2KZ0A

Solution structure of a bola protein (ech_0303) from ehrlichia chaffeensis. seattle structural genomics center for infectious disease target ehcha.10365.a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
PGSMTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLDGLNIHAIQIQTGCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords BolA family protein
publication title Structural characterization of a BolA protein (ECH_0303) from Ehrlichia chaffeensis, the agent responsible for human monocytotropic ehrlichiosis.
rcsb
source organism Ehrlichia chaffeensis
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2kz0A01
2MM9A 1XS3A 2DHMA 2KZ0A 2KDNA 4PUIA 4PUGA 2MCQA 2NCLA 1NY8A 2MMAB 5LCIA 3TR3A 3O2EA 1V60A 4PUHA
chains in the Genus database with same CATH superfamily
4PUGA 4K0BA 1N34C 2E0GA 5A1GA 4LFBC 4DCSA 1UKKA 3C5EA 4L2ZA 4DR5C 1L2FA 4PZPA 1MD9A 2QVZX 3FCEA 3NPDA 2Y27A 4U5YD 4DV6C 1KKGA 1QM4A 5CZVA 4FTFA 5BSRA 4FUQA 2D28C 3TQIA 4RLFA 4G36A 4DR4C 2UUCC 1O93A 3E7WA 4BCAA 4OYCA 4LFCC 1NY8A 3GR1A 1IBMC 4RM3A 3B7WA 2WD9A 4G1IA 2JMPA 1EGAA 4DR7C 2WP0C 1HR0C 2QW0X 3IEVA 4D57A 2DHMA 1V26A 4R1MA 1WH9A 4DV2C 3A4IA 4OX9C 2DPLA 3NYRA 3DLPX 5BUSA 3UZ0A 3LAXA 2M5HA 1MDFA 2D1RA 4JYAC 2YCBA 1ULTA 5T8TA 4GS5A 2OO4A 4GKJC 2UXCC 1O92A 2HJGA 4RLQA 1YJ7A 1MXCA 5AE1A 2KDNA 5IT9D 1XNRC 3CQ1A 1WF3A 2ONFA 2E7GA 4JV5C 4LF5C 4DG9A 2D1SA 2HHHC 5KYVA 2BH1X 3NI2A 5BSVA 3UX3A 4L4QA 1FJGC 3AY0A 3LNOA 3A9VA 3EQ6A 5BSUA 3R9WA 1QWIA 3DAYA 1LCIA 2CU6A 4WV3A 4KHPC 2BJOA 2YWBA 3ETCA 4DV3C 4B3TC 2CY1A 3OTOC 1N33C 4XX2A 3I07A 1N2FA 4D56A 4RVNA 4D4IA 4PROC 4DR2C 4AQYC 4JI4C 1P4EA 2PT7G 3VNQA 4GKKC 3IMLA 4MTNA 2OPLA 4DV5C 4D4GA 3I08A 3K6RA 3IPLA 4JM1A 1VEHA 1MXAA 4ZLPA 3A25A 4DV4C 2ATWA 5BSTA 5FLXD 5LCIA 3LGXA 3O2EA 4JI5C 3UEBA 1TH5A 3UOWA 1XNQC 1XS3A 4MH4A 3VNSA 5LMNC 3AF6A 3DHVA 5H9UA 4DR3C 4DR1C 3L95X 3TR3A 2E8CA 4KTVA 5KYTA 4LF4C 1PG4A 3CW8X 4R1LA 3NYQA 1XMOC 1T5HX 1HNXC 2OPLB 4LF9C 4RM2A 4RMNA 4JI1C 1HNZC 1N32C 3FCCA 2YWCA 1PU1A 2ZM6C 2D1TA 1FUGA 3AF5A 2UXBC 4NOZA 3KXWA 1NYEA 1P7LA 2D7VA 4ODJA 4DV7C 4RVOA 2P2JA 4IZ6A 4JI2C 2YX1A 5BSMA 2CXCA 3GPCA 4B3SC 3IEUA 5JRHA 2DYJA 5BSWA 2MMAB 2E8FA 4DCVA 4X65C 5A19A 1FLOA 4K0KC 3R44A 3VNRA 3T1HC 1ZB8A 5ADZA 3CW9A 4X66C 3PROC 1XHJA 1M6XC 4DCTA 1BA3A 4LE5A 1MDBA 2XR1A 4GXRA 5LMUC 2E5LC 2MCQA 2KZ0A 2UUBC 3R9XA 1WCJA 5A1IA 2P2BA 1MKYA 2NCLA 3L8CA 4HPVA 1IBKC 4LF8C 1N36C 4BBYA 3E7XA 3CQ3A 1UWDA 2P2MA 4R0MA 1IB8A 2MM9A 5BUQA 3RG2A 2PROA 2KZFA 1USPA 3RV2A 2UXDC 5BR8C 1HNWC 1V25A 1XRCA 4I9FA 1GPMA 1AMUA 1MXBA 1IBLC 2PN2A 1XRBA 5GTDA 2QL8A 4TPSB 4NXNC 4DCUA 4EATA 2V7BA 4X62C 3SO4A 4IR7A 3CJEA 5BURA 2Y4OA 4GXQA 2VQEC 4ISBA 3LUSA 3EERA 2JNVA 3G7SA 5KEIA 3GR0A 1T5DX 1PG3A 3A9UA 2P2FA 4BSZA 2EGTA 3J81D 1JOSA 4G37A 2OBVA 1USPB 4KTTA 3TDEA 2P02A 5K85A 4DG8A 1XMQC 2UUAC 2VZEA 2P20A 4I9GA 4PUHA 4JI6C 1PA4A 1XRAA 3GKUA 2ZZMA 2D27A 2ZZNA 1HH2P 5IFIA 1ML8A 2QVXX 2AYAA 4WS9A 4DUYC 4B3RC 3S82A 4LFAC 2VSQA 3TUFA 4BC9A 4L7IA 5A2QD 5AE2A 3T1YC 4LF7C 1ZB9A 5E7QA 3ETOA 3H2TA 4JI3C 2P2QA 1VLAA 2F4VC 3LNVA 4DUZC 4BC7A 2Z51A 2Y4NA 2ASBA 1O90A 3JAMD 3A26A 3PESA 4NDNA 3UX2A 4JI8C 2QVYX 4JI0C 1I94C 4PHTA 1J5EC 3CQ2A 1RG9A 5CZXA 1O9TA 5T8SA 5K8FA 1P4EC 1RY2A 4YHHC 2E8EA 5IWAC 2D1QA 4X64C 2M5OA 3J80D 1V60A 4DV1C 1K0RA 4PUIA 3N2QA 5AE3A 3PBKA 4B3MC 1M6XA 4LF6C 2UU9C 4ZJZA 4FUTA 4OXIA 3N54B 5DV9A 4YY3C 2VQFC 1LQLA 4JI7C 4NXMC 4DR6C 4DV0C
chains in the Genus database with same CATH topology
2MM9A 1XS3A 2DHMA 2KZ0A 2KDNA 4PUIA 4PUGA 2MCQA 2NCLA 1NY8A 2MMAB 5LCIA 3TR3A 3O2EA 1V60A 4PUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM9 A;  1XS3 A;  2DHM A;  2KZ0 A;  2KDN A;  4PUI A;  4PUG A;  2MCQ A;  2NCL A;  1NY8 A;  2MMA B;  5LCI A;  3TR3 A;  3O2E A;  1V60 A;  4PUH A; 
#chains in the Genus database with same CATH topology
 4PUG A;  4K0B A;  1N34 C;  2E0G A;  5A1G A;  4LFB C;  4DCS A;  1UKK A;  3C5E A;  4L2Z A;  4DR5 C;  1L2F A;  4PZP A;  1MD9 A;  2QVZ X;  3FCE A;  3NPD A;  2Y27 A;  4U5Y D;  4DV6 C;  1KKG A;  1QM4 A;  5CZV A;  4FTF A;  5BSR A;  4FUQ A;  2D28 C;  3TQI A;  4RLF A;  4G36 A;  4DR4 C;  2UUC C;  1O93 A;  3E7W A;  4BCA A;  4OYC A;  4LFC C;  1NY8 A;  3GR1 A;  1IBM C;  4RM3 A;  3B7W A;  2WD9 A;  4G1I A;  2JMP A;  1EGA A;  4DR7 C;  2WP0 C;  1HR0 C;  2QW0 X;  3IEV A;  4D57 A;  2DHM A;  1V26 A;  4R1M A;  1WH9 A;  4DV2 C;  3A4I A;  4OX9 C;  2DPL A;  3NYR A;  3DLP X;  5BUS A;  3UZ0 A;  3LAX A;  2M5H A;  1MDF A;  2D1R A;  4JYA C;  2YCB A;  1ULT A;  5T8T A;  4GS5 A;  2OO4 A;  4GKJ C;  2UXC C;  1O92 A;  2HJG A;  4RLQ A;  1YJ7 A;  1MXC A;  5AE1 A;  2KDN A;  5IT9 D;  1XNR C;  3CQ1 A;  1WF3 A;  2ONF A;  2E7G A;  4JV5 C;  4LF5 C;  4DG9 A;  2D1S A;  2HHH C;  5KYV A;  2BH1 X;  3NI2 A;  5BSV A;  3UX3 A;  4L4Q A;  1FJG C;  3AY0 A;  3LNO A;  3A9V A;  3EQ6 A;  5BSU A;  3R9W A;  1QWI A;  3DAY A;  1LCI A;  2CU6 A;  4WV3 A;  4KHP C;  2BJO A;  2YWB A;  3ETC A;  4DV3 C;  4B3T C;  2CY1 A;  3OTO C;  1N33 C;  4XX2 A;  3I07 A;  1N2F A;  4D56 A;  4RVN A;  4D4I A;  4PRO C;  4DR2 C;  4AQY C;  4JI4 C;  1P4E A;  2PT7 G;  3VNQ A;  4GKK C;  3IML A;  4MTN A;  2OPL A;  4DV5 C;  4D4G A;  3I08 A;  3K6R A;  3IPL A;  4JM1 A;  1VEH A;  1MXA A;  4ZLP A;  3A25 A;  4DV4 C;  2ATW A;  5BST A;  5FLX D;  5LCI A;  3LGX A;  3O2E A;  4JI5 C;  3UEB A;  1TH5 A;  3UOW A;  1XNQ C;  1XS3 A;  4MH4 A;  3VNS A;  5LMN C;  3AF6 A;  3DHV A;  5H9U A;  4DR3 C;  4DR1 C;  3L95 X;  3TR3 A;  2E8C A;  4KTV A;  5KYT A;  4LF4 C;  1PG4 A;  3CW8 X;  4R1L A;  3NYQ A;  1XMO C;  1T5H X;  1HNX C;  2OPL B;  4LF9 C;  4RM2 A;  4RMN A;  4JI1 C;  1HNZ C;  1N32 C;  3FCC A;  2YWC A;  1PU1 A;  2ZM6 C;  2D1T A;  1FUG A;  3AF5 A;  2UXB C;  4NOZ A;  3KXW A;  1NYE A;  1P7L A;  2D7V A;  4ODJ A;  4DV7 C;  4RVO A;  2P2J A;  4IZ6 A;  4JI2 C;  2YX1 A;  5BSM A;  2CXC A;  3GPC A;  4B3S C;  3IEU A;  5JRH A;  2DYJ A;  5BSW A;  2MMA B;  2E8F A;  4DCV A;  4X65 C;  5A19 A;  1FLO A;  4K0K C;  3R44 A;  3VNR A;  3T1H C;  1ZB8 A;  5ADZ A;  3CW9 A;  4X66 C;  3PRO C;  1XHJ A;  1M6X C;  4DCT A;  1BA3 A;  4LE5 A;  1MDB A;  2XR1 A;  4GXR A;  5LMU C;  2E5L C;  2MCQ A;  2KZ0 A;  2UUB C;  3R9X A;  1WCJ A;  5A1I A;  2P2B A;  1MKY A;  2NCL A;  3L8C A;  4HPV A;  1IBK C;  4LF8 C;  1N36 C;  4BBY A;  3E7X A;  3CQ3 A;  1UWD A;  2P2M A;  4R0M A;  1IB8 A;  2MM9 A;  5BUQ A;  3RG2 A;  2PRO A;  2KZF A;  1USP A;  3RV2 A;  2UXD C;  5BR8 C;  1HNW C;  1V25 A;  1XRC A;  4I9F A;  1GPM A;  1AMU A;  1MXB A;  1IBL C;  2PN2 A;  1XRB A;  5GTD A;  2QL8 A;  4TPS B;  4NXN C;  4DCU A;  4EAT A;  2V7B A;  4X62 C;  3SO4 A;  4IR7 A;  3CJE A;  5BUR A;  2Y4O A;  4GXQ A;  2VQE C;  4ISB A;  3LUS A;  3EER A;  2JNV A;  3G7S A;  5KEI A;  3GR0 A;  1T5D X;  1PG3 A;  3A9U A;  2P2F A;  4BSZ A;  2EGT A;  3J81 D;  1JOS A;  4G37 A;  2OBV A;  1USP B;  4KTT A;  3TDE A;  2P02 A;  5K85 A;  4DG8 A;  1XMQ C;  2UUA C;  2VZE A;  2P20 A;  4I9G A;  4PUH A;  4JI6 C;  1PA4 A;  1XRA A;  3GKU A;  2ZZM A;  2D27 A;  2ZZN A;  1HH2 P;  5IFI A;  1ML8 A;  2QVX X;  2AYA A;  4WS9 A;  4DUY C;  4B3R C;  3S82 A;  4LFA C;  2VSQ A;  3TUF A;  4BC9 A;  4L7I A;  5A2Q D;  5AE2 A;  3T1Y C;  4LF7 C;  1ZB9 A;  5E7Q A;  3ETO A;  3H2T A;  4JI3 C;  2P2Q A;  1VLA A;  2F4V C;  3LNV A;  4DUZ C;  4BC7 A;  2Z51 A;  2Y4N A;  2ASB A;  1O90 A;  3JAM D;  3A26 A;  3PES A;  4NDN A;  3UX2 A;  4JI8 C;  2QVY X;  4JI0 C;  1I94 C;  4PHT A;  1J5E C;  3CQ2 A;  1RG9 A;  5CZX A;  1O9T A;  5T8S A;  5K8F A;  1P4E C;  1RY2 A;  4YHH C;  2E8E A;  5IWA C;  2D1Q A;  4X64 C;  2M5O A;  3J80 D;  1V60 A;  4DV1 C;  1K0R A;  4PUI A;  3N2Q A;  5AE3 A;  3PBK A;  4B3M C;  1M6X A;  4LF6 C;  2UU9 C;  4ZJZ A;  4FUT A;  4OXI A;  3N54 B;  5DV9 A;  4YY3 C;  2VQF C;  1LQL A;  4JI7 C;  4NXM C;  4DR6 C;  4DV0 C; 
#chains in the Genus database with same CATH homology
 2MM9 A;  1XS3 A;  2DHM A;  2KZ0 A;  2KDN A;  4PUI A;  4PUG A;  2MCQ A;  2NCL A;  1NY8 A;  2MMA B;  5LCI A;  3TR3 A;  3O2E A;  1V60 A;  4PUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...