2KZ0A

Solution structure of a bola protein (ech_0303) from ehrlichia chaffeensis. seattle structural genomics center for infectious disease target ehcha.10365.a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
b'PGSMTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLDGLNIHAIQIQTGCK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BolA family protein
publication title Structural characterization of a BolA protein (ECH_0303) from Ehrlichia chaffeensis, the agent responsible for human monocytotropic ehrlichiosis.
rcsb
source organism Ehrlichia chaffeensis
molecule tags Transcription
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2kz0A01
5LCIA 2KDNA 2DHMA 4PUIA 4PUGA 2MM9A 2NCLA 1XS3A 2KZ0A 3O2EA 2MMAB 4PUHA 2MCQA 3TR3A 1NY8A 1V60A
chains in the Genus database with same CATH superfamily
3J80D 1QWIA 3NPDA 2KZ0A 1MXBA 1P4EC 3T1YC 3PESA 5K85A 2D1QA 3TR3A 2PT7G 2D1TA 4I9GA 4DUZC 3T1HC 4D57A 1HNZC 1USPB 1NY8A 5KYVA 4GXQA 2D28C 1O90A 4OXIA 1GPMA 4PUHA 4XX2A 4DUYC 2V7BA 1XNQC 2BJOA 5K8FA 2YWCA 4JV5C 3R44A 1QM4A 3OTOC 1LQLA 3O2EA 4IZ6A 4G1IA 1WH9A 3S82A 1V26A 4OX9C 5JRHA 3A26A 2E8CA 5ADZA 3TQIA 4BC9A 3PBKA 1J5EC 3EQ6A 3UX2A 4DV7C 2EGTA 1FUGA 4FUTA 4HPVA 5A1IA 1IBLC 3AY0A 1N34C 3G7SA 3IMLA 2UUBC 4OYCA 4KTVA 2OPLA 4G36A 4YHHC 4X66C 4DV4C 1MXCA 4IR7A 1UKKA 4DV6C 2HJGA 4GXRA 1UWDA 4BSZA 2Y4NA 4PHTA 4DR5C 1XMOC 2P2FA 4DR1C 1LCIA 5A19A 4ODJA 2ATWA 3EERA 5BURA 5IWAC 3TDEA 1FLOA 2Y27A 2E5LC 2Y4OA 1PA4A 4PROC 4EATA 4JI3C 1N33C 1XS3A 4DV2C 2QVXX 3H2TA 1HNWC 4PUGA 4R1LA 2WP0C 4DV1C 4D56A 4DR2C 1WCJA 2P2BA 4MH4A 4JI4C 2P20A 2PROA 4U5YD 4NDNA 4WV3A 2QVZX 2BH1X 5IT9D 2E8FA 4K0BA 3N54B 1XNRC 4JI0C 1L2FA 4LF5C 2P2QA 2YWBA 1PU1A 3L95X 2XR1A 2M5OA 4DG9A 3KXWA 1XRAA 2VSQA 5E7QA 3R9WA 1RG9A 3VNSA 4DR6C 5KEIA 4KTTA 1T5DX 2ZM6C 3LNOA 1V60A 4NXNC 3RV2A 1EGAA 3R9XA 4RLQA 2QVYX 2ASBA 4D4IA 2D1RA 3DHVA 4RVOA 5CZVA 4NOZA 1P4EA 4JI2C 1K0RA 2JMPA 4LFAC 4NXMC 3FCCA 4LF9C 4YY3C 4B3SC 4JI1C 3IEVA 1O93A 4RVNA 4TPSB 1PG3A 5BSMA 2D7VA 3B7WA 3GPCA 4B3TC 5CZXA 1ML8A 2E0GA 2CXCA 4B3RC 1T5HX 2YX1A 4KHPC 3NYRA 2MM9A 5AE3A 1HNXC 5T8TA 2OPLB 1IB8A 2DPLA 3AF5A 2UXCC 1IBMC 4BCAA 4LFCC 4GS5A 2DHMA 2ONFA 4DV3C 3VNQA 1M6XC 4ZLPA 5LCIA 2P2JA 2AYAA 1N2FA 1MDFA 1ZB9A 1MD9A 3DAYA 2UXDC 1WF3A 4JI8C 3CW8X 5BUSA 2QL8A 3N2QA 1ZB8A 1O9TA 4LF7C 2NCLA 5T8SA 5BSWA 1O92A 5A1GA 1FJGC 4DCTA 3K6RA 4RM3A 1TH5A 2P2MA 1NYEA 4BC7A 1VEHA 1XRBA 3DLPX 2OBVA 5LMNC 1MDBA 1IBKC 4WS9A 4JI6C 2OO4A 3NI2A 4LF8C 5AE1A 5BUQA 2JNVA 3GR1A 1ULTA 2F4VC 4X65C 3LAXA 2D27A 3UOWA 4FUQA 3VNRA 3L8CA 2MCQA 2UXBC 4DR3C 2M5HA 5KYTA 3TUFA 2ZZMA 3GR0A 4GKJC 3A9VA 4B3MC 4JYAC 2UUAC 4D4GA 4G37A 4R1MA 1USPA 4PUIA 3CQ1A 1V25A 3GKUA 5BR8C 4DR7C 1XMQC 3A9UA 3I07A 2VQFC 2UUCC 2DYJA 2CU6A 4R0MA 4L4QA 3CQ2A 1KKGA 5AE2A 3AF6A 4LFBC 3LUSA 1XHJA 4RMNA 5IFIA 4DV0C 4L7IA 2Z51A 2KDNA 1MKYA 5DV9A 3J81D 4PZPA 2QW0X 4DCVA 3ETOA 3UX3A 1HH2P 3NYQA 5A2QD 2MMAB 4BBYA 4DG8A 1MXAA 5BSRA 4DCUA 1N36C 2HHHC 2YCBA 4LE5A 3E7XA 2P02A 2E7GA 4MTNA 4X62C 4L2ZA 5LMUC 2D1SA 4GKKC 1AMUA 3CJEA 4RM2A 4DV5C 3ETCA 2WD9A 1N32C 4LF6C 3SO4A 5BSTA 4RLFA 5BSUA 3JAMD 4AQYC 4JI7C 4JM1A 2KZFA 1JOSA 3A25A 2ZZNA 2VQEC 4DCSA 4ZJZA 1XRCA 3C5EA 1RY2A 1PG4A 1M6XA 3IEUA 4FTFA 1P7LA 4JI5C 3FCEA 4K0KC 5BSVA 2VZEA 4I9FA 3UEBA 4DR4C 5H9UA 4LF4C 4X64C 3CW9A 1VLAA 1I94C 3IPLA 2E8EA 4ISBA 3A4IA 1BA3A 5FLXD 2CY1A 3PROC 3I08A 1HR0C 3CQ3A 2UU9C 3LNVA 3UZ0A 1YJ7A 3LGXA 3RG2A 2PN2A 5GTDA 3E7WA
chains in the Genus database with same CATH topology
5LCIA 2KDNA 2DHMA 4PUIA 4PUGA 2MM9A 2NCLA 1XS3A 2KZ0A 3O2EA 2MMAB 4PUHA 2MCQA 3TR3A 1NY8A 1V60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCI A;  2KDN A;  2DHM A;  4PUI A;  4PUG A;  2MM9 A;  2NCL A;  1XS3 A;  2KZ0 A;  3O2E A;  2MMA B;  4PUH A;  2MCQ A;  3TR3 A;  1NY8 A;  1V60 A; 
#chains in the Genus database with same CATH topology
 3J80 D;  1QWI A;  3NPD A;  2KZ0 A;  1MXB A;  1P4E C;  3T1Y C;  3PES A;  5K85 A;  2D1Q A;  3TR3 A;  2PT7 G;  2D1T A;  4I9G A;  4DUZ C;  3T1H C;  4D57 A;  1HNZ C;  1USP B;  1NY8 A;  5KYV A;  4GXQ A;  2D28 C;  1O90 A;  4OXI A;  1GPM A;  4PUH A;  4XX2 A;  4DUY C;  2V7B A;  1XNQ C;  2BJO A;  5K8F A;  2YWC A;  4JV5 C;  3R44 A;  1QM4 A;  3OTO C;  1LQL A;  3O2E A;  4IZ6 A;  4G1I A;  1WH9 A;  3S82 A;  1V26 A;  4OX9 C;  5JRH A;  3A26 A;  2E8C A;  5ADZ A;  3TQI A;  4BC9 A;  3PBK A;  1J5E C;  3EQ6 A;  3UX2 A;  4DV7 C;  2EGT A;  1FUG A;  4FUT A;  4HPV A;  5A1I A;  1IBL C;  3AY0 A;  1N34 C;  3G7S A;  3IML A;  2UUB C;  4OYC A;  4KTV A;  2OPL A;  4G36 A;  4YHH C;  4X66 C;  4DV4 C;  1MXC A;  4IR7 A;  1UKK A;  4DV6 C;  2HJG A;  4GXR A;  1UWD A;  4BSZ A;  2Y4N A;  4PHT A;  4DR5 C;  1XMO C;  2P2F A;  4DR1 C;  1LCI A;  5A19 A;  4ODJ A;  2ATW A;  3EER A;  5BUR A;  5IWA C;  3TDE A;  1FLO A;  2Y27 A;  2E5L C;  2Y4O A;  1PA4 A;  4PRO C;  4EAT A;  4JI3 C;  1N33 C;  1XS3 A;  4DV2 C;  2QVX X;  3H2T A;  1HNW C;  4PUG A;  4R1L A;  2WP0 C;  4DV1 C;  4D56 A;  4DR2 C;  1WCJ A;  2P2B A;  4MH4 A;  4JI4 C;  2P20 A;  2PRO A;  4U5Y D;  4NDN A;  4WV3 A;  2QVZ X;  2BH1 X;  5IT9 D;  2E8F A;  4K0B A;  3N54 B;  1XNR C;  4JI0 C;  1L2F A;  4LF5 C;  2P2Q A;  2YWB A;  1PU1 A;  3L95 X;  2XR1 A;  2M5O A;  4DG9 A;  3KXW A;  1XRA A;  2VSQ A;  5E7Q A;  3R9W A;  1RG9 A;  3VNS A;  4DR6 C;  5KEI A;  4KTT A;  1T5D X;  2ZM6 C;  3LNO A;  1V60 A;  4NXN C;  3RV2 A;  1EGA A;  3R9X A;  4RLQ A;  2QVY X;  2ASB A;  4D4I A;  2D1R A;  3DHV A;  4RVO A;  5CZV A;  4NOZ A;  1P4E A;  4JI2 C;  1K0R A;  2JMP A;  4LFA C;  4NXM C;  3FCC A;  4LF9 C;  4YY3 C;  4B3S C;  4JI1 C;  3IEV A;  1O93 A;  4RVN A;  4TPS B;  1PG3 A;  5BSM A;  2D7V A;  3B7W A;  3GPC A;  4B3T C;  5CZX A;  1ML8 A;  2E0G A;  2CXC A;  4B3R C;  1T5H X;  2YX1 A;  4KHP C;  3NYR A;  2MM9 A;  5AE3 A;  1HNX C;  5T8T A;  2OPL B;  1IB8 A;  2DPL A;  3AF5 A;  2UXC C;  1IBM C;  4BCA A;  4LFC C;  4GS5 A;  2DHM A;  2ONF A;  4DV3 C;  3VNQ A;  1M6X C;  4ZLP A;  5LCI A;  2P2J A;  2AYA A;  1N2F A;  1MDF A;  1ZB9 A;  1MD9 A;  3DAY A;  2UXD C;  1WF3 A;  4JI8 C;  3CW8 X;  5BUS A;  2QL8 A;  3N2Q A;  1ZB8 A;  1O9T A;  4LF7 C;  2NCL A;  5T8S A;  5BSW A;  1O92 A;  5A1G A;  1FJG C;  4DCT A;  3K6R A;  4RM3 A;  1TH5 A;  2P2M A;  1NYE A;  4BC7 A;  1VEH A;  1XRB A;  3DLP X;  2OBV A;  5LMN C;  1MDB A;  1IBK C;  4WS9 A;  4JI6 C;  2OO4 A;  3NI2 A;  4LF8 C;  5AE1 A;  5BUQ A;  2JNV A;  3GR1 A;  1ULT A;  2F4V C;  4X65 C;  3LAX A;  2D27 A;  3UOW A;  4FUQ A;  3VNR A;  3L8C A;  2MCQ A;  2UXB C;  4DR3 C;  2M5H A;  5KYT A;  3TUF A;  2ZZM A;  3GR0 A;  4GKJ C;  3A9V A;  4B3M C;  4JYA C;  2UUA C;  4D4G A;  4G37 A;  4R1M A;  1USP A;  4PUI A;  3CQ1 A;  1V25 A;  3GKU A;  5BR8 C;  4DR7 C;  1XMQ C;  3A9U A;  3I07 A;  2VQF C;  2UUC C;  2DYJ A;  2CU6 A;  4R0M A;  4L4Q A;  3CQ2 A;  1KKG A;  5AE2 A;  3AF6 A;  4LFB C;  3LUS A;  1XHJ A;  4RMN A;  5IFI A;  4DV0 C;  4L7I A;  2Z51 A;  2KDN A;  1MKY A;  5DV9 A;  3J81 D;  4PZP A;  2QW0 X;  4DCV A;  3ETO A;  3UX3 A;  1HH2 P;  3NYQ A;  5A2Q D;  2MMA B;  4BBY A;  4DG8 A;  1MXA A;  5BSR A;  4DCU A;  1N36 C;  2HHH C;  2YCB A;  4LE5 A;  3E7X A;  2P02 A;  2E7G A;  4MTN A;  4X62 C;  4L2Z A;  5LMU C;  2D1S A;  4GKK C;  1AMU A;  3CJE A;  4RM2 A;  4DV5 C;  3ETC A;  2WD9 A;  1N32 C;  4LF6 C;  3SO4 A;  5BST A;  4RLF A;  5BSU A;  3JAM D;  4AQY C;  4JI7 C;  4JM1 A;  2KZF A;  1JOS A;  3A25 A;  2ZZN A;  2VQE C;  4DCS A;  4ZJZ A;  1XRC A;  3C5E A;  1RY2 A;  1PG4 A;  1M6X A;  3IEU A;  4FTF A;  1P7L A;  4JI5 C;  3FCE A;  4K0K C;  5BSV A;  2VZE A;  4I9F A;  3UEB A;  4DR4 C;  5H9U A;  4LF4 C;  4X64 C;  3CW9 A;  1VLA A;  1I94 C;  3IPL A;  2E8E A;  4ISB A;  3A4I A;  1BA3 A;  5FLX D;  2CY1 A;  3PRO C;  3I08 A;  1HR0 C;  3CQ3 A;  2UU9 C;  3LNV A;  3UZ0 A;  1YJ7 A;  3LGX A;  3RG2 A;  2PN2 A;  5GTD A;  3E7W A; 
#chains in the Genus database with same CATH homology
 5LCI A;  2KDN A;  2DHM A;  4PUI A;  4PUG A;  2MM9 A;  2NCL A;  1XS3 A;  2KZ0 A;  3O2E A;  2MMA B;  4PUH A;  2MCQ A;  3TR3 A;  1NY8 A;  1V60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...