2OPLB

Crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
182
Chain Sequence
TVVNGVNVDQLMATIEQIKAKPEIAQFKFRATNQWMGGTHNQATIKDFYGACAEDDTRKPMVFDLDEPPVLLGENRGANPVEYLLVALSGCLTTSLVAHAAARGIALRGVKSRYEGDIDLRGFLGLSEEVPVGYREIRVFFSIDADLTDGQKEELIRMAQKYSPVYNTVAKPVPVAVLLDRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_953832.1) from Geobacter sulfurreducens at 1.50 A resolution
rcsb
source organism Geobacter sulfurreducens
molecule tags Unknown function
total genus 45
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2oplB01
4OX9C 2VQFC 3T1YC 2EGTA 1K0RA 5BR8C 1XMOC 1HNWC 3J81D 4MTNA 4NOZA 4DV1C 2UXBC 4DV5C 1ZB8A 1QWIA 4LF6C 1WH9A 4DV6C 1XNRC 4LF4C 5IWAC 2OPLA 1HNXC 4B3SC 1MKYA 3IEUA 2HHHC 4LFAC 1XNQC 4JI5C 2D7VA 4XX2A 4JI4C 1XMQC 4LF9C 2UUBC 3T1HC 1ML8A 3I07A 1N2FA 4JI0C 4LF8C 4DR3C 1USPB 4DV0C 1ZB9A 1N34C 4X64C 2CY1A 2ZM6C 4DUYC 4GKJC 4DR2C 1IBLC 3R9XA 4K0KC 2JMPA 4DV3C 4DV7C 2BJOA 4YY3C 4NXNC 4GKKC 2HJGA 2UUAC 4JYAC 4AQYC 4NXMC 1FJGC 3JAMD 1UKKA 3EERA 1WF3A 3R9WA 3IEVA 5IT9D 4BSZA 2E8CA 2E5LC 4DUZC 3OTOC 4B3RC 3J80D 4KHPC 2KZFA 4DR4C 4JI6C 4DCTA 5FLXD 4LF7C 4JI3C 4X65C 2OPLB 3AF6A 5A2QD 1PA4A 2CXCA 1I94C 2E8FA 2E7GA 4DR1C 1J5EC 4YHHC 4JI7C 1HR0C 4B3TC 4DV2C 4LFCC 1KKGA 4JV5C 2UU9C 2ASBA 2DYJA 3CJEA 4MH4A 4X66C 5LMNC 5LMUC 1HH2P 1N36C 2E8EA 4JI2C 2UUCC 4B3MC 2UXCC 1HNZC 2VQEC 4DCUA 1L2FA 2ONFA 4X62C 1JOSA 4DCVA 1IBKC 2QL8A 2YCBA 1IBMC 4DR7C 1N33C 4LF5C 1LQLA 2F4VC 2UXDC 3GKUA 4DV4C 1NYEA 1USPA 4DR6C 4LFBC 1EGAA 2ATWA 2XR1A 4DCSA 3LUSA 2PT7G 4JI1C 1N32C 4DR5C 1VLAA 2PN2A 4JI8C 3AF5A
chains in the Genus database with same CATH superfamily
4OX9C 2VQFC 3T1YC 2EGTA 1XMOC 1HNWC 3FCCA 1PU1A 2M5OA 4BCAA 1T5HX 1MXCA 1O92A 1ZB8A 2MM9A 2D1QA 1WH9A 4DV6C 2QVYX 5CZVA 3TDEA 4LF4C 2OPLA 1MKYA 2CU6A 4LFAC 2D7VA 3T1HC 5BSRA 5K85A 1USPB 4DV0C 1ZB9A 2ZM6C 2NCLA 5AE1A 4PHTA 4DR2C 1IBLC 2P2QA 1VEHA 4NXNC 1YJ7A 4NXMC 1FJGC 3CQ1A 4PUGA 3EERA 1WF3A 5IT9D 1FLOA 4DUZC 2BH1X 2ZZMA 5IFIA 1XRCA 4DCTA 1V60A 4OXIA 3AF6A 3PBKA 2QVZX 1PA4A 2CXCA 1I94C 1V26A 3NPDA 4GS5A 3O2EA 5K8FA 1KKGA 2OBVA 2ASBA 4TPSB 2PROA 3CJEA 4MH4A 4DG8A 5LMNC 5BURA 3GR0A 1N36C 4KTTA 2UXCC 1UWDA 4WV3A 1L2FA 2P20A 4DCVA 2DPLA 5GTDA 4WS9A 1IBMC 4DR7C 4FUQA 2UXDC 1FUGA 4DV4C 3GPCA 1USPA 5BSWA 1EGAA 4R0MA 5JRHA 3ETCA 1AMUA 2PN2A 5CZXA 3J81D 1P4EA 4DV1C 1P7LA 2P02A 5IWAC 3UX2A 4B3SC 2HHHC 2V7BA 4XX2A 2D1TA 2Y4NA 4LF8C 4DR3C 3UEBA 4PUIA 4X64C 2CY1A 4RM2A 1T5DX 4K0KC 4ISBA 4DV7C 4PZPA 4YY3C 4GKKC 3VNSA 2UUAC 3E7XA 2ZZNA 3JAMD 3I08A 1UKKA 3IEVA 5AE2A 5DV9A 2DHMA 3J80D 3VNQA 3UX3A 4LF7C 4ODJA 2P2FA 3LGXA 4R1MA 5A2QD 2Z51A 1J5EC 4YHHC 4JM1A 4JI8C 1MDFA 2M5HA 2MCQA 5ADZA 3SO4A 5A1GA 5H9UA 2KZ0A 4D4IA 2P2BA 2E8EA 1XRBA 3NYQA 2YX1A 3A9VA 4D4GA 1IBKC 2YWCA 4L2ZA 3FCEA 1O90A 2Y4OA 4PROC 3ETOA 1LQLA 5BUSA 3EQ6A 1P4EC 4DR6C 1O93A 3DLPX 4LFBC 3RG2A 2VSQA 4U5YD 4JI1C 1N32C 4FTFA 5A1IA 3A9UA 3GR1A 3KXWA 5BR8C 2WD9A 4RLFA 1XHJA 4MTNA 4NOZA 4PUHA 2UXBC 1GPMA 4RLQA 4LF6C 1XNRC 3TQIA 5A19A 4JI4C 1XMQC 2P2JA 3A4IA 1TH5A 1N2FA 3CW9A 4G37A 1N34C 3H2TA 4GKJC 1LCIA 5E7QA 4NDNA 3L95X 4G36A 3R9WA 2QW0X 4KTVA 4BSZA 5KYTA 3CQ2A 4EATA 3OTOC 4B3RC 3N54B 4KHPC 2KZFA 5AE3A 3TUFA 5FLXD 1PG3A 4X65C 3E7WA 4L4QA 2Y27A 4GXQA 3B7WA 3CW8X 4ZJZA 4B3TC 4DV2C 4LFCC 2UU9C 3K6RA 2DYJA 3TR3A 4X66C 3IPLA 1MD9A 2UUCC 4L7IA 1HNZC 1QM4A 2VQEC 4DCUA 3LNVA 4GXRA 1JOSA 2OO4A 4I9GA 2YCBA 4IR7A 4D57A 2D1RA 4HPVA 1M6XA 1N33C 3PROC 2MMAB 3GKUA 3A26A 3RV2A 3UOWA 2P2MA 5T8SA 1NY8A 1VLAA 3AF5A 1RG9A 5BSVA 1K0RA 3C5EA 4RVNA 5LCIA 3NYRA 3NI2A 4DV5C 2D28C 2E0GA 5T8TA 3S82A 1QWIA 1HNXC 3IEUA 1XNQC 1MDBA 3PESA 4JI5C 4LF9C 1ULTA 2UUBC 1MXBA 1ML8A 3I07A 4JI0C 2QVXX 4BC7A 1O9TA 4DUYC 4BBYA 1V25A 3R9XA 2JMPA 1XRAA 4DV3C 2BJOA 4K0BA 2HJGA 4JYAC 4AQYC 4LE5A 3G7SA 2D27A 1IB8A 2E8CA 4ZLPA 2E5LC 4RVOA 3IMLA 5KYVA 4IZ6A 4DR4C 3AY0A 4JI6C 5BUQA 1BA3A 4JI3C 2OPLB 4R1LA 2WP0C 1XS3A 2E8FA 2E7GA 4DR1C 4OYCA 5BSUA 4JI7C 1HR0C 3A25A 4BC9A 4JV5C 4RM3A 5BSMA 4DG9A 1M6XC 2VZEA 2KDNA 5LMUC 4G1IA 2YWBA 1HH2P 1RY2A 3UZ0A 3CQ3A 4JI2C 4B3MC 2ONFA 4X62C 4D56A 2QL8A 3VNRA 3R44A 5BSTA 4RMNA 1WCJA 4LF5C 3L8CA 2F4VC 3LNOA 3N2QA 1NYEA 3DAYA 4I9FA 5KEIA 2ATWA 4FUTA 2XR1A 2D1SA 4DCSA 3LUSA 2PT7G 1PG4A 2AYAA 3LAXA 4DR5C 2JNVA 3DHVA 1MXAA
chains in the Genus database with same CATH topology
4OX9C 2VQFC 3T1YC 2EGTA 1XMOC 1HNWC 3FCCA 4BCAA 1T5HX 1MXCA 1O92A 1ZB8A 2D1QA 1WH9A 4DV6C 2QVYX 5CZVA 3TDEA 4LF4C 2OPLA 1MKYA 4LFAC 2D7VA 3T1HC 5BSRA 5K85A 1USPB 4DV0C 1ZB9A 2ZM6C 5AE1A 4PHTA 4DR2C 1IBLC 2P2QA 4NXNC 1YJ7A 4NXMC 1FJGC 3EERA 1WF3A 5IT9D 4DUZC 2BH1X 5IFIA 1XRCA 4DCTA 4OXIA 3AF6A 3PBKA 2QVZX 1PA4A 2CXCA 1I94C 1V26A 3NPDA 4GS5A 5K8FA 1KKGA 2OBVA 2ASBA 4TPSB 2PROA 3CJEA 4MH4A 4DG8A 5LMNC 5BURA 3GR0A 1N36C 4KTTA 2UXCC 4WV3A 1L2FA 2P20A 4DCVA 2DPLA 5GTDA 4WS9A 1IBMC 4DR7C 4FUQA 2UXDC 1FUGA 4DV4C 3GPCA 1USPA 5BSWA 1EGAA 4R0MA 5JRHA 3ETCA 1AMUA 2PN2A 5CZXA 3J81D 4DV1C 1P7LA 2P02A 5IWAC 4B3SC 2HHHC 2V7BA 4XX2A 2D1TA 2Y4NA 4LF8C 4DR3C 4X64C 2CY1A 4RM2A 1T5DX 4K0KC 4ISBA 4DV7C 4PZPA 4YY3C 4GKKC 3VNSA 2UUAC 3E7XA 3JAMD 3I08A 1UKKA 3IEVA 5AE2A 5DV9A 3J80D 3VNQA 4LF7C 4ODJA 2P2FA 3LGXA 4R1MA 5A2QD 1J5EC 4YHHC 4JM1A 4JI8C 1MDFA 5ADZA 3SO4A 5A1GA 5H9UA 4D4IA 2P2BA 2E8EA 1XRBA 3NYQA 3A9VA 4D4GA 1IBKC 2YWCA 4L2ZA 3FCEA 1O90A 2Y4OA 4PROC 3ETOA 1LQLA 5BUSA 3EQ6A 4DR6C 1O93A 3DLPX 4LFBC 3RG2A 2VSQA 4U5YD 4JI1C 1N32C 4FTFA 5A1IA 3A9UA 3GR1A 3KXWA 5BR8C 2WD9A 4RLFA 4MTNA 4NOZA 2UXBC 1GPMA 4RLQA 4LF6C 1XNRC 3TQIA 5A19A 4JI4C 1XMQC 2P2JA 3A4IA 1N2FA 3CW9A 4G37A 1N34C 3H2TA 4GKJC 1LCIA 5E7QA 4NDNA 3L95X 4G36A 3R9WA 2QW0X 4KTVA 4BSZA 5KYTA 4EATA 3OTOC 4B3RC 3N54B 4KHPC 2KZFA 5AE3A 3TUFA 5FLXD 1PG3A 4X65C 3E7WA 4L4QA 2Y27A 4GXQA 3B7WA 3CW8X 4ZJZA 4B3TC 4DV2C 4LFCC 2UU9C 2DYJA 4X66C 3IPLA 1MD9A 2UUCC 4L7IA 1HNZC 1QM4A 2VQEC 4DCUA 3LNVA 4GXRA 1JOSA 2OO4A 4I9GA 2YCBA 4IR7A 4D57A 2D1RA 4HPVA 1N33C 3PROC 3GKUA 3RV2A 3UOWA 2P2MA 5T8SA 1VLAA 3AF5A 1RG9A 5BSVA 1K0RA 3C5EA 4RVNA 3NYRA 3NI2A 4DV5C 2D28C 2E0GA 5T8TA 3S82A 1QWIA 1HNXC 3IEUA 1XNQC 1MDBA 3PESA 4JI5C 4LF9C 1ULTA 2UUBC 1MXBA 1ML8A 3I07A 4JI0C 2QVXX 4BC7A 1O9TA 4DUYC 4BBYA 1V25A 3R9XA 2JMPA 1XRAA 4DV3C 2BJOA 4K0BA 2HJGA 4JYAC 4AQYC 4LE5A 3G7SA 2D27A 2E8CA 4ZLPA 2E5LC 4RVOA 3IMLA 5KYVA 4IZ6A 4DR4C 4JI6C 5BUQA 1BA3A 4JI3C 2OPLB 4R1LA 2WP0C 2E8FA 2E7GA 4DR1C 4OYCA 5BSUA 4JI7C 1HR0C 4BC9A 4JV5C 4RM3A 5BSMA 4DG9A 2VZEA 5LMUC 4G1IA 2YWBA 1HH2P 1RY2A 3UZ0A 4JI2C 4B3MC 2ONFA 4X62C 4D56A 2QL8A 3VNRA 3R44A 5BSTA 4RMNA 4LF5C 3L8CA 2F4VC 3N2QA 1NYEA 3DAYA 4I9FA 5KEIA 2ATWA 4FUTA 2XR1A 2D1SA 4DCSA 3LUSA 2PT7G 1PG4A 2AYAA 3LAXA 4DR5C 3DHVA 1MXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 C;  2VQF C;  3T1Y C;  2EGT A;  1K0R A;  5BR8 C;  1XMO C;  1HNW C;  3J81 D;  4MTN A;  4NOZ A;  4DV1 C;  2UXB C;  4DV5 C;  1ZB8 A;  1QWI A;  4LF6 C;  1WH9 A;  4DV6 C;  1XNR C;  4LF4 C;  5IWA C;  2OPL A;  1HNX C;  4B3S C;  1MKY A;  3IEU A;  2HHH C;  4LFA C;  1XNQ C;  4JI5 C;  2D7V A;  4XX2 A;  4JI4 C;  1XMQ C;  4LF9 C;  2UUB C;  3T1H C;  1ML8 A;  3I07 A;  1N2F A;  4JI0 C;  4LF8 C;  4DR3 C;  1USP B;  4DV0 C;  1ZB9 A;  1N34 C;  4X64 C;  2CY1 A;  2ZM6 C;  4DUY C;  4GKJ C;  4DR2 C;  1IBL C;  3R9X A;  4K0K C;  2JMP A;  4DV3 C;  4DV7 C;  2BJO A;  4YY3 C;  4NXN C;  4GKK C;  2HJG A;  2UUA C;  4JYA C;  4AQY C;  4NXM C;  1FJG C;  3JAM D;  1UKK A;  3EER A;  1WF3 A;  3R9W A;  3IEV A;  5IT9 D;  4BSZ A;  2E8C A;  2E5L C;  4DUZ C;  3OTO C;  4B3R C;  3J80 D;  4KHP C;  2KZF A;  4DR4 C;  4JI6 C;  4DCT A;  5FLX D;  4LF7 C;  4JI3 C;  4X65 C;  2OPL B;  3AF6 A;  5A2Q D;  1PA4 A;  2CXC A;  1I94 C;  2E8F A;  2E7G A;  4DR1 C;  1J5E C;  4YHH C;  4JI7 C;  1HR0 C;  4B3T C;  4DV2 C;  4LFC C;  1KKG A;  4JV5 C;  2UU9 C;  2ASB A;  2DYJ A;  3CJE A;  4MH4 A;  4X66 C;  5LMN C;  5LMU C;  1HH2 P;  1N36 C;  2E8E A;  4JI2 C;  2UUC C;  4B3M C;  2UXC C;  1HNZ C;  2VQE C;  4DCU A;  1L2F A;  2ONF A;  4X62 C;  1JOS A;  4DCV A;  1IBK C;  2QL8 A;  2YCB A;  1IBM C;  4DR7 C;  1N33 C;  4LF5 C;  1LQL A;  2F4V C;  2UXD C;  3GKU A;  4DV4 C;  1NYE A;  1USP A;  4DR6 C;  4LFB C;  1EGA A;  2ATW A;  2XR1 A;  4DCS A;  3LUS A;  2PT7 G;  4JI1 C;  1N32 C;  4DR5 C;  1VLA A;  2PN2 A;  4JI8 C;  3AF5 A; 
#chains in the Genus database with same CATH topology
 4OX9 C;  2VQF C;  3T1Y C;  2EGT A;  1XMO C;  1HNW C;  3FCC A;  1PU1 A;  2M5O A;  4BCA A;  1T5H X;  1MXC A;  1O92 A;  1ZB8 A;  2MM9 A;  2D1Q A;  1WH9 A;  4DV6 C;  2QVY X;  5CZV A;  3TDE A;  4LF4 C;  2OPL A;  1MKY A;  2CU6 A;  4LFA C;  2D7V A;  3T1H C;  5BSR A;  5K85 A;  1USP B;  4DV0 C;  1ZB9 A;  2ZM6 C;  2NCL A;  5AE1 A;  4PHT A;  4DR2 C;  1IBL C;  2P2Q A;  1VEH A;  4NXN C;  1YJ7 A;  4NXM C;  1FJG C;  3CQ1 A;  4PUG A;  3EER A;  1WF3 A;  5IT9 D;  1FLO A;  4DUZ C;  2BH1 X;  2ZZM A;  5IFI A;  1XRC A;  4DCT A;  1V60 A;  4OXI A;  3AF6 A;  3PBK A;  2QVZ X;  1PA4 A;  2CXC A;  1I94 C;  1V26 A;  3NPD A;  4GS5 A;  3O2E A;  5K8F A;  1KKG A;  2OBV A;  2ASB A;  4TPS B;  2PRO A;  3CJE A;  4MH4 A;  4DG8 A;  5LMN C;  5BUR A;  3GR0 A;  1N36 C;  4KTT A;  2UXC C;  1UWD A;  4WV3 A;  1L2F A;  2P20 A;  4DCV A;  2DPL A;  5GTD A;  4WS9 A;  1IBM C;  4DR7 C;  4FUQ A;  2UXD C;  1FUG A;  4DV4 C;  3GPC A;  1USP A;  5BSW A;  1EGA A;  4R0M A;  5JRH A;  3ETC A;  1AMU A;  2PN2 A;  5CZX A;  3J81 D;  1P4E A;  4DV1 C;  1P7L A;  2P02 A;  5IWA C;  3UX2 A;  4B3S C;  2HHH C;  2V7B A;  4XX2 A;  2D1T A;  2Y4N A;  4LF8 C;  4DR3 C;  3UEB A;  4PUI A;  4X64 C;  2CY1 A;  4RM2 A;  1T5D X;  4K0K C;  4ISB A;  4DV7 C;  4PZP A;  4YY3 C;  4GKK C;  3VNS A;  2UUA C;  3E7X A;  2ZZN A;  3JAM D;  3I08 A;  1UKK A;  3IEV A;  5AE2 A;  5DV9 A;  2DHM A;  3J80 D;  3VNQ A;  3UX3 A;  4LF7 C;  4ODJ A;  2P2F A;  3LGX A;  4R1M A;  5A2Q D;  2Z51 A;  1J5E C;  4YHH C;  4JM1 A;  4JI8 C;  1MDF A;  2M5H A;  2MCQ A;  5ADZ A;  3SO4 A;  5A1G A;  5H9U A;  2KZ0 A;  4D4I A;  2P2B A;  2E8E A;  1XRB A;  3NYQ A;  2YX1 A;  3A9V A;  4D4G A;  1IBK C;  2YWC A;  4L2Z A;  3FCE A;  1O90 A;  2Y4O A;  4PRO C;  3ETO A;  1LQL A;  5BUS A;  3EQ6 A;  1P4E C;  4DR6 C;  1O93 A;  3DLP X;  4LFB C;  3RG2 A;  2VSQ A;  4U5Y D;  4JI1 C;  1N32 C;  4FTF A;  5A1I A;  3A9U A;  3GR1 A;  3KXW A;  5BR8 C;  2WD9 A;  4RLF A;  1XHJ A;  4MTN A;  4NOZ A;  4PUH A;  2UXB C;  1GPM A;  4RLQ A;  4LF6 C;  1XNR C;  3TQI A;  5A19 A;  4JI4 C;  1XMQ C;  2P2J A;  3A4I A;  1TH5 A;  1N2F A;  3CW9 A;  4G37 A;  1N34 C;  3H2T A;  4GKJ C;  1LCI A;  5E7Q A;  4NDN A;  3L95 X;  4G36 A;  3R9W A;  2QW0 X;  4KTV A;  4BSZ A;  5KYT A;  3CQ2 A;  4EAT A;  3OTO C;  4B3R C;  3N54 B;  4KHP C;  2KZF A;  5AE3 A;  3TUF A;  5FLX D;  1PG3 A;  4X65 C;  3E7W A;  4L4Q A;  2Y27 A;  4GXQ A;  3B7W A;  3CW8 X;  4ZJZ A;  4B3T C;  4DV2 C;  4LFC C;  2UU9 C;  3K6R A;  2DYJ A;  3TR3 A;  4X66 C;  3IPL A;  1MD9 A;  2UUC C;  4L7I A;  1HNZ C;  1QM4 A;  2VQE C;  4DCU A;  3LNV A;  4GXR A;  1JOS A;  2OO4 A;  4I9G A;  2YCB A;  4IR7 A;  4D57 A;  2D1R A;  4HPV A;  1M6X A;  1N33 C;  3PRO C;  2MMA B;  3GKU A;  3A26 A;  3RV2 A;  3UOW A;  2P2M A;  5T8S A;  1NY8 A;  1VLA A;  3AF5 A;  1RG9 A;  5BSV A;  1K0R A;  3C5E A;  4RVN A;  5LCI A;  3NYR A;  3NI2 A;  4DV5 C;  2D28 C;  2E0G A;  5T8T A;  3S82 A;  1QWI A;  1HNX C;  3IEU A;  1XNQ C;  1MDB A;  3PES A;  4JI5 C;  4LF9 C;  1ULT A;  2UUB C;  1MXB A;  1ML8 A;  3I07 A;  4JI0 C;  2QVX X;  4BC7 A;  1O9T A;  4DUY C;  4BBY A;  1V25 A;  3R9X A;  2JMP A;  1XRA A;  4DV3 C;  2BJO A;  4K0B A;  2HJG A;  4JYA C;  4AQY C;  4LE5 A;  3G7S A;  2D27 A;  1IB8 A;  2E8C A;  4ZLP A;  2E5L C;  4RVO A;  3IML A;  5KYV A;  4IZ6 A;  4DR4 C;  3AY0 A;  4JI6 C;  5BUQ A;  1BA3 A;  4JI3 C;  2OPL B;  4R1L A;  2WP0 C;  1XS3 A;  2E8F A;  2E7G A;  4DR1 C;  4OYC A;  5BSU A;  4JI7 C;  1HR0 C;  3A25 A;  4BC9 A;  4JV5 C;  4RM3 A;  5BSM A;  4DG9 A;  1M6X C;  2VZE A;  2KDN A;  5LMU C;  4G1I A;  2YWB A;  1HH2 P;  1RY2 A;  3UZ0 A;  3CQ3 A;  4JI2 C;  4B3M C;  2ONF A;  4X62 C;  4D56 A;  2QL8 A;  3VNR A;  3R44 A;  5BST A;  4RMN A;  1WCJ A;  4LF5 C;  3L8C A;  2F4V C;  3LNO A;  3N2Q A;  1NYE A;  3DAY A;  4I9F A;  5KEI A;  2ATW A;  4FUT A;  2XR1 A;  2D1S A;  4DCS A;  3LUS A;  2PT7 G;  1PG4 A;  2AYA A;  3LAX A;  4DR5 C;  2JNV A;  3DHV A;  1MXA A; 
#chains in the Genus database with same CATH homology
 4OX9 C;  2VQF C;  3T1Y C;  2EGT A;  1XMO C;  1HNW C;  3FCC A;  4BCA A;  1T5H X;  1MXC A;  1O92 A;  1ZB8 A;  2D1Q A;  1WH9 A;  4DV6 C;  2QVY X;  5CZV A;  3TDE A;  4LF4 C;  2OPL A;  1MKY A;  4LFA C;  2D7V A;  3T1H C;  5BSR A;  5K85 A;  1USP B;  4DV0 C;  1ZB9 A;  2ZM6 C;  5AE1 A;  4PHT A;  4DR2 C;  1IBL C;  2P2Q A;  4NXN C;  1YJ7 A;  4NXM C;  1FJG C;  3EER A;  1WF3 A;  5IT9 D;  4DUZ C;  2BH1 X;  5IFI A;  1XRC A;  4DCT A;  4OXI A;  3AF6 A;  3PBK A;  2QVZ X;  1PA4 A;  2CXC A;  1I94 C;  1V26 A;  3NPD A;  4GS5 A;  5K8F A;  1KKG A;  2OBV A;  2ASB A;  4TPS B;  2PRO A;  3CJE A;  4MH4 A;  4DG8 A;  5LMN C;  5BUR A;  3GR0 A;  1N36 C;  4KTT A;  2UXC C;  4WV3 A;  1L2F A;  2P20 A;  4DCV A;  2DPL A;  5GTD A;  4WS9 A;  1IBM C;  4DR7 C;  4FUQ A;  2UXD C;  1FUG A;  4DV4 C;  3GPC A;  1USP A;  5BSW A;  1EGA A;  4R0M A;  5JRH A;  3ETC A;  1AMU A;  2PN2 A;  5CZX A;  3J81 D;  4DV1 C;  1P7L A;  2P02 A;  5IWA C;  4B3S C;  2HHH C;  2V7B A;  4XX2 A;  2D1T A;  2Y4N A;  4LF8 C;  4DR3 C;  4X64 C;  2CY1 A;  4RM2 A;  1T5D X;  4K0K C;  4ISB A;  4DV7 C;  4PZP A;  4YY3 C;  4GKK C;  3VNS A;  2UUA C;  3E7X A;  3JAM D;  3I08 A;  1UKK A;  3IEV A;  5AE2 A;  5DV9 A;  3J80 D;  3VNQ A;  4LF7 C;  4ODJ A;  2P2F A;  3LGX A;  4R1M A;  5A2Q D;  1J5E C;  4YHH C;  4JM1 A;  4JI8 C;  1MDF A;  5ADZ A;  3SO4 A;  5A1G A;  5H9U A;  4D4I A;  2P2B A;  2E8E A;  1XRB A;  3NYQ A;  3A9V A;  4D4G A;  1IBK C;  2YWC A;  4L2Z A;  3FCE A;  1O90 A;  2Y4O A;  4PRO C;  3ETO A;  1LQL A;  5BUS A;  3EQ6 A;  4DR6 C;  1O93 A;  3DLP X;  4LFB C;  3RG2 A;  2VSQ A;  4U5Y D;  4JI1 C;  1N32 C;  4FTF A;  5A1I A;  3A9U A;  3GR1 A;  3KXW A;  5BR8 C;  2WD9 A;  4RLF A;  4MTN A;  4NOZ A;  2UXB C;  1GPM A;  4RLQ A;  4LF6 C;  1XNR C;  3TQI A;  5A19 A;  4JI4 C;  1XMQ C;  2P2J A;  3A4I A;  1N2F A;  3CW9 A;  4G37 A;  1N34 C;  3H2T A;  4GKJ C;  1LCI A;  5E7Q A;  4NDN A;  3L95 X;  4G36 A;  3R9W A;  2QW0 X;  4KTV A;  4BSZ A;  5KYT A;  4EAT A;  3OTO C;  4B3R C;  3N54 B;  4KHP C;  2KZF A;  5AE3 A;  3TUF A;  5FLX D;  1PG3 A;  4X65 C;  3E7W A;  4L4Q A;  2Y27 A;  4GXQ A;  3B7W A;  3CW8 X;  4ZJZ A;  4B3T C;  4DV2 C;  4LFC C;  2UU9 C;  2DYJ A;  4X66 C;  3IPL A;  1MD9 A;  2UUC C;  4L7I A;  1HNZ C;  1QM4 A;  2VQE C;  4DCU A;  3LNV A;  4GXR A;  1JOS A;  2OO4 A;  4I9G A;  2YCB A;  4IR7 A;  4D57 A;  2D1R A;  4HPV A;  1N33 C;  3PRO C;  3GKU A;  3RV2 A;  3UOW A;  2P2M A;  5T8S A;  1VLA A;  3AF5 A;  1RG9 A;  5BSV A;  1K0R A;  3C5E A;  4RVN A;  3NYR A;  3NI2 A;  4DV5 C;  2D28 C;  2E0G A;  5T8T A;  3S82 A;  1QWI A;  1HNX C;  3IEU A;  1XNQ C;  1MDB A;  3PES A;  4JI5 C;  4LF9 C;  1ULT A;  2UUB C;  1MXB A;  1ML8 A;  3I07 A;  4JI0 C;  2QVX X;  4BC7 A;  1O9T A;  4DUY C;  4BBY A;  1V25 A;  3R9X A;  2JMP A;  1XRA A;  4DV3 C;  2BJO A;  4K0B A;  2HJG A;  4JYA C;  4AQY C;  4LE5 A;  3G7S A;  2D27 A;  2E8C A;  4ZLP A;  2E5L C;  4RVO A;  3IML A;  5KYV A;  4IZ6 A;  4DR4 C;  4JI6 C;  5BUQ A;  1BA3 A;  4JI3 C;  2OPL B;  4R1L A;  2WP0 C;  2E8F A;  2E7G A;  4DR1 C;  4OYC A;  5BSU A;  4JI7 C;  1HR0 C;  4BC9 A;  4JV5 C;  4RM3 A;  5BSM A;  4DG9 A;  2VZE A;  5LMU C;  4G1I A;  2YWB A;  1HH2 P;  1RY2 A;  3UZ0 A;  4JI2 C;  4B3M C;  2ONF A;  4X62 C;  4D56 A;  2QL8 A;  3VNR A;  3R44 A;  5BST A;  4RMN A;  4LF5 C;  3L8C A;  2F4V C;  3N2Q A;  1NYE A;  3DAY A;  4I9F A;  5KEI A;  2ATW A;  4FUT A;  2XR1 A;  2D1S A;  4DCS A;  3LUS A;  2PT7 G;  1PG4 A;  2AYA A;  3LAX A;  4DR5 C;  3DHV A;  1MXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...