2W2OA 3EDOA 3FR8A 3H42B 1ML8A 1TKAA 2W6JD 1JL3A 4A8JA 2OXIA 4C1BA 1M6WA 1LS1A 3ZJ5A 4BJHB 1G20E 2A4MA 2VP3A 4JT9A 2AG5A 3L01A 5EYPB 5TMEA 4ZN6A 4I81A 2O0LA 5JXWA 3P2OA 1ZXXA 4ZHQB 5GZ3A 3KUDA 3D6HA 4P31A 4Q16A 1ZPDA 5HILA 3K05A 2ZI5A 3NOQA 4NYJQ 4WZAE 2XRMA 3M2TA 2H1SA 3BD7A 4G1EB 1E0DA 2WJHA 3SU8A 2YUIA 2PRZA 1L1QA 3NWJA 3JR7A 4QDJA 2J0UB 2CJFA 2ROQA 3H6KA 5JZ9A 3NHRA 1GRVA 3G8AA 2XQIA 1P18A 4NENB 3GDGA 2DBRA 5CDTA 5LZ9A 1ONBA 2GYYA 3LWDA 1M2HA 1EJ0A 1W96A 3P0RA 5D1NA 1Q1NA 3PIRA 1JR3E 3A1TA 4DRZA 5JLJA 2Z2IA 3RKUA 1V3VA 2I7XA 2YHSA 2R2AA 2HF2A 3EFBA 1GZ7A 5ALQA 4PQYA 3LX8A 1VSVA 1ZM7A 2NU6A 4WXHA 1PJRA 1CQIA 2VNKA 1H3NA 1N25A 4RPJA 1YRLA 4GYKA 2I2DA 4BO8A 5L3RA 3ZW8A 1Z36A 4OGGA 4B6EA 4G8DA 2EP7A 2W2QA 4YRKA 5CHYA 5EE5B 5E2AA 1DBVO 4NFHA 2CHEA 3FMVA 3I39X 2VEDA 4OHPA 4MJLA 3MJRA 3IUEA 2ZM5A 1IXYA 2MSEB 3R77A 3QVLA 1Z5ZA 2FR1A 3BX1A 2QY9A 3HCBA 4TT8A 2XTAA 1UBMS 2XGSA 1FNDA 3WL6A 1HSZA 1SGWA 2QUKA 1MAVA 1JSXA 4NJOA 5LBIA 3UUWA 1RRVA 1KEUA 4M8NE 4X9XA 2ZI9A 4DRYA 3FWPA 3FHOA 2HXGA 5T8KC 2Y77A 4AULA 1M2WA 4WNCA 1EINA 2A30A 2VRBA 4UMEA 2YWDA 2Y6VA 3ESDA 1WX1A 3I37X 3I6QA 4A2CA 5K2OA 1N2JA 4DXHA 2P9HA 1DIAA 5GJCA 4FNAA 3HB9A 4X97A 1OGJA 3GB9A 1JTEA 1L8QA 3MWLA 2VI5A 3QXHA 3TLGB 4FYMA 2J9FB 4L95C 2BEWA 3NALA 2Q3BA 5LWHA 4NCNA 4R0MA 2V0NA 3VH1A 4YC7A 1TYAE 1P7YA 1SCJA 4TVKA 1QGOA 4YDHB 3BRWD 4RVDA 2VCYA 3P2MA 5CH3A 1KORA 3V2IA 5FEUA 3PHBE 1FU7A 2HU5A 1FYEA 5AI6A 5BN1A 2I6TA 1U9YA 3LOPA 4CFZA 1AMOA 3ONEA 5DXJA 1KMCA 2JAUA 3G1TA 3NEYA 3PD1A 1U8TA 2XCUA 1C7ZA 2DX7A 3OFJA 4PRYA 1VLZA 5EMKA 2HRRA 1H23A 5BXYA 3GW8A 1UBRS 4YAEA 4B1FA 1QX3A 4BMDA 5KREA 1FUEA 3AZQA 4AW9A 1XZIA 5ICFA 1GP2A 3WKBA 1H6AA 3OA0A 1WF6A 2QN2A 3GV0A 8ABPA 3FKSA 3O3OB 3SE0A 5LZ2A 4EPWA 4ENSA 2XUFA 5BN4A 3K6JA 4J1TA 4QG7A 1KZHA 2PZGA 2CLMB 2NXCA 5KYGA 4B7ZA 4J4TA 1PLKA 3ET5A 4J0QA 4RNCA 3EZ7A 1RD4A 5FA6A 1E2EA 3R41A 3ZBUA 4QD3A 3ZWOA 5K3AA 1DQSA 3RS2A 4ZJYA 1F2DA 4PPGA 3HM9A 3BF7A 1NW6A 1NUTA 3TRHA 4CIBA 2A88A 2BJHA 3VR3D 1MABA 2DTDA 1D2MA 1V1RA 2W6IA 3CTPA 3KAPA 3UW3A 3P97A 4WDRA 3WGGA 5HX7A 5BPHA 1YKGA 5CB4B 4O4HA 4DLRA 2BW0A 3AVYA 1XXLA 4MPRA 4RPGA 5BWOA 2JFOA 2OXCA 4M0LA 1CHDA 1DKOA 2ZANA 2DWQA 2DSTA 4YUVA 3ZY4A 1IXSB 1WXXA 2QZZA 4UNRA 3WGKA 4ZVRA 2X1LA 3OG9A 1GSHA 1X1DA 3CO5A 3WGVA 4W1QA 1P5JA 2QV0A 3E70C 2BT4A 2HCJB 3G2LA 3AKEA 2ZJ2A 4XD7A 4MDFA 4ZCLA 1Z5WA 3O94A 4BMPB 4NJEA 1JI0A 4AZWA 3RBVA 4PLPA 1ND6A 1ULZA 2JBAA 4FONA 4DNFA 1G3QA 3HS3A 5BN5B 1CX9B 2ZJ0A 2D1YA 3G5MA 4AZ0A 4B6FA 1KJZA 1SBCA 2XDAA 3KPUA 4H6PA 1KQ3A 3HBLA 1PBNA 3ZI4A 3LY5A 2ES4A 2DGDA 2ZYDA 3LK6A 1XD2A 2EQ5A 4KZKA 4YT5A 1UPFA 2HA5A 1FLNA 3D3KA 2QPLA 3QKSB 3R0QA 1SVKA 2FPXA 3MYRA 4NS4A 2Q8QA 4ZDWA 4CIYA 5IM4F 1L4BA 1LWOA 4IXNA 4B83A 2ZBQA 5F9MA 1WZEA 2EZTA 2OGWA 2HU2A 4MV5A 4YWJA 2W2KB 4DUYB 2ZULA 2XQFA 2Z83A 1K97A 1JDVA 2ZTUA 1K9VF 2YR0A 4ZQCB 2VTDA 2X0FA 3WDSA 1CVRA 4M1YA 2W6PA 4MAFA 1LLCA 5TJHA 1V60A 2QGZA 2RI1A 1XX6A 1NXVA 2XOKD 1O77A 1S2LA 3QVGA 4CEIB 2DPXA 2OQIA 1JFVA 1RHJA 2QN6A 1VPLA 221PA 4F3CA 4LQCA 2G9UA 1ISPA 2VK2A 3WLEA 2WKRA 3FI0A 3SBEA 1NIJA 4JYMA 2AIRA 2KMLA 3I6IA 4EB0A 3KD3A 4C4ZA 2WHRA 3G2HA 4MV8A 1Q20A 1XHLA 5AKLA 4XWKA 3EPHA 3U56A 5D7NA 3JQCA 4PW0A 3MCWA 1RQ2A 3HR7A 4EHNA 1XMXA 4G0QA 1FS4A 1JTVA 2QT9A 2RGBA 1JB1A 2NYAA 5C53B 4DG9A 1YSCA 2I76A 3UC5A 1HE4A 1KJ8A 1WABA 1UFQA 1DAGA 3G17A 2JEOA 2OFOA 3IBGA 4HSEA 3CG0A 4B76A 3WAJA 2C4WA 4Z4QA 3G1UA 1FP4A 2WMYA 2ZRBA 4KBFA 2QBYB 1URPA 2IRWA 2PUAA 4DBLC 5B30A 4M6WB 4F9EA 4XQEA 4EP1A 4BQRA 2A92A 2B35A 2GASA 1BE1A 1V5GA 3BL5A 1PJCA 4U7GA 1JQKA 2AVNA 1XMIA 3ESBA 4D3ZA 4MVYA 1LCIA 1P0QA 1BGVA 2D28C 5AW3A 2NSYA 4YCCA 1O97D 1UKCA 2HPHA 2VP6A 3FLAA 5G40A 3W3AD 4WVFA 3S81A 2G0AA 6REQA 1QCDA 3FSGA 2XT0A 5JRDS 1A5AB 4D57A 1UWVA 3MJEA 3HY3A 3OIGA 1XV5A 2B4YA 4HL6A 5JZSA 1Z15A 3F5DA 1C0PA 2RGRA 4KIFA 2LZ0A 1D6SA 3MQ2A 1LLUA 2K6GA 3U09A 1K27A 4JNCA 4RIGA 1L8OA 1NKTA 1WCIA 2ZSHA 3CMMA 5KX5B 1MMFB 1SUAA 1UJ4A 3TW4A 1GNTA 3IEIA 3CEPB 3BGOS 1LQTA 1PLLA 3MG9A 1D2EA 1WKCA 2D62A 1NATA 1X1RA 4MV1A 3PGMA 2HK9A 3FVTA 1RDFA 4MRAA 3PHCA 4D98A 3HKDB 1ZM2A 3ZWKA 4ETWA 4UVEA 4LX8A 1YVDA 1L7RA 2ECPA 5A1JA 4G9GA 4JFRA 3DTVD 5FBQB 2JLYA 2XWSA 2FN9A 4YV7A 3USES 5CR9A 1U6KA 3KZOA 2Z95A 3ONVA 2ZZKA 1T6ZA 2C04A 5FYDA 3DBIA 1RP7A 2ORIA 5JG7A 4BU0A 5IJ0B 1ZOIA 4TTRA 4ENVA 1OUMA 1FRNA 1U1IA 2FN8A 2VWGA 3EZFA 4PO8A 1ILEA 1VHWA 4QRDA 4HNUA 3FCCA 1MV8A 4LAFA 4GI5A 2QPTA 1NL3A 1XQ1A 4MH4A 1DQPA 4XCQA 5DBEX 4ADSG 4D5GA 4E7OA 3OF2A 1QKKA 2ATVA 1IVNA 4EG1A 1KE2A 5JXIA 3OM1A 2IU3A 4IRMA 2ZSFA 3X43A 1G8KA 3E8SA 3OOEA 3WTBA 4IKOA 5FPPA 2W58A 3TPFA 4BFXA 1H65A 1UFRA 2H1CA 4MV0A 5FI5A 5IVIA 3IE1A 1X8LA 5H9UA 4KQJA 1P7PA 2OT3B 2BEKA 4U8HA 2WK1A 1SOUA 4PR0A 1TM1E 3VPCA 2WD9A 1D2AA 4BB9A 1JHVA 1RYDA 2B34A 2A9JA 2ERCA 1JQ3A 1CT9A 3B1VA 4JMLA 5ALDA 3IUNA 5G0UA 3FWNA 2WJJA 4OHOA 5AE1A 1L7XA 2Z30A 4DAOA 3Q3EA 2HIAA 3OO1A 2BJWA 2VUHB 3ABIA 4INPA 5KYWA 3E3MA 1Q0LA 4QUBA 1Z6XA 1CZNA 2UVPA 3VU9A 2FQYA 3OY2A 3F6RA 1ULUA 2HSJA 2ZBVA 4FNGA 5INTA 5LDDC 3GG9A 3HA2A 1QH1B 3D6VA 3MOSA 4RGVA 1FUGA 4UXHA 5ESDA 4AJ1A 4PHCA 621PA 2E37A 3P2EA 3E9MA 3GJ8A 4O4LA 1KEKA 1TM3E 3A1EA 3DHYA 2IYWA 5EFOA 5EJ8A 5J1SB 1LV7A 3WBFA 4NXMB 1A5TA 5IXSA 1ZJJA 1P2SA 1VJDA 1G5FA 2CKMA 2FSUA 4D5EA 5I9IA 1RZRD 1NXTA 3PEVA 2V3WA 4BGIA 3QVWA 3T5CA 2VZ9A 3EAFA 4DUPA 1NP6A 3MBIA 5KSYA 3LRXA 4O4LF 3L8HA 1CE8A 1RQLA 2Z57A 3GJ5A 3ZQ4A 1I2BA 1NSTA 3C7AA 3OX3A 3P0HA 4IHQA 4TLCA 4UUNA 4ZI7B 1YTUA 1N57A 4UM9B 1USVA 3K0AB 4H16A 1OXUA 4KR7A 3W8EA 4L4UA 1EX9A 1V5EA 1YVRA 1X8KA 2O6LA 2R11A 5EKDA 3CRZA 2C82A 3NZEA 4DCOA 1EBBA 4GAEA 1N3BA 2IBTA 3SFZA 3B89A 5C5EA 1QFYA 1BHSA 1O6BA 2A67A 4RSRA 5K4AA 5JAHA 2YCBA 3LDUA 2E4WA 2O3TA 2NPFA 3MWGA 4HFMA 3ZIAD 1SKMA 2B6HA 3ZLVA 1H22A 3V4RA 2YYSA 1QYWA 3SEZA 4RH1A 2Y2UA 3QYAA 3HDVA 4MQFB 4N40A 3F6SA 4K6FA 5CTAA 4J75A 3WNCA 2VTBB 4RPLA 3RDPA 2XYPA 3HUFA 2H2GA 3A27A 5FOQA 3OE7A 3VR1A 2M5HA 4KU4A 1Y1KE 4RHUA 5FLXD 4XIJA 3LFTA 4BEWA 3AESB 2HREA 3OIWA 1AQUA 1H2BA 1OXXK 3N7AA 4X41A 1UJMA 5DGCA 4C30A 1XRQA 2Z2YA 4X45A 4GVLA 5HNKA 4U7TB 1N75A 1QFJA 2A9FA 3OT1B 2IEDA 3COSA 1SK8A 4AL4A 4GVXA 4ZZ3A 2RH9B 4YJGA 3BJMA 4X6XA 3LF1A 2JFQA 2A5JA 2Z6AA 2E4VA 4X20A 3CRVA 1PR5A 1T1IA 3O92A 4JV5B 1SQ5A 4NVRA 2H4JA 2WLSA 1GRNA 1PNVA 2WMDA 2HDNB 4EHFA 1Z45A 2BISA 1WUHS 2GERA 2PJZA 1BGWA 5DIZA 2X13A 2HR1A 2ZDQA 4R2IA 1ZM9A 4M87A 3CEJA 4MA5A 2IIVA 2O0HA 2FQXA 3R9KA 4A92A 1DLJA 1A2KC 1V95A 2FKAA 1NE2A 3I0MA 1Z6GA 2BM0A 2G5TA 4R1OA 1L8LA 5GM1A 1AK9A 1Y81A 3AG5A 4LOIA 5F5LA 5JANA 1K2WA 2PYDA 5BSMA 2P9ZA 1PTKA 3MXTA 2QX8A 1GRRA 1LRJA 4PRZA 5EWMA 2ZI4A 3RFCA 3S7ZA 4DMHA 5C1OA 3WJAA 1R37A 4GO1A 1NUHA 2GYUA 2X0JA 4KO3S 5EZYF 4W5WA 3R4CA 1V8PA 4D8WA 3PRKE 3C5HA 1EK6A 2B4KA 2WSMA 3IAM1 4X8OA 1AV6A 1XF9A 4CKCA 4BYGA 3QEKA 2RAVA 1TC2A 1Q16A 2YXNA 2ZT7A 2DUNA 1Y8QB 3W8FA 3ZHQA 3TZHA 2P6OA 1P6UA 1W9HA 4A6DA 5HJEA 1L1RA 3AY0A 2QRJA 4ARZA 5ECYA 1E3DA 1HSOA 2AMJA 4XFKA 2BHRA 3RS8A 4RCZA 3WLOA 4F5EA 1ZW1A 2WTEA 2GN4A 3W6NA 2AEEA 5CNJA 3G0BA 4XPIB 5K0SA 4QTYA 2X3UA 1KDOA 2O2GA 5DXFA 3SVZA 3H9QA 2OK7A 5G02A 1VLVA 4TT3A 1LVGA 2QRPA 3GJZA 1UMCA 1F2VA 1P91A 1N2HA 6CHYA 4QPCA 3SN6A 2YRWA 1D2GA 4ND5A 3LA8A 4BRWA 3ES9A 5DM60 4JVNA