4DCSA

Crystal structure of b. subtilis enga in complex with sulfate ion and gdp
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
433
structure length
406
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
total genus 131
structure length 406
sequence length 433
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcsA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcsA01
2CNWA 1OH6A 2KBFA 3BGWA 5KOYA 3RS2A 3KTAA 5L3VA 2NO9A 2XSZD 5CB8A 1A1VA 5JLJA 1WXQA 1W4RA 1TQ6A 4MGIR 3HU3A 4GMXA 4Q1AA 3WHLA 2G88A 2J46A 3QENA 2IS6A 2JLXA 1PLKA 1Q1QA 5JSZA 1SULA 1WP9A 1Z6TA 5EP1A 5D3MA 1W46A 2IUUA 1KJWA 4PZLA 4F91B 4PC1A 1S96A 2WV9A 4LV8B 4QBHA 2LKCA 4ABYA 3QXJA 2J5XA 1N6KA 2O8EA 2B8TA 1MABA 4D4KA 2Q9BA 4B3FX 3V4RA 2CNWD 2W83A 4Y0AA 1TAGA 2F9MA 3W6NA 1TMKA 4I81A 3VX4A 4DSOA 2JLRA 2EFGA 3FYHA 4P4SB 4ZI2A 1ZNWA 3ADCA 4M1MA 3GLGE 2RGNC 3EX7C 4QGGA 1ZYUA 3ZIAD 3OZXA 4B34A 4LYFA 5FOUA 4TLCA 3MD0A 3GLIE 2V1UA 1ZNZA 2ZRIA 3QE0A 5JWOA 4BGDA 2GXUA 5D3MB 5E7IA 5KNCA 1Q3HA 2A5YB 5EZ6B 3PQCA 3ZS9A 1NI3A 2QP3A 4DR3C 2WJGA 3CNNA 2FG5A 2NPIA 3P4XA 4PHHA 3TR0A 4TZ6A 1OKKD 5CYOA 3AH8A 4DR6C 3RS0A 1OH5A 2QENA 4IVPA 2WWXA 3U7GA 2WPDD 3GLIA 4WXPA 2O8CA 2ZYTX 1A4RA 2CDNA 5EUQB 3K70D 5HTKA 1YZNA 4TT3A 3LVRE 1N2FA 1C9KA 1WF3A 1NKSA 1U0JA 2ZRGA 1MRNA 5BYKA 1Z63A 1GOTA 1NSFA 1AS0A 2KI5A 2ZUDA 3QBTA 3QKTA 3WMFA 4BLQA 2HYDA 3AKEA 5AUPB 1GIAA 2JLYA 3JVVA 2EFCB 1OT3A 3DVLA 4UNSA 5SZHB 3KX2A 5SZIA 1E9DA 4EDHA 1XXHA 3IKJA 2FSGA 2JGNA 1HTWA 1OXSC 4WXRA 3TSOA 1FUKA 2FZLA 3LX5A 3FHTA 2IXFA 2ZRFA 1VYTA 4KITB 4KFUA 2HCBA 1P5ZB 1IN4A 3TIFA 4DV6C 1SZPA 1VPLA 1II0A 3AVXA 3MMPA 1R5NA 2E87A 4BFYA 4OJKA 4DV3C 4LOAA 2WWYA 1MT0A 1R5OA 3OHMA 4JVMA 4BECA 5FBQB 2VHJA 2ZR7A 3K0FB 4CVNA 4CT5A 1Z06A 2JDID 4A2QA 3MJRA 3RC3A 3GLIB 2MSDB 3OF5A 4DUYC 1EFHA 1XZQA 1ZBDA 3U3KA 1IY0A 4AG6A 3TW4A 1MRSA 1HQCA 2ZI3A 3KKNA 3EARA 4RZXA 4EQ6B 4P33A 4PPFA 4H9GA 1XPOA 2O8FA 4AKGA 4UNQA 3CWQA 4X65C 1US8B 2JIZA 4Q1BA 3OEHA 4Q19A 4OX9C 1GAJA 1D2EA 2HEIA 5AJYA 1E2GA 1EK0A 1CKEA 4E03A 2ZE8A 3OESA 3TNFA 4HB3A 1AK2A 1P75A 3AKDA 3SR0A 2NG1A 1G8FA 3W3ZB 3X2SA 4B44A 4ARZB 3L8ZA 3LUSA 4TN1A 1JAHA 4NCNA 5EJEA 1JXMA 1UKYA 2H18A 3AQ4A 3ZJYA 2DCUA 3FMOB 5LDDC 2IF2A 1KK3A 1NN5A 2AKAB 2IL1A 5CM8B 2IBMA 5LB4A 1KO8A 3CZQA 3LBNA 2YWFA 5IT9D 1XD8A 1DAEA 2KB0A 1E2DA 2D62A 2ODNA 2W6JD 5F2EA 1ZM9A 2PCLA 1J70A 3U3RA 3EPJA 2Q3HA 4F38A 1ZIPA 4PSVA 3PEUA 3OEED 5TB5A 4YHHC 3I8SA 3ZDQA 5KUTA 4QBFA 1P62B 1YR7A 3RNLA 3SFVA 5JSZB 2OHFA 4JYCA 2PCJA 4LHVA 4B3BA 1XRJA 1DVRA 2B7BA 4GT1A 1S1MA 3O8RA 2ZSBA 5BN3A 1KKGA 2AXNA 1JQLB 4M2LA 4YXWA 3C41J 1GG2A 4JLVA 3T5DA 4QBGB 4JT4A 5IK2A 5B64A 3TSWA 2KJQA 1OJLA 4J0QA 4EUNA 1JNYA 4Q9JA 2CHVA 2OBNA 4CIDA 4JYBA 4LJ7A 1G16A 2W6JA 1N0VC 5A0FA 1Q12A 4B3XA 1E3MA 4EKDA 3BJIC 4LHYA 3THWB 1OFIA 1XX6A 1Z0FA 3DKPA 1WB9A 1XCMA 4LRWA 4I99A 2PEZA 3PG5A 1XEXB 1OLOA 3EZ9A 1Q1EA 3FDIA 3KB1A 3TH5A 2QMUA 4KVAA 1T8UA 4LFCC 2R65A 3QF4B 1TTTA 1PLJA 4HUQA 4AK9A 2WM9B 4MUBA 3U44B 4QNRA 4KBFA 1XTQA 4O2LA 2FPMA 2XNDD 1N6LA 3BC1A 1OHHA 1R10A 4LPSA 3Q72A 3K70C 4AI6A 1TL7C 3FKQA 4PXAA 5DISB 5KSZA 3PUVA 4HAVA 1FQJA 2FWRA 5H70A 2V3CC 3ZD6A 4ESHA 3H2YA 1QHXA 2HCJB 3F3YA 1G3IA 4LV6A 5CJPA 5EE9A 3PEWA 1IONA 2XAUA 1FMJA 3MWLA 2JIZD 4MH4A 4JI3C 4M1YA 4WOPA 1IBMC 3S1AB 2BDTA 2XB4A 1JXOA 3VNUA 3QXCA 4ZIRA 1E9RA 3FWYA 2FV8A 3RWOA 3SDZA 1S4QA 5TARA 4XVRA 1W5TA 1R8QA 1UBCA 5KSPA 1M8PA 1ZNXA 5FUVA 1F6BA 2A30A 2ODBA 3RDPA 4LJ4A 2ZRKA 1KI2A 5EXSA 3K0AB 2O8BA 5BWMA 1XTRA 2PLFA 3QQ5A 1Z0JA 4JS0A 1EESA 1P2TA 1QHSA 2FEOA 1W2HA 1IJEA 1J90A 1S3GA 5LB2A 3C7KA 1EG7A 3AKCA 3IIJA 3RS3A 1COWA 1NMXA 1V5WA 4XH9B 1G3QA 2NZ8A 4OQXA 4LDJA 3G5UA 4TYWA 1WE2A 2GJKA 1U8YA 2FPLA 3D3QA 4LK2A 4PC6A 3ZIAA 4B48A 1N36C 1N6RA 3EPLA 2FA9A 2WZQA 4QGAA 4F7WA 1CBUA 4U00A 1KI9A 2HHHC 1LV7A 4A92A 4DCSA 2YZ2A 1Z6AA 5BW8A 4QNMA 721PA 3SJBA 1E2QA 1XZPA 4V02A 1NRJB 2WVJA 4POAA 4Q01A 3W5IA 1Z08A 4RKFA 4AY2A 4DT1A 4GZMA 1V43A 2D74A 4LBWA 3B9PA 3IGFA 3BB1A 3I62A 2BBWA 2D06A 2QU8A 2J0VA 4B71A 4QC2A 1EWRA 2ZRAA 3IDQA 5FTJA 5KDLA 4A9AA 4EPTA 4QM6A 4JSTA 5B57C 1KDRA 3DZDA 2GEDA 3EPHA 2YNMA 4HAUA 4B3RC 2ORIA 1E1QA 5AJZA 1NLYA 3Q9LA 4IRUB 3NIBA 4DR2C 2O8BB 2NO6A 3AGQA 2AD5A 2NGRA 4URXR 3MFYA 4JBWA 2CCJA 4LYJA 1G18A 4DLTA 2PZFA 5KTYA 4PZZA 3W6OA 2ATXA 4GBMA 4B3GA 4PO9A 2E8FA 1K6MA 4FIDA 3FB4A 1W0KD 4F4CA 1F60A 1D5CA 1H65A 3WBJA 2B8WA 1Z47A 3LNCA 3QG5A 1FZQA 4LBVA 4YONB 2GXQA 1MO3A 5E7MA 1M2OB 5BN4A 4HB0A 2C04A 4O2RA 3M1IA 1KO1A 3VR6A 2BWJA 1QHGA 4WBSA 3MCAA 5TDHA 2ZJOA 2G1JA 3N2IA 2IWRA 3PV0A 2GAOA 5DHAA 1T3LA 3KQUA 1EWQA 3X1XA 2NOAA 2NIPA 4JKIA 1NN0A 5B2ZA 2REOA 2BMEA 2XJ4A 1BMFD 4M53A 4LSGA 4MRNA 2QSZA 1U8ZA 4JBXA 2YOHA 2QT1A 1FTNA 4HZIA 1UBFA 3IIMA 1AM4D 2D4HA 2WIAA 4YC7A 5KDOA 3ZD7A 2NO7A 2IYYA 1X8JA 1LNZA 4NYJR 4HDOB 3W9YA 2CCGA 2HLDD 3LD9A 1R0YA 3EA0A 3KKOA 3LDAA 5J5CA 3KUCA 4BZQA 3H0KA 3D31A 3Q5DA 3SNHA 2CCKA 1FX0A 1XP8A 3WP1B 5GADl 1ZC4A 4IDOA 1OV4A 4US2R 5JS7A 3I5XA 4DRZA 2QQ0A 4KV9A 1QF9A 2ZRCA 1XD2A 3G0HA 621PA 2IW3A 3FMIA 2PEYA 3A58B 4CEHB 3SJCA 1MO4A 1P60A 2C9CA 1E1RA 4IHQA 3IO3A 4EJSA 3BD9A 1NLZA 1YQTA 2HDNB 3CBQA 3AB3A 3K0CA 3CR7A 3GJ8A 5C4MA 1YE8A 1UDWA 3IO5A 2DB3A 1XJCA 2C9OA 4LF9C 3AF0A 1WCV1 1RZ3A 3FHCB 2FFQA 5UKDA 1DARA 4FMCF 1SVSA 3LW8A 4GOKA 3SYKA 2Z4RA 4PO8A 5FBWB 5K8UA 5EXPA 1F48A 3WBKA 1XEWX 5FL7A 4EPWA 4I1UA 4URWR 2ANCA 3CWZA 4CYMA 1NBMD 1DAGA 2IXGA 4B2PA 5HKKA 5JHHB 1DADA 2J1LA 1EGAA 5JRZA 2DBYA 2FSHA 5C4GB 2JJ2A 4EAQA 4B35A 4L15A 1XPUA 1HNXC 1W5SA 2HT1A 4MDFA 4JLAA 1PLLA 1W4BA 5L3RA 4DWJA 2G0TA 3TVDA 5IK2D 3A37A 2V6JA 2YOFA 1L7VC 4BLSA 2IYZA 2JCSA 2OFXA 1MO5A 1OE0A 4PAOA 4ASUD 1P72A 2XTNA 2ZS9A 2D2FA 4AYTA 2DFTA 4NCKA 1ZU4A 2IK8A 4MRSA 2H92A 3T1VA 3I8XA 1Z22A 2JLUA 1HT1E 2VA8A 1NMYA 1W44A 2ZYVX 4R2HA 1QHNA 3W34A 2C8VA 4YDHB 4K0KC 3UKDA 3K53A 1EFRA 3GLGA 4L4UA 1NVVQ 3DZ8A 3WXMA 2XZLA 1WQ1R 3B9QA 5HCIA 3U6KA 2X8AA 4MYTA 2EWWA 4YQFA 3LH5A 4D4JA 1ZAKA 4ACAA 4KLNA 4ZKDA 1W36B 3K1JA 2VQSA 5LMUC 3TK1A 1IBRA 3Q85A 2BJOA 4AURA 1J2JA 1GKYA 4HB4A 4DV7C 2F1RA 3MUFA 3U44A 4JI5C 2CHQA 1KNXA 2EWVA 4MRRA 1NSTA 2ZR0A 5LMNC 2MSEB 2RGCA 5DN6A 3BS4A 2CK3A 4Q4AB 3DOEA 4XVQA 3SQXA 4LJ9A 2RGAA 3L82B 2Z6VA 3AF2A 4BE7B 2FFBA 3QKUA 3RSOA 3EIQA 2UUBC 3BFKA 2WKPA 2YC4C 2A5GA 4G0NA 2FDCA 2QEQA 2UKDA 2L0XA 3TQCA 1D9ZA 1B23P 1D6JA 2BOVA 2DHRA 4TMTA 1E1RD 2QE7A 5JECA 4KHPC 2OCAA 1K8RA 2LCFA 3NC1C 4IOJA 1KOFA 1P7CA 3ECCA 4TQUS 2F1JA 4QL3A 1SVMA 3EPKA 1YHNA 4OKSA 3QKSA 3VFDA 1VHTA 5FPKA 1S0UA 4MKGA 4IOMA 4KJZA 2XOKA 5FTMA 5ANRB 5AR1A 1E79A 3CX7A 3I72A 2ASEA 2P2LA 4Q21A 4IEIA 4PHTA 5H8WA 5HKKD 4LZZA 2J9RA 3QPWA 2ZU6A 4FD2A 5P21A 3KQNA 2ZXUA 3I5YA 1Z28A 2QPAA 4YMWA 4IVQA 2V9PA 4JI2C 1ZINA 2O5VA 2R62A 3KDSE 3GLHE 4OBEA 1OXVA 2WSSA 3TUJC 3AVTA 4BFZA 4D4MA 3CPJB 2O8DA 1G21E 3VNVA 1IQPA 3SHWA 2C96A 4OK3A 3QXSA 1W0KA 4I1SA 3FFBA 4LF5C 1R8SA 1E9AA 4RCZA 821PA 2EVWX 2BIFA 3KJGA 2YCBA 4B73A 3IUYA 4DXAA 4RJLA 2GA8A 2ZS8A 1G41A 1E79D 1US8A 3T1YC 3E2IA 3LFUA 3V00A 1OXUA 1O87A 4RD2A 3CLVA 1CP2A 3HYTA 3CH5A 2F3TA 2XXAB 4NYJQ 4DV0C 1YR8A 3GPLA 1E0JA 3X1WA 1LB1B 4NH0A 2QL6A 2WAYA 5AWFC 2C2HA 3SI7A 3QOFA 4N3NA 3FHOA 2VP6A 3DDCA 4JI8C 2W0SA 2E8EA 3IHWA 3EC2A 4XTCS 3ADBA 1YZUA 2QSYA 3QEOA 2RGDA 4G5OA 3B7GA 3OEEA 5JCPA 2J41A 3NHAA 1XB2A 4JLJA 4AKEA 4D6PA 4Z51A 3K0CC 4TL8A 5GJWC 2E9SA 1X6VA 1SXJE 3B78A 4QHYA 4TTRA 5JJLA 2VL7A 2C03A 3D7MA 1E2IA 1X8KA 1R2QA 2VLIA 4JLNA 5FL3A 1NF3A 5JI3E 4BSZA 2R8RA 4PFSA 3SHFA 1CRPA 1PV4A 3UPUA 3L8YA 2GK7A 3GKUA 1KI7A 1YRBA 1I94C 4QBIA 1JPJA 2R2AA 4RD3A 4DDTA 2WOOA 3I32A 3DMNA 3RVBA 3T35A 4DB4A 1E6CA 5JZVA 4II7A 1UPTA 1GFIA 4YMTA 4BZPA 3H1TA 3QF7A 1YVDA 1G7CA 1TF5A 3B1WA 5JBQA 1PA4A 4KO8A 4DLXA 1W36C 1P2SA 4FN5A 4K81B 2OCPA 4IDHA 4PAMA 1TUIA 4Q48A 2YV5A 2GWHA 4XWAA 2W6IA 2JJ1D 1L4YA 3R9XA 1W48A 3VR5A 2QTFA 4URVR 1VG9B 5IT5A 5AUNB 4ZV4A 2IYUA 4AYXA 1ESMA 1ZB9A 3FKSA 3MWYW 1P9RA 1D2MA 4Q1CA 2P0EA 4Q1DA 2Q6TA 3RS4A 3VR3A 2OEPA 3RRZA 4D0NA 3CJEA 1FNMA 1E2KA 1Q3TA 2AK3A 1ZUIA 2HF9A 3K9HA 4G5QA 5AUOB 4C30A 2TMKA 1EXMA 2G0NA 1Q22A 3AP3A 4Z8YA 3L0PA 4HUTA 3BBPA 1Z0AA 4NCIA 4PQRA 1VCNA 4FMDF 4TMVA 2J7KA 2O8DB 3C16C 1OYWA 2D7VA 5FTKA 4RD6A 1QBKC 5FTLA 2GVDC 2SHKA 2OG2A 1NL3A 2I1QA 3WNCA 1J99A 2GCNA 1KY2A 2G9NA 2FPKA 1JEEA 1LF0A 4E22A 1LVGA 3NDBB 2VYFA 2J87A 2CVHA 2ZI5A 1SVWA 3EC1A 3EXAA 4U02A 1SVKA 3JAMD 2QGZA 2RHDA 4URYR 1G6HA 5FI1B 2EW1A 4G5SA 3P1JA 4PPNA 1T6NA 1VCOA 2PX3A 1AQYA 1W49A 4EFMA 2E7GA 1HR0C 2GF0A 3QBVA 2UVQA 4EJSB 4HEJA 2A5JA 1T4GA 1DTSA 3T06B 4C9BA 4HAYA 2IYVA 2ZRNA 3U3JA 5JHGB 1TADA 1YZTA 2CJWA 1E98A 2YJTD 2ONFA 2G3YA 3FGNA 3GJXC 1OSNA 4XSHA 5KPJA 3AVYA 2EFHB 5G3ZA 4JYAC 4ZIRB 1KMHB 5CLLA 1KK1A 1CS4C 2I1VB 1NIPA 2JATA 2IT1A 3MRSA 2G77B 2WJYA 4PPQA 2P3SA 3RRMA 4BFWA 2P5SA 4Q9LA 4TQ9A 3MSXA 1HNWC 3L0SA 4Q9HA 1JBKA 3A4LA 1M7BA 2ERYA 3ETLA 2AXPA 1C1YA 2OFWA 1EX7A 5A2QD 1RVDA 4NYMR 3RS5A 4JLBA 4P4UA 1ZUNB 5CIQA 2CEAA 4JVNA 4B32A 4ZDIA 1BYUA 4JT2A 1NG1A 5FPYA 2FZ4A 4DZZA 2FF7A 2GILA 4O25A 2MMCA 5DO9A 5KNDA 1E2EA 4UJ5A 1E4YA 4BASA 1BS1A 3TGPA 2QAGC 3I92A 3B13B 2R6DA 2QY9A 4MGZR 2HXYA 2VF7A 4HDQB 3BFXA 2GCOB 1EFCA 2CMKA 2PZEA 3I1FA 3LY5A 5C46F 3QXHA 4ZDJA 4DDUA 5E4FA 5E95A 1Z3IX 5GVSA 1P2UA 2ZRJA 4AQYC 1GVNB 3HU2A 4Q7MB 3R7WA 2DPXA 2YWHA 2ONJA 4C0SA 2YC2C 1IBKC 2BMDA 4P32A 3LBIA 4A4DA 4BWYA 1CF4A 2BKUA 1SVOA 5L3QA 2W2XA 4RY2A 1NN1A 2Z5FA 2ZJ2A 4D26A 1BH2A 1JECA 2FE4A 2V7QD 4NONA 4MA4A 3TW8B 4LGMA 1JQJC 4Q4HA 5DGXA 3RWMB 1UJ2A 4B6FA 1JR6A 2ZU0C 3AVPA 3FMPB 2PT7A 4Z1MD 1TQ4A 1F5NA 4RD1A 3RHFA 1N32C 1G291 2QMOA 4JKYA 2C98A 1UF9A 2IYSA 1W36D 1E99A 4PQYA 4DBLC 1FMLA 5LD2C 2GK6A 1MH1A 2W00A 3UG7A 1XPRA 1CJMA 4Q4JB 2BM1A 3BRWD 3Q5EA 5JWHA 1ZW6A 1N33C 1HV8A 4LC0A 1EFTA 2GXAA 1ANKA 4V0LA 3AF4A 3VR1A 3HDTA 1DPFA 4HLUA 2VF8A 1Z07A 1KI3A 1H8HA 4PR0A 4B2IA 4OHZA 1OIVA 4DUGD 3EG5A 3LW7A 3LA6A 2F1IA 2XX3A 1QG2A 3AP2A 1CR4A 2OT3B 1HT2E 3AP1A 3O47A 4FCWA 3UIEA 3MAAC 4OL0A 1N6IA 5IF9A 3FPAA 2ZQ5A 2X2EA 3UWKA 1PJRA 4MRVA 1GL9B 3QY0A 4OHVA 2F7SA 4LBYA 4JI7C 4BPBA 4OHWA 2QTVB 4QJ4A 1ELOA 2D7DA 4AIIA 3V9PA 1CJVC 2LKDA 2GESA 4QGHA 2ZI6A 4S35A 5M04A 1QHYA 4E07A 4DUZC 1N0WA 2WHXA 3OE7A 4EQ6A 2ZUBA 3BB3A 1WBBA 1KO7A 3DEFA 4KODA 1AQUA 3FTQA 2WWIA 3KXLA 4DJTA 4BFUA 3CF0A 4TYQA 3A4NA 1Z5ZA 2QQEA 4NKRA 1UAAA 2EYQA 1U9IC 1OFUX 3IQXA 4PX9A 2EQBA 2W6ID 2R6FA 3O8DA 3TRFA 2B6HA 1KSFX 1WDTA 2RGNA 2ZAMA 3NEJA 3SU8A 2X2FA 2NQ2C 4UNRA 5AK0A 2XB2A 2R6AA 2GHIA 1YR9A 3SOPA 3WY9A 4MRPA 4NL4H 2ZSFA 4LC1A 2XGJA 3NHBA 2EFEB 4IKEA 4DSUA 1DS6A 2W58A 2BCGY 5JS8A 1ML8A 3H86A 4DCUA 4OYHA 1IAQA 2PLRA 3U7FB 1QZXA 3X1ZA 4WAUA 5LBIA 2JLZA 2JLQA 3EASA 1NVXQ 2FX3A 4A82A 3L0OA 1KAOA 2EYUA 3O8BA 4IDPA 2VIIA 4HLCA 2JLVA 4GL2A 3B60A 5AJXA 4MDEA 1NVVR 3BFVA 1FP7A 2QGNA 2WJIA 4W5WA 1N3BA 3PENA 1NN3A 2QG6A 4Q9IA 4HAZA 2ZR9A 4G5RA 5CJ2A 2IYXA 3T1OA 4C7OB 3QXXA 4H1VA 2OLKA 3R9WA 1JR3E 2VP5A 1DO2A 1XMIA 3VR4A 5FFMA 1G20E 3TUZC 3X1YA 3W6PA 2XITA 2Q21A 2KZFA 1N5IA 4C3ZA 1H8EA 1F2TA 3BH6A 2I4IA 4MKHA 4QGFA 1E2PA 3MGCA 1LS6A 4DV5C 3QIAA 5AUQA 3VR2A 2FJUA 1KKMA 5JFGA 3GLFA 3IBGA 4TLDA 5C1BA 1AJEA 1G5TA 4Q7LA 2VEDA 4YMUA 2YVUA 5KSYA 2R44A 2X19A 4M1WA 2PN2A 1LY1A 2C9YA 3TQFA 2C77A 2WWFA 3J80D 5KU1A 1SHKA 3V4FA 1UKKA 4R9UC 2HF8A 2K5UA 4JI1C 4NXMC 3MWKA 3CIOA 3UXMA 4W7SA 2QAGA 3A1SA 1G8PA 1G5RA 3EZ7A 5F9HA 1N25A 1IN8A 1FPMA 1HH4A 1L4UA 2IEYA 3CNOA 4Q4HB 3LQRA 3WMEA 4F4IA 2F6RA 3CX6A 2ASBA 3K9NA 3KKMA 3RYTC 2VHCA 3HPRA 3U3MA 2ZM6C 4JLOA 4RZUA 5EP3A 5CITA 3A36A 4Z1MA 2VHQA 2BJWA 3P26A 1GM5A 4JI4C 1VHLA 1CTQA 1OF1A 4G01B 5DSZA 1DAIA 1F2UA 1OKKA 4NPHA 4JMPA 4ZKEA 3VU9B 2ORVA 1XTSA 3U4QB 1R4AA 4G5GA 3CRQA 5D3QA 4ZCLA 4D4LA 2IYLD 1JOSA 1ZP6A 1PVOA 5JEDA 5CK5A 2PMKA 4A0GA 1E9FA 1RW4A 1U98A 2ZETA 4KVGA 4PC2A 1WBDA 4ERNA 5CLQA 2OBLA 4M4SA 2QP9X 1ZB8A 1KHTA 3NH6A 3QPUA 4F4JA 3LWNA 4FI3C 4FWTA 1W2GA 2ZRMA 1CR1A 4HUQB 4KAXA 4GP6A 1YZLA 2WICA 5GJBA 3OIWA 1T9HA 1AKEA 4MKFA 3E1SA 4ON9A 4ZO4A 4CEIB 3DL0A 2Q3MA 1Q44A 1E9CA 1FFHA 1BOFA 3PUZA 2OCYC 4OQFA 3N5CA 2ORWA 4M9ZA 4A0RA 1M6NA 4CEIA 2QM7A 5E3HA 4LF6C 1FUUA 4DR5C 3NBXX 4JL5A 3ASZA 4DLUA 1KO4A 2ECKA 1XMQC 3SJAA 3VQTA 1CLUA 1JR3A 1OXXK 1TF2A 4W5HA 1LFDB 2OXRA 4EFNA 1GKUB 1DG1G 1KMHA 2GRJA 4Q1FA 3WYFA 1I4LD 2F55A 2UXDC 1JJVA 3LX8A 3TUIC 2O8CB 2CXXA 4LFBC 5KSOA 5DH9A 1GDDA 2DWPA 1BO6A 4GPTA 1VECA 4IW3B 3RS7A 4D25A 4GOJA 2QMEA 2ZE6A 4BZXA 2OPLB 2IF0A 2JAQA 2ZEJA 1DAMA 2OUKA 4M0LA 3A1UA 4N0DA 3PJRA 4DV4C 1VCMA 2GCPA 1S9HA 4UNPA 1VKJA 4OQNA 4NYIR 5J47A 1KJZA 1NVWQ 4X8OA 4ZI3A 3CRVA 3HU1A 2QPOA 4DIEA 1II8A 2WJVA 4C0KA 3GEEA 3ZVMA 2ATVA 4TZ0A 3SJZA 1J8YF 4MITA 2ZVQX 1UM8A 1WH9A 1T5IA 1TQDA 3SS8A 4BFVA 1KZ7B 3P4YA 4DR4C 2DY1A 4UXJA 1KAGA 4OI2A 2CHGA 1Z6YA 4U5XA 4ZCIA 2D7CA 1CR0A 1TU4A 3T1TA 4FCTA 3TKLA 2VP2A 2BBTA 4NMMA 4LWZA 5IDVA 2OXCA 4JL6A 1ZM2A 1QHHB 4IFBA 4NOZA 1YZQA 1Z0KA 3LAWA 4NBSA 2A5DA 2CL7X 4B3DA 3WYAA 4M22A 1CJTC 4BFSA 1AKYA 1YU9A 4JVLA 3QKSB 4WIAA 2GF9A 4JIMA 3NDPA 1XEWY 2J3EA 1L2TA 1XDBA 1II8B 4KI0A 4L9SA 1H8ED 4TYNA 2AX4A 4QXAA 3M0EA 2PT5A 4CEHA 4C4PA 1CULC 5FUYA 3C8UA 2FNAA 1K5GA 2A78A 1DE0A 2V8OA 1PUIA 3CONA 3UMFA 2A5FA 1Z6GA 2UUAC 4M1TA 4R98A 3CW2A 1CIPA 4E09A 2GNOA 3KB2A 1NVUQ 4XTRA 2PMDA 1JR3D 1ZUHA 3Q7PA 4BRWA 3THXB 1UBEA 5TV2A 1O3YA 4X62C 3W8RA 2AHOA 2XR1A 3EERA 3BOSA 2IYTA 3KJHA 3A1WA 4UJ3A 1KK2A 4WW0A 4CRWB 3PXGA 4RSGA 4I1OA 4ACBA 3SEAA 1HA3A 2UZIR 4RZ3A 3QVUA 4H1UA 4QG7A 1LTQA 5G41A 4NCHA 4OI0A 5HE8A 5CB6A 5IRCD 4MTNA 4DEYA 1KIMA 3W5JA 3PITA 2PH1A 3LV8A 4AC9A 3LLMA 5ELXA 2IUSA 4Q9KA 4R71A 3CH4B 2WPDA 4BLPA 4QHSA 4XOIA 3EZ6A 2ZJZA 3GLGB 1JI0A 4DV1C 2PJRA 1E4VA 4O0MA 5C18A 3U7HB 2J45A 4C0HA 1RRPA 4HDCA 4PHFA 2N46A 1OXTA 1EFRD 1KDPA 4DDVA 4PSKA 2QUZA 1N6PA 2DR3A 3L0IB 2IYQA 1UEJA 4LV5B 2J0SA 2GTPA 3CR8A 1Z2CA 4CW7A 3GJ7A 1R0WA 4N0EA 4P4TA 2F3RA 221PA 1SKQA 5GJCA 5DNYB 2RGBA 1GP2A 2ZREA 4JJZA 5LD2B 2X1VA 4HLQB 2AFHE 4NDZA 2NO0A 4UNNA 3IPYA 1E96A 3RSLA 3I61A 2JEOA 1SGWA 3AEZA 1D8TA 1LF5A 4DLRA 3B6EA 4ZPXA 2ZRHA 3ND8A 4S2EA 3IEVA 2WOJA 2O0HA 2ZI7A 3U3OA 2ZE7A 4Q03A 1D9XA 4M9XA 3TAHA 3GFPA 3CPHA 4JI0C 2H1LA 4JJKA 3PEYA 3PVSA 4GP7A 4Q4JA 1NBME 2ANBA 1U99A 1G7TA 2VP0A 4P3YA 2V7QA 1GL7A 4V03A 3GLFB 3THOA 1VG0B 3ICEA 1UKZA 1NIJA 2J0UB 3GEHA 2NO1A 3QNUA 4RCYA 1T5LA 2GVZC 1JB1A 1XMOC 2FMXA 4Q66C 3QUSA 1FTSA 2IYWA 3OE7D 5FR2A 4EJSC 2DFKB 2ODEA 4AG5A 4DLZA 4EPXA 2VHUA 1KYIA 3BIFA 3JZMA 4V0NA 1VCIA 4M9QA 2G6BA 1DAFA 1MR3F 4Q5IA 3DHWC 3RABA 3KTAB 3O8CA 2CY1A 2OBMA 5EZ5A 3SE0A 1E0AA 2RH5A 1AGPA 2REBA 2XOKD 3E5HA 3DMDA 3W3AA 4RVCA 4DV2C 2E5LC 2Q9CA 1AS2A 1X86B 1GWNA 1Z29A 3IILA 4ILEA 1CR2A 4C0JA 4NYIQ 2BEJA 1GNQA 2RGXA 5C2JB 2OILA 1RRGA 3B2EA 4WA7A 1RRCA 1KDTA 1E32A 3EWSA 1XU4A 1H8HD 2WMOB 3TR5A 2ZYWX 1OPXA 2UZ3A 2PX0A 3P27A 5KYKA 4IEEA 4JLMA 4KYUA 5FOWA 2EU8A 1A5TA 3B1XA 1KO5A 5LPNA 2GKSA 3KFXA 4BLOA 1NNEA 1R5BA 1VLAA 1ZIOA 1RJ9B 2JLWA 1NMZA 3TLXA 2IS4A 1KZGB 2ZE5A 2ODWA 2Q0HA 3BXZA 1RJ9A 5HR5A 5JCZA 3EZFA 121PA 4V0KA 2GBLC 3CZPA 4LUCA 1G4UR 1AIPA 3QVVA 4X8HA 5IWAC 4FCVA 3SBDA 2WWWA 4QFMA 1N5LA 1ZM3A 2B21A 1ESNA 3LO5A 5E7JA 1Q57A 3UK6A 1JAIA 2C99A 3ZVNA 4XWOA 1J7KA 2BBSA 2P6NA 3VU9A 2VQEC 2ZSEA 3AVQA 3GLFE 3KKQA 4DSNA 2H57A 4TLAA 1P3JA 3UATA 5HPYB 1T0HB 3REFA 4GFDA 4MKIA 4PQFA 3ZLJA 4LFAC 1GSIA 1KDOA 1XD9A 4FMBB 3I07A 4TMXA 4Q1EA 2XSZA 4FINA 4P0TA 1P9NA 4Q02A 3GJ6A 2A7QA 4O3MA 2NZJA 2GDJA 3OIUA 1KI6B 3Q3JB 4KFTA 4X64C 1EFUA 4N1AA 3U60B 3TMKA 1QWIA 1AN0A 1IHUA 1XJQA 2OCBA 3PR1A 3ZGXA 4A6XA 2FEMA 1IXSB 1R6BX 1T91A 2WJJA 5G53C 4GDFA 1GRRA 3EZ2A 5KNBA 2QT0A 4DVGA 5FBRB 4DLWA 2GZAA 3GJ4A 1QG4A 3PUYA 4DKXA 2HYIC 4P31A 3THYA 1R0XA 1BYIA 2G83A 2GJ8A 1J5EC 2BBOA 2C5LA 4LCBA 2YYZA 3R20A 3THYB 1USPA 2C95A 5B30A 4W9MC 5FBVB 3NXSA 3RRYA 1SVIA 2GJSA 5FUXA 1AA9A 5EP4A 1RYHA 3ZS8A 4EIWA 1DO0A 1KSHA 4DDWA 1E0SA 1GRNA 3U7EB 4A0FA 3EIHA 5KHOC 1JALA 5CK4A 1K0RA 1Q1BA 4ESVA 1ZVQA 1E9EA 4LBZA 5FOVA 1ZD9A 3QG1A 4L9WA 3R9IA 5FBLB 2ZJ8A 1KMQA 1Q1ZA 5JWRA 4TL6A 4ZCMA 2ZRDA 4GI7A 2YHSA 4U7DA 4XD7D 2OV2A 1UKVY 5EE3A 2O0JA 4CEJB 5EQTA 2GAAA 1E1QD 1W47A 5F3WB 5AJWA 1A7JA 2IS1A 3NWJA 4RZ2A 2V1XA 4A0HA 2C78A 4AKHA 2Z4SA 1TNDA 3R7WB 4OHYA 3AUXA 3GFOA 5FI0B 2GZDA 4LF7C 1UADA 4WVFA 1ZJ6A 3QI2A 2KE5A 4JBYA 2QP4A 1S3SA 2AN9A 2GCOA 4GOXA 3LXRA 1VG8A 1TUEA 3GJ3A 2IEZA 2CVFA 5DHFA 4PSAA 3AF3A 4KU4A 1KGDA 2HUPA 1X8LA 1R0ZA 3LVQE 3QF4A 3FE2A 3VMFA 3HPQA 1M74A 1YR6A 2HT6A 1HUQA 1OB5A 2QBYB 1MKYA 1P61B 3UG6A 1HYQA 5H1YA 2PL3A 4IDQA 4FXPA 5J4YA 2B7CA 3W90A 1Q21A 2WKQA 1ZMXA 2NTYC 4LF4C 4TYPA 5EP2A 4V0ME 3THXA 1DAHA 4RFVA 1G1MA 3P20A 2CXCA 5G40A 2WBLC 4IVRA 4G1UC 4M1SA 2V55B 4GMDA 5HZHA 1G3UA 3A4MA 4URZR 3HWSA 1CJUC 2WWHA 2AKYA 5FLXD 2WIBA 3HR7A 4TMKA 1AGRA 3HYRA 1N34C 5DI9A 1XNQC 3WYGA 4TT3D 3FOZA 2IHYA 2J0UA 2D2EA 1T8TA 1ZM7A 1ZD8A 2ZVPX 1Z0IA 2R6GA 3L43A 3QEJA 1BKDR 4XVUA 2WMNB 1FW6A 2HXSA 2XTZA 1W0JA 1WRBA 3AV0B 2J7PA 4M9SA 4F92B 3IBYA 1U0HC 3BB4A 1GNRA 1U0LA 3PUWA 5TY0A 3RAPR 3AVOA 2YWEA 2P5TB 2ZIAA 1YJ5A 3CF6R 2PJZA 3ZVRA 1RC8A 5BR8C 3KKPA 1NJFA 3QPVA 3ZQ6A 2CBZA 1U9IA 2YINC 4RKEA 3GFTA 5DN6D 1Q0UA 4PZYA 1FNNA 3U5ZB 2F1HA 2N1BA 3KZ1E 3K0EA 4RFSA 2P65A 1W7AA 1GNPA 3J81k 3MLEA 1KI6A 2GXSA 3HJNA 1IXZA 4A8JA 4B74A 4BFXA 4JL8A 4IXMA 4D2IA 2J0QA 2VQFC 1P4SA 3NH9A 4JLKA 1XFAA 3TBKA 4Q7JB 2RAPA 4DSTA 4FMDB 5AJVB 3UWOA 2IA5A 4HLDA 5J4VA 4HLUC 1JEDA 2F9LA 3DM5A 4K8OA 1ZM4A 4B76A 1N0UA 4A6PA 5DIFA 1IBLC 1NP6A 4LY6A 2IXEA 4BEJA 1QHIA 1ZU5A 1XTKA 4LF8C 3WNBA 4DIDA 2OE2A 3L2OB 4C2UA 3ZZ0A 1VG1A 4MUAA 3VKWA 2YKGA 2P6UA 2OFOA 4A8JC 3GLHA 3EA5A 2W2VA 1SXJD 4D0LB 2ZITA 2CL0X 3E70C 3AKYA 4PPGA 2Z83A 5FOXA 4KBGA 1YZGA 1E94E 1G17A 2AD1A 1IJFA 2JASA 3C4JA 3KXKA 5CDFA 4DHEA 2FN4A 2N42A 3K9GA 3CUEF 1S9DA 1XXHB 3PIRA 4NZYA 5CM9C 5JI2E 4DUGA 1NYEA 1XTJA 3EWAA 3I73A 3OFNA 4TMZA 1TEVA 4TL7A 1Y63A 4IDNA 1XMSA 3T1HC 4X66C 5GVRA 3T5GA 2H7VA 4DCNA 2H8KA 3CRRA 6Q21A 2VHTA 2WSSD 3T15A 5L3SB 1HNZC 3T1QA 4LJ5A 1HQYE 4B47A 3H4MA 1E2JA 2XEXA 2IHBA 1PZNA 1N5JA 2CJWB 2OM2A 2R6CA 3B82A 1QVAA 4BRUA 1N6HA 4BUJA 3PUXA 1IY2A 3NVAA 3PCRB 1QRAA 1TF7A 2ZRPA 1ZNYA 3CNLA 1WMSA 3SN6A 2ATWA 1NY5A 2ZUCA 2XXAA 3ADKA 4PANA 1IN6A 1T0JB 3NBFA 3BH7A 3CRMA 1SXJB 5KDDA 4KYIB 3PFIA 4TQAA 2ZYUX 3D6TB 1Y3AA 3BAFA 1A82A 1KSGA 1II9A 2EGTA 4IJMA 1VTKA 2GJAA 3BWDD 5TMPA 3VHXA 4IFEA 4A2PA 4NYMQ 1OIWA 1XF9A 4YDSA 4WZBE 4P4SA 4LHXA 5L8VA 1IM2A 4WZ6A 4OQMA 2BMFA 2GEUA 2Y8EA 2AL7A 1L2FA 1G9XA 2H16A 1OW3B 1N2CE 2FGJA 1GZSA 2UUCC 3DPUA 2DYJA 4I1VA 3A8TA 3ADDA 1QVRA 4XWKA 3OIYA 4ZDWA 2QL8A 1OB2A 4E5UA 4A1FA 4HAXA 3NC0C 5CIWA 3B1YA 2VRWA 3I3SR 2IWHA 1WA5A 1XXHE 2BC9A 4KXFB 5DYIA 2NMVA 4KFRA 4K46A 5J4LA 4LJ6A 1TEXA 2AK2A 4FMCB 2OPLA 1W0JD 1XTIA 5JJIA 1D2NA 1G3MA 1SXJA 4Q47A 3K9LA 1FJGC 4CT4B 1SKYE 2BKEA 2WTUA 1RIFA 5KPDA 1IXRC 3KQHA 4BFTA 3F8TA 1E9BA 1XCPA 2ZSDA 3QKRA 4TTQA 1N6NA 1ZC3A 5JEEA 2QTHA 4AD8A 1KTVA 2ONKA 4PHGA 4XJXA 3C14C 2KBEA 1ONBA 1EX6A 2D3WA 4B33A 2DWOA 4Q18A 1HE1C 4B3MC 2ZTSA 2DFNA 4TLEA 4LJAA 2ZPTX 2EFDB 2OZEA 3FFAA 4AWXA 2XNDA 1A2KC 1NG9A 5H68A 3UMSA 3IEUA 4D81A 1GITA 2GZHA 3Q7QA 2RMKA 2AWNA 2CLSA 5GJVC 2ZRLA 3RLFA 3P32A 3NKVA 5DYGA 5FOSA 3T12A 1KY3A 3GLHB 4WZAE 3OAAD 2BVNA 3KJIA 5EE1A 3HP1A 5FTNA 2WWGA 1G7RA 3CPEA 3GJ0A 4B2LA 1W4AA 3QKRB 4W5JA 4EPYA 4DB2A 4OHXA 4A15A 1X3SA 2BMJA 2OO7A 1OFTA 4LHZA 2HJGA 1M34E 2QROA 1E2LA 3HR8A 1S8FA 4QM7A 2A3RA 1JJ7A 1Z0DA 4GRAA 4ITRC 5JRJA 1ZCAA 1YKSA 3CKLA 4D82A 1AZSC 4GKKC 1BIFA 4M1KA 5TXGA 5EXXA 3ZZTA 3IHLA 4G3XA 4I4LA 4HB2A 2UU9C 3SQWA 1GTVA 1RPZA 4BLTA 3LRPA 1FL9A 2AFIE 1I2MA 1LS1A 4HATA 4M8NE 3RRNA 4BEBA 5HZKA 3RANA 5K8TA 3FKSD 4JVSB 5A4JA 4EFLA 3K70B 3AF1A 4NCJA 4X8LA 2QAGB 4HYYA 3B8HA 3BK7A 1SKYB 3OIVA 4HAWA 4RFSB 2F43A 4DC9A 1PUJA 4LJYA 2AR7A 3X1DA 1J8MF 2QA5A 1LQLA 3VTKA 4EPRA 3D8BA 4OI4A 5FH9A 2W2TA 2ZANA 1XMJA 3LLUA 2RGEA 1TQ2A 3T61A 1CXZA 1GL6A 1HE8B 3EIEA 5FL7D 1MABB 4Z54A 1F2TB 2ZM5A 1XCGB 1U8AA 3M4YA 521PA 5FPHA 2BM0A 3U61B 4MQBA 2FSFA 5CDFE 2J7PD 3R8CA 3CM0A 3LQQA 1G19A 1DELA 2RHMA 3KL4A 5A5GA 4TLBA 4TSFA 1F3OA 2REXB 4M21A 1CRQA 1G7SA 1NY6A 1VIAA 4DEXA 1KI1A 4F93B 2A9KA 4PTLA 4C7OA 2QM8A 1XD2B 4V0OA 2CLDX 2H17A 1G5PA 3FMFA 2G1KA 2QE7D 4HZUB 4FW9A 3JVUA 4XSGA 1HY3A 3SZRA 1XWIA 5BN5A 2OAQ1 3KXIA 1IY1A 2BCJQ 3TJZA 2CE7A 2OESA 3SYNA 4OI1A 5SZKB 5IHPA 3IQWA 4Q7KA 4Y0VA 4L5BA 1W1WA 4LYAA 1X1SA 4LX0A 1T3SA 2ZI9A 1YZKA 1FX0B 2HLDA 4PC7A 3NBZC 2FOLA 4B75A 5L3SA 1CJKC 1TU3A 3M6AA 1DBSA 1FP6A 4JZKA 2BJVA 1VIYA 2GJ9A 3AUYA 3ZH9B 2CE2X 3SYLA 3DO6A 1XEFA 2JA1A 4TSFD 1G64A 2DYKA 2QI9C 1NLFA 4US0R 4JSYA 3TSZA 4D80A 3JZAA 1ETUA 1Q20A 3C5HA 3KUDA 1CU1A 4JI6C 2QBYA 1BMFA 4MYCA 4YY3C 2UXCC 4X8MA 1OIXA 4DCVA 2V6IA 5FPSA 3AVVA 1XBTA 2GBLA 3VKHA 4LPKA 1ZCBA 2BEKA 4QJ3A 5EE0A 5F98A 4DLVA 3K09C 2VTKA 4LJ8A 8OHMA 2CK3D 4TWZA 4C0LA 1JPNA 1KNQA 2XZOA 1VYVA 4CGZA 3GMTA 2VSOA 5F9FA 3CO5A 4HSEA 3WMGA 1I4DD 1RRFA 4OQLA 4UXHA 3TAUA 3PEVA 3U4QA 2XJ9A 2ZSAA 4CEJA 1E2MA 1HEIA 1F2UB 2QRNA 3ICQB 2RGGA 4ASUA 3R8FA 4PAQA 1E69A 2E1RA 4KLZA 3KQKA 3B5JA 2O0KA 4NP6A 5BYJA 4TYYA 3K0SA 4US1R 2GETA 2YWGA 3DM9B 2Q3FA 4CZ2A 2RKOA 5HCNA 1SHZA 3GD7A 3NEYA 1NKTA 4A8JB 4DT1B 4TMWA 4KCGA 5J4HA 5SZJA 3FVQA 4NHOA 3B85A 3AGPA 2F4VC 1LW7A 2QPTA 2NPFA 1OFHA 4YXWD 4R7ZA 2QN6A 3OAAA 4V0MA 4B43A 3VX3A 1UKEA 4C2TA 4ZDKA 4BQSA 4NE2A 3NTUA 3K8YA 2MMGA 3WP0A 5B58C 1S1CA 3K09A 421PA 1TX4B 3DOFA 3SC3A 2ZJ5A 3CX8A 4B3TC 2P67A 1M7GA 2JMPA 3H84A 4QHTA 1G8HA 1G6OA 2VP9A 5EE5B 1I2DA 3NBYC 4OK5A 2FU5C 3A1VA 2PBRA 1OHHD 1UEIA 1Z83A 2XZPA 2MSCB 4MYUA 3AF5A 2W0MA 4QJ5A 1I4TD 4GSYA 4M1OA 3F0TA 4PO1A 2IUTA 4DLSA 4DLYA 3OTOC 4Z8XA 2QNRA 1ODFA 2F43B 5HE9A 4QRHA 3AM1A 1A2BA 2LWIA 2FFHA 4FWIB 1P6XA 2AWOA 2WJHA 2OLJA 4IXNA 2E8CA 2JDIA 3VKGA 2YOGA 3K0AA 3MWJA 5JJKA 2QMHA 3QJYA 2VSFA 5L3QB 4C0QC 5CYPA 4RD0A 3IIKA 1Z6XA 2VP4A 2BHRA 4MYHA 1DOAA 2WSMA 1E9SA 3S1AA 2B92A 5J4KA 5KO2A 5K8LA 3UANA 3CRW1 2Z43A 4OK6A 4QKQA 3EAQA 3RC8A 5FPTA 3WRYC 1MOZA 1XNJA 2FFAA 1P9WA 5EUMA 1G8GA 1RE0A 2J59A 1UDXA 1RKBA 2FH5B 4B6EA 1GUAA 3CB4A 1IN5A 3OFND 2R9VA 2VO1A 4OJQA 3C15C 1MO6A 4KFSA 4UKDA 2KWIA 3SBEA 2KSQA 3T34A 4JV5C 3ZVLA 2Q9AA 1G3RA 1XMVA 4L8GA 1N5KA 1T3HA 1R7RA 4LYHA 4AKIA 1AZTA 2V4ZA 4L16A 1L8QA 2DWQA 2ZJBA 3DKVA 1K5DA 2FGKA 2ZS7A 2ZJAA 2I3BA 3AVWA 1KSJA 1E2NA 1U2RA 2XTMA 3BORA 2QRZA 3GQBA 3ASYA 1DEKA 5BXQC 3OEHD 1KJYA 3GP8A 3W8NA 1N6OA 3THWA 2O52A 3I4LA 2UXBC 1IOZA 3ZYCA 4LI0A 4TTPA 4XX2A 1GKIA 4URUR 3UMRA 4C0AC 2V54A 2HV8A 1Z8FA 4KSCA 1DG3A 1U90A 5DLQC 2IS2A 2VBCA 2WAXA 4HZUA 1SQ5A 3GJ5A 5EXTA 3ZQJA 4D0GA 4DCTA 1QDEA 1CEEA 2IYRA 2HJVA 3B1VA 1OH8A 4NXNC 3VHLB 1S2MA 4DR1C 1ZD1A 1G8YA 1OYYA 3BE4A 3LBHA 3U6BA 1DAKA 2VPPA 4JLDA 2CLCX 3F5FA 1P2VA 4MGYR 3N70A 2VSXA 4GZLA 1XJ0A 3N2EA 4KSBA 1G4AE 1USPB 1UBGA 4C0BA 4CDGA 5K8IA 1KK0A 2ZRBA 4CF7A 5TVKA 4B3SC 1W4CA 2IC5A 2PZGA 3EW9A 5BQ5A 2ZAOA 1AS3A 2GEVA 4QOSA 4R2IA 1U94A 1KKLA 1QHHA 2XNSA 3IPXA 1COWD 1SXJC 2QZ4A 3GCGA 1HH2P 1E0KA 2ZJYA 4NU0A 3G82C 4HI0E 4YLGA 3TE6A 3ND9A 1FQKA 1OH7A 4YMSA 4JLPA 2H5EA 1U81A 2IX3A 4MH0R 4IOKA 2JJ8A 5FR1A 1HURA 4EPVA 4ARZA 3WRXC 1RFLA 2VH5R 2JLSA 5FUWA 4MGKR 2O8EB 2QAJA 4Q4LA 2OSBA 3ONWA 3GEIA 3NG1A 5JMTA 5FOTA 1VDZA 3J81D 1M1YE 4A36A 2ERXA 1YRAA 4PC3A 2DFLA 2O8FB 1P73A 2PT7G 1FOEB 1GILA 2QORA 2JJ1A 1X1RA 2RCNA 1MV5A 3MJHA 4KHZA 4GKJC 2ZROA 3BH0A 2FSIA 3K0FA 4UXIA 1VYUA 3C5CA 2JJ2D 3TVTA 4XIGS 3VAAA 4XD7A 2OAP1 1M7HA 2WKRA 3ZZUA 4LHWA 4A2WA 4NTZA 3U2QA 4RD4A 3CF2A 5DI3B 1XNRC 1C4OA 3LXXA 4TL9A 1NJGA 3KFVA 4DR7C 1UFQA 1SVLA 1VMAA 5J40A 4YMVA 3BERA 4B3CA 1IN7A 1E2FA 3KQLA 3AF6A 1NBMA 2ZI4A 3SFZA 1XEXA 3A6PC 2Z0MA 1ZRHA 4GNKA 1B0UA 4Q4AA 4IOLA 1Z2AA 3MG9A 3AVUA 2RB4A 4Q00A 3WHKA 2CL6X 2A2ZA 1TPZA 3QSYA 1KI8A 4AYWA 3REGA 4BLRA 1E2HA 2X77A 1GRQA 3B1ZA 5G3YA 1KI4A 3WNDA 2BV3A 2P6RA 1RYFA 5DI3A 5DE3A 4UQOA 3Q8XB 3A1TA 3KJEA
chains in the Genus database with same CATH superfamily
1PFQA 2CNWA 3IJRA 3B3GA 2Y0CA 2O9JA 2GZMA 2XF8A 1FFSA 3NIWA 4ARSA 4HWKA 1WXQA 4L6CA 3VHRA 1NVDA 3LF2A 4YECA 4DA9A 4AMGA 3FBWA 2Q3LA 3BGSA 4L4SA 3ZHUA 3SHOA 4CDRA 3D2BA 1Y3IA 4IF6A 3VPDA 4D96A 1QVWA 3HO8A 1NVEA 3L8EA 3K2QA 3FOAA 2H1FA 2I9PA 3CH6A 2E4XA 4WLUA 4HYQA 5TPWB 5BRAA 1HLGA 2C3OA 2IX9A 3QEMB 4I6GA 4KN9S 5D3MA 3WL4A 1KJWA 4LXQA 1LDGA 1BRMA 1IZYA 1UPAA 4J7XA 4JP1A 4PZLA 3GIWA 4F91B 1QNFA 1FLAA 3HVHA 1S3FA 3MMNA 5CBKA 2LPMA 1F06A 4LV8B 4YPOA 2AV6A 3IBFA 2OO5A 2O8EA 3HTXA 3G9ZA 3HI4A 2PIDA 4KZKA 1E3IA 4PN7A 3FTFA 3LRTA 2C1ZA 3QM1A 4UE2A 4JJ6A 3VU1A 2R0QC 2CNWD 1KGSA 1QGOA 4RKYA 4EHDA 3T7TA 5AVRA 1TMKA 2DCMA 3A14A 3VX4A 1V7QA 1D07A 3OY7A 1LDBA 4RK6A 1KFKB 4L76A 4CLEA 5F1OA 4JNKA 1YKFA 5BW5A 4EB8A 4A16A 4DRXB 5P8WA 4I3GA 1CVRA 4BQNA 1NXVA 2JIPA 3EQ8A 4J16C 4J4TA 4X66B 3EX7C 4OB7A 4FBGA 5FOUA 3RSQA 2ZSIA 4UUAA 3PC4A 5GWXA 4BMPB 1WCIA 5HMLA 1K5PA 3QE0A 1EXVA 1PD1A 1PFUA 4RF3A 4RDHA 5D3MB 2Q7DA 2H54A 1Q3HA 3GNLA 2A5YB 2X4IA 2ZBQA 4ENQA 2QT9A 3BILA 3B1JA 3ZS9A 5SICE 5GZ6A 4DR3C 3P4XA 4PHHA 1D1SA 5KHAA 3GEMA 4G1EB 4E30A 5JQGA 1UFKA 1OKKD 4J7CA 1NDQA 2X1LA 3DBHB 5GQSA 3UN1A 3S82A 4RK4A 2A7XA 1VKNA 1E89A 2N3ZA 3IAM1 2O8CA 1K7FB 3O2SB 4OJYA 4IJQA 2QD5A 2EERA 2YBEA 2AMLA 1T9BA 3HA7A 3I6QA 4RPLA 3WLEA 3AOEC 3FGOA 3TLGA 4C4ZA 2IUEA 4JYPA 4RVUA 1Y8CA 2KI5A 3BIXA 2AG1A 1NU6A 2OWDA 3UB2A 3QBTA 2ECQA 2HYDA 1NYQA 2XE6A 1GIAA 3SX0A 5JRHA 2Q5HA 1ECJA 3LZ6A 3DVLA 3QUCA 3QW4B 3D2LA 4UNSA 5ALTA 1PNOA 2PBLA 1E9DA 4B9AA 4YJGB 3K32A 1XXHA 5I7EA 2FSGA 3K05A 5E7QA 2JGNA 4G4SO 1OXSC 4MW7A 1DJNA 1W94A 3TRDA 5A3JA 2G9QA 4QUJA 1Q6YA 4OAPA 5DP1A 2ZRFA 4HNQA 4KITB 4FU0A 1FDUA 2ZJ3A 5LQSA 5FA8A 4NV0A 1OROA 5BSRA 3Q7EA 4FTFA 2MSNA 9ATCA 3JQBC 1WPRA 5A4KA 1P91A 3K8ZA 1VPLA 4RAOA 3MMPA 1R5NA 4TGLA 3RUDA 4DJDC 1J07A 3NHUA 4PUIA 4ZT7A 2DC1A 3KEOA 2QOEA 1MT0A 4OGFA 3F71A 3OHMA 2J9XB 1E3TA 4U9IS 4GI2A 4INOA 1HDRA 4YJHA 5FI5A 3DKKA 2P7HA 1VKHA 3SIRA 4A2QA 4G0VA 2WU8A 3MJRA 3VGJA 3GLIB 2R751 3PX7A 3LPNA 3LHFA 3NRCA 1B1CA 2QUHA 1IY0A 3U3KA 3G5LA 3WV4A 4AG6A 2WAMA 4D0RA 3O84A 1HQCA 4V1CI 1N7GA 1SAYA 3HWWA 3FX2A 1FZTA 3EARA 3S81A 4YPFA 1PL7A 2JGIA 2OD9A 4FHEA 4KGXA 1RBMA 1CB0A 2Z5VA 3QIVA 4LSWA 1P1CA 4N3GA 2I3DA 2J6CA 2RI6A 1BMDA 4AMZA 2HQOA 3CWQA 1LVUA 4Q1BA 1SH7A 1PR0A 3JASB 4GMDA 4NX2A 2EG5A 3GN1A 3UW1A 4GBGA 3WLAA 2D1FA 3PA8A 5K05A 4AS3A 1QUFA 2ZE8A 2Z2KA 3IQGX 3OESA 4LYGA 2QL7A 1E62A 2YQ4A 4H1WA 4V1CA 1QMPA 1ML3A 2WM8A 4MLCA 3WZMA 3X2SA 2P2YA 4Z5XA 4F71A 1UAGA 5HHTA 1VPWA 1UKYA 2H18A 2IPOA 3FY4A 2B36A 4AL4A 1YJXA 2OC4A 2YUTA 5AJTA 4RLSA 4L4QA 4N3BA 4YAGA 4S1VA 5LUAA 5EZSA 3PDHA 2BI8A 2PQ2A 2YWFA 3Q3CA 3SDBA 3V7YA 3WIUA 5AI0A 1XD8A 2NYAA 2KB0A 1JMKC 2E4UA 2ODNA 2OQIA 2W6JD 3LBYA 4J1QA 3DTTA 1ZM9A 2PCLA 3U3RA 3J7AC 4F38A 1M6HA 3ZY4A 5IT4A 5KUTA 4YHHC 3I8SA 3JWJA 3KSDO 3B7PA 3PQ2A 3TDNA 3ZGNA 3ZDCA 4ROSA 2HJ9A 3RNLA 3MMXA 1BWQA 3HDJA 3R3ZA 4LYEA 2FR8C 2HSEA 4FT4A 2OHFA 4MVCA 2VTEA 4FPXA 3UV3A 4F2DA 2PCJA 3ETJA 4IL5A 4WLVA 4O02B 4GT1A 1S1MA 2XYHA 5BN3A 4DMHA 1LDMA 4L1KA 4NBKA 2AXNA 2R6ZA 3OZWA 3KWMA 1YK0A 4QGBA 4AJJA 5IEJA 4ABTA 3VI3B 1UK7A 4JLVA 3RHTA 2I6UA 3HSKA 3M6UA 3QMWA 4KDEA 4QBGB 1FK8A 1FXUA 1VDMA 4KWIA 1V39A 1XKXA 5IK2A 2H4FA 3IKTA 4G1FA 4PLWA 4I9NA 1UMCA 4J0QA 4RMNA 3BFPA 4BCBA 4WX2B 4Q9JA 2R8BA 2WNSA 2OBNA 4CIDA 4JYBA 2IE0A 2O20A 1TJYA 4D98A 2W6JA 3AIKA 3RJZA 2J8ZA 4DMKA 1COZA 1XQXA 2X0FA 1B6TA 4B3XA 1CUFA 2BH9A 2PV7A 3D3WB 2D5BA 4RTSA 4LHYA 5BUQA 5FB3A 1WB9A 1KF0A 3KVVA 3A2KA 3OBIA 4EY6A 4DV5B 4DV4B 5HKLA 3GQBB 4I99A 4NH4A 4YCBA 2D00A 4BYMA 4P86A 3QWBA 5TS2A 3GCXA 4YRQA 1BRTA 1M6YA 3EZ9A 1AUXA 1K2VN 2HC9A 3PD1A 4DNXA 1W59A 3DLTA 2XUFA 4LFCC 1WU8A 1XZHA 2R65A 3OCJA 4YIKA 2H4JA 5EUCA 4KHPB 3U44B 3ISVA 2QM3A 3DF9A 3FBGA 1XTQA 1Y6JA 1BXRA 4O2LA 3R3YA 1MU0A 2LUOA 1D3AA 3IYLW 3LC1O 3IB6A 4RTRA 5AJHA 3K70C 1TAQA 3Q6MA 3KOMA 5IDWA 3RYCB 4GXTA 3RHSA 3R40A 3RVMA 4PROC 5DISB 4RJIA 1PQWA 3ELYA 2GUGA 3PUVA 1VI2A 4HAVA 4I50B 1FQJA 2G7ZA 4PXYA 2V7TA 3VAYA 3H2YA 2HCJB 2FQXA 3IP5A 5CJPA 1QJCA 3SYMA 3TTSA 3NGLA 3E7FA 1GYRA 2E5WA 1QQ6A 3A6EA 4YP5A 2BFBB 4CKZA 1E9VA 2WIKA 4R1TA 5ABPA 4F4HA 2AQ8A 1ZN8A 1FRZA 1GZ5A 2FFJA 4WSOA 1GTG1 4JEMA 3BXEA 4NBRA 3B2NA 1I2CA 4WK0B 4B09A 2FV8A 2XVXA 1Y9EA 3EHEA 3RWOA 2XHEA 2K2QB 5TARA 4DPMA 3SSAA 1RXSA 1RM3A 1I7LA 1ZNXA 2QX8A 3NUZA 4IQ4A 4LMRA 3DXXA 2FY8A 4XD2A 2ZRKA 4TXJA 4D0SA 2O8BA 1BEUB 3M4NA 2PLFA 3RAGA 3KHTA 2PUAA 1P2TA 3FZYA 2FEOA 4L75A 3BJEA 1IJEA 4E21A 2ZIUB 2SKDA 3C7KA 2O7QA 1IM5A 2F8LA 4MQEA 3P2KA 3A9UA 3H4VA 1VJCA 2NZ8A 4OQXA 4XH9B 4YH1A 3G5UA 1WE2A 4G8DA 3ZWPA 5K6TA 1U8YA 3FR7A 2FPLA 1KMCA 5ERYA 5KTTA 1UBKS 3EPLA 1N36C 5IXSA 3JYOA 1NUQA 3DAHA 3IUBA 3EVAA 1LUAA 4L9AA 3IX7A 1LK7A 1ZIYA 4GI5A 1WCXA 3NVKI 2HU2A 1K5HA 4L4XA 1VLMA 4A92A 1Z6AA 3NWPA 4D42A 1VJ1A 2OYCA 1RXCA 5ILGA 3OBBA 3U4GA 4LQLA 5EKSA 4Q01A 5JDCC 1V3QE 3B7WA 1R0BA 4RKFA 2CLEB 1D8AA 5KKNB 4DT1A 3VNRA 1FX1A 4FUTA 3CVJA 1IG3A 2W6PA 3B9PA 3IGFA 4QEKA 5EN4A 5IARA 4RTQA 3K71B 5JMPA 3ASUA 5ALIA 1ULHA 3VKVA 4RH0A 2PX6A 5FTJA 1DDGA 1TKBA 5LWHA 4BO4A 3CBGA 1NYRA 3U31A 1JL3A 4GLBA 1PT6A 1TYAE 1ZL0A 1IEVA 2GEDA 2OUIA 3IJ5A 4PSCA 5AJZA 4DJEC 5JD5A 1NLYA 4IRUB 4YMHA 3TW8A 5F5LA 4E5KA 1VPEA 3DWEX 3CCFA 1E3EA 3MFYA 4CQMA 1SXGA 1WD7A 4BBYA 3KQMA 4LYJA 1QR2A 1G18A 2GF2A 3O9MA 4CM9A 2AFVA 4PZZA 1WHTB 1O95D 3U5TA 3ZJUA 1A76A 2ATXA 4QQFA 5MDHA 3GJRA 4AJPA 3IA2A 1QFSA 1EMDA 2X1MA 1OY1A 4JYAB 4QYTA 2CZGA 3KCQA 2RH8A 1Z4NA 3MS4A 1PE0A 2VRCD 5CW2A 4PYNA 1Q7EA 4OHOA 2G80A 3OIDA 1FZQA 2GDZA 3QG5A 1WEKA 2GXQA 4XB2A 3COSA 1M2OB 5BN4A 1QE5A 4DM7A 2C04A 3KDPA 4O2RA 2AVNA 1QO7A 1KO1A 4JKOA 3VMMA 5C8VA 2ZTUA 3NOXA 3OA0A 2H51A 1Z7EA 2NXWA 5DKFA 1KDZA 5L6LB 3WWCA 3PV0A 1JXAA 3MRTA 1BCRB 4M99A 5ADUS 3X3HA 3FW1A 3OQ1A 1XZ8A 2REOA 1CSEE 1A77A 1QM4A 4M53A 3VNAA 2VHYA 2B1JA 4LSGA 1WX1A 3DGEC 4OFBA 5D85A 4BMCA 3MRXA 4TPSB 2VPIA 4UTXA 3IEKA 2QT1A 2VEOA 1T6XA 4EG4A 4PBTA 5FNZA 3IIMA 1AM4D 2D4HA 2WIAA 1P3Y1 2OV1A 3GZNB 3ZD7A 4ENWA 2ZT7A 2IYYA 3K8OE 1VPDA 2CCGA 2O7NA 4N7RA 2X14A 4TWRA 3DMYA 3DXYA 3RSCA 3ZW7A 5FLXA 3SC4A 4P3KA 4MHTA 3Q5DA 3NBMA 1KZYC 4IDOA 5JS7A 4RDCA 4CBVA 3TPZA 2F59A 3L07A 4MP8A 4IQGA 4KV9A 3G0HA 2ZRCA 3N2QA 1XD2A 3QFTA 3IDAA 2PEYA 1P18A 3SJCA 5C5EA 3B51X 1XN1A 1P4EA 2P4UA 1TCCA 3IPAA 2MSKA 4JQZA 5HDBB 3STTA 3CR7A 3IB3A 4QQNA 1XJCA 4X54A 4E4YA 3I6ZA 2ZVJA 2BISA 3B53X 4GOKA 4DCGA 2QM0A 2C3YA 3BMNA 4L95C 1XEWX 3GT0A 4GEGA 1N5MA 1GG9A 4ZALA 3RF7A 4F2WA 5B2EA 1K7XB 3E61A 3L7LA 5JCJA 3GPDG 3RC9A 1H42A 3L4BC 4B6QA 4C6TA 1O6ZA 4F5ZA 2H4YA 2DEUA 2JFPA 3HLYA 2ZG6A 5D2CA 2DBYA 4KYTA 5C4GB 1ZY2A 2XXBA 3K31A 4AJOA 4BN0A 4F9TA 4BC0A 3G6WA 3EQ9A 4RA6B 2HT1A 3DTVA 4JLAA 4X91A 1W4BA 5L3RA 5THKA 3TVDA 1RQ2A 3NYIA 4HRXA 2I4NA 1T36B 2FXVA 3CSDA 3EXG2 1MO5A 2YW9A 5MN4A 1OUMA 4NMXB 4ER7A 1KYTA 4CWAA 2ZS9A 2AEJA 2D2FA 4R1PA 2NXCA 1XJ5A 1YHYA 4NCKA 4MS1A 2XLBA 5A3QA 2WMDA 1NJ8A 1T4CB 3KJQA 2ZYVX 3LC2O 4KWTA 1JE1A 1QHNA 4PVCA 2C8VA 4QPNA 3UJ3X 3K53A 4BEWA 2VJQA 3L4SO 3AZQA 2XZLA 2NXJA 3WXMA 1KETA 1WQ1R 1TK3A 1S02A 2OP0A 3GA0A 1SQSA 3GA5A 3U6KA 2FPIB 4JITA 4MYTA 4YQFA 3Q11A 3CVOA 5AW1A 1CY4A 4ACAA 1DRJA 4P35A 1W36B 2W2OA 1XZFA 1PNVA 1FFWA 3H8WA 4KMSA 4X3PA 1GKYA 3MJEA 3AB8A 1QU2A 3VPHA 3ANTA 3HEBA 2F1RA 4LVUA 1CF9A 5JVDF 1FRFS 2WAOA 4JI5C 3U44A 1KPIA 1XTUA 1KNXA 1NBOA 3MCUA 2OGSA 1LBTA 2UDPA 3E9QA 5JNUA 5LLSA 2GNAA 3H5IA 4YI3A 4ZT6A 5KAMA 4NG4A 1ZSVA 2MSEB 2I9KA 4P81A 3BS4A 4E2ZA 2PS9A 3DOEA 1NBAA 4XVQA 3T1YB 4OXNA 2P6OA 2VOEA 3EXHB 4MIYA 3FYSA 5F23A 2H07A 2GBPA 3NT4A 3QKUA 2YV2A 4UU0A 3WWPA 1SC3A 4KQCA 5JAZA 1XRNA 2JD1A 3RSOA 1NBIA 3EIQA 2UUBC 2NAFA 4PTYA 3H2ZA 4I4IA 2YC4C 4RXMA 4CMJA 6GPBA 2YQ5A 3FUTA 3N2KA 3CT6A 4NXNB 5T41A 4CODB 4E2FA 1F38A 1B41A 2QEQA 2UKDA 3FSRA 4V2IA 1YTUA 3ON5A 3TQCA 4W63A 1RAEA 2XWQA 5FYQA 1G55A 3M82A 3ONEA 5DSTA 2E4ZA 2PSSA 3RU2A 3L8GA 1E1RD 4UMVA 5JTTA 1EJ0A 4PG5A 2HIGA 2I03A 5B37A 1WSBA 1WG8A 4BGIA 1TVEA 1GQOA 4TQUS 1JEOA 3ECCA 2OC9A 4YVFA 4H7IA 5LUBA 3QKSA 3L7NA 3E9NA 1DNPA 3SQLA 4MKGA 2IPAB 4IOMA 2ES4A 2HF7A 4KJZA 3WVNA 5BWOA 3RAEC 1DJMA 1LZLA 2IZ0A 3CWCA 2DM6A 3HO6A 1I33A 3C7CB 5AR1A 2IODA 4BQEA 3DW1X 3I72A 3HRHA 3NHRA 1UC9A 4IEIA 5HKKD 3KV3O 1UC4B 1FXWA 1RI2A 2QPAA 5PGMA 4NI5A 3A4VA 2PGDA 3DUFB 1M67A 1NPTO 4MEJA 5CH5A 1PSWA 4FHZA 4JI2C 4EM6A 5COBA 1KYYA 4AFNA 2R62A 4N5LA 1ZGZA 3E3AA 4DNQA 3NMUF 1RBQA 5C8DA 4IILA 2QD1A 2G08A 4MKRA 4M9UA 1B14A 4OBEA 3TI9A 1UBJS 5KREA 4GYYA 3WLQA 1J5XA 4JR1A 2BP7A 3CPJB 3DOIA 3P5SA 1IQPA 1IZ7A 1A2OA 3EMVA 1U8FO 1DKNA 2C96A 2XCUA 4OK3A 4E5SA 2GOYA 3PIIA 4RNCA 2QSUA 4LF5C 5BPHA 1R8SA 1WDWB 2VOJA 3N2LA 4RCZA 1HT3A 4N03A 2YCBA 3GU3A 3H0EA 4C4TA 1GTL1 1G41A 2H1SA 5K85A 1LZKA 1AH2A 1BX0A 3II6X 3LFUA 3HGMA 2EKQA 2Q29A 2ZIZA 3EYWA 1CP2A 3ESBA 3WK7A 3CH5A 3A6HA 4BZWA 2XXAB 3KZOA 1FB5A 1H2XA 4ZI7B 2Y1KA 4NG5A 4NYJQ 4QOGA 3W7AA 4B4DA 4EKYA 4S24A 4S12A 4XCXA 2CFOA 1GTSA 1LB1B 3LP6A 1USGA 2ZB4A 3S29A 2WAYA 1JG7A 1SR8A 3LM8A 5AQ1A 4BS9A 3NWEA 1U8EA 3FHOA 5U9CA 5KWSA 4KP7A 3DDCA 5CURA 3O92A 3WQRA 4F0JA 3K70D 4BDTA 1CZHA 1HOTA 3UZ0A 3KZVA 2NUAA 1JR4A 1GUYA 1FFGA 4XTCS 2BEWA 4YAWA 1Z4MA 4KOEC 3ADBA 3BWBA 2AOTB 5JCPA 3WJ2A 1YE5A 2FVYA 2J41A 3OM1A 1NNSA 4Z51A 2ZIXB 1MNQA 1PT7A 1XZAA 5EWLA 3W78A 2QUBA 2P9CA 2OXFA 1X6VA 1SXJE 1PX2A 2AKEA 3VU8A 1Z0ZA 1XU9A 1ZK3A 1E2IA 2YMMA 4YLEA 3NM4A 4WN9A 5FL3A 1H85A 3L05A 3D6UA 5TQVA 2R66A 3UPUA 3L8YA 1MN6A 1EVKA 3GKUA 4JDPA 4PS1A 3WGTA 5KNCH 3WGVA 4FEAA 1I94C 1ODSA 2A9VA 2L69A 4E4RA 3ZBPA 1EVJA 2C4UA 2R2AA 4RD3A 5HJ5A 1XCBA 3GRUA 3I32A 4OKIA 4WZBB 4RXTA 2R96A 3RVBA 3T35A 4EYSA 3V1UA 4DB4A 5LIPA 4II7A 1G20A 4KMOA 5EJ2A 2VDWB 3EE6A 4MEBA 1TRKA 4BZPA 4YMTA 2FPPB 5BSTA 1YVDA 3QF7A 4DCJA 4EUFA 5JBQA 1RPTA 4C08A 4HNSA 5K4HA 4KO8A 1POXA 4DXHA 2ZTHA 1EA5A 5KS2A 1B16A 2IEIA 1GZ6A 3LF1A 2GWHA 4YV1A 2VR1A 4HH1A 1OC2A 1ZJZA 2Q2VA 2XVZA 3IHTA 5JJBA 2X42A 5IFKA 3RJMA 2IYUA 3RQIA 5MGNA 3UBMA 3C3AA 1I51A 1ZH0A 3FKSA 1I4WA 1ZGGA 3PA6A 1P9RA 1W73A 1D2MA 1HFKA 2FFRA 2QRKA 3I6BA 1VGVA 2GPNA 4Q1CA 5ECWA 4DBZA 4FSXA 1NJ5A 5I9MA 2ZJ4A 3RS4A 3SQOA 1Y5MA 3VR3A 2JW5A 3UJHA 3W2TA 5J2UF 3UBTA 1IOLA 4D0NA 4RUKA 1N57A 3CJEA 3H5WA 3ETCA 1U3FA 1HRKA 2PRIA 3CLTD 1CUAA 2B4AA 3K9HA 4G5QA 4NNJA 5KYWB 1MB2A 2Q5OA 4C30A 3P52A 5CB4F 3UEBA 1P3DA 3EUEA 3Q7IA 4G0XA 4B84A 4IMIB 1Q22A 2GNPA 3AP3A 4Z8YA 1C0LA 1NC1A 1AZLA 2MR5A 5BRNA 1VCNA 5TT1A 5CEEA 1JQEA 3W3AH 3GBVA 1RHJA 3CGGA 1RNLA 2QIOA 4K6MA 1WUIS 3UA4A 3JQ7A 2D7VA 1XKTA 2DUMA 3SLGA 2SHKA 2OG2A 1Y9JA 2I1QA 3WNCA 2GCNA 3STUA 2BKAA 3DMHA 3SF8A 1MXBA 1LF0A 1FU8A 1LVGA 4MJXA 1XIVA 2Q6KA 4O2AF 4NOJA 3WLKX 4U02A 2YJNA 2C2ZA 3JAMD 1RTTA 1CUUA 4EJ6A 2VKQA 3BCRA 3C3CA 2EW1A 4CDMA 5JISA 1Y6GA 3P1JA 3NU1A 5LC1A 3NHLA 1USKA 2PX3A 1W49A 3R3WA 1GCIA 4EFMA 2CF6A 2UVPA 1HR0C 1WF6A 2GF0A 4OMUA 5EIBC 5EXEA 4OP3A 3ZV6A 5IG2A 4HEJA 2A5JA 3U0BA 2ECOA 1R5JA 1NNUA 5JHGB 4C9BA 2ZRNA 2NSYA 5ES3A 1V1RB 2CJWA 1IRIA 1E98A 1DJOA 2ONFA 1BJTA 3LNOA 4MWZA 2MINA 3GJXC 3HXMA 2C7OA 5A3VA 1I1HA 2BMAA 4IUYA 3WSVA 1YTLA 1ODIA 2I76A 4J0KA 1ZJYA 5AT1A 5EAIA 4Y2JA 3L7JA 2JATA 2IT1A 4R2LA 4XM1A 3MRSA 1Q19A 1VEHA 4JQSA 4EWLA 2F17A 2PUGA 3FNHA 5EPEA 2P3SA 3RTBA 1JE0A 3ED1A 2NSDA 4LTMA 2P5SA 2AMFA 4Q9LA 4H18A 4FGJA 4YAEA 2R6R1 2HBQA 2QY6A 1P4HA 1M7BA 4P5PA 4FK8A 4KO1S 1V6SA 2GM9A 1RVDA 2Z09A 4IGAA 3ETGA 4JLBA 5FJJA 1AGXA 4ZOQI 3SVLA 5E6UA 1WZCA 3DDZX 5CP8A 2FZ4A 4B17A 4JV5B 3LCJA 1YUNA 3NGXA 2X6RA 3I5MA 4O25A 5C8YB 1VE1A 3ZWOA 1E4YA 5KZMB 3PFKA 4DPLA 1SC9A 4ILKA 3EGOA 2VWGA 2HPAA 3D6NB 2HIAA 1DBPA 3O8OA 3LY5A 4J03A 4F96A 1TA0A 1NUUA 4ZDJA 2LIPA 5ESDA 5E95A 5GVSA 1ZHFA 3SLRA 1P2UA 3V8EA 2VXCA 2RHBA 1G6Q1 3AFIA 3HU2A 4OIMA 1ZLXA 4FQ8A 1W1IA 5EIBD 1HTTA 3IDFA 3ZNQA 2R5WA 4V0SA 1E6KA 1DQYA 1P7WA 3JALA 5L4NA 3N07A 2DBVO 4BPRA 4K9SA 4PRZA 5L3QA 5F51A 2DKNA 5F2OA 5ICCA 3P0RA 5GMOA 4E1VA 1BH2A 2FE4A 1XTPA 2V7QD 1V1MB 3JQRA 3WIBA 5HXAA 1XELA 4Q4HA 2A35A 4L02A 4KBYA 2C59A 4YRJA 3RWMB 3ZWVA 5FQNA 1YB6A 2ZU0C 2CUZA 2FDRA 3BMCA 2FX5A 4P3NA 4ADSG 5ALUA 2Q2NA 3AEKB 1KFJB 4JB3A 4ZA2A 3RRXA 3RVQA 1QWOA 4XM2A 1NZFA 1SHTX 5K2OA 2H1CA 1CDZA 2YY5A 4WCFC 4FNGA 1QR6A 3C85A 1W36D 4BWFB 5KOJA 1NI4A 1U3CA 3KUXA 4PQYA 1PWZA 4L7QA 4R2JA 1JIIA 5HS6A 2W00A 3COPA 2O1XA 2P4QA 3PR2B 1ORVA 1YRLA 4M83A 2QYSA 2Z1DA 5JWHA 4H16A 3I2JA 4KLAA 4LC0A 1ANKA 4N3AA 4V0LA 1CHNA 3S2GA 3HDTA 3TLZA 5IASA 2VF8A 3GPIA 3ZKAA 1KI3A 1PJ2A 1ZXLA 3F5DA 4XUGB 4KE6A 3TL2A 2HA4A 4EGJA 1FU4A 3I8OA 4BUCA 2LTAA 1E3WA 2D8MA 1AV7A 1UPXA 1HT2E 2OT3B 1EHYA 4FCWA 4TS4A 3UIEA 1QQBA 3MCVA 2AZXA 4F72A 3OTIA 5D6NA 1D6NA 2X2EA 3UWKA 1MG0A 1P1HA 1PKXA 3QY0A 4LCJA 3WGNA 4BP8A 4LBYA 4O29A 1EUZA 1N9GA 1M2HA 1RP1A 2YXBA 4MOWA 4OHWA 3G0OA 4QJ4A 3S6JA 3AKZA 2D7DA 2P69A 5K0JA 2PS3A 4LOKA 4RW0A 4B6GA 5AHKA 3D8SA 1BXGB 2I4OA 2GESA 5TRTA 5HK9A 4E0BA 3COWA 2P5UA 1KQGA 1TLFA 1MA3A 3ILSA 1Z2PX 4AS2A 2X7HA 3HUTA 4J7UA 1AQUA 3NX4A 4I36A 2I2AA 1WV1A 3HE3A 3VJRA 1SK9A 2QQEA 4JOCA 3B48A 1UAAA 3IQXA 4PX9A 2W6ID 5DXJA 4MPJA 3DE0X 1BXRB 4F5DA 1UINA 1WDTA 1DJLA 2RGNA 4L0DA 4XGIA 1E2BA 1AXEA 3RTGA 1RAFA 3SU8A 2O0LA 1UP6A 4R3NA 4EVSA 2CBXA 1NW6A 2A14A 1KZHA 3ZHZA 3SOPA 3WY9A 2HRQA 4P4GA 5IDYA 1H2YA 1ST2A 1Y42X 1PR1A 4NL4H 1PVDA 3A70A 1L4KA 2AQHA 2EGHA 2P4EA 2R8XA 2EFEB 2VDQB 3WG9A 4D41A 5TS3A 4BU1A 4DSUA 5BSFA 5ED4A 4JXZA 4FC7A 1K89A 1Z68A 2BCGY 3F46A 1ML8A 3B3JA 4MAAA 5AVZA 4DCUA 1Z8HA 2ZGVA 2DGDA 5KKAA 3L5KA 4EVRA 5U4QA 2JLZA 3CA8A 4E51A 2PZ8A 1CY2A 1NVXQ 2WVHA 3PNSA 4PZ9A 4A82A 4CETA 5J58A 2BZ0A 3N54B 3H18A 1YD7A 3MWDB 4IDPA 1EEXB 4LZJA 5DGCA 4YRSA 3IUSA 1TEHA 4MDEA 1CLEA 3E3MA 4DILA 3BFVA 2WA2A 2WJIA 5K3FB 3VBEA 1M2VB 2EJBA 2VHXA 5CA0F 2W2KA 2ZR9A 1YB1A 2IYNA 1D1PA 4DWOA 3NXKA 3UUFA 4CPDA 1HX7A 2JGEA 5I6DA 2R1TA 2OLKA 4BKRA 1V8BA 3SJUA 2I2CA 2JZNA 5IKOA 3VR4A 3X2FA 2VJCA 4LF6B 4IHJB 2Q21A 3HADA 3UK1A 4AJ1A 1I32A 4FBLA 2WU4A 1N5IA 3OOYA 4RZSA 3HCDA 1H8EA 1QZZA 1GZDA 2P0YA 3JQ8A 2P9EA 3QV2A 4GX5A 4DV5C 3SP1A 5BR4A 1UL1X 3DCIA 4BMYA 4ED9A 1IU9A 3NT5A 4F97A 4EGQA 2ZKIA 3L01A 3TLCA 3B6KA 5FFFA 4C4OA 2JHGA 1GADO 2VTVA 4M1WA 1LY1A 4CF5A 5C34B 1TC2A 2C77A 2WWFA 3H1FA 3KB6A 3HQ4O 2HF8A 2K5UA 4M8LA 3G23A 3MWKA 3CIOA 7AT1A 3I61A 2GD2A 2H2WA 4UHEA 1E5TA 1N25A 3EEIA 2VAVA 1IN8A 1FPMA 5MGBA 3LQRA 1WCJA 4F4IA 2XUQA 1Y81A 4A27A 1JKFA 3G79A 3KKMA 3RYTC 1OR8A 3W77A 3P45A 2V7UA 2PUBA 1WMAA 5EP3A 1XCLA 5BMVF 4Z1MA 2XADA 2XRMA 3UFBA 1OF1A 3A3PA 1DWQA 1YAHA 4ZJYA 2POCA 2JKYA 4NPHA 5HA5A 3JQ6A 1UFVA 1P0CA 2PRKA 1YL5A 2GO7A 3H3XA 2FRDC 5G0VA 4EF6A 1H94A 1XTSA 4NCAA 3CRQA 4D4LA 5DT2A 4KO3S 3MJDA 2CNLA 5JEDA 4RVOA 1SVNA 4P2BA 2ONCA 1U98A 1UBUS 4PC2A 1X13A 3H6KA 2IH5A 3GYBA 4BTVA 3A6JA 1RC1A 3O26A 1FP2A 4MLDA 4ND3A 3UOGA 2WP8J 3QFSA 2V7GA 2JHPA 2QSJA 4FVTA 4HUQB 4KAXA 1DMSA 1YZLA 4A6DA 2RK6A 4JUDX 4ZZ0A 1YQEA 1LK5A 2H2GA 3ME5A 2D2VA 2Q5QA 2SCUA 4ON9A 5GV7A 2ZZMA 1C1XA 1SHUX 4J94A 3DL0A 5FT9A 2BH2A 2LCQA 5JSKA 3PUZA 2OCYC 2OG1A 3AHHA 3TBKA 3PT9A 3F6RA 3UUGA 1CB7A 4DMUB 1EA7A 2QM7A 1GNVA 3CXRA 3NBXX 3TFOA 1CVLA 4DRYA 4DLUA 3ONDA 3G1TA 1L4HA 2COUA 5JCOA 2J3MA 3FF1A 5CDSA 1JR3A 1XVAA 4W5HA 5CVDA 3T3NA 1CYEA 4QQ8A 5DFAA 2LW7A 1QCCA 1WWKA 1MORA 1HO3A 1W34A 4EBBA 5KYYB 4IZOA 2UXDC 3LX8A 1ODKA 4P53A 3CU5A 4EW1A 3LQ2A 3REQA 2O8CB 2CXXA 2QL5A 2FE1A 3DPSA 4H7FA 5AI9A 2VDLB 4GPTA 1BO6A 1VECA 4IW3B 5J9FA 4GOJA 4N0QA 5KTPA 2M2IA 2ZE6A 3ELBA 4PZ0A 4BZXA 2KHZA 5IAJA 4UREA 4Y2VA 2J3HA 4Z9XA 3E7DA 5A19A 3GNQA 1S9HA 4G65A 5SY6A 4LYDA 4OQNA 4WINA 5ITZA 2QVLA 1YJCA 1KJZA 2BM9A 5J47A 3M7IA 1FRVA 4F8EA 1V4NA 3H04A 1I6LA 3HU1A 4KI7A 3UCFA 2WJVA 1EP1B 4FOSA 4Y67A 3TJMA 2QZSA 3O93A 1KE1A 4B9EA 4KGZA 4EI2A 4MS4B 1DBIA 4D8UA 4YIHA 2JVJA 4ZAGA 2RKBA 5LNK6 2WM3A 1UM8A 2LVBA 2HKIA 2XTAA 1OASA 1WH9A 3GFFA 2E82A 2XAAA 1TQDA 2C3PA 4H77A 5DEOA 3E3LA 1YV9A 4JUBA 4BFVA 5IXYA 3P4YA 3KYCA 4QRDA 5LQNA 4RMHA 4CF6A 1A04A 2CLOB 1QFXA 2D7CA 4C0WA 4ZCIA 4MTLA 1XDUA 1TU4A 3R3SA 4FCTA 1NMSA 4B6OA 1ZEMA 1M1NA 3GP3A 2BBTA 5JZSA 4LWZA 3C3WA 1YC2A 3NALA 1IHXA 2EBUA 1DWPA 3AHCA 1JG6A 4IFBA 3VR6H 3A6DA 3DDSA 5HGJA 3LAWA 3RS8A 1XLTA 4KSYA 1DC5A 2A5DA 2CL7X 4XCVA 4KMMA 2CLFB 3ZHYA 2NCLA 4YJ2A 2E4WA 2Q2WA 2WEKA 4MUJA 5EERA 2VFAA 3PYLA 4WIAA 3NRJA 1IUNA 2GF9A 3T9AA 1D7AA 2XGMA 1OFUA 3NDPA 1NQVA 5DU2A 3HM9A 1II8B 1YDEA 1H8ED 3FRHA 3R7BA 1M1YA 1BGVA 4GKVA 1WO8A 1C4WA 5DHUA 3K9QO 3S28A 3L4EA 3EEOA 1NVGA 1FYFA 1CULC 3IQZA 5FUYA 1LU9A 3C8UA 1Q0ZA 5KCMA 4QTUB 4AP5A 1DE0A 1Y1RA 4QX6A 3EOAI 2F4NA 3IAS1 3JATB 2ASVA 2VUHB 3KZKA 2F67A 4MVYA 3VZQA 4C04A 1G21A 1A95A 2GNOA 2J5RA 4XR9A 2Q1UA 3H5NA 5ENVA 4EW2A 1SKUA 1SBZA 1ADGA 1ZLYA 3QJ5A 3RTCA 3SC2A 1EFPB 1JMVA 3EUFA 1DJQA 2IYTA 3A1WA 3F3KA 3QX8A 4UJ3A 4NABA 4BO2A 1SCDA 1WS6A 3PQ3A 3E7XA 1XI2A 1DIGA 3T52A 3ZCXA 4IIUA 1UWKA 4UU8A 3RKRA 1NOIA 1PYDA 2QNBA 1IULA 2C31A 2UZIR 2ZWVA 3JYLA 3MLAA 2QN3A 3QPBA 1X15A 3UFXA 2Y05A 3WB9A 5AVQA 5JSQA 4NCHA 1VMKA 2HCTA 3REOA 4CCAA