2KZ0A

Solution structure of a bola protein (ech_0303) from ehrlichia chaffeensis. seattle structural genomics center for infectious disease target ehcha.10365.a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
PGSMTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLDGLNIHAIQIQTGCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a BolA protein (ECH_0303) from Ehrlichia chaffeensis, the agent responsible for human monocytotropic ehrlichiosis.
rcsb
source organism Ehrlichia chaffeensis
molecule tags Transcription
molecule keywords BolA family protein
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2kz0A01
5LCIA 2MM9A 2DHMA 2KZ0A 1V60A 3TR3A 2NCLA 2KDNA 4PUIA 3O2EA 2MCQA 1NY8A 2MMAB 4PUHA 1XS3A 4PUGA
chains in the Genus database with same CATH superfamily
3G7SA 4PROC 3TQIA 3ETCA 1HNWC 2E8CA 5A1GA 4PUHA 2UXBC 5A19A 4B3MC 3LUSA 1LCIA 1N33C 2KZFA 3TDEA 1NYEA 1XMOC 1P4EC 1XNRC 4RLQA 4DR4C 1XHJA 3A4IA 2Z51A 4DUZC 5KYTA 4IR7A 4R1MA 5BSTA 4PUGA 2PT7G 4D57A 5CZXA 2QVZX 4B3SC 1RG9A 4JI6C 3DLPX 4G37A 4JI2C 3LNOA 2CXCA 3K6RA 3N2QA 4L2ZA 2D28C 3NYRA 4LF6C 2OBVA 5T8SA 3NI2A 4I9GA 4D4GA 3AF5A 4BC7A 4DCTA 4FUTA 4OYCA 1HNXC 4NOZA 2ZZNA 3I08A 5K8FA 2E5LC 3EERA 2D1TA 4D56A 2YX1A 4KHPC 4DV1C 3T1YC 2DYJA 3IMLA 4FTFA 2P02A 5A2QD 3OTOC 3CJEA 1O9TA 4GXQA 3VNRA 4NXMC 4ZJZA 1M6XA 3KXWA 1PG3A 1FLOA 1XRBA 3FCCA 2VQEC 1GPMA 1PG4A 5T8TA 5BSWA 5LCIA 2KZ0A 1TH5A 2QL8A 2WP0C 4PHTA 4RVOA 5LMUC 4JI1C 4RLFA 2ZM6C 4K0BA 5K85A 5BR8C 1UWDA 3VNSA 4XX2A 4RM2A 3C5EA 4DR1C 2P2MA 3CW9A 1KKGA 5E7QA 4DV4C 3A26A 4DV6C 4DV7C 3R9XA 3RG2A 2VQFC 2ATWA 1MXBA 3UX3A 4IZ6A 2E8EA 2ONFA 1LQLA 4YY3C 5FLXD 1MXAA 5IFIA 1YJ7A 4BCAA 4LFCC 1WF3A 3A9VA 4TPSB 4DV2C 1XNQC 1IB8A 2PROA 4D4IA 1P7LA 2M5OA 2BH1X 2QVYX 2OPLA 2KDNA 4MTNA 1N34C 5AE3A 4EATA 4DR2C 4LF8C 5BSUA 5BSMA 1IBLC 3UOWA 4L7IA 1MKYA 4DG8A 3O2EA 1USPA 3B7WA 2JNVA 1FJGC 2P2BA 3A9UA 4GKKC 1T5HX 5GTDA 1NY8A 4R0MA 4BSZA 3T1HC 3J80D 4LF9C 1AMUA 4LE5A 1K0RA 1HR0C 1XS3A 2CU6A 2UXDC 3GR0A 1ZB8A 5BUQA 2EGTA 3LNVA 4OXIA 4U5YD 3R9WA 2UUCC 2AYAA 4BBYA 2BJOA 2MMAB 3LAXA 1IBMC 3PROC 1MDFA 4NXNC 4DCUA 1N2FA 4PZPA 4LFAC 4NDNA 1V60A 2QVXX 4JI5C 4G1IA 2D1QA 4JYAC 4K0KC 2UUBC 4LFBC 4DV5C 3CQ1A 4DV0C 2CY1A 3I07A 3ETOA 4GKJC 2ASBA 4GS5A 4LF7C 1VLAA 4DG9A 1M6XC 4RM3A 5ADZA 1MD9A 3E7XA 1XRAA 4GXRA 1O93A 1I94C 3TR3A 2F4VC 5CZVA 4LF5C 2JMPA 3SO4A 1T5DX 2V7BA 2UUAC 2P20A 1HNZC 3UEBA 4MH4A 4B3TC 4KTTA 3GPCA 3L8CA 1IBKC 3GR1A 4DUYC 1MXCA 1PA4A 2QW0X 4JI3C 4R1LA 3LGXA 1BA3A 3EQ6A 2D7VA 1WH9A 4ISBA 4ZLPA 2E8FA 2DPLA 1HH2P 2HHHC 3JAMD 3AF6A 3DAYA 3N54B 1EGAA 1QM4A 1V26A 4BC9A 1O92A 1J5EC 4LF4C 4WV3A 2MCQA 1ML8A 3TUFA 1RY2A 3J81D 4ODJA 4AQYC 2D1RA 4PUIA 3UZ0A 1XRCA 1N36C 5A1IA 2E0GA 2HJGA 4JI0C 3IEUA 2WD9A 3GKUA 4DR5C 3CQ3A 4DCVA 3UX2A 4DR7C 4JI7C 4WS9A 2P2FA 5H9UA 2UU9C 3S82A 1ULTA 1L2FA 3PESA 1WCJA 4X66C 5AE1A 2P2QA 2UXCC 5BUSA 2P2JA 2XR1A 5JRHA 2Y27A 4X62C 4JM1A 4FUQA 1XMQC 2YWBA 3PBKA 3RV2A 4YHHC 4G36A 2OO4A 2E7GA 1O90A 5DV9A 3R44A 1N32C 3DHVA 3H2TA 2YWCA 2YCBA 3CW8X 4DV3C 2ZZMA 2NCLA 4RVNA 3IPLA 4X64C 4OX9C 1V25A 2D27A 2Y4NA 4RMNA 5AE2A 4L4QA 3A25A 4JV5C 5IT9D 4DR3C 1ZB9A 3NPDA 5LMNC 3E7WA 4KTVA 1PU1A 5KEIA 4I9FA 2VZEA 1JOSA 4X65C 4DR6C 3CQ2A 4HPVA 3NYQA 2PN2A 5IWAC 2DHMA 1MDBA 4JI8C 4JI4C 1FUGA 2D1SA 3IEVA 4B3RC 2OPLB 1UKKA 3VNQA 5BSVA 4DCSA 5BURA 1VEHA 1USPB 3FCEA 5BSRA 1P4EA 1QWIA 2MM9A 3L95X 2M5HA 2Y4OA 5KYVA 2VSQA 3AY0A
chains in the Genus database with same CATH topology
5LCIA 2MM9A 2DHMA 2KZ0A 1V60A 3TR3A 2NCLA 2KDNA 4PUIA 3O2EA 2MCQA 1NY8A 2MMAB 4PUHA 1XS3A 4PUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCI A;  2MM9 A;  2DHM A;  2KZ0 A;  1V60 A;  3TR3 A;  2NCL A;  2KDN A;  4PUI A;  3O2E A;  2MCQ A;  1NY8 A;  2MMA B;  4PUH A;  1XS3 A;  4PUG A; 
#chains in the Genus database with same CATH topology
 3G7S A;  4PRO C;  3TQI A;  3ETC A;  1HNW C;  2E8C A;  5A1G A;  4PUH A;  2UXB C;  5A19 A;  4B3M C;  3LUS A;  1LCI A;  1N33 C;  2KZF A;  3TDE A;  1NYE A;  1XMO C;  1P4E C;  1XNR C;  4RLQ A;  4DR4 C;  1XHJ A;  3A4I A;  2Z51 A;  4DUZ C;  5KYT A;  4IR7 A;  4R1M A;  5BST A;  4PUG A;  2PT7 G;  4D57 A;  5CZX A;  2QVZ X;  4B3S C;  1RG9 A;  4JI6 C;  3DLP X;  4G37 A;  4JI2 C;  3LNO A;  2CXC A;  3K6R A;  3N2Q A;  4L2Z A;  2D28 C;  3NYR A;  4LF6 C;  2OBV A;  5T8S A;  3NI2 A;  4I9G A;  4D4G A;  3AF5 A;  4BC7 A;  4DCT A;  4FUT A;  4OYC A;  1HNX C;  4NOZ A;  2ZZN A;  3I08 A;  5K8F A;  2E5L C;  3EER A;  2D1T A;  4D56 A;  2YX1 A;  4KHP C;  4DV1 C;  3T1Y C;  2DYJ A;  3IML A;  4FTF A;  2P02 A;  5A2Q D;  3OTO C;  3CJE A;  1O9T A;  4GXQ A;  3VNR A;  4NXM C;  4ZJZ A;  1M6X A;  3KXW A;  1PG3 A;  1FLO A;  1XRB A;  3FCC A;  2VQE C;  1GPM A;  1PG4 A;  5T8T A;  5BSW A;  5LCI A;  2KZ0 A;  1TH5 A;  2QL8 A;  2WP0 C;  4PHT A;  4RVO A;  5LMU C;  4JI1 C;  4RLF A;  2ZM6 C;  4K0B A;  5K85 A;  5BR8 C;  1UWD A;  3VNS A;  4XX2 A;  4RM2 A;  3C5E A;  4DR1 C;  2P2M A;  3CW9 A;  1KKG A;  5E7Q A;  4DV4 C;  3A26 A;  4DV6 C;  4DV7 C;  3R9X A;  3RG2 A;  2VQF C;  2ATW A;  1MXB A;  3UX3 A;  4IZ6 A;  2E8E A;  2ONF A;  1LQL A;  4YY3 C;  5FLX D;  1MXA A;  5IFI A;  1YJ7 A;  4BCA A;  4LFC C;  1WF3 A;  3A9V A;  4TPS B;  4DV2 C;  1XNQ C;  1IB8 A;  2PRO A;  4D4I A;  1P7L A;  2M5O A;  2BH1 X;  2QVY X;  2OPL A;  2KDN A;  4MTN A;  1N34 C;  5AE3 A;  4EAT A;  4DR2 C;  4LF8 C;  5BSU A;  5BSM A;  1IBL C;  3UOW A;  4L7I A;  1MKY A;  4DG8 A;  3O2E A;  1USP A;  3B7W A;  2JNV A;  1FJG C;  2P2B A;  3A9U A;  4GKK C;  1T5H X;  5GTD A;  1NY8 A;  4R0M A;  4BSZ A;  3T1H C;  3J80 D;  4LF9 C;  1AMU A;  4LE5 A;  1K0R A;  1HR0 C;  1XS3 A;  2CU6 A;  2UXD C;  3GR0 A;  1ZB8 A;  5BUQ A;  2EGT A;  3LNV A;  4OXI A;  4U5Y D;  3R9W A;  2UUC C;  2AYA A;  4BBY A;  2BJO A;  2MMA B;  3LAX A;  1IBM C;  3PRO C;  1MDF A;  4NXN C;  4DCU A;  1N2F A;  4PZP A;  4LFA C;  4NDN A;  1V60 A;  2QVX X;  4JI5 C;  4G1I A;  2D1Q A;  4JYA C;  4K0K C;  2UUB C;  4LFB C;  4DV5 C;  3CQ1 A;  4DV0 C;  2CY1 A;  3I07 A;  3ETO A;  4GKJ C;  2ASB A;  4GS5 A;  4LF7 C;  1VLA A;  4DG9 A;  1M6X C;  4RM3 A;  5ADZ A;  1MD9 A;  3E7X A;  1XRA A;  4GXR A;  1O93 A;  1I94 C;  3TR3 A;  2F4V C;  5CZV A;  4LF5 C;  2JMP A;  3SO4 A;  1T5D X;  2V7B A;  2UUA C;  2P20 A;  1HNZ C;  3UEB A;  4MH4 A;  4B3T C;  4KTT A;  3GPC A;  3L8C A;  1IBK C;  3GR1 A;  4DUY C;  1MXC A;  1PA4 A;  2QW0 X;  4JI3 C;  4R1L A;  3LGX A;  1BA3 A;  3EQ6 A;  2D7V A;  1WH9 A;  4ISB A;  4ZLP A;  2E8F A;  2DPL A;  1HH2 P;  2HHH C;  3JAM D;  3AF6 A;  3DAY A;  3N54 B;  1EGA A;  1QM4 A;  1V26 A;  4BC9 A;  1O92 A;  1J5E C;  4LF4 C;  4WV3 A;  2MCQ A;  1ML8 A;  3TUF A;  1RY2 A;  3J81 D;  4ODJ A;  4AQY C;  2D1R A;  4PUI A;  3UZ0 A;  1XRC A;  1N36 C;  5A1I A;  2E0G A;  2HJG A;  4JI0 C;  3IEU A;  2WD9 A;  3GKU A;  4DR5 C;  3CQ3 A;  4DCV A;  3UX2 A;  4DR7 C;  4JI7 C;  4WS9 A;  2P2F A;  5H9U A;  2UU9 C;  3S82 A;  1ULT A;  1L2F A;  3PES A;  1WCJ A;  4X66 C;  5AE1 A;  2P2Q A;  2UXC C;  5BUS A;  2P2J A;  2XR1 A;  5JRH A;  2Y27 A;  4X62 C;  4JM1 A;  4FUQ A;  1XMQ C;  2YWB A;  3PBK A;  3RV2 A;  4YHH C;  4G36 A;  2OO4 A;  2E7G A;  1O90 A;  5DV9 A;  3R44 A;  1N32 C;  3DHV A;  3H2T A;  2YWC A;  2YCB A;  3CW8 X;  4DV3 C;  2ZZM A;  2NCL A;  4RVN A;  3IPL A;  4X64 C;  4OX9 C;  1V25 A;  2D27 A;  2Y4N A;  4RMN A;  5AE2 A;  4L4Q A;  3A25 A;  4JV5 C;  5IT9 D;  4DR3 C;  1ZB9 A;  3NPD A;  5LMN C;  3E7W A;  4KTV A;  1PU1 A;  5KEI A;  4I9F A;  2VZE A;  1JOS A;  4X65 C;  4DR6 C;  3CQ2 A;  4HPV A;  3NYQ A;  2PN2 A;  5IWA C;  2DHM A;  1MDB A;  4JI8 C;  4JI4 C;  1FUG A;  2D1S A;  3IEV A;  4B3R C;  2OPL B;  1UKK A;  3VNQ A;  5BSV A;  4DCS A;  5BUR A;  1VEH A;  1USP B;  3FCE A;  5BSR A;  1P4E A;  1QWI A;  2MM9 A;  3L95 X;  2M5H A;  2Y4O A;  5KYV A;  2VSQ A;  3AY0 A; 
#chains in the Genus database with same CATH homology
 5LCI A;  2MM9 A;  2DHM A;  2KZ0 A;  1V60 A;  3TR3 A;  2NCL A;  2KDN A;  4PUI A;  3O2E A;  2MCQ A;  1NY8 A;  2MMA B;  4PUH A;  1XS3 A;  4PUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...