4DCSA

Crystal structure of b. subtilis enga in complex with sulfate ion and gdp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
433
structure length
406
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
total genus 131
structure length 406
sequence length 433
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcsA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA01
1E2KA 2OO7A 4C0HA 4KI0A 1FQJA 4HB3A 1SKYE 4HZIA 4Q9JA 1NMXA 1AZTA 3QPWA 4KHZA 4RZXA 4JI4C 4EQ6B 3THWB 4ZCLA 3P27A 1KNXA 1Z0AA 4CW7A 2WZQA 2ZSFA 4X8LA 1KY2A 1WF3A 1FL9A 4KLNA 4Q4JA 3H1TA 4DIDA 3THXB 1FNMA 3M6AA 4FCWA 3RRYA 2XGJA 4TQUS 1AM4D 3GJ8A 5CLQA 5EP3A 1E1QA 5JS8A 6Q21A 2GAAA 4QM7A 3UWKA 4KVGA 1N0VC 2ZJ2A 2XXAB 2FGKA 3ZH9B 1YQTA 5KDLA 2FGJA 1CXZA 3BB1A 3A37A 4OHXA 5GJBA 4IFBA 1IN5A 3A58B 3GLHB 5IF9A 4LCBA 3LQQA 3I72A 2UXDC 4DLYA 1QHIA 4URWR 4DT1B 1X86B 3RWOA 1Z29A 2W2VA 3SOPA 3ZIAD 1Z6GA 1RYHA 3RSLA 3IIJA 2FN4A 3BE4A 1SXJC 4Q01A 5JJLA 4M9ZA 1U94A 1YZQA 3G82C 2GXUA 3LO5A 1XMVA 2KJQA 4QGFA 2ZS7A 4MGKR 3KQLA 3MAAC 5LD2C 1KI6B 3NIBA 4LHVA 3ADDA 1T6NA 3SFVA 5E7MA 3GLIB 3T1YC 2AX4A 4QRHA 5H70A 3AP3A 1HNZC 4RZUA 1XTIA 2GCNA 2PN2A 1GDDA 1KK0A 2AKAB 4YQFA 5DN6D 3T06B 4TYYA 2AWNA 4G3XA 5F9HA 4KHPC 2KZFA 1IBMC 2VYFA 3CF2A 3MJHA 1HE1C 4DR3C 3WNCA 1COWD 3O8DA 3W34A 3PENA 1OB2A 4HATA 3KL4A 1YR6A 3IKJA 2IS2A 2Z5FA 2WJJA 5EQTA 5LMUC 3KXKA 2ZJ8A 4IFEA 4FWTA 2D7VA 2A9KA 4IDPA 2XITA 2VA8A 3ZIAA 1JQJC 3QOFA 4TMZA 4MYHA 2VLIA 5CM9C 4BFSA 2ZRCA 4GPTA 4DR1C 2OBLA 5BN3A 3QJYA 1II8A 3T1TA 1G18A 5KOYA 2JLVA 1Z0JA 4ESHA 1EXMA 3R8CA 1Z06A 3PQCA 3TIFA 3GP8A 5DLQC 1ZD9A 2HF9A 1J90A 1SGWA 2RGAA 2VBCA 3CIOA 3LW7A 3IQXA 3D31A 4QGAA 3FMOB 1C9KA 3KKPA 1OIWA 2ODEA 3UIEA 2GA8A 2QAJA 3UG7A 1PJRA 3LBHA 4FD2A 3SQWA 3T35A 3TRFA 5J40A 3NC1C 4FMDF 4A2PA 4TLAA 2CDNA 2AHOA 2BMEA 1HNWC 1QHNA 5FBLB 3LWNA 5DI9A 3THYB 1SHKA 4KBFA 3CF0A 121PA 2UKDA 1XTKA 5KYKA 2EYQA 4HB4A 5L3QB 3LUSA 3BD9A 4CEJB 1ZB9A 2MSDB 3MJRA 4YMWA 2X19A 1FQKA 2ZUBA 4Q4AA 3GKUA 4GT1A 3W90A 2OM2A 1QDEA 4B6EA 1WB9A 3VKHA 4DV4C 3QBVA 4I4LA 2ZUCA 1W5TA 2QL8A 5B57C 5JSZB 4YMVA 1T8TA 2C99A 4DV7C 2WPDA 5FBRB 1YRBA 4LRWA 1XNJA 5JEEA 2NPFA 2CJWB 5IWAC 1Q22A 1CJTC 1T8UA 2H7VA 3ETLA 3N70A 5SZKB 5GVSA 2IYUA 1YHNA 3HYRA 1R6BX 4DEYA 5CIQA 2P6RA 3K0FA 2IHBA 1W47A 2ORWA 2PCLA 2PLRA 1RRFA 4GFDA 4GKJC 3QEJA 2L0XA 3AUYA 1GUAA 1W0KA 2OPLA 2ZVQX 2HF8A 2WKRA 1NVVQ 2QRNA 2IS6A 1J99A 2CCKA 3A6PC 4JVMA 1GRQA 1M1YE 5K8IA 4QBFA 1L8QA 4GZLA 4JLNA 2YOFA 3DKPA 4Q7JB 5DHFA 3QKSA 4TZ6A 2GK6A 1CEEA 4B3TC 3BFKA 2BBWA 2BV3A 1Z8FA 4TLBA 1MRNA 5K8UA 5IHPA 3OFNA 4LYHA 2UZIR 1NSFA 2DWPA 4TT3D 1JXMA 4LV5B 1NKTA 1IM2A 4FMDB 5FTNA 3T1QA 2DHRA 1I4TD 4EUNA 2RGDA 1XBTA 4B3XA 3LLUA 4UNNA 4LJYA 3WMFA 1Q1ZA 5FPKA 4HLDA 2IYSA 3I8XA 2GWHA 3SBEA 1TQ2A 1VIAA 4NOZA 4AQYC 1KSHA 1W2GA 4JI8C 4FCVA 4LOAA 4PO1A 5E7IA 2AK3A 3KQNA 1WCV1 5FTMA 4Q4HA 4EIWA 3HU2A 4WIAA 1EFTA 1CR4A 2XB4A 2WOJA 4BEJA 2R6GA 3NHAA 2VP6A 4G5RA 1GL7A 4AG6A 1G64A 3QKSB 3BWDD 2JMPA 5BN5A 2BHRA 4LHZA 1XMJA 3CM0A 4V0MA 1N25A 4DV0C 4P33A 1ZB8A 1KKMA 4Q7LA 3IGFA 1G7RA 1IONA 2J87A 3GJ3A 1OJLA 1Z47A 1KSJA 5C4MA 1CJKC 4OI4A 1UAAA 5GADl 1G5RA 1G7TA 4W5WA 5AUNB 3X1DA 1PV4A 2E87A 4DDWA 1MT0A 4DR2C 1XEXA 5HE8A 2FZ4A 5K8TA 4JI0C 3EAQA 4HZUB 1OLOA 3WHLA 2O8DB 1OXVA 5JSZA 1TUEA 3AKYA 4GL2A 1DAEA 3GEEA 2GF9A 1Z28A 1A82A 2QORA 3KKMA 4DDUA 4JLPA 1B0UA 3GLGE 1BKDR 3SJAA 3DHWC 3NH9A 1R5NA 4R98A 3FOZA 4Q7MB 5LD2B 3ZVNA 1VHLA 2VL7A 5CM8B 4B3GA 3PEWA 3P4XA 3AVVA 1EG7A 2E8EA 1Y63A 2J0VA 2D7DA 1DAGA 2J0UB 2REOA 1H8HA 3KTAA 1NYEA 5FBQB 5LBIA 1FUKA 4B33A 1CRQA 5EXSA 4F4CA 3AVYA 1AS0A 2Q9AA 1G21E 4DSOA 1BH2A 3GMTA 2OCPA 4DCUA 1ZU5A 4C0AC 4C7OB 2QP9X 3E1SA 4JJZA 2FDCA 3EW9A 2YWFA 1OB5A 3T61A 3N5CA 4B3DA 1Z2CA 2IS1A 2PJRA 1F2UA 1E9FA 1S2MA 2WBLC 4TSFA 2AKYA 3DL0A 2IC5A 5G40A 2Z6VA 1G8GA 2FSGA 4OQFA 2FPLA 5AJZA 4Q1EA 1W4CA 3LLMA 2PZEA 1OF1A 1ZC4A 2I4IA 2G83A 2ZSBA 3N2IA 4P4SB 1ZBDA 4UJ3A 3TAHA 5L8VA 4PC7A 3TR0A 2RGXA 2QGZA 4P3YA 3U44A 3JVUA 2VP0A 1GRNA 4Q4HB 4BFXA 2OLJA 3R9WA 2CNWD 3ZD6A 1OIVA 1NL3A 2XOKA 4A8JC 2UUAC 1XRJA 1N0WA 4Y0AA 3W9YA 1OKKA 4QM6A 4RFVA 2VSOA 1D8TA 3MFYA 1Q44A 1NVWQ 5HCNA 2BDTA 1BO6A 1PLLA 2PL3A 4TYNA 4OQLA 1G1MA 4IVRA 2YCBA 2O0JA 4TMXA 4P31A 2BEJA 4RJLA 1JEDA 4JI7C 4LHYA 3SJCA 3MWJA 5GJWC 1X6VA 3QPVA 1GM5A 3J81k 2UXCC 1OW3B 2CJWA 4FN5A 2J41A 4PSVA 1I2DA 1JXOA 1ZINA 3EERA 1Q1QA 1XD8A 3H86A 2OFXA 1AN0A 4HAZA 4JZKA 2Q6TA 2R2AA 2YVUA 3RABA 4DV6C 1IQPA 1F3OA 4HDQB 4LFCC 3X1YA 3D3QA 5EXTA 2F55A 3NBFA 1P75A 2OESA 3K9LA 4O25A 2D7CA 4TT3A 2WSSA 4Z51A 1TQDA 2CE7A 4HLUC 4OL0A 1TEVA 1NBMA 3U7FB 4IVQA 1Z07A 3DOEA 4MA4A 2JLWA 3KKNA 2WWGA 4RD6A 2JLRA 2FSHA 4BFUA 4WOPA 1GZSA 3K9NA 2B8TA 3QI2A 3NHBA 3ECCA 1OFTA 3PFIA 3U3JA 5FUWA 4KO8A 1X8LA 4A9AA 4KBGA 4QNRA 4DDTA 1A2KC 1JJVA 2J7PA 1MH1A 1GWNA 3A1WA 1W44A 5TV2A 4D80A 5HKKD 1PVOA 3U7GA 1E9BA 2JASA 4GNKA 5HZKA 2AXNA 2QM8A 3GEHA 1DADA 1RFLA 3EC2A 3TE6A 2G1JA 2ZTSA 3TMKA 3IHWA 3IEUA 1EFHA 1FW6A 1XXHB 4PR0A 4B76A 4LFBC 1EFCA 4TYPA 3LQRA 2G0TA 1GFIA 1M6NA 1XPUA 2ZRNA 2PZGA 3CH5A 5FPYA 1E4VA 4OI2A 4AD8A 2KB0A 2PEZA 2X1VA 2XNSA 4PANA 4EPXA 1Q57A 4KFTA 1JBKA 1NN0A 4QJ4A 3REFA 2F3TA 2PH1A 1E9EA 4OBEA 4II7A 4A82A 1LS6A 1DAMA 5H8WA 1ZD8A 3KB1A 3FKSA 2HJGA 4RY2A 3CUEF 3KQKA 1HY3A 4MUAA 4ZKDA 3KDSE 1NN1A 4UXJA 2CLSA 4MH4A 3OEED 4B71A 2ZM6C 4GKKC 2GTPA 3B13B 2EU8A 4DC9A 2VHQA 4DLXA 2RMKA 1RPZA 2XTNA 2HCJB 3I3SR 4DCVA 3K9HA 4KJZA 4M1YA 1R7RA 1SQ5A 1R4AA 3BXZA 2ZR0A 2KI5A 2NO7A 3CB4A 3K0FB 1NLZA 3TK1A 4PAQA 1TQ6A 1RC8A 2Q9CA 2ZSAA 3IO3A 1YR9A 4JLOA 1II8B 2ZE5A 2IYLD 4Q48A 5H68A 4TYQA 5JI2E 1G9XA 3B1VA 4IDQA 4LBVA 2JEOA 4URXR 1IBRA 1JNYA 5AJWA 4BEBA 4ILEA 4X65C 1VIYA 4DLSA 1DBSA 1YZTA 3D7MA 1ESMA 3LBIA 1X8JA 1J7KA 2IS4A 1W36C 1SVWA 2NOAA 3RNLA 1S9DA 3BH6A 3GLHA 5AJYA 4DLTA 2W58A 2WM9B 1CF4A 1NY5A 1VG9B 4LF8C 3CO5A 1E0KA 1R5OA 1VYTA 3M4YA 1E1QD 3NBXX 2BM0A 4FI3C 3B7GA 3BH0A 2WV9A 2GJSA 3GJ0A 4GSYA 1Q0UA 3KJEA 5CK4A 4OHVA 3QG1A 4Q4AB 1ZUNB 5J4KA 2EWWA 2J3EA 2ZU0C 4ZV4A 4NXNC 3I92A 2JDID 3GPLA 1E2JA 1IN4A 1UKYA 1U2RA 3TSOA 1HT1E 2GEVA 4JS0A 4UKDA 4W7SA 4ACAA 4PO9A 4G0NA 3ND8A 2YJTD 3M1IA 4XSGA 1JR6A 3GLHE 4FMBB 2WMNB 1OH6A 5JLJA 1OE0A 2A5JA 3GFTA 3VNUA 4TTPA 4F92B 3EZ7A 3KQHA 3FMIA 2WAYA 2BCJQ 4Q00A 2CK3A 1QHXA 1KTVA 1JR3E 4JI3C 2LCFA 2V4ZA 2ZI9A 1WXQA 4YXWA 1UBFA 4MKGA 2VHCA 1WE2A 5FR2A 4F4IA 1FZQA 4LBWA 1U81A 3LXRA 4NYJQ 2QE7D 2DYKA 2WOOA 2OEPA 1XTJA 4B44A 1OXUA 3ADBA 5EE3A 1DAHA 1SXJD 3U3OA 4LPKA 4I1VA 3OEHD 3E2IA 4RFSA 1LTQA 4B34A 5CDFA 3L8ZA 4A4DA 3O8RA 2NG1A 5JCZA 2QSYA 2IWRA 3PUZA 2O8EA 1EFUA 3NDBB 2WJHA 1W7AA 3DM5A 2IYTA 4HLQB 4LYJA 1UF9A 3PJRA 4KLZA 1MO6A 4AURA 4LDJA 5ELXA 1G3MA 4KU4A 4Q18A 1JAHA 2A7QA 3B5JA 4XX2A 2FFAA 2IYRA 2OCBA 2FOLA 4GDFA 4MRSA 4LWZA 4OK3A 3F5FA 1GKIA 3FHTA 3I62A 2XZPA 4C2TA 1NVXQ 4RCZA 3DMDA 3GJ5A 3S1AA 3QNUA 5E7JA 2LKCA 1ETUA 5E4FA 4DCTA 4BE7B 1U9IA 4JI5C 1E9RA 1R0WA 2QBYB 2XB2A 2Q0HA 2W00A 1XCMA 2J1LA 3L8YA 5DI3A 4PHGA 1Z0KA 1G6HA 2IXGA 1M8PA 2Q3HA 3BC1A 2OHFA 4KXFB 3TLXA 4DSUA 1W1WA 3B2EA 4JBXA 4ARZB 3HWSA 5J4YA 2BBSA 3A4NA 3BBPA 3NBZC 5JECA 4EJSA 1M2OB 1S1CA 4US0R 4MYTA 4QBHA 4KFRA 5J47A 2GHIA 3THXA 4OK6A 2RHDA 2D4HA 2FJUA 2QL6A 1Z5ZA 2IUTA 4NCHA 1XXHE 2ZRFA 3BIFA 3IPXA 1KZ7B 1XTQA 4PHTA 4QHTA 3EASA 2P65A 2YWGA 5BYJA 2F1JA 3ZD7A 4LJ7A 4M0LA 5CB8A 3QG5A 1ZC3A 5FBWB 3WRYC 1FP7A 4HB2A 1H65A 1XTRA 1FOEB 4CEHB 2QUZA 1LW7A 3REGA 3IUYA 1TF2A 4UJ5A 5EZ5A 4D6PA 4EJSB 5K8LA 2WHXA 2R6AA 3T34A 2PCJA 4MITA 5KSOA 3P20A 2QQ0A 4IJMA 1BS1A 2CMKA 2WJVA 4URUR 3QKRB 4O3MA 2MMCA 3CPEA 2EVWX 4Z1MA 2J0QA 1DELA 1P72A 3A1VA 3A1UA 3IPYA 1QZXA 1VMAA 3PITA 3GLGA 3EXAA 2B6HA 2C98A 5G41A 4C7OA 1IN7A 3F8TA 2C95A 4QHSA 2FEMA 4L4UA 1Q3TA 2J59A 1SHZA 2ZM5A 2OAQ1 4LF6C 4X8HA 2QMHA 1N32C 4X8OA 1N6PA 1T91A 1Z6YA 1ZUIA 1JQLB 3HP1A 1L4UA 3AF1A 2FSIA 1N5LA 1Z83A 1XMQC 3ZZUA 3ZGXA 2C9OA 3C5CA 4JYBA 1J8YF 5EJEA 4BFZA 1N6HA 2DR3A 2QU8A 1GNQA 1G8FA 3MSXA 5JRJA 2HV8A 4LJ9A 4DLVA 2IUSA 4DLRA 3AF0A 2CXXA 1E9DA 1E99A 3R8FA 3EG5A 3B9PA 3B85A 2PBRA 5B58C 4JI6C 1II9A 2AXPA 2QTVB 1M7HA 4GP7A 4PX9A 4C0BA 1TNDA 1KAOA 2HXSA 5AJVB 2A5YB 4AG5A 1ZM9A 1SZPA 3U3RA 1AQYA 3SR0A 5EE5B 4X64C 5G3ZA 4BASA 1FX0A 2NGRA 4GZMA 4DKXA 1G4UR 2B21A 2ONKA 3P32A 3RS4A 3CZQA 3FE2A 4E09A 2AFHE 5DHAA 1P2TA 3PUXA 1P60A 1U8ZA 2BM1A 1OT3A 2R9VA 3L0OA 1XEFA 3IHLA 1GKUB 1P61B 2HHHC 1WA5A 4L16A 4PPGA 3PXGA 1ZM3A 5HR5A 4P32A 4OJKA 4WZBE 1AGPA 2O5VA 2ZRGA 3NG1A 1NRJB 2ZS8A 5CLLA 5LDDC 3LY5A 3UXMA 1FFHA 1JR3D 5FTJA 3RANA 3O47A 4GI7A 4FMCF 1N6NA 5A2QD 3HPQA 4L8GA 2IYZA 1UADA 2ANBA 2IK8A 2W6IA 4DR6C 5DYGA 3N2EA 2UZ3A 4CYMA 4E22A 2YKGA 1FX0B 4U02A 1LVGA 1OHHA 5JWRA 3O8BA 3RDPA 4JLMA 5JI3E 1KI1A 2C5LA 1S96A 4AYTA 3V4RA 4Q1FA 3SDZA 3VFDA 4F4JA 4F38A 4JL5A 4PQFA 1WMSA 1P9RA 3BERA 1VTKA 4LC1A 1CR1A 5BXQC 2KSQA 3I07A 2ZAMA 4BFWA 2EWVA 4ZIRB 4BZQA 2BWJA 1XNRC 1HYQA 5E3HA 2AWOA 1USPA 3BFVA 4N0DA 4S35A 2MSEB 1SVSA 3LVQE 3ASYA 4NBSA 2QAGB 3NH6A 2WVJA 3MMPA 2O8DA 4BQSA 4WBSA 4UNSA 1ZCAA 2I1QA 3K09A 3CLVA 3TBKA 2ZRPA 3Q7QA 1NG9A 2CY1A 3C14C 3ZQJA 2GNOA 4I1UA 4DV5C 1DARA 2EGTA 2V3CC 2GESA 5KHOC 1R0XA 1Y3AA 5L3SB 4HAWA 1ZU4A 3U3MA 1W4AA 2A78A 3AF2A 3L0IB 2VH5R 3SQXA 4Q7KA 3DVLA 2V55B 5DE3A 2CK3D 4BFYA 2EW1A 2E9SA 1BMFD 2XSZD 3UG6A 3K70D 4ERNA 4PPQA 3CRW1 4P0TA 1XP8A 4WAUA 3KZ1E 1KSGA 4R71A 1Z63A 4OQMA 4YXWD 2O8BB 1Z0IA 2NTYC 4G1UC 4QGGA 1AS3A 4JIMA 2IL1A 4M8NE 2OCAA 2GXAA 1MKYA 2E1RA 3B8HA 3QQ5A 4KSCA 1DVRA 1NBMD 2FNAA 4IOKA 1HEIA 4M2LA 4C3ZA 1G16A 4BLTA 4MRPA 4TLCA 4NCIA 3GQBA 3AQ4A 5FH9A 4XOIA 2F9LA 3MCAA 3RS7A 5IK2A 4RKFA 1QHGA 3UMRA 1X3SA 4WW0A 2O8FA 3VHLB 3NEYA 3CF6R 2WSMA 4M21A 5FR1A 2LWIA 3LH5A 5C1BA 3B60A 4YMSA 1S8FA 2N46A 2OG2A 1RZ3A 5FL3A 4BLRA 4ACBA 4NHOA 2QMUA 1UBGA 1WP9A 4LY6A 4LYAA 2IUUA 1DE0A 5EZ6B 1LNZA 2NPIA 1H8HD 4BGDA 1AJEA 3J81D 1G5TA 4AK9A 1CJUC 4NMMA 2QP4A 3K70C 1NBME 5UKDA 2QT1A 1C4OA 2V8OA 1N3BA 2FPMA 4URZR 1VCIA 3RWMB 1CKEA 4JV5C 2ZIAA 1II0A 3U4QB 4B2IA 3AEZA 1G3RA 1G20E 3F0TA 3FTQA 4GOKA 3SJBA 2O8FB 3KUDA 2XNDA 2OE2A 4QJ3A 1PLJA 1QBKC 2AFIE 2GJ9A 4YLGA 4DCSA 1NMZA 1YZLA 3B78A 1NN3A 1ZM2A 4KSBA 4PC1A 2OZEA 2JJ1D 1VCNA 4B35A 1O3YA 4M9QA 1BOFA 2R65A 3WXMA 2BMFA 3TNFA 2P6UA 2P3SA 1FJGC 2XTMA 4C4PA 1TU3A 2D06A 1CULC 2GXQA 5JHGB 2JIZA 1HA3A 1RIFA 4GP6A 4IW3B 2CEAA 4RD0A 4TMWA 5FL7D 2EFEB 4MDFA 4LF5C 2QGNA 2NZJA 1RVDA 1BIFA 3DDCA 1NY6A 2IYXA 2XX3A 4PQRA 2B7BA 4UQOA 1PUJA 4DV3C 3L82B 3Q72A 1MABB 3TQCA 1A4RA 4GBMA 3VR2A 1Q21A 1U9IC 1AIPA 3FYHA 4KV9A 4OYHA 3FKSD 4UNRA 5JBQA 5L3QA 1TPZA 1E2EA 4ZI2A 5LMNC 4KITB 2WWXA 4H1VA 4R9UC 2A5DA 4TMKA 1W4BA 4M1MA 1EWRA 2FMXA 1TADA 4IVPA 3UMFA 4X66C 4LX0A 1AA9A 3BORA 3QXSA 2CHQA 4EAQA 2NO6A 5CIWA 1A1VA 4A1FA 1SXJA 1I4LD 3RS5A 2XZLA 1OH8A 2MSCB 1VG8A 4XVUA 4A8JB 2DFTA 3QE0A 4ZDKA 5J4LA 3C15C 1HV8A 1KI2A 1N5JA 2YC2C 2GK7A 2VQFC 3NVAA 2GDJA 3C41J 1YKSA 4WZAE 5DN6A 3R7WB 3UWOA 1UDWA 1E2MA 4DR4C 1NKSA 1XD2A 4B43A 2QSZA 1U0JA 5EE1A 3GFPA 1OKKD 2CVFA 4AKEA 1MABA 1Q20A 1VYVA 2QENA 3CRVA 3P26A 4JLBA 4LK2A 4QG7A 3SC3A 3TW8B 2OPLB 2DCUA 2F4VC 4D4KA 3AGQA 5FUVA 1ZM7A 3KKOA 4AY2A 1NG1A 2P5SA 2VSFA 3P1JA 4JMPA 2J0UA 4ZKEA 1SVLA 3U60B 1MO4A 1TL7C 4LBZA 2OXCA 4WA7A 2P5TB 4HLCA 1KK3A 4D26A 2LKDA 4KFSA 4ZDJA 5EUQB 4JLKA 2DBYA 3ND9A 2BJVA 3T12A 1A7JA 1RRPA 5G53C 3EPJA 1JECA 4F7WA 2EYUA 1KI6A 3GJXC 5CITA 4DV2C 1N6KA 5AR1A 4EFNA 1XCGB 2H17A 4NCJA 3THYA 1DG1G 2VP5A 2QZ4A 4FW9A 1RJ9A 2OCYC 2BIFA 1JEEA 2Z4SA 4JLDA 3KJHA 4D4JA 4M1OA 1ANKA 2ERYA 1F6BA 4HI0E 3R7WA 4US2R 2QA5A 1P2VA 2HLDA 1DPFA 3LDAA 4XVRA 4D4MA 4BLPA 2HCBA 1XMSA 3OE7D 1U98A 4LI0A 3L2OB 2Z4RA 3CRMA 2C04A 1P9NA 3MWLA 1V43A 5TXGA 3VMFA 4M1WA 4DEXA 2NQ2C 1MV5A 3U7HB 1Q3HA 2QEQA 2SHKA 3WYGA 4PTLA 3KFXA 1JPJA 4NYMR 4BLOA 1W36D 2XOKD 3FGNA 4BZPA 1R5BA 2B7CA 4OI0A 4DIEA 5A4JA 1XWIA 2ZVPX 2IF0A 3RRZA 2V9PA 4G5GA 3RVBA 4YY3C 1QF9A 2ASEA 2VSXA 3I8SA 4HAXA 1IOZA 4MKFA 2GRJA 5KNDA 2BBTA 1JJ7A 4V0OA 4LHXA 2JLYA 5KDDA 4YONB 1TF7A 3DZ8A 2GZHA 5SZIA 1OSNA 2G1KA 4MKHA 2KE5A 2NIPA 2WJYA 1E2FA 3CX8A 5DO9A 1GL6A 2HEIA 1FTNA 4KODA 4HUTA 2F1IA 3RHFA 3IILA 1XD9A 2CVHA 1QHSA 2Q3MA 2RKOA 2ZPTX 4PPFA 4O2RA 3FB4A 3SU8A 4BLSA 3GJ6A 1KI3A 1JAIA 2DWOA 4CEIB 4OKSA 2EFHB 3CNOA 2FV8A 3ASZA 3PIRA 2OSBA 3BGWA 1G8HA 2NO1A 3LD9A 3W3AA 2QAGA 4WXRA 2C2HA 5KDOA 1VG1A 3ZDQA 3PCRB 2J46A 4GOJA 1F5NA 2Z43A 3K9GA 2BEKA 4JI1C 4YDSA 5FUXA 1T5IA 3GLFE 1KMQA 1E6CA 4PO8A 5CB6A 4NXMC 1GP2A 1FNNA 1SVOA 3SN6A 1RYFA 2D74A 1MOZA 1GILA 1PZNA 1XU4A 3FVQA 3RC3A 4R2IA 5C46F 2HLDD 3EA0A 4CEIA 2G0NA 1HURA 2JDIA 1W0JA 1KO7A 4YDHB 4DSNA 5C18A 3W8NA 3EX7C 5L3VA 2PMKA 3OIYA 3LW8A 2FG5A 1ZNXA 2FFQA 1XXHA 3LVRE 1OYYA 1VECA 4LFAC 5TDHA 3JVVA 1OFIA 3V00A 1ELOA 2P6NA 2FSFA 3BS4A 3VR3A 4K0KC 1XF9A 4C9BA 2C78A 1GAJA 1US8B 4W5HA 5BWMA 5F98A 3SZRA 2C9CA 3PEYA 2ZI4A 4JLJA 3B1XA 2RGBA 1E2HA 3TQFA 4DJTA 1P4SA 2C9YA 2GBLA 3AKEA 1AK2A 1NVVR 1ZJ6A 1E2DA 2JLZA 2XR1A 4HUQB 1J8MF 1NI3A 4EPYA 2I1VB 1L4YA 4JL8A 5A5GA 2UXBC 3KFVA 4K81B 4LJ8A 4C0KA 5BN4A 1TQ4A 1OIXA 4LBYA 721PA 1NF3A 4U7DA 2ORIA 2ZUDA 5DH9A 4PXAA 2OBMA 3QY0A 2VHJA 2NO9A 4N3NA 1OXSC 3FMPB 5FOTA 2EFGA 2ODNA 1UKKA 2OILA 3IBGA 1ZMXA 2GJ8A 3QPUA 1F2UB 1OFUX 1Z6AA 2RGEA 3ZLJA 4DBLC 2IBMA 3MG9A 3MLEA 3LRPA 4JBYA 1F60A 4LSGA 4XIGS 5EXPA 4QKQA 1N2FA 1Z2AA 3WMGA 1EWQA 1OV4A 4TZ0A 3BOSA 2ZRMA 2YZ2A 2RB4A 5FPHA 3EPHA 3K1JA 1E0AA 2FH5B 3GLIE 2W6JA 2ZQ5A 3RS2A 1E98A 2P2LA 2FZLA 2ZITA 4XWAA 1I2MA 2IA5A 3NWJA 4F91B 5E95A 4BFTA 4ZI3A 2GJAA 2FPKA 5FOWA 1JI0A 5JJIA 4QHYA 4PHHA 3QXJA 2DFLA 4TL7A 3CR7A 3Q7PA 4HAUA 2GVZC 3H2YA 4P4UA 4IRUB 3KUCA 4IXNA 2AR7A 2H16A 3KJGA 3QXHA 5HCIA 3AP1A 3K0EA 3V9PA 1G5PA 4LJ4A 2E7GA 2PT7A 2RH5A 2ZRAA 1BMFA 2XSZA 1OFHA 1WQ1R 2AL7A 1UM8A 3AVUA 4OHWA 5AUQA 4CF7A 4KAXA 4B6FA 3T1OA 1RKBA 4QXAA 2ZYUX 4MGYR 2ZRDA 3IO5A 2OFOA 3AKDA 3WP1B 1XEXB 4QNMA 4A8JA 5JZVA 1RE0A 3B6EA 4JYAC 3AP2A 3LNCA 3LX5A 2A5GA 5JCPA 4KVAA 2XJ9A 3LV8A 1P6XA 2KWIA 2YV5A 4F93B 2AK2A 4H9GA 1ZNZA 4A0RA 3FHOA 5CJ2A 3K53A 4ON9A 4PZZA 1U0HC 3AF5A 1QG2A 4LV8B 2GEUA 4C2UA 2WWWA 3ICQB 2JA1A 4EFMA 1CR0A 1R0ZA 4R7ZA 5SZJA 3AVWA 4OX9C 4DSTA 5IDVA 2V7QD 2ODBA 3VNVA 5FLXD 4XD7D 3SHWA 4E07A 4URYR 3DEFA 2ZE8A 1UKZA 1OHHD 2W0SA 3EZFA 4NCNA 2VHUA 4I1OA 4IOJA 4EPRA 4I99A 1CTQA 1QVRA 1EESA 1U0LA 2YC4C 3CWZA 4TTRA 3TR5A 1CIPA 1AGRA 2OFWA 4BWYA 2X2EA 3ONWA 3D8BA 4AYXA 4EDHA 2WWFA 5CYPA 3D6TB 1T9HA 2HYIC 4EQ6A 3C16C 1E1RD 1NVUQ 2JJ8A 2XNDD 4LJ5A 2IT1A 2FU5C 4UXHA 2CCJA 4PHFA 3HPRA 2C77A 2QTFA 5FTKA 2ECKA 3VU9A 1QHHA 2CCGA 1HNXC 4HZUA 3OEHA 2BKUA 4TL8A 5JWOA 1FMLA 2YYZA 4TTQA 4EPWA 1VKJA 1NSTA 1U8YA 2QPOA 3BB4A 5IT9D 3EARA 3KQUA 1UEJA 1G17A 3Q85A 1ESNA 4LV6A 4M1TA 1MO5A 5FL7A 1G3IA 3UATA 3W6OA 3CPJB 4JKIA 2AD5A 2UUCC 1XDBA 2K5UA 4MKIA 5FI0B 4Q1AA 2CE2X 1Q12A 4IOMA 4NYJR 1HH4A 4W9MC 1D2MA 2H92A 1KI8A 3BK7A 2YNMA 1K0RA 1LV7A 1SVIA 1GSIA 3TJZA 1L2TA 1SKQA 1W49A 5HPYB 1OH7A 5TVKA 4JT4A 5JJKA 3QKUA 1D9XA 1HTWA 1XB2A 1X1RA 4TMTA 2R44A 2BJWA 5DSZA 5JHHB 2YHSA 2KBFA 3GJ4A 3EWAA 4US1R 2A2ZA 2Y8EA 3T15A 4A6PA 4YMTA 4CEHA 4JLVA 1DTSA 2JAQA 4YC7A 1PA4A 2R62A 1HQYE 1XFAA 1XJCA 2O8CA 3FPAA 3GLFA 3CRQA 3K8YA 2YOGA 3M0EA 3QUSA 4HSEA 3ZJYA 2ZYVX 4TSFD 2IYWA 2ZSEA 1R8SA 3RRMA 4NDZA 1E2QA 4OI1A 1TUIA 4CEJA 2F9MA 4Z1MD 4PC6A 3U6BA 3B9QA 1KAGA 3CRRA 4IDHA 4DZZA 1YE8A 1RW4A 1AKEA 3SI7A 2JGNA 5TARA 4LC0A 4D82A 1XMOC 4LGMA 2V6IA 2BKEA 521PA 3WP0A 1DAKA 3L43A 2O0HA 3ZZ0A 2DFNA 1CLUA 2ASBA 1FMJA 1KJWA 3Q8XB 3KX2A 1YR8A 5P21A 4A0FA 3AF6A 4OHYA 1A5TA 1W46A 5JMTA 4XTCS 2PMDA 2QPTA 2QROA 3CZPA 3PG5A 1KO5A 4RD3A 3HU3A 3QSYA 3J80D 1XJ0A 3TGPA 1ZRHA 2QBYA 2FEOA 4I81A 3BRWD 1KSFX 4TL6A 1CJMA 1R8QA 4HAYA 4NYIQ 3CJEA 2D62A 1G41A 1E4YA 3RSOA 3W5JA 4ASUD 4DV1C 1P7CA 4EFLA 2W6ID 3PEUA 2WIBA 4D0NA 2WTUA 1KGDA 3Q5EA 4FWIB 4DRZA 4LF4C 5LB2A 1UFQA 3G5UA 5F2EA 4UXIA 2X8AA 1EX7A 1G7SA 1H8EA 4GRAA 4DVGA 2ZROA 4A0GA 3W6NA 2CHVA 4B48A 3EZ2A 1KDTA 2WJIA 2WKPA 5FI1B 3WNDA 2ZE6A 3SEAA 3TUJC 2JATA 2YINC 3CPHA 4DUZC 2QY9A 2XJ4A 4R2HA 1W0KD 2D2EA 1O87A 1NLFA 3VU9B 4IEEA 3VAAA 2ZEJA 2QTHA 1KK2A 1QG4A 1TU4A 2OT3B 3KXIA 4X8MA 4XSHA 4A6XA 1NJFA 3KB2A 2J7PD 1KI9A 2OBNA 2ZRBA 3AM1A 1D9ZA 1N5IA 2WMOB 3A1TA 1K6MA 3F3YA 2GBLC 2ONFA 2VF8A 2F43A 1HUQA 3SYLA 5J4HA 4JBWA 4Q02A 4B47A 1U8AA 1E9SA 1KNQA 2WWHA 1YZGA 4AKHA 5FTLA 4FCTA 4PSKA 3GLFB 5AWFC 3AKCA 3SE0A 2WWYA 4QGHA 2GF0A 221PA 1PLKA 4DUGA 5IK2D 2IWHA 4Q9IA 3SS8A 4Q66C 4XJXA 5KSZA 1GITA 3OFND 2DYJA 3LFUA 5FBVB 5KO2A 1LFDB 1GTVA 3THWA 2A30A 3ZVMA 2O8BA 2IYYA 4ZPXA 1IN6A 2P0EA 4MRVA 1R0YA 1TTTA 4BSZA 1DG3A 2ZRJA 2A5FA 4ARZA 1RJ9B 1S9HA 2VHTA 2IW3A 1Z0DA 3QXXA 2Z0MA 3PR1A 1ONBA 2TMKA 3MGCA 5C4GB 1KDRA 3UMSA 1XNQC 4CVNA 2ZR7A 2E8CA 3BB3A 2QM7A 3VX4A 3LXXA 1P5ZB 2QE7A 2YOHA 2G6BA 2XAUA 5CDFE 1Z08A 2IF2A 3SNHA 3B1ZA 3P4YA 4NKRA 2REXB 2ZANA 2ZI5A 1UBCA 4BZXA 4IXMA 3EPLA 3SHFA 3TUIC 4EJSC 5C2JB 4V0NA 2PT7G 1D2NA 1NJGA 1NIJA 2W83A 4HAVA 4WVFA 5FPTA 2JLXA 2CHGA 3W6PA 1YR7A 5DNYB 5B30A 4MDEA 1DS6A 3QEOA 3A36A 3QVVA 4FINA 4DB2A 3K0AA 3GFOA 2IX3A 3A4MA 1WDTA 1XTSA 3THOA 1JPNA 3HDTA 2WSSD 1JOSA 4AIIA 4XD7A 3I4LA 4FMCB 4JL6A 1YRAA 1CRPA 1EX6A 2F1HA 4QL3A 1F2TA 1G8PA 4C0QC 3ZZTA 3E70C 2NMVA 1VHTA 3ADKA 4DB4A 2V1UA 3ZVLA 2ZI7A 3AGPA 4HUQA 3VR1A 3ZS8A 1MR3F 4M1SA 3AF3A 4MYCA 1NMYA 2FF7A 2V54A 3X1XA 4C0SA 1TEXA 3QKTA 3U44B 1FTSA 4PC2A 1N36C 1CP2A 1AKYA 2QP3A 3TAUA 5KNCA 3JZAA 3QVUA 2J7KA 4KFUA 4TQ9A 4Q4LA 5F9FA 1NN5A 5FOXA 2WICA 2RAPA 3E5HA 2J45A 3GJ7A 2X2FA 1S1MA 4ZCMA 1H8ED 5AK0A 4ESVA 2JJ2D 3SYNA 4AI6A 1J70A 4RZ2A 2VO1A 2F6RA 4D81A 3NDPA 1TAGA 4RD4A 4PZLA 4Q1BA 4G5OA 2GCOB 1XJQA 4M4SA 3K0CC 1SULA 5B64A 2ZJZA 4G5QA 4GMXA 4ASUA 4MRRA 1KO4A 3TKLA 1G8YA 4TLDA 1IBLC 3R9XA 1V5WA 5FPSA 5B2ZA 2PX3A 4ZCIA 1UKVY 4JSYA 2IHYA 5J5CA 5D3MA 1GIAA 1OXTA 1F48A 2W0MA 4RZ3A 3B1WA 4BPBA 3C4JA 1F2TB 1ZYUA 4TL9A 4BUJA 1J5EC 2PT5A 4M9SA 2DPXA 3MUFA 3AV0B 3FWYA 4G5SA 2W6JD 4Q9LA 2JLQA 1G7CA 1US8A 1XMIA 4M22A 3AF4A 3CKLA 1IXZA 1E32A 1LY1A 2BVNA 4C0JA 1ZAKA 3DOFA 3KJIA 2D3WA 1Z22A 1KZGB 5CYOA 2WKQA 2HUPA 3H0KA 1OH5A 5JEDA 4B73A 5M04A 5LB4A 2NZ8A 2IXFA 2FFBA 4A15A 2JIZD 2ZU6A 2PJZA 3NTUA 5BQ5A 1E79A 3T5DA 3PV0A 3AVTA 3TVTA 1GNRA 2ZYTX 2ZJAA 4IDNA 1AQUA 1E2IA 3VHXA 2RGGA 2WWIA 3TSZA 2HYDA 1KJYA 3OZXA 1S0UA 1UKEA 1VYUA 2BMDA 4LYFA 3U6KA 3GLGB 2PLFA 4Q9KA 2Q3FA 2BCGY 2QG6A 5KPJA 2FA9A 3DZDA 4EKDA 5FUYA 3EIHA 3TH5A 2ODWA 3EIQA 3ADCA 1I94C 4O2LA 2C03A 3Q9LA 4TWZA 1KKGA 1J2JA 1MRSA 1NP6A 4C30A 5EXXA 3NXSA 1KHTA 4D2IA 5LPNA 4D0LB 1YVDA 3SJZA 2GCPA 4DR7C 3BJIC 3OHMA 2P67A 5EUMA 4AWXA 2FE4A 4NONA 4O0MA 5EP2A 4Q5IA 3GCGA 1R10A 2HXYA 3I73A 4QOSA 4DDVA 4IOLA 1GL9B 4IEIA 1T4GA 3K0CA 4NCKA 5GVRA 3OIVA 2XTZA 1QWIA 1LQLA 3C7KA 4DCNA 3WRXC 3AH8A 2OAP1 4HDCA 4MGZR 5KNBA 2XZOA 1N6OA 1N34C 3NEJA 1GNPA 5KU1A 3DPUA 3EPKA 1N0UA 3IIMA 4Q21A 1M34E 2GZDA 1HR0C 1E69A 1L7VC 1T3LA 3HJNA 1YZKA 5EP4A 1TMKA 2PZFA 4OQNA 1ML8A 1LB1B 1X1SA 1Q1EA 1IHUA 2WIAA 4JT2A 4B2LA 621PA 3FFAA 5L3SA 4DLWA 1W5SA 2ORVA 2VQSA 1CS4C 2ZE7A 4NZYA 3JAMD 4QFMA 4CT4B 1KMHA 1AS2A 5DYIA 4TN1A 2GXSA 3LA6A 1LF5A 3VR4A 2QN6A 3ZQ6A 2O8CB 3QF4B 3H4MA 4JVNA 4CRWB 1N5KA 2V1XA 3VKWA 5KUTA 1AZSC 3H84A 2IEZA 4JI2C 1W0JD 4MH0R 2JLSA 4Z8YA 3S1AB 2BJOA 4RD1A 4M1KA 3B82A 2CBZA 2Q9BA 2ZXUA 1T0HB 4CIDA 1DAFA 1GKYA 2O8EB 1KKLA 5DI3B 2AD1A 1QVAA 2VQEC 1KI7A 2RHMA 1GVNB 4JLAA 3U7EB 3WY9A 1IJFA 3T5GA 4GMDA 2IYQA 4PC3A 2VF7A 5SZHB 3DM9B 4B3RC 3EA5A 2I3BA 5ANRB 3MWYW 3AUXA 1P2UA 1BYUA 4L15A 4NE2A 4M53A 4J0QA 5JWHA 2GILA 1K5DA 3CR8A 1XZQA 2ONJA 4ZIRA 5GJVC 5GJCA 4CDGA 3A8TA 3AB3A 1G3QA 1I4DD 2GEDA 2YWEA 1RRCA 3B1YA 2A3RA 3AVXA 2CL7X 1T3SA 3UANA 4D0GA 1R2QA 1N6RA 4MUBA 4AYWA 4IDOA 4DT1A 2DWQA 1KY3A 2C96A 1T3HA 4C0LA 2QT0A 3EZ9A 3GEIA 3CNLA 3NKVA 3AVOA 3QF4A 1E2GA 2H57A 4QJ5A 4B32A 1IAQA 4L9WA 2ZI6A 4Q9HA 5TY0A 4NU0A 4WZ6A 1S3GA 2G3YA 4QBIA 3VR6A 2F7SA 1KDOA 2CL0X 3FDIA 4TLEA 4BLQA 3RLFA 5DISB 4E5UA 4Q47A 2GVDC 1SXJE 2ATXA 2R6CA 3OEEA 3QENA 2C8VA 4TQAA 1WBBA 4B3CA 3U61B 5EE9A 4U5XA 1KOFA 2G9NA 2PEYA 5JFGA 5HZHA 1WH9A 4I1SA 5HE9A 1YU9A 4KCGA 2OUKA 3EZ6A 4BECA 2J5XA 4PAMA 4Z54A 1E79D 2W2XA 2HJVA 1XPOA 1W36B 2WJGA 4ABYA 4AKGA 2KBEA 3AVPA 2ANCA 3PUWA 2J9RA 3CX7A 4HDOB 1B23P 3UPUA 1YJ5A 1E3MA 2CNWA 2ZR9A 4YHHC 3U5ZB 3UKDA 4AKIA 2IEYA 4FXPA 3WYAA 1XCPA 3OE7A 2XEXA 2RGNC 1XZPA 2IXEA 1E96A 1N6LA 2OV2A 2ZYWX 1P2SA 4L9SA 2UU9C 5J4VA 3Q3JB 3ZS9A 1UDXA 3AVQA 1HQCA 4ZO4A 5EP1A 4DLZA 4XVQA 4AC9A 4HYYA 1N2CE 1ZIPA 1G19A 3EC1A 2QI9C 2ZJ5A 1KDPA 4ITRC 5D3QA 3RYTC 4B75A 3FFBA 3MD0A 4DLUA 5KSYA 4TYWA 2CXCA 1ZP6A 4RSGA 3OAAD 3Q5DA 3I5XA 2N42A 4LHWA 1W2HA 2EQBA 4Q1DA 3HYTA 5TB5A 4NL4H 4V0ME 5FFMA 1G291 4JVLA 421PA 1EK0A 3PEVA 4POAA 5BW8A 1FPMA 2GKSA 1E9CA 4LUCA 1Q1BA 2V6JA 1K5GA 4S2EA 4A2QA 3DKVA 4G01B 4GOXA 3VKGA 4OJQA 2QAGC 4MGIR 4PPNA 2ZJBA 4XH9B 3QBTA 2ZJOA 1IJEA 3IQWA 4B3BA 1G4AE 5AUOB 4OK5A 4NYIR 2J0SA 1IBKC 5D3MB 4Q4JB 2XXAA 2V7QA 5HKKA 1CBUA 1U90A 1IY2A 1TX4B 2ZS9A 3RS0A 3V4FA 4B74A 3WBJA 4EPTA 2H5EA 4N0EA 4RD2A 3IIKA 4PQYA 3CONA 1EFRD 3CNNA 2F43B 1E2PA 2FFHA 4PAOA 4LZZA 2W2TA 1P73A 1ZNYA 1HH2P 3BFXA 2CL6X 4LPSA 4DWJA 3VTKA 4NPHA 1IY1A 2GJKA 1EGAA 1USPB 3SBDA 1ZM4A 3PVSA 1KIMA 3BAFA 4H1UA 5AUPB 5JS7A 2VPPA 3HR8A 3O8CA 1ZVQA 2QMEA 1D6JA 1S4QA 1G6OA 1VCMA 3VR5A 1VPLA 1ZD1A 2GETA 2QRZA 1E2LA 2YWHA 2RGNA 1DAIA 4RCYA 4Y0VA 4RVCA 1SKYB 4PZYA 5AJXA 1IY0A 4RFSB 1QRAA 3RC8A 4HB0A 3GD7A 4V02A 3WNBA 2HDNB 2VEDA 2WPDD 4HLUA 4B3MC 1DEKA 1XD2B 3MWKA 1HE8B 3QF7A 1KK1A 3SFZA 1C1YA 1TF5A 1Z0FA 1CJVC 1E0JA 4XWOA 2RGCA 3SYKA 2JJ1A 1EFRA 1G3UA 1P3JA 3W5IA 1KO8A 5CK5A 2DB3A 3IEVA 2QNRA 4P4SA 5H1YA 1WBDA 1NLYA 5FOSA 1CR2A 1P9WA 1WRBA 1E2NA 1LF0A 2RCNA 1VDZA 1D5CA 4NTZA 1Z6XA 4N1AA 1YZUA 1OPXA 2FWRA 3EIEA 4P4TA 3HU1A 5IRCD 1HT2E 1E9AA 2ZAOA 4EPVA 2E8FA 2ZRHA 4DXAA 5TMPA 3LAWA 3DO6A 4KYUA 3K0SA 3OTOC 3NC0C 1T0JB 1KMHB 5BYKA 1Z6TA 1Z3IX 4Q1CA 2ZJYA 1VCOA 2BC9A 4NH0A 1CU1A 2FX3A 4CGZA 2BOVA 4Z8XA 2F3RA 1XPRA 3BH7A 4WXPA 1SXJB 2IYVA 3TVDA 2NO0A 2ZETA 4U00A 3X1WA 2VP2A 3PUYA 3K70B 3HR7A 3WHKA 3IBYA 2GAOA 3JZMA 4CT5A 1UJ2A 3U2QA 1E94E 4QC2A 2HT1A 2H1LA 2VRWA 2JLUA 2VP4A 4LJ6A 4OQXA 4LJAA 3RRNA 5BR8C 2REBA 4V0KA 1JR3A 2CLCX 3ZVRA 1UEIA 2BMJA 2QMOA 2ZREA 3X2SA 3OF5A 3FKQA 1NNEA 2JCSA 1FUUA 3EWSA 1M74A 2UVQA 1BYIA 3RAPR 2QPAA 4A0HA 3U4QA 1NIPA 5KPDA 1ZCBA 1XX6A 2H18A 1QHYA 1U99A 1KO1A 1IXSB 1VG0B 2MMGA 1KI4A 1QHHB 2ATVA 2GZAA 2DY1A 3FHCB 821PA 3GLIA 3I61A 4A92A 1ZIOA 3CWQA 4RKEA 4A36A 4B3SC 4L5BA 4DHEA 4UNPA 3WYFA 4A2WA 2G88A 5CJPA 4MTNA 3R9IA 2UUBC 2Q21A 1GG2A 2R6DA 3L0PA 3LBNA 4K8OA 3ICEA 5EE0A 2BBOA 1UBEA 2ZSDA 3CX6A 3T1VA 2OLKA 1UPTA 2JJ2A 3TW4A 4BRUA 3ZYCA 3QKRA 4DR5C 4FIDA 2ZRKA 3A4LA 2H8KA 2E5LC 4E03A 3C5HA 2B8WA 1K8RA 1IXRC 3IDQA 3I1FA 4V0LA 1VLAA 4B2PA 3L0SA 1D2EA 4PSAA 4DUGD 8OHMA 2ZRIA 4IKEA 5DGXA 3K09C 1DOAA 2B92A 2HT6A 4XTRA 3LX8A 3VQTA 4XWKA 1S3SA 4ZDWA 3W3ZB 1LS1A 4LF9C 3CBQA 4QBGB 2OXRA 4JKYA 2ERXA 1L2FA 3I5YA 2ZRLA 5JRZA 1SVKA 5KTYA 2VP9A 1JB1A 1ZNWA 1PUIA 3PUVA 4URVR 3DMNA 1OXXK 4LF7C 4IHQA 4PFSA 3TSWA 3KKQA 3QIAA 1N33C 2EFDB 1IN8A 1RRGA 3OIUA 3TUZC 3CH4B 1E1RA 1SVMA 3NBYC 1M7GA 1COWA 3QXCA 1ODFA 2AN9A 3I32A 5G3YA 5FOUA 5DIFA 5A0FA 4NYMQ 1DO0A 3UK6A 1X8KA 4NP6A 5HTKA 1W48A 2R6FA 2VIIA 1XEWX 1XEWY 1A2BA 2GCOA 3KTAB 3R20A 4OHZA 4Q19A 2CLDX 3U3KA 3OESA 3WMEA 2ZI3A 1YZNA 4HEJA 4KYIB 2DFKB 1E0SA 4TMVA 1OYWA 4JJKA 3A1SA 4UNQA 4M9XA 5L3RA 1DO2A 1ZUHA 5KSPA 1FP6A 3RS3A 4V03A 1JALA 2ATWA 1N6IA 2QQEA 5IT5A 3C8UA 2WAXA 1KJZA 5FOVA 4BRWA 4MYUA 5F3WB 2X77A 4DUYC 1P62B 4JSTA 2O0KA 3OIWA 3X1ZA 3CW2A 4MRNA 1KYIA 4X62C 3T1HC 3VX3A 1M7BA 2R8RA 4D25A 4Q03A 1GRRA 3G0HA 3FMFA 3K0AB 4CZ2A 2PX0A 3WBKA 1GOTA 3OAAA 2N1BA 2O52A 4B3FX 2D2FA 2VTKA 2EFCB 1ZW6A 4JVSB 1W4RA 2F1RA 3W8RA 3KXLA 4W5JA 4JYCA 4BFVA 4ZDIA 4D4LA 2Z83A 2G77B 4YMUA 4K46A 3MRSA 4MQBA 1T5LA 1MO3A
chains in the Genus database with same CATH superfamily
2J3MA 3WDMA 4EK9A 4HB3A 1QJ4A 1SKYE 3LNTA 1THZA 5DLDA 4Q9JA 3ZW7A 3AU8A 2CD7A 2WDPA 3M9LA 3N8KA 4LJKA 4UQPA 4D79A 1K89A 4XLZA 1KNXA 1WV0A 4CT0A 2P30A 3RYHB 1W35A 5T3UA 1XKLA 3P9PA 2IGTA 2F00A 1WF3A 1PFQA 2HB6A 2HPAA 3EF3A 1W25A 4Q4JA 4ZV9A 2P27A 4DIDA 1ADYA 1P74A 4TTJA 4BYGA 5BPHA 2VAWA 3F6CA 1Y4UA 1XNGA 4TQUS 2FETA 4HRVA 5IAKA 2C29D 2J4DA 5I9MA 3UWKA 4QOJA 4KUHA 4BGVA 3A26A 3RS8A 3N7AA 3UJ6A 2QYOA 4KIWA 3ZH9B 4C03A 1O94C 4J9UE 5KDLA 1CXZA 1DKRA 3EDQA 2QKYA 3IMEA 1V1MA 4OHXA 4JH0A 4CF6A 3GLHB 4CL3A 5ALDA 4OU4A 5CA0B 3OUUA 1SELA 3LQQA 2UXDC 4DLYA 4I8DA 3TG2A 2MJLA 1QHIA 3ONEA 4URWR 5E9AA 3R6TA 1X86B 3EZYA 4QU0A 1H9CA 1Z6GA 1RYHA 4EMBA 3RSLA 5BSKA 3FBGA 1FLNA 2TECE 5A19A 3K5WA 3QUBA 3FZNA 4MHOA 4YVFA 2GZ3A 3ENWA 5DYTA 3NP7A 1YZQA 3LO5A 3SIPA 5DV9A 4EVQA 4FFMA 1XMVA 3C6BA 3U7FB 3EIOA 3NBQA 1RI3A 1V60A 4CUZA 1Z33A 1U7XA 2VHYA 2WYWA 5FFNA 1YK0A 3ADDA 2JA2A 3GLIB 2ZGVA 4PZEA 2AFRA 1WD7A 1S3IA 1MGOA 2O3TA 1XDUA 2OQ2A 4YP0A 5H70A 3AP3A 1CDEA 2DTXA 4XWWA 4RZUA 2FZKA 1Q7GA 1GDDA 5D7NA 2Q8NA 3L9WA 4BMNA 3O9VA 5DN6D 4BKPA 5K99A 1XK7A 3T95A 4G3XA 3DPSA 5CCDA 2IP2A 3O75A 1SUBA 4IQ8A 2KZFA 3L4BA 5F9HA 2VYFA 3CF2A 3V8EA 5A4IS 3ROTA 1YL7A 3FLAA 1C0IA 1CYDA 4JB8A 1I3CA 5ECDA 4DR3C 3SOZA 3BTVA 3IE0A 1COWD 3WNZA 1PD1A 3AILA 3CVWA 2VDKB 4HATA 4EQZA 3IKJA 1NTOA 2Y93A 2Z3WA 3ZNPA 4JXJA 5C80A 1S2OA 1M5UA 4G37A 4IFEA 2A9KA 3KOOA 3GGOA 4WL0A 3CVYA 4JYAB 1V11A 3GUUA 3ZIAA 4BAUA 1CB0A 1M1XB 2P79A 2VLIA 3LC2O 2ZRCA 2XWSA 3F98A 4MYHA 4YI5A 5E0OA 4WSOA 2OORA 3T4UA 1II8A 3T1TA 1C80A 3JD3A 3IE1A 3HWRA 1MPXA 4X94A 5KOYA 1L5HB 1L3CA 3K0BA 2IYEA 5FNVF 1NVAA 2HFKA 4ZOAA 2EGHA 4ESHA 1CLEA 1KRWA 3PQCA 3OTGA 4R8SA 1LWOA 1ONPA 3D6HA 3RH0A 3TIFA 1O90A 1UJ4A 3GP8A 1K92A 4HLDA 5LA6F 5DLQC 1E6KA 1ZD9A 4GL4A 1J90A 2QW1A 1LJUA 2NSHA 2Q8QA 2ACVA 1S2IA 1PIWA 3BMOA 3LW7A 3IQXA 3OOHA 4XQCA 3WGUA 4QGAA 3J80A 2Y1KA 3FMOB 3JAKB 4WKBA 4Z7QB 2ODEA 3ZQKA 1DKMA 4EX6A 2GA8A 1PD0A 3MF4A 3R7NA 1TMOA 2IFTA 3LBHA 2B8NA 3TRFA 5AIBA 4H1TA 5J40A 3EGIA 1FPQA 4PG5A 4QTZA 4ALMA 5CIYA 4A2PA 4ZVKA 3TLJA 4OHFA 4LRUA 3GFSA 3WO0A 4FGZA 4FDAA 3H6HA 2JF0A 4FDMA 3TZEA 1B74A 4WVLA 1QGDA 5I9TA 4QT4A 3A6HA 1VL0A 1JYEA 4IILA 1BU8A 1LKZA 2WM3A 2XQVA 4NNJA 3S55A 3LUSA 3DE3X 4UBJA 4F97A 1W76A 4ZYTA 5GZ1A 1RMTA 3MJRA 3I6QA 1Q0TA 2X19A 3NUZA 4Q4AA 3VR6H 4EMUA 5B36A 1QDEA 1IMJA 4BNGA 4B6EA 3UK0A 3QBVA 1V26A 2WVAA 4YA6A 4DGSA 3DBHB 2G4LA 1R0CA 2G82A 4X1YA 5HM8A 4L57A 4PF1A 5LA6A 3SWWA 4DHWA 1O94A 1PU2A 5DYWA 4DV7C 3UC5A 5FBRB 4UPVA 3T3GA 2CZCA 4L0QA 3QUAA 3BF7A 3SZLA 4DMGA 1XNJA 2GUGA 3IHTA 1QANA 2NPFA 1W75A 2H7VA 1GCIA 2GLTA 4X9XA 1YHNA 4DEYA 1R6BX 2P6RA 1C7RA 5CIQA 1GTSA 4EH1A 1D2AA 2H65A 1Y5RA 2A3NA 3VPDA 1W47A 1NXVA 2ORWA 3FPHA 1MORA 2PPVA 4GKJC 4RKWA 4FYIA 3OM0A 2EKQA 4R1TA 1H9BA 1G8JA 1ZN9A 3AUYA 1RM0A 4TXHA 3M6UA 1XHEA 3SO4A 1W0KA 4M49A 2HF8A 2C9BA 2QRNA 1UXIA 1DAPA 1J99A 2CCKA 3G2NA 1XZCA 4JVMA 5ICEA 2HHAA 1K68A 3L84A 4IZOA 4AJKA 2IHTA 4FZVA 1KBOA 2PUHA 4D98A 2XMQA 2YOFA 2Q0SA 5DHFA 4AIRA 3T9FA 4CLXA 5BN5B 2JG3A 4TZ6A 1KXZA 2GK6A 4B3TC 2XVMA 2JPDA 3HUFA 4DLKA 1H4SA 1KR2A 1F9AA 4Z7OB 1YIAA 1SOMA 2B98A 1UFVA 4QELA 1FDUA 4LYHA 1HE4A 1L5FA 2DWPA 4YAOA 4LV5B 1U2DA 3T1QA 1HMPA 4O4IF 5T64A 2B7LA 2ZUFA 1XBTA 3BICA 1ADGA 3LLUA 4KXNA 4C7XA 1Q1ZA 2F8MA 2ISQA 3QWIA 1PFUA 4OHUA 4S1WA 1NQAO 2B83A 1XDWA 1VIAA 5IJAA 1W93A 2VN8A 4NOZA 4RK4A 1KSHA 1P7PA 5EJ9A 3V7NA 1CJCA 4FCVA 1GCGA 3U0VA 2BUCA 3TUFA 2WLTA 1E7YA 5HGJA 4H6WA 3C6XA 4X20A 1P39A 3GYBA 1EFTA 2FWIA 4MPRA 3LP6A 4D6YA 3HVKA 2BSQA 1CR4A 4D97A 2W2NA 2XB4A 1AKVA 5ALKA 1NV8A 5AD1A 1L5YA 3BRQA 4YRCA 4AG6A 3C6MA 1G64A 1WLSA 4FQ5A 1SC9A 3IAM6 3QKSB 5B7QA 2BHRA 1RRKA 2FN9A 2VOEA 5KC8A 3O8QB 4P33A 1U6IA 1KKMA 1K4YA 4Q7LA 2VR1A 1UBLS 1UMDA 3MQ4A 3M6IA 3TINA 2D1SA 3W7AA 1NM5A 4EGSA 1B3RA 1F0NA 2G4CA 3FI0A 1EH5A 4CDNA 2G1PA 4V39A 3DTYA 4OI4A 4Z4EA 1J2EA 2WA2A 3OIDA 5C7OO 1C3OA 1G5RA 2CHFA 1G7TA 4W5WA 5AUNB 1VE9A 3L6DA 3FN4A 1AV7A 3JQ9C 3CLSC 3QWHA 3IV6A 3JQ9A 2WR8A 4JQZA 4QYTA 3W3AD 4NY1A 1MT0A 5A7GA 2ZWOA 3ZHYA 4K28A 3F46A 2FZ4A 3HN2A 5L4LA 5G4LA 2DXIA 4D02A 1PTJA 4HZUB 1OLOA 4J7AA 4YJ3A 1OXVA 3WHLA 4F7DA 1YRYE 2O8DB 2FLWA 2LD4A 4CNBA 3E22B 4LXXA 1DAEA 4GL2A 1W94A 2IXBA 4XDYA 5CCXA 2GF9A 2HRZA 3DQPA 3KKMA 4DOMA 1I01A 5SY4A 3HP4A 2RBGA 5AK5A 2PM8A 5BUZA 1ZX1A 2M6KA 3UT5B 2B1QA 1NDHA 1YA4A 2DECA 2FI1A 1R5NA 3KVOA 4U2BA 4D9FA 3ZVNA 3UUGA 4B3GA 3PEWA 3P4XA 3AVVA 1DG9A 1Y63A 2J0VA 3DGEC 5DF1A 2PL5A 1DAGA 1GNVA 1KA9H 2C2KA 3WI7A 5LMZA 5BW6B 4IXDA 3WHPA 3FFTA 5FBQB 3KTAA 5LBIA 4P5DA 1CRQA 3T0FA 4DB2A 4TRRA 1YGPA 1Q2UA 3OLZA 2WSYB 3AVYA 1AS0A 1VZ2A 5KNCD 2CKMA 1BHQ1 5G4KB 4BTLA 4W5NA 4JGBA 2BP7A 3V33A 4NNOA 2VWPA 3NGMA 1C3JA 4C0WA 2OQRA 3EW9A 1PNRA 2AC2A 2XEDA 1XZEA 4K9RA 1E9FA 3PPIA 4QYMA 1F7UA 4KBYA 3DL0A 3SX2A 4UASA 4BBPA 5G40A 2Z6VA 2WWVD 1G8GA 4N8DA 4EBFA 5DGIA 2IHVA 5AJZA 4ALKA 5KVCA 3H0CA 3LPCA 2NM0A 4EHJA 4GGPA 2C7QA 2I4IA 2ZB7A 2ZSBA 3N2IA 4J2OA 4P4SB 4Q82A 5C51B 5CA0A 4F06A 4TQGA 1QIGA 2RGXA 1MXHA 3KV3O 3DL2A 2QUIA 4G0QA 1H05A 2QOEA 2VP0A 4BO9A 1SNYA 1GRNA 3MBIA 3VSDA 4AF6A 2OXTA 3DQZA 3T8YA 1BQEA 2OLJA 3R9WA 2CNWD 1D2GA 3K5HA 2XOKA 4TV8F 5A4MS 1XRJA 4QM6A 3G9ZA 1U2GC 2AE2A 2PMCA 3GZJA 4OM8A 4BX8A 3PJFA 3FR8A 3MFYA 1Q44A 3NHYA 2PL3A 1BO6A 4BV2A 1R9GA 3GXBA 4L4XA 4WCFA 3JV7A 4RACA 1O95A 2YCBA 3TW6A 4WLNA 2BEJA 3KBBA 3RYHA 3FOEC 3QE9Y 1DSSG 2QR3A 3D4PA 3M70A 5CT5A 5CVTA 5EIBD 1X6VA 2IY7A 5EEHA 1A71A 2B1IA 2I4MA 3JYNA 4MIEA 1OGIA 1GM5A 4FN5A 2J41A 3ECAA 4RGQA 5A0VA 4EG3A 3EERA 3TPZA 1XIVA 2ZFUA 2ZXFA 4O4JF 4R8RA 1AN0A 4C7BA 3K1AB 5KNDH 3HCBA 2B20A 2YVUA 3HKEA 4NEQA 1F3OA 4HDQB 4LFCC 1DCKA 1YVUA 4N18A 4ZRNA 4U6NA 3KXWA 2F55A 2BFMA 3NBFA 7ADHA 4YWHA 1UDCA 1YNSA 4HBZA 1YCHA 5FT9A 2NYAA 3CUSA 3ICVA 3IUNA 3K9LA 4ZCPA 1QYIA 2D7CA 3IAS6 3M6LA 3TFWA 3JD4A 3UPDA 4D9HA 2CE7A 4Z9XA 4HLUC 3RVJA 4D1YA 1TEVA 1NBMA 4ZK2A 3QEMB 1SCNE 1Z4MA 2P6MA 3KKNA 4QUGA 5ITWA 1T5SA 1OBFO 4WOPA 4YCSA 2B8TA 2VHWA 2J67A 2O20A 3ECCA 4JJ7A 1IIRA 2O2IA 3OM1A 2D5AA 3DUFA 4XIFA 2VCEA 1JJVA 4EUHA 2VQEB 1GWNA 5C1PA 4U7FA 1FA9A 4YALA 4D80A 3DULA 4HN9A 1BC5A 1TB4A 4GNKA 2GCGA 1EB8A 4BC7A 3QPDA 4ZO7A 4UMEA 4DNFA 3IEUA 5M7EA 1EVJA 4UOQA 2PMEA 1ISFA 1D7OA 1XXHB 4W82A 4C5CA 3AL3A 1C4XA 4FFWA 1FUYB 3LQRA 1UMBB 3O84A 4GBGA 5HRCA 1NP7A 5AI8A 3QZUA 4CU5A 1XPUA 1KZ9A 4FYHA 1YOVA 1NW5A 2H4ZA 2KB0A 2C82A 2XNSA 1ZI9A 3A9TA 1HNNA 1U2SA 3AL2A 4MWSA 4V0QA 5L53A 2CSXA 1IWPB 3HJAA 2PH1A 4OBEA 2XB6A 5L7YA 3U7QB 4F72A 2XZDA 1F6WA 2P9JA 1I3OA 1NXWA 2N0SA 3EUEA 1GTMA 2C2GA 3ITEA 1QQAA 3SVTA 4YASA 1YBAA 2YL2A 4RY2A 13PKA 1HY3A 4MUAA 5IVDA 3GL9A 1Q0SA 1IEWA 1ZLYA 3FDZA 3KHKA 3OEED 4GKKC 4B71A 5MF6A 2EU8A 4H08A 4X7PA 3AHEA 2A0FA 3KQOA 4NZMA 2RMKA 3JYHA 1GRVA 5E9QA 3IFSA 4QPJC 3OHPA 1YI1A 2X8BA 3A31A 3EPPA 4KJZA 5ER9A 3TXXA 1EWYA 1R7RA 1R4AA 1OXMA 2ZR0A 3CB4A 3F5DA 3GC6A 1NLZA 5JCJA 4DIUA 2G9QA 2QN9A 3TK1A 2QLFA 4BMOB 3AJDA 1TQ6A 1Z5PA 3F3SA 3GROA 3QWFA 4PAQA 1FDWA 2Q9CA 4AJIA 2C2BA 4WNYA 1YR9A 4HRXA 5JDIA 2KM1A 3D8TA 2A6PA 4Q48A 5CLHA 4W6ZA 3LZ6A 1G9XA 5JSFA 4LBVA 3L0DA 5KKCA 4LXHA 5AI9A 4URXR 4XFDA 2HBQA 5AJWA 2QS9A 4BEBA 1YE3A 3S7TA 4X65C 2YICA 1QYRA 2NXJA 4A8PA 1ESMA 3NHZA 3CT4A 2JK0A 1X8JA 1J7KA 5K8FA 2G9ZA 4IH9A 4M7OA 4U7GA 1RP7A 2F8SA 4QYWA 3RNLA 5CXUA 2Y99A 2OD7A 4YRJA 4DLTA 2WM9B 3L49A 4BMDA 4Y6SA 3CX3A 3GUHA 2AGVA 4LF8C 3AUJB 2Q4DA 3AM4A 3OQNA 1QM5A 3UEBA 2CZQA 2BM0A 4DZRA 1ISIA 3KSAC 2P4QA 3FIJA 5I8PA 3GJ0A 2JH8A 2XGSA 3KQMA 1RSZA 3QG1A 1ZUNB 3LECA 5J4KA 2EWWA 1OXBB 2J3EA 4GM1A 4W1RA 1PK7A 1LI4A 2AN1A 4RDHA 5KSWB 5DMXA 3PUIA 3RUEA 2HSDA 3AZQA 1BEZA 2B61A 5DW0A 5IC4A 5JU6A 1TCVA 3NHWA 2ZLBA 3MJDA 3PQEA 1HT1E 3TSOA 4GM4A 2ZUSA 2D5IA 4X7BA 4L5CA 3VTZA 4DEVA 2O3QA 2FE1A 3INRA 3L0ZA 2P4EA 5JVDB 2FQ1A 2NZXA 2ZSUA 4XDZA 4XSGA 5GMOA 2B2NA 4L6AA 5DHPA 2PNJA 4E6EA 3OCWA 1VIVA 4KQ6A 4EMSA 3FNIA 1A9TA 1IATA 1JHXA 3TEMA 2VA9A 3I30X 1H4QA 3HDVA 1XVIA 2VC2B 4BP3A 2WUEA 2BFEB 2YQ5A 3ETNA 2RH8A 5F77A 4Q00A 1JFTA 1QGUB 4Q3NA 5DTRA 1RXVA 2I2DA 3P8ZA 1YBHA 3PPXA 4YCJA 2ZI9A 1O94D 4YXWA 3PQ6A 2P2JA 2D0DA 5K03A 2PKEA 3WIUA 4Y9SA 4QWMA 3ENVA 1CDDA 3U37A 1Z37A 2HIGA 1FZQA 5FQNA 3NYRA 1D4OA 5BNFA 3N2KA 2E4ZA 1SPBS 1XCJA 2JI7A 1FMTA 3H2KA 1BDMA 1XTJA 2ZB4A 5C5CA 2Y4NA 3QHAA 1N2CB 3OZCA 3DZHA 4C6SA 2VTBB 4RFSA 4TS4A 1RLUA 4BTEA 2JKZA 2P7HA 1LTQA 3L8ZA 4RLSA 3R0ZA 4HS4A 5KOJB 3C3JA 5ISMA 2JFVA 1CF9A 3NDBB 2WJHA 2R85A 4U5YD 2CYAA 2VZLA 3DM5A 3NO4A 3ZHBA 4P3PA 4K2HA 4CKCB 2PZMA 1MO6A 4RHTA 1PVVA 3GCXA 3KWJA 3ANNA 3B5JA 2OCBA 2FWJA 1DUVG 1OQAA 2DFPA 1LDBA 2HXGA 1NX6A 1K75A 1TAHA 2IY9A 1V3VA 5AK3A 1WMAA 2UVDA 2XZPA 3IBTA 4FYJA 4BGEA 4PROC 2QXYA 3WV4A 2IEAA 4TKMA 3SLKA 1BWPA 5E7JA 1T4CB 2LKCA 2WNIA 3OTHA 5E4FA 3W5AA 2JD0A 2WTAA 3IQEA 4JI5C 1R0WA 2XB2A 2Z2KA 1XR3A 2PZKA 2GD6A 1T24A 3CFYA 3L8YA 4PHGA 1G6HA 2IXGA 4HOYA 2IPOA 4XVHA 4KXFB 1GXSB 4X00A 3DNPA 3B2EA 4JBXA 4AS2A 2O2EA 1VPDA 2J85A 1ML3A 2CLIB 4PFJA 4NWIA 3L3BA 5FWYA 3CVXA 3SZUA 3OJEA 1JZTA 4QSHA 5J2UA 5B3JC 3G9QA 5CTJA 1O6BA 2PMWB 3CLTC 2V9CA 3PGJA 5A4AA 4YP5A 2NQTA 1DX4A 2IOHA 1WEHA 3SSAA 3H83A 2FJUA 3ZY3A 3T7TA 2H07A 1UMCA 1Z5ZA 1N5DA 4AVYA 1XXHE 2C92A 4PHTA 2ZRFA 4B6OA 4QHTA 4CMCA 4CIWA 3QVXA 3UFXB 1Z16A 2FZEA 3CRZA 2CXOA 1VLHA 3HDGA 4LJ7A 3ZZ1A 5FBWB 3EGCA 4BYMA 4W9NC 3W8DA 3I6BA 2PANA 2QUZA 1ID1A 5A9SB 1X14A 1A9XB 4Z51A 1TF2A 1DWOA 2EKPA 4J75A 3H9GA 1JHOA 3R40A 2WHXA 5TS3A 5HBRA 2GM4A 1UOEA 1Z7YA 3K20A 1GXSA 4LX8A 2CMKA 2YIJA 1N34B 1U3GA 1U3DA 2FJ0A 2Y1CA 1FVXA 2EVWX 3CPEA 1DELA 1UK8A 4BCAA 2XB9A 1VMKA 4N3AA 3LAXA 4LCEA 3ROGA 2NX2A 4MLPA 1YFLA 2B6HA 3A9UA 2XHEA 3B6IA 3FW1A 4RL4A 3DB1A 5T3YA 4K0KB 3W05A 2C95A 4U2CA 2GBIA 5IS2A 5FJJA 4Z6KA 3DE0X 4PZPA 4R3UC 1B8VA 3NETA 2L42A 2EBHX 2JFGA 2XRMA 5DSXA 4LF6C 1VSUA 4X8HA 2QMHA 5M29A 1HGXA 1N32C 1KXJA 3P0RA 4U4AA 2UU9B 1UBHS 2KDNA 1BN6A 3Q0EA 1TW3A 2OHGA 5B1YA 2JGDB 2AJDA 2ZYDA 3HP1A 3MC1A 1M75A 3L6OO 4HL6A 1L4UA 3AF1A 3K9BA 3ZK9A 1N5LA 2GEBA 3I6IA 3L8FA 1O8BA 2B4KA 3ZZUA 1B6SA 3I01A 3GMSA 4YPOA 3AFHA 1J8YF 3DAGA 4BFZA 1N6HA 1WXEA 2YXLA 3OQHA 4JP5A 2YJZA 4JUDX 4LKOA 4P35A 1GNQA 3OKAA 4RJJA 2D4AA 3AZOA 4L50A 1G8FA 2DMRA 5JRJA 4M0PA 4FFBB 3AOGA 1U2ZA 1X1TA 4L1KA 5LVAA 3OUTA 1MMFB 4B4KA 2CXXA 2PK3A 4YP1A 1E9DA 2D1TA 3G7NA 4U3JA 3CSSA 4R1QA 5CTAA 3ZE6A 3B85A 3PBKA 3KG2A 1J0EA 2PBRA 5LMNB 1II9A 1ZLXA 5JSQA 2AXPA 1EA7A 2QTVB 4GECA 1WMBA 3CEMA 4BL5A 4GP7A 3ZN2A 4DSAA 2DH5A 4XPIB 2QMZA 1L4GA 4C6TB 4BQIA 1SQSA 4ZZ2A 3MM4A 3L4EA 4HXFB 1ZGZA 4NARA 1RQ2A 5AJVB 2A5YB 4QXMA 4P7KA 1C1XB 3FZGA 1HFWA 3EXG2 3W7VA 1MJNA 4AG5A 2AEEA 1AQYA 3EIFA 1U5AA 4KE6A 1FSSA 4L6CA 3BL5A 1FX0A 2NGRA 1CZKA 2QLBA 4XQ0A 1P2FA 2B21A 1GT6A 1Y3HA 4W8GA 5ADHA 3TZQA 3FE2A 2I6XA 3IRVA 2AFHE 3AG5A 3GIWA 5T57A 4CMEA 1T2EA 1U8ZA 3ESBA 2R9VA 2VTVA 3EY4A 4GYKA 4B1FA 2GN1A 3WWYA 4W99A 2YXPX 2JFYA 4V2IA 3U7QA 2BRUC 2NV0A 1P61B 3EEFA 3I52A 4E5SA 5LP6A 1KGSA 3N0VA 2O50A 4DA4A 3TNDA 2VBFA 4NDAA 4P32A 1G21B 1F3LA 1QKIA 5H81A 1DHTA 4XWGA 1U9ZA 1RXCA 2ZS8A 3QWAA 1SHUX 5LDDC 4Y2SA 4CXMA 5LQNA 3ZXYA 1FFHA 4GG1A 3RR2A 2MM9A 2GOYA 1J2UA 2JBWA 5HF8A 1DLIA 5A2QD 1NFRA 4L8GA 3V80A 1RRMA 4LZPA 2FFRA 2IYZA 1UADA 2ANBA 3DBOB 2DHCA 2W6IA 4YROA 1I9CA 2JK1A 2AR9A 5DYGA 1FP4B 3M1LA 3UWPA 4CYMA 4E22A 3SDBA 2O7SA 5I7FA 1AY0A 2NW6A 1RR6A 4EHFA 4KRYA 3GEBA 2C3OA 3ITDA 3ZWKA 4JLMA 3SG0A 3HO1A 1FDVA 2QJFA 3V7UA 1S96A 4AYTA 4YMHA 4C1BA 2QL7A 1IB8A 1M76A 3CUTA 4LSMA 2C20A 1KQNA 3CKMA 4F38A 2V7VA 1VTKA 1CR1A 4BFWA 3I2KA 1UPUA 2EWVA 3RROA 1L8OA 1FW8A 2OXFA 1XNRC 1SCDA 1GGKA 1HYQA 4RGYA 4BZQA 5AW6A 4Q3CA 3HG7A 3LL7A 1R18A 2WABA 5JC1A 3QYJA 4FX2A 3JQGB 3H5OA 5ALMA 3G7SA 1CUJA 5DP2A 4ER3A 4LZLA 3LVQE 1EVZA 5TR9A 3AUSA 5GWXA 3MCVA 3NH6A 1ZPDA 4JK3A 3EFBA 2B94A 2DVMA 5HQ3A 1O0CA 4EUKA 1MOSA 3ZCQA 2P4SA 2O8DA 4N03A 3SC4A 4MB0A 3AIMA 4URHA 1WJGA 1FLDA 4Y2QA 2I1QA 1Q77A 4H17A 4DIFA 1K3TA 4PLYA 3D7KA 3O9ZA 1Z88A 3EVBA 3EUWA 3TBKA 1OMOA 1UC9A 1W5EA 4MMYB 3ST7A 3UB2A 2CY1A 1L7QA 1H2WA 3D02A 2Q1TA 1F6DA 1NHGA 1NOIA 1Q0ZA 3SHOA 5DM60 5KHOC 4WH0A 4RPHA 3MSCA 2J4FA 1OGYA 3ITNA 5DVZA 3CA8A 5TMDA 4HAWA 4NESA 1GZ5A 3FCUB 2A78A 2E21A 3JWJA 3L0IB 2WJZB 3DWGA 1JS1X 3BE6A 3C4QA 2CK3D 5DE3A 3UG6A 1BMFD 2XSZD 3PFFA 2HU2A 2CB9A 4Y67A 5TEVA 4WAUA 1WUTA 1XP8A 2X4LA 3BK1A 3H2SA 1L5KA 4C08A 2GAJA 4OQMA 4UEOA 4R71A 2MYNA 2SBTA 4YXWD 2QRJA 4G56A 3RYCB 4XB1A 2O8BB 4ZQFA 2PUJA 1QGZA 3EEYA 5L7WA 2WT9A 2NYRA 1SU6A 1G20B 2XECA 1SHLA 4UCFA 4ZANA 4R05A 3S28A 3V46A 3WGJA 4D5EA 3WMXA 3MK31 3R4CA 3ZDDA 2VDUE 4FUTA 3ENKA 4TTSA 3IVAA 3A27A 2FNAA 3OOSA 5B58T 8AT1A 4M2LA 1HEIA 8LDHA 1PWXA 5AVTA 1KQOA 5L3ZA 5HA5A 4JGIA 1DIBA 3HNOA 3HY3A 4Q3KA 1A5BB 2AFHA 1RKXA 3LYAA 1OZGA 3BMQB 5F1PA 2C3YA 5AXBA 4R3NA 1RACA 3RUAA 3ME5A 5IK2A 2NP7A 1N2OA 3AUTA 3UMRA 1OWMA 1KYXA 1X3SA 1Q0PA 1ZA1A 3BJZA 3MINA 3OA0A 2WSMA 4M21A 2VJBA 4XPZA 4Y1FA 5FR1A 3LH5A 4YMSA 5FL3A 4HNGA 3JD2A 4QPPA 1I7LA 4RVOA 1ABFA 4GSKA 4UD2A 5GONA 2IUUA 3DFUA 4AWAA 4BGDA 1ZKDA 1NI4A 3K71B 1XZDA 2I1LA 3J81D 3HXLA 3BWBA 3I4FA 2J9GA 1G5TA 2Y9PB 3SLRA 4XCQA 4F9FA 4ZYWA 4NMMA 2QP4A 5UKDA 1TDJA 2H48A 1C4OA 2QT1A 2V8OA 1ISHA 1ODSA 2OO3A 3WFIA 3V8RA 2NAPA 1AF7A 4RCVA 3U4HA 4OLBA 3VDXA 4BNVA 3O2EA 3ZU6A 4ZAZA 3KB6A 5J5AA 3SJBA 4GOKA 1U0SY 5DB4A 3VPFA 4XQEA 3EMBA 4DR2B 1JXAA 2WMYA 3UJDA 3SHTA 5LNK6 3BDVA 1RFGE 1RZUA 4ND5A 5CB4A 3FWNA 1G1AA 1ACMA 1QC5A 1UJBA 2OZEA 3R3JA 4JLUA 3BRCA 1O3YA 1R12A 1XTVA 4M9QA 3GJSA 3WXMA 4YYZA 5CBPA 4Z3OA 3DDUA 2P6UA 2P3SA 3L5KA 3QU2A 4J2HA 3TNFA 1VQ1A 1RHRA 1AT1A 2P2ZA 5AQ1A 5CA1F 4QLAA 2GXQA 4GP6A 1RIFA 1JG2A 1LLDA 2EFEB 4O4LA 3PPVA 3IVRA 2H2WA 4FBMA 4ZJYA 1L0BA 4HC4A 2W37A 5H3LA 1WY5A 4PQRA 4CTJA 1ZJ4A 2ORYA 2YWJA 4RIEA 1C8LA 1VMIA 3RTGA 2CV1A 3RIYA 3TQCA 1A4RA 1RXYA 1E3SA 2WE8A 1IHPA 1ACJA 1AIPA 1Q21A 1IUNA 1U9IC 4KV9A 4Q3AA 4IMPA 4ECEA 1E2EA 4NBUA 4OMFG 4KITB 2K87A 1L4HA 3R9XB 3OZIA 2WWXA 2AHRA 4W5TA 2PXCA 3HJBA 2RGRA 1E5DA 1S01A 1MQSA 3AERB 2OHJA 1W4BA 1DOZA 1E4EB 2FMXA 4G65A 4JA2A 4ML3A 4XFJA 4CG2A 1N75A 3NBMA 2NO6A 3ZWOA 4B4UA 2DPMA 2LBPA 4CG3A 1D1PA 3FSRA 5CIWA 1KJJA 1A1VA 3L8MA 4A1FA 1BVHA 1GYRA 4QNNA 3AR8A 5ESWA 2IHZA 1JKFA 4XVUA 5AVVA 2XDQA 1H69A 2AJLI 4HVLA 5J4LA 5KJCA 4JV5B 3BZUA 1KI2A 1AOXA 1KZHA 3Q0TA 3TLYA 2XIJA 3NVAA 2GDJA 3C41J 3HR4A 3OTWA 1YS4A 1N7JA 2BCEA 4U7JA 3JQ7B 4W1SA 3P71T 3TL6A 5F76A 1DZIA 2QSZA 4BJ5A 5L7TA 2RHGB 4JA0A 3O7MA 1JHZA 1QAOA 4HYTA 3PGVA 4JLBA 2A4KA 2FKNA 2PKYX 2FFJA 5I7RA 3W79A 3TW8B 1V9SA 4JCCA 3PT5A 4DIBA 4DMMA 5IWCA 2JFWA 3IKMB 5FUVA 4DLAA 3EDRA 4HSGA 5KX5B 1GQRA 2P5SA 4PEVA 3CTMA 1H2BA 3Q3EA 2EJTA 2YJ6A 4OB6A 4WN9B 4UOEA 5BQFA 4KR7A 4ZKEA 3ZK7A 2YR0A 2PX8A 5EI5A 5J43A 4OQQA 3O94A 2F4VB 1BDBA 3LKVA 3N87A 4M87A 5EUQB 2HY7A 4JLKA 2DBYA 3ND9A 9LDBA 3ABSB 4KN8A 1GEGA 1UJ5A 4KNYA 2L69A 2PSHA 3I5AA 2YS6A 4WQMA 2JIMA 2WIKA 2O2XA 3CJTA 3GP3A 3GVHA 3OZWA 1K63A 2EYUA 2XVXA 1P1RA 3OKPA 1NA5A 4ZZ1A 3OI7A 4XE5A 4DRYA 1XCGB 4E2WA 3THYA 1B6RA 4R1MA 1OZAA 5LOVB 2OG1A 4R2KA 5K2MA 2D7JA 4MVJP 1U4OA 2Z5GA 2OCYC 3CC8A 2HSWA 3G5LA 2BIFA 4PV7A 3O95A 3KJHA 2XWPA 3GP5A 4A0QA 2QA5A 2CMGA 3AINA 3R7FA 4BC1A 1DPFA 3V1NA 4JBGA 1RBMA 1T3ZA 4XVRA 2FN3A 1JWBB 3KVYA 5AK6A 4BLPA 1Z25A 5IVHA 3TLBA 1IB0A 1CQJB 4D7AA 3EVEA 4Y1GA 2QRGA 2C04A 2B78A 2FW9A 2DPHA 3CRMA 1LZKA 3MBOA 1N1GA 2GRUA 3UAVA 2NQ2C 3WK4A 4DW8A 2FYTA 1B93A 3U7HB 3ZH2A 2QEQA 2A1TS 2GAIA 2XOKD 3UGTA 4BLOA 2B7CA 1W36D 1L9KA 2FK8A 1CUSA 4ZAWA 5A4JA 5MN6A 4C4RA 3UB3A 1DU4A 1X1BA 1LX7A 2ASEA 4HAXA 4PYLA 3VAZA 4DIKA 2BBTA 1K6XA 3W8EA 5KNDA 1VI6A 4BXOA 1B14A 4X7MA 1E7SA 2Q99A 4PE5B 5SZIA 4CM1A 2UAGA 1KMIY 1ICIA 2KE5A 3LG2A 3ZI0A 2WJYA 1E2FA 2NO4A 4XEHA 5DO9A 3JTMA 1TO6A 3VC2A 2ONCA 4KODA 1A8HA 4DWVA 4FNGA 1HLFA 1P19A 2FN7A 3A05A 3K5IA 1OVGA 2Q3MA 4IIEA 4BBAA 2G80A 4O33A 4P5PA 2HMAA 2O3UA 2FY8A 3KPJA 3EG9B 4O2RA 2VZ0A 4MKRA 4J0KA 3AR7A 1AKNA 4BLSA 1IZ8A 2ZJ3A 2J0EA 2FV8A 3ASZA 3RSZA 4WZBA 3I4CA 2QZJA 4AZ3B 4LEIA 4I4TB 3LD9A 4BNUA 2C8KA 2EKZA 4QE3A 4WXRA 1E6EA 4JR2A 2C2HA 2R00C 2Y0CA 1AB6A 1DP4A 1VG1A 3BIXA 4GOJA 4Y9RA 3ZDQA 3E3NA 3WQSB 4NJOA 5FUXA 3JQ6A 1QRSA 1T5IA 3Q7SA 1E6MA 4NXMC 1GP2A 1NAIA 2RK3A 1EM8A 3TZKA 1RYFA 2X1LA 2D74A 4RQBA 3FUXA 1E3LA 1XU4A 3V8BA 5C46F 2HLDD 3HYSA 3VDRA 5AVUA 2PJDA 3RSFA 2A59A 3E5NA 1I36A 2NUAA 3VOBA 1W9HA 3A1FA 3G1TA 2OR3A 4CKCA 1NRIA 3A2MA 1QX4A 1XZJA 1JMVA 4DCCA 2GBFA 5KYUB 1E58A 1OLSA 5JZ9A 2FG5A 4Q15A 3FTPA 4G24A 1ZNXA 2HSJA 5DBGA 5LP6C 3RIGA 3I83A 4F84A 5JY1A 1XXHA 3H9EO 2WJAA 1WUKS 3LVRE 4LFAC 5TDHA 1GPAA 2CVQA 1RKVA 3PJEA 1USKA 2P6NA 3BS4A 3ESYA 2NO5A 3VR3A 1XF9A 1J5EB 3WGNA 1GGEA 2W98A 1CUCA 5F7ZA 3IAXA 5BWMA 5F98A 2C9CA 2C84A 2ZI4A 1VGRA 3OFKA 3B1XA 4JLJA 2DPYA 1O6GA 4RIIA 3VYWA 4YRSA 2NSLA 3T5AA 4ZI7A 1AGYA 5FJIA 5KQGA 2GBLA 5FUBA 3AKEA 4XDGA 2B6NA 5EXDA 1SC3A 2JLZA 3PX2A 2WU4A 3WL8A 1GJRA 2ZT7A 3F6BX 5CFMA 1HZZC 1Z8HA 4EB3A 1B1AA 3I09A 4ZZ0A 2A9PA 3EF1A 4RVGA