2KZ0A

Solution structure of a bola protein (ech_0303) from ehrlichia chaffeensis. seattle structural genomics center for infectious disease target ehcha.10365.a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
PGSMTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLDGLNIHAIQIQTGCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BolA family protein
publication title Structural characterization of a BolA protein (ECH_0303) from Ehrlichia chaffeensis, the agent responsible for human monocytotropic ehrlichiosis.
rcsb
source organism Ehrlichia chaffeensis
molecule tags Transcription
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2kz0A01
4PUGA 4PUHA 1NY8A 2MM9A 3TR3A 2MCQA 3O2EA 4PUIA 2KZ0A 5LCIA 2KDNA 2NCLA 2MMAB 2DHMA 1V60A 1XS3A
chains in the Genus database with same CATH superfamily
4DG8A 1NY8A 1PG4A 1XNQC 4PUIA 4RM2A 1ZB9A 2CY1A 2ONFA 3TUFA 1UWDA 1ULTA 4BBYA 2UU9C 4NDNA 2E0GA 2ZZMA 3EQ6A 1XRBA 5KYTA 2P02A 1MXAA 4MH4A 4X66C 3CQ1A 2YWCA 3J80D 1P4EA 1ZB8A 4GS5A 3N54B 4R0MA 4DCTA 4DR3C 1O90A 2ZZNA 2QVZX 3JAMD 2EGTA 1P4EC 5AE3A 1XMOC 2BJOA 4XX2A 4GXQA 3IEVA 5KEIA 4DR6C 1V26A 4LF7C 1LCIA 2QW0X 5H9UA 3GR0A 3DAYA 5DV9A 4LFBC 4X65C 3PBKA 1HNXC 4X62C 4FTFA 3E7XA 2E7GA 3TQIA 5E7QA 5BUSA 2Z51A 5A19A 4MTNA 4PROC 1T5HX 4PUHA 1FLOA 4OYCA 2WD9A 1XNRC 1XMQC 4GXRA 3DLPX 4OXIA 3UX3A 4DR2C 4JI1C 3EERA 2E5LC 4JV5C 4DV5C 3FCEA 5A1GA 4RLFA 1TH5A 5BSVA 3LAXA 4L4QA 1GPMA 3IPLA 3A9UA 4ZJZA 3NYRA 3LUSA 4JI3C 2QVXX 1N2FA 4TPSB 4DV6C 3PROC 1PU1A 4OX9C 5A1IA 3LGXA 4L2ZA 4U5YD 2DPLA 4FUTA 4JI4C 3VNQA 3RV2A 5IFIA 5T8TA 3FCCA 3AF5A 1L2FA 1WCJA 2UUBC 4LFAC 3VNSA 2QVYX 4RM3A 2PT7G 3OTOC 4KTTA 4ZLPA 4L7IA 1PG3A 4LF9C 2VZEA 4DV3C 1MXBA 4JI5C 2UXCC 3NI2A 1XHJA 2V7BA 1UKKA 1EGAA 1AMUA 3K6RA 2UUCC 4ISBA 3S82A 1XRAA 2JMPA 1USPB 2D1SA 1USPA 4IZ6A 2Y27A 4LE5A 4DR4C 1HNWC 3J81D 4JI2C 2KZFA 3GPCA 5BSRA 4LF5C 4I9FA 2VQFC 4KHPC 4WV3A 1VLAA 4DR5C 1IBKC 4JM1A 4K0BA 3CW9A 4RVNA 3CQ2A 1VEHA 3A25A 3R9WA 4PHTA 2QL8A 2VSQA 3AF6A 1N33C 1JOSA 2CU6A 4LFCC 4DR7C 4JI8C 4K0KC 5AE1A 2ASBA 4EATA 3UZ0A 1YJ7A 2P2FA 3IEUA 3H2TA 2ZM6C 1PA4A 5GTDA 1XS3A 2F4VC 4GKJC 4JI6C 1RY2A 1HH2P 1IBLC 3O2EA 4BC7A 4DG9A 4DV2C 4JI0C 1O9TA 4AQYC 4DCVA 4RMNA 2MM9A 3L95X 5BSMA 2PROA 4D57A 2YX1A 2MCQA 3NYQA 5JRHA 3ETOA 1MD9A 4I9GA 1MDFA 2MMAB 2P20A 3UX2A 1HR0C 1XRCA 3PESA 2OBVA 2D1RA 2ATWA 3AY0A 1V25A 4PUGA 5BSUA 2OPLB 4B3TC 2E8EA 1IB8A 2OPLA 2D1TA 2D1QA 1MKYA 5A2QD 2DHMA 4DUYC 5AE2A 5ADZA 5IWAC 4R1MA 5BUQA 3A4IA 2VQEC 4B3MC 2YWBA 5BSWA 1I94C 3G7SA 2DYJA 1MDBA 4DCUA 4G37A 3NPDA 5BURA 5K8FA 1HNZC 1IBMC 1QWIA 3LNOA 4BSZA 2D7VA 3UOWA 4NXMC 1KKGA 4NOZA 4YY3C 4BCAA 2XR1A 2P2MA 4DV7C 5T8SA 1QM4A 4IR7A 4G36A 1NYEA 1K0RA 4HPVA 4D4GA 3A26A 5BR8C 4KTVA 4GKKC 1T5DX 5LMNC 5BSTA 4DUZC 3I07A 2M5HA 3SO4A 1J5EC 2Y4NA 2KDNA 4X64C 4DV0C 4FUQA 4G1IA 2PN2A 4DV1C 3GKUA 2P2BA 3LNVA 5KYVA 3KXWA 4DCSA 1N34C 3CQ3A 4DV4C 5LMUC 1WH9A 2UUAC 3B7WA 4NXNC 1MXCA 4BC9A 3E7WA 1N36C 2UXBC 1M6XA 3VNRA 1LQLA 1ML8A 4D4IA 2P2JA 1N32C 4D56A 1M6XC 4JI7C 5K85A 4B3RC 4ODJA 4LF8C 2D28C 5LCIA 2CXCA 3GR1A 2WP0C 3TDEA 4JYAC 1FJGC 2AYAA 4RVOA 2HJGA 1RG9A 4RLQA 2KZ0A 3A9VA 1BA3A 1WF3A 2OO4A 2P2QA 1P7LA 1O93A 3C5EA 4WS9A 3T1HC 1FUGA 2JNVA 3DHVA 3UEBA 2E8CA 5CZVA 3N2QA 2NCLA 2BH1X 2E8FA 1V60A 2M5OA 4B3SC 5IT9D 4LF6C 3TR3A 1O92A 3R44A 4PZPA 4R1LA 3L8CA 2HHHC 4LF4C 5CZXA 3CJEA 5FLXD 2D27A 4DR1C 3RG2A 2UXDC 3IMLA 2Y4OA 3T1YC 3CW8X 3I08A 3R9XA 3ETCA 4YHHC 2YCBA
chains in the Genus database with same CATH topology
4PUGA 4PUHA 1NY8A 2MM9A 3TR3A 2MCQA 3O2EA 4PUIA 2KZ0A 5LCIA 2KDNA 2NCLA 2MMAB 2DHMA 1V60A 1XS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUG A;  4PUH A;  1NY8 A;  2MM9 A;  3TR3 A;  2MCQ A;  3O2E A;  4PUI A;  2KZ0 A;  5LCI A;  2KDN A;  2NCL A;  2MMA B;  2DHM A;  1V60 A;  1XS3 A; 
#chains in the Genus database with same CATH topology
 4DG8 A;  1NY8 A;  1PG4 A;  1XNQ C;  4PUI A;  4RM2 A;  1ZB9 A;  2CY1 A;  2ONF A;  3TUF A;  1UWD A;  1ULT A;  4BBY A;  2UU9 C;  4NDN A;  2E0G A;  2ZZM A;  3EQ6 A;  1XRB A;  5KYT A;  2P02 A;  1MXA A;  4MH4 A;  4X66 C;  3CQ1 A;  2YWC A;  3J80 D;  1P4E A;  1ZB8 A;  4GS5 A;  3N54 B;  4R0M A;  4DCT A;  4DR3 C;  1O90 A;  2ZZN A;  2QVZ X;  3JAM D;  2EGT A;  1P4E C;  5AE3 A;  1XMO C;  2BJO A;  4XX2 A;  4GXQ A;  3IEV A;  5KEI A;  4DR6 C;  1V26 A;  4LF7 C;  1LCI A;  2QW0 X;  5H9U A;  3GR0 A;  3DAY A;  5DV9 A;  4LFB C;  4X65 C;  3PBK A;  1HNX C;  4X62 C;  4FTF A;  3E7X A;  2E7G A;  3TQI A;  5E7Q A;  5BUS A;  2Z51 A;  5A19 A;  4MTN A;  4PRO C;  1T5H X;  4PUH A;  1FLO A;  4OYC A;  2WD9 A;  1XNR C;  1XMQ C;  4GXR A;  3DLP X;  4OXI A;  3UX3 A;  4DR2 C;  4JI1 C;  3EER A;  2E5L C;  4JV5 C;  4DV5 C;  3FCE A;  5A1G A;  4RLF A;  1TH5 A;  5BSV A;  3LAX A;  4L4Q A;  1GPM A;  3IPL A;  3A9U A;  4ZJZ A;  3NYR A;  3LUS A;  4JI3 C;  2QVX X;  1N2F A;  4TPS B;  4DV6 C;  3PRO C;  1PU1 A;  4OX9 C;  5A1I A;  3LGX A;  4L2Z A;  4U5Y D;  2DPL A;  4FUT A;  4JI4 C;  3VNQ A;  3RV2 A;  5IFI A;  5T8T A;  3FCC A;  3AF5 A;  1L2F A;  1WCJ A;  2UUB C;  4LFA C;  3VNS A;  2QVY X;  4RM3 A;  2PT7 G;  3OTO C;  4KTT A;  4ZLP A;  4L7I A;  1PG3 A;  4LF9 C;  2VZE A;  4DV3 C;  1MXB A;  4JI5 C;  2UXC C;  3NI2 A;  1XHJ A;  2V7B A;  1UKK A;  1EGA A;  1AMU A;  3K6R A;  2UUC C;  4ISB A;  3S82 A;  1XRA A;  2JMP A;  1USP B;  2D1S A;  1USP A;  4IZ6 A;  2Y27 A;  4LE5 A;  4DR4 C;  1HNW C;  3J81 D;  4JI2 C;  2KZF A;  3GPC A;  5BSR A;  4LF5 C;  4I9F A;  2VQF C;  4KHP C;  4WV3 A;  1VLA A;  4DR5 C;  1IBK C;  4JM1 A;  4K0B A;  3CW9 A;  4RVN A;  3CQ2 A;  1VEH A;  3A25 A;  3R9W A;  4PHT A;  2QL8 A;  2VSQ A;  3AF6 A;  1N33 C;  1JOS A;  2CU6 A;  4LFC C;  4DR7 C;  4JI8 C;  4K0K C;  5AE1 A;  2ASB A;  4EAT A;  3UZ0 A;  1YJ7 A;  2P2F A;  3IEU A;  3H2T A;  2ZM6 C;  1PA4 A;  5GTD A;  1XS3 A;  2F4V C;  4GKJ C;  4JI6 C;  1RY2 A;  1HH2 P;  1IBL C;  3O2E A;  4BC7 A;  4DG9 A;  4DV2 C;  4JI0 C;  1O9T A;  4AQY C;  4DCV A;  4RMN A;  2MM9 A;  3L95 X;  5BSM A;  2PRO A;  4D57 A;  2YX1 A;  2MCQ A;  3NYQ A;  5JRH A;  3ETO A;  1MD9 A;  4I9G A;  1MDF A;  2MMA B;  2P20 A;  3UX2 A;  1HR0 C;  1XRC A;  3PES A;  2OBV A;  2D1R A;  2ATW A;  3AY0 A;  1V25 A;  4PUG A;  5BSU A;  2OPL B;  4B3T C;  2E8E A;  1IB8 A;  2OPL A;  2D1T A;  2D1Q A;  1MKY A;  5A2Q D;  2DHM A;  4DUY C;  5AE2 A;  5ADZ A;  5IWA C;  4R1M A;  5BUQ A;  3A4I A;  2VQE C;  4B3M C;  2YWB A;  5BSW A;  1I94 C;  3G7S A;  2DYJ A;  1MDB A;  4DCU A;  4G37 A;  3NPD A;  5BUR A;  5K8F A;  1HNZ C;  1IBM C;  1QWI A;  3LNO A;  4BSZ A;  2D7V A;  3UOW A;  4NXM C;  1KKG A;  4NOZ A;  4YY3 C;  4BCA A;  2XR1 A;  2P2M A;  4DV7 C;  5T8S A;  1QM4 A;  4IR7 A;  4G36 A;  1NYE A;  1K0R A;  4HPV A;  4D4G A;  3A26 A;  5BR8 C;  4KTV A;  4GKK C;  1T5D X;  5LMN C;  5BST A;  4DUZ C;  3I07 A;  2M5H A;  3SO4 A;  1J5E C;  2Y4N A;  2KDN A;  4X64 C;  4DV0 C;  4FUQ A;  4G1I A;  2PN2 A;  4DV1 C;  3GKU A;  2P2B A;  3LNV A;  5KYV A;  3KXW A;  4DCS A;  1N34 C;  3CQ3 A;  4DV4 C;  5LMU C;  1WH9 A;  2UUA C;  3B7W A;  4NXN C;  1MXC A;  4BC9 A;  3E7W A;  1N36 C;  2UXB C;  1M6X A;  3VNR A;  1LQL A;  1ML8 A;  4D4I A;  2P2J A;  1N32 C;  4D56 A;  1M6X C;  4JI7 C;  5K85 A;  4B3R C;  4ODJ A;  4LF8 C;  2D28 C;  5LCI A;  2CXC A;  3GR1 A;  2WP0 C;  3TDE A;  4JYA C;  1FJG C;  2AYA A;  4RVO A;  2HJG A;  1RG9 A;  4RLQ A;  2KZ0 A;  3A9V A;  1BA3 A;  1WF3 A;  2OO4 A;  2P2Q A;  1P7L A;  1O93 A;  3C5E A;  4WS9 A;  3T1H C;  1FUG A;  2JNV A;  3DHV A;  3UEB A;  2E8C A;  5CZV A;  3N2Q A;  2NCL A;  2BH1 X;  2E8F A;  1V60 A;  2M5O A;  4B3S C;  5IT9 D;  4LF6 C;  3TR3 A;  1O92 A;  3R44 A;  4PZP A;  4R1L A;  3L8C A;  2HHH C;  4LF4 C;  5CZX A;  3CJE A;  5FLX D;  2D27 A;  4DR1 C;  3RG2 A;  2UXD C;  3IML A;  2Y4O A;  3T1Y C;  3CW8 X;  3I08 A;  3R9X A;  3ETC A;  4YHH C;  2YCB A; 
#chains in the Genus database with same CATH homology
 4PUG A;  4PUH A;  1NY8 A;  2MM9 A;  3TR3 A;  2MCQ A;  3O2E A;  4PUI A;  2KZ0 A;  5LCI A;  2KDN A;  2NCL A;  2MMA B;  2DHM A;  1V60 A;  1XS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...