2HJGA

The crystal structure of the b. subtilis yphc gtpase in complex with gdp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
434
structure length
400
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLDNNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTP-binding protein engA
publication title The essential GTPase YphC displays a major domain rearrangement associated with nucleotide binding.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 120
structure length 400
sequence length 434
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hjgA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA01
4X65C 2BIFA 3HR8A 3GLFA 3QBVA 4OK6A 2J3EA 5JHHB 2GA8A 2GKSA 3OHMA 2EFCB 3AVYA 5JI2E 4X8OA 4TL8A 2DWPA 4IVRA 1ZUHA 2GXAA 2HF8A 3QKTA 3WMFA 4DDTA 4HLDA 5J40A 4HLCA 4Q4AB 4H9GA 3RHFA 4Q48A 1P4SA 2VL7A 4GOJA 4TWZA 1ZB9A 4LF4C 2GCPA 2GJSA 4EPWA 2VSFA 4GZLA 3VR3A 3AF6A 4Q1EA 3ZIAD 4AURA 3UMSA 4ZDKA 4M22A 1IY2A 1S8FA 2YWEA 1TEXA 3AF0A 3T5DA 1W1WA 1N6IA 3P26A 2RGDA 1XMJA 1C4OA 5H70A 3AF3A 5DHAA 5EUMA 2CL7X 4F91B 4CEIA 1CIPA 5EP3A 2CHGA 4HB2A 3ZLJA 4DUYC 1PV4A 3Q5DA 3TSZA 1E96A 3K0SA 1Z08A 2IHYA 2C9CA 2UZIR 2ZRJA 1M7GA 3K0AB 1WDTA 3SU8A 1U8ZA 4B34A 3RS2A 5KYKA 2ZETA 3A1TA 2J1LA 1IBLC 1Q0UA 1G6OA 2OSBA 3DDCA 1OYYA 1USPA 1ZBDA 5TVKA 1WMSA 2F1RA 3VKWA 5IHPA 3DEFA 1R0ZA 4LK2A 4B35A 4XX2A 3EPKA 3K9LA 4X8MA 2P67A 2W00A 4M1YA 4RY2A 2ZRCA 2JLUA 3NXSA 1ZD9A 2A3RA 3BERA 4WA7A 1U90A 2QPAA 2IWHA 3ZJYA 4M8NE 3RVBA 4OX9C 4US2R 1VHTA 3U7EB 5HE8A 1M7HA 1KOFA 4E03A 4QBGB 3QVUA 1K0RA 3GJ0A 3UG7A 4Q21A 1YR6A 3MCAA 1IAQA 2WVJA 3THWB 4NHOA 1SHKA 4BEBA 3KJIA 4HYYA 5TV2A 4DB4A 2NOAA 5KSOA 4F92B 4B3TC 1LFDB 4GT1A 1KI3A 3CF2A 3B5JA 4MRVA 2CXCA 1VYUA 2IYTA 2CK3A 2WZQA 1CLUA 4NZYA 1Z63A 4F38A 2ZR9A 2FSGA 2F55A 1M1YE 3KQLA 2RCNA 1I4TD 2WJVA 4PPFA 2QM8A 2ATVA 2WIAA 3ECCA 1HA3A 1NN3A 1TQ2A 2ZUBA 3K0FA 4LHXA 4QHTA 1H8HD 4JIMA 3HWSA 3LX5A 5FPSA 4DSOA 5L3QB 1XNRC 3IBGA 5FUXA 2ANBA 3OEED 2ZSDA 2VTKA 3FKSD 1W0KA 2Z83A 2ZSFA 3WP1B 1N6HA 3PITA 3W5JA 1UBGA 2VHTA 1E9FA 2VRWA 2O5VA 5KDOA 4K0KC 3QVVA 4LCBA 1UF9A 1E2HA 2EVWX 1GM5A 3U3JA 1CF4A 1Q22A 1TMKA 4TT3D 2X19A 2V55B 1Z22A 5LPNA 4EJSB 3QPVA 4M4SA 1KO7A 3KQHA 2IYRA 3BC1A 4MGIR 2OLKA 3CJEA 2IUSA 2QQ0A 3S1AA 1UPTA 1PA4A 1XMVA 2KE5A 2D7CA 3ZVRA 2QAGB 1AJEA 2NO0A 4AKHA 3T1YC 2IXFA 4V0NA 4LRWA 5FBLB 4LV8B 2IYSA 1KKGA 3B13B 2ZRDA 4NE2A 3UWKA 3OIWA 3FPAA 2YNMA 3LUSA 2ZROA 4TLBA 3AF2A 3PQCA 4CEHA 1RRGA 1TUIA 2V6IA 1IBRA 4FI3C 3BH6A 1NY5A 4CEJA 2O8CB 3QSYA 1G17A 5G3YA 3MSXA 1I4DD 2F4VC 1NF3A 3GLIB 4C7OA 1KKMA 2IYVA 2J7KA 3O8DA 4V03A 1P9WA 4XOIA 5J4VA 2JJ1D 4RCYA 1YZKA 2ZITA 3BH7A 3ASZA 1G16A 1J8MF 2CXXA 4NYIQ 5J47A 3AB3A 3UK6A 2WICA 2PCLA 3RNLA 4Q7MB 2V6JA 3FGNA 2XB2A 2ZRBA 2FSHA 2BM1A 4C0HA 3BS4A 3QJYA 1JALA 1TU4A 4CF7A 3EPLA 1EESA 3THXB 1KAGA 2O0HA 1KMHA 1G19A 2HF9A 2OILA 1OT3A 1QVRA 4TQUS 3I4LA 5JI3E 1D9XA 1SXJE 1K5DA 4N3NA 3THYA 1VMAA 2GJAA 2QE7A 1VECA 2QTVB 1BYUA 4R9UC 4QKQA 1G18A 1Z6XA 2R2AA 1G4UR 4JLVA 3LBHA 4KFUA 2RHDA 4NXNC 1G1MA 1CULC 1DS6A 1N2CE 3U6BA 3QF4A 1VIYA 3GJ5A 4AIIA 4PZLA 4BFWA 2E8FA 1ZM9A 1LW7A 2EU8A 1W46A 2REOA 1II8B 2JMPA 2ZYUX 1QHIA 3R8FA 4KVAA 1WB9A 1XX6A 4Z51A 2UUBC 4FINA 1U0LA 5AJWA 2B8WA 3I5XA 2EYQA 2V3CC 2GJ9A 3KQNA 1KMQA 1T91A 2O0JA 3A1UA 3AP1A 4D0GA 2WJJA 2ZJ8A 4JKIA 3SEAA 3DZ8A 4YC7A 1AGRA 2C04A 3BJIC 4XWAA 1W5SA 1JOSA 4YXWA 3LAWA 3WBKA 1XMSA 2CCGA 3WBJA 1G291 2Z0MA 4DV2C 1KIMA 3JZMA 1KDPA 2NPFA 3E1SA 4DDUA 3ZVNA 3AKYA 3BFKA 1MO5A 1E1RD 2ZE5A 4MH0R 1FP7A 2VSXA 4G0NA 1KDTA 2AX4A 1OHHA 4MUAA 2CK3D 1KI6A 1T0JB 3K8YA 3R20A 4C9BA 2KBEA 3F8TA 2CLSA 3BB3A 5IT5A 2XAUA 5EXSA 1G5PA 2ZE6A 2PT7A 3V00A 3TGPA 2W2TA 4Q1DA 1UJ2A 2OUKA 5JRJA 4JSYA 3GJ7A 3IQXA 3W3ZB 4DV7C 1ODFA 4DR7C 4TMZA 4BRWA 4OHYA 1S1MA 3MJRA 4XSGA 1W0KD 2IWRA 4W7SA 3TH5A 4DRZA 2OCYC 2CCKA 1U98A 4ZKDA 3AUXA 3CZPA 2G88A 5JSZB 4DWJA 3MWLA 1GAJA 3CPEA 1O3YA 2J59A 4Q19A 1UBFA 2PLRA 1KNQA 2PZGA 5KPJA 3I07A 1E2IA 1XJQA 1G9XA 4WXPA 3SBDA 1ZJ6A 2KB0A 4M21A 4DB2A 4GL2A 1WA5A 1X86B 1TQ6A 2ZJOA 1NMXA 2PEZA 4IW3B 4MRSA 1E9AA 5DGXA 3UXMA 1HNWC 1XTRA 2O8EA 3LLUA 4W5HA 3VKGA 3TE6A 3NBZC 1FNNA 3DO6A 3DOEA 1VG9B 4PHFA 5KHOC 2ZJ5A 4R7ZA 1CKEA 2WJHA 4XVUA 3TR5A 4ARZB 4HDCA 4DV6C 1GL7A 5J4LA 5DLQC 3MG9A 4DLUA 5BN5A 4GKJC 1OKKD 4IKEA 3VHLB 5J4HA 4B3GA 3A1SA 1P75A 2Q21A 2Q3HA 3QOFA 1AS0A 5EE5B 4U00A 3U5ZB 4DT1B 2BEKA 1JI0A 1G3UA 3HYTA 3UPUA 4UXHA 1Z0FA 1LQLA 1SKYE 1Z07A 2Q9CA 5EXXA 3C5CA 2L0XA 4NXMC 3SC3A 1WH9A 1P72A 3ADDA 1P3JA 4BLTA 4BLSA 3B60A 2E87A 1NMYA 1XF9A 2J0UA 1J5EC 4UNRA 4TLEA 3D7MA 3AVOA 4URXR 5KU1A 2CVHA 3BK7A 3ADKA 2MSDB 4JI7C 3TIFA 2UXCC 3K1JA 3UG6A 2IXGA 1H8EA 5KUTA 1KI2A 4KAXA 2R6FA 3NDBB 1NI3A 2ZRAA 4LFBC 4IOLA 2PX3A 5EZ5A 1G4AE 4LSGA 3AGPA 4MRRA 2ZRMA 1E2JA 4PO9A 2JEOA 4B2LA 4LJ4A 1DARA 4KLNA 2OXRA 3I32A 4IFBA 2BJOA 3X1YA 1YKSA 1MH1A 3OF5A 3QXJA 2Z5FA 2FMXA 5FOUA 1G64A 5F9HA 3LQQA 1SULA 5IRCD 2JLSA 2GJKA 3R9IA 2VF8A 1DAFA 2O52A 4Q9IA 4A0RA 1KJZA 3PXGA 1TF5A 2OLJA 1F48A 1X8JA 4YXWD 3E70C 2D2EA 2RGNC 2H57A 1LVGA 3H4MA 2QI9C 3NBXX 1OSNA 4B3MC 1VCMA 4LF8C 1J2JA 3AP2A 1Q3HA 1OXSC 4UNSA 3UMRA 3QXSA 1NKTA 3TUIC 3RYTC 1SZPA 1CRQA 1PLJA 4Z8YA 4B3CA 2ASBA 3K53A 3RWMB 1KHTA 3I73A 2H5EA 2D4HA 3VR4A 4DV0C 4FMDF 1IN8A 5FTJA 2JJ2A 1GDDA 3GJ6A 1HE8B 2OO7A 4WOPA 4NONA 1QF9A 1KO1A 2IEYA 4NKRA 3H84A 2UVQA 3B85A 3KTAB 2C2HA 2RGXA 3NIBA 1KGDA 2DFTA 4NU0A 5LMUC 1US8A 5K8IA 2GAOA 3ZYCA 4LF6C 3QENA 3C16C 421PA 1JEDA 1HQCA 2IS6A 5KSZA 1SVWA 4RD6A 3SDZA 3ZVMA 1WCV1 4JVLA 4YHHC 3X1XA 3T12A 5C18A 3T1VA 4C4PA 2BJWA 1D9ZA 4KO8A 1AS2A 5C46F 1RYHA 4D2IA 1E2FA 2MMCA 1LB1B 3EG5A 2DYKA 4DIDA 4IDNA 4QGHA 4DLRA 1IM2A 2ANCA 1QHSA 3OAAD 5BQ5A 1PZNA 3QPWA 2VP6A 4Q02A 5C1BA 5F98A 1NVXQ 2CE7A 5FTLA 4YDHB 4HUQB 5E7MA 4L9WA 5BYJA 5KNCA 4FWIB 4BFTA 5GADl 3BB4A 3ADBA 4JYAC 2B7CA 2YHSA 2BJVA 4DCNA 2RGGA 2ZRFA 3REFA 3EWAA 4A8JA 3B1YA 1R10A 2VP4A 1Q20A 2NO9A 2OZEA 1JEEA 5EE3A 3B6EA 3MWKA 3OZXA 4DLZA 2Q9AA 4KHPC 2R6DA 3RRYA 4ZDWA 1XTIA 3Q72A 3GPLA 4OJKA 5CK4A 4G5QA 2UUCC 4JLMA 5HR5A 2C96A 4ESHA 4GDFA 3GLHA 2A7QA 3GMTA 1RRFA 2IEZA 2VYFA 4WZBE 1G8FA 1QBKC 2PT7G 4KI0A 4CGZA 3FKQA 1T5IA 4WZ6A 1RRCA 4OQXA 5A2QD 2ZYTX 1D2NA 3EZFA 3GEHA 3VMFA 3NVAA 3ICQB 3NEJA 2UZ3A 4JLKA 2F9MA 1UKYA 2BM0A 2FG5A 4I1UA 3LLMA 1NBMD 3O8BA 1XP8A 2ATXA 3C15C 1IBKC 1N6RA 1LF5A 3SHWA 3PG5A 2BBWA 4XSHA 3FFBA 4D4MA 4LF5C 5DO9A 2ZPTX 2V4ZA 1H8ED 3P32A 3KKOA 1N5LA 2MSEB 4M2LA 3CPJB 2REBA 5FOVA 2OBLA 4E07A 4F4JA 2QP9X 2CJWB 3PUWA 4QBFA 3R7WB 5KNDA 2X77A 1C9KA 1P9RA 4FXPA 2GZHA 1L4UA 3RS5A 1GSIA 1NL3A 2EWVA 5DYIA 3A37A 1ZC3A 4NCJA 3RRMA 4HAVA 3L0IB 1ZNYA 2BBOA 1CR0A 5BWMA 2Z6VA 3QKUA 1N6OA 4HUTA 1DOAA 4DV3C 3SYLA 3UATA 1Z47A 1R7RA 5A4JA 3NH9A 1WRBA 4ZKEA 1P61B 2PT5A 1CXZA 2JJ8A 5AJZA 2ATWA 1G41A 4IVQA 2QU8A 4BLOA 2RAPA 2WJGA 3K0EA 5FPTA 2QPOA 2H18A 1S0UA 5JJKA 2WSSA 5GJVC 3FDIA 1JR3D 1OXUA 2JATA 2JLYA 2PJRA 1U0JA 4D80A 4DHEA 2QG6A 4HLUC 5CJPA 3C7KA 3L2OB 1GVNB 2BEJA 4HAYA 3RANA 3WY9A 1CR4A 4RD0A 2P6UA 4UJ5A 3T34A 2CLDX 3WRYC 1WQ1R 3PIRA 1TTTA 2JJ2D 5CB6A 4HSEA 4BWYA 3AF5A 2FF7A 3GFOA 2J45A 1HH2P 2GZAA 5K8LA 1KO5A 3TSOA 5F2EA 1W47A 4MGKR 3AP3A 3QKSB 4C2TA 4KYIB 2DR3A 3GEIA 2BC9A 1E6CA 1QHHB 1GFIA 4CW7A 1CJKC 1JQLB 1ZIPA 2A5JA 5KDDA 1YZGA 2JIZA 1AGPA 3CRQA 3D31A 3B9PA 4NH0A 1FZQA 1ANKA 1NP6A 2ZJBA 4P0TA 4JLOA 4M1SA 4ZDJA 2WOOA 3WNDA 4TYNA 1XEXB 4NYIR 1OH5A 1XMIA 4TLCA 4D81A 1ETUA 4IHQA 2WMNB 2RGEA 2IYYA 621PA 1ZM2A 3GJ4A 2PZFA 2AKAB 2EFHB 5LBIA 2G9NA 3A36A 2VA8A 1ZCAA 1Z8FA 3I72A 3T5GA 1M8PA 5H1YA 5IDVA 3ZS9A 4EPVA 2C99A 1N6NA 3CWZA 5L3SB 3GLGE 4GBMA 4ACBA 4I1VA 3ZZ0A 3O47A 3IQWA 1GITA 1G5TA 4JBWA 1NNEA 1A1VA 1UEJA 3WMEA 2CY1A 4DR1C 3GJ3A 3QEJA 1N6KA 4LJ7A 2DWOA 1GNRA 1AZTA 3GLFB 1UKVY 3LBNA 2BKUA 5SZIA 1KI9A 2CEAA 4DUGA 1FX0A 3PUZA 4IDHA 3QI2A 4M0LA 2HCJB 1NRJB 1F3OA 1QG4A 2GEUA 1ZINA 1NLFA 5JECA 4E5UA 1P62B 3T15A 5SZJA 3RS7A 1ZW6A 4RVCA 4K81B 2FFBA 4X64C 3CRVA 4C0BA 4POAA 4KFSA 1XU4A 1DE0A 5JJIA 2ORWA 2C98A 1JAIA 4MKHA 1XEWX 3A8TA 3BE4A 2F43A 1T5LA 4EIWA 4A2QA 4V0LA 1TNDA 1SGWA 1E9SA 1SQ5A 4HZUA 4JKYA 3SOPA 3W3AA 3CRW1 4DJTA 3DVLA 3N2EA 1AZSC 4Q00A 4A2WA 1IJFA 4GOXA 4CVNA 2XSZA 3A4MA 4JT2A 1HT1E 4GNKA 4CEIB 1MT0A 4JI3C 2VPPA 3SFVA 4MYTA 4HB0A 1XXHE 1MRNA 3SBEA 1NIPA 4A6XA 2KSQA 4OHXA 1U2RA 3NWJA 2LWIA 1G8GA 4DLVA 2ZVPX 3KKNA 5EE0A 3K70C 4DR2C 1EK0A 1USPB 3OE7A 3T1TA 2XZLA 3OTOC 1ZB8A 2RB4A 2YCBA 2VO1A 4KITB 1CEEA 2QAJA 4K46A 3BAFA 3LDAA 1LTQA 2G83A 4WVFA 4II7A 4MKIA 2E7GA 4JYBA 1CJUC 1OB5A 3L43A 2P0EA 4QNRA 2R6AA 4CT4B 2GHIA 5DI3A 2QTHA 2SHKA 2FPLA 3TUZC 4NBSA 1NVUQ 2ZR0A 1KSGA 3U61B 1SXJA 1T0HB 1XMQC 4JL6A 5DH9A 2FGJA 1BO6A 1N3BA 3N2IA 3VTKA 4LJ8A 2WKQA 2BCJQ 4D4JA 1VCNA 3P20A 1DPFA 3GKUA 1Z0JA 4BZPA 2OAP1 1F2UA 5FOWA 4P32A 1S4QA 2IYZA 3HYRA 4Z54A 3K09A 3V9PA 3X2SA 4V0ME 3HU3A 1W4RA 3FHCB 4LYHA 3IIKA 4D4KA 1IOZA 2OFWA 4EPTA 3A1VA 3BFVA 3KXIA 4JT4A 4NCKA 3U7FB 1F5NA 1L2TA 4BUJA 2I1VB 1JPNA 2Q3MA 3K0FB 4HLUA 2F1JA 4P4SB 3AM1A 1D2EA 4H1VA 2JIZD 4OQLA 4PAMA 5BR8C 2NO7A 2WPDA 2J41A 2KWIA 1G7CA 2V8OA 4Q4AA 2NQ2C 3TMKA 3G0HA 2CNWA 2GK6A 1IN7A 1T6NA 3WYGA 5KPDA 2OAQ1 1OIVA 4QJ5A 2FWRA 1N5KA 3KKMA 3WNBA 5DYGA 4UNQA 2KI5A 3QG1A 4DBLC 1TF7A 2UXBC 3SJZA 2R6GA 4HB4A 2LCFA 2QRNA 3BBPA 4GMXA 4MGZR 4URVR 5JEDA 1XZQA 1P9NA 4JSTA 5FI0B 4OJQA 2QMHA 3HPQA 3WYAA 1E0JA 2P65A 3S1AB 5HCNA 4EKDA 2OFOA 1HT2E 2VQEC 3IPXA 5EXPA 5TDHA 2P5TB 2D7DA 2F1HA 1QWIA 2BDTA 4DR6C 1MABA 2EW1A 3QKRB 4ABYA 4A0HA 3T1HC 2IW3A 1E2NA 1YHNA 2X8AA 5LMNC 1XNJA 1ZD1A 2OXCA 4X66C 1X1RA 3FYHA 4DLXA 4CEHB 3EC1A 4X8LA 4WXRA 4CEJB 5M04A 3LV8A 4QXAA 3A4LA 2N1BA 2H17A 1GOTA 3NBFA 2OPLA 3EW9A 4C7OB 1R5OA 4TMWA 4DDVA 2OEPA 1YRBA 4CZ2A 3LXRA 3NHAA 2ODNA 2UU9C 5JLJA 2QBYA 1P73A 1J90A 4EPYA 4ZV4A 4FMDB 3J81k 1EFRA 2GCOB 4B48A 5H8WA 1FQKA 1DO2A 3EC2A 4PZYA 1Z28A 1ZC4A 1NYEA 1OIXA 1KMHB 3ZVLA 3IEUA 4NCNA 4B73A 4BQSA 1KO4A 1V5WA 2OM2A 3GJXC 4JLPA 4HATA 4B75A 3MUFA 4BFYA 2QORA 2ZU6A 2XSZD 3VX4A 4RFVA 4DIEA 5IF9A 1TX4B 1Q12A 1RJ9B 2ZRPA 4TL7A 1GTVA 4A82A 1HQYE 3CR8A 3BFXA 4X8HA 4EPRA 1IJEA 1JBKA 3EPHA 3LW7A 2A5DA 5F3WB 1ZP6A 5P21A 3QF4B 3QQ5A 3H1TA 3RDPA 3EPJA 2QMUA 5EE9A 1QHYA 4OK3A 4RD4A 2ZE8A 3KFXA 5DHFA 3OE7D 3CNNA 3Q85A 4PXAA 1Z2AA 2J9RA 1LS1A 3JVVA 3P4YA 1G3MA 4O2LA 3LWNA 1WF3A 1IY0A 1FW6A 4JZKA 4K8OA 1U8YA 2GNOA 4A4DA 4DCVA 1YR7A 2FN4A 821PA 2DCUA 4Q4LA 1CR1A 5FOSA 2AKYA 5G3ZA 3PUVA 2AWNA 1OLOA 2JLVA 4V02A 3TJZA 4B47A 2ZI6A 1E2QA 1E32A 1HNXC 5AUQA 3TNFA 4EJSA 3WMGA 1XTKA 2J7PA 1YJ5A 1OXTA 3CRMA 2AXNA 4P4UA 2QSYA 2ZI5A 1TF2A 3K9HA 2WOJA 3IBYA 4FD2A 4Q1FA 1Q1BA 4OKSA 4DUZC 1UDWA 1KI6B 1Z83A 3OIYA 2B6HA 2YINC 1JJ7A 3ND8A 3QNUA 4LPSA 4B3DA 3Q5EA 4JI5C 4DR5C 4PO1A 5FL7A 3VQTA 3TBKA 5J4KA 2O8CA 2YWFA 4DV5C 3B1XA 5EP4A 5G40A 2QY9A 1XJ0A 2CL0X 4KU4A 3ZD6A 1WXQA 2CNWD 5AK0A 1E2GA 6Q21A 1Z0DA 1EX7A 4PAOA 2HEIA 3PVSA 2GVDC 4PPNA 5JS7A 4UNNA 3KKPA 4Q47A 4TTQA 1Y3AA 4LFAC 3CX8A 4M9SA 1ZIOA 4C0SA 3NH6A 2E9SA 5HZKA 1QG2A 1SVMA 4AKEA 1VG8A 4D6PA 1G20E 4LY6A 1U0HC 4D4LA 3SZRA 3PUXA 4PO8A 1W2GA 4FW9A 1DADA 3K9GA 5LB2A 3WHKA 3HP1A 5FBQB 1RPZA 1OPXA 4B74A 3CNLA 3JVUA 1YR8A 3MGCA 2QZ4A 2AL7A 4JV5C 4TLDA 5IK2A 521PA 5JJLA 2FFAA 4JJZA 5BW8A 3CX6A 1G5RA 1XD8A 2ORIA 3I5YA 4LJAA 5EE1A 3KQUA 2BWJA 3RS0A 4A8JC 2QENA 4BSZA 5CDFA 4JMPA 3BB1A 2ERYA 5KSPA 4JL8A 2QSZA 5JWRA 2XTZA 2WWIA 4DCUA 3RSOA 1ZM4A 2G1JA 3TRFA 3PEWA 4R98A 1L2FA 2D2FA 5IWAC 2G6BA 2GBLC 1Q21A 3H2YA 4OI2A 5EP1A 4CT5A 1I94C 1JAHA 1P2SA 2F6RA 4EUNA 3CZQA 1AK2A 1EFRD 1ELOA 4QJ3A 2HT6A 1OV4A 1ZVQA 3T35A 2CHQA 1R0XA 4Q18A 1FJGC 4LGMA 1KDOA 1TQDA 1W0JA 4RFSA 3U3MA 4B6FA 4B76A 4IEEA 2H7VA 1XBTA 4JBYA 1G7SA 4PHTA 4QGGA 5LD2C 1T3SA 2A2ZA 2F7SA 4LFCC 2VP0A 3W8RA 4B3SC 2WWYA 1GL6A 3MFYA 3CLVA 4DSNA 3CF0A 3Q9LA 2ZAOA 3NBYC 5B30A 2KZFA 3CW2A 4DEXA 2ZJAA 2GAAA 1P2UA 3MAAC 2G3YA 1RRPA 4M9QA 3RABA 4QC2A 4GP6A 2IT1A 721PA 4KBGA 1FP6A 3ZQ6A 2QP4A 1JPJA 2BHRA 1T8UA 2IYQA 2ORVA 3B1WA 2CBZA 2WKRA 1S2MA 4C3ZA 3PJRA 2AFHE 4LX0A 1EFHA 2E5LC 1E79A 5GJCA 4QBIA 5FTMA 1JR6A 2QE7D 1GZSA 5IT9D 4EDHA 1X3SA 4V0KA 3SJAA 4A9AA 3WXMA 1I4LD 4GZMA 4XTRA 4MA4A 4NYJQ 1ZRHA 5BYKA 3B82A 3I92A 2E8EA 3K70D 2D62A 1TUEA 4RZXA 5L8VA 3DKVA 4AG5A 1GKIA 2C9YA 4OL0A 4LC0A 4C0QC 2REXB 4NPHA 2QRZA 1XTJA 4V0OA 1EFCA 3AVXA 2H8KA 3C5HA 3SI7A 4AQYC 1XNQC 2WIBA 4L4UA 1RZ3A 1MKYA 4HLQB 1VCOA 5FL7D 3GLIE 3VU9B 2B8TA 5D3QA 3ZD7A 2JA1A 4DCSA 4LF7C 2FV8A 4LJYA 4NDZA 1XWIA 1JXOA 1KK2A 1YZTA 1W36C 4KFRA 2NPIA 3J81D 2YC2C 4RSGA 3U3RA 4DLSA 4E22A 4MRPA 1UEIA 4TMTA 1HE1C 4NCIA 3O8CA 3CPHA 2V9PA 4LWZA 2BKEA 2H16A 4JVNA 2DY1A 3VAAA 2JLQA 4MUBA 3K0CC 1DAGA 2ZIAA 2H92A 3CKLA 4JLJA 3KXKA 1PUJA 1OHHD 1ZNZA 3LFUA 4TN1A 2GVZC 1ML8A 4JVMA 4QHYA 4BEJA 5AUPB 1R6BX 2ZRIA 2R65A 1AM4D 2GXSA 1RVDA 1N25A 3LW8A 2ONKA 4A8JB 4JLBA 2W6JA 3QXCA 2ZVQX 4MKFA 5CDFE 1XCPA 5IK2D 5E95A 3W6PA 4GP7A 2GWHA 3ZH9B 4QM7A 2FEOA 5FOTA 3B9QA 2A5FA 3OIVA 2DFNA 4NTZA 1RC8A 1YZNA 3AVTA 2O8DA 3LVQE 1JECA 1F6BA 1XTQA 2R44A 3GLHB 2IF0A 2CHVA 1KKLA 2A9KA 4Q03A 3SR0A 4PANA 4BLQA 4EFLA 4J0QA 1A4RA 2QPTA 3BXZA 4I4LA 4MYCA 2R9VA 4WIAA 4GPTA 1XRJA 4AYTA 1KZGB 3TK1A 3U44B 221PA 1TAGA 5EQTA 4QRHA 1V43A 2ZRLA 3FTQA 3IO3A 3CO5A 1VTKA 2PBRA 3EA5A 3N70A 2A30A 2IX3A 3FFAA 4FIDA 4Q4JB 1XPUA 2ZI7A 4JJKA 2PJZA 4Q1AA 4RCZA 1DAKA 1CTQA 3LXXA 5KTYA 1N36C 1DAHA 4R71A 3NKVA 1Z6AA 1GWNA 1IN5A 1E69A 1OE0A 5TARA 3HPRA 1Z2CA 1KY2A 5DSZA 4JLAA 1DAMA 3L8YA 3GLGA 2GBLA 1XCGB 1ZAKA 2IYLD 4E09A 4TSFA 1KJWA 3NDPA 3REGA 2G0NA 1UBEA 4US0R 1N32C 2C8VA 4IDOA 4RZUA 3HU2A 2ZU0C 4EQ6A 1ZMXA 2ZM6C 1EFTA 3EZ7A 2CDNA 4OQFA 1NG9A 3U4QB 4GRAA 1T9HA 3GCGA 3T1QA 1HV8A 3RRZA 4HZIA 4QJ4A 4A2PA 1EWRA 3BORA 4JLDA 1W4CA 3VR2A 1D6JA 4XTCS 3W90A 2F9LA 4JL5A 4TZ0A 2NO6A 1YZLA 4XJXA 1E79D 4QGFA 5LDDC 5FTNA 2JGNA 5FL3A 5CB8A 5HCIA 1B0UA 1UKEA 2R6CA 2HUPA 2JDIA 2H1LA 3KJGA 3QPUA 3B8HA 2XZPA 3SS8A 2AN9A 2QP3A 2HDNB 1NBME 4O25A 4JI2C 3OEHA 2R8RA 1FTNA 1S9HA 2RMKA 3BIFA 3KJEA 4TQAA 3AVVA 2VP9A 4PSAA 1AS3A 2FEMA 2YOGA 1G3IA 3CM0A 2QGZA 1L4YA 1W4AA 2FFQA 4N0EA 4ASUA 4PPGA 2GESA 4LYFA 3PEUA 3F3YA 1E1QA 2IUTA 1E94E 2VH5R 5DISB 5HZHA 1MRSA 2MSCB 1M7BA 1XXHA 3LH5A 5FPYA 5B57C 3B78A 1SXJC 4BFZA 5AUNB 1MOZA 2VSOA 4C0JA 3CONA 2AFIE 2EFEB 1PVOA 2QL8A 2HLDA 1VG0B 2C5LA 1G21E 4LHZA 4L16A 3ADCA 1XZPA 5HTKA 2FOLA 2QEQA 3K09C 4Q9HA 2N42A 4KHZA 4NCHA 2JLXA 4XD7A 4D26A 1N6PA 1CRPA 2FDCA 1A5TA 2NO1A 2D74A 3P27A 5TY0A 1E9EA 1E3MA 3RS4A 2XXAA 5J4YA 1P2VA 1XEFA 3R9XA 2QGNA 2ZANA 4IDPA 4LJ6A 2O8BB 1P7CA 3EWSA 4KFTA 1XEWY 3SQWA 4DV1C 4G5SA 2AD5A 1J8YF 3KZ1E 4CDGA 3B1VA 4TYQA 3AH8A 4LPKA 4LV5B 5D3MA 1TEVA 2FJUA 2HJGA 1LS6A 4I1OA 4LUCA 3EA0A 3OFNA 3RLFA 4TYYA 3FMFA 3BWDD 5SZHB 5AJYA 2NMVA 2XR1A 1CP2A 1KZ7B 2G1KA 3IPYA 1JNYA 3AF4A 4G3XA 4P4TA 3GJ8A 1JR3E 1BKDR 2UKDA 2NIPA 4MDFA 4CRWB 1IXZA 4OQNA 2QUZA 2W6JD 5CJ2A 4DEYA 1GNQA 1E9BA 4B3XA 4MQBA 1DBSA 1OYWA 2YKGA 3P4XA 1SVLA 3KB1A 2YOHA 3M1IA 4V0MA 4AYWA 5K8TA 1N2FA 1K5GA 2RHMA 2D3WA 3ZDQA 4BLPA 2E1RA 1E4VA 3BH0A 3U7GA 2DHRA 2V54A 2C9OA 3EERA 3K0CA 4H1UA 1DEKA 3KX2A 4I1SA 2HCBA 3LD9A 2YZ2A 1YE8A 1E2KA 1OW3B 1FX0B 1PJRA 5KNBA 5CYPA 1E2LA 5TXGA 3V4RA 4QG7A 4DLWA 3WYFA 4BFXA 2QROA 3IIJA 5KO2A 1W2HA 1LNZA 1U9IC 1Z6TA 2IS2A 4MH4A 1AKEA 1SKQA 1UBCA 2QT1A 1Z5ZA 4GKKC 1U8AA 4DC9A 2PH1A 4LJ9A 2XGJA 4DDWA 4JI4C 4Q1CA 2G0TA 5KOYA 1ZNXA 2OBNA 4Q7LA 3TQFA 4JBXA 1JB1A 3SYNA 2OT3B 1A2BA 2W0SA 4XVRA 4M1OA 2Q0HA 5CLLA 4YLGA 3RRNA 4KCGA 5FBWB 1QHXA 4BFUA 2ZS8A 4HZUB 4Q7KA 5L3VA 2YV5A 2BMJA 2GILA 1UKZA 4AYXA 5A0FA 4B33A 3JZAA 2JASA 4TSFD 2O8FA 5B64A 1CJVC 3SNHA 1XPRA 2I3BA 3MWJA 2WWHA 2Z43A 3RS3A 3FVQA 1Z6GA 3T61A 1CJTC 1U99A 2GTPA 2ASEA 1KY3A 1HEIA 2DFLA 4AD8A 2CLCX 3LY5A 2OFXA 1Q57A 4B32A 3PCRB 1OXXK 4JYCA 4EFNA 4PHGA 4BZQA 1SHZA 3DMNA 4KBFA 1G8HA 1YZQA 3T06B 2ZJYA 4LYAA 1P5ZB 2JDID 1E2MA 1KI8A 4C0LA 1HNZC 1SVIA 4XIGS 2W83A 2OESA 1W49A 2WKPA 4ZDIA 3OEHD 4AG6A 5DI3B 4LI0A 1R0YA 2W0MA 4TT3A 2IBMA 4O0MA 3LQRA 4FMCB 2UXDC 4MTNA 1DAIA 1ZM3A 3VKHA 1E9RA 1SXJB 1GRRA 4UXJA 2FPMA 2ZUDA 4UKDA 4ASUD 1F2TA 4X62C 1FUKA 1E1QD 4LC1A 1N6LA 2ZSEA 3ZS8A 1M2OB 3PEYA 4EJSC 4JI6C 5L3SA 2HT1A 1C1YA 1F2UB 3ASYA 1EGAA 3FHTA 1XD9A 3QF7A 4P31A 3I8XA 4LBWA 5AJVB 2HLDD 4W5JA 3SE0A 2QAGC 3CIOA 4Q4HA 1E0KA 1E2PA 2YVUA 4MRNA 4TL9A 1HUQA 3QEOA 2B7BA 1QHNA 1VHLA 4M1KA 1LY1A 4XD7D 4PC2A 1KSFX 2AD1A 4XWKA 2WSSD 4GMDA 2GXQA 1BYIA 1OFIA 1HH4A 1NG1A 2IF2A 2A5GA 5EXTA 4YMVA 4F93B 2F3TA 4M1TA 2JJ1A 2V7QA 1T3LA 1KO8A 2N46A 1NMZA 4BPBA 2BVNA 2J0SA 1XD2A 4KJZA 5JEEA 4LBYA 1U94A 2WWXA 1ZD8A 5B58C 1SVOA 4ZIRA 1UADA 3OFND 3VNVA 5AWFC 3GD7A 4ZI3A 4PX9A 1FNMA 4B43A 1Q1ZA 1M34E 4WZAE 1W36D 2GXUA 4NYMQ 4AK9A 1OIWA 1XDBA 4D0NA 1ZUNB 4S35A 4HDQB 1FL9A 2PLFA 4D82A 4URZR 3MD0A 5E3HA 1MABB 3QY0A 1SVKA 4Q5IA 1FUUA 4PR0A 1RFLA 3IDQA 1NJFA 3L0SA 3AUYA 2XEXA 2CL6X 2ZI3A 4C0KA 2LKDA 4ON9A 4GOKA 4PC3A 4JI1C 5FFMA 2OHFA 3AKCA 4YY3C 2DB3A 4FCVA 3JAMD 4N0DA 4PFSA 2V1XA 1UM8A 1J7KA 1FOEB 1GP2A 1NN0A 3CX7A 1H65A 2JCSA 4PHHA 2OPLB 2XZOA 5JCPA 4RKEA 3CB4A 3P1JA 1TL7C 3RC8A 2FFHA 1KK0A 1KI1A 2ZE7A 2R62A 5FUYA 1ZU4A 3F5FA 2HXYA 4DKXA 3ICEA 2GDJA 4G5OA 4XWOA 2BMFA 2QTFA 1XFAA 1KNXA 2IS4A 1B23P 3V4FA 4TYPA 2QBYB 5EZ6B 2VHQA 4U5XA 4IDQA 2ONFA 3NHBA 1EFUA 4FWTA 2GEVA 1E9DA 2QQEA 1K6MA 2BOVA 5CYOA 1PLLA 1UFQA 2ZUCA 3C41J 4ITRC 2QM7A 3L0PA 2OBMA 1DAEA 4NYJR 1AKYA 3WRXC 2PZEA 1AA9A 1G3RA 4URUR 1NVVQ 1U9IA 1OF1A 1E1RA 4DUGD 2F1IA 5UKDA 5KSYA 4IOMA 3K0AA 5AR1A 4A92A 4YMSA 4PQYA 4CYMA 4M1MA 3KKQA 5FUWA 1KI7A 4M9ZA 3A4NA 4TTPA 5CM8B 4BFSA 3NEYA 4Q66C 4ZCLA 1Z06A 3I3SR 3RC3A 4P4SA 5DN6A 2RGAA 5C2JB 1AQYA 1CR2A 1R4AA 3CWQA 3EIQA 1Y63A 1SKYB 4LDJA 1HTWA 4EPXA 1OJLA 3AVUA 3KFVA 2ZTSA 3D6TB 1OB2A 1QDEA 4ERNA 3EARA 4HAUA 5B2ZA 3ZZTA 5GVRA 3ND9A 3KUDA 3EIEA 3THYB 1OH8A 5FLXD 1HURA 1WE2A 4WW0A 1XTSA 5K8UA 1E0AA 3THWA 4RD2A 3BRWD 3K70B 1N0VC 4KYUA 1X1SA 3D8BA 3DMDA 4MKGA 4BASA 4BLRA 4AY2A 3DZDA 1WP9A 3W6OA 2P6RA 3F0TA 4UXIA 2RKOA 4OBEA 2JLRA 1OH7A 1COWA 5HPYB 3GLFE 1FTSA 3SYKA 2IL1A 3QKRA 2P3SA 4DXAA 1PUIA 2XITA 2ZXUA 4JLNA 2FPKA 4QGAA 4Z8XA 2C03A 2XNSA 5L3QA 2CMKA 1CS4C 1BH2A 2AR7A 2EQBA 1GIAA 3KL4A 1P60A 3IHWA 4KLZA 5FUVA 4YQFA 2AK2A 1YZUA 1DTSA 1VYTA 4IJMA 4QM6A 3GFTA 4URWR 3EZ6A 2YWHA 3L82B 1OKKA 5ANRB 1XB2A 4D0LB 2IYXA 4US1R 1S1CA 2XB4A 5JMTA 2GRJA 3IHLA 4PQFA 2V7QD 3ZZUA 5GJBA 1SXJD 4OK5A 2AK3A 2FZ4A 4NOZA 3QG5A 3WNCA 2ZAMA 1M74A 2ZEJA 1QVAA 1E99A 3ONWA 3Q7PA 2GCOA 4LJ5A 5FBVB 2QAGA 3DPUA 2VBCA 2TMKA 2X2EA 4HI0E 2IC5A 1I2DA 1NSTA 1KSJA 2Y8EA 2VLIA 3K9NA 2WBLC 1GKYA 5AJXA 5LB4A 4TLAA 2JAQA 3DL0A 1UKKA 2ONJA 1RJ9A 3FOZA 3FHOA 5L3RA 1RE0A 1FMLA 1IY1A 1ESMA 1ZUIA 1YQTA 2OE2A 2PCJA 2WSMA 4IEIA 1AN0A 1NN5A 2WPDD 1IONA 5DNYB 4L9SA 1ZM7A 1W4BA 3GLIA 1CJMA 1VCIA 1NVWQ 4DR4C 3VNUA 4RZ2A 4DSTA 3C8UA 2NTYC 4DVGA 1IXRC 2ZS7A 4B2IA 3SHFA 4YMWA 4MGYR 2O0KA 1G6HA 3IIMA 1KK3A 1QRAA 4BECA 2FGKA 2DYJA 3I61A 3LA6A 1A82A 2JLZA 2NZ8A 5BN4A 1N5JA 3EXAA 2C78A 4FCTA 3THXA 2FZLA 2J0QA 2WWFA 2ZSBA 3CH4B 3E2IA 3PEVA 4NL4H 3HJNA 3LX8A 3CRRA 4AKIA 4RFSB 2O8EB 1VLAA 2GZDA 4UNPA 2GF9A 5EP2A 3G5UA 2IS1A 5E4FA 2P6NA 1FQJA 1RYFA 4NMMA 4HAWA 3AV0B 4LV6A 1TADA 3AKDA 4FMCF 3KQKA 4OYHA 3FWYA 1E2EA 1MV5A 4C0AC 2X2FA 1ZCBA 2NGRA 1II8A 4R2HA 2WAYA 2IYWA 4OHWA 3VHXA 1JJVA 3QXXA 2QT0A 5JWHA 4G5RA 4A36A 3FE2A 2EYUA 4AWXA 1OFHA 1GL9B 5DN6D 2JLWA 2GK7A 1D5CA 5AUOB 1NKSA 4KV9A 1VG1A 5HE9A 2PX0A 3UANA 5JWOA 1GNPA 1M6NA 1EG7A 2RH5A 3VR1A 3QXHA 2ERXA 2GF0A 4QNMA 4ACAA 5JCZA 4IRUB 4C30A 1OFUX 2J0UB 4M53A 3TVTA 3ZGXA 2HXSA 4EFMA 3UMFA 4B44A 3HU1A 1N34C 5GVSA 1I2MA 1L8QA 4HDOB 3OAAA 4C2UA 2RGBA 121PA 3BGWA 1BMFA 4F4CA 3AF1A 4PAQA 2W6IA 4PC1A 3R9WA 1NN1A 2ZM5A 3CR7A 2FH5B 4QBHA 2XOKA 4OHZA 3AGQA 2IK8A 4Y0VA 1EX6A 1COWD 4L15A 5JHGB 2P5SA 1EXMA 3NC0C 4G5GA 3AVQA 1Z6YA 1ZNWA 1IHUA 4HB3A 2J0VA 3DM9B 3TSWA 2NZJA 1Q44A 2B92A 4FCWA 4CIDA 3FMIA 2Q3FA 3Q7QA 1NY6A 4PSVA 3PV0A 2XJ9A 2ZR7A 1T4GA 3H0KA 4L5BA 1Z29A 4NP6A 4B3FX 4U7DA 4JS0A 4MYHA 4Q9JA 1SVSA 1MO3A 2OG2A 2VF7A 1DO0A 3W6NA 3A6PC 1Z0AA 4DR3C 1XJCA 5EUQB 2YYZA 5JSZA 1W44A 3QE0A 3IUYA 4RZ3A 1TU3A 5CLQA 2QMEA 2WMOB 2QNRA 3OIUA 1XPOA 1T3HA 2GCNA 3GQBA 2OV2A 4LZZA 5FR2A 2J7PD 1N0WA 1KJYA 3U3KA 2YC4C 4DV4C 1D8TA 1NJGA 4BFVA 1J70A 1P2TA 3IKJA 3OESA 1DG3A 5CM9C 2EFGA 1NBMA 2ZREA 4Q9LA 4I81A 3M6AA 5DI9A 4ZCMA 4YONB 5EJEA 3GP8A 2MMGA 4G1UC 4XVQA 2VHUA 2WTUA 3AVWA 5BXQC 3I8SA 1KI4A 4TQ9A 2V1UA 4D25A 1XCMA 1G8YA 1GG2A 3KB2A 4ARZA 3O8RA 1Q3TA 1OFTA 1X6VA 1US8B 3W8NA 4TL6A 3NTUA 3KDSE 2ZRNA 1E98A 4U02A 3TW8B 1R2QA 4LYJA 2D7VA 3GFPA 3AEZA 4YMTA 3LBIA 4PPQA 2O8DB 4JI8C 4DT1A 1HR0C 2E8CA 2FA9A 2XTMA 2WV9A 4GFDA 4DLTA 3PUYA 2XNDA 4KXFB 2BMEA 2A5YB 1W5TA 2VP5A 2ZYVX 3RSLA 4A1FA 4OHVA 3UWOA 1RIFA 1N5IA 2FSFA 2ZRHA 4RD3A 2FE4A 4A6PA 1GKUB 1R5NA 2FNAA 2ZI4A 4PQRA 3M0EA 2XX3A 4ZPXA 5FBRB 3IO5A 1W7AA 1D2MA 3QBTA 3QIAA 5GJWC 3EZ9A 2FX3A 5A5GA 3W5IA 3TR0A 1O87A 1JR3A 3KUCA 4KVGA 4GI7A 4P3YA 4TMXA 3TLXA 1IQPA 2F3RA 3B2EA 2IUUA 4HAXA 1KK1A 2DBYA 3VFDA 4BE7B 2J46A 3GLGB 2KJQA 2IA5A 3I1FA 4A0GA 4QOSA 1GILA 3N5CA 3PFIA 5FI1B 3TQCA 4DSUA 1Q1EA 3VX3A 4ILEA 4LBZA 4M1WA 1VYVA 4LF9C 5H68A 3TUJC 4F7WA 4EQ6B 3MWYW 3SJCA 4B2PA 3VU9A 2HHHC 2DPXA 1IBMC 4UQOA 2ODWA 5JFGA 1Z0IA 5FOXA 2B21A 3TAUA 2VQFC 1VKJA 2K5UA 3Q3JB 5LD2B 3CUEF 3X1WA 1UAAA 1W0JD 1CBUA 1NLZA 3U6KA 2GEDA 1W48A 1A2KC 4IOKA 4QFMA 4B3RC 3EIHA 4XH9B 3W34A 1J99A 1MO4A 2GETA 1DG1G 4EAQA 3BOSA 2HV8A 1N33C 1BS1A 3U2QA 3NC1C 1AQUA 1BMFD 2QN6A 3H86A 2W6ID 4OQMA 5HKKA 1R5BA 5FH9A 2XOKD 1II9A 4MDEA 1S9DA 2GJ8A 4Q01A 3EX7C 1YVDA 5CIQA 3U60B 1G3QA 1GRQA 1MR3F 3DM5A 4NYMR 3KTAA 4DCTA 4LHVA 4IXNA 4ZCIA 2ZRKA 3LNCA 4G01B 4KSCA 1OXVA 1X8LA 2VQSA 3C4JA 3MRSA 3PR1A 2EWWA 2BMDA 2QA5A 1HY3A 1XXHB 5BN3A 2YJTD 1KAOA 3I62A 2BCGY 2VHCA 1YRAA 4JI0C 3Q8XB 2WWWA 5FTKA 2RGCA 3IILA 3SN6A 2BBTA 4Q7JB 2VEDA 1IN6A 4PC6A 4ZI2A 4L8GA 3BD9A 4YDSA 3AQ4A 2WJYA 1FFHA 4N1AA 2YWGA 2QL6A 1E0SA 4MITA 1BIFA 4R2IA 3U44A 1UDXA 3MJHA 4HUQA 2XXAB 2C95A 1II0A 4FN5A 4M9XA 3UIEA 4PZZA 2QMOA 3TVDA 4RJLA 4Q4JA 4B6EA 2I4IA 5D3MB 4WBSA 4O3MA 2WHXA 3DHWC 3NG1A 2FSIA 1KTVA 1T8TA 4W5WA 1QZXA 3MLEA 1KSHA 4TTRA 4W9MC 2OCBA 4Z1MA 1IN4A 4RD1A 4IFEA 4ESVA 3D3QA 1W36B 1YR9A 1XMOC 3B7GA 3RWOA 1ZYUA 2AXPA 3R8CA 3EASA 4JVSB 1NVVR 4I99A 3DKPA 1S3GA 4Y0AA 1TPZA 1AIPA 1RW4A 1E2DA 1GRNA 5CIWA 4ZO4A 5TB5A 5C4MA 1YU9A 2ZRGA 1BOFA 3B1ZA 3TW4A 3UKDA 1WBBA 1R0WA 1R8QA 3TKLA 3U4QA 1FMJA 3KXLA 2PN2A 4BGDA 5SZKB 2XNDD 4LBVA 4OI1A 4B71A 2CCJA 2PMKA 3U3OA 2W58A 2CE2X 2LKCA 3VR6A 4BZXA 1HYQA 3A58B 2J87A 1P6XA 3ZIAA 2C77A 2BV3A 3FMOB 2PL3A 1R8SA 5CITA 1L7VC 1IXSB 2EGTA 2XJ4A 3J80D 1DELA 2HJVA 4OI0A 1ZU5A 3FB4A 1U81A 5JBQA 2OCPA 4B3BA 2VHJA 3SFZA 3CNOA 4IVPA 3PENA 4MYUA 4KSBA 2ZYWX 5DIFA 4AC9A 4QHSA 2CJWA 2VP2A 1WBDA 3R7WA 1Q1QA 5G41A 1NLYA 2ZSAA 4IXMA 2G77B 4OI4A 2ZI9A 2W2VA 5JS8A 3LRPA 1QHGA 1F60A 2VIIA 2O8FB 1RKBA 1K8RA 2KBFA 3IEVA 1G8PA 3GEEA 3AKEA 4O2RA 3L0OA 2PMDA 2RGNA 3T1OA 2YOFA 3FMPB 3DOFA 3M4YA 4KODA 2ODBA 3X1DA 4YMUA 1G7TA 2AHOA 2Z4SA 1Z0KA 1Z3IX 2FU5C 5G53C 3W9YA 3ETLA 5DE3A 4LOAA 3SQXA 1G7RA 1OH6A 3LO5A 2Q9BA 1S3SA 2WJIA 4TMKA 2AWOA 1VIAA 2ZS9A 1KYIA 2IYUA 3HDTA 2WAXA 3THOA 2F43B 3A1WA 3U7HB 4Q9KA 1X8KA 2O8BA 1CU1A 3EZ2A 2D06A 2IHBA 3CF6R 5J5CA 2XTNA 5HKKD 1NIJA 2DWQA 1LF0A 3VR5A 2OCAA 4A0FA 5FR1A 5JZVA 4FMBB 5CK5A 4HAZA 2HYDA 1VDZA 4AI6A 2Z4RA 4BRUA 4AKGA 1EWQA 5KDLA 1FPMA 4GSYA 5E7JA 2I1QA 1F2TB 2IXEA 3CBQA 2J5XA 2ZQ5A 2BBSA 3EAQA 3IGFA 4QL3A 2EFDB 3QKSA 2P2LA 4P33A 3WHLA 1E4YA 4LHWA 1QHHA 4RKFA 4S2EA 1N0UA 4URYR 5FPKA 1VPLA 1PLKA 2PEYA 2Q6TA 1E9CA 2ODEA 3GLHE 1TQ4A 3HR7A 4HEJA 4WAUA 3RAPR 2ECKA 5FPHA 4TZ6A 3ZQJA 2ZJ2A 1H8HA 4PSKA 4Q1BA 3QUSA 2NG1A 4F4IA 4LHYA 2CVFA 3CH5A 4Q4HB 1JXMA 3E5HA 3OEEA 3FKSA 2WWGA 3MMPA 1MO6A 1KDRA 1XEXA 3KJHA 3G82C 2A78A 2WM9B 2ZJZA 1DVRA 1NSFA 5TMPA 4TYWA 4A15A 3AVPA 2HYIC 2W2XA 5C4GB 1S96A 1LV7A 1ESNA 1ONBA 4PC7A 3WP0A 4UJ3A 1GUAA 4PTLA 3C14C 1XD2B 3SJBA 2X1VA 4DLYA 2UUAC 1JQJC 5ELXA 4ZIRB 4IOJA 3TAHA 3L8ZA 1A7JA 4Z1MD 4DZZA 3X1ZA 5E7IA 5F9FA 3LVRE 8OHMA 5JRZA 4TMVA 2DFKB
chains in the Genus database with same CATH superfamily
3N39C 4AO8A 4OK6A 1P1CA 2J3EA 2IUFA 4P80A 2EFCB 3OCZA 4IVRA 1ZUHA 3GMSA 2GXAA 1XCJA 2ONCA 2P35A 2B4RO 4OQQA 4DV1B 3DC7A 1KBQA 3OQHA 4LMAA 1QJCA 1EJBA 1I9CA 3NATA 3P96A 4H9GA 5CXSA 5HF9A 4D0RA 4WWHA 1SC4A 4TWZA 1VBNA 4CG3A 3A3NA 3C6XA 4FW8A 5JD3A 4LF4C 1DRVA 2BFWA 4BB6A 5IDWA 2YFKA 2ACEA 4Z2YA 1Z7YA 3DZFA 3LBYA 3ANMA 2E6UX 1JYFA 2QVCA 1K0UA 4M1ZA 5DBIA 3ITEA 3CUTA 3LO8A 4BC1A 2J8ZA 1RYEA 4ZDKA 2XD9A 3DOUA 1R0LA 2FP4A 3QJ5A 3KZXA 1IY2A 1EB8A 1IC6A 1UBNA 5AE3A 2IIBA 1TEXA 3AHHA 3F8WA 5DP1A 1W1WA 5KYYB 2ERCA 1Y9AA 4PVDA 1ZRMA 4M89A 3KYBA 4IGEA 3VKVA 4C88A 1GUZA 1CLEA 1C4OA 1EE2A 2JW5A 2HCFA 2XQVA 1G20B 2PWPA 3PKJA 5DHAA 1A4IA 1ZCZA 2CL7X 4R2JA 4OBBA 4F91B 1JHXA 1XRBA 3L1IA 3OMLA 1AUPA 1CIPA 4LZOA 4HB2A 5TGZA 1N4AA 3ZLJA 2P91A 5ICCA 5A1GA 3Q5DA 2PYIA 1ZJJA 2ICAA 1P77A 3KWJA 4U9HS 4AUMA 1CUZA 1MEJA 1M2OA 3R3WA 4AF7A 2PBZA 2ZRJA 3R3XA 4X94A 5DYYA 4CM3A 5KYKA 2B34A 3AERB 3RS2A 4C08A 4AZ0A 1BJKA 1Q0UA 5LDHA 2OSBA 1XKTA 2XIQA 4X95A 5CUQA 5TQ0B 1WMSA 1OI4A 2F1RA 5IHPA 3ESQA 1X38A 1UBSB 4BO3A 1BD4A 3EGDA 1GZHB 4XUGB 2VDOB 3DZJA 2CLIB 3MERA 2WUWE 2HPZA 2P2QA 2BISA 3AZOA 4PBRA 1IG0A 2G4CA 3NXSA 2VUSA 3WRYA 2X14A 1U90A 1YJBA 2QRQA 1Y9EA 3BCUA 3FM9A 1NVEA 3LSYA 4M8NE 5CU7A 3ZJYA 1E7WA 1R50A 2HD4A 3JATB 3U7EB 2DG2A 5E0OA 2R00C 1IUPA 2YUIA 3DBLB 4QBGB 2OHJA 1K0RA 1RACA 1PZFA 3O21A 3EGIA 1KHHA 4HYTA 4Q21A 2HO5A 3WJ7A 1GZ3A 2O23A 2G8NA 1SHKA 2P3OA 4J7CA 4BEBA 3KJIA 3B53X 2JLAA 1XA0A 3ZUPA 2MM9A 2NOAA 4U6NA 5K3FA 4YRPA 5SV2A 4F92B 5C3MA 4RQBA 5AVRA 5FAKA 3IQZA 3CF2A 3B5JA 1VYUA 1EAMA 3F7TA 1Z4JA 3NCTA 2V7BA 1G2PA 3RU3A 1CNFA 4F38A 2O54A 5J2UB 2PNJA 2Y1LA 4ERXA 1KPHA 2W2MA 1GDTA 1FBNA 4PPFA 4P86A 3DBIA 3ECCA 2Y6VA 1HA3A 4IDDA 2ZUBA 4MW6A 2XIJA 3ITKA 4FS3A 4IS3A 1H8HD 3EBPA 3ANSA 5FPSA 3MUEA 1LA2A 2VATA 1YDMA 1DT3A 1N9ZA 2ZSDA 4LMBA 4EELA 2AH5A 3DVAB 3ESBA 3ZBTA 1Z36A 2FW1A 2HZ7A 3PITA 5ALUA 4G0WA 1ZY2A 4EMTA 1AY0A 3KIPA 2O5VA 3P9CA 2ABWA 4LCBA 3BGOS 4D4IA 1CSEE 1J0AA 3FIJA 3OZVA 3QOYA 2PS0A 3LY8A 4BNKA 1BRTA 4UHFA 1TO2E 2DVMA 3OM8A 1CFZA 1Y3FE 2ACKA 2V55B 4OCZA 5LPNA 4NVRA 3R4VA 4I2NA 2PH3A 4ZCSA 4E15A 1EJ2A 2YZNA 3LA8A 2QQ0A 5B5SA 1AZLA 1OTHA 4MVJA 2IPLA 2B7LA 2F59A 2ILVA 2KE5A 1FVXA 4U4AA 2D7CA 1I1OA 1JUDA 5CB4B 4LRWA 5JVDF 3MJVA 4LV8B 1LZKA 2VR1A 3B13B 3T3IA 3ICPA 1AGXA 3HRIA 2X0FA 2CYBA 2ZGVA 4PHCA 2YNMA 1Y9JA 3MELA 5DTQA 4CEHA 5ESRA 3MCZA 1LRKA 4TM7A 4Q3KA 1NY5A 4CEJA 2O8CB 1ST3A 2B20A 2X6QA 3O94A 1G17A 2VYVD 5HOQA 2EGHA 1I4DD 3WKCA 3CN7A 3HCEA 3LKZA 1NF3A 1F0NA 4LRYA 3TLYA 2Q07A 2FRDC 1QZ3A 4CIXA 4L5JA 3KAJA 5FCDA 4AG3A 1KKMA 1S6YA 1P4RA 2NZXA 3HDJA 3O8DA 4PZEA 3TNJA 2XCIA 2JJ1D 1H4SA 2ZITA 4MKRA 4K6MA 3FCEA 2CXXA 5KCZA 4DPKA 4I36A 4PBSA 5GMOA 4LY3A 4GL4A 4L8VA 4MRMB 4IS2A 4D9GA 4GPIB 5EKUA 2FSHA 2BM1A 4G07A 3G5TA 4U7GA 5K4AA 1TU4A 1QE0A 2P9TA 1EESA 2OQVA 2CXTA 1T1JA 1KMHA 1G19A 1JHUA 2O0HA 4KQCA 2ADOA 4TYMA 5NULA 4OFXA 2OILA 5B1SA 2X0DA 1OT3A 1I5OA 1WX1A 4I6JA 3IAM1 4TQUS 1KJQA 5IJZA 5JI3E 3DDNA 3LDFA 3ZHUA 3HHPA 1K5DA 2PBLA 2VDMB 1J42A 2IYNA 2FLKA 2X1LA 4N3NA 4YJ3F 4F86A 1BYUA 4RZIA 2R2AA 3O7WA 1G4UR 5DV9A 4JLVA 4N6OA 3II6X 1G1MA 3N28A 4R1SA 2CFRA 2RJOA 1DS6A 1N2CE 3H3FA 4XM1A 1VIYA 3WQSB 4PPYA 1I13A 3C4VA 1LX7A 3AIMA 3MJEA 5JD6A 4PZLA 4TTSA 1NOKA 2HUNA 3EQ8A 4BFWA 2JFNA 1EUYA 1Z4QA 3LP8A 3R8FA 2WG0A 1DNPA 2CN1A 2C61A 1DCFA 4Z7OB 2HSWA 2YY7A 2DBVO 1BG6A 4EB3A 3F8SA 5D86A 3D7RA 2UUBC 4L85A 5AJWA 4HQKA 1KZHA 2B8WA 2O1SA 2NXWA 2QB5A 4AS2A 2V3CC 2GJ9A 3MGKA 2YZGA 1T91A 1JDTA 4J9VA 3WRWA 3EVFA 2WJJA 3R6TA 4PFKA 1C0KA 1CIJA 1IYZA 1YB5A 4OGKA 3TCNA 2ENUA 1DG9A 3TTTA 3I28A 1SC3A 1IJKA 1JOSA 1M2NA 1OCEA 1W5SA 1EK2A 4F6RB 3N2KB 2CLMB 3ZHRA 3ZHZA 1XMSA 3OD5A 2Z0MA 1P7PA 4W4TA 1AV6A 2W8BA 2EWMA 4DV2C 5JV5A 1A9QA 2FWPA 2PKQP 3JQ7A 3ZVNA 3WMXA 4EFNA 2ZE5A 1MTOA 4UMFA 1D2GA 3CGGA 3CUYA 1A8QA 2UZ0A 4BOYA 4XB2A 3KV3O 4DQ0A 4OXIA 1EGMB 4NMHA 1FXSA 4FQ7A 3GBVA 1O9HA 1KDTA 2Z56A 4G0NA 4RWZA 4L3OA 3BMCA 4Z53A 1LNSA 2WU8A 2WP8J 1PJSA 4OQDA 3AHCA 4WY5A 5EEGA 1IEQA 2QRVA 2W9XA 1B6GA 4TMFA 1KI6A 3R20A 4HVAA 3ZW7A 5A4IS 1FQOA 2I4NA 2CLSA 2LXNA 2X5JO 5EXSA 3FCCA 1P4EC 2H3EA 2X5KO 2ISSD 3KR2A 4JJ6A 4M60A 4CLXA 3TGPA 4FXOA 1P9OA 1SK8A 3PE6A 4RA6B 2W2TA 2HQOA 1J23A 3GJ7A 1TVEA 3W3ZB 1ODFA 4TMZA 3UWDA 1W0KD 2G08A 3IP6A 2OO5C 2IWRA 4DRZA 4F9EA 2OCYC 3GRPA 2GUGA 1POXA 2ZTUA 4ZKDA 2XWBF 1R3UA 3AUXA 4E7PA 1TFRA 2G88A 5JSZB 3HFRA 5BO5A 1H2ZA 3WFJA 4DWJA 3MWLA 2H00A 3CPEA 3OF2A 4JKOA 1UBFA 1T36A 2PO7A 2V58A 2XMGA 5KPJA 1E2IA 4FJ0A 4L0CA 4Q4DA 5IARA 5GINE 1YFJA 3WWDA 1RI1A 3O4JA 3KR0A 3SQMA 1WA5A 1X86B 1TQ6A 2GHQA 1NMXA 4IW3B 2ZXFA 1E9AA 3CVJA 1VBKA 3GUCA 4I8IA 1HNWC 3KOUA 2O8EA 3C3JA 3LLUA 1M0TA 4W5HA 3S4YA 4JQOA 2YJGA 3WSWA 4BNIA 2PA0A 1N7GA 5DX1A 3NBZC 1KFJB 1V5FA 3DO6A 2P2ZA 1E1LA 3FI9A 4R7ZA 4YQZA 3H6GA 4KQ6A 2C8KA 3DLHA 4ARZB 2MHCA 1WKCA 3FUWA 3R6LA 3VO8A 2NNWB 2I4OA 2WR8A 3MG9A 4BMCA 1CZOA 3VHLB 1MVLA 1NULA 5C32A 2V5UA 3IMGA 2QUHA 1X7XB 5IZ4A 4OLBA 1PHRA 2AFIB 2Q21A 3X2EA 4RTLA 1O95D 3GRFA 5EE5B 2VLBA 4PX5A 1G21B 4M0KA 3LOQA 1ADCA 4C6SA 1JI0A 3ILXA 1G3UA 2A1IA 2IITA 3HYTA 5DHQA 1SKYE 1Z07A 2DQYA 2Q9CA 3EXEA 3ONEA 3V33A 3FPHA 3ADDA 1TLLA 1JV2B 1L4MA 2OWDA 1OT5A 1VL0A 4BLTA 4Y2VA 1JILA 5E8RA 1PFWA 4G1MB 1LPNA 5DYWA 5ALKA 4IH1A 4XIFA 4MI9A 5C1IA 4B80A 3ZLUA 1VIMA 1OI3A 2PBFA 1XR3A 2FRDA 1A88A 2AOUB 3FRJA 4WKPA 3EVBA 5ABPA 3L7OA 5EJ6A 5I7UA 2ZSHA 2GBIA 1PBTA 5H9VA 1GPMA 2PN1A 1JWAB 5CVUA 4A0QA 4OBWA 4MVJG 4UPVA 2RAUA 5KUTA 2ZRAA 1VB3A 1W29A 2EEZA 2O2JA 3P0EA 4MS1B 4WSOA 5DMXA 3KXWA 2OZVA 1G4AE 4LSGA 2ISQA 3AGPA 4MRRA 2ZRMA 2ZAIA 2AI1A 4B2LA 1YC2A 4ZRDA 4ZT2A 1Y9DA 2N0SA 3WSVA 5IC5A 5AESA 4CMHA 3Q12A 4HGZA 2OZLA 3HI6A 1Y1PA 4A8PA 4QVGA 1EZ1A 2HU7A 3RKRA 1QH1A 4EHDA 4EB6B 1X7WA 2WA2A 3AUJB 3RQIA 5ALHA 4E11A 4EB0A 5J2UF 1REQA 3ST7A 3TQHA 1SULA 1PQYA 3L05A 5E3IA 1QORA 4O8ZA 1MJHA 2JLSA 2P78A 5T64A 3TB4A 1Z5OA 1H2BA 2UDPA 4MW2A 3E53A 4WERA 1O92A 1QNLA 2VF8A 4X84A 4N54A 3HZRA 1U8CB 4HP8A 4X6XA 1NXQA 1EA7A 2MYPA 4F1JA 1DIAA 1WCXA 4YXWD 5J3JA 2VDWB 3P9NA 5DTIA 3T5MA 4OVKA 4MLDA 3T7SA 4C76A 3AP2A 2OHGA 1JR2A 2ZVJA 3WNZA 1OZ0A 2V7PA 1OXSC 1UBLS 3UJ8A 2V97A 1QFYA 3N3BC 3P2OA 2Q50A 3TUIC 3RG2A 2HMYB 5KYXA 3RYTC 4JX8A 1IN1A 3PIIA 3N07A 4CFYA 2OXFA 5EG5A 4HDMB 2W4IA 4X3CA 1XA3A 3H5LA 2WTEA 2D4HA 5AMXA 3L4KA 1Y9ZA 4NH4A 3DQZA 4RKWA 4RVUA 5GZ1A 4ZZIA 1GTZA 2DPHA 3H42B 4YRIA 2JJ2A 5CVDA 5CB4F 3GT3A 1ZISA 1NUPA 2NVBA 3DOIA 3BKXA 2C7BA 4NONA 2IEYA 1KO1A 2C5HA 2R8ZA 4FBLA 1GKLA 1UT8A 7MDHA 4R7TA 1US8A 1ZD5A 1UZAA 2GAOA 2PAFA 4LF6C 3UB4A 2WB4A 5F3RA 3I5UA 421PA 1JEDA 1HQCA 2V3VA 3MTIA 4KOEC 4F4FA 3BBLA 5DNUA 3SDZA 1LPOA 4RV5A 3ZVMA 1WCV1 3ABIA 3FAZA 2ZUFA 3I6IA 1Z3CA 1J0BA 2C31A 3T1VA 3WYDA 1D9ZA 5C18A 1AS2A 1RYHA 1OASA 3TDMA 1O5IA 1T4DA 4M54A 2H7XA 4EEKA 3V1UA 1OLSA 5JRDS 3BA6A 4HXYA 2ANCA 4D98A 4JUIA 3QPWA 2IZ1A 2X3FA 3CTPA 3KOMA 2H2DA 4Q02A 2BR4A 4MR9A 1GNLA 5F98A 4A27A 3UFXB 4PX2A 1E6UA 2XQKA 3UFBA 1P4EA 3PFGA 2QNBA 5CLIA 1C4XA 4L9WA 4UTXA 3KSAC 3RVNA 5LZ9A 4RLQA 2P4HX 4JYAC 2B7CA 2YHSA 1B8UA 3MNFA 4QUEA 1EM6A 3BIJA 1JG6A 1TI7A 2ZVDA 4B7ZA 4DCNA 3T54A 3CU5A 4BIMA 1R10A 2NO9A 4IIGA 3RGWS 3HO1A 4DLZA 2FR0A 1NXPA 2RHOA 3DA8A 3KWLA 4QOHA 5LCXA 5MHTA 4Q82A 1NC3A 1JQ5A 1Q2XA 4WVLA 4ZDWA 4EB8A 5AI9A 3M2PA 2I71A 3E5NA 1RAFA 2IU4A 4TV8B 2C96A 4QYWA 4FEAA 5DGHA 3C3PA 4N5DA 1Q0ZA 3GMTA 3CNHA 1RRFA 1S7CA 3AXSA 3QPCA 4DGSA 1U11A 3KELA 4KLAA 3D6NB 1QBKC 3NGMA 4KI0A 4E5NA 2VCYA 3PCTA 1T5IA 1N7IA 3H99A 1RRCA 2SCUA 4OQXA 5DX0A 1Z34A 2Q1UA 2O6HA 5IHXA 1D2NA 1Q17A 1E3IA 1P1BA 1IB8A 1PTKA 2E5WA 2WDPA 4DILA 1RWMA 2BKXA 2I34A 3GW8A 3NEJA 2F9MA 3S8MA 3IYLW 1QRDA 5FFNA 9ABPA 4I1UA 3F5DA 4GGMX 4GKAA 4R1MA 2FPGA 4PZCA 2UXCB 4I9FA 3ACDA 1UWDA 2BFDB 1N6RA 4OXNA 4MIEA 3PG5A 3DAYA 5I7AA 1TMOA 4M7PA 1Z2DA 3I8OA 1JA9A 2PJDA 2XUHA 3E61A 2XYPA 2FR1A 3JVEA 5CX1A 1KOGA 4K2AA 4BBAA 4CMJA 2DZDA 3FAKA 5DM1A 3Q0TA 5BSWA 1L1QA 5FXMA 1D07A 3O95A 2AJ8A 5GPBA 2B4YA 2MSEB 3SX0A 1YOVB 5LA6B 2O4UX 5FOVA 3BF8A 1MW8X 4JI8B 3QTBA 3ELDA 2Y1EA 2AN4A 1A8UA 2QP9X 5I48A 3PGVA 3RUAA 3OM9A 2OTCA 3PUWA 4GI1A 4N39A 4QBFA 4U2EA 3R7WB 1AO3A 1L7DA 1P9RA 3RYIB 5KNDA 1GSIA 5DYIA 3T3MB 2ZT7A 1BEEA 3A37A 4IMIB 4NCJA 5AXBA 1ZNYA 1JHAA 2CXOA 1OAOC 2BBOA 1NXSA 2BONA 2Z6VA 3VMMA 5MN5A 1QRUA 4MI3A 4DYHA 1OD6A 3N2YA 2H2WA 3F47A 2AQHA 3B1FA 4GZ5A 2BFFA 3GEMA 1N8KA 4KRYA 4RPCA 3KOOA 5LZ8A 1TZMA 2IH2A 2PUAA 1NZFA 3UTDA 1T9GS 5A4JA 1WSWA 3HKEB 1GYPA 1ZJ5A 3HE3A 4HZGA 4MLPA 3UB2A 3VO9A 1P81A 2ATWA 1QX4A 2BP7A 4G36A 2QU8A 4W6QA 4BLOA 4YRTA 3JAWB 1IQ0A 5HMLA 4BKUA 4BCBA 4HSGA 3ZDFA 1I5RA 5FPTA 2QPOA 3TXYA 4G0VA 4NJMA 3ZW8A 3DFZA 1MQ9A 3UX2A 4C7JA 2WHPA 2G4VA 1QWSA 5DT2A 4D80A 1RKXA 4HLUC 4DIBA 5CJPA 2V6MA 2PDAA 1GVNB 3JWJA 3WY9A 1CR4A 4Z0NA 2W2QA 3I76A 2WD7B 4ZI7A 1DJMA 2VOJA 1WQ1R 1MOPA 3GVCA 1KMIY 3AF5A 2BEUA 2PXXA 3BDIA 2VJMB 4I14A 2J45A 2OV4A 3ENKA 1BFUA 1E3DA 1HH2P 1G6Q1 1G6KA 2FUG1 2VXYA 3BCRA 3PTZA 1KO5A 4IGIA 1R0BA 5CRIA 1L5YA 3WLTA 3Q11A 2OGUA 1G0OA 3GEIA 1W4LA 3IVMA 2XUDA 1V2HE 4PYOA 3IMFA 3R7AA 2FAXA 5K05A 1LGYA 1NXOA 3FYUB 4Q3BA 4NFHA 1FDWA 3DSRA 4QD3A 2D5CA 1GXSB 4XSVA 1FZQA 4PN3A 2LDXA 2IV3A 2ZJBA 3JZDA 4P0TA 5IDYA 1HETA 4G37A 1IQRA 4NYIR 4DARA 3G79A 1MC8A 2B8JA 4KQIA 1XVAA 3UENA 2WMNB 4Y6RA 5KNCD 4FZJA 2P9EA 2X9VA 4EG4A 1ZI9A 2EP7A 2Q1XA 3COWA 5ALQA 5T8KC 4C7VA 1QGED 621PA 1ZM2A 1RPJA 2PZFA 2YFQA 4ZN6A 1P8JA 2HFJA 3AHFA 4R2MA 1NXVA 3OUZA 4E6PA 1GGHA 4H2DA 1TM2A 1ZCAA 3VU8A 1Z8FA 5GGYA 2O2EA 2MT9A 1M8PA 5F7JA 5D87A 3ROFA 4BUZA 1C1DB 2AUNA 2H4ZA 3AHJA 3KLOA 3CWZA 4EA7A 3WV4A 4X1KB 3L0CA 1IEXA 2NU7A 2D8MA 2YIVX 3PFFA 4I1VA 4BGEA 5I7SA 1NNEA 1OJ7A 3LU1A 1J0CA 1JSLA 1ULTA 2CY1A 1I4WA 3OQIA 1N6KA 1GNRA 5FPPA 3SM3A 3LBNA 3TKYA 1IUKA 5GONF 1KI9A 1SIOA 3KL2A 4JLSA 1XTVA 1GTRA 1FX0A 2BLNA 3L1VA 3A9UA 3E9NA 3PVZA 3PUZA 2XI4A 4M0LA 3T52A 3T41A 4QO7A 2Q5IA 3C3YA 4GBGA 1NRJB 2XT6A 4GX2A 2NZWA 4DUPA 2GAJA 2H2HA 2OGZA 5DBOA 4AZWA 2OAEA 4D8YA 1WOYA 2O19A 3PC2A 4HT3B 5G4KA 1VA4A 5SZJA 4JX9A 2HTFA 2FFBA 5DPMA 5JJIA 3NOVA 2VJOA 4NU5A 4POAA 4E2FA 2Y1GA 2WKSA 1SBIA 1DHTA 1PZXA 2F2TA 3CE9A 5HRAA 1PG3A 5KOIA 4MKHA 4C14A 4QPCA 3BE4A 1ZRNA 1IPHA 2F43A 5DB4A 2FP4B 5ER9A 3HU5A 1LCIA 3V8BA 4A2QA 4EIWA 2DECA 1SQ5A 1XG5A 5CVTA 2G06A 3PQDA 4HTFB 3CRW1 3NONA 4DJTA 1E7SA 2IOYA 2OP0A 3PC4A 3ZG6A 4CU2A 1FMTA 4EUHA 1BA3A 4LE5A 1IJFA 4GOXA 4A2WA 4HDRB 3FLAA 2BI7A 2XSZA 3A4MA 3EEYA 1O0SA 3HVIA 3VI4B 4GNKA 2AXQA 3L7LA 1MT0A 3C7CB 5LZ7A 3SFVA 4KR2A 4CTNA 3TD9A 1XZLA 4J3JA 1XXHE 3Q7EA 3QVXA 3SBEA 1NIPA 1VL8A 3MUOA 1J0XO 1IH8A 3UW3A 1P3Y1 2E85A 5ESDA 2VJNA 2POCA 1U2RA 3RUPA 2LWIA 3P9QA 1G8GA 4BV3A 3OHSX 3DE2X 4D3SA 4YPOA 3KKNA 4RLSA 5EE0A 3SFTA 3HVKA 1W8IA 2HJWA 2GEFA 2PUHA 4BKMA 3U4IA 1ZHFA 2BRUC 3B48A 4DR2C 3OE7A 2NSYA 5E1MA 4Q9NA 1I7QB 2D6FA 3O3MB 3ETCA 3OTOC 2QE6A 3I58A 2YCBA 2ZT5A 4YV0A 5A0TA 2QAJA 1KRHA 3NTLA 1W5AA 3QPBA 3ADOA 3PEFA 1HDRA 2Q49A 4UHDA 5J5VA 3LDAA 1LTQA 4II7A 3IOMA 1XELA 3IAXA 2E7GA 1H2WA 4RIFA 1CJUC 2DY0A 1JQ3A 1OB5A 2ZOSA 3N0WA 3IULA 1CUWA 1NX6A 4CT4B 3KVVA 2GHIA 3PT9A 1OAOA 5CNMA 1IUOA 3EEIA 3FFWA 2QTHA 3I1YA 2FPLA 4FFWA 3VR6H 4BJ6A 1UBTS 4PWYA 1E7QA 1H2FA 1T0HB 3KQOA 1CEQA 2L17A 2FGJA 1HSOA 3N05A 2XHEA 7YASA 1F38A 1VCNA 1DPFA 1Z0JA 4BZPA 2OAP1 1F2UA 4P32A 3P5SA 5DGIA 1S4QA 3IP5A 2O2YA 2BH9A 3AI3A 3AUKA 5K3FB 4Z54A 3V9PA 5A02A 1QFXA 3E0QA 3IIKA 3V8RA 1OUMA 2QWXA 4EPTA 1KQPA 5CJJA 1R8YA 3V2IA 4JT4A 2OY0A 6ADHA 2PUWA 2VWHA 1ZJYA 3K92A 2ZUEA 1H05A 1E4EA 4HLUA 3ZXXA 2F1JA 4LOHA 1VLQA 4TV8F 2EF1A 5BR8C 1ZIDA 3RADC 2V8OA 1Y8AA 2NQ2C 4P4GA 2EKZA 3BXEA 3IKVA 4BLUA 4C22A 2CNWA 4IJ5A 3S0JA 3T0FA 3WHIA 1R74A 3DUFA 1P7ZA 4NI5A 4QIHA 4Y30A 3DPSA 4QJ5A 3HMQA 4BV8A 2HNAA 5EIHA 1V3TA 2M6SA 5F21A 4DBLC 4YVFA 1LJUA 2LCFA 3DLIA 3L3BA 3K2QA 1Q14A 4GMXA 4TKLA 1FS4A 1IJBA 3N0TA 4F2PA 1DAOA 1XZQA 1NW3A 1WNTA 5FI0B 4OJQA 5HIMA 3FLMA 3HPQA 2C9MA 2RBEA 4CTJA 4WRRA 3ENNA 3PDWA 3IPXA 1KZ9A 5EXPA 1XHEA 2P5TB 4R0NA 4YP9A 5LUBA 2HGSA 2G80A 4RACA 1U0NA 5BV8A 2EW1A 2XUKA 5LA6F 2Q8NA 2KLBA 2PWZA 1QFMA 3JQBC 3OCCA 2X8AA 5LMNC 1ZD1A 1YFZA 3GZJA 4YROA 4GU5A 5LZ5A 3LVBA 4X66C 3FYHA 3ROQA 1E3SA 4CEHB 3EC1A 5EFOA 2B9VA 1V3VA 2A9PA 2BF7A 2IP2A 2B78A 1H4TA 4CEJB 1DRUA 4EHAA 4R3NA 3A4LA 3DQPA 1YZFA 3F1KA 3GU3A 4XPZA 3PROC 4AM8A 4MWCA 1P5JA 1O5OA 1KDZA 3USES 1R5OA 1V60A 5CXXA 1OR8A 5SYNA 2EATA 4E2YA 4UOZA 3MCVA 4IQ8A 4C4TA 3OOEA 3GNTA 1WO8A 4IUDS 3FMGA 4MVXA 1E92A 2MSNA 5JLJA 4F3KA 4W7IA 1P73A 1RNLA 3FVWA 2W2PA 4HFJA 3ZHBA 4BTLA 2AJDA 1RI5A 2GCOB 4GICA 2R97A 3PUIA 3OKCA 1RZRD 5H8WA 4D99A 3UO8B 3E3MA 1RJWA 1UC8A 3EC2A 1I1HA 3O82A 1ZC4A 2NZVG 4I4NA 4YAFA 3WWEA 1KMHB 4B73A 5U1PA 4JI3B 1KO4A 2CLOB 3O4IA 1L7QA 2Y1WA 4JLPA 1BSVA 4QUAA 4ZEXA 4YCDA 3U17A 4AMVA 2FR8A 4CCWA 4BFYA 1PJLA 3ZWVA 2YCLA 3ESRA 2X22A 1GN8A 1HDXA 4BFLA 3QFRA 2P3QA 2QNIA 1TX4B 1U28A 1JDJA 2PT6A 2ZRPA 1GTVA 4TL7A 4LF4B 1URPA 1YZYA 1SUIA 1JBKA 4FLFA 1PWHA 2A5DA 2D3TA 3MFQA 1N5OX 5HSGA 4G56A 3QVLA 4CDNA 1WZ2A 4C29A 3IIEA 2GOYA 1N57A 1QHYA 3B3AA 4RD4A 1M8FA 3KFXA 5CCBA 3X3HA 2C2ZA 5TQJA 4DF3A 4YAKA 3AL2A 2JFOA 3CNNA 1Q83A 1Z2AA 3P4YA 4XJSA 4F9GA 4O2LA 5DGDA 1U6IA 1E18A 4HDKB 1FW6A 2ZPAA 2ZYGA 4JZKA 1U8YA 2GNOA 4NY1A 4LMPA 3Q98A 3UA3A 3RTAA 1XNGA 2AQKA 4LDPA 3DO5A 1JLHA 5CG1A 4HQ6A 5EIOA 3G9XA 4ZT6A 4WQMA 8GPBA 3I52A 3U9SA 3WGJA 3A4IA 4RM2A 3PUVA 2E18A 3E9DA 3DV9A 4JXJA 1B2LA 2I4TA 4NARA 2JLVA 1Q1AA 2IYAA 2JD2A 4EJSA 4MPTA 1ESCA 5AT1A 1EZZA 2Q9UA 3IB6A 3ZV5A 3DL2A 1AQIA 3SWWA 3WMGA 1OGYA 2IS6A 2W8BB 2BRUA 3OIGA 3JQ7B 4YP1A 2RONA 1L7OA 4K1LA 1RZVA 4S1PA 1XVUA 2FMFA 2ZI5A 4LGVA 5JZBA 4X61A 1BHQ1 5LUAA 4Q1FA 4OKSA 2OL4A 3K1ZA 2DHEA 5CXQA 3BMCB 3OC6A 4G9EA 3SLKA 5I7EA 1KI6B 4H1HA 3M6WA 2WC1A 1Z7EA 4B3DA 1M10A 2QU7A 2ZRQA 2C1XA 4Y2QA 4JI5C 5FL7A 5P8WA 5BUSA 5F2OA 2C3OA 2EKQA 1HOXA 3B1XA 4ZOQI 5JXHA 1IOWA 5BUCA 3RT1A 2WIKA 2CL0X 4MWOA 3EVAA 3ORQA 5C31A 4DTIA 2B5OA 1YZ3A 2D8AA 4GPZA 6Q21A 3QLVC 3KXDA 4A7PA 4EYKA 2K87A 4ML3A 4BP8A 1XS3A 2HEIA 4LXUA 3KQPA 1XVIA 4UUMA 3CEHA 3WOHA 1PSWA 3IBFA 5KZMB 2ECOA 4FM9A 4TTQA 4ZVVA 3U4GA 1Y1RA 3CX8A 3UMJA 2VAWA 1UOEA 4M9SA 1E6EA 4P81A 3HCPA 4M7WA 5FKJA 1W76A 3RVDA 3CH7A 4AKEA 1T36B 2AC7A 2QD4A 4QATA 4YHBA 2RKWA 3VH2A 1VG8A 4D6PA 4D4LA 4OYCA 2I80A 1XRSB 2P2NA 4D3DA 2XZDA 4YRCA 1G5HA 2CFSA 1DADA 2GSDA 5BWLA 4MEAA 1B6RA 5F4ZA 1VPEA 1Z5WA 1JDPA 2C3MA 3KZNA 4YASA 5DW0A 4ESEA 3T3NA 2QZ4A 3CURA 2LRHA 3EULA 4ZO9A 4AJ9A 2JHGA 1WV1A 3VNQA 1KU0A 1OROA 1V3UA 4DM3A 4DREA 3KQUA 4RSMA 2BWJA 3FFXA 3MAGA 3RS0A 3TF5A 1EXNA 4FJ2A 1EQAA 3QYPA 2GI4A 4ME6A 4L5AA 1V6SA 1RXIA 1RG9A 3PDHA 3KYCA 2JAWA 3ND7A 1W88A 2QK4A 3ZGLA 2XE7A 1ZM4A 2G67A 3CX4A 4YBRA 3TRFA 5JXWA 1PR3A 2WM3A 1V95A 4BP9A 1KGSA 2PKYX 2D2FA 2G6BA 3WVNA 1Y1SA 2X7JA 3H2YA 4IH4A 5JNSA 1QCYA 4MVJD 4EUNA 1P2SA 2F6RA 1HLPA 1T2NA 3EXEB 4ND6A 1UL1X 1M5TA 2XBMA 5FBZA 2D59A 1ATZA 1ELOA 1Q7EA 1RAHA 2FVYA 2HT6A 2D00A 3BVPA 4F4UA 4QJ3A 3IKTA 3E03A 3GR0A 4LGMA 4P8RA 1T6XA 3FPFA 4WY8A 3T3HA 3U3MA 3WIDA 1DDGA 4IEEA 1N3IA 4W9NC 3BILA 4B6FA 4B76A 5BORA 5BP7A 4L2IA 2H7VA 4ZPJA 4PHTA 4QGGA 3CUSA 2F7SA 1ODIA 4DZRA 1S8OA 3DEKA 4B3SC 4J2TA 4FQ8A 4XW2A 5FIUA 3GNLA 4E51A 2W4QA 5AHOA 2WUGA 1GL6A 1E1DA 5LN1A 3PNSA 4P6VF 1AK1A 2E1PA 1G60A 1OTXA 1BVYF 1ULHA 5B30A 2KZFA 5L51A 3KJFA 5IN4A 4I8DA 4B4DA 4KNYA 3OPMA 3HA7A 3P2JA 3N9IA 2OZLB 4XYLA 1GGMA 3ZXUB 1RRPA 2PRSA 1M2JA 1QH1B 2JGKA 1X7WB 2XUOA 4QC2A 1KZ1A 2C59A 2IT1A 721PA 1REQB 2RHTA 4O4IA 2BHRA 1MJNA 1XMOB 4B6GA 2ORVA 1B6SA 1F1JA 4C89A 4H3KB 1Q1NA 3W5UA 1FE8A 2XGSA 2HIAA 4JQZA 1MU0A 4RESA 1J1IA 1DT5A 3BJRA 3TMAA 5AIBA 5FTMA 1JFRA 4BAGA 3K1AA 1GZSA 5ADZA 5IT9D 4EDHA 1UBOS 2X1MA 3P71T 5DSTA 4GIBA 3WXMA 1O93A 1NM5C 4RX1A 1FYVA 2J6IA 4D5EA 1U1FA 5KYXB 1TZKA 1RM5A 1GCGA 1KE2A 1U0TA 2PMWB 4OSEA 3DKVA 4FYJA 3SQLA 4BMZA 4UTVA 4JH0A 3VOSA 5MFPA 1GKIA 2UUBB 3PU6A 1DL5A 1TIKA 2MR6A 1FUGA 2REXB 2UZAA 4NPHA 2QRZA 4GUDA 4MVJF 4B4UA 3L4BA 2ZIWB 1OFVA 3IXQA 4C5BA 3HI4A 1T0IA 1X1CA 2H8KA 3SI7A 1V4VA 5ERYA 1SA0A 1N5RA 2I6TA 3JTEA 4DJDC 1UK6A 4JUAA 2P69A 2RBGA 5ECYA 5AD1A 1MKYA 2WMYA 3FZQA 3KQYA 3SAJA 3IT3A 1ORRA 2BH2A 3GLIE 3G6WA 2B8TA 4FU0A 4RORA 2NP6A 1JHYA 2V6FA 4YDRA 4PM4A 1KDYA 4UBKA 3ZU6A 4LF7C 4INZA 4DA6A 1NI5A 4K9PA 3W2TA 1XTTA 1J8VA 3PXBA 4MJXA 4RHEA 4AXXA 4Z2AA 1HEYA 3RU9A 4EKEA 3GDGA 4EEZA 5ITWA 4FGKA 4EJMA 1PJ4A 1GGVA 1OLSB 4J7UA 3KJZA 5C34B 4KP7A 4ITUA 4WS9A 3MT7A 3TLCA 4H1WA 4PVCA 3T7JA 3O8CA 4RDHA 3WQRA 3NFRA 3F6PA 2DY1A 3VAAA 2JLQA 1B43A 4N0PA 5A6VA 1G59A 1DAGA 1RXSA 2NVWA 4ODJA 2JGRA 4L9RA 5DN9A 4BWVA 4BIIA 4F9FA 2G9QA 5CH5A 3I0NA 4BEJA 2D0IA 3Q8WA 3ACBA 3TRKA 4HNSA 2ZRIA 4Q4CA 5JSYA 3V4SA 1NDUA 2W98A 3OOHA 4K9QA 5K0TA 1N25A 2C3PA 1KZ4A 2P5YA 2V45A 3LW8A 3QLVA 3O1LA 2QF7A 4Q1VA 4N7RA 4RAQA 2FQ1A 4BO9A 5CVVA 2ZVQX 4MKFA 1HL7A 4DCCA 3IIIA 4JXKA 5ENDA 5DCYA 1SELA 4JNKA 5F23A 2OV8A 5FOTA 3ABRB 2CXRA 1ZPDA 4MW5A 4ZARA 4E5MA