4DCSA

Crystal structure of b. subtilis enga in complex with sulfate ion and gdp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
433
structure length
406
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN ENGA
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 131
structure length 406
sequence length 433
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcsA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA01
1E9SA 4TT3A 2H1LA 2NO1A 2WIAA 3P27A 2ZQ5A 1R7RA 1KIMA 3UKDA 4DC9A 3CRMA 3RDPA 4DVGA 4R7ZA 1TAGA 1VIAA 4EPXA 1QVRA 5GJCA 3MJHA 2GBLC 1P75A 2FF7A 3ASYA 4OHXA 1NKSA 4QBIA 2JLVA 4B3RC 1NIPA 1PLJA 1UKVY 1Z06A 2HJGA 1I4TD 4C3ZA 2EVWX 1SXJB 1W4CA 1G5RA 1MO4A 2GHIA 1GL9B 1Y63A 1EWRA 2A5GA 4A15A 4TLAA 4OKSA 1E4YA 3NC1C 1KNQA 3WBKA 4WIAA 1EFRA 4A2QA 2E5LC 2WAXA 3IGFA 3PG5A 1FTNA 2H5EA 4CEIB 2ONJA 4DLWA 2J1LA 1HH2P 3CRQA 5TDHA 3W8NA 4NYIQ 3AVUA 4LCBA 4CEJA 2ZJ2A 3FVQA 3PV0A 3ZD6A 2ZJ8A 2FZ4A 2AFIE 4XVRA 1II0A 3B1XA 2V6JA 3CPHA 3CF2A 3PQCA 4MDFA 3H86A 1G41A 4N0EA 1D2EA 3BRWD 4UNSA 4JZKA 4DDTA 3U44A 4L16A 1OYYA 1NNEA 2GJSA 4R98A 3ADDA 1GWNA 2RGAA 1UF9A 1XCGB 3S1AB 3CBQA 5BWMA 1N6HA 2FU5C 3RSLA 3PCRB 4Z1MA 2YOGA 1NBMA 3BAFA 1YZUA 4HEJA 4BEBA 4QHTA 1W0KA 1NMZA 3A1TA 2FEMA 1ZUHA 4B73A 1SHZA 3IQWA 4Q47A 3NBXX 4X64C 2IS4A 1T0HB 2V54A 3BB3A 1Q1QA 3NBFA 1Z28A 3THYA 1D2MA 1HT1E 1LV7A 2WHXA 2JLWA 3VR1A 4OJQA 3B13B 1USPA 3Q5EA 1JI0A 1VCNA 4JLVA 3RC8A 1AS3A 2KI5A 1E2EA 5AWFC 1DO2A 1GNQA 3TVDA 1R0XA 3NH6A 3SYNA 1IBKC 3TAUA 5D3QA 4U02A 4WVFA 5KOYA 4ACAA 2ZRBA 3C4JA 2IT1A 1HNZC 3DOFA 3EC2A 3WMEA 4CDGA 2BBTA 4JLDA 3O8CA 3AVTA 2IYQA 2J46A 2I3BA 3FWYA 121PA 1KOFA 1UAAA 3EPHA 5AJVB 2PX0A 4O2LA 1FTSA 2PMKA 4IDPA 2LKCA 1Q3HA 4KVAA 2QGNA 3CO5A 5E7IA 1N6NA 2YCBA 3J80D 2QEQA 1XFAA 4G5GA 2ZM5A 4TSFD 4Q9IA 2VF7A 1Z0IA 4QHSA 1GTVA 3WNCA 1YZGA 2Z83A 4HUQA 4EKDA 1HY3A 1US8A 2VEDA 3CF0A 3ZD7A 1E6CA 5KU1A 1RRCA 4V0MA 3CW2A 1NG9A 3JVUA 3EX7C 1Z3IX 1R10A 1EFCA 4IFBA 2HJVA 4URZR 4OHWA 2XOKD 1W36C 2ATXA 4IOKA 1ZM3A 2LKDA 3WY9A 1TNDA 2D2FA 2D2EA 3DMNA 2VA8A 3Q3JB 2AHOA 2ANBA 3D8BA 4NXMC 4LX0A 5E95A 4DLSA 4FMCB 1XB2A 1F2TB 3RS0A 2J41A 4G0NA 3GLHB 3TR5A 2RH5A 3H84A 5M04A 4BPBA 3GJ3A 1CS4C 1QZXA 1N36C 2DWOA 3B78A 4QNRA 4BFSA 5FOWA 1OE0A 4B71A 3C16C 5FR2A 5FOXA 4TZ0A 4KFUA 3NHAA 1XEFA 4UNRA 1IONA 2Q3HA 2O8DA 2YWGA 2ZM6C 2NO0A 5LD2C 1KZ7B 2JJ2A 3GLFA 1NMXA 3VHLB 3K53A 1JR6A 4LF6C 4A6PA 4LV8B 2PEZA 2DFKB 3U7FB 4FMCF 3T61A 1W5TA 3LX5A 2ONKA 3NIBA 5TMPA 2GF9A 3FMIA 2ZSDA 1U0LA 2BBOA 5KSZA 2RGNC 4ZKEA 1N0UA 2RGXA 3CRW1 3TQFA 3R8FA 4PZYA 2QRNA 4DUYC 1ZM4A 2C9OA 1P5ZB 1QRAA 4EJSA 4B47A 2ODNA 1WH9A 1U8AA 3KKQA 4ARZA 4FWIB 1X6VA 1HNWC 1WXQA 3DZDA 5EUMA 4FCWA 1D9ZA 2V4ZA 3CUEF 3GEHA 2GAOA 4HZUA 3J81k 5IRCD 3A58B 1YR9A 4QJ3A 2PZGA 3N70A 3TUJC 3QUSA 5HKKD 4GZMA 4EDHA 2GXAA 1HA3A 3OHMA 4BFTA 1JR3E 5DO9A 1AZSC 5EXXA 5FPHA 2R8RA 1RC8A 3LXRA 1CJVC 4JBYA 5AR1A 1RYFA 2KE5A 1U2RA 4EFLA 4XTCS 2CEAA 3X1WA 2QG6A 4A1FA 3ONWA 2MSCB 3OEHD 3QBVA 3CX7A 1DE0A 5CDFE 1Z0DA 1XEXA 2C99A 4HSEA 2DYKA 4PHGA 3EZ7A 2FFHA 4JBXA 1W2HA 3C8UA 2QY9A 2RMKA 3VR4A 3FKQA 3RAPR 4YMVA 3V4FA 1H65A 1DG1G 4JLMA 4D82A 4CEHA 1TF5A 2QQEA 1W0JD 3P32A 4B76A 4M2LA 4HLQB 3IBYA 3ZS9A 4PQYA 1CJMA 3EXAA 1Z29A 3P20A 1AQUA 1VLAA 4QXAA 2OSBA 1CJKC 1GRRA 2JMPA 4XSGA 2JJ8A 4QC2A 4LK2A 2QA5A 4PO9A 2LWIA 1JB1A 3LY5A 4A4DA 1QHGA 1U81A 4GOJA 5SZIA 3MMPA 2BEJA 4DDVA 1XPUA 3ASZA 4L9WA 2REXB 3TE6A 1CU1A 2CHGA 5F2EA 2IW3A 4BZQA 4F4CA 1QHHB 3DM9B 2C95A 1CF4A 4PQFA 2IF0A 3B1VA 2REBA 4R2HA 5FBWB 5AJZA 4F4JA 4ZCIA 3Q5DA 2FH5B 3K0FA 4WZAE 2WSMA 4JLAA 2V7QD 4FWTA 2XGJA 1ZU5A 1M2OB 3VMFA 5DGXA 2ASBA 4EIWA 3T1YC 1OIWA 3E5HA 3RS2A 3B5JA 4B6FA 4H1VA 3RRZA 2BM1A 4PAQA 3NC0C 1W4RA 3M0EA 5CYOA 1Q1EA 1Q0UA 2C8VA 4JI5C 1FNNA 2WWFA 1P2VA 4V0OA 4KLNA 1VCIA 3U7EB 5K8LA 3NWJA 4PTLA 3C14C 1IY1A 5AJXA 3GFOA 4N3NA 4C4PA 2VSOA 2QAGA 2AX4A 2WWIA 4BFWA 4E5UA 4JJKA 4IDHA 2B21A 4TSFA 2ZE7A 5H68A 4PANA 1FQJA 2DHRA 4BRWA 1OLOA 1ETUA 1IN7A 1VECA 2J7KA 2ZEJA 3NDPA 5K8UA 5L8VA 1UBGA 1OH8A 1G6HA 4P32A 3RS7A 4RY2A 4HATA 1UPTA 1TEVA 2QP3A 4ZDIA 1WQ1R 3RS4A 2G1JA 1NLFA 2ONFA 5EXTA 4MRSA 4MGYR 3C5CA 4MDEA 3RVBA 2XOKA 2P0EA 3PUWA 2IS1A 2IHYA 2UUCC 4Q66C 4RD3A 1PUJA 1YRBA 1JNYA 3UIEA 1TQ4A 1BYUA 3OZXA 2W58A 3W5JA 4TMWA 1V43A 1KSJA 3HU2A 2WMOB 1T0JB 2ZROA 2JEOA 2WV9A 4U00A 1GP2A 3T1OA 4DB4A 5FL7D 2X19A 2Q21A 1LB1B 1GIAA 1KDPA 3HPQA 1W46A 4AD8A 1VHLA 4Q5IA 5C2JB 2FZLA 4DSOA 3IUYA 2GKSA 4KHZA 2OXRA 3UATA 1HNXC 3KB1A 5GJWC 1W5SA 1SXJD 2G88A 1NY6A 3QKSB 4DSTA 2A5DA 4Q7KA 5JJIA 4PX9A 4XVQA 3IEUA 3WRYC 3QI2A 1E2PA 5KHOC 4BLRA 4HB4A 3T1QA 2AK2A 1JBKA 1TL7C 4OK3A 4PAOA 4U5XA 2E1RA 3M1IA 3LQRA 4PC7A 5EP3A 5TXGA 4JLPA 3RHFA 3CRRA 4HYYA 1ZIOA 2NG1A 3SYLA 1H8ED 2IYWA 4PSVA 4AKHA 2ZI4A 1GOTA 2AXPA 3DHWC 2QSZA 1XZQA 3A4NA 2R6GA 2VP2A 1OFIA 2DFLA 3BK7A 3AUYA 1XD8A 4DDUA 5GJVC 1AK2A 1FNMA 2P65A 2ZI6A 3MRSA 1T8TA 2FGJA 1GM5A 1KI3A 2BVNA 3LA6A 2QPAA 4EFMA 2Q6TA 4I1SA 2A5YB 3MWKA 2ERXA 3GLGE 1Z8FA 2VF8A 1ZW6A 2F4VC 5EE5B 3BGWA 5DI3A 1E69A 3V00A 1G16A 2BBSA 3ICEA 5A2QD 4GDFA 2VL7A 3B60A 5DI9A 3I62A 1SVIA 5GVSA 2WJJA 3HR7A 2E8FA 3KXLA 1U9IA 1X1SA 3BWDD 5JCPA 1MRNA 2YINC 1XNRC 2K5UA 2P67A 2HF9A 4D4JA 4RCZA 3AVWA 5CLQA 1IY2A 2DWQA 4LJ5A 3KQLA 1WB9A 2OAP1 3IKJA 3LVRE 5FTLA 3RNLA 2B6HA 3OEHA 3W8RA 4JVMA 3ZLJA 4ZCMA 1L2FA 3K0CA 4PZZA 4Q1CA 4YMUA 3QENA 1W49A 4P0TA 3I5YA 1HQCA 1ZB9A 3QSYA 3AH8A 3K8YA 4RSGA 2XTMA 4XJXA 2XZOA 1DAEA 2C2HA 1BO6A 1W0JA 2GRJA 2WZQA 5KSOA 1WMSA 4IDOA 2ZUCA 3I8SA 2VSXA 2A9KA 1P4SA 3T1TA 1XWIA 3AVQA 4ZDWA 1R6BX 1AA9A 2D3WA 3QKRA 2KBEA 1IQPA 1S1CA 2FWRA 2QP4A 4NBSA 4X8OA 2HCJB 1Q1ZA 2YOHA 2ZAOA 2IX3A 1A1VA 4NH0A 1MH1A 1VYUA 1GNRA 2FNAA 2ZRHA 2A30A 3GD7A 3GLIE 1P2TA 1DAIA 2CJWA 1CIPA 2J0SA 2HYDA 3WBJA 5KSPA 2IA5A 3QF4A 4ERNA 1ZVQA 4D4LA 2GEUA 2UU9C 1T4GA 4RD4A 3QE0A 5J47A 2JAQA 3P4YA 3X1YA 3IQXA 3K09A 4ACBA 4S2EA 5BN4A 4AIIA 5FPTA 4DV1C 1G8FA 2DFNA 4M53A 1Q21A 1KK2A 4ZDKA 4P4SB 3LBNA 2GDJA 3TKLA 1KI6A 2XB4A 4Q4HB 2BMFA 3MGCA 2FSHA 3NBZC 3MUFA 3MFYA 1U8ZA 1T5IA 1RJ9B 2ZI9A 3KKOA 4J0QA 4Q21A 2IYZA 1K8RA 3FYHA 3VR6A 4KVGA 4QBFA 5IK2D 1EX6A 1L4YA 4OI2A 5LDDC 2W0SA 3W6PA 4URWR 1KI2A 3VHXA 1SVWA 4Q01A 4BFXA 4OQFA 4US2R 2PLRA 4C0HA 2WJVA 2PH1A 3U61B 1OJLA 3I73A 1XMQC 5H8WA 3KQUA 3AGPA 4Q4AB 1K5GA 4LHYA 3AP1A 1S1MA 1TQ6A 1UDXA 2GWHA 3QBTA 1ZNWA 3CM0A 1DS6A 4HAYA 4GOKA 4A6XA 2QTFA 4TLDA 4TL8A 4RZ2A 4I1UA 3OIWA 4K46A 1OV4A 5DH9A 5FL7A 2D06A 4BASA 3THWA 3V9PA 3SJCA 2O8EB 2H92A 4XIGS 3CZPA 5DN6D 5J4KA 3DKPA 4BZXA 4DV2C 3VNUA 2FPMA 4M22A 2PT7A 4NONA 5F9FA 1FJGC 4RD1A 2FEOA 2VHQA 1HE1C 1SXJA 3QVVA 2OO7A 2PT5A 3UPUA 1U90A 2AKYA 4B2IA 4G1UC 3T5DA 4URVR 3LBHA 2EQBA 3K70D 5DI3B 2EFDB 3PUVA 4L5BA 4US1R 2CVFA 4WZ6A 1O3YA 1YJ5A 2TMKA 1XTQA 4QM6A 2GEDA 4A2WA 1W1WA 3ZVNA 1KAGA 4KV9A 2OPLB 1U94A 2JATA 2HCBA 3DZ8A 1J5EC 5ANRB 3GKUA 1B23P 3LLUA 1Z08A 3A36A 5KNCA 2OEPA 821PA 4P3YA 3HYTA 1ZD1A 1BKDR 1ZCBA 4NCHA 1KJWA 1Z5ZA 4A92A 4UJ5A 3V4RA 3KQHA 4IVPA 4LDJA 1R4AA 1KK0A 3GQBA 1S8FA 4WBSA 3LD9A 5AUNB 2IC5A 1LF5A 1UKYA 3CR8A 4NL4H 2O8CA 1CRPA 4KHPC 4RVCA 1LW7A 1BYIA 1XJCA 1ZM2A 4ZO4A 4Q1BA 1SULA 3SR0A 3RSOA 4B34A 5CLLA 3REGA 2H18A 3QKRB 1ZD8A 4NU0A 5FFMA 3X1ZA 4DR3C 1OSNA 3RYTC 1YZLA 4CYMA 4O3MA 4F91B 3QIAA 2ZYUX 4DEXA 5J4VA 4JLNA 4X62C 4GMXA 2CJWB 4FMDB 4LJ9A 2PL3A 4NYMR 4X65C 2QTVB 3EPKA 3AB3A 4JL5A 3F5FA 1X1RA 3M6AA 3QF4B 4ZDJA 2JLRA 3CNOA 3I8XA 4PXAA 1ZCAA 2NO6A 4LYJA 4YXWD 4CZ2A 4MGIR 4DDWA 5JS7A 2OT3B 1KI7A 3SFVA 4CGZA 3GCGA 4DEYA 2DWPA 2HUPA 3M4YA 4JLBA 2X77A 1KMHB 3A8TA 3N2IA 4RZXA 4B3CA 4V0KA 3K9GA 4V0NA 4BLSA 1MKYA 1KI6B 3FHTA 4DCTA 2G6BA 1P3JA 4OL0A 4XD7D 4A82A 2AL7A 2FPKA 2GVDC 3LO5A 2AXNA 3TUIC 4JYAC 1P61B 2OUKA 2O8FA 4IDQA 2GCOB 3I5XA 1RRFA 1JQJC 2CBZA 5BYJA 4TTRA 2ZUDA 3QG5A 2DYJA 5JI2E 3LDAA 2OCAA 3R7WB 5FH9A 3EPLA 3U3KA 1VHTA 1SVKA 2BMEA 3MD0A 3WYAA 2GZHA 1CJUC 4PHFA 5FTJA 4KFRA 4MKHA 2AN9A 2V1XA 4ZI3A 5B30A 1XXHE 2ECKA 4NHOA 3SQWA 1F2TA 3ADCA 4GP7A 1ZB8A 3WNDA 3GLHA 4B2LA 5JHHB 5ELXA 4MH0R 1DAGA 1GSIA 4KU4A 5FOSA 4TMKA 1YKSA 3JZMA 1DAMA 4DR1C 2Z6VA 2BEKA 4LZZA 2WIBA 4A0GA 3U7GA 3T15A 3QF7A 2CVHA 5CJ2A 3THWB 4GI7A 4LC1A 4TMTA 3L82B 1G18A 5JECA 4PC2A 3MG9A 1Q3TA 4FMBB 4LSGA 1UKKA 1N3BA 5IK2A 5G40A 4MKGA 2V55B 1XMIA 1P2UA 3LXXA 4CVNA 2GZDA 3HU3A 3HWSA 1KO1A 4DB2A 3VKGA 1II9A 4CW7A 2QSYA 1D8TA 2C96A 4IW3B 2RHDA 4FW9A 3K0SA 3SHWA 1I2DA 2CLDX 2QRZA 3QEOA 2C98A 3AEZA 4JKIA 1YHNA 2FSIA 2ANCA 4C9BA 1W36B 1MO6A 2HF8A 2BM0A 1BOFA 4M1WA 2XNDD 1DELA 1E2LA 4JSTA 4DJTA 4HDQB 1A2KC 4RFSA 2DB3A 3VAAA 2QNRA 4KYIB 1XCPA 4A0RA 1GL7A 1NI3A 3TMKA 3CNNA 3W34A 1B0UA 2CCGA 1FP7A 4PHHA 4YMSA 5DN6A 3TLXA 2B92A 1E98A 4B3XA 2BOVA 4TYWA 1CLUA 2Z43A 3RWOA 4KSBA 2BJOA 4BE7B 5L3QA 4Q4JA 2VO1A 3THOA 1ZUIA 1DVRA 2O8CB 2ASEA 4HLUA 5LD2B 4FINA 1LF0A 3I72A 4JT2A 2O8BB 1OH5A 5FOUA 3K9HA 4HZIA 2ZS9A 4KYUA 4OX9C 4D4KA 4NYMQ 3J81D 2P5TB 4K8OA 1G17A 1P2SA 1XU4A 1ZP6A 4UXHA 4WOPA 1KO4A 1CR1A 1J70A 3CWZA 4QNMA 4BRUA 4ESVA 4AKGA 1JR3D 4UKDA 4DLRA 2HXSA 3KKPA 4NCKA 2H7VA 3H2YA 1MABA 1Q20A 1MV5A 3EIEA 2GA8A 1NY5A 2WKQA 4JBWA 3WMFA 5K8IA 3UMRA 5HZKA 1SHKA 4Q9JA 3MSXA 3T1HC 4LJ6A 2QM7A 3I07A 1SVLA 3I32A 2JLZA 4WXRA 3REFA 5KDOA 1AIPA 2FE4A 4BSZA 2P2LA 2A2ZA 2QENA 4GP6A 3FMPB 3X1XA 4RZUA 4DLVA 3VU9B 5IHPA 4LBYA 3LLMA 1CP2A 2NGRA 2ODEA 2AWOA 4E09A 4ASUD 1QG4A 2WJIA 4WXPA 4NKRA 5B2ZA 1QHHA 1XEWY 2O8FB 2QMOA 2JJ1A 5FUXA 4M9XA 3Q8XB 3SZRA 2BV3A 3NG1A 1DAFA 3O8BA 3AM1A 4X8HA 4LF7C 1WBDA 2HDNB 2F43B 1E94E 4TQ9A 1G7SA 4YDSA 1CR4A 3U3JA 1G19A 4D6PA 4L4UA 1XTSA 3EWAA 1XDBA 5SZHB 1QHYA 4LF4C 1HQYE 2GNOA 3T34A 4XVUA 3U5ZB 3AF3A 1TUEA 1N5KA 5A0FA 1Z2CA 5P21A 3LV8A 5JJKA 1E1QD 1COWD 4GT1A 1S96A 4XD7A 4UNPA 1K5DA 1G7RA 3U3OA 3JZAA 4JVSB 2QL8A 3L8YA 4I4LA 1II8B 4FD2A 1MR3F 5FUVA 2CHVA 2D62A 3H1TA 1JEDA 1KI8A 4AYXA 4O25A 2IHBA 4HLDA 3T1VA 2FGKA 5KYKA 5G3ZA 5DHAA 4QGHA 1N2CE 2IYVA 1GUAA 1W44A 3TSZA 4L15A 5HZHA 5IT5A 1NN5A 2ZRCA 1IY0A 2ZU6A 2SHKA 1GVNB 4ABYA 1E9EA 1FW6A 3NXSA 1LS6A 1R5BA 1KJZA 1OPXA 1YE8A 2VHUA 4EFNA 1JECA 1Z6TA 3CZQA 2GJ8A 1CR2A 1TX4B 2UXBC 1G8YA 2Q9CA 3ZZUA 3C5HA 3ADKA 1XTJA 5L3SB 3CX8A 3TJZA 1VYVA 1VTKA 2VPPA 3DOEA 3GJXC 4M1YA 3IIKA 1T3HA 5E7MA 4L9SA 4ON9A 1AKEA 3N5CA 1XXHB 2WWYA 4O0MA 1T3SA 3QKSA 2Z5FA 4MUBA 2EWWA 1R8QA 3FMOB 2BMJA 4HB3A 4A0HA 5L3QB 3L8ZA 4Q4JB 1EGAA 1XF9A 2C9CA 3PIRA 3K70B 2G77B 1KJYA 4Q9HA 3SE0A 1PVOA 3AV0B 1Z0FA 4URYR 2HYIC 2VRWA 3NDBB 1IBMC 2REOA 1FUUA 5CIQA 2GK6A 4Q19A 3K9LA 2P3SA 4JT4A 1X86B 4Z8XA 3KJGA 4LYFA 4URUR 1F6BA 2XNDA 2Z4RA 1L8QA 2NIPA 2EGTA 1EFTA 1MABB 2H17A 3AF0A 4QG7A 3Q7QA 2BWJA 1I2MA 2QP9X 1SQ5A 2W6JD 4DR6C 2ZI3A 4Y0VA 4H1UA 3FFAA 3KZ1E 4DUGD 1FUKA 2I4IA 2D7VA 1FL9A 2IWHA 3SJBA 2EW1A 3T12A 2GK7A 1OT3A 1DTSA 4P4UA 4I99A 2YJTD 3VKWA 1CBUA 4B48A 2JLXA 4G5SA 1HURA 4JI4C 3PITA 1QHNA 3SBDA 1EFUA 1MO5A 1K6MA 3MWJA 4DR5C 2CL6X 2O0KA 3IO3A 4PHTA 2AD5A 4B3BA 3I4LA 4B74A 3K0EA 2XB2A 2YWHA 5DYGA 1J7KA 1JR3A 5BXQC 3ZIAD 2I1QA 3IHWA 3SJAA 3CPJB 1N25A 3EZ2A 3GJ5A 4Q1FA 4EPTA 3LWNA 2GEVA 3TAHA 1I4DD 3MWYW 4OJKA 8OHMA 2YKGA 4C7OB 4OBEA 2IWRA 2DPXA 5F3WB 3IEVA 3ECCA 4D80A 4R71A 3DL0A 5CDFA 2A3RA 3U3RA 3VNVA 1YRAA 1Z6GA 3BIFA 5IDVA 1LS1A 3OIVA 2VQSA 2FJUA 3BJIC 2QQ0A 5J4LA 5BYKA 1N0VC 3LBIA 2ZJZA 1Z6YA 2LCFA 1P6XA 2A5FA 1G5PA 2G83A 2D4HA 4URXR 2BCGY 4ASUA 1Q44A 1HUQA 2W2TA 5L3RA 3ETLA 2NMVA 2BHRA 5GVRA 1AGPA 3BBPA 2MMCA 1I94C 5L3VA 1XX6A 4AKEA 4E07A 3VTKA 3SHFA 4MKFA 4G5OA 1N5IA 5DE3A 4B2PA 3LRPA 5HCIA 1KYIA 4DRZA 1OXXK 2IEZA 4LYAA 5EXPA 4GKKC 4OYHA 2ZE6A 3HPRA 5K8TA 1E9BA 4PSAA 2G3YA 5EZ6B 4P4SA 4NYJR 3GJ4A 4LJ8A 4EPYA 4Q4HA 1XPOA 4HDOB 4B3GA 1XBTA 1XNQC 4JYCA 3SFZA 2DCUA 2ZIAA 3ZVRA 2HEIA 1U99A 2C5LA 5CM8B 1TQ2A 3SU8A 5JHGB 3GP8A 1KSGA 1RJ9A 4QGGA 1E1QA 1COWA 5GJBA 2Q0HA 1T5LA 5FTKA 5JJLA 5J4YA 3RLFA 5JRJA 1T91A 4TN1A 4LYHA 1KDRA 2NZJA 4PPFA 2XXAB 1A7JA 1P62B 4AQYC 3CNLA 3K0AB 2ZI5A 3D6TB 1E0KA 3NKVA 4ZKDA 4RFSB 1D6JA 4GSYA 1IN5A 5TVKA 3L0OA 3HJNA 3SN6A 1NVWQ 3HP1A 4M9ZA 4ZCLA 3GEEA 4Q4AA 1YQTA 3T5GA 4RJLA 4TMXA 2CLCX 4Y0AA 2J45A 3LX8A 4HAXA 4DV4C 5FBVB 1RYHA 1W36D 4A8JA 2WAYA 4QKQA 5EP4A 1W2GA 4G5QA 2JDID 1RRGA 4HB0A 2NPIA 4IDNA 1XJ0A 4KFSA 1KKMA 4TLEA 4B75A 1XZPA 1RKBA 1P7CA 1HE8B 3WMGA 2ZR9A 2YWEA 4KI0A 2O8EA 2VYFA 3KXKA 5IT9D 4LRWA 5AJWA 4QGFA 5FBRB 4K0KC 2C77A 2WICA 1ZNXA 2CDNA 2R44A 4IRUB 1GNPA 3ND8A 1N6KA 5HE9A 1RE0A 2KSQA 4JI3C 2MSEB 2OBNA 2W00A 5JWOA 5CIWA 5HKKA 3L43A 1L2TA 4LJ4A 4ITRC 1FZQA 3UG6A 1Z83A 2BMDA 3CLVA 3PR1A 5AUQA 1SKYE 3A4MA 1A2BA 4LFBC 2IYUA 5KO2A 2R2AA 4B6EA 2J3EA 2OPLA 1OIXA 2IYRA 3B9QA 2ORVA 2CNWD 2FG5A 2J59A 4IOMA 4DV6C 1YR6A 1GFIA 1Q12A 1HV8A 2UZIR 3A1WA 4DT1B 4MA4A 4Z8YA 4NCNA 4R2IA 1QBKC 5C18A 3LW8A 3Q85A 2WPDD 3B82A 1QF9A 1CXZA 4M9SA 2PT7G 4W5WA 4XOIA 1YZQA 4PQRA 5DNYB 5J40A 1A5TA 2BDTA 2W6JA 3OEED 1FPMA 3L0SA 3EZ6A 2XSZD 4LPKA 1M1YE 4LC0A 4DUGA 1WE2A 4AI6A 1D9XA 1RPZA 4C2UA 2GBLA 2EFEB 4JI0C 2QZ4A 3PEUA 5EE1A 5C46F 3EW9A 2CL7X 3EIQA 1D5CA 1PLLA 4F4IA 1IN6A 2E87A 3WP0A 5D3MA 2ZJ5A 3CJEA 3CH5A 4B43A 5E7JA 4Z51A 3QXCA 3WYGA 2VTKA 3GLGA 3A6PC 1E2DA 1FOEB 3KFXA 5JZVA 2QUZA 5H70A 1NLZA 2ZAMA 2ORIA 2ZSFA 2E7GA 3CR7A 2QBYB 4II7A 4TMZA 1FX0A 5E3HA 3ZIAA 4KFTA 4FIDA 1IN8A 4FCTA 4HAVA 4TLCA 1TUIA 1KDTA 2N46A 5FBQB 4EJSC 5A5GA 3NH9A 4NYJQ 2O0HA 2DFTA 3Q72A 2KZFA 3VR3A 4IXMA 1OH7A 2H16A 2V7QA 3QOFA 1UEIA 1ZU4A 1ZNYA 3I3SR 1UM8A 1CKEA 2RAPA 3DDCA 3LUSA 1KMHA 2F7SA 2R6DA 3BORA 1QHIA 2C04A 1F5NA 1X8LA 2KJQA 4JVNA 4GL2A 5C4GB 1TPZA 3IO5A 3AKEA 3NEYA 4CT5A 1R0WA 4M1SA 2GCOA 3U60B 1EX7A 4N1AA 1T8UA 3FPAA 4D0NA 2ZR0A 4C0JA 1ZJ6A 4DUZC 4RZ3A 4JI7C 1N32C 1SVMA 1ZNZA 2IUSA 2ZR7A 4JL6A 4MITA 4Q02A 3R7WA 4BECA 1PUIA 1KK3A 4XWAA 4IEEA 1TMKA 2VP9A 3FHOA 2PBRA 1PZNA 4IOLA 4ZIRB 1UEJA 3TRFA 4C0SA 1X8JA 3GLIA 3BD9A 3RS5A 3FDIA 6Q21A 2ZJBA 4LHWA 1XD9A 3QY0A 2ZREA 1NVVR 4A8JB 2JLUA 3AF6A 2ZRMA 2FX3A 2VP6A 4S35A 4OHYA 1NMYA 1P9RA 4RKFA 1M7HA 5UKDA 2OZEA 2WMNB 4D0LB 5JEDA 2OCYC 3F3YA 1SKQA 3G0HA 3EG5A 2WKRA 2ZE5A 2GJAA 3F0TA 4TYQA 5SZJA 1GKUB 1R2QA 3QKUA 3EZ9A 3SJZA 1F2UB 2BBWA 3DVLA 3ZS8A 3WHLA 4US0R 4Z54A 1BIFA 4FI3C 4QL3A 3P26A 3A1SA 5J5CA 1DAKA 1ELOA 1W4BA 2B7BA 2ZRLA 4QGAA 4BLOA 2PJRA 2E8EA 4NMMA 2UUAC 4Q9KA 3B1ZA 4D25A 1H8HD 1E4VA 4DV5C 1H8EA 1XMSA 1JQLB 1TQDA 4I81A 1LQLA 1XD2B 1JPNA 1KTVA 5LMNC 5JLJA 3PXGA 2X8AA 1C1YA 1CTQA 5FBLB 4JLOA 3ADBA 5KNBA 4Z1MD 2W6ID 4F7WA 3I61A 1KKGA 4TL6A 3UXMA 2O5VA 2JGNA 5EE3A 2QAGC 4AURA 5IF9A 4ZI2A 4W9MC 4ESHA 1N34C 1AS2A 1EWQA 4HB2A 1VIYA 5C4MA 3THXB 3P1JA 2OLKA 2AWNA 1NSTA 1TU4A 2RGEA 2PLFA 3ZJYA 1OXSC 2O8BA 4MH4A 3AKCA 4OHZA 3VKHA 1LFDB 4DCNA 4IVRA 3TSOA 4M9QA 1XEWX 1EFHA 1KSFX 2VH5R 4LJYA 3WP1B 4A0FA 3SBEA 2J0QA 1VYTA 5LBIA 4LHZA 1JALA 2F1JA 2V9PA 3IIMA 4DV7C 5D3MB 1YZTA 4AYTA 2ZJAA 2QROA 4KLZA 1OB5A 3GLGB 2CNWA 1FFHA 1AGRA 4TQUS 1FMLA 1G1MA 4GMDA 1KI1A 1FMJA 2RGNA 2GJKA 3PEWA 2IF2A 2QE7D 2ZPTX 3L2OB 3ZVLA 4EAQA 1FX0B 4OK5A 5HCNA 4B3DA 1AM4D 5DLQC 4Q48A 2WPDA 5FR1A 1DBSA 3ZGXA 3H0KA 2MSDB 1G8PA 2VHCA 3L0IB 4LWZA 3C7KA 4WZBE 3OEEA 4OI0A 1LTQA 2XSZA 2FV8A 1ESNA 4AG5A 1N33C 4XTRA 2BC9A 3F8TA 5FOTA 1NSFA 2BKEA 3GFTA 4G5RA 4A2PA 4AWXA 2Q3MA 1IXSB 4DBLC 3R9WA 2Q9BA 1QG2A 1XTKA 3W6NA 4B3FX 2NO9A 3VU9A 1F3OA 4IKEA 1M34E 2RHMA 2W2VA 5B58C 5BQ5A 1O87A 4FMDF 3FGNA 1G3QA 1W7AA 2VP0A 3IPXA 4DLXA 2YV5A 2PCJA 3AVVA 2UZ3A 4F92B 3QPVA 3UWKA 2OCBA 4LFAC 1VCMA 1VDZA 5TARA 4CT4B 1P9NA 2OXCA 1YR7A 4HAWA 4Q18A 1NVVQ 3UMFA 2ZS7A 3BFXA 3IDQA 2F43A 1KY3A 2QPTA 4YQFA 4GRAA 2XTZA 2ZRKA 2Z4SA 4PC6A 2PMDA 2V6IA 1HYQA 3D7MA 3B7GA 1VG8A 2GXSA 4E22A 3U4QA 2F55A 3IIJA 2WWXA 3GLIB 3O47A 4UJ3A 2W0MA 1PA4A 2RCNA 1Z22A 4TYPA 3W9YA 1TEXA 3PUYA 4DWJA 2A5JA 5CK4A 5EQTA 2GXQA 1G4AE 1G7CA 4QBHA 1U9IC 2JCSA 2VQFC 3SC3A 1II8A 2CK3D 5FPSA 2ZRFA 3A1UA 2OG2A 3WHKA 4MUAA 1E2IA 1YZNA 2NO7A 2ZJOA 3EASA 1E2QA 3FKSD 3B1WA 4TQAA 2JIZD 2WJYA 2OHFA 4BFZA 3K0CC 1DO0A 1J99A 4B3SC 2F1IA 3DPUA 5EE0A 2QMHA 5KDLA 3RRNA 1ZRHA 2QMUA 2ZI7A 2IL1A 3PENA 4RD2A 1UJ2A 1S3GA 2WVJA 1GKYA 3BS4A 4TZ6A 2V1UA 1KSHA 2GVZC 3QEJA 3QNUA 1NVUQ 2OBMA 4HUTA 1NBME 1Z2AA 2C9YA 2PCLA 1G64A 5KUTA 1OFTA 2J87A 2CE7A 2XJ9A 2YYZA 3PFIA 2YOFA 4OHVA 2ZSAA 4LJAA 5L3SA 3BH7A 4MTNA 2ZE8A 4DZZA 2IK8A 4G3XA 1NN3A 2YC2C 2ZS8A 1ZC3A 4MYTA 2PN2A 2EWVA 1XP8A 4DCUA 5HR5A 3PJRA 2IBMA 1XXHA 2WSSD 1E9CA 1L7VC 4QFMA 4Q7JB 1WDTA 3P4XA 1OFUX 4LFCC 1XPRA 2P6RA 4FCVA 3E70C 2R6CA 3E2IA 4MYUA 1QVAA 1Z0KA 3OAAD 1KDOA 5JSZB 2VHJA 1E9AA 2ZANA 3KJHA 4W7SA 2RGDA 2CXCA 4Q03A 4M8NE 3RWMB 2RKOA 4OI1A 3K09C 2NTYC 2CL0X 5EUQB 1QHSA 1K0RA 3AF1A 3W90A 1H8HA 3W6OA 3AP2A 3QVUA 5TY0A 1N6PA 4MRNA 1OYWA 5J4HA 2CMKA 2QL6A 2R9VA 3A4LA 3Q7PA 2NOAA 3CB4A 4LBVA 3AVPA 2W6IA 5CJPA 5SZKB 2F9MA 2AK3A 3OF5A 1JOSA 2BIFA 3EZFA 2O52A 2PEYA 2JLQA 5FOVA 1IAQA 2VQEC 1G8GA 1JXOA 4JLJA 4V0ME 3BB4A 2ODBA 4LOAA 1P73A 3R8CA 2EU8A 2R62A 3RS3A 2XNSA 3AF2A 1AQYA 1U0HC 2R6FA 4NE2A 4PAMA 1QDEA 1NYEA 3C41J 4BGDA 2HXYA 3ZDQA 5JBQA 1M6NA 4LY6A 4RFVA 2EFCB 2NZ8A 4DR2C 1CJTC 3AVOA 4KITB 2GTPA 4NPHA 4W5JA 3EA5A 4HAZA 5KPJA 4XWKA 3EAQA 3U7HB 5LMUC 1J8MF 4Q7LA 3W5IA 5TV2A 3QG1A 2WJGA 2IUTA 2BKUA 3ZYCA 2F6RA 4DCVA 1G8HA 2CXXA 2W2XA 2QE7A 2ZJYA 1IJFA 1FQKA 4C7OA 3BERA 1GKIA 3EARA 2ZYWX 3GFPA 3K1JA 1VG0B 4Q7MB 4JJZA 1AKYA 5FI0B 1MT0A 1UKEA 3TK1A 3JVVA 3GLFE 1IXZA 3GMTA 1NVXQ 1NJFA 2EFGA 4YXWA 4TWZA 1DAHA 2QU8A 2WWHA 3OE7D 3KUCA 5G53C 3L0PA 4B33A 1XTRA 3UG7A 3U4QB 3OTOC 4GKJC 1JJVA 1LNZA 1KZGB 3PUXA 1SXJC 1SZPA 4NDZA 2IYXA 4P4TA 1U8YA 4CIDA 1YU9A 1OIVA 4C0AC 4EQ6B 3FB4A 5FTMA 1L4UA 2ZRJA 3X2SA 3FTQA 2KWIA 3SOPA 2CCKA 4GOXA 3AF4A 3BH0A 3D3QA 1XTIA 4CRWB 3I1FA 4NCIA 4B35A 3WXMA 4B32A 1OHHD 4KJZA 3CH4B 2VHTA 4M1KA 2R65A 3MCAA 1DEKA 2L0XA 1ESMA 3AKDA 4M1TA 4PPNA 3DKVA 1KO7A 4RCYA 3SDZA 5JCZA 4D2IA 4UNQA 2KBFA 3ICQB 5JWHA 4DV0C 2JLSA 2WOOA 1HR0C 3JAMD 5FPKA 2OE2A 2J9RA 1RZ3A 3DMDA 4YLGA 2B8TA 1G7TA 2IYYA 1A82A 1OH6A 1Z6XA 4C0LA 3KKNA 1G5TA 4JI8C 2OFOA 2AR7A 1EK0A 1E9DA 1W48A 1Z6AA 3CWQA 4AC9A 2KB0A 1ODFA 4JI2C 221PA 4M0LA 1BS1A 721PA 3RC3A 5DHFA 2CK3A 1TU3A 1KGDA 5HTKA 1T3LA 2XXAA 2QT0A 1RVDA 1J2JA 1ZM9A 3QXSA 4TLBA 3K0AA 3KFVA 3KJIA 2Y8EA 1Q22A 2C78A 2VIIA 2GETA 2GF0A 1IOZA 2JIZA 3FKSA 2QGZA 1PLKA 1RFLA 5DSZA 5JMTA 3ZQ6A 1N5JA 5JWRA 1WA5A 3ZZTA 4YC7A 2RGGA 3PUZA 1RW4A 4CEJB 4TYYA 4DR7C 1NRJB 2D74A 4UNNA 4Q9LA 4LV5B 4OQNA 1HEIA 2IXFA 2G0TA 2RGBA 4BFUA 4IHQA 3CX6A 5FUWA 2OESA 1NJGA 1IXRC 2BJWA 3FFBA 2P6NA 4ILEA 2X1VA 4CF7A 2ERYA 1Z07A 1R0YA 3U44B 1RIFA 1A4RA 2OFXA 2PJZA 3GJ0A 4IEIA 2ZRPA 2WBLC 2FN4A 4MYHA 4BWYA 1N6RA 1XCMA 1YZKA 1WCV1 4IJMA 5EZ5A 1UFQA 1G6OA 5FI1B 4UXIA 1OW3B 2R6AA 1XMJA 1GITA 1GRQA 2WJHA 2WSSA 2ZRIA 4YDHB 4B44A 5H1YA 2XJ4A 2ZYTX 4Q1AA 4HI0E 3TW4A 4M4SA 1F48A 1UKZA 2PZEA 1Y3AA 3SYKA 4BLQA 3A37A 3OAAA 4AKIA 2JLYA 3THYB 1XMOC 1DG3A 4PPQA 421PA 1TADA 3GEIA 1USPB 4QJ4A 1X8KA 3C15C 3BB1A 2IYLD 2E8CA 2OFWA 3NHBA 3RABA 4NXNC 1G3UA 4FN5A 5DIFA 4C0BA 4MGKR 4JVLA 4DT1A 2FDCA 4OK6A 4AK9A 2F1HA 4MKIA 2NPFA 2XZPA 3ZVMA 3ND9A 2N42A 5DISB 1ZIPA 2B7CA 2X2FA 2D7DA 3QXHA 4BFVA 4D4MA 1OKKD 2UXDC 1NG1A 4NCJA 1BMFD 4RKEA 4HDCA 4WAUA 3VX4A 1D2NA 1Z0JA 2A78A 2OILA 3QPUA 4PC3A 1E2FA 4QHYA 4AG6A 3KQNA 4M1MA 3SI7A 2YHSA 3KB2A 2JA1A 1G21E 1JEEA 3B6EA 5FLXD 5LPNA 4B3TC 2YVUA 1Q1BA 3NTUA 3K9NA 4YONB 1G4UR 3TW8B 5KNDA 2GESA 1ZYUA 2JASA 2QT1A 2FMXA 2ZYVX 5CM9C 1E0JA 4YMTA 1S2MA 4TYNA 1OFHA 3DM5A 4GNKA 2DY1A 4HUQB 1VCOA 3LFUA 1US8B 1WRBA 2RGCA 3E1SA 4KBFA 3R20A 3ZZ0A 2QAJA 2QI9C 1KI4A 3IBGA 5KTYA 3AP3A 5C1BA 2MMGA 1HH4A 2BCJQ 3FOZA 1R0ZA 1E2HA 3AUXA 1E1RD 2QBYA 4TTQA 1E79D 2OBLA 2WTUA 2IYTA 1EXMA 4IOJA 3AVYA 3AKYA 1IBLC 2OCPA 3CRVA 1P9WA 1OB2A 4NP6A 1CRQA 1IJEA 2YC4C 3SEAA 1NL3A 5EP2A 3EPJA 5A4JA 1GG2A 4FXPA 2IXGA 3KL4A 4GPTA 1DPFA 3AVXA 2D7CA 1N2FA 1KY2A 3OE7A 4TTPA 3KQKA 3KDSE 2W83A 5TB5A 2GCNA 2AKAB 3BC1A 5BN3A 2EYQA 4D0GA 2O8DB 1NN0A 2IEYA 3EIHA 4Q1EA 4HLUC 2HV8A 2QMEA 1VG1A 4C0KA 1KHTA 4EUNA 1JAIA 4A36A 2J5XA 4JKYA 3BFVA 2AD1A 3GLFB 1VMAA 3KUDA 2QN6A 2ORWA 3OIUA 1E2GA 1WF3A 1KO5A 1OHHA 2GZAA 3KJEA 2EYUA 1XRJA 3RANA 3SQXA 5EP1A 5BN5A 3U3MA 1KI9A 1E96A 4WA7A 3U6BA 1SVSA 1IM2A 4DIDA 5JS8A 1E99A 4QM7A 2UXCC 1W4AA 4DIEA 4ZIRA 2ZTSA 4W5HA 2ZUBA 3G82C 1EG7A 4EJSB 1J8YF 1E3MA 5LB2A 2UVQA 5CK5A 5CB6A 4H9GA 4PC1A 2GXUA 3O8RA 2CCJA 2UUBC 4ARZB 1G291 1TTTA 1W47A 3IPYA 1X3SA 2VSFA 1ZINA 4HZUB 1UBFA 1E2JA 2J0UA 2A7QA 5IWAC 2OV2A 3GJ7A 2WM9B 621PA 2IS6A 2XAUA 1PV4A 1CEEA 5EJEA 4KODA 2J0VA 1FP6A 1LVGA 3CONA 3WNBA 4ZV4A 5BR8C 5AUPB 2GILA 1E2KA 2F3RA 2ZSEA 3HR8A 4AY2A 3TH5A 3OFND 1F2UA 3AF5A 2YNMA 4YHHC 1ZBDA 1AN0A 4F38A 3TUZC 1G3MA 3UWOA 1JAHA 5B57C 2VBCA 2WOJA 5FPYA 1E0AA 1N6IA 2F9LA 2CY1A 1E9FA 2OM2A 2XTNA 3G5UA 5CYPA 4MGZR 1XEXB 4P31A 4NTZA 2FFQA 3A1VA 4PZLA 521PA 2ZITA 3PEYA 5EE9A 2FSFA 1XD2A 1E32A 2OLJA 4JI6C 2VLIA 3VFDA 1E0SA 5CB8A 2IS2A 1OXUA 2HLDD 2PX3A 4CEHB 1N0WA 1S4QA 2O0JA 3DEFA 3GJ8A 3X1DA 4DLYA 1S3SA 1I4LD 4PPGA 4HLCA 3R9XA 1Z47A 4Q00A 3U2QA 5JEEA 4MRVA 4KSCA 4LPSA 1ML8A 3CPEA 1NLYA 4D81A 2RB4A 3TGPA 3THXA 4KAXA 5JRZA 2PZFA 2NQ2C 5GADl 4E03A 3RRMA 4OQXA 5KPDA 4JMPA 2HT6A 5F9HA 1N6LA 2ZRGA 4BUJA 4TMVA 1KNXA 2AFHE 4LV6A 2HT1A 4JLKA 1MRSA 1KAOA 2P5SA 1S9DA 2I1VB 2ZSBA 4QOSA 1KMQA 4LBWA 2OAQ1 4KO8A 4U7DA 1DOAA 3BOSA 2FA9A 3KTAA 4G01B 1ZC4A 3OIYA 4QRHA 3K0FB 2ATWA 3CKLA 3N2EA 1NF3A 2EFHB 1IBRA 2WWWA 3KX2A 4C2TA 4LHXA 2GAAA 1OKKA 4KCGA 4BEJA 1BMFA 4XH9B 3TSWA 5BW8A 4LHVA 4XWOA 4BQSA 2XZLA 1SGWA 4NZYA 1DARA 4UQOA 1QWIA 3CIOA 2QAGB 1XNJA 5HPYB 2ZVPX 1NKTA 3EWSA 1BH2A 1XJQA 1S0UA 2ATVA 4HAUA 5G41A 2QTHA 4AYWA 1RRPA 1R8SA 4QJ5A 1G9XA 4Q4LA 2Z0MA 4TL9A 1E1RA 4PO1A 1M7BA 1E79A 4PR0A 2G0NA 4JYBA 1Q57A 2ZRDA 2V3CC 2J7PD 3LNCA 1Z63A 2WWGA 2QPOA 1YR8A 1ANKA 3GPLA 1NN1A 1HTWA 3B9PA 4TT3D 2QM8A 4M1OA 5LB4A 1SXJE 1Z0AA 2F1RA 4JS0A 2YWFA 4KXFB 4V0LA 5AK0A 4JSYA 3QJYA 1AZTA 5JFGA 1GDDA 4DKXA 1KK1A 4R9UC 1OF1A 3O8DA 5EXSA 3U6KA 4GZLA 3ZH9B 5HE8A 4A9AA 3I92A 3NVAA 3QKTA 4LF5C 2J0UB 4UXJA 1G20E 3H4MA 1ZAKA 2GCPA 2CE2X 4DCSA 4LF9C 2FFAA 4PFSA 3HYRA 1J90A 1GAJA 1JPJA 1EFRD 2ZVQX 3GJ6A 3TNFA 4OQMA 1T9HA 4DLTA 1G3IA 1MOZA 3K70C 2ZU0C 2WKPA 3QXXA 4LBZA 3SNHA 1VG9B 2XEXA 4ZPXA 1P60A 1OXTA 3UMSA 1EESA 3LW7A 4C30A 2FSGA 5FL3A 1GZSA 2G1KA 2VP5A 1GL6A 3KKMA 3Q9LA 4GBMA 1JJ7A 2B8WA 1AS0A 3WRXC 4EPVA 4X8LA 4KBGA 3SS8A 1U0JA 1IN4A 3MJRA 2JDIA 4POAA 2HHHC 3VX3A 3BXZA 4QBGB 4P33A 4BFYA 4C0QC 3B85A 4LUCA 1N5LA 3PEVA 4BZPA 4JI1C 4XX2A 3TVTA 1UDWA 1NBMD 5FTNA 5E4FA 2V8OA 2DBYA 4IFEA 3BE4A 1W0KD 1M8PA 5F98A 1ZD9A 2H8KA 4OI4A 1TF7A 2FFBA 3T35A 3CF6R 3EC1A 3OFNA 5JSZA 5KDDA 4CEIA 4DLZA 1VPLA 3FE2A 1R5NA 1WP9A 1GILA 3AQ4A 3VQTA 4WW0A 1MO3A 4DLUA 5AUOB 1V5WA 1LY1A 4N0DA 1ZM7A 4DR4C 1E9RA 1T6NA 1IHUA 1M74A 3BH6A 3NBYC 2QORA 1F60A 2ZXUA 3KTAB 2N1BA 4L8GA 3AGQA 1CR0A 1C9KA 2IXEA 4NYIR 1PJRA 1DADA 2HLDA 3S1AA 4I1OA 4M21A 2H57A 2ZRAA 3HDTA 3MLEA 3MWLA 1SKYB 2FOLA 1GRNA 4I1VA 5KSYA 4D26A 2P6UA 5B64A 3OESA 1G3RA 4DV3C 4MRPA 4RD6A 4RD0A 1XMVA 3FMFA 4YMWA 2YZ2A 4MQBA 4V03A 1S9HA 3BFKA 4DHEA 3VR2A 3QQ5A 2XX3A 3EA0A 2GJ9A 2C03A 4GFDA 4V02A 1ZMXA 4JL8A 3PVSA 2IUUA 4K81B 4MRRA 1C4OA 4O2RA 3MAAC 3LH5A 4IXNA 2JJ1D 1UADA 4XSHA 4DSUA 2BJVA 4B3MC 3GLHE 1ONBA 3TBKA 1HT2E 3B2EA 1R5OA 3QXJA 4EPRA 3HU1A 3KXIA 4NOZA 2F3TA 3B1YA 4A8JC 1AJEA 1CULC 3T06B 3QPWA 1WBBA 5CITA 4DXAA 1UBCA 5DYIA 1YVDA 3LVQE 3EERA 4X8MA 2DR3A 4YY3C 1QHXA 4EPWA 5FUYA 4F93B 2CLSA 4PSKA 4LJ7A 4DSNA 2XITA 1U98A 1ZUNB 2E9SA 3LAWA 3W3ZB 1SVOA 4EQ6A 2X2EA 1N6OA 2IYSA 3UANA 3IILA 2ODWA 3R9IA 1E2NA 2JJ2D 2ZRNA 4TL7A 3LQQA 2Q3FA 2ZETA 2G9NA 3FHCB 3TQCA 1E2MA 2VP4A 4X66C 4IVQA 3VR5A 1KKLA 5JI3E 4JIMA 3ZQJA 1JXMA 1UBEA 1TF2A 3TIFA 4LGMA 4BLPA 3W3AA 4PO8A 2UKDA 3D31A 4MYCA 3DO6A 4OQLA 2CHQA 4Q1DA 1NP6A 3B8HA 3WYFA 1VKJA 5G3YA 4JV5C 1NIJA 1P72A 1OXVA 4LI0A 3IHLA 4BLTA 2J7PA 3RRYA 2Q9AA 2XR1A 1KO8A 4LF8C 5AJYA 3UK6A 3NEJA 2FPLA 3TR0A 1M7GA
chains in the Genus database with same CATH superfamily
4XB2A 3E03A 3IUNA 2H1LA 3HGQA 4TTVA 2PX2A 3UKDA 4DC9A 4G2TA 3CRMA 2KPOA 1I6KA 4LRQA 3RDPA 5MN4A 1TAGA 4S12A 3B48A 3M81A 4CTKA 1D07A 3NONA 2ON6A 4QUAA 4QBIA 4AZ0A 4JSRA 1YH3A 1NIPA 2PFSA 3O83A 1ND6A 1O5OA 1UKVY 1X1CA 3FYUA 1DKNA 2GR9A 2OMKA 4RM2A 3V4VB 5ADUS 4LF4B 1FSGA 1MO4A 2G67A 3N9IA 1BWPA 1UIRA 5EUBA 1GL9B 3TDKA 1JSXA 2VF4X 4PIPA 4V24A 1U7OA 3OPNA 4BZZA 2QU7A 4A15A 1JQBA 4OKSA 2BAGA 3LY7A 3ZK7A 1PJ2A 3G2LA 2MIIA 3JD1A 4NBWA 4AZ3A 3JATA 3KJNA 2JIRA 3SZLA 4A2QA 4EYGA 3G0CA 5IYZF 3WGJA 5KYUB 2ZZKA 2GN6A 1OJ7A 4CEIB 4DLWA 4W5NA 4H27A 1LU9A 3INTA 3U1TA 5H0IA 4MROA 1G20B 1KZ1A 2DQSA 4ZVPA 1X92A 2H0RA 3A26A 3TTUA 2QYHA 5DBOA 1TDJA 1ABEA 4WJLA 4OSPA 3CPHA 3I23A 2V6JA 4RPJA 1C8KA 1PS8A 3CF2A 3UHAA 1K6JA 1HR0B 1E77A 1M1NB 3SQNA 1C9JA 3TLKA 4UNSA 4JZKA 5DM2A 4L16A 4YAEA 4EY3A 4IJUA 1GNSA 2GJSA 1NNEA 3RQIA 4ZN6A 2JJQA 5IH3A 1FUGA 5KEIA 3H83A 1U7DA 4JT9A 5EQJB 2C5FA 5KNCH 4L6CA 3UJ7A 4B7CA 1SU4A 4ZTZB 2YOGA 1NBMA 2WTNA 3BAFA 1NXQA 4WLFA 4WK4B 4HEJA 5FWNA 1NMZA 4N0PA 2FEMA 2GBPA 4Q47A 4G1FA 5AOAA 1QFSA 4G26A 3E7FA 2V54A 4FEYA 3TJMA 4BO6A 1EFAA 1Z28A 5T4BA 4B6GA 5IS2A 3BL8A 3VR1A 1HKUA 4WNYA 2DHDA 1USPA 3Q5EA 1VCNA 4BC7A 4PZEA 5DP2A 3VXKA 1ZMTA 3RC8A 2ATCA 2Q0QA 1AS3A 2HSGA 1QGAA 2KI5A 3MLAA 3RK0A 2GZMA 2Y9PB 4TTTS 1HEYA 3TVDA 2B99A 4QYTA 3TAUA 4RJ2A 1IMJA 1BZYA 4WVFA 3L7NA 4XPIB 5E6UB 3ZIDA 1ECBA 2ZRBA 1FE8A 1YI8A 2EBUA 4L9AA 4YH1A 1KVQA 3QU7A 2VUHB 3WMEA 1IXYA 1ZHFA 3RS9A 1XR3A 2WJAA 2J46A 3LRTA 4HY3A 4OF4A 5BRAA 3FWYA 4BUZA 1L4GA 2Y0CA 3V1KA 3JSAA 5JU6A 4QU9A 2GTIA 2LKCA 1ZLYA 1A0OA 5HA5A 3J80D 2G9UA 3HXKA 1BDHA 3PFGA 4BN4A 2QEQA 2AUNA 4G5GA 3DULA 1T26A 4XWTA 4HVCA 1S2IA 3INYA 3TW8A 4V1CA 3MTQA 2EBWA 3W4IA 3LY9A 5JE8A 3KZOA 2JIPA 1YZGA 1Z2EA 5DBFA 4UD2A 3RWBA 4MUJA 4XDHA 4BC1A 5F2KA 2ZB7A 3OU6A 1RM0A 5KMGB 3CJQA 3F98A 4YJGB 5IXSA 5I9TA 3EX7C 1BE8A 1EX1A 3O0TA 3SY8A 1EFCA 1OBOA 5FNVF 1DINA 2HJVA 2VJMA 4ZGWA 3DVQX 1YC2A 1W36C 2ATXA 2D8MA 2E4WA 2VJDA 5JOQA 1B8UA 3A05A 3SLKA 5E7QA 2V6GA 3CEHA 3FNRA 3KPWA 3B3JA 4BU0A 3DMNA 3ZJVA 1FRNA 4NXNB 4KAJA 1UZMA 3DKIA 4FZVA 4DLSA 2IY8A 3DAOA 5G4KA 3V2UA 3Q2OA 5EP4A 1EGQA 1XB2A 3RS0A 1F3LA 4G0NA 3TR5A 3H84A 1Y0BA 2Z2YA 4BPBA 3B78A 3DLCA 5TC4A 2UXDB 1F6WA 1NW6A 1OE0A 3JR3A 2NQTA 3U4MA 3ANLA 1I4WA 4FDTA 3EXHB 4FOTA 4G4IA 3FGPA 5KOJA 1A96A 2Q3HA 5DCYA 2QTWB 4PFJA 5DM0A 2JJ2A 2G1PA 3KCNA 2I8LA 4BNVA 3U49A 3VHLB 3WA7A 1JR6A 2C9MA 2VK2A 4A6PA 2PEZA 1KMCA 3T5MA 1EXDA 4NU5A 1PK7A 1ZZEA 1W5TA 1RE1A 3LX5A 1SIWA 1EDEA 3NIBA 4DSZA 4F8YA 3D0OA 5A4IS 1CRLA 2B1IA 4AZ3B 3HB5X 2ZSDA 1U0LA 4D92A 2YBDA 1G9TA 1YBFA 4G0ZA 5TSDA 5KSZA 2FWPA 5KU7A 3CRW1 1KRWA 5A1JA 3AM4A 3UC5A 4OB7A 4RHYA 1Q0TA 1P5ZB 2B98A 2C58A 3K4PA 3X43A 3ZLVA 3CVXA 1QKKA 2ODNA 5K45A 2B6NA 3EFHA 5KREA 4RK4A 2HU7A 5CG2A 5JAZA 2C82A 4FWIB 1X6VA 5LC1A 3DZDA 3RSFA 3CUEF 2YW9A 1T8RA 3FCXA 3PCTA 4J3FA 3KD2A 2BZGA 4N3BA 5JNWA 3SJUA 4ZYLA 1QR2A 1YR9A 2WU8A 3EVNA 2PZGA 1AQ6A 3KE8A 3N70A 3TUJC 1BU8A 2ZW9A 5CHEA 3UVEA 4Y6GB 1D09A 2B9VA 2LUOA 3VNAA 3SVZA 4BFTA 7ADHA 2GXAA 4L5IA 4S1OA 5EXXA 5FPHA 4XARA 5JNSA 5ARCA 2LCIA 2R8RA 3LXRA 5HFAA 3ZCQA 4JBYA 4RX1A 4D8WA 3KBOA 5AR1A 3R7LA 1WMBA 2KE5A 3G3EA 4J9UE 3ZWMA 1PEAA 1ZZGA 4IV5A 1IL0A 2O4CA 2VDLB 3N8NA 3CX7A 2GRAA 1XEXA 4HSEA 4PHGA 3EZ7A 3MJDA 3BFJA 1W2HA 2GX6A 2UXCB 3HTXA 2RMKA 1EU1A 1E3IA 3JQ7B 4POOA 5LSAA 1RI2A 4AICA 3RROA 1TC1A 5T4FA 3K8ZA 1O03A 4E21A 5I7EA 1UP7A 3V4FA 1H65A 1ZR2A 5EGSA 2VRBA 4PLZA 1TIBA 4R84A 3RYHA 1OQAA 3P32A 4B76A 5IC5A 4M2LA 2UUBB 1QF7A 1M83A 1X94A 4JC0A 2QE6A 4PQYA 1E8NA 4ZI5A 1WBJB 4X97A 3ZNNA 5C5CA 2YFQA 1RWMA 5BY2A 3QWIA 3T3NA 3IXLA 1RJWA 3OD5A 3P20A 4RH1A 2XMRA 2LE0A 1QSGA 1A71A 2IOQA 1CJKC 1GRRA 2JMPA 3NFRA 1VLLA 3TFQA 1SQ6A 2GFHA 5HGXA 4PO9A 4Y1RA 4A4DA 1QHGA 2XRYA 4AJEA 1CVLA 2Z1MA 4PSCA 3ASZA 3G9QA 3EFEA 1XHEA 3I8OA 3MCVA 5M5BA 1PG0A 3WYDA 1CU1A 4F4CA 3N76A 1QHHB 1JT9A 2RAUA 1YJBA 4ARAA 1KZ6A 2IF0A 2XF2A 4TRJA 1SHUX 2CNKA 4QYIA 5FBWB 1HLFA 3ZNOA 4HNAA 3TUFA 2FH5B 3UW3A 5CDUA 1C4XA 1HE2A 2QUAA 2V7QD 1A8UA 2YYSA 3ETGA 3NP7A 4JLAA 2PVSA 4MK4A 1M10A 4RTKA 4YB8A 2ASBA 3T7KA 2PUGA 1ISGA 2ZBUA 4GSLA 1H93A 3QVMA 4BP3A 1KEVA 1VIDA 4DV6B 4YYEA 2QTRA 3W6UA 5DJ5A 3V7NA 2C8VA 5G4KB 4RGQA 4V0OA 4RK5A 5K8LA 1KJNA 5JZOA 3R3XA 2PNFA 3T9DA 1QS0A 2W4MA 3J80A 4C4PA 4MW9A 3KQYA 1RPJA 4QTZA 3W77A 4F4UA 1QQTA 3CO0S 4DBZA 3VAZA 2QR3A 4BDSA 4BRWA 4EKNB 1NMSA 2J7KA 4PUHA 3T4EA 4E11A 4P32A 2OECA 4EHKA 2XHEA 1TEVA 4CN9A 3HWWA 4QATA 3LY8A 5ULLA 1NLFA 1TUBB 2AGVA 5BURA 1UPXA 3QELA 4XWYA 4CCWA 2ZWOA 4L07A 2IHYA 1ADBA 5K8FA 3DMGA 2C3PA 4RPIA 1PUJA 5DXFA 4BC0A 1JNYA 3LCUA 1KAMA 3VSEA 5A2GA 4H17A 1K6IA 3NTOA 4NQZA 5AK4A 3WIOA 3TSCA 1J49A 1ACJA 1GP2A 1VL6A 2GEJA 4JYZA 5DFAA 1ADCA 2X19A 4K88A 3MYYA 4MLPA 3OKFA 4MCIA 4NOJA 4FKBA 4INOA 3SMQA 1RACA 1D4OA 3HB7A 4DWVA 5C2JB 1ABBA 2AC2A 3R3UA 3SSAA 2Y1KA 4XYGA 2JBHA 3AY0A 3H3FA 3WS7A 4KR2A 1VL5A 3CV3A 4GWKA 3G0OA 1SXJD 3TCXB 3H11A 1I24A 2XQVA 3O94A 4H4EA 3C6KA 2FX5A 1NW3A 3HJRA 3LCRA 1VSUA 5JJIA 1IE3A 1X1AA 3FPHA 4PX9A 3R3VA 2PQ6A 1UOOA 3C98A 4LYEA 3WRYC 3QI2A 4MTCA 4RVGA 4BLRA 3DCYA 5AKHA 4UVDA 5IM4A 3F96A 1TL7C 1RTTA 1EVYA 4U5XA 4PYLA 2I67A 3MOSA 1H9CA 2WMDA 3O2QB 2HNKA 2QLTA 1H8ED 1OROA 2VF5X 1C30B 1T34A 3WRWA 4V1CI 4BB9A 1GOTA 2CFTA 3DHWC 3JD4A 3V7UA 4ZCPA 1WDKA 2QSZA 3TKAA 2I54A 3E6AA 1CUBA 1ZCJA 3IOYA 3NAQA 4GYWA 5EXDA 1FNMA 5D00A 5B7GA 3FNBA 1ADYA 3EDYA 4FSHA 4ZYVA 2V7UA 1GM5A 1C7IA 1Z4PX 1X2BA 5L51A 1QPBA 1UBJS 2QPAA 2X0EA 4I4IA 5BV2P 1EUZA 3BA1A 4XD2A 4E1AA 3WGIA 4MRMB 4I1SA 4GWGA 3PS9A 1I51A 2B4TO 3L7YA 3M6WA 3CURA 3PCXA 4UVGA 3RYHB 1OBVA 2XE4A 1G16A 2BBSA 2HA7A 3HCEA 3NFYA 3CS3A 5DI9A 3ZGLA 5FB3A 5BRJA 2J08A 2WD7A 4QDKA 3AESA 3JAWB 1I0ZA 3HJCA 5JCPA 1DIAA 4CPDA 3P96A 2IV7A 2DWQA 4OQEA 1IZ7A 1MPTA 3CLHA 2K87A 4LJ5A 5CT5A 4K9LA 3WGYA 3UJPA 2L2QA 3MTAA 4UHJA 5FTLA 2QRUA 2Y76A 1DCTA 3MMSA 4HWSA 2XE8A 1E2BA 1A2OA 3LDGA 4FNAA 4MLCA 4NNOA 5E2BA 3RREA 4BE4A 3ZLJA 3JSXA 3KDAA 4PZZA 3TZ6A 2A67A 4FEEA 5IUNC 2IJGX 4GSKA 2E48A 4H7PA 1O5TA 4P0TA 4QYIB 4HNAB 1T0BA 3D02A 1UMKA 1MVOA 3JQ6A 4UHDA 3V46A 2FLWA 2OBXA 4NZMA 3ETHA 3G2HA 4BX2A 1J1UA 2XNKA 2WFZA 3VZCA 5KSOA 4IDOA 4NULA 2X0KA 5A9TA 5EJ9A 2CLHB 2VSXA 1THGA 3W7VA 2Q4OA 3N2YA 1P4SA 2PBFA 1I2CA 1QCYA 4J0EA 4P7FA 2XQKA 4YCJA 3A32A 1M1ZA 1KP2A 3HCRA 1AA9A 1F2VA 3QKRA 4NBSA 2QP4A 1S1CA 3K2BA 3IAM6 2HCJB 4RXUA 4ARBA 2YOHA 4CM8A 2VWPA 2IX3A 1A4IA 4NH0A 1A1VA 1MH1A 1VYUA 3KELA 4XUCA 1W88B 2IOFK 2BFNA 3ZJ4A 4K9RA 5ALQA 3IOEA 3ANXA 2P9YA 4UHKA 3L1HA 1E5LA 4GVPA 4KQMA 1CIPA 3KTDA 1B6TA 4W9NC 1T9KA 1NE2A 3QWBA 4C6TA 1UDRA 1JF8A 1OR8A 2WHQA 4D3YA 1XIVA 3KVVA 4URFA 1V8OA 1H5UA 2XCUA 4RD4A 3OOHA 4PX5A 4YX9A 1JJFA 4S2EA 4ACBA 4D97A 3JQPA 4AIIA 1BH6A 1TCVA 3HCNA 2C7GA 4WBNA 3OFKA 5FPTA 5FBKA 5HFJA 3ESXA 1D1QA 2QRQA 1FFAA 1G8FA 2DFNA 4M53A 4P7KA 1KK2A 2PR7A 4Y7CA 5KWVA 5B6IA 1C0PA 3Q11A 5LMCA 1PBTA 1C8BA 1PX0A 1KI6A 1VXRA 2GDJA 4Q3EA 5U9CA 1GPJA 3WO1A 3GRCA 5CFPA 3KCQA 1AO0A 1H2ZA 1VBKA 3MFYA 4D57A 1FTQA 1Z82A 1T15A 2ADOA 1RJGA 4U2CA 2ZI9A 1RJ9B 3KKOA 1I5RA 3U48A 1XAGA 2IYZA 4RS4A 4UDOA 3ZE8A 4AB1A 3FYHA 4BNMA 3UHOA 5IK2D 2YZKA 4RPKA 3SE7A 1U8EA 2PBLA 4OI2A 1JG4A 3WSWA 3EVGA 3WLHA 2QIPA 3RJMA 3H11B 2A9FA 1R0SA 3DL4A 4DMFA 5HIJA 2PH1A 4ZYTA 3ZJUA 3MM4A 2CL5A 1AUVA 3U61B 1OJLA 1RBZA 1X3LA 4UBMA 2J6HA 3SBXA 2E5WA 3I73A 2QVXX 1ML3A 1XMQC 3IBCA 3MJCA 3PF9A 4RQTA 2YV2A 5I9NA 1L7EA 2RK6A 2NSYA 1RJDA 3VUFA 2E2WA 3T3PB 1O6GA 4CV2A 2JGDA 5F23A 1UQRA 4IQ8A 1N7IA 1PR3A 3C7DB 1T2VA 2CMFA 3QBTA 4XDYA 3MWDB 3U56A 3CM0A 2H8GA 4FE7A 4AZSA 3NHMA 5K1ZA 5EJ6A 2YR0A 2H2GA 5DH9A 4BASA 3V9PA 2IEIA 3BMQA 1DBIA 3CZPA 4MV4A 3DKPA 1QK4A 3OM1A 2IXAA 4W1PA 4Z49A 3FSJX 1TKCA 4BTEA 2P62A 5F9FA 5IM4F 2FEOA 4BYGA 2O20A 1SXJA 3QVVA 3UPUA 3RC1A 2ZR8A 4G1UC 3STTA 2EFDB 1SZDA 4C6TB 2CVFA 2LXNA 4LI3X 5ADHA 3C3XA 2XVYA 5LVAA 4E12A 3LHKA 3AESB 4QM6A 1YXMA 1PZMA 3IRUA 1KAGA 5BV0A 2NZ2A 4KV9A 3CX4A 5EWJB 2JHCA 3ZVNA 3RQSA 1EKXA 3M1YA 2D0DA 4NDAA 5EVCA 1Y3BE 1C7QA 1FLNA 1FU7A 2QMQA 4E5YA 3CZ9A 1Y1SA 5KB3A 3TNJA 821PA 5CXUA 3HYTA 3IMCA 3PHCA 4AU1A 3ROTA 1QFXA 2PUAA 2EX1A 3WLPA 3WB0A 3IURA 2JFFA 2UVPB 2WUFA 4W8HA 4JXZA 3HCPA 1CQXA 4KYTA 1KEEA 2EWMA 1S8FA 2TRSB 1JDPA 3ROPA 5AUNB 3P9PA 3ZNQA 1LF5A 3CR8A 5K6TA 4ZMSA 4PZPA 2Q6KA 4NAHA 4PNPA 1ZOIA 4EB6B 4BMOB 1R0CA 2D1QA 4FONA 3CQ9A 4R7GA 4B3RB 2JD2A 2OXTA 2PBZA 1UFVA 3RSOA 1C1XA 3V8EA 3TSAA 3UCXA 3N58A 2C4NA 2PUDA 3PUHA 2H18A 3I53A 3QKRB 3VZRA 3A27A 3G5AA 3EQ2A 3RYTC 1OA1A 1T1SA 3FNHA 4C7KA 4S05A 4K9DA 4J1TC 2Q62A 2QSJA 3QIAA 4WRRA 5K3EA 5JH7B 1R12A 2PGIA 1CQJA 4ZVMA 5AXAA 3WGTA 4GI1A 3FPEA 4NYMR 4R54A 3G2OA 3EPKA 2IBSA 1XRBA 2I55A 3DMPA 1Q7TA 1C3EA 3F3KA 3E4DA 4ZDJA 4TVOA 4PXAA 3KZVA 4YXWD 4NJEA 1P80A 4IUCS 4CZ2A 2EV9A 2REQB 4MGIR 2HL6A 2Q6IA 1GFSA 3TSYA 1OREA 1R6XA 3HEBA 5I7RA 3KKEA 2I29A 4NE9A 2WG2A 4G0QA 3A3NA 2GD6A 2DWPA 3I1YA 3M4YA 4XM1A 3A8TA 4RZXA 3AHCA 1EB8A 4ER7A 3FCEA 2FX2A 3RV3A 4AJLA 1KI6B 2G4LA 1YQXA 3BCSA 4IH4A 4MVCA 4MIEA 4EQZA 4KPFC 3P19A 2XCRB 2AL7A 2D27A 3R09A 1AC5A 1JHOA 3F6CA 4OHKA 4C7VA 3SX0A 1D6NA 2HCTA 3LO5A 4G0PA 1RP7A 4NK4A 3UFXB 4GBED 5T7BA 1EM8A 4X64B 2X8WA 1U2SA 2F3UA 4O59O 4IDQA 4WCFA 4ZU6X 3BXPA 4HXFB 3MHTA 3OX2A 2FMIA 3D2AA 2ZSJA 2RBEA 4RMGA 4WBNF 2CBZA 1K68A 5BYJA 4ESEA 2XMSA 1XZIA 5IZ4A 4Y2PA 2ISQA 2GB4A 3BDAA 4TXHA 1V1RA 2VYVD 4GM0A 4WXHA 4YRMA 1Z8HA 3B5IA 2GZHA 4RESA 5ENVA 1YIDA 2FZ5A 2V1XA 1MJNA 1PR4A 3GLUA 4PPYA 5DGHA 3WWOA 1FUYB 1IBKB 1HK7A 3F2IA 5IDXA 3AV3A 1E7WA 3ADCA 1N2EA 1N5OX 3NATA 3T5TA 1R6UA 4MH0R 2FQYA 4PLCA 1DAGA 3EEOA 3TDEA 1KMIY 1OXKB 2CBXA 4WLOA 2XCSB 1JTEA 4TMKA 5DT2A 1RQLA 2JZOA 4J75A 4LZZA 2Z6VA 3E9RA 1PW7A 2ERCA 4R83A 2NUPB 2RG1A 2CVHA 5CJ2A 4GI7A 4LC1A 4TMTA 4AUNA 2OVBA 3LUHA 3A0UA 3RKRA 2PT9A 2XMQA 1CY7A 3U62A 5JECA 1Q3TA 1Q0SA 3ZQUA 3ZHSA 2FEPA 4LSGA 1UKKA 2YW2A 5IK2A 5G40A 3O4RA 3BD6A 2H11A 4UUNA 1PFVA 1NQUA 1TM2A 1UAGA 2V55B 3LC2O 1ONPA 2GZDA 4L4SA 4RK6A 4RV9A 3TLGB 4DL9A 4GKJB 2OB2A 3PJGA 4D9BA 4CW7A 2GSDA 2R11A 4N12A 1W29A 2QD1A 5GAJA 2B36A 2IU0A 5JALA 3TG8A 2CV2A 2RHDA 1SUWA 3RSSA 3U1VA 4E5MA 2OHJA 2CLDX 4ND7A 3I5UA 4KK4A 1BWQA 4JKIA 4RK1A 4X95A 2FSIA 3PC4A 4BFLA 1Z2PX 3ND5A 4WK6A 3I2GA 3WHIA 4DMLA 3DXZA 3VMMA 4RTSA 2DUWA 2XW6A 4KDCA 4RQAA 5HOQA 4R8LA 3WK9A 3EF1A 5CNKA 5C8XA 5F3RA 1BFDA 4G0YA 4DNFA 4M1WA 1DELA 2C2XA 2GN1A 2MSKA 4YFYA 1GUYA 2AEFA 3I42A 5DK6A 5E1DA 4I2NA 4NXMB 1S7GA 1AMNA 3TMKA 4HNHA 5ER6A 3NYWA 2CCGA 5HK8A 4MZDA 2WE7A 2VPQA 1FP7A 4Q93A 2GN0A 3B53X 2F90A 2YUIA 3E35A 1U7WA 3A1EA 3UGJA 2VDJA 4IX1A 2QLFA 2O9JA 4Z4FA 2Q1SA 2D5IA 3O9ZA 5E9QA 1U28C 2C54A 3GAMA 3GXBA 3BD8A 5T4EA 1S4MA 2ASEA 1CUWA 1U8XX 4PICA 3VSDA 2ZM6B 4FINA 5LD2B 4JI8B 1YQDA 4ZJZA 1GA6A 2O8BB 4PYRA 5FOUA 5F78A 2H2HA 3AZPA 1UK7A 3K9HA 5FWXA 3U9SA 1CQIA 4BV3A 1C1XB 4NYMQ 1U0SY 2YJ3A 5LUBA 2MINB 1ZESA 1SAYA 1G66A 1XU4A 2FQQA 3BWVA 4N01A 3OY2A 4WOPA 4QNMA 1CR1A 2XXBA 1PX2A 4CDNA 4AKGA 2DFPA 2IODA 4UKDA 3HY4A 4IM7A 5LYYA 2PD4A 2OZLB 1EFKA 3EFOA 1LDNA 1MABA 4NCKA 4XEHA 5LIRA 2FG6C 3DP7A 4G41A 3EIEA 4KMSA 4PCVA 2BDUA 2VPYA 1CQJB 3DHNA 5DHPA 2O7VA 4DUYB 3H5WA 4WK2B 3UT6A 2W43A 3UMRA 4FDVA 3AJEA 1YUMA 1SKBA 4Q9JA 1U2ZA 2PGAA 3I07A 2QL9A 4FYHA 3JYLA 1D1PA 3L06A 1DJLA 5CNJA 2QTMA 4HYQA 3GPIA 6CHYA 2A2ZA 2QENA 3SC6A 3CLSD 2B5WA 1M9NA 1SY7A 1AH2A 1BA2A 1IN1A 5JZBA 4JA0A 1ZSNA 4G56A 4H60A 4KI7A 3LLMA 3M4ZA 1CP2A 4PHCA 1X38A 3RHTA 2AWOA 2VHZA 4AUEA 3QVOA 5ALVA 4G0OA 2GEKA 4ASUD 2JH9A 2WJIA 2W6CX 2Y0EA 4NKRA 4U7TB 4WXPA 4EEKA 4GYYA 3R9KA 3OTWA 3ECSA 5NLLA 1H0HA 2P6MA 2HLPA 1X15A 1TIKA 4P7JA 4O29A 2Q1WA 5AP9A 4N9WA 1U4NA 5FUXA 4WCFB 1ONSA 1D4AA 3ENQA 4R9NA 3SZRA 4Z6KA 1DAFA 1RMYA 4P38A 4J7XA 2F43B 2IHKA 1HTTA 3Q3VA 1G7SA 1SMKA 5KKCA 1HXHA 3U3JA 1QIJA 1KAHA 3K20A 1YNOA 1Y80A 4AN4A 2PSDA 4MPJA 1ULZA 3QLVC 5AYVA 5SZHB 4LF4C 1CUHA 1HQYE 4U2KA 3T34A 2DERA 1JHYA 4JEMA 1TUEA 2I2DA 3CGGA 3Q6MA 4KXLA 4MEJA 1N5KA 4HNVA 5AW8A 5A0FA 3CXUA 2P3QA 3OICA 2DWCA 2WUEA 4D3XA 5BSEA 5MN5A 1XA0A 3O6VA 3KJXA 4ETWA 3JZAA 2QL8A 4I4LA 4FJ2A 4EHDA 2CHVA 2FJ0A 1QRUA 3M6XA 1TM5E 2HPAA 5A0VA 3VA7A 1YV9A 1DFHA 2IHBA 3LPNA 3O8NA 3EG9A 5AI4A 2ZFUA 1A50B 2H48A 1LI4A 1XZDA 5G3ZA 5IAGA 4HQFA 3I2IA 5JG7A 4FGWA 3A7DA 3SF8A 3UGTA 3UMGA 4A8PA 1N2CE 4UBJA 1FSZA 2VYVA 4TKUA 1G8SA 1ZIYA 3WKEA 3DZCA 5IFLA 2ZRCA 4QO7A 4BXOA 1IY0A 5JY1A 4BVKA 1RABA 4B6OA 3NXSA 4LNAA 4PRKA 1EFLA 5J5AA 1RY2A 4KQCA 5LA6B 1JX6A 2PKRA 2QRHA 1A4UA 1NW4A 3IERA 3IUPA 2H29A 4ISBA 1I3LA 1EXWA 3CZQA 4KVZA 1TX4B 3V4SA 3JYPA 5KWSA 4QFBA 2XUPA 3PFBA 2W22A 5DEOA 1VYVA 3C43A 4CIXA 3ZJ5A 4KUGA 4ZT3A 1OCEA 1UBUS 1XCJA 3RRXA 3W1WA 3RYCB 1C4KA 1YACA 2XB9A 4GU5A 4L9SA 4NDNE 5E7MA 1AKEA 5GONA 3NTRA 2QI9F 1YBVA 2XTAA 4BTLA 4NBKA 5H9WA 1QO0D 3ENKA 3BMCB 3Q8WA 8LDHA 1X7YB 3IAEA 3RIGA 4HB3A 1F8UA 4ZWNA 4D9KA 1EGAA 2CFRA 3GZNB 1Z25A 2P9HA 2G77B 1PVOA 1UT5A 4KQFA 4XM2A 5BN1A 4OQPA 1P0MA 1IWBB 1KOJA 5EJFA 3AV0B 3TD6A 1HDGO 5K0FA 2ZCUA 1A5BB 3EIUA 2H7CA 1TD9A 1L5ZA 2LTAA 1IBMC 3HJUA 1C1DA 1FUUA 4R9RA 2GK6A 1FS5A 3D6NB 4RM3A 3L7OA 4NATA 4Q16A 5D51S 3KZMA 3N7UA 3QVKA 1M6XC 4OBXA 1H3FA 1V6CA 3BRCA 4URUR 4WECA 3UJ9A 1F6BA 4RANA 2Z4RA 3HKDA 3K32A 5CT9A 3OZEA 1IATA 1MABB 1VBFA 1DAPA 1XAIA 3TRIA 3EQ9A 4K9OA 4GX1A 5BORA 2QP9X 2PAFA 1DKUA 1SQ5A 1PYDA 1RBMA 2O2DA 1K5PA 2VJPA 2W6JD 3O7MA 4HTFB 3KZ1E 4DUGD 5BSKA 4DA8A 3OQOA 2PRSA 1QFZA 4HH4A 1ISMA 1FL9A 1JLMA 3ZHBA 2EW1A 3T12A 3B6ZA 1OTYA 1RS0A 2CJXA 4H0FA 1B6GA 2FKNA 5AVVA 4KQHA 4I99A 4R41A 4M0PA 4CE6A 3O4HA 5CYFA 2J9XB 3WDMA 5AE1A 4DNQA 4G5SA 3UBMA 1HURA 5HOEA 1YS7A 3G2KA 5I8ZA 3TLEA 3IO3A 1KU0A 2AD5A 2G4CA 4LXQA 3JCZA 5GGXA 2CSXA 3HJFA 4ENRA 3BL6A 3BK2A 4R3NA 5ITZA 1ODSA 2YWHA 2JLBA 4IQ0A 4QJBA 2OGZA 5DYGA 3IHWA 3OURA 3CPJB 1LK0A 1N25A 3QFCA 4GICA 3BZBA 2DPLA 3OBBA 3ONDA 4G5HA 3TAHA 3PQ8A 3MWYW 3PNBA 4OJKA 4C7OB 3D8UA 3GLVA 1CQZA 2ZUFA 3G9TA 2D0OB 5F3WB 1XF1A 4RDXA 3IEVA 3NJRA 4UEKA 4AAYA 5CDFA 2ZDQA 3KZCA 4U6SA 4Y2RA 4OUDA 1LSOA 5FFNA 4K2AA 5IDVA 1NT4A 4M0UA 2O8VA 2VQSA 3B36A 3FYUC 5FHRA 4YRJA 1IHXA 4Y2VA 2FJUA 5ELMA 4HHEA 1N3LA 2YHAA 2Q4DA 3I2FA 3LBIA 1CDEA 4MGEA 2WF9A 4UU7A 3S4YA 2XUFA 3DFFA 4TQGA 4DMMA 1P6XA 1G5PA 1EB9A 4ASUA 2JZNA 1FU8A 3BJEA 3OQVA 2AN5A 5GVRA 1XNRB 4MPPA 3RRJA 4W5RA 1TTHA 4IIBA 2XIJA 2MMCA 2VP3A 2JBWA 3TW0A 4CLXA 3RK4A 4M36A 4E07A 1LRJA 1PV2A 4EMTA 1TZBA 1WIWA 3VVMA 1I1OA 1SBYA 1N5IA 2FVXA 3AEKA 1RRVA 4PLGA 3LRPA 4OGFA 4R1UA 4B2PA 1FDUA 2BDEA 4R69A 4JFAA 3SKXA 4KWTA 3RO7A 2UYCA 3DB1A 1UXGA 1M73E 1Q7BA 1QYIA 1TW2A 1RXSA 2ZE6A 1XGKA 4EHHA 3CSUA 4PV7A 1LWNA 2G3YA 1QXSA 4PSAA 2XRFA 3PNPA 4FDLA 3RC2A 4AMZA 1NQAO 2EL9A 3IAXA 3LO8A 4MWTA 3EH2A 4X93A 3ES9A 4B3GA 2XVZA 2IE0A 3UJAA 5B5SA 2JL1A 4TN5A 4UVHA 4I46A 1T8SA 1UJNA 3BWCA 2PGXA 3ZVRA 1E6KA 4CKEB 5HQ3A 1Y4ZA 3HL0A 1I30A 4QGGA 2Z98A 2B8EA 1RLMA 3IOCA 1MEEA 3SEZA 1TJ4A 5GJBA 4B8YA 5FTKA 2JFGA 3E8MA 3ELUA 4H3VA 3G89A 5JRJA 3ZE9A 1OX4B 1YD7A 2GBCA 2XY4A 2YXEA 4LYHA 3I6YA 5GONB 4GS5A 1P62B 3QFSA 2V0NA 1T8YA 2CEKA 3CNLA 2DLDA 3K0AB 4LZLA 2ZI5A 1XCBA 4NENA 1P45A 4KQKA 1LEHA 2AXQA 4RPLA 4UM5A 3TVYA 1AQNA 1W8DA 3CKYA 3DG9A 2GPSA 3OOWA 1MHTA 3ON5A 4DADA 1ML4A 4C43A 4N40A 3BVPA 2CLCX 7MDHA 1KWGA 3ZX5A 4K8RB 1SQGA 2SCUA 4KX3A 2CUKA 3N5KA 5IJWA 1YASA 2UU9B 1WXDA 1L5OA 1W2GA 2BFEA 2Q5OA 2JDID 3QBDA 4G5QA 1C1DB 3IKVA 3DKKA 1XJ0A 4IDNA 4INPA 4KFSA 5IM5A 1LI5A 2IUFA 2R86A 1XZPA 3C6ZA 5GONF 4G0WA 2PX8A 5ICEA 2AG1A 2NPOA 1P7CA 1RAHA 2PLNA 4ZZ3A 4MOWA 4IP0A 5JJCA 3WMGA 1C9EA 3PHJA 3IQGX 2ZGVA 4KI0A 3A04A 5BUSA 1K08A 5IT9D 4NV3A 1VP9A 1H2AS 5EAIA 5AXBA 1VB5A 4X65B 2WICA 2XODA 3N7TA 1PNTA 1BDJA 1QM4A 3VISA 1DAOA 2OC4A 2MSEB 4IIFA 5T6MA 4L50A 3H13A 5CIWA 5BW4A 2HQBA 3LUJA 5FAKA 5KVSA 1GPYA 3UAZA 1XKTA 3G9ZA 1K4KA 1Z83A 3CLVA 4RWEA 1ICEA 1M1XB 4OCZA 5AUQA 1SKYE 1T5OA 3D6AA 3IEMA 5CLJA 4LFBC 1QGUB 3QI7A 2DBRA 2IYUA 4LCJA 1G0OA 4B6EA 1RWKA 4K86A 2OPLA 1QIHA 3H5IA 4IILA 5F9MA 2A35A 4DV6C 2PIDA 1YR6A 1GFIA 1C7JA 1WF6A 1YK1A 4PZUA 4CM6A 3A1WA 1FFXA 3EMDA 3RUHA 2FUEA 3ZWOA 2XCQA 3KLMX 2HJHA 3IP7A 4CKWA 4R2IA 2ST1A 3T3IA 3MPUA 3LW8A 4IDEA 5C18A 1Q7CA 2JGRA 4OUKX 2CV0A 1QF9A 4M9SA 5DNYB 4BJ6A 1YZQA 2W2LD 3G13A 3L84A 1JE0A 1A5TA 2W6JA 1K7YA 4PROC 2XSZD 2QZJA 4RA6A 4DUGA 1WE2A 2DETA 1D9XA 1RPZA 3UW1A 2R8ZA 3T0GA 1OBFO 2RARA 4JGGA 1VI2A 3T0FA 2GBLA 4JI0C 2QWXA 1JXAA 3VNBA 4KXUA 3WQQA 1VHJA 3PEUA 2WFMA 1QNLA 2YIVX 1H6AA 4XB1A 4ENUA 4D9EA 3OPQA 5WRFA 2PZMA 3MVEA 2FOIA 2CL7X 3EIQA 2P9ZA 1AKNA 4F4IA 1EYZA 3CE9A 1UINA 2ZB3A 3F78A 4GEKA 4MW0A 5D3MA 2DPGA 1TKRA 5IN5A 1NJ1A 4D0SA 2ZJ5A 2YXPX 3SAJA 4FW8A 4B43A 3QXCA 3D2BA 2VTKA 5CH8A 4RAQA 1K89A 3A7EA 2QUZA 4WEOA 1UOEA 2Z8YA 5IDWA 4JR1A 2ZAMA 3DO5A 3UUFA 3Q0EA 4K6KA 2ZSFA 2E7GA 5JPDA 2IYFA 5ITSA 2DKNA 5AK3A 1I9CA 2E82A 1FMTA 2WG0A 4KFTA 1IN8A 4ZV7A 3VVBA 4WNCA 2N46A 1V2HE 2UAGA 1YRHA 4OFBA 2DFTA 3RFFA 3DHYA 3T41A 2KZFA 1DKOA 2R60A 3LQ4A 1ULAA 3ZDZB