2HJGA

The crystal structure of the b. subtilis yphc gtpase in complex with gdp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
434
structure length
400
Chain Sequence
b'KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLDNNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein engA
publication title The essential GTPase YphC displays a major domain rearrangement associated with nucleotide binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 120
structure length 400
sequence length 434
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hjgA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA01
1DAGA 4RCZA 4DLSA 2WZQA 4Q47A 2QTFA 2BJWA 3QKSB 2YWHA 1GL7A 2ZJAA 1L8QA 3WYGA 1KIMA 2PBRA 4NHOA 2ODEA 4CEJA 2GRJA 1KKGA 5AUOB 2J0UB 4DLRA 3AUYA 5J4YA 2ZR7A 2ZYTX 1OFIA 3K09C 2GJSA 5A4JA 1N32C 2F43B 1E2FA 3BB4A 2AWNA 5FOVA 3SBDA 4B33A 2GEDA 1CJVC 4CGZA 2XB2A 2C96A 5EZ6B 2ZQ5A 4EPXA 1T91A 2CHGA 1KSJA 8OHMA 5KSOA 1N6NA 5SZHB 2IYUA 4DV0C 3AKYA 1XWIA 4MRSA 1HNXC 2GZDA 3PUZA 3WY9A 5AUNB 1JR6A 1GZSA 2LWIA 5H8WA 1VLAA 2K5UA 4MKFA 4Q9IA 3MWKA 3MCAA 1XMOC 3U4QA 2O8FA 1X1RA 4NOZA 1U0HC 3EC1A 3SR0A 4Q7JB 2R9VA 4OQLA 3W6OA 3AGPA 5HE8A 3B5JA 3OIVA 4QHSA 3K70D 1YQTA 2WJYA 4QGFA 2GA8A 3O47A 3KKNA 1II0A 3W5JA 3JVVA 5DSZA 3THXA 2F3TA 4GRAA 5FH9A 2GCOA 1VG9B 5L3VA 2G1JA 4LHXA 4EIWA 1JI0A 1LF0A 2BMDA 1A1VA 2GK6A 3SN6A 1W48A 1UKKA 4NKRA 3QXJA 4Q4AA 1JNYA 2OUKA 3A4NA 3P27A 2YJTD 1EFHA 2FEMA 1OF1A 1XNQC 3BRWD 2ATVA 3DDCA 3LH5A 4JS0A 2QEQA 1SVOA 1AK2A 3IBGA 3LQRA 4A36A 1OH7A 1AA9A 3GLHE 4OI2A 3PEVA 2WKRA 3F0TA 2NGRA 2UZ3A 2ZYVX 3BB1A 4P0TA 2ZRIA 4YMUA 1NY5A 1E9AA 4BLTA 5L3SB 2GAOA 3KUDA 4O2RA 4NYJQ 1E94E 2OE2A 3SOPA 1G8FA 1NIJA 3TKLA 4DCNA 2QP3A 1N6IA 2OBMA 2NTYC 3LUSA 1E32A 2ZU6A 3BXZA 3EZ7A 5FPKA 2O8BB 1ZNWA 2Z0MA 1L4UA 2ZIAA 1CLUA 5DI3A 3SS8A 2FSGA 1EG7A 3RC3A 1N6LA 2YNMA 4Q4JB 4JSYA 1E2LA 1ZC4A 2IT1A 4GPTA 4E5UA 1M8PA 5KDLA 4LBWA 1A82A 3MUFA 1ZUNB 2ZYUX 5EZ5A 1J70A 4RJLA 1VKJA 3V4FA 3QKUA 2CNWD 4N0DA 4BLPA 2ZI9A 4R98A 2IUTA 4OQMA 1E9RA 1DS6A 1I2DA 3N70A 3RWOA 1E9DA 1MR3F 2FJUA 5FL7A 1NN0A 1Z0IA 4BLOA 4CEJB 5CIWA 5FPHA 4ASUA 5UKDA 2QPTA 2GEVA 1RZ3A 4PHGA 2HHHC 2XSZD 3TUJC 3X1DA 2JJ8A 4B48A 1ZNYA 4ZCMA 3G0HA 1VPLA 3KQLA 1UBCA 2QSZA 4Q7KA 4Q66C 1Z0JA 5KDDA 1JJVA 3GQBA 1I94C 1IONA 4WOPA 4JYAC 2JLWA 4A0FA 3CLVA 4NE2A 4ACBA 1KK1A 1HTWA 4AWXA 4LX0A 1A2BA 4EQ6A 2PL3A 3F3YA 1E2PA 3FKSD 4AC9A 2FFQA 1Z6TA 2F1HA 2Z4RA 3ZZTA 3LBNA 4DV6C 1OB5A 2OLJA 2E87A 5FR1A 4IDQA 5JJKA 4Q9JA 5JCZA 3U4QB 3M4YA 5AUQA 2O8FB 1KI6B 3B1ZA 1RYHA 3H2YA 3KJEA 2VP6A 4V0KA 2JLVA 2W2TA 2BMEA 2C9CA 1XF9A 2QTVB 2WJVA 5J4VA 3SHFA 2VP0A 1DBSA 3THXB 3SQWA 1FZQA 1PA4A 2GCOB 4CEIA 2QAGA 3SQXA 4OK5A 1IBRA 4Q7MB 4QGAA 4URZR 1IHUA 1W5SA 5JFGA 4Q4AB 4YMSA 4TSFA 3Q5EA 1W4CA 3VR5A 3IILA 2OAQ1 4I1VA 3IUYA 3G5UA 1DAHA 4BZPA 2R8RA 1GVNB 1UKZA 3UG7A 1UJ2A 1Q21A 721PA 4QG7A 1VG1A 1KHTA 2N42A 2QMHA 2ZAOA 4X8MA 4EFNA 3BB3A 3B82A 2FU5C 4LV8B 1R8SA 2ZSDA 2VSFA 4DDTA 5KYKA 3U7EB 4PZZA 4GDFA 2CLCX 1JR3A 4LK2A 4OI1A 1CS4C 2AK2A 2V8OA 1XCPA 3VHXA 2C04A 2EW1A 1Q1QA 4IOJA 1C1YA 4B2IA 3KKMA 1Z83A 3ZVMA 2GWHA 3Q85A 5CDFE 4X8LA 3NHAA 4LHYA 2OBNA 3K9GA 3AVUA 3MWYW 5DI3B 1UPTA 3FMIA 2KI5A 3SU8A 3MAAC 5FTNA 1TPZA 4XX2A 4GKJC 2ZR0A 5FBQB 2NPFA 3ZZ0A 1P62B 1Q1BA 1HR0C 5EQTA 4ZKEA 1CU1A 3CR7A 3M6AA 1U8YA 3AVTA 1Q3HA 3MJRA 3NBYC 2IYQA 4G5QA 2ZRAA 4TYYA 2R6DA 3AF2A 3A8TA 2ZITA 1NRJB 4WA7A 3T1QA 2ECKA 5KO2A 2YINC 4M4SA 5EE1A 2G9NA 1C9KA 4KU4A 4MRRA 3WP1B 3THWA 2W2VA 3EIQA 3HR7A 2ZU0C 2ZYWX 3K9HA 2IHBA 3L0OA 2V54A 5DN6A 1N25A 5FUYA 3U44A 1G18A 3I62A 1E2EA 1YRAA 4EQ6B 3D7MA 3DZ8A 4A1FA 4B3SC 1JECA 3UMRA 1G4UR 5FOUA 4MTNA 2UUAC 5JRZA 4P31A 5LD2C 4BLSA 4S2EA 4Y0AA 4IOMA 4JVLA 4C0QC 2C98A 4YHHC 3BWDD 4QNRA 1LTQA 2FWRA 1NKTA 4EPTA 1SHKA 1OKKD 1M7GA 3IHLA 4FCTA 3PUWA 2QGZA 4TLAA 1S1CA 4DR2C 3CB4A 1NL3A 3FOZA 4MRNA 4BASA 1S96A 4HAZA 3FGNA 4PHTA 4CEIB 2GCPA 4Q03A 1ZVQA 3EERA 4IJMA 2QAGB 1GL6A 3FPAA 4DUZC 3AVVA 1PLKA 1YJ5A 5EE5B 4LF4C 1GSIA 4OHWA 2W0MA 2W6ID 2ATXA 3LNCA 3TLXA 3IO5A 3SEAA 1NYEA 2OCYC 3PEYA 1N34C 4YY3C 1ODFA 2GJAA 4TYQA 1HH2P 3LVRE 4V02A 1D2MA 4NMMA 4PAOA 5CJPA 3B8HA 1D6JA 3OHMA 3UIEA 1EESA 5FOTA 2A5YB 2GZHA 1OYWA 4TTPA 2RCNA 4G1UC 4PPGA 1T3HA 1RRGA 4JBYA 3CNOA 5KSZA 3LDAA 2QMUA 3I72A 1GAJA 2HJVA 1VECA 4A82A 2YKGA 4BPBA 3RLFA 3FMFA 4MUBA 2WOJA 4MH0R 1Z8FA 3U7FB 4Z8YA 1CEEA 1XDBA 1OT3A 3PG5A 3KQNA 1XTIA 1BYUA 4HLUA 2NQ2C 4DV4C 1WE2A 4XVRA 5EXPA 1LFDB 1Z28A 1LB1B 2XJ9A 3PEUA 1IY2A 4DR5C 1H8EA 2DHRA 1NLZA 1XMSA 3ZS9A 1WH9A 3THYA 4O2LA 1N0WA 2Q3HA 2VP2A 1ANKA 1RRFA 1ZINA 2CMKA 4AKHA 3UWOA 4PO1A 4WIAA 4R7ZA 4DVGA 1G8PA 4LFAC 4JBXA 4V0LA 4PAMA 4NP6A 1UBFA 4HB3A 1E2QA 1W4BA 2KB0A 1V5WA 4QOSA 4C30A 3W34A 1AM4D 2QORA 4Z51A 2Q3FA 1EFRA 2BM0A 3MMPA 4EPYA 4LFBC 4Q9HA 1AS0A 3H86A 3V9PA 3MD0A 1PVOA 4ITRC 2YC4C 3LVQE 1RIFA 4GBMA 4PQFA 4ESHA 5J4HA 2FFBA 3PVSA 4EFLA 1OPXA 3THWB 3QG1A 4QHTA 1XPUA 4JV5C 1Z0DA 2GHIA 3U44B 3TVTA 2MMGA 3QQ5A 3TAHA 4C7OA 3AVXA 2E7GA 1NSTA 3CRQA 1GRQA 4JI0C 4V0ME 2VYFA 2QI9C 5E7IA 2FFAA 3VKGA 4BSZA 3TQCA 3FFBA 5LBIA 4JLOA 3HYTA 1E1QD 1HT2E 2ZJBA 3LO5A 1XPOA 1E2GA 2W0SA 3I3SR 3DO6A 1D2EA 3CWQA 3EPLA 2IXGA 4PR0A 2ZRJA 1II8A 1M7HA 3KXLA 4G0NA 3X1YA 1II9A 4M9XA 4DC9A 2Q6TA 1E4VA 1XFAA 1TUIA 2RHMA 1DPFA 1IXZA 3QEOA 4GI7A 4Q5IA 1D2NA 3EZ9A 2EFGA 3AP1A 2F6RA 3T1HC 4TT3D 3AF0A 4DLWA 4TL7A 1KTVA 4W7SA 1QF9A 3CM0A 1P3JA 3C41J 2HLDD 4AQYC 5EUQB 2QAGC 2G88A 3EC2A 2LKDA 1ZD8A 2VF7A 3A1WA 4LJ8A 3FB4A 5JWRA 2A5FA 1S8FA 1MO4A 2KWIA 1VYVA 3O8RA 3QPUA 2WAYA 2CK3A 121PA 4LCBA 3T61A 2QNRA 3VMFA 4Q19A 1KNXA 1QG4A 4AYWA 4A15A 3BH6A 4HDOB 2F55A 2HT6A 2VF8A 3TNFA 1YHNA 3H0KA 3RSLA 5F9FA 2X19A 2YYZA 5FL7D 2BBSA 1TEXA 4DRZA 5LPNA 4JKIA 1XTRA 2OILA 1FMJA 1PUJA 3WXMA 1N2FA 1G41A 1XMVA 2V4ZA 4TMXA 1WQ1R 2OM2A 2JLRA 1KI9A 2DY1A 3CZPA 1S4QA 4YC7A 4I1UA 3LW8A 3QSYA 2XJ4A 2OFOA 2ZSAA 4KFSA 3THYB 4JSTA 3KUCA 3CH5A 2NIPA 3K09A 4PC6A 2H8KA 3OEHA 3ICQB 4RD6A 1NJFA 1UM8A 1ZCBA 3C4JA 2FE4A 4M2LA 5FUWA 2GXSA 3IQXA 3FFAA 4LF6C 4MYHA 4D2IA 4EPRA 3QI2A 3F5FA 4MGKR 3UPUA 4Q48A 2PN2A 3TSOA 1OIVA 4LYAA 1CRQA 1QZXA 3WNDA 3IIKA 3NH9A 5H68A 1Z2AA 2D7DA 4ILEA 1MO5A 1YKSA 3BFXA 3ZGXA 4GMXA 1WXQA 3PEWA 1GOTA 4C2TA 3AVPA 3U61B 3BFKA 3VR6A 4TYNA 3KFXA 1J8YF 2CNWA 2ZROA 5FTMA 4C7OB 2VSXA 1XJCA 4LSGA 2IHYA 4KYIB 4S35A 4DLTA 1QHIA 2EVWX 2JLYA 1UBEA 4G5GA 4PTLA 1DTSA 4LDJA 4URXR 1G3MA 1HT1E 1AN0A 2XSZA 1KI7A 5JS8A 4PPNA 4UXHA 4B44A 4PC2A 2LCFA 3I8SA 1KAOA 4Q01A 3RWMB 1LS1A 4DUGA 1U0LA 4I4LA 1II8B 4QJ5A 3X1XA 2CLSA 5DE3A 3NEYA 2XNDA 2P65A 3D8BA 4OQXA 4ZI3A 2BJOA 4H9GA 3ND8A 1E79A 1OHHA 5L3RA 1JR3D 1XJ0A 2VHUA 4X66C 2OV2A 3FKSA 5E95A 3B1XA 5IK2A 1GRRA 2C9OA 3U5ZB 4K0KC 2J3EA 2VL7A 1LS6A 2XTNA 3A37A 1XMQC 5C2JB 3C7KA 1S3SA 3WBKA 2ZXUA 4U5XA 2Q21A 2O8CA 1FL9A 5IDVA 1BIFA 3R7WA 3RRMA 3VR4A 4Q7LA 3GJ6A 2EFEB 4DR6C 4M1SA 4LZZA 3K70B 1N0UA 2IYVA 1NMYA 2XITA 2RGXA 1KY3A 1P2VA 3DVLA 3KJIA 1F3OA 3LRPA 1E2DA 4TQAA 3EZ6A 1AIPA 1IN6A 2ZS8A 1GKUB 1ZD1A 4AK9A 3EA5A 3KJHA 2OCBA 3AP3A 3TSWA 4V03A 2IWRA 3U3MA 3UMSA 2XR1A 1JB1A 4QBIA 3CIOA 1HY3A 2QGNA 3U2QA 3W3ZB 5C46F 3GLIE 3QF7A 4RKEA 1NG1A 2C77A 4PPQA 4DT1A 2AKAB 2GAAA 4HLUC 2YZ2A 1KO7A 3B6EA 1E9BA 4KFUA 4NH0A 3OIWA 3T1OA 5K8UA 1M6NA 2OT3B 2VHQA 2FFHA 3B7GA 4DLXA 3HWSA 1TNDA 2R6FA 2XTZA 4UJ5A 5SZKB 3RS3A 4A0GA 2RMKA 1KSFX 5C4MA 5DI9A 3SJCA 4M1KA 5EXXA 1KYIA 3QVVA 4Q00A 1NVVQ 1RJ9A 1G7CA 1OH5A 2MMCA 1EX6A 4QGGA 2WWXA 2GF0A 2HDNB 4LJ7A 4YLGA 4DDVA 5JRJA 5AJVB 4I81A 2YWGA 3NTUA 2UUBC 4AYXA 1DAEA 1TEVA 2W83A 4FMCB 1TQ6A 3KX2A 3LV8A 4KAXA 5LDDC 4GP6A 3A6PC 3GLFA 1IXSB 3AB3A 3AH8A 1TL7C 4OJKA 3PR1A 2IA5A 1NKSA 1U81A 4DB4A 2RGCA 1E2NA 4V0OA 4ZO4A 2PT5A 5SZIA 1OXUA 4L4UA 4DB2A 1XEWX 5G3YA 1ZU5A 2P67A 2MSEB 3BORA 3L0SA 4B76A 3A1VA 2CHQA 3D3QA 1X86B 1YR9A 4LYJA 4WZ6A 4NL4H 1US8A 1Y3AA 4JLKA 5FOWA 2O0JA 4PC3A 4NCKA 4V0NA 2IYSA 5G53C 3CZQA 1F2TA 3WNCA 4AKGA 1QBKC 3TUZC 4JMPA 3EA0A 3MJHA 3ONWA 2V1UA 1P73A 1XXHE 4Q9LA 3RANA 3DM5A 3ZIAD 3QVUA 5F9HA 2RAPA 2O8CB 1EFUA 4HSEA 2PMDA 3R7WB 3WYAA 1IN5A 1E9EA 1OKKA 2WPDA 1H8ED 4TMWA 2C78A 4WXRA 5B2ZA 4AD8A 2AD5A 2VP4A 4UNQA 5CK5A 5FOXA 5TY0A 1IQPA 2P6RA 1R5OA 1J2JA 5AK0A 1NBMA 2IS2A 3M0EA 3R9WA 2H17A 1TMKA 4TWZA 2GKSA 3T5GA 3K1JA 3W3AA 2W6IA 4NDZA 4QM6A 2ANBA 4Q4LA 5FR2A 1HA3A 1J8MF 4HB0A 1OFHA 2H7VA 4CDGA 3I5XA 2AXPA 2FA9A 5KPJA 4Q4JA 4DT1B 4HLQB 2WWWA 3EIEA 2CBZA 2QTHA 3ECCA 2OXRA 3SE0A 3E2IA 1OIXA 4B71A 4BFSA 3NIBA 2OAP1 4IW3B 4US2R 2CDNA 3DMNA 1AS2A 1YZGA 1NNEA 4KBGA 4B3BA 2E8EA 4OHYA 1XEFA 3L0IB 4AKEA 2GCNA 2DWQA 4G3XA 3KL4A 3JVUA 4KSBA 1RJ9B 1HV8A 3E70C 3CO5A 2IYYA 3GJXC 1YZUA 3CRRA 1T6NA 3U6KA 2Q9AA 4IDNA 4LOAA 1JEDA 2JDID 2X2FA 1BKDR 4TL9A 4XIGS 3GJ8A 2IXEA 4HLCA 1S3GA 4B3DA 4M0LA 4XH9B 2J7PA 5FTKA 4JI1C 1E0KA 1ZW6A 1FOEB 4Z8XA 1RPZA 3GLFB 1S9HA 1G3RA 2PLRA 1CBUA 5GJBA 5HKKA 1U9IC 3HU2A 4XWAA 1AQYA 2PH1A 1KI6A 2IYLD 3RS2A 1G17A 4DV5C 4UXIA 4LBZA 3R8FA 2CCKA 5FLXD 3AF6A 4DDUA 4Q1DA 5JZVA 4NCJA 4IVRA 4DV7C 4GOXA 2F9MA 2CK3D 1IJEA 1QHHA 1T0HB 2CL6X 3OF5A 3B85A 4IVQA 4URYR 1KK0A 1G8HA 2V9PA 2ATWA 2GVZC 3I32A 4R9UC 4B6FA 4C0SA 4N3NA 1US8B 1ZB9A 3P20A 4NYMQ 1VHLA 4B2LA 221PA 3O8CA 3EPJA 1EFCA 3UXMA 1F2TB 1MV5A 3QEJA 2DYKA 2QPAA 1WCV1 4LJYA 1WBDA 2H57A 3RC8A 1VMAA 4PC7A 1E1QA 1MOZA 3A36A 3QPWA 2EWVA 3I07A 3Q3JB 4YDHB 4D0GA 4IDOA 4LGMA 2JLQA 2GDJA 4YONB 1NN3A 4L15A 1AKEA 3HU1A 4E22A 2CE2X 1E1RD 2B7CA 2SHKA 1WF3A 2ZUDA 4QNMA 2GXQA 3NEJA 2R6CA 3OEHD 5IRCD 1U98A 3B60A 2J59A 4TT3A 1OV4A 1MO3A 4UXJA 2HYIC 1EWQA 2CXCA 3TW8B 2R6AA 3PV0A 2CJWA 1XD9A 1ESNA 2HLDA 2OESA 2WKQA 1OSNA 3CF2A 3PITA 4OQFA 4X62C 1WB9A 3KXIA 1T5IA 4JIMA 4EAQA 3CRW1 3GFPA 4MUAA 4ZCIA 1FTSA 2J7KA 1IBLC 1Z6XA 3QPVA 4L9SA 3KQUA 2C99A 3SJAA 3HDTA 2C9YA 3WBJA 3WNBA 1KK3A 3NKVA 1T5LA 1G5TA 2ZS9A 1VIAA 3BBPA 4IXNA 2WOOA 1E9SA 1N3BA 4PQYA 3GLHA 2ZM5A 4KFRA 4GFDA 5LB4A 2VBCA 1W0JA 5C4GB 1P4SA 1VYTA 1W4RA 5C18A 3OTOC 2QQ0A 1A7JA 4EPVA 3C8UA 3O8DA 4OX9C 2X2EA 3IQWA 4DUGD 2XNDD 3I4LA 3QY0A 4N0EA 5JWHA 3TQFA 4UNRA 1E79D 1TQDA 2XTMA 1GNRA 1OHHD 2ZRBA 4KODA 4O25A 6Q21A 5LD2B 5GADl 2J0QA 1T8TA 2ZE7A 4LPSA 5HZKA 5IK2D 4MYTA 4LJ9A 2ZUCA 3P4XA 2ZANA 4JI5C 4OK6A 1JQLB 1P6XA 3T06B 2FOLA 2AFHE 4LYFA 2OG2A 1QHXA 3ZD6A 2I3BA 3IPXA 2WAXA 2XZOA 5TB5A 3J80D 2VH5R 2Z6VA 3D6TB 3LA6A 5JHGB 1KK2A 4HATA 5FPTA 1W7AA 1QHHB 2YHSA 1KKLA 5KHOC 2G6BA 5CM8B 1CR4A 2UU9C 3I73A 1SKYE 2GESA 4PHFA 4TMVA 4AKIA 5DHAA 4TLBA 4NCIA 1NSFA 3GJ3A 4U7DA 3OFND 4PO9A 2ZUBA 3VAAA 4UQOA 1UFQA 3ZDQA 1HYQA 1P9NA 5J4KA 1I2MA 1Z6AA 2ZI5A 1IN8A 5CIQA 2ASEA 3PUVA 3H1TA 5TARA 1CF4A 4OHXA 4D0NA 2IC5A 2D2FA 2OO7A 4DR7C 2IYRA 3CJEA 3T35A 5KSYA 1E0AA 4MDEA 4A8JA 1AZSC 2JJ2A 3C16C 3QE0A 3DKVA 4FMDB 2W00A 2AFIE 4TN1A 2QU8A 2VHJA 4B3FX 1FNMA 4JT4A 4NYIQ 1UKYA 3MRSA 4D4MA 1G3QA 3LX5A 2KBFA 1Z63A 2IS1A 5EP3A 2Z43A 3R8CA 1Z3IX 2FH5B 4HI0E 5JECA 5BR8C 1N5JA 2CJWB 2FNAA 4M1WA 1G7RA 2ZJZA 3CX6A 2IF0A 4IVPA 3LWNA 3GMTA 3RS7A 2AHOA 3J81k 3EASA 2E9SA 2QE7D 4FWTA 1S9DA 4LFCC 2F1JA 2LKCA 5DIFA 4KLZA 4KLNA 2H92A 4KCGA 4RZUA 4F93B 4IXMA 3C15C 1IBKC 3I92A 1QVRA 1XP8A 2BBWA 3A1TA 4BFYA 2YWFA 1YRBA 3B1VA 4X8HA 4LF9C 5EP1A 3VR1A 3GLHB 3R20A 1FQJA 1ETUA 3K9LA 3AF1A 4R2HA 2V6IA 1RVDA 3AKEA 3E5HA 1COWA 4QGHA 4HLDA 5IT5A 1IXRC 1KMHA 1W47A 4XWOA 5TMPA 4IDPA 2VA8A 3AKDA 5AWFC 1F6BA 3WHKA 1G7SA 1NF3A 3DOFA 3IPYA 1JAIA 2WICA 1NJGA 1CJKC 5A2QD 1E9CA 4F4IA 1CR1A 1Z08A 5CDFA 1CKEA 2Y8EA 2QN6A 1G1MA 5FI1B 4Z1MA 2QMOA 1GP2A 3U3KA 1B23P 3EPKA 2PLFA 5DYGA 2WSMA 1XD2A 3REFA 3SBEA 4L8GA 4TYWA 1M74A 2VP9A 2WHXA 4MKHA 2ZI6A 3ZS8A 1ZNZA 2WPDD 1UKVY 2PEZA 1OXTA 2OSBA 4FMCF 3PJRA 4DXAA 4XJXA 1R2QA 3VQTA 1NBMD 1SHZA 2ZE5A 5A0FA 3AGQA 1VCNA 5AJZA 2CL7X 4JZKA 4C3ZA 4BFZA 2CVHA 2A7QA 2ZI7A 4O3MA 4OBEA 2GETA 2EGTA 4AG5A 3DOEA 5TDHA 2ODNA 1W44A 5JBQA 1IJFA 2HCBA 3EWAA 4I1SA 1N5KA 2XGJA 1T9HA 3VR3A 3RYTC 3IGFA 1CJMA 4M9SA 2QY9A 3EZFA 5JJLA 2ZVPX 4LRWA 1JPNA 1KJZA 3FYHA 2ZRGA 3BERA 4DLUA 5DGXA 2OCAA 4A8JB 4D82A 3WHLA 3ZVLA 2UXCC 2QRNA 4C2UA 1KI1A 5HPYB 3U3OA 2VLIA 4NYJR 4BRUA 2J9RA 2O0KA 5K8LA 1L7VC 3WMFA 3THOA 3VTKA 4ON9A 2X77A 3NC0C 2OCPA 3BGWA 3S1AA 1NN1A 4IEEA 1VYUA 3V4RA 1S1MA 3PCRB 1JJ7A 3ZIAA 2FGJA 1ZJ6A 3BS4A 1ZCAA 4EFMA 4BFWA 2VQEC 2WMNB 4QFMA 2H18A 1XPRA 2NZ8A 4B74A 1GFIA 5KTYA 1GKYA 3VKHA 4MQBA 3AVWA 4ZIRB 3LBIA 2DFLA 1DAKA 1WA5A 3IEVA 1DEKA 2B92A 1F60A 1GUAA 2ZRHA 4Q9KA 3VU9A 1UKEA 2J7PD 2REOA 1JQJC 3CRMA 3UKDA 1FP6A 2G77B 2YOGA 5DISB 2ZRKA 5HKKD 2P5TB 3T15A 4ZI2A 1KO1A 1LF5A 2D74A 2WSSD 1RKBA 1H8HA 2G0TA 2O0HA 3JZMA 4RFSA 3I8XA 3N5CA 5DLQC 3RS0A 5JLJA 2WBLC 5IWAC 1KO8A 1KMHB 4M1YA 4AY2A 3B9PA 4JI2C 4LJ6A 1SZPA 3CRVA 2PJZA 4K8OA 5JS7A 4G5RA 2WJGA 1Q1EA 1F2UA 1E96A 4M1MA 2XNSA 2CLDX 1DARA 1ZM4A 2MSDB 2WV9A 4WAUA 4LJ5A 4C9BA 3VNUA 5L3QA 1U2RA 2ORWA 1XD2B 1N5LA 2D7CA 4B3TC 4LHZA 4MKIA 4DJTA 1TU4A 4MH4A 1HUQA 1E4YA 3OAAD 5GJCA 2ZM6C 2DBYA 4HAVA 3K0SA 1Q12A 2QT1A 3U7GA 1EK0A 2QROA 4RVCA 4X65C 3IDQA 3U6BA 4US1R 2JDIA 4P33A 1KKMA 3TMKA 2VP5A 1QHNA 1AS3A 3SFZA 4DEXA 3P4YA 3GP8A 4FXPA 3CONA 2FF7A 3IEUA 1N6HA 5J4LA 2R62A 1YZQA 1W49A 4YDSA 4BFTA 4DR4C 1XJQA 1A2KC 1B0UA 1QHSA 4POAA 4D4JA 3BE4A 1Z06A 4CT4B 1FMLA 1GKIA 3U3JA 5E3HA 4TLCA 3AVQA 5FUXA 3HJNA 3Q7QA 1KI4A 3KB1A 4PAQA 4V0MA 2HJGA 3Q7PA 3RS5A 2EFCB 1YE8A 2JA1A 4DCTA 3IHWA 1R7RA 5KUTA 2QZ4A 3VX4A 2IYTA 1ZM2A 1VTKA 4PFSA 3LY5A 3WMEA 4LBVA 2RGAA 4KJZA 4WXPA 4A8JC 4NXMC 3S1AB 1VG8A 2H1LA 5DH9A 4B2PA 4BQSA 3FTQA 1D9XA 2PZEA 3B13B 1W0JD 4EUNA 2IF2A 2BHRA 4B6EA 2C03A 3L0PA 2AWOA 3B1WA 2HT1A 1OIWA 2OFWA 2B8TA 4B32A 1CP2A 3W8RA 4JI3C 2ZR9A 2I1VB 5BN4A 4GKKC 1SXJE 4KV9A 4B47A 1E1RA 4E07A 5DNYB 2GNOA 4FW9A 5EP4A 3VU9B 4NONA 2WWFA 1NLFA 2DPXA 2C5LA 4II7A 1CIPA 4GT1A 3ADKA 4QM7A 5FBLB 2EYUA 2ZREA 3WRXC 4ERNA 3FHOA 3TAUA 2UUCC 2VRWA 3QNUA 1DELA 2JCSA 3KXKA 4U00A 4RFSB 1PUIA 1BS1A 2GTPA 3U60B 1IAQA 4QHYA 1LW7A 3K0AA 4ZPXA 3UMFA 4O0MA 5FTLA 4QJ4A 1U9IA 2WVJA 4URVR 2I1QA 3BIFA 3HR8A 4NU0A 1F2UB 3UWKA 4LBYA 1HNZC 2YWEA 1NG9A 1SVKA 1TQ2A 5L3QB 1KAGA 2FSHA 3W9YA 4YMWA 1DO2A 2A9KA 4QXAA 3RDPA 4IKEA 4Q1EA 3GFOA 1UF9A 4FD2A 3ZQJA 2DB3A 1Z6GA 3CR8A 4M9QA 2JJ2D 1E98A 4JKYA 4AIIA 2ZI4A 1P2SA 4MGZR 4XD7D 1LVGA 2ZRCA 4PSAA 4TMZA 4BFXA 2RGEA 1I4LD 4WVFA 5G40A 3HU3A 3RSOA 4A2PA 5CITA 1UDXA 1X6VA 4RD3A 5KOYA 4I1OA 2RGNA 3LFUA 3GLGE 1W4AA 3FMOB 4QC2A 1T8UA 4IOLA 3QJYA 4BECA 1EXMA 4HZUA 4KHZA 3PFIA 4YXWA 1E2HA 2DWPA 3AUXA 3L8YA 3MGCA 4B35A 3FKQA 5JI3E 5JMTA 4LHWA 5HTKA 3GJ7A 2IK8A 4UKDA 1Z0AA 3CNNA 3E1SA 2EQBA 3R9IA 2VQSA 4MYCA 1S0UA 3AKCA 1ZBDA 3CX8A 3OFNA 1P5ZB 5F3WB 1KJWA 2WJHA 2REXB 4JLAA 2G83A 3MLEA 3KKOA 3L82B 3ZVNA 1JOSA 2UZIR 2NMVA 4KYUA 4C4PA 2FPMA 1COWD 4W9MC 5EE9A 4HB2A 2V55B 4FMDF 2BIFA 4PZLA 1UEJA 1Y63A 1E3MA 1GITA 3ZD7A 3CW2A 2GBLA 1TADA 1VCMA 5H70A 2QUZA 1W46A 1N6PA 1YZKA 4Z1MD 2KBEA 2F9LA 2P0EA 4TQUS 2ERYA 4JLNA 2J45A 5FBWB 2W6JA 1PLJA 5JSZA 3RS4A 5FFMA 3MFYA 5BW8A 4ARZA 2CCGA 3K0EA 1XNRC 1G8YA 1Z22A 4KO8A 5EP2A 3TR5A 5B57C 4G5SA 3K0AB 5E7JA 2CEAA 2QE7A 4B3XA 2JLSA 2QM7A 4LPKA 2WWYA 2CXXA 4IEIA 2ERXA 2OBLA 3IO3A 3UK6A 1ZP6A 3GJ4A 3GLIA 2OFXA 1L2FA 1XZPA 2F3RA 2BEKA 4C0AC 1KDOA 3B2EA 2V3CC 1AJEA 4DV2C 2GJKA 2AX4A 2HEIA 3BFVA 1WRBA 3WRYC 1OH8A 2JLUA 1ZMXA 1TF7A 3GCGA 4BUJA 2FGKA 5GJWC 1KNQA 2GK7A 1RW4A 5TV2A 3HYRA 1KDTA 2ODWA 4R71A 1X3SA 3EG5A 3X1WA 5K8TA 4B3MC 4RKFA 1FPMA 5F98A 4MRVA 1U99A 3J81D 3EW9A 3ZZUA 3VR2A 2DFKB 4FMBB 2JASA 5FBRB 1BYIA 5FL3A 4DSUA 4HZUB 4Q21A 4DSTA 4JJKA 2J0VA 4A92A 2RH5A 3CPEA 1G3IA 3NG1A 4LJ4A 2ZRFA 4GOJA 5AJYA 2IX3A 4XTRA 5IT9D 4MGIR 2WM9B 1ONBA 4KVGA 2JMPA 4RY2A 1L2TA 4NPHA 5LMUC 4PSVA 2KE5A 4MRPA 3GKUA 1NVWQ 1SULA 3TIFA 4MYUA 3TUIC 1FP7A 4TMKA 4WZBE 1WDTA 4TTRA 2P5SA 2B7BA 2BV3A 1DG1G 5HE9A 4F7WA 1N0VC 1KY2A 1H8HD 3I5YA 1OLOA 1E9FA 4OHVA 4TL8A 3SYNA 4A6PA 5L8VA 4W5JA 4G5OA 1Z47A 2ZJ2A 4KHPC 3B78A 1R0YA 3ADDA 5P21A 1Q22A 2A2ZA 3T5DA 1XCGB 1G6OA 3K8YA 1GILA 1XTQA 1ZC3A 1XXHA 4NTZA 2IEZA 4JI7C 5KNCA 4UNPA 3W6PA 4JL8A 2O8EA 4PO8A 5JSZB 3OIYA 2AXNA 2CE7A 3OZXA 3GJ5A 2A5GA 2XXAA 1G3UA 1NVXQ 1FNNA 2G1KA 1MKYA 4X8OA 4FI3C 4ARZB 3DHWC 2FSIA 1KSHA 2ANCA 1JAHA 1P7CA 1ZUHA 2GEUA 2XX3A 1ELOA 2ORIA 3P1JA 1QRAA 3FMPB 1Z29A 4LV6A 3WP0A 4MA4A 1D8TA 1PLLA 2OLKA 2QA5A 3NHBA 4OK3A 1LNZA 1R5NA 5A5GA 4EKDA 4BE7B 3AQ4A 4U02A 2IYWA 3GLIB 2ORVA 2D06A 4LF5C 3IBYA 4B43A 1SGWA 2O5VA 5FPSA 3EPHA 1KMQA 2BVNA 2WSSA 3KKQA 4ZV4A 4KITB 3ICEA 4TMTA 1M2OB 1X8LA 5D3MB 4QRHA 1WBBA 1G6HA 3ADCA 1DOAA 4UNSA 4HYYA 4M1OA 1AZTA 1VG0B 4NXNC 3AEZA 3FWYA 5HZHA 5JEDA 1Z0KA 1M34E 1USPA 1Q0UA 1PJRA 1SXJC 2UKDA 3QENA 2BWJA 4G01B 2REBA 2PX0A 4HAUA 1ZB8A 4UNNA 1GG2A 3CF0A 2F1RA 1KO5A 3AF3A 3ND9A 2QQEA 4GZMA 3TK1A 4CRWB 1ZIPA 2IBMA 4M9ZA 3M1IA 4EPWA 4HAXA 5TXGA 4QBGB 4BEJA 2R44A 2IYZA 2GZAA 2QP4A 3QXXA 4F4CA 2O52A 1JBKA 3OAAA 1AGRA 1WMSA 3CH4B 3QXSA 5BXQC 1E2KA 1BMFA 1HEIA 3PIRA 2RGNC 2HXSA 1GTVA 2AN9A 2ZETA 2O8DA 4MKGA 1FQKA 3KFVA 2OXCA 4F4JA 3REGA 3ZJYA 2X1VA 1AGPA 4OHZA 3K0FA 1TF5A 4QJ3A 3QG5A 1KDPA 1XTJA 1TTTA 2QBYA 1NVUQ 1DVRA 4HZIA 5FI0B 3CF6R 5JI2E 2QM8A 4PC1A 4DUYC 1HE8B 2QMEA 5FPYA 1GL9B 3GJ0A 4DLYA 2IUUA 2DYJA 4I99A 4A2WA 4D80A 5KNBA 5JHHB 5ANRB 4DDWA 1P72A 3EX7C 3Q72A 1KO4A 3EAQA 3LXXA 4P4UA 4TZ0A 1U90A 5G3ZA 4F91B 1XXHB 2GXAA 2VTKA 2OPLA 4JLBA 3WYFA 3A4LA 3DMDA 1DO0A 1G20E 3L2OB 1T0JB 2GBLC 3UG6A 1IBMC 4GL2A 2O8EB 3KKPA 2GF9A 2NO9A 4OQNA 4K81B 1ML8A 2N1BA 4HDQB 2XXAB 1SXJD 3RRZA 1E69A 3F8TA 1NVVR 2JGNA 4B3RC 3K0CA 4JBWA 5EUMA 1O3YA 2RB4A 5GJVC 2ZS7A 3JAMD 2FN4A 2IUSA 2ZJ8A 5DO9A 2EFHB 4EJSA 2BJVA 2DR3A 3X2SA 3A4MA 3NC1C 4HAYA 4NCHA 1XNJA 1RE0A 1TAGA 1YR6A 4BLRA 4DLVA 3U7HB 3AM1A 2ZRLA 2ZTSA 4CEHA 1T3LA 2NO0A 4URUR 4F92B 3MG9A 2V6JA 4RD2A 3ZVRA 3DEFA 3CBQA 2J87A 1UADA 4DR3C 5CJ2A 3BAFA 4JLDA 5FBVB 2NOAA 4YXWD 1CR2A 4JLMA 3W6NA 821PA 2DCUA 3NH6A 3H84A 4B75A 3SYLA 2V7QD 5J47A 1BO6A 2WKPA 3VX3A 1N33C 2P3SA 3R9XA 2E8FA 3QKTA 3K9NA 4ZCLA 1USPB 2AKYA 2XAUA 4LI0A 2JLXA 2XZPA 1E0SA 5KPDA 4FINA 5SZJA 1CJTC 1QDEA 1FJGC 2QAJA 4JL5A 5ELXA 1OXXK 1T4GA 4XVUA 4PXAA 2XOKA 4GMDA 2PZFA 4HAWA 1JR3E 1QVAA 1K5GA 1QHGA 1A5TA 1W1WA 2VHTA 4X64C 4DR1C 4A9AA 3B1YA 2UXBC 4HUTA 5BWMA 1W36B 4Q4HA 3V00A 1YZNA 1RFLA 2OEPA 2Q9BA 2CVFA 2C95A 4H1VA 5JWOA 3EARA 2B8WA 2F7SA 2O8DB 4RZXA 4L16A 1HH4A 2PMKA 4DV1C 2R2AA 4XD7A 4IOKA 1XZQA 2WWGA 2J5XA 3K0FB 3Q5DA 4PQRA 4GOKA 4PSKA 5BYJA 4CYMA 2A78A 4D4LA 4PANA 2W6JD 4Q02A 3SI7A 4TTQA 1TQ4A 1YR8A 1IOZA 3NVAA 1OB2A 2QBYB 1G21E 3GEHA 5EXTA 1KZGB 1ZYUA 2A5DA 3GFTA 2XEXA 2D3WA 2HYDA 2GVDC 4WZAE 1J90A 1AKYA 4HUQA 5BN5A 3VHLB 1X1SA 1L4YA 3TRFA 4ZIRA 5C1BA 1NP6A 3BH7A 1G291 2CHVA 4OI0A 4P4SA 2W2XA 3BJIC 4MITA 3NXSA 2HV8A 2ASBA 4DWJA 1OE0A 2OPLB 1V43A 4LWZA 1OW3B 4WW0A 4DCVA 4E03A 3RABA 2KSQA 3QKRA 1MABA 1R5BA 4UJ3A 1DG3A 4Q1CA 2D4HA 3T1TA 4PZYA 1R4AA 3RRNA 3VNVA 4ACAA 2J46A 3NBXX 4OJQA 1UDWA 4PPFA 2ZE8A 5HCIA 1LY1A 1NY6A 1Z6YA 4R2IA 2Q9CA 1OFUX 2QL6A 2NZJA 3TGPA 2FG5A 5CM9C 1XBTA 3TW4A 4CT5A 3GEEA 1DAMA 1MO6A 4EJSB 1X8KA 2FZLA 2H16A 1F48A 3GEIA 5HCNA 1KI3A 4C0KA 4CEHB 2ZRMA 2HF8A 5CYPA 2PX3A 1SVMA 1SVLA 4RD4A 1G64A 1R0ZA 1XCMA 2HF9A 2JIZD 4DZZA 2VPPA 1E2JA 5G41A 4LUCA 1NMZA 3O8BA 1MRNA 2BMFA 4JYCA 3PQCA 1YZLA 5J5CA 2X8AA 2QL8A 2RKOA 1TX4B 3LLUA 1QWIA 5AJWA 4OI4A 1XX6A 1U94A 2ZRDA 3CPHA 2F1IA 3EIHA 3EZ2A 3G82C 3SYKA 3CWZA 4FIDA 2ZJ5A 4NYMR 2ONFA 5KNDA 2JAQA 1M1YE 3T12A 4ABYA 2ZEJA 2B21A 2QRZA 2HUPA 4Q1BA 4XSGA 2JLZA 5KU1A 2GJ8A 1UEIA 2AK3A 4K46A 3PUXA 5K8IA 2BKUA 1Q1ZA 1RRCA 4Q4HB 1ESMA 1XTSA 4IDHA 1FW6A 2IXFA 4BZQA 4KI0A 2HCJB 3SFVA 4B3CA 4AURA 4TYPA 1W36C 3QIAA 4GP7A 2MSCB 3EXAA 3ZLJA 2FSFA 4A0HA 3SJBA 3TR0A 2JJ1D 1SVSA 3VFDA 1XD8A 4IHQA 1N6RA 5FTJA 3WMGA 3C5HA 3U3RA 2FPKA 3I1FA 4KFTA 4RFVA 3OE7A 3AF4A 1KZ7B 2WMOB 1P2UA 5AR1A 5DHFA 3NWJA 2VHCA 2ZSEA 2Z83A 1X8JA 3DKPA 4PHHA 3SC3A 1G9XA 4DIEA 3ZH9B 3LBHA 2P6UA 5AUPB 1VCIA 3AVYA 1K0RA 4FWIB 3SHWA 2PZGA 3CUEF 1IM2A 1OYYA 3DM9B 3LW7A 1N2CE 3QOFA 1SKYB 3VKWA 4HUQB 4TLDA 1BOFA 1DE0A 3H4MA 2D7VA 4P4SB 4KVAA 2VQFC 2IW3A 4C0LA 1CXZA 2H5EA 2IYXA 1GWNA 4LHVA 2G0NA 3FHCB 2KJQA 2HXYA 1SVWA 1WP9A 3ASZA 2XB4A 4DBLC 3QKRB 2FPLA 1MABB 1FX0A 3LQQA 3IKJA 1CULC 3QUSA 1FTNA 3UANA 1KI8A 4L5BA 4QBFA 1YU9A 1LV7A 2Z5FA 1U0JA 4OL0A 2J41A 2VIIA 2BOVA 2YOHA 2JATA 3KDSE 4JLPA 1EGAA 3X1ZA 3D31A 1UAAA 1Q44A 5EXSA 3OEEA 3P32A 4XVQA 4GSYA 4JJZA 2E5LC 5E4FA 1SVIA 3K0CC 3NBZC 4LY6A 5H1YA 421PA 4KXFB 2ZE6A 4YMTA 3C5CA 3L8ZA 1Z5ZA 3DZDA 4C0HA 1VDZA 4BFUA 4EJSC 4WBSA 2WIAA 4Y0VA 3BH0A 2IWHA 4BGDA 1W36D 1Z07A 3BK7A 1N6OA 2GXUA 1MH1A 2P2LA 1BMFD 1HURA 1KSGA 1W0KA 4KSCA 4AYTA 4Q1FA 4QBHA 2ZSFA 4BEBA 1G7TA 2OZEA 1OFTA 4ESVA 2YCBA 1EFTA 4DCUA 1DADA 1GIAA 2Z4SA 3ADBA 4N1AA 2RGGA 5IF9A 2P6NA 1E2MA 1OJLA 4C0JA 1NI3A 1LQLA 3AVOA 1IN4A 1S2MA 1JEEA 2AD1A 1TU3A 3KB2A 1XB2A 2TMKA 4L9WA 4A2QA 4Z54A 3NDBB 4HB4A 3Q8XB 1R6BX 4JI6C 4JYBA 4XTCS 4A0RA 1JALA 2E8CA 1N36C 2QSYA 3HPRA 5JEEA 1NIPA 2VO1A 2NO6A 3FHTA 2YC2C 3RNLA 3LXRA 1AQUA 2C8VA 1IY1A 4LF8C 3CX7A 4Q1AA 4TZ6A 3PENA 2DFNA 4NYIR 1P9RA 2OHFA 1EWRA 2A3RA 3CKLA 1A4RA 3T1VA 4ZDKA 1OH6A 1XTKA 4NCNA 4US0R 3HP1A 2FDCA 4DHEA 1ZD9A 1Z2CA 4XSHA 4BFVA 3IIMA 1J5EC 4J0QA 4RD0A 1M7BA 1SQ5A 1R0XA 4B3GA 1FUUA 2QPOA 2RHDA 2NO7A 3BOSA 1BH2A 2IS4A 4P3YA 1ZAKA 5TVKA 4GZLA 3P26A 4RCYA 2ZSBA 3QF4A 2EYQA 2GILA 1KJYA 1HE1C 2YVUA 4XWKA 1TUEA 2QT0A 4URWR 1RRPA 1J7KA 3AF5A 3LD9A 3MWJA 3TSZA 3DL0A 4ASUD 3SNHA 1FX0B 1ZU4A 2PEYA 3LAWA 1XEXA 5D3QA 3W90A 2J0SA 3PUYA 1R10A 1P2TA 4B34A 3LLMA 4B73A 1P75A 4W5HA 3RHFA 3C14C 3ZQ6A 1G16A 2CCJA 2QENA 2ZJOA 4P32A 4EDHA 4A6XA 2IEYA 4M8NE 3PXGA 2EFDB 4M21A 4MDFA 3SJZA 2BEJA 2NO1A 2BKEA 2WWHA 4CW7A 1E2IA 2BBOA 3K53A 1EX7A 5BQ5A 3IIJA 2ONJA 1T3SA 3GD7A 4CVNA 1CRPA 2ZI3A 1VHTA 5BYKA 2XOKD 4C0BA 5KSPA 3W8NA 4BRWA 3DPUA 4CZ2A 4RD1A 4AG6A 4JVSB 1SXJA 1PV4A 1XU4A 4DV3C 2BCJQ 1GNPA 3N2IA 1CR0A 1KGDA 4OYHA 3BC1A 2ZVQX 1GRNA 1I4DD 2JEOA 1KOFA 4CF7A 1CJUC 4M53A 1D5CA 1KDRA 2FEOA 1ZUIA 3QBTA 4JL6A 5EE0A 4DSNA 4ZDIA 1ZRHA 4DSOA 1RYFA 1ZM7A 4D0LB 5CB8A 5F2EA 1W2GA 3TVDA 3ZYCA 4Q18A 5M04A 4TSFD 2YOFA 2NG1A 2YV5A 4ZKDA 2Q3MA 4LC1A 5EJEA 1ZM9A 1JPJA 2PT7G 3TJZA 5E7MA 1MRSA 2WTUA 3ETLA 1K5DA 4KBFA 1H65A 1RC8A 2V7QA 4FN5A 5JCPA 4LF7C 1XEWY 1SKQA 2AR7A 3OIUA 4RZ2A 4YQFA 3NDPA 1P60A 1Q20A 2BC9A 3KJGA 4JLJA 2CL0X 1F5NA 3SZRA 3UATA 4YMVA 4MGYR 3EWSA 4AI6A 4BLQA 2WJJA 1C4OA 3FVQA 4W5WA 4OKSA 4DCSA 3QXCA 1OXVA 5LMNC 1YR7A 2C2HA 1JXOA 2WJIA 3FE2A 4LYHA 4DIDA 5CLLA 4E09A 4IFBA 1UBGA 1YZTA 1FUKA 2GJ9A 2UVQA 4FCWA 2D2EA 1XMIA 1E0JA 2R65A 4H1UA 4LJAA 4D4KA 5KDOA 4JVMA 3MWLA 1E6CA 5GVRA 3QF4B 2R6GA 2UXDC 521PA 4D26A 3A58B 1MT0A 2IL1A 2J1LA 2ZAMA 2L0XA 1QG2A 3GLGA 3KZ1E 2F4VC 2AL7A 2BM1A 1K6MA 4NBSA 1ZIOA 2WIBA 4HEJA 4IRUB 3KTAA 1NMXA 3KQHA 2I4IA 1PZNA 3GLFE 1XEXB 5CYOA 1N5IA 2FZ4A 3OESA 1ZNXA 4NZYA 1IN7A 2IS6A 5LB2A 5GVSA 1YVDA 1XMJA 3CPJB 5DN6D 2BCGY 4F38A 2CY1A 2RGDA 3KQKA 1DAIA 3MSXA 1DAFA 3QKSA 5IHPA 4P4TA 1HQYE 2Q0HA 2FV8A 1GNQA 2J0UA 2KZFA 4D81A 2PCJA 3CNLA 1JXMA 2A30A 2F43A 4LC0A 1G5RA 5CK4A 3RVBA 2FMXA 2E1RA 1P9WA 1R8QA 4FCVA 4LV5B 5BN3A 3AP2A 3TH5A 5JJIA 5D3MA 2PJRA 1SXJB 4TL6A 3AV0B 3A1SA 3BD9A 1VCOA 3NBFA 4QKQA 3I61A 1R0WA 1G19A 1I4TD 4M1TA 1IY0A 1O87A 1HQCA 4A4DA 1G5PA 2D62A 5B64A 1G8GA 3T1YC 1G4AE 1K8RA 621PA 2B6HA 4ZDWA 1Q3TA 4CIDA 1NBME 3OE7D 4JLVA 1D9ZA 2ZRNA 2EU8A 1GDDA 4RZ3A 2BMJA 1U8AA 2NPIA 4JVNA 1HNWC 2QP9X 1P61B 4D6PA 2A5JA 4PX9A 5FOSA 5AJXA 2JIZA 4RSGA 5J40A 3N2EA 1N6KA 2N46A 2ZJYA 2VSOA 5EE3A 3RRYA 2VEDA 1E99A 3B9QA 4BWYA 2ZRPA 3JZAA 1QHYA 1NN5A 3ASYA 2XZLA 5B30A 1OXSC 2BBTA 2DWOA 3FDIA 3A1UA 4M22A 4D25A 1FFHA 1W2HA 2BDTA 1ZM3A 3W5IA 2FX3A 2RGBA 4BZXA 2ODBA 2W58A 4JI8C 3T34A 3L43A 3GPLA 3TBKA 2DFTA 3RAPR 3OEED 4XOIA 5L3SA 2G3YA 4TLEA 1CTQA 3K70C 5HR5A 1XRJA 3GLGB 1TF2A 4JI4C 4DKXA 4HDCA 3TE6A 4GNKA 5CLQA 2JJ1A 3QXHA 4JT2A 2PCLA 3QBVA 2O8BA 1VIYA 3KTAB 3Q9LA 2V1XA 2WWIA 4TQ9A 3SDZA 5B58C 1W5TA 4DLZA 5DYIA 4IFEA 1U8ZA 1EFRD 3HPQA 2PT7A 4DEYA 5CB6A 1Q57A 1KI2A 1Z0FA 2ZPTX 2ONKA 1NLYA 5FUVA 2EWWA 4ZDJA 1GM5A 1W0KD 3LX8A 1J99A 4QL3A 2QG6A
chains in the Genus database with same CATH superfamily
3PQDA 1L6RA 2VK8A 4Q47A 4TKZA 1XOIA 1GL7A 2ZJAA 2HHHB 2PBRA 4L0QA 1KEUA 5AESA 1PZHA 1R0RE 2TRSB 3AUYA 4TUYF 2ZR7A 3AZQA 1OFIA 3OE5A 5IBRA 4XZ3A 4EB6B 1N33B 3ZOZA 4B33A 2E4WA 2FQ1A 4JYAB 5U9CA 5BN3B 2VAWA 3LC2O 2Z6UA 5EZ6B 2Q4OA 3T7AA 4EPXA 4TRRA 2XF8A 1KSJA 5CEJA 4I6GA 4QO7A 2WA2A 1PG0A 5D86A 5ERYA 4LSMA 1LLCA 2CXPA 1XLUA 1XWIA 2XADA 1HNXC 1NXWA 4EB0A 1PR2A 1OXMA 1NZDA 2JFPA 5EY5B 1IVSA 2HL6A 3DEAA 4PUHA 2IEBA 3HB5X 1H85A 1C80A 1ZIDA 4NY1A 1XZGA 3RFTA 1VLAA 2UXBB 2ZSJA 3MWKA 1BCRB 3BWBA 1DO8A 1P19A 4GGOA 3SR0A 4OQLA 1K97A 3W6OA 1OLSB 4Q34A 5DLYA 1H4VB 1M2KA 1KR2A 5TMEA 1NAIA 3BRSA 3LUFA 1WY5A 1Y37A 4OGGA 4Q6BA 3KKNA 3VOSA 1FYDA 3JVVA 1OLUA 1OT5A 4KNWA 1M1NA 3T3EA 3UQYS 2GCOA 3OM8A 4JH0A 1DUVG 5FHRA 5BW5A 5LC1A 1JI0A 1LF0A 3U44A 3DZBA 1A1VA 2QVGA 1ECBA 3SN6A 5JTTA 5JCOA 5AQ1A 2PS9A 3I6BA 5E6SA 4Q4AA 4XLTA 4Z2YA 1ZR4A 2ZGVA 1RTKA 1UFKA 1VE9A 2OUKA 5HYVA 2YJTD 1OF1A 1XNQC 3JATB 5CD9A 3CT6A 2POCA 4JS0A 1ZJ5A 3D7RA 4OGLA 2Z3WA 4QULA 1JFVA 4H7DA 1K86A 4EL5A 1AA9A 1FVOA 3GLHE 4OI2A 2BTQA 1KDVA 3PEVA 1FY2A 1ZXLA 1HPLA 4CHTA 2ZYVX 2VXYA 4KW7A 2ZRIA 2VUSA 1NY5A 3WICA 4YMUA 3M7IA 4BLTA 5A5EA 2R4TA 1JG3A 1G59A 4L7QA 4CF3A 3LXUX 3Q0IA 4EGJA 3V4OA 2SKCA 2OBMA 3NRJA 4LOKA 1AT1A 1N3IA 2OK8A 3EZ7A 3G2NA 1C0EA 1QV6A 1ZNWA 2VH1A 1FUYB 2JGJA 2MR6A 5LDGA 5LNK1 2ZIAA 2HQRA 3ESCA 5BYBA 4H27A 5A04A 1EG7A 5PGMA 3RC3A 5JAIA 4OP1A 3USCS 2YNMA 1YU6A 3OPYI 1N1GA 1ONPA 2DPGA 3ED1A 3HY4A 4TWBA 5BSHA 5JS1A 1K8YB 1CD5A 1ZUNB 4WZBB 1J70A 1EJ0A 1JLRA 2EP7A 3QKUA 5IX8A 3ELWA 7REQB 1G4HA 2CNWD 1WEHA 3FYTA 5IEJA 4XW2A 1NTOA 3D4IA 4BLPA 4EJ2A 4QO8A 3MBOA 4EX6A 2VNIA 3HR4A 3R3ZA 4ADSG 1MR3F 2G76A 5A1GA 5BUCA 4WS9A 2PKWA 5CIWA 3O9VA 4WFJA 5UKDA 2BGIA 1NRWA 2XSZD 2XVXA 3B12A 4MIKA 1AF4A 1WVIA 4F6RA 2VJNA 1AU9A 2QSZA 1JSXA 4Q66C 3QYAA 1SIWA 3DUFA 2IXTA 5DBEX 1YFZA 3B48A 4WOPA 5B4VA 3D3WB 1G20A 2JLWA 5A6VA 1ZEMA 4IZHA 1Z5NA 1FTGA 2PGNA 5KWJA 1QTRA 1XCOA 1A2BA 4LX0A 1CY1A 1ODLA 2HWUA 2IPMA 1KJIA 2NUAA 3F3YA 3IDAA 2FFQA 4RDHA 5JQGA 4TKLA 2Z4RA 2I8LA 1GTZA 1QWOA 3PLNA 4DV6C 2E1PA 1IEQA 2OLJA 2EW8A 1T4MA 3ETDA 5FR1A 3RTAA 4BBJA 3D4NA 2ZBGA 3FAKA 5JJKA 3GZTB 4JZYA 1QE5A 4NNPA 2O8FB 3ENVA 1RYHA 3OC6A 3RYHA 2C5FA 1Z4IA 1VP3A 2GZMA 4MR8B 3MERA 2V98A 3NORA 3M4ZA 2I54A 4CMBA 1V26A 4KQEA 2BMEA 1XF9A 2QTVB 4LJKA 1ICEA 4DCOA 2C0PA 3NGMA 4LYEA 4PLVA 3SZ3A 3BRQA 2VP0A 1DBSA 2O2IA 2WFLB 4LF4B 3THXB 1DAOA 4FLEA 4FFRA 1YRQA 1GVHA 2JIQA 3SQXA 4IJVA 4OK5A 4H0NA 1IBRA 5JSQA 3WQBA 4OJMX 3B70A 4AF6A 3V7UA 3IJPA 2OCLA 4QECA 1ZGGA 4GI2A 2RHRA 4NBUA 4TSFA 1EX1A 4WCFB 3FPBA 3VR5A 3IILA 4NBVA 2WE8A 4DLZA 2IZ1A 1QV9A 2OAQ1 5F2KA 4B09A 1VXOA 3LL4A 1GVNB 1PNTA 2WTBA 4F6LA 5ITZA 1ACJA 2E49A 1JHRA 3M5WA 1UJ2A 1ZMTA 2MDTA 2R8BA 1H5QA 5DCLA 4E31A 4QG7A 4EUEA 4OHKA 3ROKA 4ZJZA 3QEMB 5GZ1A 1O4WA 3B82A 2I4RA 4DDTA 2ZSDA 5MHTA 2Z9CA 1WXHA 2Z5LA 3U7EB 2CLCX 1JR3A 2GD6A 3KAPA 1JDJA 4P3PA 1AQNA 2V8OA 2ZIUB 4N40A 2EW1A 3ER6A 4FX2A 4F2DA 4IOJA 4B2IA 1GFZA 1RKQA 3KKMA 1B2LA 4PCVA 2C3MA 3AYZB 1Z83A 4CMHA 4RK5A 4DR5B 4CM1A 5JDIA 5CDFE 5A9RA 3NHAA 4Y2HA 3T52A 1ODIA 1UUFA 2OBNA 2FYTA 4LHYA 3MWYW 2K7FA 5DI3B 1JHDA 1UPTA 2CD7A 3AERA 3AK4A 3D8UA 1AKVA 1VBFA 2KI5A 3HVHA 2P2MA 5CH5A 2Q3DA 3MAAC 1YB6A 3VPDA 3FSEA 1VC2A 4XX2A 2ZR0A 2W11A 4J2TA 5FBQB 1KYVA 2Q5IA 3S2ZA 4Z7JA 1C4XA 1Q1BA 2FW7A 4XUCA 5HTOA 3ESDA 4OG2A 2OY0A 3M6AA 1WAMA 1ZOPA 1IHDA 1EFPA 1EXVA 5DNDA 1HOTA 3AVTA 2G06A 3NBYC 1A7KA 4NOLA 1SIBE 4AMUA 1CV2A 4LFBB 4G5QA 4J4HA 4JASB 2HREA 1GZVA 2WIGA 4V0QA 2EFYA 5E4TA 1HYHA 3A8TA 1F9EA 2ZITA 4GBED 3T38A 2NT4A 3V2HA 4ENRA 2I4TA 4G5FA 3I45A 3KS9A 4HDSB 3ETOA 4M0UA 3UFXA 2PUTA 1E8MA 5IJ9A 1QRSA 1A9RA 1C9KA 5DFAA 3AY6A 3UX3A 3WP1B 2NVBA 3T99A 2HR1A 2HQSA 2ZU0C 3L8GA 4PICA 3L0OA 5FUYA 3CLTC 1TKRA 4LXIA 3D7MA 3OQNA 4K9OA 3FYUC 3O03A 1JECA 4Q9DA 1WCIB 4G5HA 4H1TA 1YHZA 4IIJB 4I55F 2J5KA 2PKYX 5JRZA 1I6LA 1T15A 2M5HA 3SMVA 5JYBA 3EFOB 2QSJA 4M83A 3BDVA 1MC5A 2J4DA 3Q3CA 4ZCSA 2IBSA 1IOLA 2ZLBA 5D5PA 5H9WA 5DM2A 4BMCA 4L5YA 1B00A 3FJ1A 4EPTA 1OKKD 4IGFA 3RV2A 3IHLA 4BMSA 4XD2A 3UJCA 2XNHA 4HSGA 5EKDA 3PUWA 2C7QA 2WWRA 2R2GA 1I30A 5LJIA 4A10A 5J43A 1DJPA 1ESCA 4J9VA 2XKAA 3ISJA 2W2OA 4G1VA 4QU5A 4CEIB 3IURA 2WF9A 1ZVQA 5GONB 1SXPA 1OZAA 1D7OA 1W30A 1JTVA 4KP7A 5E9AA 4B79A 1L0BA 1KFJB 2CDBA 5FOQA 5A4KA 5HF8A 2NZXA 5BVGB 1CJCA 1N34C 4YY3C 1NQOA 1ODFA 2CJPA 1R4ZA 2GJAA 2HFJA 3NPDA 2QV0A 2QN8A 1D2MA 3LFHA 4AJEA 3IP9A 3B8HA 1D6JA 3UIEA 4ZRDA 2H7CA 3M4JA 4RHEA 1DC6A 4NOKA 3C6QA 5KAMA 3DDOA 3CNOA 5KSZA 3PQ6A 5SV2A 3WV5A 2C3PA 4AUNA 1VECA 4EECA 3RLFA 3TLKA 3ETCA 4MUBA 2WOJA 3VHXB 1ZPDA 2EZ4A 3CVYA 1OFGA 1OT3A 4G26A 2X0JA 3JPYA 4RSMA 2AMYA 2B2NA 3PG5A 1FXUA 4RGYA 3A2LA 1GA4A 3JSAA 4RGQA 3KQNA 2VRCA 1AHIA 2ZYSA 1L4KA 2E5WA 2J67A 2CNNA 3UW1A 4OF4A 3RC2A 2NSLA 2XJ9A 4PE5B 1KAEA 3PEUA 4PRKA 4DF3A 2G71A 3UMJA 1OTHA 1R6VA 3AY3A 3PYLA 4HWKA 4KGZA 2DHRA 1DJQA 1NLZA 4LSZA 4V1CB 2OWEA 4DA9A 2NWQA 1MRZA 4RGBA 1RWNA 1NM5A 2VJKA 2VP2A 3S2FA 1ANKA 2GA9A 3TNYA 1EKXA 1ZINA 5ALXA 4NBKA 5EWMB 1U2PA 3RO7A 3N54B 2ISSD 4C01A 3PF8A 4UTVA 4JYZA 4AKHA 3W4JA 4PO1A 1NYRA 1UBUS 1VE1A 1Y3BE 4BMNA 5EJ7A 4E11A 3IT1A 4C88A 4NP6A 5IBQA 1W4BA 5KQGA 2IPLA 2ET6A 2KB0A 3F1LA 4QOSA 3TW6A 4DCJA 4S3MA 4Z51A 1EFRA 1C3XA 1YQWA 3WGZA 5A9SA 4ZCTA 4DGSA 5JVDF 1NVGA 4M9RA 4CG2A 2F1OA 5BQXA 2NVOA 1G66A 1PR6A 5J4HA 5ICFA 5CAEB 3WFIA 1GR1A 1YBHA 2PKEA 4X20B 1PWYE 1OPXA 3LHDA 4O2AA 4UMDA 2BFBB 1U5AA 3SC4A 4EG6A 3ZGZA 4JV5C 1CZHA 1T9GR 1Z0DA 3AEKB 4GYJA 4PYOA 4IX1A 4DMKA 4EA8A 4IGAA 2GAIA 5EC8A 1MENA 1WZNA 3DQPA 5CB0A 2DHCA 4D46A 2VYFA 4LQCA 1V5FA 2FFAA 4B82A 3VKGA 2PXAA 1TMOA 2PSJA 4IIXA 1YJ7A 3IBTA 3GL9A 4UOEA 1YK0A 1U2TA 2CLEB 1MLDA 3FNHA 3LO5A 4L75A 1DB3A 4YCNA 2W0SA 2C7OA 2VJLA 1SUDA 4L07A 5EHNA 2IXGA 5EIBC 1RWBA 2YJGA 4PR0A 4M6WA 2HPZA 1Z4JA 4IRMA 3PQFA 4G0NA 4OVKA 3T3GA 1WS6A 3R7BA 4EUHA 3FGZA 2BFEB 1TK9A 2ID8A 1TUIA 5FNVF 1HLFA 1IXZA 4GI7A 2PXXA 1YACA 2KQUA 2EFGA 2QRMA 3O4VA 2CBGA 4WECA 4DLWA 5KX5A 1TYEB 4W7SA 3P2EA 4X61A 4AQYC 1H23A 2QAGC 1ISRA 3EVZA 4K05A 3UUEA 1K4YA 2PR2A 3A1WA 3FB4A 2Z1DA 1TKBA 4LJ8A 2A5FA 4UHDA 2DQ4A 3H2HA 4MCHA 4BNFA 3DHEA 3CNBA 4ERXA 5JXWA 4RPJA 2GB4A 2W37A 3JY6A 1W88A 1VYVA 1MD9A 1E5DA 1HE4A 1O77A 1SU8A 1SB9A 2R4QA 2Q5FA 3EXHA 4KQIA 3O3MB 1X1QA 1QUEA 4XFKA 2H9YA 5BMVB 4AYWA 5KC8A 1M2HA 1T10A 3R40A 3ZHOA 2V5UA 5KYXB 3MC1A 2F55A 3F78A 3H0KA 1CB7A 5F9FA 1QQTA 3SF0A 2BFFA 3FZNA 2XUZA 5FL7D 3LUJA 3EG9B 2QT9A 3UOGA 1MPXA 3DBRB 3KLBA 2VPXA 3TZQA 4REOA 4NBTA 3Q8LA 1FMJA 1PUJA 2O7RA 1U11A 3WXMA 1G41A 2EJCA 5TC4A 1DV2A 1WQ1R 2Q5HA 2OM2A 3H11B 4A5SA 2YJNA 1NSYA 1TK2A 3CR3C 3I76A 4BVJA 3DP9A 2IE0A 4NX2A 3G88A 3B3JA 2ZSAA 3DKIA 4KFSA 3THYB 1MXAA 1UC4B 3W2IA 3CH5A 5CRIA 4ZT6A 2X0NA 3Q8MA 3DAHA 4KOAA 4PC6A 1J42A 3WLPA 1BMTA 4M2LA 3HSYA 1TXGA 4ZD6A 2Z8XA 3AESB 3OTWA 1BW9B 4JR0A 4PYMA 4YA6A 3RIYA 3ABSB 7GPBA 2XBMA 3T9DA 4HNSA 3BMOB 3UPUA 3TSOA 3R5JA 1OIVA 4TMFA 1JWBB 1RWWA 3TXAA 4FFBA 2EJBA 5GWXA 5BV8A 2H85A 3AB7A 2ETXA 3IIKA 4QWWA 4RVDA 3WNDA 1Z2AA 2D7DA 2O1SA 1G6Q1 2JHFA 3GCDA 3GRRA 4IY1A 4MB6A 1CZUA 1MO5A 1YKSA 3OEWA 4C2TA 3ZX5A 3V3KA 3NAQA 5F3RA 1N2IA 3A9RA 3H5AA 5E2AA 2PNJA 1J8YF 3LT1A 3GI1A 5IFIA 1C30A 3IELA 1FDTA 4GZ3A 2QN2A 1NW7A 2O9JA 5ALGA 4ZV7A 4MAMA 4P83A 1YF3A 2H07A 2D27A 3RU7A 2JLYA 3KUUA 2PFSA 1QONA 3G7SA 1T0IA 2YH2A 1DTSA 1BRMA 1X74A 4QBKA 3ZTTA 3OU7A 4XX1A 3IBCA 3GFVA 5JS8A 3TG8A 2A58A 1UBNA 4PC2A 4OP3A 1N2OA 1UM9B 2FDRA 4KR9A 4XA8A 3TLBA 4QJ5A 4I4LA 1II8B 2ZAIA 1B8OA 3ZIDA 4CDNA 1SC3A 3ND8A 2PKQO 1RQRA 4KXVA 1JJAA 3ZJ4A 1FTWA 4X66C 1I1NA 4X7RA 1NU6A 3C8MA 4BO0A 1B1AA 3IQEA 4JJ4A 3B1XA 1BVUA 5BOSA 1TOAA 2PGIA 3O31A 1LS6A 4G4GA 1XMQC 4OIMA 5C2JB 4MI6A 2ZXUA 2CGEA 4O4JA 2R8PA 3KAJA 2J9YB 1I6WA 5KQMA 1CEYA 1Q15A 3PC6A 3QMPA 3MYYA 3HY6A 5EA2A 1SVNA 2JIBA 3BTVA 3G6KA 2XRYA 2R66A 1QRUA 2C57A 3TKYA 2EFEB 1P0IA 2FP4B 2HPHA 3M49A 1XZMA 4LZZA 3RSFA 2IYVA 1NMYA 5FI5A 2XITA 1IYZA 4NU5A 4TQAA 1L8OA 2QLBA 5LWHA 4CLOA 2ZS8A 1EDDA 1GLNA 4JLSA 2YXDA 1ZD1A 4BNMA 1JA9A 4HDAA 4X24A 3ZQ4A 2OCBA 1V0JA 3N58A 4DG5A 2IWRA 1CUUA 1TVCA 2FHSA 2PH7A 2Y0DA 3I08A 3PPVA 1EHIA 3CIOA 1YQUA 1HY3A 1TGYA 3I9V1 4IICA 3MUEA 4UASA 2QGNA 3DWEX 1B23P 3W3ZB 1DFIA 4NDNA 5HKBA 2C77A 2WINI 1FC0A 3GUUA 3KBOA 1CQIA 4Y2RA 3FTPA 4DT1A 2GN2A 1W94A 2GAAA 2HRZA 4RSHA 2GASA 2OD2A 1EIWA 2YZ2A 4FHCA 1KO7A 2I7DA 1UIRA 3B6EA 1NR5A 1YFKA 4PTYA 3T1OA 3DP7A 2FFHA 4OB7A 4FOSA 1EGVB 4YJ2B 2XTZA 2R6FA 4UJ5A 5AKKA 3QVLA 5SZKB 5JXIA 2RMKA 1KSFX 3U7QA 3HYLA 3SJCA 1DT5A 2D2VA 2X8LA 5IZCA 5EXXA 1TM3E 2IOQA 4QTUB 3R5XA 1KYIA 4QTYA 4C04A 4CQMB 3DEHA 2EBUA 2XWSA 5B1HA 4Q00A 3OZDA 1VLVA 1PW7A 3FY4A 5HGJA 8ATCA 1KMMA 2MMCA 5GM1A 3S2EA 2UZ1B 2WWXA 4YLGA 4UBNA 4CQLA 5AJVB 1XYVA 4ITUA 4I81A 5IFLA 3AUJB 2H51A 2ZZMA 1V4BA 4AYXA 2G80A 4GPEA 1TEVA 1A71A 1W85B 2EHJA 2P40A 3PHJA 3TTSA 3GLUA 3P2YA 2LW7A 2N47A 4GP6A 5H16A 3PQEA 4YJKA 1A50B 3K1YA 4X1YB 1S4MA 4OJKA 1TT5A 4JGIA 4K2HA 2IA5A 3B7WA 3OCCA 4DB4A 4F56A 3R6GA 1ZH8A 2O14A 4N18A 4C06A 1QLJA 1L5ZA 2NVWA 4CIXA 2IH2A 4M0MA 5SZIA 3L06A 1S8AA 1EEHA 3V4ZA 5IUJC 1V60A 1Z68A 1XEWX 2BFMA 4HQFA 4EA7A 3TL6A 3BORA 3L0SA 1MX1A 4CCYA 2Q3LA 4B76A 3A1VA 1GAQA 1KKUA 2XTJA 1JN0A 4BGVA 1FFSA 1X86B 1NWHA 1YR9A 2VJPA 1TUBB 3KZKA 2X86A 2VJDA 1PYOA 3SICE 1Y89A 4HRXA 4J1SA 1T1IA 4V0NA 3A70A 4MWOA 1S2LA 4J2HA 5J2UA 1B8PA 2DQZA 2WSBA 3C1OA 4JMPA 4EYKA 1TW3A 4C29A 4HDKB 1VXRA 3MJHA 3ONWA 3OD1A 3ENQA 4Q9LA 1XXHE 5K0FA 2V1UA 1OFUA 1UKCA 4LWPA 2O8CB 3ZHTA 2PMDA 2WA1A 4GKVA 3B9BA 3R7WB 5IKPA 4WXRA 1FDSA 3PNPA 2WPDA 4CMGA 2II6A 4LGVA 3WGHA 5BXQC 3IEPA 4F5YA 2VP4A 1YGPA 1RQ2A 4UNQA 5FOXA 5TY0A 2P6RA 1QFMA 1WUHS 4YIHA 2A86A 3K92A 2IS2A 1Z15A 1Y9AA 5EZQA 1SBZA 4D26A 4JXKA 2X0DA 2ZB4A 6ADHA 1Z6PA 2JEZA 4X62B 3DL2A 3C3DA 3K1JA 2W8BA 5ALMA 4OSEA 2WP8J 4FD3A 3W3AA 1ODCA 2W6IA 4NDZA 2JANA 2ZIGA 1B73A 2ANBA 2ZIEA 1I14A 1VPVA 3IOMA 4P6VF 4Q4LA 5FR2A 2ZJ0A 3FTCA 3IJ5A 5FB3A 3VAZA 2VHVA 4ZVPA 3PNOA 1SKBA 4Q12A 2ZSHA 4NMWA 1WD7A 3RSQA 4F3YA 1BVRA 4D9GA 4EI7A 2WKWA 1BN7A 2CBZA 2CZGA 2HAEA 3EIEA 1XZDA 4H3KB 3FHLA 1QS0B 3FYDA 3MHPA 5JVDB 3SP1A 4ZV9A 1K68A 3PI6A 3LDUA 1M6VA 2EKQA 4HQKA 3S7ZA 2XKJE 3QHAA 4WNAB 4DMUB 1YZGA 1NNEA 4L8WB 1V1JA 4KBGA 4B3BA 2CHFA 1GG9A 2XZDA 4X1IA 3UBTA 4OHYA 5D5HA 3CKYA 4G2NA 1G42A 2XDWA 3ASVA 4CTJA 4XQCA 3D8TA 4WK2B 3N8DA 3GJXC 1T6NA 3I9KA 3OZFA 5KOHA 1I3LA 3EEIA 2G8LA 3CLUD 3OTIA 2O2XA 2IITA 4LOAA 1JEDA 2X2FA 1PV1A 2QJFA 4XIGS 1TTPB 3HCFA 1Y6ZA 2CNLA 4HLCA 2D7JA 4B3DA 4XH9B 4YXFA 2X40A 4JI1C 3ZR4B 1SOWA 1EINA 3PI7A 4Z8XA 3F7TA 1M1ZA 3GLFB 3IERA 4RK4A 5FNVB 4J16C 1GPAA 1U63A 5GJBA 4ZCPA 4NV1A 1HZZC 3DWIA 3AHDA 3H9GA 1R8JA 5DBGA 3ZK9A 3P7MA 4EELA 4PVDA 3WIOA 2GERA 2PUVA 3KOMA 4DJJA 4KWIA 5C32A 3NJ8A 4NCJA 4LZJA 2WHPB 5BP7A 3RFFA 2VSNA 4U4AA 2QF7A 1ADJA 1KK0A 1G8HA 4JR1A 1VSBA 3U31A 4IJWA 4B6FA 3H2IA 1US8B 3P20A 4REMA 4GW3A 1NT2A 3LKVA 3ZK8A 3UXMA 1AGXA 4NE7A 3QMVA 2D5LA 1PVDA 1WBDA 2H57A 2XV1A 4CG0A 3DV0A 4PC7A 1E1QA 1MOZA 1OYVA 1QAQA 2YBEA 4CKWA 1THGA 3DYBA 2FOXA 2PHZA 2ATCA 3OLYA 3I07A 4D0GA 4IDOA 3HZHA 3JALA 3LO8A 1NN3A 1P0CA 1ZSVA 2GM5A 4HVAA 4ZMRA 3I52A 1X7GA 2SHKA 4IGIA 4OX9Y 3C1TA 2C59A 2YDXA 2ZUDA 4QNMA 1Q0RA 2ZDGA 3KWJA 3LCMA 3OEHD 4S1TA 4ZT2A 2V5VA 3USES 5HUQA 1MHPA 3B89A 1Y7LA 3G5AA 2J59A 3ETGA 4UXJA 1MO3A 2AN5A 1FU7A 1V7ZA 2PXCA 3SXUA 5HIAA 5LZ9A 1EWQA 2CXCA 3TOZA 1GNTA 5CVTA 2CJWA 2HLDA 2OESA 1WD5A 1OSNA 2YZ7A 1TA4A 1UBKS 3SVLA 5J59A 5TNXA 3DMPA 4L5CA 1EFVB 3M82A 4YWHA 1H4TA 3EGXB 3U4GA 4L9SA 4MUHA 5KCMA 4J3NA 1TMGE 1MORA 1RM4A 2GBGA 1PJTA 3K20A 4RL4A 5ALUA 4OFZA 1DTEA 1RJFA 2F9FA 3WNBA 4LF9B 3OI7A 5TQJA 4FILA 1G5TA 3KJQA 2ZS9A 1L8LA 1VIAA 2QJOA 4N6OA 4PBRA 4E4TA 2A9QA 4TRMA 3DYVA 2WOOA 9MHTA 1HFKA 1K4KA 5FWXA 4PYIA 2I6TA 5JAHA 2Q2OA 4GVXA 4CMEC 3Q6NA 1ADFA 2NTNA 1MVNA 1P4SA 1VYTA 1GUBA 3IKMB 1GGVA 4L4XA 4D92A 2OBYA 4M87A 5DXFA 4DUGD 3R7FA 4IUYA 5FWAA 4IXDA 3QY0A 4N0EA 3VYRB 4UNRA 1E79D 5LD2B 6Q21A 4PIMA 3GT7A 1BVHA 1F6DA 2J0QA 3QV2A 8MHTA 2ZE7A 4YHHB 2HSJA 4AJ2A 1PK7A 3MCZA 1XJ5A 3QLUA 5HCUA 1ARZA 1FRNA 1XZJA 1USVA 2ZUCA 3P4XA 3QZUA 4BQFA 3VYSB 1JQLB 4HQ0A 1T26A 3WOVA 1YZVA 2Q5LA 3KUKA 3T06B 2Z1NA 3KLPX 4M89A 4P4LA 2I3BA 4OXIA 1L3CA 5FHQA 2VTBB 5IC4A 4YV7A 2JVKA 4AU1A 1BOOA 2BISA 2HQOA 2MT9A 2GEKA 2VH5R 3D6TB 3IUMA 5I7VA 5JHGB 4L8YA 5JJ5A 4KTTE 4OH1A 1J2EA 1L7RA 2AI2A 4DMMA 1QHHB 3CG4A 3WGLA 1KKLA 3F5SA 4NCAA 5CM8B 5BRAA 2UU9C 1Q7EA 4RKWA 2NXCA 2GESA 4PHFA 3LX6A 3A10A 3UN1A 5BSFA 4NCIA 4AJNA 1PCXA 3FCCA 3EC7A 4U7DA 5ALSA 4PO9A 5PNTA 1KVQA 3F47A 4YRFA 1JIKA 5A71A 1KGSA 2XGMA 3U37A 3VAAA 3ZDQA 4GR9A 1RWMA 3R76A 5DNEA 1V39A 1LA2A 3OHSX 3R3HA 5CIQA 4BNJA 5JV5A 4J0DA 4PZCA 4MV6A 5TARA 4L4ZA 4ALKA 1WZEA 4OLHA 2IC5A 2O23A 1HQDA 2C00A 2OO7A 3F97A 5GGXA 5JYEA 4RIEA 5KSYA 2DHDA 3OLVA 4GPD1 3VH1A 2H7XA 2EP8A 4A8JA 3DFMA 4FMDB 1R50A 3QE0A 1LBQA 2W00A 3FWKA 1WCJA 1J8FA 4MWCA 1J33A 2C29D 3MRSA 4V2IA 5F4BA 1EP2B 1MNQA 4Y2YA 5D3ZA 2CNKA 2XD9A 5ER9A 5TEVA 2LXNA 3H16A 5EP3A 3BL6A 1EM6A 2GZSA 3Q3EA 1HLGA 4KMRA 3FRJA 5AO9A 1AB6A 1RLOA 4WACA 2PUBA 1NW6A 1UWKA 4NJMA 4PLYA 3CF4G 1J23A 1JA0A 1VSTA 2ZJZA 3GGDA 1UBLS 3KXDA 3AINA 1DXOA 3GMTA 1BXZA 2BMAA 2PIAA 3HKCB 3NATA 3CZ9A 2Z2KA 3SXPA 1J0EA 1U7PA 2B36A 3KRTA 3PJDA 3T5CA 1J5XA 1D2HA 2LKCA 2M98A 4DSAA 1WNFA 4B6QA 4XWWA 1QO7A 1YD7A 1JA1A 3PC8C 2NN3C 5B58T 5K51A 9LDTA 2VK2A 1HNNA 1UMCB 4CKEB 3C15C 1YVEI 1IBKC 2PMCA 3HNPA 1QVRA 2BGNA 1I7DA 4BFYA 2QS9A 1YRBA 5FQNA 3DV2A 3TDKA 3OSZA 4AS2A 1T36A 4CPDA 3H8SA 3GLHB 5BO5A 1ETUA 3K9LA 4ZOCA 2XDQB 3UWSA 4J9UE 3AKEA 1RVDA 1UT8A 1CFJA 2G72A 1KMHA 3E3AA 4MQMA 5ICEA 4IDPA 2VA8A 3RVJA 1HRDA 3VZRA 4S1WA 3DNPA 3WR5A 3IPYA 4JI0B 2HQ1A 3FF1A 3MTDA 3ZXSA 1AKQA 3L01A 3LZDA 1SC1A 3AEKA 3QYFA 1CJKC 5HF6A 4C6HA 1CR1A 2XDYA 2PUEA 2GM4A 1SK8A 2H9AA 4D56A 3AU8A 5ALOA 4MRMB 2PLFA 3GN2A 1J2RA 3AOGA 4H59A 5EIFA 4A8PA 4DC0A 4K3UA 3REFA 4L8GA 3UXEA 5K0EA 2IGTA 2R48A 4ZOAA 4B0PA 3P9ZA 5ALKA 1HZJA 2P90A 4MKHA 4O08A 3O21A 5EJ2A 1QYCA 3ZS8A 1RI2A 2PZKA 4E5KA 4BNYA 5LCIA 4DXAA 4XJXA 1R2QA 4XASA 3HVKA 5DWQA 4NOJA 2ZE5A 5DPMA 1E7SA 3AGQA 4IMPA 5LN1A 2CL7X 4JZKA 4C3ZA 2P6PA 3LUPA 3S40A 1I5OA 2DP4E 1V1RB 3ANTA 4O3MA 5BY2A 3VYTB 5L7TA 1RQLA 3CWCA 4MVJP 3TYXA 3WA6A 3DOEA 3AC0A 3H5WA 4Z0NA 5C3MA 2ODNA 3KKLA 3Q8KA 1BNCA 1OBFO 1UC8A 1HL7A 2AQ8A 4RA9B 4CIWA 1AO0A 1V5IA 2GHQA 1V8DA 2IIBA 4LNAA 1QMGA 5IJXA 2P3LA 4D9NA 4M9SA 1M0WA 1HDXA 4LRWA 2F59A 1JPNA 3UUWA 3MELA 3FYHA 1EXDA 4HGYA 1U8EA 4BVLA 3BERA 1TLTA 4DLUA 2OCAA 4A5OA 4B45A 3GP5A 2W6QA 5BMVA 5IF3A 1RHJA 3ZVLA 2YHIB 4C2UA 3K9BA 4KEAA 1NW5A 3IC5A 3PXBA 4D9CA 1FZTA 3HLTA 2RBKA 4OFBA 1DKOA 2O0KA 3ZWBA 1L4FA 1L7VC 3THOA 5K8LA 3DLHA 2X77A 3EG9A 1ZN8A 3DTVA 3I9OA 3NC0C 3A7DA 2L2QA 4EBBA 3F6EX 3HO1A 4IEEA 1CUYA 2PGOA 1LDYA 1S1MA 3ZIAA 1JJ7A 2MSNA 2JW5A 1QFZA 3OWXA 1ZHOA 1D2AA 3SF8B 4B83A 4U63A 4D96A 4QFMA 4NJOA 5KYNA 1GFIA 2EATA 1Z5GA 2EKPA 3VKHA 1Q0PA 1JGTA 2D8AA 4ZIRB 3FZGA 1F60A 2B92A 5HEKA 4P80A 1UKEA 4RK0A 2REOA 3PGA1 3T8YA 2GAJA 4BFCA 3D7KA 3DBLB 4BOYA 4D5EA 3IEXA 3CXRA 4EFDA 1QQAA 4QEDA 1P74A 3FCAA 2ECPA 3UMBA 1DEOA 2OQRA 3LGXA 4U2DA 3KTFA 2P9TA 4WZAB 4KRGA 5AHKA 1SEPA 1N2CA 4OJYA 5JNWA 1E59A 1YCDA 3BXEA 2WSSD 3GRKA 1RKBA 1DRKA 2VEOA 4CKBA 3FSJX 1V35A 3K32A 4KWTA 4EGFA 3CTPA 1JFTA 2G0TA 2IHTA 1CLEA 4R0NA 4UEJA 3G0IA 1QKKA 3RS0A 4LDAA 3HU5A 4QYIB 1NJSA 4M1YA 2F48A 3UUFA 4AY2A 4O33A 3QFFA 2E82A 2IRWA 2Q45A 4YHBA 1HNZB 2UVDA 1V9LA 1VE5A 1YJAA 2PJZA 4CNBA 4D3FA 1DAPA 4G5RA 5CFRA 3EXIA 1PJLA 1X2EA 4G8BA 1E96A 1U2SA 3BL8A 2XNSA 3BSFA 4PGFA 1F9AA 2JAPA 5LP6C 2WV9A 2OORA 4I4TB 1XDSA 2OHJA 1NP7A 2VUIB 3S2GA 5L3QA 1PT5A 3W05A 1N5LA 4MRAA 4XIYA 3WWPA 5I7FA 2Z09A 2SKEA 1HUQA 3RYIA 3OAAD 3VPAA 5GINE 3TB6A 2RONA 5GJCA 2I6UA 3IVGA 3MRXA 1OAKA 4HAVA 4V0SA 4K03A 3AEYA 3WSTA 3K0SA 1LPNA 1JF8A 3U7GA 2VYVD 1DDOA 1UOPA 1PZGA 4RVCA 3W5DA 3IDQA 2ZUEA 5INTA 1ZH2A 5LU9A 5B2FA 4K0KB 4WFQA 2PT9A 4ZTUB 2Z8YA 3TMKA 2VP5A 5IKXA 2O5EA 4ECEA 1M6YA 3TO5A 4DS3A 4DEXA 1Y4SA 4V39A 3ORQA 3GP8A 4QSMA 3CONA 1CPYA 3IEUA 3I9NA 4AICA 5B4UA 3ZY4A 5J4LA 4NLLA 1YZQA 5BV1A 1UXGA 1N0HA 3O9ZA 4DR4C 1XJQA 3OX1A 4LEIA 4MS4B 4POAA 4BFTA 1G38A 1Z06A 3D6MA 1OXBB 3U3JA 5E3HA 4TLCA 1ZITA 5FLXA 2NZWA 5KVSA 1UXKA 4UUAA 1E2UA 3MUOA 4JC4A 1FP4A 3RS5A 1DQNA 1YE8A 1Y3HA 2JA1A 5J2UF 4R1MA 2WZDA 5BUQA 2Q27A 5F5XA 3FZQA 4ZU3A 2QZ4A 4G0UA 4YACA 4PFSA 3W1VA 1BGVA 1WKVA 3T4PA 4IDDA 4ZP1A 4WXPA 1SCAA 3KEFA 4FJ0A 4U0KA 2D1YA 2H1LA 4BQSA 3G5LA 1UOOA 4F3KA 5DBIA 1TO6A 2X58A 4EUNA 2IF2A 2ALJA 5T6BA 5CBKA 1ZLYA 2NU9A 4BQIA 2C03A 1PTJA 2Q1TA 2DM6A 3L0PA 5DNWA 3B1WA 3PL5A 5LCXA 2OFWA 2B8TA 3I4FA 3W8RA 5LZ2A 4Y6GB 4P3NA 5K85A 4ZO6A 2I1VB 1CUJA 4MVJG 3S2YA 3AY0A 3HXKA 2ZBPA 2OZLB 1E89A 3LY7A 4JBLA 1JLLA 4B47A 4XWGA 5EJ6A 3AHIA 4FZJA 4LE1A 5EP4A 3VU9B 2Y0EA 3KSAC 3PB3A 4ZEXA 2YN0A 3QK7A 3KK0A 3OJFA 1IXKA 4MQ6A 2ZJ7A 1XNRB 3UB4A 3ADKA 1S02A