4DCSA

Crystal structure of b. subtilis enga in complex with sulfate ion and gdp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
433
structure length
406
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN ENGA
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 131
structure length 406
sequence length 433
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcsA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA01
5KSPA 1G5RA 1B23P 2YHSA 2ZETA 3I8XA 3CH5A 3FHCB 3QXCA 2IF0A 4EJSB 1G3MA 3IIJA 4PX9A 5CIQA 2GCOA 3ADKA 3VR3A 3FOZA 2YZ2A 2WSSA 1SXJA 4TWZA 5FPKA 1UKVY 4V03A 3EZ2A 2CLDX 3U4QA 1ZNXA 3C5HA 3NEYA 3K0SA 4YMSA 3QIAA 3FTQA 4AQYC 2EYUA 2IK8A 3HR8A 4OQXA 5KO2A 2CXXA 3K9HA 2WWFA 3CJEA 3EERA 2O8DA 4KV9A 1NN1A 1XWIA 5FBLB 1R8QA 2VBCA 4OI4A 3PEWA 5B57C 3L2OB 3KXIA 4AYTA 5LBIA 4F7WA 3THYB 3KQNA 1DO2A 4DR3C 3U6BA 4QNRA 3N2EA 3RLFA 2WPDA 2ZEJA 2ATWA 3LW7A 3OF5A 3Q7PA 4BE7B 1GM5A 2PEYA 2O8BA 4TN1A 3SJZA 2ASBA 1NMXA 1T4GA 2D2EA 1MABB 1EX7A 2BCGY 3OHMA 2QM8A 3TUJC 3A36A 1G1MA 1ZM9A 1ZCAA 2YWHA 1CTQA 1K0RA 4IOLA 1NJGA 3OE7D 4LHZA 3AF4A 1PUJA 1W49A 1NVUQ 1EFRD 1TX4B 2A7QA 4IOKA 3TKLA 4IW3B 2OCBA 4WZAE 4NCNA 3LO5A 3I07A 2F3RA 3T1OA 1AGPA 2RGEA 2IYXA 2NG1A 4JJZA 1QWIA 5LPNA 2B7CA 1OXSC 1E2EA 3M4YA 4RZ3A 2PT7G 4XWAA 1NLFA 3TAHA 2ZI7A 4S2EA 1PLKA 2J3EA 4B73A 4HB2A 4OK6A 5TVKA 1F3OA 1GUAA 1ZM7A 3EWSA 3FKQA 1OIVA 1KHTA 2E7GA 5IWAC 5JCZA 5KTYA 4DHEA 2ZRBA 3FVQA 2HHHC 1BMFA 3CBQA 4QBHA 4FMDF 3R9XA 5M04A 2OCYC 3BGWA 3O47A 2KBEA 2R2AA 3TSZA 2PJRA 1GRQA 3IQWA 2HLDD 4I1SA 3QKRB 4CDGA 4JZKA 2MSCB 3A4MA 3UWKA 4DWJA 1L8QA 1QHHA 2FPKA 1BYUA 3ZJYA 2AWOA 4Q1AA 3QOFA 4B32A 3I5YA 4D25A 3QF4B 4DSUA 4KBGA 4QGFA 5E7MA 2JLYA 3CKLA 1JJ7A 3TLXA 4QBFA 4QGAA 2QNRA 2XGJA 4M53A 4UXJA 5DGXA 3TMKA 2ONFA 1NI3A 2R44A 3QPUA 2NGRA 5FR2A 5JBQA 3K09A 2F1JA 1ZNYA 1G8HA 1KY2A 2G3YA 4XX2A 3L43A 4NCKA 5TV2A 4TMKA 1W0JD 1H65A 2GRJA 2JLQA 5KDOA 5JJIA 1Z0JA 3RDPA 3I1FA 1UBCA 2R6FA 2QE7D 1CBUA 2XTNA 4NYJQ 4DVGA 2BKEA 3CNOA 2O8EA 3HP1A 4WZ6A 1OFIA 3ZIAD 4C4PA 1NF3A 2GJKA 4LJ4A 3KTAA 4OX9C 1BS1A 1CR4A 4LBVA 3BC1A 4LBWA 1KI1A 1XTQA 3QEJA 3AP3A 1Q3HA 5K8LA 5EP4A 3LD9A 5K8TA 1E2GA 4QXAA 1U0HC 4U00A 4OHXA 2VIIA 2LCFA 3OE7A 4LF6C 4AKIA 4JV5C 2CBZA 1RRFA 3SZRA 1YR8A 1TU4A 4HLQB 1EFRA 1MR3F 2CHVA 2ZYUX 5J40A 1FUUA 2P6RA 4UXIA 1SVIA 2QTHA 3F8TA 3T5DA 1TUIA 2VPPA 2VP0A 2YC4C 3VMFA 2PT7A 1HV8A 3Q72A 4DDVA 1FMLA 1DO0A 2IW3A 3MAAC 2VP2A 2UXCC 5P21A 1US8B 4PC7A 2WWYA 3AF5A 5FOSA 1I94C 3QENA 3WMEA 3AVTA 2GXUA 3AVWA 4FIDA 4MRRA 4V0OA 4PO1A 5FFMA 1N6LA 3AVOA 3UG6A 4G5SA 1FOEB 3OTOC 2RKOA 4DLZA 1ZMXA 4HAYA 3CRW1 1XXHE 3K0AB 4EKDA 3EZ6A 1EFUA 4OKSA 3RS7A 4FWIB 2ZS9A 4I99A 4Q7MB 1DPFA 2HLDA 1N3BA 2BBWA 2R6AA 4BFTA 5A2QD 3B82A 4JLOA 2F3TA 1KYIA 2FFAA 1FNMA 4LK2A 4TMWA 1SVSA 1NKTA 5EQTA 5IT5A 4LV6A 4ERNA 4NP6A 3KQLA 5L3SB 1KK2A 2ZE8A 4Q47A 3WBJA 4EJSA 1N32C 5SZKB 6Q21A 4IRUB 5LMUC 4GT1A 4IXMA 2ECKA 1HNXC 4LX0A 3TIFA 1W0KD 1TL7C 5IK2D 3DM9B 5AJVB 1T6NA 1CJKC 4RZUA 3H1TA 1W0JA 2IHYA 3SYKA 5EE3A 2XEXA 2PN2A 3BB4A 1Z0IA 1DAIA 2Q3HA 2QE7A 3JVUA 3QEOA 4Z1MD 3CX7A 1FQKA 3ZIAA 4WBSA 1Q1BA 1VIAA 2YKGA 2GXAA 4GSYA 2F1RA 3B1YA 2FV8A 1HE8B 3C4JA 1RRGA 2ZSAA 2KE5A 3CF6R 521PA 4YMTA 4PSKA 4BZXA 1GDDA 3AV0B 2QP9X 4L9SA 1P73A 1DARA 4TLAA 4A9AA 1JXMA 2ZTSA 2Z83A 1DE0A 3VTKA 2WJVA 1Z08A 2NO7A 4FXPA 2O8FB 2E8EA 1T5IA 4GOJA 1AK2A 1ZW6A 3TSOA 5CYOA 3C41J 4QHSA 1HT2E 4Z51A 5FR1A 5EXXA 1LF5A 2F43A 2IYTA 4YDHB 5KU1A 3WNCA 2BIFA 5L3VA 1Z0AA 4HLDA 1IOZA 2J7PD 2P2LA 2NPFA 1TMKA 2IEYA 4ACAA 1E2LA 5HTKA 4ZV4A 2JCSA 3WNBA 3R7WB 3T35A 4LV8B 4YC7A 3UIEA 1AQYA 1C1YA 4CGZA 3VU9B 3THWA 1V5WA 4BFUA 2J0UB 1GKYA 1Z2CA 3VR4A 3LH5A 5DI3B 5JEDA 4DUZC 1E9RA 3IBGA 4TLCA 2XNSA 1II9A 1KI7A 1ZUIA 3S1AA 1USPB 1PZNA 1XEXA 2OCAA 4JL8A 1DG3A 4PFSA 1N34C 1MRNA 3HJNA 4L9WA 4JL6A 3NBXX 3A4NA 4RZ2A 1DS6A 1PLLA 1WBDA 2ZRKA 3HYRA 2WMOB 2CE2X 4LFBC 3F3YA 1R4AA 3IEVA 1QHYA 1KSJA 4O0MA 5BXQC 1AQUA 1X6VA 4HDCA 3JZAA 2CCJA 2REXB 1G3RA 1HYQA 1GAJA 4LHYA 3MWJA 3RS5A 1ODFA 1U0JA 5TY0A 4ZDKA 1OF1A 3IHWA 2P6UA 4AKGA 1QG2A 1W46A 3HR7A 3KB2A 1A2BA 4LJ5A 5DYIA 1LQLA 2JLUA 2FEMA 1KZGB 3U3JA 2QT0A 4B3RC 2QRZA 4Z1MA 3OEED 4TQAA 5DO9A 1JAHA 3T5GA 3NDBB 3KJIA 1C4OA 2OXRA 2BJVA 2YWGA 3J81D 4JLPA 4P3YA 1XMQC 1SVLA 2A9KA 2ORIA 2XZLA 1I2MA 4G1UC 4Q19A 3HU3A 4E09A 2IBMA 4JYAC 1R5OA 1QVAA 2OBLA 3QVUA 2FMXA 3GJ3A 1UKZA 1QDEA 3NC0C 4G5OA 5FOXA 1F2UB 4JT2A 4LBZA 1IY1A 3R8FA 5A0FA 4LF5C 2OBMA 3PUYA 1W47A 2N1BA 2JEOA 4RFSB 2GBLA 2NZJA 3BWDD 4E5UA 2KSQA 221PA 4M4SA 1PJRA 2JGNA 3UWOA 4BLRA 5KOYA 1X86B 4R98A 1WE2A 5HZKA 1TNDA 5DHAA 3GLIE 1N6RA 1ZNWA 3FMFA 1J5EC 5DYGA 1ZU4A 2D7DA 1SZPA 1GTVA 1UDWA 3ADBA 1E9DA 5CLQA 1GSIA 2ZRJA 2O8CB 2FX3A 2FZLA 5F9HA 2QAGB 1XTIA 1E2IA 4CRWB 1QVRA 1BYIA 2D06A 4LY6A 3BJIC 1Z6AA 1OHHD 3UMFA 4HUTA 3BFXA 1TQ4A 3PCRB 4ZDIA 4EQ6A 4JVLA 2P3SA 1GL7A 5AUQA 4M1SA 2QZ4A 1N5KA 3KFXA 5DHFA 5FL7D 4GI7A 2G9NA 2EFEB 1D6JA 5LB2A 1L2FA 4R2IA 4TL8A 1R10A 1KDRA 3T06B 3A1WA 5JS8A 2GAAA 3T1QA 1E2NA 1KSGA 5TXGA 5DIFA 2ONJA 1CJUC 4OYHA 2AK2A 4B47A 2AD1A 1XD9A 2EFGA 3ZD7A 4X8HA 3IEUA 3EA5A 2IYVA 5HPYB 3VKGA 1MH1A 1MO4A 2I1VB 4LJAA 2BEJA 2Q21A 1CXZA 4BPBA 1L7VC 5L3SA 3EW9A 1ZM2A 4EIWA 1ZINA 4C7OB 3OEEA 3NG1A 3RRZA 2GDJA 2O0HA 5KSYA 4KAXA 3AKYA 1HE1C 1KDOA 5EE9A 4BFZA 3VR2A 3AVPA 3CM0A 2RGDA 3QKSB 1RPZA 4DLVA 1XMVA 4QC2A 1II8A 3DOEA 3FDIA 2QA5A 3RSLA 2NQ2C 4JI7C 4FW9A 3TQFA 1VHLA 4YXWA 4JL5A 4XVUA 4UNNA 4GNKA 2P5TB 5FH9A 1JR3E 2CY1A 1S4QA 3W9YA 4XJXA 4K0KC 4GDFA 3DKPA 5JECA 1RIFA 3K9NA 5G3ZA 5JEEA 5JHGB 4JI6C 3TK1A 3MFYA 1W36D 1A4RA 4AIIA 2QL6A 2R62A 2J41A 2HYIC 3B85A 4BECA 5BN4A 2Q3FA 4ZCLA 4DIDA 2RH5A 3K1JA 2C8VA 1Z47A 1DBSA 4P31A 3AF0A 4Z8YA 2BJWA 3VHXA 1F6BA 2G0NA 2YOFA 2Z5FA 4M1WA 3GLHE 1CKEA 1W4AA 3DDCA 1W44A 4NDZA 3UMRA 3Q85A 4TYQA 4OQNA 3I92A 1AM4D 4X66C 2A5FA 4B33A 3EARA 5H8WA 5EZ6B 1JQLB 4G3XA 3PVSA 3L0OA 2GCOB 2W0MA 3O8BA 1S3GA 1SXJB 4PR0A 4PPNA 2PJZA 2REOA 5JWOA 1QRAA 5H1YA 1PUIA 3RRYA 3U4QB 5FL7A 2I1QA 4YONB 2B8TA 3W8RA 3B2EA 1S1MA 2KWIA 4WA7A 4LF8C 2J0UA 1MT0A 4A1FA 2OEPA 4U02A 2JIZD 1G291 4NBSA 4C3ZA 1QF9A 3EPKA 2O8DB 4M9SA 4EAQA 1X1RA 3SHWA 5GJVC 2UZIR 2BDTA 2BC9A 1R0ZA 3GJ0A 4DUYC 4XSGA 3KJEA 3NDPA 1P4SA 2HDNB 2QEQA 4R2HA 4WVFA 2HYDA 1X8LA 2O8BB 2W6JD 5JJLA 2WICA 5CB6A 5AWFC 1SKQA 3OAAD 1G9XA 4PQYA 3I61A 2RHDA 2PZGA 3ICEA 3ND8A 4B3CA 1E98A 121PA 5FPHA 2UXDC 1KOFA 3KUDA 3KJHA 1R0XA 2SHKA 3E70C 4BUJA 1YZUA 4NXMC 4HI0E 1XFAA 2WJIA 5CK4A 4Q1DA 2XAUA 1SHZA 3O8RA 1CIPA 3BS4A 4DBLC 1Q12A 1MRSA 4TMXA 4MYUA 3RANA 5KPJA 5FUYA 4F4JA 2C96A 1HEIA 2ZRFA 1II0A 4GMDA 4NTZA 2IX3A 4D0NA 2IA5A 4DXAA 4DLWA 1E94E 5HKKD 3SYLA 5SZJA 3V00A 4JSTA 1NYEA 2C5LA 1KDPA 2LKDA 5F3WB 3I4LA 1DOAA 3GQBA 4URXR 4DV5C 3TR5A 1KDTA 2IC5A 4JLBA 3ZZTA 3KFVA 1LS6A 3LBHA 4PSVA 3A1VA 1F5NA 1IJFA 2CLSA 3VFDA 1W1WA 3GLFA 4ZPXA 4BFSA 4HUQB 1QHHB 2B6HA 4FINA 2FOLA 3C7KA 4LCBA 4AURA 4FMCF 2Q9BA 3QY0A 3AF6A 1KO1A 5EUQB 2HXYA 2IXFA 3LUSA 2QAGA 4EFMA 5JRJA 4D82A 3IHLA 4ABYA 1ML8A 2UUCC 1TPZA 2JIZA 5L3RA 4Q4HA 1OH8A 3M0EA 2G1KA 4AK9A 4IFEA 5CDFE 1NKSA 2H57A 2HCJB 3ZVRA 5HE9A 3M1IA 4YDSA 3PUVA 4LJ9A 2NIPA 3VAAA 5BW8A 4JVMA 4RD6A 4TZ6A 2A5DA 2XX3A 1N6KA 4KLNA 4KHPC 4LUCA 5GVRA 1NN5A 2W6JA 3RRNA 3VX4A 1GG2A 1GZSA 3KTAB 3OZXA 2ZI3A 4XVRA 2J59A 1KKLA 1YHNA 5FI0B 3AQ4A 4TTQA 3GPLA 4OBEA 2QUZA 2WPDD 2CL7X 1D2NA 1JALA 3BIFA 3AUXA 1ZD9A 1E2QA 2ZJAA 1WCV1 1IONA 4MH4A 1NLZA 5C4GB 4IVQA 1KJWA 4EPWA 4XOIA 4MTNA 2QMUA 3AF3A 4DV2C 3WRXC 2ZR0A 5B30A 2Q6TA 1IXRC 4CVNA 1RRCA 2QQEA 3ZZUA 4NXNC 1P2UA 1NIPA 5IT9D 2FEOA 2FFQA 1XPUA 2C9CA 1NG1A 3U6KA 2CMKA 3KXKA 4W5HA 3OIUA 4MGKR 3SR0A 5HKKA 1IXZA 4IEEA 2OSBA 1JQJC 2GEUA 1U8YA 4KLZA 4F93B 4DLXA 2DCUA 4L8GA 3RWMB 4M1KA 5FUWA 5JLJA 1H8ED 3K0CA 2VHCA 1UBFA 4MGYR 4D6PA 1G4AE 5FTJA 2V54A 4P32A 5AK0A 4PHTA 4I1UA 2KBFA 4LC0A 3OIYA 4ZDJA 1OB5A 1MO3A 4RKEA 1COWD 3BH6A 2C77A 1Z0KA 2ATXA 1OH7A 5J47A 2IL1A 2HJGA 3RS2A 4LJ8A 1TQDA 2UZ3A 2J46A 2D2FA 3ZS9A 2J1LA 3EC1A 2O52A 3THOA 1RFLA 1IY2A 2CLCX 1UEIA 2W0SA 1E2KA 2VF7A 4EPXA 1V43A 4AC9A 4PO8A 4D0GA 3TJZA 3VNVA 1NVVQ 3HWSA 4MQBA 4X62C 1OJLA 3DPUA 3HU2A 5JI3E 2YWFA 2YC2C 1YE8A 1SHKA 4PZYA 2P6NA 3SE0A 1SKYB 3X1DA 5JWRA 1HNZC 1NMZA 2ANBA 3OIVA 4M1TA 5C4MA 1Q1EA 4U7DA 4TMVA 1DG1G 2GJSA 1SXJC 3NH9A 3U3KA 1UKYA 1VG1A 3PEUA 4GBMA 3TGPA 1N6PA 3H4MA 2XTMA 5AR1A 4B76A 1XMOC 4NL4H 3N5CA 4D2IA 1KTVA 5FOWA 5HCIA 3VKHA 3OEHD 2Z4RA 3G5UA 4I81A 1Z06A 2QGZA 1G3IA 1UBGA 1UM8A 2X2FA 3AB3A 4FI3C 4KCGA 3SI7A 1HURA 1M2OB 4N3NA 4DKXA 2CEAA 1G7TA 3AVVA 2F43B 4GKJC 3IKJA 2UUAC 1GRRA 3MWLA 3QBVA 3RYTC 5IHPA 4JI4C 1KKMA 4MRSA 3QKTA 1OXTA 2QTVB 5FL3A 3BH7A 3W34A 3I72A 2IS2A 1CULC 2KI5A 5GJBA 1KNQA 3QSYA 1W7AA 2ZRHA 2ZVQX 1FX0A 1DAHA 1YZLA 3TAUA 3KZ1E 4M0LA 1FQJA 1D8TA 3RAPR 4B6EA 3ONWA 3PUXA 3MJRA 4US1R 3FKSD 3THWB 1FFHA 1IXSB 2QG6A 1R0YA 4ACBA 2JJ1D 1H8EA 2H1LA 3LLUA 3B60A 4BLOA 4CYMA 4ESHA 5HZHA 3QI2A 3QPVA 3Q9LA 4A2PA 4DSOA 2PCLA 2AWNA 4KBFA 2GCPA 4AKEA 4ZCIA 5KDDA 3S1AB 2ZM6C 2ZRPA 1XEXB 2VQEC 3T1HC 1EGAA 1VCMA 4RVCA 4KITB 2GJ9A 4QJ3A 2V6JA 5HCNA 1JECA 1B0UA 2ZSEA 1COWA 2FSIA 2ZIAA 4LRWA 3HPQA 5KSOA 1KI2A 1M7HA 1NP6A 1CP2A 2XNDD 3MUFA 1T8TA 3SNHA 2GTPA 3NKVA 1IM2A 4HUQA 2GHIA 2ZRIA 2QPOA 4ITRC 3K70B 3JZMA 4LHVA 1M7GA 2IYLD 1E4VA 4MUAA 4ZI2A 5BWMA 2F4VC 2FPMA 1YQTA 1E9EA 2ZE5A 4DDUA 3GCGA 4EDHA 3QJYA 1WQ1R 2IF2A 2EU8A 1HY3A 4Q9JA 4B3BA 3W90A 1UEJA 3L0IB 2FG5A 4JBWA 2J9RA 4C9BA 4IDNA 2IXEA 2W2VA 3O8DA 4ZKEA 3AVQA 1UKKA 4JS0A 4WW0A 3KJGA 3WNDA 2FGKA 4PXAA 2FU5C 3TR0A 4OI0A 3AP2A 3DEFA 1N36C 1Q57A 3LLMA 3M6AA 1M8PA 3PFIA 1KKGA 3AF2A 3IBYA 4P4UA 4FCTA 3OEHA 4JI2C 1LTQA 2W6ID 1XX6A 3K09C 3RC3A 4AI6A 2R6GA 1G20E 1P3JA 2IYUA 2IYWA 3A4LA 1CU1A 4HLUC 4Q9HA 3QPWA 5JZVA 3V9PA 1N5LA 2DFNA 3H84A 3NBYC 4MRPA 1P9RA 2Z6VA 2BMDA 2V9PA 1VMAA 5E7IA 2ZRNA 1XTRA 2HUPA 2ANCA 3AP1A 3B9PA 4JI8C 2ZJ8A 4IVPA 2IXGA 4N0DA 3WP1B 4ESVA 1Q0UA 1P62B 5JS7A 4II7A 3FB4A 3FHTA 4QL3A 4UNRA 3FKSA 5EXPA 5DISB 3TNFA 2PX3A 1N6HA 4XTCS 3E1SA 3L0SA 2WZQA 2CVHA 2JJ1A 3CH4B 4JBXA 5G3YA 4XWOA 4PPQA 1CF4A 4PAMA 3Q5DA 3SQWA 1X1SA 3SC3A 4EQ6B 1EXMA 1EG7A 2MSDB 1F48A 3B7GA 1TEVA 1AKYA 4FN5A 3TQCA 2E8CA 1OE0A 2IUTA 2QPAA 1GIAA 3EAQA 1ZP6A 2ZRGA 3IO5A 3NWJA 4G5RA 4K81B 4O2RA 2VHTA 4MKIA 4MYHA 2BEKA 1VG8A 4HEJA 3B9QA 3IO3A 3KKOA 3RWOA 4URWR 4TTPA 1YZTA 1Z6XA 2XNDA 4LPKA 3FWYA 4NU0A 4I1VA 2TMKA 3KUCA 2E1RA 3B1XA 2BBTA 1KK1A 1RW4A 2MMGA 2ZYVX 1U94A 2BBOA 3SJBA 1S1CA 4B34A 4ZKDA 1TF7A 3MCAA 5DE3A 4DV6C 2XZOA 3JAMD 3RSOA 2NO6A 2PZFA 4JLDA 4FCVA 4TLDA 2WWWA 1X3SA 2GILA 2BM0A 4V0MA 5KNBA 4JLMA 2C04A 4HB3A 3K70D 1AZTA 1NG9A 4MYTA 2GEVA 5DLQC 1HNWC 2GJ8A 2XXAA 2BKUA 4PHHA 4H1UA 4AD8A 4A0RA 4GKKC 4KVAA 1GNQA 3DOFA 3DZDA 2V55B 1II8B 2DWPA 3F5FA 4BASA 4A36A 3EX7C 4LF9C 2DFTA 3TRFA 4AYWA 1NVVR 1GITA 3SHFA 1S2MA 4C0QC 4EJSC 2EFDB 1T0HB 4JLJA 4N1AA 3W5IA 1CR1A 4DCTA 1ESNA 1LF0A 2ZYWX 2W6IA 4I4LA 1D9ZA 4B71A 2RGGA 1ZAKA 2VHQA 4LJYA 1LV7A 3BE4A 4P4TA 3P20A 1UADA 3FE2A 2QU8A 3ASZA 1P9WA 4WOPA 1ZIOA 1DVRA 2A5GA 3CNLA 4MUBA 4L16A 3CIOA 5SZIA 1CRPA 2KZFA 2EVWX 3CNNA 2E87A 2ODBA 4JIMA 3R9IA 2LKCA 3KDSE 4O3MA 1E2JA 3MD0A 1BO6A 4JKIA 2ORVA 2VA8A 3WXMA 2IYSA 1JXOA 1A7JA 1IBRA 1W4RA 2VL7A 2VP5A 4Q1BA 4BEJA 2D74A 2XJ4A 1D9XA 2WVJA 1A2KC 1KJYA 1T5LA 2H5EA 5FBVB 2CCGA 5E95A 3EG5A 1MOZA 2YNMA 1VYUA 4RY2A 3EWAA 3ICQB 1Y63A 4W5JA 4LF7C 3CZPA 4HDOB 3DVLA 1P5ZB 4TQUS 1NVXQ 5AJYA 2AD5A 4A2WA 1QHGA 1G8PA 1IBLC 3WMFA 3UK6A 2GZDA 4TTRA 1IAQA 2BMJA 3IDQA 4PQRA 2UXBC 3HDTA 5AJWA 5J4YA 4POAA 2PLRA 3ZQ6A 4HAVA 1Z6GA 2CNWD 3L82B 2WAYA 3A1UA 2OPLA 1R5NA 1L4UA 1VPLA 1PV4A 1G41A 2YVUA 3UKDA 4X8MA 1UF9A 3W8NA 2J0SA 1SXJE 3FGNA 1Y3AA 4RD2A 3UPUA 5C18A 2QBYA 1IN8A 2EW1A 2OHFA 2ZRAA 4W5WA 1J70A 2BMFA 3LQRA 2G1JA 1G8YA 1VIYA 3VNUA 2YOHA 2F9LA 4XSHA 1ZJ6A 4OQLA 4DZZA 1FP6A 2QMHA 1W36B 2PZEA 4BLTA 5K8IA 4B3TC 1YZKA 2RGXA 4YLGA 4KSBA 1HA3A 4YXWD 3LVRE 3WP0A 3U60B 2OAP1 2JLVA 1ONBA 1UDXA 1TU3A 1AZSC 5JCPA 2QSZA 2OFOA 1RC8A 2C99A 4ZDWA 4R9UC 4B6FA 5LDDC 3AF1A 3ADDA 1KAGA 3KQHA 4RD4A 2ZJOA 1DAEA 1U0LA 1ZIPA 3THXA 2FFBA 2QSYA 5FBWB 1Z2AA 4DB4A 4LOAA 1VTKA 2QRNA 3GLFB 3CB4A 3PV0A 4OJQA 2EFCB 4F4IA 4QJ4A 4M1YA 2OFXA 2IWRA 1BH2A 4ON9A 2YV5A 1OIXA 5JWHA 2FJUA 1GKUB 4R71A 3HPRA 1AGRA 2AXNA 4IDOA 1NBMD 2GBLC 2RGNC 4B75A 1NIJA 2WOOA 1FTSA 1NLYA 4X8LA 4A8JA 4Q4HB 5JJKA 3IPYA 5KDLA 3P26A 4JI0C 1W5SA 3KL4A 2VO1A 4NYMR 1FZQA 4WIAA 1OH6A 1GNRA 1P75A 1YZGA 2AR7A 4D4LA 4NCJA 2ZR7A 3BXZA 3EASA 3I32A 1DAFA 4UNPA 3U2QA 5FOVA 3AH8A 1KO7A 3T15A 2UVQA 4Q4JA 2ZU0C 3ZVLA 2W58A 1XMJA 4LWZA 1U90A 2QT1A 2CNWA 3MWYW 1LS1A 1P2SA 4A82A 1W4BA 1E9AA 1Q1QA 1HT1E 3AKEA 3CWQA 1T0JB 1XTSA 3MGCA 3AM1A 3FFAA 4DLUA 1GOTA 3VQTA 5JSZA 4DCSA 4URUR 1VECA 4CF7A 1YJ5A 3OFND 3MLEA 2KB0A 4CEJA 4GL2A 3GMTA 1KI8A 1QHSA 2JA1A 3IUYA 4E03A 1FNNA 1HQCA 4FWTA 1RYHA 1PA4A 2E9SA 2VP9A 3SOPA 2WAXA 1PVOA 4PTLA 2NZ8A 2GA8A 1ZU5A 3NVAA 2F6RA 4TMTA 1CR2A 2CXCA 2D7VA 3ZDQA 2P65A 2WHXA 3GD7A 4LZZA 1XNJA 4PC6A 5KHOC 3CONA 4JLAA 3CZQA 4FD2A 1X8KA 1Z22A 2IT1A 2HF9A 2WWIA 4IDQA 1EESA 3KB1A 2YINC 4QJ5A 2OZEA 1U8ZA 3GKUA 3H2YA 3FMOB 4LFCC 4JKYA 1W48A 1ZUNB 3WYFA 3GP8A 2BCJQ 2V8OA 3RS3A 2HF8A 5EP2A 1P9NA 3C8UA 5AJXA 4LYHA 1AJEA 1U81A 1VG9B 4Q7KA 2BV3A 3DMNA 3DO6A 1NBMA 2HJVA 3Q8XB 4RCZA 4YMWA 3UXMA 2RHMA 4CEHA 1KK0A 4B3FX 3WHKA 1XZPA 1T91A 2GCNA 3NIBA 1E2FA 3EIQA 3W5JA 4DDWA 5IDVA 3OESA 3WYGA 4DCUA 1LVGA 1NL3A 4B3MC 4AWXA 4PC1A 2ZUBA 2PH1A 3ADCA 3UANA 4Q21A 5EZ5A 1XP8A 1TTTA 4HB0A 4D4MA 2JLZA 1N5IA 5SZHB 1ZM3A 5BN5A 2QMOA 2VP6A 4H1VA 4ILEA 3AVYA 4OK5A 2IUSA 2WJGA 4Q9IA 5D3MB 1G7CA 3ZH9B 5CJPA 1FW6A 2FE4A 5DN6D 2ZE7A 1G21E 2GVZC 1E6CA 3D8BA 3C5CA 2BVNA 2J5XA 2FSFA 3GEHA 5E3HA 1XBTA 3FMPB 1OT3A 2C9OA 4GPTA 4Q4AB 4G5GA 1Q21A 3OFNA 3P4XA 3BBPA 4NYIR 4CEIB 1CJVC 3FHOA 2ZR9A 2W2TA 4RD0A 2D3WA 3MMPA 1ZB8A 4AKHA 4LBYA 3U3MA 5FOUA 4QBIA 4US0R 4KFUA 2HCBA 4P4SA 4OHYA 2ZXUA 2H16A 3A58B 4NZYA 2PEZA 3KKMA 4BRWA 2R8RA 4OQMA 1FX0B 4OI2A 1KK3A 1Q20A 3CR8A 3PG5A 1SKYE 3BFKA 5TDHA 4KFTA 4NOZA 3P1JA 2EGTA 2JJ2D 3CX8A 1Z63A 3AVUA 1U9IA 3SEAA 1W2HA 5BN3A 4DUGD 3DZ8A 4ASUA 1QG4A 5KUTA 1D2EA 2I3BA 3PEVA 5CLLA 3UATA 4QM6A 2J0QA 1Z0DA 3B1VA 3MG9A 2RGAA 4YY3C 1XEWY 4C2UA 5L3QB 1IN6A 1HH4A 4UNSA 1E2MA 4Q9KA 5CB8A 3TH5A 4DR6C 1TF2A 3IQXA 1G6OA 2WV9A 4GOXA 5KNCA 2E8FA 2ZRCA 1W36C 2OAQ1 4QM7A 2A78A 2B21A 3VKWA 4BRUA 1WBBA 1AIPA 4URVR 5J4VA 1KIMA 1UPTA 3BAFA 4AG5A 4V02A 4A0GA 2E5LC 2EWWA 2Q9CA 4KODA 3LXRA 3PXGA 2ZANA 1E3MA 2PLFA 2RB4A 1IJEA 1Z6TA 1KY3A 1E79D 4RFVA 2I4IA 4GRAA 1IY0A 1R5BA 2P0EA 3B78A 2QTFA 4JYBA 2OLKA 3V4RA 1XXHA 2QP4A 4HAUA 1HR0C 2QENA 2AFHE 5FUXA 4RSGA 2ZRLA 1E99A 5ELXA 2GXQA 3FMIA 5H68A 1NSFA 1EX6A 4A6XA 2ZPTX 4LHWA 1MKYA 2P67A 1S96A 4UJ5A 3MSXA 4L4UA 1VHTA 5DN6A 1ZD8A 1WP9A 4U5XA 1GP2A 2FFHA 5UKDA 5D3QA 4P0TA 5TARA 5C1BA 2QAGC 4WZBE 2XB4A 3DMDA 4DR1C 4TQ9A 1NNEA 3PIRA 1ZC4A 1W5TA 4Y0AA 1N2FA 1YKSA 2GNOA 2N42A 2DY1A 4B3SC 2FF7A 4OHVA 4LHXA 3P27A 4CIDA 4EUNA 3I62A 2ZJYA 4DLYA 4QGGA 4DT1B 2ZYTX 1VCIA 2ZSDA 4NCIA 2A30A 1DTSA 3TSWA 4DLTA 5JMTA 4MDFA 1XCMA 2GJAA 3SQXA 2GF0A 1GILA 4ARZA 2ZROA 3ETLA 3K9LA 4LF4C 4BFXA 2AKAB 4TYYA 1GL9B 3EIHA 4F92B 2YWEA 2WWXA 4O25A 1XNQC 1EK0A 1JI0A 2JJ2A 1U99A 2CVFA 2PT5A 3L8YA 4DUGA 4Y0VA 5FPYA 1FL9A 1N6NA 1RRPA 1OB2A 4PAOA 3MWKA 3W6NA 4DLSA 2F1IA 1HTWA 4D80A 1SVWA 2HT6A 3LNCA 2Q3MA 1YU9A 2C98A 3U7GA 1KMHA 1CEEA 1RKBA 2C2HA 1OFUX 2VSXA 1WA5A 3CUEF 4KVGA 2WKRA 3C14C 2AK3A 3CRMA 3W3AA 1G17A 5EP1A 1K6MA 2VSOA 1Z0FA 3SU8A 4EPYA 4TYWA 1OW3B 2D7CA 1J7KA 2BWJA 2ODEA 3MJHA 4C0BA 1KI9A 1YRAA 4I1OA 4PQFA 1E0KA 1E79A 3LX5A 3ZQJA 1J8MF 4PHFA 4BLSA 3B13B 1KZ7B 2GAOA 4PANA 3CF0A 4BQSA 4QHYA 4D26A 3U3RA 5JHHB 2GK6A 5LMNC 1JPJA 3U44A 5JI2E 3K0CC 721PA 2ONKA 1Z83A 5FUVA 3X1YA 3QE0A 3T12A 2DWQA 3LXXA 2Z0MA 2QORA 1OFTA 2UUBC 2FGJA 2XXAB 1OYWA 1T8UA 4CW7A 2IS1A 3QXHA 4M1MA 2WJHA 2QN6A 2VP4A 4XVQA 2YJTD 1KI4A 1L2TA 3E2IA 4HZUA 5TMPA 1K5GA 3EIEA 5FOTA 3QVVA 1J90A 1G7RA 3LRPA 4KFRA 2OILA 3BB3A 3RHFA 1KI6A 5D3MA 4R7ZA 3E5HA 4LSGA 4RD1A 8OHMA 2PCJA 1ZD1A 1E96A 4Z8XA 3WRYC 4ZIRA 4Q03A 5A5GA 4IFBA 4V0NA 2VSFA 4GFDA 4Q4AA 3SYNA 1VCNA 2BOVA 4JBYA 1OKKD 5KSZA 4CEIA 2MSEB 5J4KA 1QHNA 1VYTA 1UJ2A 3NTUA 4MRVA 3RVBA 4PZLA 3LBIA 2C78A 3REGA 3GLGA 3A6PC 5G40A 4B2LA 3R8CA 3KQUA 3LA6A 3T1TA 1GKIA 2HEIA 2NO9A 2QPTA 1A82A 3D3QA 4D4JA 2BM1A 1SULA 4HSEA 1JR3D 4PPGA 4E22A 1CLUA 2PMDA 1HUQA 3AUYA 2PX0A 4QGHA 3BRWD 2XOKD 5FTKA 3B5JA 1E2PA 1XNRC 3BB1A 3TW4A 1ELOA 1R8SA 1XMSA 2AKYA 2D62A 4EPVA 4Q5IA 2ZU6A 2AXPA 1P2VA 2REBA 4IHQA 4X64C 2XITA 4OQFA 2OESA 4DEYA 5C2JB 2G83A 1GWNA 1QZXA 2B8WA 2AFIE 4DR2C 5CM9C 1XZQA 4C0AC 2WWHA 2ZSBA 4JYCA 1YZQA 2JATA 2VYFA 3GLIA 3PR1A 4LDJA 2GKSA 4GOKA 1A5TA 1J2JA 4PAQA 5CYPA 4F38A 2ZM5A 5GADl 4KFSA 5L3QA 2OO7A 1ZUHA 4DDTA 2DWOA 3QF7A 5FPTA 2N46A 4E07A 3GEIA 5FTLA 2EQBA 1WDTA 1CRQA 3EPJA 3CPHA 1SVMA 4A92A 2A5JA 1W4CA 4OHWA 5EE1A 1R6BX 1AS0A 2OPLB 1NBME 2GK7A 1JOSA 4MGZR 3GJ4A 2FPLA 1E4YA 1G4UR 2GETA 1SQ5A 3K0EA 1S3SA 1YR7A 1XD8A 2NPIA 2O0KA 4DV4C 2Q9AA 3NXSA 4TSFD 4Q9LA 2RCNA 2QBYB 4WXPA 4JI3C 3NEJA 1JEEA 1I4DD 1VYVA 5EE0A 5G41A 1BKDR 1IN4A 1JB1A 2ZRMA 4G01B 4PC3A 4PPFA 4PSAA 1EWRA 1YR6A 2JLWA 2IYQA 1OXUA 2CCKA 1LFDB 4JVNA 1IQPA 3CPEA 4IXNA 2R9VA 1P72A 3QXSA 1E0JA 2IYRA 2VTKA 4B74A 1FJGC 3RRMA 4BZQA 1OPXA 2VEDA 1Z6YA 4NCHA 4MKGA 1ANKA 1XB2A 4Q02A 4TMZA 4ZO4A 5GJWC 4AY2A 1FPMA 1WH9A 4DC9A 4YHHC 2XZPA 2ZS7A 3BFVA 2AN9A 2KJQA 1U8AA 2QP3A 4RD3A 2IYZA 1OKKA 2GZHA 5KPDA 1XPRA 1E69A 4LYFA 1E2HA 3FYHA 2GESA 2QGNA 421PA 3KKPA 1XPOA 1OSNA 1XEWX 2F55A 2DR3A 5BQ5A 2ODWA 1MO5A 4DR7C 4A6PA 5CJ2A 3A1SA 2EWVA 4KI0A 4C0JA 3THXB 1NY6A 4DT1A 3LWNA 2ATVA 5AUOB 4HLUA 3QQ5A 3WMGA 3BORA 1JR3A 4HLCA 4TYPA 3F0TA 1FUKA 2XOKA 3QXJA 1SVOA 2ZI6A 1M74A 4A0FA 1XRJA 4C0LA 4H9GA 2W83A 1SVKA 2UU9C 3N70A 4MGIR 3VR6A 4ZCMA 1AS2A 4QKQA 2FN4A 3AKDA 5GVSA 4MH0R 3K8YA 2ZJBA 4TL9A 4ZI3A 5J4HA 4A8JB 5J4LA 2JLXA 1RZ3A 2CDNA 4TL6A 4NYMQ 2C9YA 5CM8B 3SBEA 3IIKA 3QUSA 3GLHA 4LJ6A 1KSHA 5FLXD 3LBNA 3SDZA 2GWHA 4QBGB 5H70A 3SFVA 3QBTA 4DV7C 4LYJA 2GF9A 2R6CA 5EE5B 5EUMA 2ZUCA 3H0KA 3KXLA 4EFLA 2HV8A 4Q4JB 4LPSA 3GFOA 4MRNA 2HXSA 3FPAA 2H17A 1VLAA 1LY1A 3T34A 1RJ9B 3KKNA 1Q22A 4LYAA 4NKRA 3GLFE 2XSZD 3A37A 3IIMA 3CPJB 4C0HA 1QBKC 4BEBA 5JSZB 3I3SR 4TSFA 2X19A 4IEIA 3MRSA 4CEJB 1E9BA 4TT3D 2H92A 1WRBA 2J0VA 1XF9A 4TZ0A 2RGCA 3K53A 2ZI4A 4JI1C 2VQSA 3JVVA 3EXAA 1Z3IX 2OUKA 3GJ8A 2WIBA 4RCYA 2OCPA 2DFLA 2R6DA 4FMCB 3CRQA 1FP7A 1S9DA 5FI1B 1PLJA 2A3RA 4GZMA 3TW8B 1EFHA 2WSMA 4G0NA 4KHZA 4MITA 2O5VA 3A8TA 5FPSA 4DV0C 3X2SA 1G8GA 5AUNB 1G5PA 2AL7A 1I4LD 3AKCA 4IOMA 4M22A 4M9QA 3VHLB 4Q18A 2JDID 3BERA 4D81A 1JEDA 2FA9A 1G16A 1N2CE 3A1TA 1E9CA 2OT3B 3FFBA 1N0WA 3KX2A 4GMXA 1OV4A 1ZNZA 3DHWC 1Z07A 2JLRA 3WYAA 2WOJA 3ECCA 3K0FB 3KKQA 1E0AA 4L15A 4CT4B 1ZM4A 1OYYA 2V4ZA 5B58C 5EXTA 4NE2A 2VQFC 5AJZA 2NTYC 4S35A 4US2R 3THYA 1S0UA 1WB9A 3ND9A 3QXXA 2RGBA 2ZI9A 4CEHB 3QG5A 2P5SA 3EZFA 1NVWQ 3TBKA 4M21A 2Q0HA 4NONA 2BBSA 2G88A 2Z4SA 3K9GA 3REFA 4IVRA 4M1OA 1N0VC 1FTNA 5FTNA 1MABA 1NMYA 2ZREA 3U7FB 3BH0A 3QNUA 3I5XA 1OIWA 1NSTA 4HYYA 3PJRA 4JLVA 5EXSA 3U5ZB 2DB3A 2X1VA 1ZC3A 3RS0A 4UNQA 5F2EA 2GZAA 1O3YA 2QL8A 3PENA 4DEXA 4DCVA 821PA 2XSZA 2ZQ5A 1R2QA 3W3ZB 5HR5A 2H18A 2IS6A 3GFTA 4NYIQ 1F2TB 3LY5A 4AYXA 5DNYB 4RZXA 1IN7A 2OV2A 1DAGA 3B1ZA 1KI3A 4TT3A 1UAAA 1LNZA 3GFPA 5L8VA 3ZYCA 3UG7A 5CDFA 4LI0A 1JAIA 1ZB9A 3LFUA 1TQ2A 3EPLA 5G53C 1ESMA 1YRBA 3B1WA 2X2EA 4B2PA 1DAKA 4PO9A 3CX6A 4P4SB 4BFVA 2Z43A 2BHRA 1G8FA 2CK3D 2NO1A 1G64A 1XMIA 2OXCA 3LVQE 4HATA 1GNPA 3T1VA 4XH9B 2A5YB 2XTZA 3RC8A 2WJYA 3PITA 1XJ0A 3QKRA 3TVDA 1Z29A 3K70C 2JDIA 3BK7A 2JLSA 1W0KA 4NHOA 4B3XA 2CE7A 5IK2A 1IBMC 4Q1FA 2IEZA 3QF4A 4UXHA 2WWGA 3LX8A 3T61A 1JJVA 4B3DA 4W9MC 1SGWA 1EWQA 1OH5A 5FBQB 2VH5R 3NH6A 4IDPA 1ETUA 4Q66C 1Z8FA 4KSCA 4A15A 2RMKA 1G3QA 4KU4A 4QHTA 1AKEA 1L4YA 4HAZA 2FSHA 2BJOA 1FMJA 2IYYA 5HE8A 1JBKA 1NY5A 2QQ0A 4DV1C 1XCPA 5E7JA 2ERXA 2MMCA 3GLGE 4XIGS 1MO6A 1YVDA 4JI5C 3D6TB 1F60A 1D2MA 3NC1C 3SBDA 1Z28A 5E4FA 4M9ZA 2GXSA 4K8OA 1IN5A 1M6NA 4V0LA 4NYJR 4NH0A 3ZVMA 2A2ZA 1ZCBA 1S8FA 4B2IA 1TQ6A 1XJCA 4HB4A 2K5UA 2XR1A 1XJQA 1XXHB 2G6BA 3O8CA 2F1HA 2V3CC 1E0SA 3ASYA 2YYZA 5KNDA 4KYUA 1K5DA 3V4FA 3U7HB 3VX3A 4MA4A 3N2IA 4V0KA 5CITA 2RGNA 1G18A 2FDCA 2FZ4A 3AEZA 2ZAOA 1DELA 2J7PA 2V7QD 5LD2B 3CWZA 1X8JA 2JAQA 2NO0A 4C0KA 1GRNA 1K8RA 4OHZA 2CL6X 5CIWA 1P2TA 4WXRA 2V6IA 1TEXA 2ZJZA 1TUEA 1G19A 4LC1A 3RNLA 4HZIA 3QG1A 1XU4A 4JLNA 3CF2A 4XTRA 2WBLC 1CJMA 1RJ9A 1OXXK 1RVDA 1MV5A 4A8JC 3SFZA 5EJEA 1US8A 2WKPA 1XTKA 2DYJA 1M1YE 2PMKA 4YMVA 2OLJA 3D31A 1AA9A 1CS4C 2J45A 3CO5A 3EZ7A 1BOFA 4OI1A 4BGDA 2CJWB 4FMDB 5B64A 1XD2B 1KSFX 1W2GA 2DBYA 2CK3A 1IHUA 1XCGB 4C30A 4DLRA 3LW8A 5JFGA 3ZLJA 2IWHA 2DFKB 3C15C 3K0AA 4F91B 2C95A 4C2TA 4ARZB 2DHRA 1G3UA 3RABA 2ASEA 3H86A 1KO8A 2ZAMA 4B43A 2JJ8A 1QHXA 1XEFA 1EFCA 3GJ5A 2ZVPX 4M9XA 4DB2A 1VKJA 1RE0A 3AGPA 2J87A 3L8ZA 1Q3TA 2G77B 4PC2A 2CHQA 4EPRA 3LAWA 3DL0A 1OXVA 5GJCA 3WHLA 3CLVA 1J99A 2WJJA 4OK3A 4B35A 3LDAA 4KYIB 1KO5A 4N0EA 4URZR 4DCNA 2OE2A 1KMHB 2B92A 4D4KA 4JVSB 3ZS8A 4D0LB 2FWRA 2QMEA 1E9SA 4IJMA 4ASUD 3CR7A 1U98A 2ZE6A 1H8HD 3VR1A 4DSNA 4UKDA 1XTJA 3LQQA 5F98A 3ZVNA 1TAGA 2O0JA 3QKUA 3NBFA 3K0FA 3TVTA 2WMNB 4BFWA 2L0XA 3LV8A 4TL7A 3U61B 3ZZ0A 3Q5EA 4L5BA 2H8KA 1CR0A 4GZLA 4YQFA 1R7RA 1T9HA 4Q7LA 2VLIA 2X8AA 1NN3A 2ORWA 4Q00A 4YMUA 3U44B 4Q1EA 5BYJA 3GJ6A 1EFTA 2FSGA 1E1RD 4UQOA 3SS8A 2NMVA 3G82C 3GJXC 2GEDA 1G5TA 2V7QA 5DH9A 4JMPA 5JRZA 4DSTA 4M8NE 2O8FA 3TE6A 1E1QD 4NMMA 4IKEA 4HZUB 5ANRB 3I8SA 1DEKA 3SN6A 3GJ7A 3CW2A 2W00A 3L0PA 1XDBA 1JR6A 2ZJ2A 1KI6B 1JPNA 1OHHA 2H7VA 4BWYA 4Q1CA 1J8YF 2F9MA 2W2XA 3R7WA 5DSZA 4ZIRB 3DM5A 4JJKA 1N5JA 1F2TA 1P61B 4PHGA 2J7KA 2CL0X 2EYQA 2ODNA 2Y8EA 2ZUDA 3CRRA 2YOGA 3NBZC 3VU9A 2F7SA 2WKQA 1JNYA 4QRHA 4RJLA 4TLBA 1S9HA 2V1XA 3D7MA 5DI3A 3TUIC 5BYKA 5IRCD 2ERYA 1YR9A 3GLGB 4V0ME 3SJCA 1UFQA 3ZD6A 4HAWA 5BR8C 4BLPA 2WIAA 1USPA 1T3HA 5DI9A 5FBRB 3EZ9A 4JSYA 1N0UA 3PQCA 2ZI5A 1M7BA 4B44A 1HQYE 2DPXA 3P4YA 1YZNA 3PEYA 3NHAA 4Q01A 4TLEA 4Q48A 1M34E 1BIFA 2D4HA 4KXFB 1OFHA 1R0WA 2CHGA 5B2ZA 2AHOA 4QFMA 2XJ9A 1H8HA 2ZITA 3X1ZA 1ZVQA 3GLIB 4AG6A 4DIEA 2VHJA 2WTUA 1I2DA 2HT1A 2OM2A 3P32A 3IGFA 3IPXA 2VHUA 1ZYUA 4WAUA 3EPHA 3B8HA 4G5QA 3R20A 3B6EA 1U9IC 4DR4C 1AN0A 3W6PA 4X8OA 3X1XA 2V1UA 1NRJB 3HYTA 2OFWA 4MDEA 1E1RA 1OLOA 4BFYA 5IF9A 1P60A 3J80D 4HAXA 5KYKA 4DV3C 2WM9B 1O87A 4DJTA 2QROA 1F2UA 4DR5C 1E1QA 2X77A 4UJ3A 1E2DA 4O2LA 1ZRHA 4A2QA 2PL3A 4LFAC 1C9KA 4QG7A 4RKFA 4RFSA 2OBNA 1VG0B 4KJZA 2EFHB 4BZPA 4Q7JB 4LGMA 4MYCA 4B3GA 3NHBA 1P7CA 1I4TD 1T3LA 2ZJ5A 1WXQA 1DADA 4Q4LA 4XD7D 4BSZA 2ZRDA 1WF3A 2B7BA 1ZBDA 3CRVA 3SJAA 1T3SA 4HDQB 4GP6A 4M2LA 4EPTA 3WY9A 2QY9A 2O8CA 4EFNA 1WMSA 3G0HA 1N6IA 1RYFA 5CK5A 3AGQA 1G6HA 3U7EB 2FNAA 1U2RA 4CT5A 1QHIA 2FH5B 1KGDA 621PA 3OIWA 5LD2C 2WSSD 1SXJD 2XB2A 2R65A 1VCOA 2RAPA 1LW7A 1IBKC 1Q1ZA 1KMQA 1GL6A 2CJWA 1GFIA 1XD2A 4NPHA 4TYNA 3Q3JB 1Q44A 3ZGXA 1UKEA 4C0SA 2G0TA 2QM7A 4MKFA 1KNXA 1NN0A 3X1WA 2O8EB 4IOJA 3BOSA 1TADA 4K46A 4URYR 3BD9A 1TF5A 2VRWA 3T1YC 4LV5B 4DRZA 3Q7QA 3C16C 3OAAA 3PUZA 4QOSA 2OG2A 5J5CA 4X65C 4A0HA 3W6OA 3AVXA 1G7SA 2ZS8A 5AUPB 4BLQA 3TUZC 3I73A 3J81k 5FTMA 4Z54A 1GVNB 4P33A 1D5CA 4JLKA 4A4DA 3GLHB 4C7OA 4CZ2A 3UMSA 1N6OA 2JMPA 4QNMA 1Z5ZA 3DKVA 3KQKA 3WBKA 1KJZA 2YCBA 2UKDA 4FCWA 4FMBB 1LB1B 4F4CA 4IDHA 3QKSA 3IILA 4GP7A 5K8UA 5A4JA 2GVDC 3GEEA 2IHBA 4W7SA 1N25A 3PUWA 4OL0A 5EP3A 1NJFA 2QI9C 1P6XA 2LWIA 5TB5A 3RS4A 2IS4A 1DAMA 1KAOA 4JT4A 2ZSFA 1N33C 3HU1A 4OJKA 4MKHA 2JASA 2IUUA 1KO4A 1AS3A 5C46F 5F9FA 3EC2A 4KO8A 1UBEA 3VR5A 2BMEA 2QAJA 3R9WA 2AX4A 4PZZA 5LB4A 2NOAA 1VDZA 1E9FA 1E32A 1A1VA 3U3OA 2DYKA 2C03A 2PBRA 1HH2P 4XD7A 4B48A 4XWKA 1BMFD 1CJTC 4J0QA 2VF8A 3EA0A 4LJ7A
chains in the Genus database with same CATH superfamily
1W34A 3ABSB 3CQ3A 1O97D 3SYTA 2YHSA 4LF9B 1KOGA 1B23P 5CA1F 1P1RA 2ZETA 4KIJA 5KTOA 1RYBA 3WGOA 3I2HA 3VTAA 1Z7YA 2ZBGA 3IEKA 5FUBA 3FDZA 2G9UA 5AKYA 1SXJA 4TWZA 1JHUA 4YCMA 4V03A 1QV9A 2WP0A 4P82A 1B16A 2CLDX 4R9VA 5T4BA 3VAZA 5JJCA 1ZNXA 2GLXA 1VSBA 4G0MA 4LIPD 4LMRA 1WVMA 3OPNA 3QYJA 3EF1A 4AQYC 4XYBA 5CDSA 1TKBA 2EYUA 4B83A 5DNCA 4OQXA 5KO2A 5DK4A 5CXQA 2FZKA 5AHRA 5HIAA 4JBGA 2O8DA 1C3XA 4MR7B 1R8QA 1WABA 4QYSA 5B57C 1S8AA 5CVCA 3OG9A 5HEKA 1TCCA 5IBQA 2JVIA 3MMXA 5LBIA 3THYB 1DO2A 5KYVA 3NX4A 3P0EA 2B5VA 4PG8A 4QNRA 2JZNA 2H51A 3TFQA 2ARKA 3OF5A 3Q7PA 4I9GA 3JPYA 1WOYA 2AOTB 5C8DA 1XO1A 4LKOA 2BZSA 1NW7A 2WF6A 4QDTA 4TN1A 5B6JA 5D5PA 1PEAA 4R16A 4YLEA 5A05A 1FVOA 1QAMA 2D2EA 1YIOA 3CFYA 1B3BA 3JQGB 4WADA 4YIKA 1QZUA 2GASA 4X1KA 3NRCA 3MHPA 5I3CA 2DT5A 4UVGA 3A36A 3ZIDA 4FHZA 1E5TA 4NBWA 1VPDA 2YWHA 1CTQA 4E12A 3BVPA 1K0RA 4IOLA 9LDTA 5C5IA 4EH1A 3GRYA 4E1VA 2OGSA 3ZE1B 4H7HA 3EQ8A 5K7SA 4WOBA 4RTPA 4Q4CA 1ZXBA 4HDRA 1RRMA 1ECCA 3LC0A 5IH3A 4JWKA 4A91A 4B09A 5MN4A 4TS4A 1H22A 5ALKA 1N34B 2RGEA 4OHUA 3ZW8A 4LVOA 3HJUA 4WNCA 2B7CA 5KOJB 4QVIA 2XHEA 2LW7A 4LFBB 1K89A 1YQQA 3BGIA 1IOLA 1ADCA 1SU8A 2ZI7A 4MP6A 2CVPA 1LD3A 3DZKA 4G07A 4TTTS 4YACA 1ZISA 2J3EA 5DM4A 4GWGA 4OK6A 1VJCA 1HOTA 1F3OA 3FKQA 1ZM7A 1KHTA 1WXWA 4ZMBA 4DHEA 1FDOA 2QG9A 3KBBA 1DAPA 1ZI6A 1NQAO 3IEXA 4QBHA 3D0QA 4YAFA 5K0NA 4BWGA 3LHSA 5CFNA 5M04A 3HK2A 5T8KC 2PJUA 3BGWA 3QZUA 4G2TA 2BZ1A 4M8KA 5FWNA 1DOZA 2PJRA 2B4AA 2HLDD 4I1SA 4JJ7A 1Z6QA 4UBNA 2D6FA 4JZKA 2NT4A 1A9RA 4KWIA 2BUCA 3ZJ4A 3AFGA 1T8WA 1QHHA 3H5TA 2OVBA 2PRKA 3QOFA 1OZHA 2ONCA 2PV7A 4D25A 1WPXA 2JLYA 1KZ9A 1Q84A 2KYRA 1CUSA 5CPFA 4A8HA 4G56A 5DGXA 2EKPA 4ZMRA 2ONFA 4B6SA 2M5OA 4IMIB 2JIDA 2R44A 3HJAA 3WGVA 3F3KA 5IZCA 5JBQA 5EFOA 1VA5A 6CHYA 2MYNA 2G3YA 3L43A 4WCFC 2JARA 1B2LA 4KPEC 4WINA 3KSMA 3A4TA 3MMSA 4UD6A 2EEPA 2H5JA 1UIMA 2CLOB 3OD5A 3Q2IA 3RDPA 4AB1A 4DXHA 5BOSA 1KAMA 1I0IA 2Q4BA 2QE7D 4C4PA 2WC1A 5T7BA 2Y6UA 4JEHA 3HC7A 8MHTA 3RYIA 2RHRA 1E7RA 4V1CI 2W5UA 3A9WA 1P7PA 3MS2A 4LBVA 4JGBA 4DBLE 3SQLA 2I80A 1XTQA 3AP3A 1BVRA 5HXAA 3DMTC 4CQLB 5BUSA 3RTAA 3K30A 1U0HC 2NUPA 4P54A 2VPXA 3FG9A 3FNGA 1W581 3AXTA 4LF6C 4C07A 1PU1A 4JV5C 3S40A 3ZE9A 4AO7A 2CBZA 3RVQA 4FW8A 1Q0RA 1MR3F 2P6RA 3DLCA 3E2PA 4KWHA 2PWBA 1YGYA 4IO0A 4KO2S 4NMWA 1M6HA 2XCRB 3KAPA 1R4MB 3H1PA 1TUIA 1UK7A 2X1MA 4RKYA 1LPSA 3AUJB 3UXHA 2G17A 2PRYA 3SEFA 3TSYA 4AJPA 1DO0A 3MAAC 2X15A 3HUUA 5K5EA 4PC7A 3OT1B 1B6TA 4MP3A 3AF5A 5KSWB 3QENA 4O1MA 3AVTA 3AVWA 5MF6A 1A8QA 1A1SA 3MQ4A 2UVPA 4GM1A 4IF4A 4DNPA 3AVOA 2A0XA 1M33A 2DERA 4KQIA 4Y1GA 2QRGA 3OJOA 5DCLA 2WWRA 4HAYA 4J94A 3RBXA 3O9VA 3K0AB 4B6GA 3IBCA 1MHPA 3H5AA 3NOVA 3ROZA 3O7WA 1P5FA 1E4OA 3E22A 1RAAA 3EDCA 2LIPA 3GDHA 2H1VA 4I99A 3RFUA 3RK0A 5CFLA 2EKDA 2GN0A 2R6AA 4KH1A 1UWCA 1QR6A 1VP3A 5C80A 3EMDA 2NWQA 1I7QB 4LK2A 3CVWA 3EXG1 3G68A 4K9QA 4TMWA 2WFLA 3FR7A 3E05A 4NNOA 2H9IA 4HADA 2TYSB 2W2OA 3W7BA 1KK2A 2X0NA 5DULA 2OGWA 3WBJA 3H7IA 1ZL0A 3LDFA 1S2LA 3KK0A 5LMUC 2PVSA 4IXMA 4LX0A 4NENB 5C32A 1H93A 1OAAA 2JFVA 2Q2WA 3DM9B 3CVUA 1CJKC 5GIOE 3H1TA 5CEEA 1FFSA 2QJRA 2Z6AA 3BRCA 3VKUA 1ZOOA 2XEXA 3UH0A 3LQ2A 4BVFA 3BF8A 4CV2A 5LQUA 1O08A 2PSDA 3H42B 4NY1A 1P7YA 3MUNA 4WBSA 2GXAA 4EEKA 4CDNA 3B1YA 4GMFA 1QAQA 4U4AA 1RRGA 2ZSAA 2KE5A 4NC9A 4O02B 4D74A 1GDDA 1DPGA 2WE7A 3L84A 1XLVA 4UHDA 3MJVA 5JMPA 4BLUA 1JWAB 2FLWA 2QD4A 4AJNA 1FSZA 3AV3A 1DLJA 4EY7A 2X2OA 5CUQA 1JXMA 2CN1A 1X19A 2Z83A 1XK7A 2QIOA 3JRNA 4E11A 2PSEA 5AT1A 2JK1A 3UMBA 4FXPA 5FI5A 4C01A 3TYXA 4GOJA 1MJFA 3PPIA 4HF7A 3FYUB 3KUUA 1I10A 5CR9A 4Z51A 4AYXA 4DTIA 1M6VB 4FLMA 1E8NA 2OQIA 2R68A 2W8BA 3D54D 2F43A 3NHLA 5EIWA 4RELA 4Y2HA 4GW3A 4FN4A 5L3VA 1MW8X 1U8TA 1HWYA 2RI0A 1Z0AA 2HPAA 4HLDA 1IOZA 2DX7A 4YASA 2P2LA 1UDBA 1KRWA 3C1UA 4HZGA 1SKMA 2LDBA 2VYCA 4ZEOA 2JGJA 1T24A 3MMZA 2NPFA 2OBVA 3EDRA 2DFPA 1N0IA 1NY8A 4OVKA 1KP2A 4ZV4A 5JIBA 2JCSA 2FX2A 3G9ZA 4DUYB 4CM5A 3DP7A 1JWBB 2IIPA 1QO9A 4BNLA 1HZJA 4OHOA 3G8AA 3EGXB 4YC7A 4XEHA 4EGFA 1FQOA 2EJWA 3PHJA 4CGZA 4IXWA 4Y2QA 4I55A 1V5WA 1Z12A 3PNOA 2XDQA 4ADSG 1R0KA 1BU8A 5JEDA 3OKAA 4DUZC 1BX3A 2BJHA 4H4DA 1E9RA 4J0JA 3EAFA 1II9A 1T1GA 2UXDB 1ZUIA 3CLUC 3V1UA 1DG3A 1VRVA 2DQ4A 1H94A 1DIHA 4L9WA 1I6LA 3IVMA 3PEFA 4NXMB 4F1KA 3NBXX 1ZESA 2JCXA 1DBIA 3A4NA 1DS6A 1PLLA 1YMUA 1EM8A 3KDPA 4CIBA 3F3YA 5ERXA 3N6VA 3MTAA 1ODJA 2EC5A 2IZ5A 2RBGA 2WD9A 1QHYA 1NWHA 2VP3A 3JQDA 3VNQA 1AQUA 3QU2A 2FQWA 4HDCA 3T7SA 1PJBA 3N76A 4AJ1A 1G3RA 2CLLB 4K0RA 4RVDA 4C4ZA 2A1UB 3PI6A 1BXGA 3NDRA 3RUIA 3HR7A 3JARA 4LJ5A 1G5IA 1DAOA 1QQTA 1LQLA 2AYZA 1J0EA 5LLTA 2JLUA 2FEMA 3U3JA 3ZI4A 4HH3C 3KL2A 1X1EA 2ZYRA 2SKEA 5FEMA 5G0VA 3NDBB 2EW8A 1GPMA 5I9SA 1UBTS 2FFRA 1O94A 2OXRA 1B1AA 3PU6A 2YL2A 4Y2SA 3ZDYB 1JUDA 4DR6B 2ZCJA 3EGOA 3HNRA 3MXTA 4W7IA 3F7OA 4ZOCA 3MJCA 4P3YA 5IW8A 1XMQC 1SVLA 4AZVA 1DKQA 1ULBA 4Q19A 4LXYA 4CLEA 2IBMA 4U7HA 2VYQA 5A9SA 3E7WA 2FMXA 1NW9B 2RKWA 3GJ3A 4MRMA 2C4MA 1ESCA 3NC0C 3SXUB 4CFZA 3PFGA 4BL5A 3DTYA 2VXYA 4KUHA 3WGTA 2GO1A 5IT0A 4LK3A 4ZT4A 4EKGA 3B36A 2IP2A 4RFSB 1W1UA 3SLKA 3L7IA 3TNDA 4M4SA 1OI3A 1PJRA 2JGNA 4XGQA 1NR7A 2UUCB 2XB8A 4WI1A 3KQYA 4AZTA 1WE2A 3AEQA 4R81A 1ZMTA 3KZCA 2BHLA 1N6RA 2WAAA 2OHVA 3FMFA 5DYGA 4J91A 4KR7A 2D7DA 3HO1A 2ZTMA 1UANA 2P68A 2Q3LA 2V3VA 1G9SA 1GTVA 1RFGE 2G9ZA 1UDWA 3ADBA 3H1GA 1ACMA 2ZRJA 2FX3A 3N86A 2YQ4A 4CHGA 5IYZF 5ALTA 1OWNA 4CRWB 1QVRA 4Z5XA 1BYIA 3AHDA 5DNUA 5A4IS 4G4SO 1CW2B 3PNVA 4KXMA 3BFXA 1U9ZA 4BV3A 4YRBA 4EA8A 2IOFK 4LNAA 3YASA 4EQ6A 1ZKMA 2LVBA 5LWHA 5AUQA 4M1SA 2QZ4A 1TRKA 1ONSA 1A8HA 4GI7A 4Q05A 5BVGB 3GGDA 4HEA1 4RV4A 5JAUA 5AE2A 4TL8A 1XMXA 1RJGA 3SMQA 3VZCA 3F73A 2P11A 4M87A 3V6LA 3CKYA 5DIFA 2X8BA 2QV0A 2RHWA 5FWYA 2AK2A 5DW0A 2AD1A 2F64A 1F0PA 2B34A 2RBEA 2VPYA 4PU0A 5CFQA 1KQFA 3UK2A 4NXNB 3IEUA 1FNCA 3EA5A 2IYVA 4TTSA 4LDPA 1AG9A 4DV1B 2BEJA 4V2UA 3UK0A 4L2ZA 3O8OA 3IFSA 5IUKC 4B3HA 2XWQA 2LDXA 1AXRA 1ZM2A 5KVCA 3F6PA 4C7OB 3T4XA 3L7AA 3OEEA 1LEHA 1W8DA 1UPAA 5KSYA 4REQB 3NHRA 5KC8A 1KDOA 1VLLA 4XUEA 1XTUA 3GA0A 4LTDA 2EX4A 3FXAA 1QRSA 3OICA 5CHEA 2XT6A 4HPJB 2QV7A 4JD5A 3I9LA 2NQ2C 4FW9A 1KE1A 1NBAA 1VHLA 1TM4E 2HF2A 3EBLA 4P58A 3A7EA 2VATA 1Y98A 5H59A 1AF4A 2P5TB 5DTMA 1BKYA 2C84A 3W9YA 4XJXA 1OZGA 4K0KC 1TXGA 1QFXA 3DKPA 1CUUA 3PQ3A 5JECA 3IP7A 4OF4A 2EP8A 3WL5A 3ZCRA 1Y48E 1LBHA 2IQ5A 3TK1A 1ZH8A 1EDDA 2R62A 2J41A 3MB8A 4P22A 3WDSA 5IFLA 2GYVA 4XYGA 3RG2A 3G5LA 4XJTA 4BBJA 2BTQA 4P53A 1CF9A 4DIDA 1KY4A 2JFWA 5BNTA 2IDZA 3TCKA 3ND7A 1Z8DA 4P31A 5I4KA 5JYCA 3VI3B 1JT2A 3K7EA 2W42A 3EXFB 4ZC8A 4UUNA 1C3OA 3ZWDA 3BMQB 3HZRA 1W4AA 4EB3A 3F74A 1Z2PX 3K9QO 3KU4A 3Q85A 3OIGA 3UMRA 3WQBA 1I7DA 4IP0A 1UKCA 1L6RA 1IB6A 4M54A 2A5FA 5FHQA 5H8WA 2D2VA 1SC1A 3U80A 2O5RA 4G3XA 4ATNA 5LU8A 3L07A 4L08A 4F5ZA 1P0PA 2BEWA 2W0MA 3FDZB 3DDWA 3C8DA 4HH4A 1SXJB 4PR0A 1G2QA 5CP8A 3T7JA 2CFOA 2REOA 2WG0A 3SX4A 4MHTA 1PUIA 3RRYA 1XYGA 2X8JA 4U7DA 3ON5A 5FL7A 1N2EA 4E5YA 4C76A 3SR3A 3PQ7A 4YONB 1Y5IA 1P0CA 1ZIYA 2J3IA 1RTKA 1E77A 2Q62A 1NBIA 3B2EA 3GR0A 3E27A 4OCZA 2J0UA 1JEQA 2OPHA 1OWOA 3UENA 4IHJB 4NBSA 3T0FA 2FW9A 1GUYA 2ZWMA 4MV6A 5AXAA 1JI3A 1VI5A 1L5RA 3FN4A 4EGJA 5EIAA 2NVOA 3LT5A 2AH5A 3GAZA 3VZDA 2ICAA 3VZPA 4GKJB 5ESXA 2BC9A 1U1DA 3L1IA 4XSGA 5DCYA 1EB8A 3KJEA 1IFXA 1P4SA 3PEEA 2Z2XA 4KDCA 5C3MA 1XQVA 1SFRA 5CTAA 4DJFC 4E88A 1X8LA 5HM8A 1BN7A 4HH0A 3PNYA 2AKEA 5CB6A 2DG2A 1W9MA 2FN3A 1EDZA 2AE1A 3I28A 5FA8A 5J5AA 4OB7A 3TQIA 2YZNA 3C2QA 1T0UA 3E48A 5KAPA 2RHDA 4X1KB 3ZDBA 2PZGA 3ILSA 3KYBA 4DA7A 1QPBA 3KUDA 4FC6A 1RVV1 1YFZA 2XCSB 3F96A 4BUCA 4DM3A 2AN1A 1JA1A 2HTFA 4HI0E 2ASVA 3R3YA 1PJAA 1RHQA 2Q1WA 3HCAA 4Q1DA 5IABA 3CX3A 1V25A 2NT3A 3I05A 4HDRB 4DBLC 5AHKA 5JAPA 5K05A 1SG9A 3C6KA 1MRSA 1GGJA 3QE4A 3RANA 1JDJA 4OMCA 1J0BA 1QBGA 4J7XA 4CU5A 2WU8A 1D7AA 2HSEA 2QY6A 1HQKA 1AOXA 3SX0A 1Z9BA 4AUKA 3PK0A 1EUZA 5AIBA 7ABPA 5L95A 2IX3A 2IA5A 3V5NA 4O5AA 1Y42X 1GHTA 4AU1A 4B7ZA 4I4TF 2VF4X 4K9PA 1OI2A 2O0MA 4MCAA 1XDDA 4U6SA 5JW6A 5CVTA 1NZDA 1QIEA 3I4LA 1DOAA 4XIIA 4QGSA 1RBMA 3TZQA 1J6UA 1Q0TA 3F7MA 2JLCA 2O2EA 3ZZTA 4GYJA 2ZKIA 3ZE6A 4R1LA 1CV2A 1XJ5A 2I29A 4HRXA 4ZU3A 3QA9A 5IJAA 2K4MA 3JTEA 1XHJA 1NGSA 1A3CA 1TLTA 4XFDA 2D5CA 3REOA 4UHEA 1F5SA 5JC1A 2CLSA 5BV0A 1K08A 1W1WA 4AY4A 3GLFA 3DZHA 4BFSA 3VKVA 1QHHB 2B6HA 2J32A 4R4JA 1ECBA 3BWMA 3C7KA 3L4BC 1QU2A 2QVZX 5DNVA 3QVMA 3I39X 4LWPA 4KPFC 1JRLA 3PT5A 3AF6A 1EU1A 1SD5A 2X42A 3KOMA 1N36B 3LUSA 5HIJA 4QWWA 1ULZA 4M6WA 3QX3A 3LT0A 2OFPA 4TWIA 2FK8A 5HJ7A 1VLQA 2M9MA 2JIZA 3HE3A 4NE9A 4KZKA 4Q4HA 4RK5A 5B3JA 4JI2B 3D6MA 4AN4A 1OH8A 1P0QA 2FMIA 4DFDA 3L1UA 4IFEA 4L75A 1XCOA 3LGSA 3GCDA 3OM8A 2HCJB 4CM6A 1N3IA 2WR8A 3C0KA 4K05A 2FYTA 1ENYA 2H7CA 4ZLPA 2X3FA 3PUVA 4YDSA 1YE5A 2IOYA 1JVNA 1QGDA 5BOSB 5CBPB 4CODB 3B38A 1UAYA 1HT0A 1F12A 3TCXB 1N6KA 3C6XA 1T26A 3RYIB 2ZJ0A 4J3NA 2W6JA 1G5QA 1R50A 5IJXA 1GG2A 1GZSA 3L7CA 3M49A 3URKA 3RASA 1T15A 3WLHA 4AP9A 4UTPA 4U7TB 1B2RA 1KKLA 2ZJ1A 1N2CA 4YMLA 1HL7A 1O1YA 3AQ4A 3MQFA 3ICOA 2E5FA 2EQAA 3BIFA 4V1CB 1JG6A 1ZD9A 2NUPB 2ZJAA 1WCV1 3ID6C 1X1DA 2IY9A 4PTYA 2X7HA 5JCXA 1GTRA 5T4EA 4EPWA 1MG0A 1QGZA 2QQ5A 2JFOA 3AF3A 1R64A 3PNQA 2PGDA 2R79A 3R41A 4PPYA 4XLZA 1P4JA 1TB4A 3KKLA 5B30A 4UEJA 3SHTA 2CFIA 3F1LA 3CHYA 1UBNA 1QQ5A 1T6BY 1ZK4A 2QQEA 4YO8A 4DV7B 3QGMA 5KOHA 1CYDA 1CZLA 1F20A 1YT5A 2AG5A 3ETCA 3W9BA 2CMKA 3KXKA 4QDZA 2GPAA 1QE5A 2CHEA 4KLZA 3ZWYA 4AICA 3E9DA 5J2TA 2HREA 1WZIA 3INNA 3NFYA 2DCUA 3RC9A 2IEBA 2EJTA 5CX4A 5EWLA 4DUPA 4O4IF 5JDCA 5CB4A 1SIUA 4UMDA 3RWMB 4E5SA 1QIDA 1D07A 3RBVA 3L7DA 5JS2A 3E22B 1UBFA 4UCXA 5C7OO 5GOTA 3V8VA 4RH3A 5I6DA 1NW6A 2FI1A 1FFCA 3OZRA 1KSGA 1NF9A 2FVXA 4PHTA 2HX1A 3ETGA 2KBFA 2EBFX 4I1UA 4QX6A 4EGAA 1EVLA 1G8JA 4RQTA 4EZIA 5BSEA 4GKKB 4RKEA 1U3WA 1SN7A 1Z0KA 3OU7A 4TYMA 4RKQA 3RS2A 4HDNA 1YV9A 1NF8A 2HQOA 3C3KA 1DDGA 1L7AA 1TQDA 2Z5VA 4A7PA 4YR9A 2D8AA 2J1LA 2O52A 4W1PA 3H1FA 5F1YA 1RFLA 1PU2A 4IV0A 1XHLA 1UEIA 5DRTA 5EMJA 2VF7A 1A2QA 1X9GA 1F2DA 3C3BA 3EODA 3GPDG 4PO8A 5EQDA 5A0TA 2R8YA 3S4YA 4I9UA 2GPWA 4DAOA 5BT8A 4BQEA 3GRVA 3M6VA 4PFKA 1OJLA 5IXSA 4LZWA 5JI3E 5IAJA 5JWRA 3N2ZB 1SKYB 1GQRA 4RL4A 1HNZC 3X1DA 2NU8A 4X97A 4C88A 5KBYA 4YO7A 5MGNA 2YIMA 2Y4NA 2XVMA 3HB9A 4RPCA 4U9HS 3PL1A 1EFPA 3DA8A 3P5SA 4MIEA 4YJDA 3SM3A 3U3KA 3WAKA 1Y3IA 3DYIA 1VG1A 3L7OA 4N65A 1O0BA 3A28A 1WMAA 1B26A 2ZP1A 1ENOA 2C5HA 2XTMA 4FZRA 1I4WA 4B76A 1V47A 4GXRA 1KTIA 4MYSA 1X77A 1GCGA 2HNAA 1YB4A 3E4DA 4ZICA 3KIPA 1XZAA 3D0RA 1WPQA 1FFXA 1YS4A 2NU6A 3WGZA 1E7MA 1Z7GA 5DYNA 1UBGA 1V7ZA 2VJQA 2N1MA 3SI7A 4N3NA 2W8BB 3AVVA 1YVRA 2F43B 3HQ4O 3IKJA 4HAOA 1GRRA 3HA7A 3L40A 3MWLA 2VK2A 4RV9A 4JI4C 4BNDA 1WUHS 4MRSA 4KLRA 3QKTA 4XM0A 5TQJA 1G5FA 5GJBA 2O0LA 1CUFA 1OAKA 3KPUA 2YV2A 4KRFA 4FNGA 5A62A 3FF1A 4JC8A 3TAUA 1CQJA 5JROA 1LLUA 2YDYA 4NLLA 5JYDA 1IBLB 1UIRA 1V3UA 4QICA 2ES4A 1OXBB 2B1IA 1MVOA 2QG6A 1IXSB 2VDQB 3AJ9A 4PAGA 5F33A 5FKJA 1ILEA 4K9LA 1R0YA 3T9BA 3ZWNA 2XDQB 1BE0A 5IWCA 1H8EA 3LLUA 4LHSA 5HZHA 3UEBA 1NC3A 1A98A 3OSUA 2ON6A 1LC3A 1JYFA 1JE0A 2AWNA 3GFVA 3QPVA 4K6GA 4IGIA 4GF5A 4KBFA 5KU7A 1EIWA 2VQEC 4A5SA 1EGAA 1VCMA 4BNFA 4KITB 4IG4A 1RZUA 5D2CA 2V6JA 5H5JA 1JECA 1UOPA 2ZSEA 3P0FA 2FSIA 1KYQA 2AMVA 3HPQA 5KSOA 4DNXA 1KI2A 1CP2A 1XCJA 3JW8A 1RBYA 4BUZA 1BE6A 1YB6A 1VRCA 3ZWQA 2OMEA 5JCJA 3SC2A 4G86A 4LHVA 4ZI2A 5JAIA 1G8AA 2CVOA 1BXGB 2HLNA 2V5UA 1IBMB 3JARB 1R0LA 4G8DA 3NWBA 4RY8A 3ABZA 3GCGA 4FHFA 4MQ6A 5DNWA 5AMXA 3RJZA 1G9TA 4FCCA 4FKBA 4KK4A 3RSGA 3W90A 1U6IA 4B3BA 2MT9A 2FHPA 5A7HA 5KKCA 1G59A 4R2MA 3L0IB 2C59A 4LMAA 1G1AA 2B4YA 4KTTA 1IHYA 4K6MA 4RHYA 5IJZA 3NI2A 1ATIA 1YK0A 2IPAB 3NYWA 3KPWA 3ZU3A 3R6LA 3WVNA 4CQMA 2P2YA 5DBFA 2BGUA 1PX0A 1P5HA 1K6IA 3GH3A 3AP2A 2A4KA 4AS1A 5A9SB 3E1KA 1Q57A 4C1NA 1PF7E 1NQVA 1GNTA 1R74A 4WNAA 2PBLA 1J8FA 1J97A 4MV0A 4MRMB 3K31A 4ZAGA 5H82A 4B4UA 3OT5A 5B3LA 1R6XA 5B1IA 3FFXA 2W6ID 1JKMA 2DQYA 3ZNNA 4RA6A 1G20E 2N3ZA 4BP8A 1CU1A 4FFMA 3TR3A 3QPWA 2XE4A 5AI8A 4YI5A 3V9PA 1Y3DE 5BQFA 4WX2B 2R0QC 1Q0ZA 2DFNA 3S8EA 1L6IA 4JENA 2N47A 1XZLA 4JX8A 3QPCA 3WL3A 3ZX4A 4MW9A 4OXXA 4JBHA 2ANCA 3B9PA 4CIXA 4JI8C 2IXGA 3QFSA 4ODIA 4QYTA 1VYHA 4LECA 1Z73A 4QOFA 4X94A 5JS7A 4II7A 4CJXA 3PXEA 4QL3A 1Y7TA 3KP1A 5EXPA 5DISB 4RNDB 4GRIA 3TNFA 1PGJA 4F5DA 1S2DA 1P1IA 2BRUA 1VM6A 5G3YA 1RKVA 2CF5A 3M82A 1X1SA 4RHXA 3WLKX 1EXMA 1KJJA 1K6EA 3AFMA 4N5LA 1ORDA 1R88A 1TEVA 1O8CA 3BDIA 3HRKA 4DA9A 5JD6A 2X6QA 3TQCA 2QPAA 1OE0A 3NWJA 2ZRGA 1A69A 5JQWA 2PUDA 3ZNOA 3LHIA 1JHAA 1S7GA 4HN2A 1MC8A 2X76A 4CF3A 2BEKA 2BZGA 2O19A 1NXPA 3EY4A 3KKOA 5FWYB 3VYUB 4NU0A 5DHUA 2XUHA 3LY7A 1ND5A 1XN1A 3KUCA 5LYJF 1T5OA 1XEAA 1SRQA 5B7QA 2HK6A 1PL7A 3PA8A 4LQDA 5K8FA 2BBOA 3SJBA 3O8OB 5GGYA 3E9QA 4Y6OA 1TF7A 5CCEA 1MNQA 3HADA 4TV8F 2YW2A 1K0UA 3T95A 2FHSA 1A9TA 2RB5A 1SCDA 2NO6A 2JGAA 3DQPA 3H0EA 3QVTA 3LOUA 4FCVA 4PGAA 3ER8A 3BT7A 4OGWA 5KNBA 3CZ5A 1L1RA 1H9CA 2RHLA 2O06A 5HIMA 1FU8A 2Q4RA 5IAAA 3WO0A 2GEVA 2CV1A 2XBLA 4AD8A 5AVJA 1FDSA 4MPTA 3DEJA 3NYIA 3F98A 1MC1A 1XZIA 1XS3A 3D2BA 2DWPA 3DZDA 3L6CA 4GPEA 4JR0A 4BASA 4LFCB 1SWVA 2P4EA 2OD9A 3B3FA 4L72A 1N8KA 5I8ZA 4IUBS 1GITA 3SHFA 3WFIA 3QMVA 3ZG6A 4EJSC 3D3WA 4JUBA 2EFDB 1U02A 3MBIA 2Z30A 5T6MA 2EARA 2W70A 3TOVA 2B94A 3JQ6A 1D2CA 2C5GA 4PQGA 5KTSA 3WA7A 4KN6A 1WHSA 2X4GA 2G1AA 4U2GA 1ZAKA 1J21A 4LJYA 2BTQB 3BE4A 4R6WA 2E5WA 4RSMA 4A23A 1R0SA 3AUSA 1R1DA 1P9WA 4WOPA 3OMXA 2AZXA 4JVOA 3L05A 3CNLA 5K0GA 4L16A 1C3OB 1NQUA 1ZK2A 4RLFA 4XIYA 5SZIA 3NYRA 3CNNA 3L7NA 4NAHA 4RULA 1IEVA 4B6PA 3C6ZA 5A7GA 2P27A 2JHCA 3ZNPA 3E35A 2VWQA 9MHTA 5LXTB 2BUAA 1BE8A 2FRDA 4MVYA 2NUAA 2BEWB 2AC2A 5H4HA 3JD1A 1A7JA 3ZCSA 1W4RA 4AMUA 1YDHA 2VP5A 5IVPA 2QVBA 1YS2X 1STOA 2XJ4A 1PJLA 1D9XA 2WVJA 2X8JB 3BK2A 1A2KC 1OTHA 4NQZA 1O57A 3P2EA 2CCGA 1HXHA 3ZVKA 2G28A 4MJLA 3GFGA 4GX5A 3UUWA 2YNMA 1UJCA 1WUJS 1JEQB 4RY2A 3EWAA 4JROA 4ZPJA 4GS5A 2QYHA 1FW8A 4JLSA 5DM1A 3W2FA 2IV2X 1LK5A 1EFVA 3P2YA 1L7MA 4K9MA 5BN5B 2P2CA 3JSAA 4HDAA 3V1YA 4EZBA 2ZQZA 3SWWA 3H7AA 2IV7A 3CZPA 1I2AA 1LRLA 2C2YA 3BCRA 3DVLA 4EQ6B 3ESQA 1D8AA 2QN2A 3DQZA 3LIIA 1G8PA 3TTVA 5KYXB 3KYDA 3WMFA 1DJOA 4TTRA 4RIHA 5AJWA 3ZY5A 1A4IA 2UXBC 4W1QA 2FWIA 4EI9A 4KX3A 4PSUA 3JRWA 1DIRA 2PLRA 4X1OA 3ZQ6A 3U0BA 3V42A 2OAGA 1EDEA 2WAYA 2QRLA 2CZQA 2KS6A 3VJLA 3TD9A 4M0KA 2Q8NA 1PV4A 3FRHA 2YVUA 2EW2A 4RSRA 1UF9A 3W8NA 1YNSA 1E20A 2FUNB 3FGNA 3QUAA 1Y3AA 6NULA 5C18A 1JX6A 3KTFA 4TKMA 2RIRA 3ANNA 5CXSA 4V24A 2NQ8A 3NPMA 1Z2DA 1Q1AA 4MEBA 3GGGA 2YOHA 2HGSA 4P9NA 3UHJA 2ZBEA 4F3KA 3SZUA 3ZU6A 2QMHA 1Z39A 1YGPA 2Q2QA 3NVDA 1W36B 4J1QA 1XELA 4B3TC 2RGXA 5CA0F 4YLGA 1TUGA 1GCOA 5T6BA 3T7IA 3WP0A 5IM4A 3DEIA 3TTXA 4BO2A 4DZRA 1TU3A 5JCPA 5HDBB 4W5RA 3C8HA 3ZV7A 3JQQA 4L8WB 1KJNA 5CIYA 4IRXA 4ZVQA 4ZDWA 2Z2ZA 1FP1D 4UAUA 3TEJA 1RABA 3A10A 4XAQA 4QUEA 3ADDA 2YJ6A 2PKYX 3AM3A 1DAEA 5CZVA 1Q7TA 1RQNA 1U0LA 1YL5A 3FYDA 3IQIX 3KOUA 3GDFA 3N6XA 4JJGA 4OMUA 4JP8A 3KOZA 1J24A 4DB4A 2FDXA 3D4BA 3TGLA 3CB4A 3EUFA 3V8PA 3ZLVA 1NVTA 4AMYA 3GNTA 3OP1A 3GLFB 3DE4X 4F4IA 3FOEC 2IEIA 1XZMA 1U3CA 4Q3LA 1N5DA 1U7XA 9GPBA 3I6ZA 4FFWA 4YMGA 2CV2A 1T1RA 2BFFA 1WL8A 3IDZA 5T64A 4R71A 5DM60 3I76A 2ZUWA 2VN8A 4MVXA 5KWVA 3CUYA 3ER9A 3MAJA 4M6WB 2G8LA 5EIBC 1L4BA 1NBMD 1BTOA 2GBLC 5LBUA 5TGZA 1SCQA 1SVUA 4FNAA 1VZ3A 3ZEAA 2PQ0A 3LWBA 3Q3EA 4Q4HB 5JJKA 3IPYA 2GPJA 4Z0PA 2MCFA 5KDLA 2YWJA 2X0IA 4D3FA 1AQ6A 3S5UA 1CCWA 4EKEA 2H2AA 2OZPA 3K5WA 4TM8A 1H2XA 2X4IA 1C1XA 1YI1A 1QGOA 1XN4A 4W1SA 4YGYA 4WASA 5AKGA 2XW6A 3RAGA 3BXZA 3EASA 1A7AA 2JFXA 2YMLA 2A1TS 4UNPA 5I5EA 1KGSA 2O23A 3AH8A 1KO7A 2FZ5A 4J76A 2ZU0C 4TRJA 3FHLA 4Z0NA 4MARA 1IMOA 3N8KA 3RTEA 2O20A 6GPBA 5CNJA 1S6YA 1N2CB 4FZ5A 1LS1A 2JI4A 2ZIFA 4R8KA 4YJHB 1S02A 1E9AA 1L4FA 3KT8A 3PTZA 1L7RA 3WL6A 2WRZA 4DSZA 6REQA 3CWQA 4YUXA 2R8PA 3IUNA 3UXYA 1XTSA 4X65B 1NOJA 3AM1A 3FFAA 2RGUA 1R6AA 1UWLA 1WSDA 1ADFA 3OFND 4OQ4A 5K3DA 4GL2A 4FOLA 3KQPA 5HK9A 1N9ZA 1ZVKA 2PH3A 3K1TA 2ZOSA 2W37A 1SQFA 2PPLA 2H1SA 2V4UA 1X70A 3V1KA 1SURA 5KOHB 3H9JA 2A1IA 2WAXA 1PVOA 2C97A 1ZU5A 3INYA 8LDHA 2H48A 4R41A 1FRNA 1SOVA 2VVTA 4EABA 1Q1NA 5H7XA 1BXRA 4NOLA 4JU9A 2CXCA 5AM0A 3IDOA 1KQ3A 4YREA 3KT3A 3GD7A 4LZZA 4F6LA 4BMXA 5LQMA 3E18A 4N03A 4PC6A 5K0EA 5J2TB 5KHOC 3HO6A 3CZQA 2C7RA 4PVDA 1HO3A 2PR7A 2OCLA 4YCSA 4CF4A 2WWIA 2C7OA 4LQCA 1EESA 1YJ7A 5JASA 4QJ5A 3D64A 4L57A 3R3WA 1EUDA 1JIVA 1U8ZA 3GKUA 3OP4A 5DSXA 5B3AA 4I5FA 4MEJA 2X5OA 2H0AA 3O26A 2BFEA 3BE6A 3GP8A 1M9NA 2WJ6A 3FSJX 3EY9A 3RS3A 2CXOA 5HGXA 4Y98A 4AO6A 1UUFA 2AN5A 1UPBA 3QVOA 3Q1KA 4LYHA 5AJXA 3L7JA 1FCJA 1VKZA 1VPTA 5FJIA 5G4KA 4Y2VA 1I4EB 5MFPA 2A9PA 3CUSA 4AX8A 3W2GA 1EJ2A 4I4CA 1OU4A 4JDPA 4TXLA 5IASA 5ITZA 1DXQA 1PCXA 1M0EA 3V32A 4B3FX 3WHKA 2VK4A 3PNMA 2GCNA 1PG2A 3EIQA 3GYGA 4OXQA 5TPZA 3X0DA 1TH5A 3G7UA 3OESA