2KZ0A

Solution structure of a bola protein (ech_0303) from ehrlichia chaffeensis. seattle structural genomics center for infectious disease target ehcha.10365.a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
PGSMTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLDGLNIHAIQIQTGCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BolA family protein
publication title Structural characterization of a BolA protein (ECH_0303) from Ehrlichia chaffeensis, the agent responsible for human monocytotropic ehrlichiosis.
rcsb
source organism Ehrlichia chaffeensis
molecule tags Transcription
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2kz0A01
2KDNA 3TR3A 2NCLA 2MCQA 2DHMA 1XS3A 3O2EA 1V60A 4PUHA 2KZ0A 4PUGA 1NY8A 2MMAB 2MM9A 5LCIA 4PUIA
chains in the Genus database with same CATH superfamily
2Y4OA 4L4QA 4K0KC 1LCIA 2D28C 2DPLA 3N2QA 4PHTA 2P20A 3GR0A 2WD9A 5A1IA 5BR8C 5GTDA 4JI3C 2P2QA 4FUTA 1GPMA 1N33C 4LF8C 3J80D 3DHVA 1LQLA 4MTNA 3R9XA 4ZJZA 1JOSA 4TPSB 1XHJA 3E7WA 4DV2C 4G37A 4B3RC 4B3MC 1VEHA 1V26A 1HH2P 4DV1C 4JI2C 1HNWC 2UXCC 2PT7G 5H9UA 4NOZA 1WH9A 3VNQA 2DHMA 3OTOC 5IFIA 4JI1C 4DCVA 4FTFA 4DG8A 1IBLC 5E7QA 3CQ2A 3IPLA 4NXNC 4K0BA 4D56A 2KDNA 2E8FA 1V60A 4DR7C 1NYEA 4JI4C 3E7XA 2P2MA 2QVYX 3NI2A 2E5LC 3NYRA 1IB8A 3GR1A 4DR5C 4D57A 3G7SA 4DR2C 3A9VA 4WS9A 4LE5A 1ULTA 4D4IA 2QVXX 1KKGA 2UXBC 3AF5A 2MMAB 4X62C 1O93A 3O2EA 1FJGC 4BSZA 1IBKC 5LCIA 1XRAA 1XNRC 1L2FA 4BC7A 4GKJC 4JYAC 2V7BA 4DR6C 4JI5C 1QWIA 4PUHA 1O9TA 4KHPC 2D1SA 4JI6C 2D1TA 1ML8A 2ASBA 4IR7A 3UX2A 5FLXD 3LUSA 4RLQA 2ATWA 4ODJA 1AMUA 5KEIA 1YJ7A 2OO4A 4MH4A 3L8CA 2YWBA 3DLPX 3R44A 5KYVA 3IEVA 1USPA 3FCCA 3EQ6A 2ZM6C 4OX9C 3UOWA 4G1IA 1ZB9A 2EGTA 4R1LA 1MXAA 4PUGA 4NDNA 1N34C 3T1YC 1RY2A 2M5OA 2DYJA 5BSRA 2JMPA 4PZPA 3FCEA 2D1RA 3A9UA 1M6XC 3LNOA 2KZ0A 1M6XA 1TH5A 1IBMC 3UZ0A 2UUCC 1MDFA 1P4EC 1XRBA 4R1MA 2MM9A 3RV2A 1P4EA 2UUAC 4DUZC 2QW0X 5BSWA 3K6RA 2MCQA 1XRCA 4GS5A 4YY3C 2PROA 4RMNA 1J5EC 4PUIA 4DCSA 5A1GA 2WP0C 4PROC 3CQ1A 2P2FA 5AE3A 4JI0C 3RG2A 4GXRA 5BURA 1PG4A 4FUQA 4XX2A 1NY8A 2D1QA 4DG9A 4BC9A 3LAXA 2YCBA 2YX1A 2CXCA 4WV3A 4DR4C 3IEUA 5DV9A 5BUQA 2VQFC 3TUFA 4KTTA 3CW9A 1MDBA 2E0GA 2CY1A 2D27A 3ETCA 3UEBA 5T8SA 2OBVA 3NPDA 5BUSA 1RG9A 2E8EA 3NYQA 3N54B 2E8CA 4JM1A 3LGXA 2BH1X 4D4GA 1MD9A 1V25A 4DCUA 3H2TA 2YWCA 2Y27A 1QM4A 4HPVA 4DR1C 1USPB 4LF9C 4LF7C 4B3SC 2ONFA 4YHHC 1N2FA 1VLAA 1FLOA 3EERA 2VZEA 4R0MA 4X64C 3AF6A 2D7VA 3J81D 4DV3C 5CZXA 3PBKA 3R9WA 4I9FA 4NXMC 2UXDC 2HJGA 2M5HA 3L95X 4DR3C 3A26A 1I94C 3T1HC 5IT9D 1PG3A 4DV0C 4JI8C 3DAYA 1N36C 2JNVA 4DV6C 3TR3A 3CQ3A 1T5DX 2XR1A 1XS3A 4LFCC 4ISBA 1WF3A 4X66C 3JAMD 2QL8A 3VNSA 4LF6C 3VNRA 3TQIA 4OYCA 2HHHC 2BJOA 1O90A 4RLFA 4ZLPA 2OPLA 5BSMA 5AE2A 5A2QD 3KXWA 2PN2A 3C5EA 4LF5C 2UU9C 2UUBC 1N32C 1O92A 1HR0C 5BSTA 4X65C 2VQEC 5LMUC 1K0RA 1XMOC 3GPCA 5LMNC 5K85A 4DV4C 4DV5C 5AE1A 1HNXC 4KTVA 4RM2A 2ZZMA 4DV7C 1MXCA 5JRHA 5T8TA 1BA3A 2CU6A 5BSUA 5CZVA 4BCAA 3CW8X 4AQYC 3LNVA 4JI7C 4L2ZA 3CJEA 4BBYA 4U5YD 3S82A 5BSVA 3AY0A 2P02A 3A25A 1EGAA 5K8FA 1XNQC 1MXBA 3ETOA 4DUYC 1P7LA 2P2BA 2F4VC 4I9GA 2NCLA 1PA4A 1UWDA 2Y4NA 1WCJA 2QVZX 3UX3A 3B7WA 2AYAA 1ZB8A 4DCTA 4LFAC 5A19A 2VSQA 1HNZC 2P2JA 4G36A 3PROC 4OXIA 4RVOA 1UKKA 3I07A 3PESA 2E7GA 4EATA 5IWAC 2KZFA 4B3TC 1FUGA 3A4IA 4LFBC 4IZ6A 3TDEA 2ZZNA 5KYTA 5ADZA 2Z51A 3SO4A 3GKUA 1PU1A 1T5HX 2OPLB 3IMLA 4RVNA 3I08A 4JV5C 4RM3A 1MKYA 4LF4C 1XMQC 4GKKC 4GXQA 4L7IA
chains in the Genus database with same CATH topology
2KDNA 3TR3A 2NCLA 2MCQA 2DHMA 1XS3A 3O2EA 1V60A 4PUHA 2KZ0A 4PUGA 1NY8A 2MMAB 2MM9A 5LCIA 4PUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDN A;  3TR3 A;  2NCL A;  2MCQ A;  2DHM A;  1XS3 A;  3O2E A;  1V60 A;  4PUH A;  2KZ0 A;  4PUG A;  1NY8 A;  2MMA B;  2MM9 A;  5LCI A;  4PUI A; 
#chains in the Genus database with same CATH topology
 2Y4O A;  4L4Q A;  4K0K C;  1LCI A;  2D28 C;  2DPL A;  3N2Q A;  4PHT A;  2P20 A;  3GR0 A;  2WD9 A;  5A1I A;  5BR8 C;  5GTD A;  4JI3 C;  2P2Q A;  4FUT A;  1GPM A;  1N33 C;  4LF8 C;  3J80 D;  3DHV A;  1LQL A;  4MTN A;  3R9X A;  4ZJZ A;  1JOS A;  4TPS B;  1XHJ A;  3E7W A;  4DV2 C;  4G37 A;  4B3R C;  4B3M C;  1VEH A;  1V26 A;  1HH2 P;  4DV1 C;  4JI2 C;  1HNW C;  2UXC C;  2PT7 G;  5H9U A;  4NOZ A;  1WH9 A;  3VNQ A;  2DHM A;  3OTO C;  5IFI A;  4JI1 C;  4DCV A;  4FTF A;  4DG8 A;  1IBL C;  5E7Q A;  3CQ2 A;  3IPL A;  4NXN C;  4K0B A;  4D56 A;  2KDN A;  2E8F A;  1V60 A;  4DR7 C;  1NYE A;  4JI4 C;  3E7X A;  2P2M A;  2QVY X;  3NI2 A;  2E5L C;  3NYR A;  1IB8 A;  3GR1 A;  4DR5 C;  4D57 A;  3G7S A;  4DR2 C;  3A9V A;  4WS9 A;  4LE5 A;  1ULT A;  4D4I A;  2QVX X;  1KKG A;  2UXB C;  3AF5 A;  2MMA B;  4X62 C;  1O93 A;  3O2E A;  1FJG C;  4BSZ A;  1IBK C;  5LCI A;  1XRA A;  1XNR C;  1L2F A;  4BC7 A;  4GKJ C;  4JYA C;  2V7B A;  4DR6 C;  4JI5 C;  1QWI A;  4PUH A;  1O9T A;  4KHP C;  2D1S A;  4JI6 C;  2D1T A;  1ML8 A;  2ASB A;  4IR7 A;  3UX2 A;  5FLX D;  3LUS A;  4RLQ A;  2ATW A;  4ODJ A;  1AMU A;  5KEI A;  1YJ7 A;  2OO4 A;  4MH4 A;  3L8C A;  2YWB A;  3DLP X;  3R44 A;  5KYV A;  3IEV A;  1USP A;  3FCC A;  3EQ6 A;  2ZM6 C;  4OX9 C;  3UOW A;  4G1I A;  1ZB9 A;  2EGT A;  4R1L A;  1MXA A;  4PUG A;  4NDN A;  1N34 C;  3T1Y C;  1RY2 A;  2M5O A;  2DYJ A;  5BSR A;  2JMP A;  4PZP A;  3FCE A;  2D1R A;  3A9U A;  1M6X C;  3LNO A;  2KZ0 A;  1M6X A;  1TH5 A;  1IBM C;  3UZ0 A;  2UUC C;  1MDF A;  1P4E C;  1XRB A;  4R1M A;  2MM9 A;  3RV2 A;  1P4E A;  2UUA C;  4DUZ C;  2QW0 X;  5BSW A;  3K6R A;  2MCQ A;  1XRC A;  4GS5 A;  4YY3 C;  2PRO A;  4RMN A;  1J5E C;  4PUI A;  4DCS A;  5A1G A;  2WP0 C;  4PRO C;  3CQ1 A;  2P2F A;  5AE3 A;  4JI0 C;  3RG2 A;  4GXR A;  5BUR A;  1PG4 A;  4FUQ A;  4XX2 A;  1NY8 A;  2D1Q A;  4DG9 A;  4BC9 A;  3LAX A;  2YCB A;  2YX1 A;  2CXC A;  4WV3 A;  4DR4 C;  3IEU A;  5DV9 A;  5BUQ A;  2VQF C;  3TUF A;  4KTT A;  3CW9 A;  1MDB A;  2E0G A;  2CY1 A;  2D27 A;  3ETC A;  3UEB A;  5T8S A;  2OBV A;  3NPD A;  5BUS A;  1RG9 A;  2E8E A;  3NYQ A;  3N54 B;  2E8C A;  4JM1 A;  3LGX A;  2BH1 X;  4D4G A;  1MD9 A;  1V25 A;  4DCU A;  3H2T A;  2YWC A;  2Y27 A;  1QM4 A;  4HPV A;  4DR1 C;  1USP B;  4LF9 C;  4LF7 C;  4B3S C;  2ONF A;  4YHH C;  1N2F A;  1VLA A;  1FLO A;  3EER A;  2VZE A;  4R0M A;  4X64 C;  3AF6 A;  2D7V A;  3J81 D;  4DV3 C;  5CZX A;  3PBK A;  3R9W A;  4I9F A;  4NXM C;  2UXD C;  2HJG A;  2M5H A;  3L95 X;  4DR3 C;  3A26 A;  1I94 C;  3T1H C;  5IT9 D;  1PG3 A;  4DV0 C;  4JI8 C;  3DAY A;  1N36 C;  2JNV A;  4DV6 C;  3TR3 A;  3CQ3 A;  1T5D X;  2XR1 A;  1XS3 A;  4LFC C;  4ISB A;  1WF3 A;  4X66 C;  3JAM D;  2QL8 A;  3VNS A;  4LF6 C;  3VNR A;  3TQI A;  4OYC A;  2HHH C;  2BJO A;  1O90 A;  4RLF A;  4ZLP A;  2OPL A;  5BSM A;  5AE2 A;  5A2Q D;  3KXW A;  2PN2 A;  3C5E A;  4LF5 C;  2UU9 C;  2UUB C;  1N32 C;  1O92 A;  1HR0 C;  5BST A;  4X65 C;  2VQE C;  5LMU C;  1K0R A;  1XMO C;  3GPC A;  5LMN C;  5K85 A;  4DV4 C;  4DV5 C;  5AE1 A;  1HNX C;  4KTV A;  4RM2 A;  2ZZM A;  4DV7 C;  1MXC A;  5JRH A;  5T8T A;  1BA3 A;  2CU6 A;  5BSU A;  5CZV A;  4BCA A;  3CW8 X;  4AQY C;  3LNV A;  4JI7 C;  4L2Z A;  3CJE A;  4BBY A;  4U5Y D;  3S82 A;  5BSV A;  3AY0 A;  2P02 A;  3A25 A;  1EGA A;  5K8F A;  1XNQ C;  1MXB A;  3ETO A;  4DUY C;  1P7L A;  2P2B A;  2F4V C;  4I9G A;  2NCL A;  1PA4 A;  1UWD A;  2Y4N A;  1WCJ A;  2QVZ X;  3UX3 A;  3B7W A;  2AYA A;  1ZB8 A;  4DCT A;  4LFA C;  5A19 A;  2VSQ A;  1HNZ C;  2P2J A;  4G36 A;  3PRO C;  4OXI A;  4RVO A;  1UKK A;  3I07 A;  3PES A;  2E7G A;  4EAT A;  5IWA C;  2KZF A;  4B3T C;  1FUG A;  3A4I A;  4LFB C;  4IZ6 A;  3TDE A;  2ZZN A;  5KYT A;  5ADZ A;  2Z51 A;  3SO4 A;  3GKU A;  1PU1 A;  1T5H X;  2OPL B;  3IML A;  4RVN A;  3I08 A;  4JV5 C;  4RM3 A;  1MKY A;  4LF4 C;  1XMQ C;  4GKK C;  4GXQ A;  4L7I A; 
#chains in the Genus database with same CATH homology
 2KDN A;  3TR3 A;  2NCL A;  2MCQ A;  2DHM A;  1XS3 A;  3O2E A;  1V60 A;  4PUH A;  2KZ0 A;  4PUG A;  1NY8 A;  2MMA B;  2MM9 A;  5LCI A;  4PUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...