2HJGA

The crystal structure of the b. subtilis yphc gtpase in complex with gdp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
434
structure length
400
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLDNNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The essential GTPase YphC displays a major domain rearrangement associated with nucleotide binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-binding protein engA
total genus 120
structure length 400
sequence length 434
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hjgA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA01
5B30A 3GLGB 2J0SA 4BFUA 4MGYR 3QSYA 3TUJC 2DHRA 4NONA 1YR6A 2AR7A 4DCVA 1TU4A 2GZHA 4YMVA 3FOZA 1G3MA 4LGMA 2IHBA 2FZLA 2ZRPA 3A1WA 4DC9A 2PJRA 1ODFA 2YVUA 2ZI6A 4D6PA 4RZXA 2HF8A 1XTJA 4JMPA 4RKFA 2X19A 4BQSA 1HNZC 1SVSA 2LKDA 2HF9A 4BZXA 1G5TA 2G0NA 2ZJ8A 4LBYA 1KI7A 4MRNA 1UKVY 3FHCB 3PCRB 3J81k 2QSYA 4L16A 3TSWA 1XTSA 2FZ4A 3IQWA 3T15A 3U3RA 3EA0A 1BMFA 5H68A 4LJAA 4A6PA 5CLLA 2QBYB 1II0A 3I32A 4V0OA 3PEUA 3AP3A 2A78A 2ERYA 2XJ9A 4QHTA 1P62B 2LCFA 2Q0HA 2JAQA 2XAUA 4DCTA 1B0UA 3RS4A 5DO9A 3FB4A 5FUXA 4TYQA 1JAHA 4ARZB 2FDCA 2BBOA 4BEJA 1R8QA 2CJWB 2GZDA 1XJ0A 2Q21A 3AVUA 1GAJA 1E4YA 3TH5A 1W1WA 3CH4B 1DVRA 4RZ3A 4Q1CA 5JECA 2JLQA 3F5FA 2ZM6C 1KNQA 2OFXA 5ANRB 2ATWA 2YCBA 2R6FA 4TMTA 2OFWA 2QSZA 4A0RA 1MR3F 2WV9A 3O47A 3Q5DA 2REBA 4PTLA 2ZSAA 2JDIA 5FI0B 4TLDA 2IXFA 4I4LA 4B74A 3VR1A 5CK4A 1Z83A 4ABYA 2C5LA 3ZIAD 2ZANA 1QG2A 3BGWA 4X8OA 5GJCA 4BFYA 5EXXA 4XWKA 2PMKA 2WBLC 3MUFA 3QPWA 3TW4A 2ZJ2A 3WNDA 1VHLA 2HT1A 4MKGA 4AYWA 1NMXA 3UK6A 1P61B 3ZD7A 2W00A 4J0QA 3H2YA 1BYUA 4JLJA 2ZJBA 4LYJA 5BXQC 1Y3AA 4B71A 4Q4JB 1Z29A 4X64C 1H8EA 2VL7A 4HZUA 2ZI7A 4A92A 1G7TA 2AFHE 4OQLA 5HE8A 1IN5A 4M0LA 4UJ3A 4JI1C 4BZPA 3NDPA 3BC1A 1AK2A 1Q3HA 1YZTA 1GNPA 4HAZA 1GRQA 5HKKA 4M1SA 3R9IA 4LV8B 4PANA 1KKGA 4QRHA 4RFVA 2ONJA 1QF9A 2VP0A 3QVUA 2BKEA 2QQ0A 4B2PA 1NVVQ 1CF4A 2Z43A 2IYWA 4AG5A 4FMDF 1XD2B 4A8JC 2W6IA 2ZRAA 3UKDA 3IIMA 4DKXA 4GFDA 1XMJA 3P20A 2ZRNA 4B2LA 5AJZA 4TN1A 2IWRA 3QY0A 2WTUA 1UBCA 4QBFA 3LV8A 2PZEA 4A2PA 2YNMA 1D2NA 2JLRA 5H8WA 1XFAA 1JNYA 1KHTA 4MRRA 4Q00A 1F6BA 2JIZD 3IIKA 4PSKA 3M1IA 5C46F 5EXSA 1YRAA 2J0UB 2YOHA 3RS7A 2XR1A 4NP6A 1CBUA 1T0HB 1VCMA 3B1VA 4FI3C 4YONB 2UKDA 3KTAA 2QE7D 2Q9AA 4GRAA 5IDVA 1KDRA 4B3RC 5KSYA 2ZI5A 2IYYA 5KOYA 1R0XA 3G82C 4LF8C 4KVAA 2FSIA 2I1VB 2IK8A 4LBWA 1T3HA 4HDQB 2J5XA 1VECA 3DEFA 4MUAA 2OCYC 1M7HA 1W4BA 2ZRIA 3B1XA 1Z0IA 3B9QA 5A5GA 5EE9A 5GADl 4PPNA 1DEKA 1E2GA 1KK3A 4CF7A 1US8B 4PXAA 2BKUA 1Z2CA 3NBYC 5GJVC 3PENA 4JS0A 3EPHA 1YRBA 4RD3A 1FL9A 4HB3A 4N0EA 4JI8C 3H1TA 4FMBB 2VP5A 3UMFA 3UMSA 4DHEA 1U9IC 5FH9A 2QP4A 4KBFA 2CXCA 3W9YA 3U7FB 4JLNA 1V5WA 1G20E 4BLOA 1O87A 3B1WA 3TAHA 3X1YA 1UBFA 3T12A 1KK2A 4JLDA 4C7OB 1OFUX 3BWDD 1KI2A 4I99A 3KQNA 4JI5C 1K5GA 2OBMA 2G88A 1E96A 4FCTA 3ND9A 3W90A 4Q03A 2DBYA 3JAMD 4URZR 4GMDA 1AZSC 3G5UA 1EFHA 3NEYA 3X1DA 3EIEA 2C77A 3TMKA 2ZJYA 4OQMA 1W2GA 2YJTD 4CT4B 4QGFA 5DYIA 5K8UA 4XSHA 821PA 3GJ4A 1HE1C 3VR6A 3QF4B 3EW9A 5TV2A 1CR4A 3OTOC 3F3YA 1TQDA 2GVDC 1M7GA 3LXRA 3D8BA 2B92A 4E5UA 2BV3A 3FFAA 1ZNWA 2GILA 1JR6A 1F2TA 2VSXA 2FJUA 4NYIR 4JYCA 4WOPA 5HCIA 5KDDA 1XMSA 2G1JA 4Y0AA 2D2FA 3D31A 5ELXA 4LCBA 4CIDA 1MOZA 5JS7A 5EP2A 1N0UA 1N33C 1J99A 1CS4C 1XDBA 1DARA 1MO4A 4N1AA 5FUYA 1K5DA 1NN5A 1YZNA 2FN4A 3SJCA 3JZMA 4AG6A 1E2PA 2IT1A 2NO9A 2Y8EA 3CO5A 3DL0A 2GRJA 2G1KA 2JJ1A 4ACAA 5GVSA 5JMTA 5KSPA 2FV8A 2IYLD 3BJIC 4B47A 3CWQA 4G0NA 4KI0A 2HYIC 1WRBA 4CEIB 4JV5C 2CK3A 2W6JA 2XNDA 4KJZA 1SVOA 3FMPB 4KU4A 1U90A 1ZM3A 4KYIB 1SXJA 1N6RA 4A8JA 2QMEA 1GP2A 1KMQA 4V03A 3MG9A 4HSEA 1X8LA 3SFZA 4JVLA 1T8UA 4EPXA 3HYTA 1MT0A 1Q1QA 1G9XA 1OXVA 1P72A 3EAQA 1GL7A 4MH0R 5EZ6B 3IO3A 2WSSA 1N5KA 1R0ZA 3OIWA 1T6NA 4LZZA 1Z0JA 3LQQA 1UBGA 1CU1A 2BEKA 1YR9A 3DDCA 3EIQA 4JJKA 2KI5A 3SI7A 3K0SA 1SKYB 2A3RA 3UANA 1TTTA 2F43B 4E07A 4F4JA 5AUPB 1SVIA 3AVXA 1ANKA 3R8FA 5FI1B 5C2JB 2UXCC 4LHWA 4YMTA 2H57A 4WZBE 3BFVA 1AS3A 3EX7C 4MDFA 1IONA 4IOJA 2WVJA 1IY2A 4IEIA 4IVQA 3KZ1E 2WKRA 2ZRMA 3FVQA 1NKSA 2P67A 4YDHB 1Z63A 2JLZA 2JASA 5F2EA 2VLIA 3AKYA 2IUUA 3CF0A 4AC9A 1IY0A 2ANBA 4JLVA 4B2IA 5JI3E 5LD2C 3UXMA 1KO1A 3GJ5A 3KKOA 5FTNA 3VU9B 5JWOA 3DMDA 4BASA 2WWGA 5JHHB 2ODBA 3FWYA 3QXXA 3P4XA 1W48A 3CPHA 4U7DA 3QBTA 5DHFA 4LJ5A 3PEVA 1P7CA 2F9LA 3CRW1 5CM9C 2N46A 4XVQA 1QVAA 4DDTA 1E1QD 3SBDA 5KYKA 3AGQA 4NE2A 3K9LA 3QI2A 2IUTA 4DR3C 4IXNA 4DT1A 3TR0A 1KO4A 4DVGA 3ZLJA 4F4CA 1NLYA 1RVDA 2WJJA 4MGZR 1GM5A 1GKUB 1KI1A 1W0JD 2YC2C 2ZREA 4E09A 4A8JB 5EQTA 4DSUA 4GL2A 4M1MA 1SVWA 4ILEA 4TQUS 1S96A 2CL6X 3RYTC 3TAUA 3TW8B 1QHHA 2YOFA 1BH2A 4RD4A 2DFLA 1ZD1A 2WZQA 4OQFA 1UDWA 2JLVA 3U44A 3KUCA 4JBYA 4AKGA 3IO5A 2QAGA 1GKYA 3MWJA 2ZROA 1NJFA 4M9SA 1XMQC 4RD6A 5DE3A 5FBWB 2YHSA 3CKLA 1E98A 4NTZA 1QHXA 2UUBC 4DV0C 2IA5A 2DPXA 3PUXA 5E7IA 3Q8XB 1KJWA 5DIFA 4IDHA 2F43A 4IOMA 1AGPA 1OJLA 5C18A 4YMWA 5EJEA 2RGNC 1GKIA 1D6JA 1W44A 4Q19A 3K9GA 2J46A 4B3TC 3FTQA 2BM1A 5D3MB 2G83A 3AUXA 4UXHA 1IN7A 2ZU6A 2WM9B 4OQNA 3ZQJA 1NBME 2IS6A 1G8PA 2WICA 2GWHA 2OSBA 4IDOA 3EZ7A 2ZE6A 1QZXA 1ZIOA 3L8YA 4G1UC 1J7KA 1UAAA 2WOOA 1X8KA 2DFTA 2NMVA 5EUQB 2RGXA 2O8DB 2EW1A 3SOPA 2GXSA 1DAEA 5F98A 2WPDA 3GJ8A 3RS2A 3QNUA 3SU8A 3O8RA 1USPA 1U94A 1ZM9A 3AVTA 3ECCA 2RGGA 1ZNXA 3RRYA 3T34A 3J81D 3BB4A 2C9CA 3OEHD 1UADA 3A37A 1FP7A 3BBPA 3FMOB 4WBSA 3KX2A 3SYNA 4LYHA 1WF3A 3MJRA 2P6NA 3PFIA 5BYKA 4JI0C 1ZNYA 1VG8A 2MMCA 4Q9JA 5JCPA 1LW7A 4TZ6A 4YC7A 4A4DA 4W5WA 4QL3A 3THXA 4C0LA 4QGHA 1TF7A 2H8KA 1YZGA 1VG0B 2EFGA 2PT7G 1Z2AA 1W4RA 3LXXA 3MJHA 1EFCA 1UKEA 2ORWA 4DDUA 3U6KA 4C0SA 3B78A 2OAQ1 3CW2A 4TLAA 3LW7A 1EFTA 2VRWA 1T9HA 3QXHA 1D2EA 4JL8A 5BR8C 4CW7A 4B3DA 5CK5A 2E7GA 2WJIA 2PH1A 1ZBDA 3NH6A 4BLTA 4MRSA 3KKQA 2J59A 1KAGA 1XJCA 4P4TA 2ZRCA 1TAGA 5E3HA 2A2ZA 3QG5A 4R7ZA 1DAIA 2XX3A 4DRZA 4YQFA 1IBKC 3UMRA 2WPDD 3SEAA 4DLRA 5AUOB 5F9HA 1M74A 4B3FX 4B6EA 2EWWA 5EE3A 1U8AA 4A36A 2ERXA 2J7KA 1N6PA 4RD2A 4PHTA 3AKEA 3W8RA 5L3QA 2E1RA 2RKOA 1GTVA 1S0UA 4M22A 4EQ6A 1RPZA 2O8CA 2FPKA 4HYYA 1CR2A 5JLJA 4JL6A 3SR0A 2QN6A 3A1UA 1QHIA 4MYHA 2DR3A 1MO5A 1UKYA 1X86B 4BEBA 4DR1C 2WJVA 4KO8A 4OK5A 4DSTA 2C78A 3OAAD 4TWZA 2REOA 1S9HA 4S35A 4NZYA 4ZV4A 3CZPA 4WAUA 3CX8A 3IHWA 4M1WA 5LMNC 3DMNA 1NI3A 3E5HA 1ZAKA 2ZR7A 3CNOA 4LOAA 2V1UA 2FSGA 2WWYA 3OAAA 1T0JB 3AH8A 3ZJYA 1GIAA 2GCOB 3NTUA 3K1JA 4D4LA 1KMHA 2FWRA 3UATA 4ZI2A 5DI3B 4D4MA 4PFSA 1XP8A 1IHUA 2BJWA 2YYZA 4LFBC 4BUJA 3WMGA 4BFWA 1FNMA 3GLFB 2ZM5A 3HWSA 2P0EA 3EXAA 4M2LA 1HQYE 4HEJA 2HV8A 5TB5A 1GVNB 4OHWA 2D06A 3D6TB 1BKDR 1WA5A 1K8RA 4RD1A 3I8XA 2HLDA 1RC8A 4LY6A 1OB5A 3A1SA 4HLUA 3U2QA 2E5LC 2QUZA 3CH5A 3VTKA 5JBQA 4TLCA 1YKSA 5JEDA 1KDOA 2NO1A 1IJEA 3IEVA 1NSFA 3B1ZA 3LLUA 1EK0A 4DWJA 2ZI9A 3GLHB 1JQJC 3NG1A 3TNFA 1CXZA 3P1JA 1H8ED 1O3YA 2HUPA 4MRVA 4URWR 3E1SA 1NN0A 4GSYA 5LD2B 1P3JA 3PUWA 1HV8A 1RJ9A 2BMEA 2QU8A 1N6HA 2NG1A 4LF6C 1TU3A 5CM8B 4DLUA 1NN1A 1XCMA 4DB4A 1AN0A 3TVTA 2LKCA 5CYOA 2E8FA 1E2MA 5AJYA 2ZRLA 3TKLA 4LK2A 1E2FA 4EKDA 4KLNA 1C4OA 3KKMA 3WYFA 3CM0A 2ZSEA 4PQYA 4B3SC 4P4UA 1DG1G 4MUBA 3DO6A 4PSAA 3M0EA 1II9A 4DR7C 2AD1A 2KSQA 2WWWA 3HYRA 3A8TA 3KQHA 4DV5C 2BHRA 1IM2A 2JDID 5DGXA 2RGCA 1FNNA 4LPSA 4YHHC 1WMSA 4P32A 3THYB 1FUKA 1NVXQ 5HZKA 1RRCA 3GJ3A 4O0MA 3WMFA 1VG1A 1K0RA 4Q1DA 4EJSC 5UKDA 4DCSA 3NIBA 3CX7A 421PA 3GLFA 1KO7A 4NCNA 4AY2A 1BMFD 2GEDA 1FMLA 2CK3D 2ZRBA 3B13B 5CITA 3PUZA 2I1QA 2AD5A 1R5BA 4M1YA 1Q1BA 3EARA 4DV1C 1RYFA 2VPPA 3CIOA 2V7QA 4C0KA 4C9BA 4B35A 4XH9B 1XNRC 5J5CA 3QVVA 3VR2A 121PA 1Z3IX 3VR3A 3VNUA 2QE7A 3C14C 2OAP1 4TMXA 4TSFA 5A4JA 4L9WA 3NH9A 4KCGA 4II7A 4JVMA 5TDHA 1TPZA 5L3SB 1N6NA 3AM1A 1TQ6A 3A4NA 1ZVQA 2QZ4A 1UPTA 1ZNZA 3GFOA 3NWJA 4UNPA 1NG9A 3AVWA 1E99A 2ZVPX 2ZRJA 2O8BB 3TJZA 2NO7A 2YWFA 1F2UB 3U4QB 1UEIA 4AK9A 3W6PA 4FMCF 3SE0A 5DN6A 2BBSA 1FP6A 2NTYC 1N5IA 4ZI3A 3SBEA 3U3MA 3K70D 1UF9A 4V0MA 2PT5A 4W5HA 4XTCS 3VKWA 1ZUHA 3BH6A 3ZVRA 3I07A 2JLYA 4KLZA 4O2LA 1ZM4A 4GNKA 3F0TA 4LJYA 2BM0A 1S1CA 3DVLA 2W58A 2W0SA 3MWYW 4PHFA 4Q4LA 5GVRA 5FPTA 3U7GA 2I4IA 4CRWB 3K9NA 4K0KC 4OHYA 2KBFA 3CWZA 3REFA 3Q72A 2FOLA 3RANA 4EDHA 4W7SA 3SZRA 4FD2A 1OYWA 1KI9A 2IYSA 4PHGA 1E9DA 1X8JA 1E9FA 3AP1A 3QEOA 1U99A 2GA8A 2FSHA 2EFCB 2V3CC 2NOAA 4G5OA 1PLLA 2BWJA 4C0QC 1HTWA 2PBRA 1CTQA 2P65A 2HYDA 2FFAA 3C5CA 1OH6A 4TT3D 4Q47A 4DV4C 4MRPA 3OE7A 3SHWA 4JI3C 3R8CA 1FUUA 1XCPA 2W83A 5J4KA 2WHXA 3T1VA 4I1SA 5HCNA 1XRJA 1L8QA 1NN3A 2D62A 4A0FA 3NC0C 1FQKA 3AVQA 4JLMA 4E22A 2GCPA 3N5CA 3TUZC 4DLSA 4DUYC 3K0FB 4EJSA 1X1RA 1G3RA 1R2QA 2P5TB 2WWFA 3DOEA 4LPKA 4LHZA 1G64A 4BLSA 1VPLA 2VSOA 1HEIA 4KFTA 3Q5EA 2AWOA 4W9MC 2IF2A 4UQOA 4A0HA 4KVGA 4TL8A 3RRNA 5B58C 2ZIAA 2UZ3A 4I1VA 5HTKA 2P5SA 1OH7A 2OCAA 2XNDD 3K53A 2W6JD 1KSGA 5BN4A 1G7RA 5FBLB 3ASZA 3B82A 5LDDC 5HE9A 1S3GA 4M9ZA 3LVQE 5HZHA 1KI6B 2OLKA 3VMFA 4CT5A 2PX0A 2E8EA 3V9PA 3C5HA 4HB2A 4BFZA 2CNWD 1Z6AA 5AWFC 3C15C 3MCAA 1P73A 2QA5A 2G9NA 2DY1A 3KJIA 1PV4A 2CCKA 1EXMA 3K09A 1N25A 4L4UA 4Q1BA 3T1QA 4HDOB 1R0WA 3KL4A 1E79A 1EWRA 1Z0AA 1OXUA 1T5IA 3AF2A 2ZVQX 3B2EA 3ZS8A 3UWKA 2ECKA 3QEJA 3U3OA 4M1KA 1AGRA 1V43A 1Z0FA 3FMIA 4URUR 3I8SA 3PUYA 2I3BA 1EWQA 1Z06A 2QGNA 5D3MA 1QBKC 2R6CA 3N2EA 2BCJQ 1QG4A 2HCJB 4NYIQ 2HCBA 2AHOA 2CJWA 3EZ6A 1VYUA 1JB1A 3AVOA 2OV2A 4HLQB 3K70B 3OFND 2P3SA 2ZS7A 3P26A 4XD7D 1SZPA 1ETUA 2QROA 3I5XA 2HT6A 1YJ5A 1CRQA 4JT4A 2EFHB 3LO5A 4S2EA 2V4ZA 3DPUA 3L43A 2WSMA 1RYHA 1USPB 1H8HD 3PIRA 5TXGA 4A2QA 2V8OA 1F2TB 5FL7A 4TL9A 2ZRDA 4B6FA 2JJ8A 2O8DA 4F7WA 4M9XA 3ND8A 4D80A 4GI7A 3W5JA 2UUAC 4LBVA 2GETA 3TVDA 3LAWA 5CIWA 2YV5A 4V0LA 2CLDX 6Q21A 3QG1A 3QPVA 3RS3A 5FBQB 4NHOA 2BC9A 3BH7A 3GLFE 1XTKA 3A6PC 3RC8A 3U3JA 2ZU0C 3B60A 2AKAB 5C4GB 1U8ZA 2Q3MA 2VIIA 3THXB 1AQUA 4QBHA 3QBVA 4BRUA 3UG6A 3TR5A 4TMWA 4B32A 4JBWA 3VHLB 1JXOA 1XBTA 4UNSA 5TARA 3DOFA 2KBEA 3I92A 4BRWA 3KQLA 2YWGA 2KB0A 1G1MA 1PA4A 3DHWC 2ZJ5A 5EE5B 4EFNA 3J80D 1DTSA 3X1WA 3EG5A 4QJ4A 4DLXA 4OKSA 4KITB 3ZD6A 3GFTA 3PEYA 1T8TA 3SFVA 1G5PA 1XEXA 4F38A 3KTAB 3RSOA 2OT3B 1NYEA 4DSOA 2G3YA 3GLHE 1ZP6A 3BRWD 2F1HA 3NDBB 3T61A 1Z28A 5FTJA 2XOKA 1QHSA 2OCPA 5FOVA 1JXMA 3CJEA 4OBEA 4BFXA 2GVZC 3HPQA 4UNNA 2ZAOA 3K0CA 2OZEA 1KSFX 4ZCMA 1SHZA 5JEEA 2O8BA 4CEJA 3GPLA 3L0IB 3K0EA 3X2SA 1R5OA 1SGWA 4JBXA 5F3WB 2GF9A 1NL3A 3WBJA 1T91A 2JGNA 4FIDA 1HA3A 1KTVA 1S3SA 1I2DA 2RHMA 1PLJA 1YE8A 2ZI3A 3H86A 4JKIA 3W34A 4US2R 3GLIB 4GMXA 1G17A 1NVWQ 2B8WA 1DOAA 3S1AA 3B7GA 2CCJA 4Y0VA 4X8HA 1MABB 3AV0B 1NG1A 1CP2A 2GJSA 3QOFA 2RGAA 3SHFA 4C0BA 3JVVA 1VYVA 4K46A 3T5GA 2PCLA 1ZRHA 3TQFA 4A15A 1XXHA 3I1FA 4Q7KA 1S1MA 2BMFA 2UU9C 2WIAA 3TBKA 1DS6A 1US8A 1NBMA 1Q22A 2W2XA 3C8UA 4G5GA 1Z22A 3GKUA 2QI9C 4Q4AB 2J3EA 1CEEA 4MKIA 2VSFA 4GKJC 1EX6A 2ODWA 3QPUA 3EWAA 4PC3A 3IDQA 2C2HA 3AGPA 1QHHB 2IUSA 1CJVC 1IJFA 3GMTA 3QF4A 1T3LA 1N0VC 3GLHA 3GJXC 2C95A 3FGNA 5DI9A 2NO6A 3VHXA 1UKZA 2OBNA 1RW4A 1D9ZA 2QG6A 1S8FA 5BW8A 2CLSA 1HY3A 3ZIAA 5K8LA 2ZETA 4BZQA 3AP2A 5EP4A 1Q1EA 2IL1A 721PA 4HAXA 2KJQA 2D7VA 4PR0A 2IHYA 5A0FA 5HPYB 1KZ7B 5SZIA 2GJKA 3W3ZB 1C1YA 1U98A 2Q3FA 4QBGB 5GJBA 3IEUA 1DAFA 1VKJA 2ZRKA 1YZKA 1G16A 1RRGA 2PEZA 2FF7A 2XZOA 4DR4C 4L9SA 4DIDA 3QKTA 1E2HA 1DG3A 4D2IA 1XPRA 4GP7A 3UWOA 1XEWX 1KYIA 5CB8A 2WWXA 4H1UA 4MH4A 1E2KA 1UKKA 5J4YA 4HAVA 1J2JA 2WJYA 3I3SR 4LJ4A 5FPKA 1EESA 3VQTA 2J45A 2PT7A 5FPSA 2CBZA 5B64A 1JECA 3AF5A 1FOEB 4X65C 2CHQA 5DISB 4YXWD 2ZRHA 4US0R 4H1VA 1W0KA 4PPFA 4U00A 4TTPA 1E1RD 1KAOA 2QTHA 2V1XA 4O2RA 4RD0A 3ASYA 1YU9A 1P2TA 3BORA 4P4SB 2ZUCA 4TLEA 4V0NA 4H9GA 4AIIA 3MWLA 4RFSA 3DZ8A 2XGJA 1GNQA 2GKSA 3BXZA 4LYAA 1Z6XA 1IY1A 1XPUA 2ZRGA 4DR2C 1SVKA 2IXEA 2FPMA 4WIAA 1TQ4A 1IXZA 4DDWA 3MGCA 3QKRB 4DCNA 3GEEA 5KSOA 4YY3C 2NQ2C 4WW0A 4WXPA 1Q1ZA 2FFQA 2MSDB 3AKCA 3NBFA 3QENA 5CYPA 2IBMA 3KJHA 5F9FA 3KFXA 3P27A 3DZDA 1KI8A 3MWKA 2R2AA 3T1YC 3EIHA 1QHYA 3RWOA 3THOA 3PV0A 5DNYB 1JJVA 4CEIA 1G21E 3M4YA 2QEQA 1NLZA 4BLRA 4LI0A 2HEIA 3WYGA 1SXJB 1KIMA 2UZIR 5AR1A 2A5JA 2GXQA 2OCBA 1UFQA 5CDFE 1P75A 4GOKA 5L3SA 2GHIA 4RZUA 5KUTA 5JI2E 4ZDWA 2C03A 4PO1A 2DWPA 4D81A 1U0LA 4Q1EA 4GOXA 3C7KA 4MTNA 5DSZA 5JCZA 1Z0DA 1SXJC 3ZYCA 3AF1A 4XWOA 4JI7C 3LX8A 1FJGC 1ZINA 3HU2A 5G41A 3CBQA 1SVLA 3FFBA 1DAHA 3EZ9A 4EQ6B 4R71A 3ZZ0A 2OBLA 1LTQA 2O8EA 2CL7X 4L5BA 1N32C 1VCOA 4TYNA 5DHAA 3FKSA 5KNBA 1Q20A 2ZTSA 1DELA 5JJIA 1XEWY 5G40A 4IVPA 1KKMA 4C0JA 2BOVA 3TK1A 3T1OA 2LWIA 1IN6A 2XOKD 2QPTA 3NVAA 2DB3A 2AL7A 1D2MA 1XU4A 2EWVA 2CNWA 3KFVA 4TYYA 4TZ0A 2VBCA 2IS1A 4AURA 5G3ZA 4NBSA 1VDZA 1E0SA 4Z51A 2H17A 2ZE8A 1HE8B 4NMMA 2OILA 5FR2A 3PXGA 3ADDA 4LF5C 5EXPA 1A1VA 3VU9A 2OFOA 1Q57A 3BFKA 4JI2C 5H70A 1ZIPA 3UIEA 1U8YA 4DUGD 4C2UA 5IT9D 5CIQA 1GDDA 3MMPA 4FCWA 1GNRA 1NMZA 2H7VA 4MYCA 5H1YA 4UNQA 2GEVA 2VP6A 3FMFA 2F55A 1T4GA 1LFDB 5L8VA 2ORIA 4RSGA 4PPGA 4A1FA 4OI4A 5FLXD 1LF5A 1VHTA 2O0JA 1E94E 1JR3D 1TADA 1N6OA 3QXCA 2WMNB 1XD9A 1KSHA 3PG5A 2ZS9A 3K0FA 4IDQA 5J40A 4EJSB 3V4RA 3QUSA 1EFUA 3KXKA 2VQEC 4ON9A 2ZPTX 4DCUA 3BE4A 2QQEA 2RMKA 4F4IA 3IHLA 3TRFA 2WJHA 1MRNA 1E9EA 3R7WB 3FE2A 1CJUC 4NOZA 3CNNA 4WVFA 1Q3TA 2MMGA 4BFSA 3BH0A 3LX5A 2HXSA 3WRYC 2UXDC 2IYUA 5KDOA 5GJWC 3A58B 3OE7D 3U61B 3I72A 4G5SA 4XVRA 2YWHA 3X1ZA 1NIPA 4KODA 5AJWA 3A1TA 1G6OA 2VF8A 2QMUA 4EPTA 2HDNB 2XXAB 1E3MA 2KWIA 5KNCA 1PUIA 3NKVA 4NXMC 2WAYA 3ADKA 1TL7C 1N5LA 1W7AA 2HXYA 2NGRA 5FBVB 4JYAC 4WZ6A 2FGKA 4D82A 5JJLA 2EYUA 4NYMQ 1GRNA 3S1AB 4X66C 4Q4HA 2OXCA 1GWNA 1M7BA 1TUEA 3LW8A 2WWHA 2BEJA 4KSBA 4URXR 2RGDA 1RRPA 3VR4A 5J47A 1M6NA 2FEMA 2W6ID 5JWHA 1SXJD 2VHUA 1Z8FA 3K0AA 2ZYWX 3KJEA 3TUIC 1P2UA 2A5YB 1NKTA 3A4MA 1OXTA 2GJ8A 2VHCA 1XF9A 2GAOA 4RJLA 2BJOA 4QHYA 4ZO4A 1SULA 4NCJA 4Z54A 2ZSDA 4DR5C 1OLOA 1VMAA 5E4FA 1NBMD 1YZQA 1NVUQ 5FOSA 4PC1A 4G01B 4A2WA 4IXMA 5KSZA 2XITA 3HR8A 1J8MF 4NCKA 1BO6A 3RRZA 3JZAA 4XJXA 5L3RA 1WDTA 4XIGS 2RCNA 4QNRA 2A9KA 2ZJZA 2OM2A 1G8HA 4TTQA 1NMYA 2IX3A 1RFLA 4TTRA 4G5QA 2ZE5A 4M4SA 2R44A 2CDNA 1OXSC 5SZJA 3CLVA 1R8SA 5L3VA 2DCUA 3HU1A 4B3BA 1OHHD 5EE0A 4EPVA 621PA 2CVFA 2DWQA 4Z1MA 2O8FB 3OIYA 5IHPA 2XZLA 2B8TA 1CJMA 2H16A 4LJ8A 3SDZA 1M8PA 4PAQA 1U0HC 1PZNA 1Z07A 1F48A 4MGKR 4QBIA 1YQTA 4ZKDA 2AK2A 3ZQ6A 1LS6A 2YZ2A 1BYIA 2H5EA 2E87A 1GL9B 1IN4A 2BMDA 4AYXA 1XD8A 4JLPA 1WE2A 2CEAA 2GESA 4DLTA 5IK2A 2IYXA 3TIFA 2J0UA 1A7JA 3B1YA 1KDTA 4MYTA 2PL3A 4LBZA 2FSFA 5KPDA 2Z4SA 2Z4RA 1KMHB 4R98A 4V0KA 3TGPA 2QP3A 4LC1A 2C98A 2ZXUA 2QP9X 1L4YA 2CL0X 4KHPC 2QTVB 1HR0C 2Q6TA 2C96A 4TT3A 4ZIRB 2L0XA 1VYTA 3QIAA 3OEED 5B57C 3KQUA 4CZ2A 4U02A 5DYGA 1L2FA 1LY1A 3A36A 4OYHA 1HUQA 2MSEB 4MDEA 4URYR 1P9RA 2RAPA 1TMKA 4BFTA 4QGGA 1PJRA 3CR7A 4ASUA 1AS2A 1XMIA 1LVGA 1T3SA 2F6RA 1M1YE 5JJKA 3SJZA 4B34A 4C0HA 2Z6VA 2CVHA 4LSGA 3QKRA 4LC0A 4B33A 2TMKA 4KFSA 1UBEA 5KDLA 1VG9B 4KV9A 1OH5A 2UXBC 4HZIA 3DM9B 2OUKA 4JI4C 4LJ9A 3EPJA 2GCOA 2CMKA 4Q9HA 1H8HA 2Z83A 3KQKA 4GZMA 2DFNA 1OT3A 1AIPA 4TQAA 1GRRA 4FXPA 1A5TA 2D4HA 1P2SA 2ZS8A 3VX3A 1NLFA 4Q48A 4KXFB 4K8OA 4JLAA 4IFBA 3OFNA 1E0AA 1KK0A 2F9MA 4XX2A 3VKGA 2XTZA 4DEYA 1W2HA 4FWTA 3AB3A 3IIJA 4DEXA 3THWB 2GBLC 1Q12A 1G7CA 1IBMC 1IBLC 3L2OB 5FFMA 4KYUA 4C0AC 1G291 2QTFA 1EGAA 1KNXA 3ADCA 3V00A 4NU0A 4NYJR 4LJ7A 4N3NA 1PVOA 4I1OA 1N3BA 3L0SA 4ZDIA 3WBKA 3GLIA 2FGJA 1E9RA 2QAJA 3PQCA 4AKEA 4GPTA 1NIJA 4KAXA 1GL6A 1BIFA 5JFGA 2YKGA 4DLZA 4PZYA 1XXHB 4HATA 2ONFA 3ETLA 1AA9A 3R20A 1JAIA 1I4DD 1G3QA 1NY5A 1R6BX 4DV3C 1YZUA 4IVRA 3LWNA 3Q3JB 5E95A 3RRMA 3VAAA 1GZSA 4K81B 3PVSA 5SZHB 1KI6A 3CRRA 2H18A 1W0JA 4P3YA 5JS8A 3OHMA 2SHKA 3PR1A 1KY3A 4F93B 1SQ5A 4MGIR 5FUWA 2BBTA 1UJ2A 2ATVA 3NBXX 3P4YA 1TX4B 4D0GA 3VNVA 2RH5A 2DYKA 2BVNA 4G5RA 4JLOA 4LX0A 4Z8XA 2FH5B 2Z0MA 3Q85A 2GJ9A 1VCIA 4LRWA 1HT2E 4UNRA 3KXLA 4CEHA 4PZZA 2CLCX 2V6JA 3AQ4A 4OJQA 2PEYA 1OPXA 4IFEA 3RSLA 4XVUA 5JHGB 2QL6A 4Q66C 2OE2A 2UUCC 4QJ5A 1L2TA 3RS5A 4FN5A 3LVRE 1KKLA 4EPRA 2ZYVX 2CCGA 4OJKA 4JI6C 1SKQA 5EUMA 1VIYA 2QRZA 2XB2A 1U0JA 5JRJA 3E2IA 1E9SA 4B76A 2RGBA 1J5EC 1MV5A 3L0PA 4DZZA 4A9AA 3ZVNA 2IEYA 1W49A 2JLXA 3GJ0A 1F5NA 1KOFA 1ONBA 1HNWC 4P31A 2FFHA 1Z08A 1X3SA 1JPNA 2IYQA 2QENA 4DB2A 1HH4A 1OXXK 4O3MA 4Q1FA 4OK3A 5AJVB 4YMUA 4P33A 3N70A 5DLQC 2XXAA 1Q0UA 2W2VA 1XMVA 5BWMA 2B21A 3CPJB 1XWIA 3VKHA 4JZKA 3B5JA 4C4PA 4DLWA 2QM8A 2IC5A 5FTLA 4ACBA 4HLCA 4DV6C 1WH9A 3TQCA 1FW6A 2Q9BA 2VP2A 2J87A 2R65A 5M04A 1HURA 3WNBA 1OFHA 2X1VA 3X1XA 3TSOA 1ZCAA 1OIWA 2QNRA 4M53A 1JEEA 2FG5A 1KDPA 2XEXA 1CR1A 1PUJA 2GNOA 2HLDD 1N36C 5E7MA 2X8AA 5SZKB 2JLSA 1OIXA 3WRXC 2EYQA 2HHHC 1P6XA 3K8YA 4WA7A 2P6RA 1JPJA 3U44B 1JJ7A 1XXHE 2IYRA 2QAGB 3OEHA 2EFEB 4NH0A 4DLYA 5CB6A 1II8A 1UEJA 4E03A 2J7PD 3EASA 5LB2A 1D8TA 4G3XA 1GG2A 1OSNA 2FE4A 4O25A 2QPAA 5D3QA 3WYAA 1XNQC 1XNJA 3GJ6A 3BB3A 3SS8A 4B3GA 5FUVA 4P0TA 1JALA 1IQPA 5IRCD 3FKSD 1CIPA 1Z6YA 1IOZA 3L82B 4LF7C 2NZ8A 3WP1B 1WBDA 3G0HA 1GILA 3HPRA 3SNHA 3LQRA 3GEHA 221PA 5JZVA 1FPMA 3AF3A 4TSFD 2GXAA 1NNEA 3IPXA 5DN6D 2C9OA 1G3UA 1Y63A 4FINA 1G19A 2E8CA 3FDIA 1A2KC 2O8EB 1CR0A 4XOIA 4YDSA 1E2EA 3B8HA 4MYUA 2VHQA 4OHVA 1COWA 4IRUB 3LH5A 2VO1A 1IXSB 2KE5A 1OH8A 1HNXC 1W46A 4M8NE 4NKRA 2A5GA 4LHVA 4AI6A 4AQYC 2XTMA 4N0DA 1IAQA 4HLUC 1GITA 1OV4A 1FTSA 1CKEA 1OYYA 2OPLA 1S4QA 1SHKA 1G8YA 2NPFA 1G7SA 2V7QD 3AF0A 2AWNA 3GP8A 3ICQB 3GQBA 3KXIA 2ASBA 4ZIRA 3OZXA 4QHSA 3GCGA 1G6HA 4MQBA 3L8ZA 2ODEA 3MD0A 1XMOC 2VP4A 4HZUB 3O8BA 3CONA 2VF7A 1JBKA 5J4LA 1VTKA 2F3TA 4FW9A 4XWAA 4QKQA 2H92A 2VQSA 2ZSFA 4OI0A 5LMUC 1MH1A 1OKKA 3EZFA 4JSYA 1J90A 4YXWA 3T5DA 2FNAA 4X8MA 4B75A 3RAPR 5K8TA 1KI4A 3NC1C 2E9SA 1TEVA 1R4AA 1TEXA 1G8FA 1XD2A 4GZLA 4HLDA 5FL3A 3QF7A 1JEDA 2XNSA 5EP1A 4JYBA 1ZUNB 3VR5A 2JLWA 3R7WA 3TSZA 4HUTA 5KPJA 4PAMA 1IBRA 1W4AA 1WP9A 1E9BA 1R10A 3H4MA 2WKPA 4AYTA 5J4HA 1TF5A 2X2FA 5IK2D 4RY2A 1OF1A 4QOSA 4JSTA 4BPBA 2A30A 2G77B 1LQLA 1MO3A 4KHZA 4XD7A 5FOXA 3RLFA 2YWEA 4EAQA 1WCV1 2YC4C 1E69A 3K0AB 2R8RA 1VIAA 1I4TD 4C30A 3ZH9B 2ANCA 2ZR0A 2O0KA 4Z1MD 4FMDB 2CHVA 5DI3A 4B43A 1XPOA 4LV6A 2ZJOA 4ZCLA 1N6KA 2ONKA 1ZJ6A 2AXNA 2XTNA 1E9CA 1VCNA 4PQRA 2CE7A 4IKEA 4MITA 5C4MA 1DAKA 4B3MC 3W8NA 1KSJA 5HKKD 1SXJE 2AXPA 2CE2X 4D4JA 4CGZA 4M1TA 4POAA 5EXTA 1NVVR 1FTNA 2R62A 1LS1A 1XZQA 1GOTA 1OB2A 1AKYA 3P32A 4HAUA 2WJGA 4KFRA 4KBGA 1FMJA 4TYWA 2OEPA 5KHOC 2VH5R 1FX0B 1ELOA 4BLQA 4CEHB 3BD9A 4EIWA 1LB1B 2QORA 3IPYA 3CUEF 1P5ZB 1NP6A 2VP9A 3KJGA 3CPEA 1CULC 3C41J 2V54A 2PLRA 3CRQA 5LB4A 3BS4A 4I81A 3WXMA 1HQCA 3WNCA 2IXGA 4JKYA 1DPFA 4AKHA 1NY6A 2OESA 3LBHA 4OL0A 1F3OA 2D74A 2FA9A 2DWOA 2ZE7A 3EA5A 4LHYA 3U3KA 2VEDA 3GFPA 3IQXA 3GD7A 5FOTA 3ZS9A 2O8FA 1MKYA 4NXNC 1W4CA 1WBBA 4TMZA 4YMSA 3I5YA 4URVR 2GCNA 1F60A 1Z5ZA 2EVWX 2WOJA 3LNCA 3CX6A 3LLMA 3KB1A 2GF0A 1D9XA 4ZKEA 1ZU5A 2AN9A 4R2HA 4WZAE 4HAYA 3FHOA 5KTYA 4B3CA 1C9KA 4HB0A 2J9RA 4IDNA 1NRJB 3BAFA 5FPYA 1E2LA 4EUNA 3SQWA 5EP3A 4LFAC 1OKKD 1OFIA 2DFKB 4Q9IA 3ZGXA 2BJVA 2JJ2A 5LPNA 1GSIA 4IHQA 1G5RA 4OI2A 4XTRA 4BECA 3VFDA 1JR3E 4CDGA 2REXB 3EPKA 4NDZA 4PPQA 2UVQA 1RZ3A 1XEFA 4Q4JA 1N0WA 1RJ9B 1E2JA 4Q4AA 1N6IA 4ASUD 5FR1A 4BE7B 4EFMA 1G41A 3GLIE 4CEJB 2PCJA 3AF4A 1GUAA 1HH2P 1FQJA 2OG2A 3LD9A 4DR6C 3T1TA 4KFUA 1E6CA 2QT1A 2QL8A 4DUZC 3WY9A 1OE0A 4GBMA 2IWHA 1EX7A 2OHFA 4MKHA 4CYMA 4HI0E 3SQXA 1DADA 1J70A 2PZGA 2W2TA 4RZ2A 3VX4A 2QY9A 2ZI4A 5G53C 1MABA 1R5NA 2HJGA 3ONWA 4PC2A 3CZQA 3NEJA 3HDTA 4Z8YA 3RDPA 1J8YF 4B48A 2F4VC 1R0YA 4TYPA 4ZDJA 2G0TA 4OHZA 3NHBA 3W6OA 3THYA 2ZUDA 3K9HA 1UM8A 3ICEA 1CJTC 1W5SA 3RS0A 3FKQA 2JJ1D 3RHFA 4FWIB 4UJ5A 3LY5A 1SKYE 3HP1A 5E7JA 1YR8A 1MO6A 2W0MA 2FMXA 1Q21A 1I4LD 2P6UA 3QKSA 4R2IA 2ZYTX 3BFXA 4ERNA 2F3RA 4W5JA 2QMHA 3GEIA 1OHHA 2J0VA 2OLJA 1QWIA 3AEZA 2F1RA 4GKKC 4Q1AA 3HJNA 4DXAA 2VA8A 2RGNA 4PX9A 1ESNA 4JLKA 4YLGA 2KZFA 3PUVA 3SJBA 4F91B 4JIMA 1DAGA 1E4VA 3QQ5A 1Q44A 1E0JA 1E2NA 1W36B 3D3QA 2OXRA 2Q9CA 1SVMA 4LUCA 3LA6A 3I62A 2D2EA 2FEOA 4QJ3A 2ATXA 3QXJA 4Q01A 4V0ME 1ZMXA 4P4SA 4RVCA 1CRPA 4PAOA 3T06B 4RCYA 1E2QA 5AUNB 1QVRA 2HJVA 1BOFA 1F2UA 4NCIA 3NXSA 4DBLC 1E79D 2GEUA 4Q21A 2C8VA 1S2MA 2ZQ5A 1ML8A 3ZDQA 2CHGA 3LBNA 4JLBA 2QBYA 1H65A 2YINC 2FU5C 4LF9C 3MAAC 2H1LA 5AJXA 3CR8A 3IUYA 2GK7A 2BDTA 2V9PA 1S9DA 2XJ4A 4OK6A 2J7PA 4ZDKA 3EC1A 4Q02A 1N34C 2NPIA 2IS4A 1E1RA 2PZFA 3LBIA 5HR5A 2D7DA 4TMVA 1W0KD 3BK7A 5FTKA 2QMOA 1KO8A 3K09C 1RRFA 2WWIA 5G3YA 5LBIA 1XX6A 1XJQA 2N1BA 3B85A 1U81A 3N2IA 3W5IA 4UKDA 1ZUIA 3CB4A 2QM7A 4AD8A 1VLAA 1LNZA 2ODNA 1E1QA 4HB4A 3SYLA 4ARZA 4IOLA 3IBYA 4D4KA 4NPHA 2PLFA 1P2VA 4PHHA 2B7BA 1HT1E 3TLXA 4DJTA 2GZAA 2O0HA 5JWRA 2A7QA 3CF6R 4JVNA 2EU8A 2PJZA 3DKVA 4TMKA 1W36D 1KZGB 1ZD8A 1ZYUA 2JJ2D 4UXIA 2O52A 3F8TA 4QM7A 5TVKA 5FPHA 2ZAMA 2ZR9A 1B23P 3JVUA 3MRSA 3PITA 4I1UA 4Q9KA 4AWXA 4BFVA 3WMEA 2J0QA 1N5JA 2R6DA 1DE0A 2F1JA 4IOKA 4JJZA 4OQXA 2C04A 4Q7JB 1DO0A 2GBLA 2ZUBA 3GLGE 4LHXA 1YZLA 4LV5B 1TQ2A 2NIPA 1G4UR 2B7CA 1A4RA 4DSNA 4QM6A 4ZPXA 2ZEJA 5KO2A 3T35A 4BWYA 2JCSA 3MSXA 4TLBA 5JRZA 3NBZC 2EFDB 2NO0A 1RKBA 4PO8A 3Q7QA 1P9WA 3OESA 4BSZA 1P60A 1HYQA 1TF2A 3K70C 1U9IA 2N42A 3B6EA 4PSVA 4KSCA 4C3ZA 1WB9A 2RHDA 5KNDA 1Z6GA 1UDXA 2AK3A 2V6IA 2ZITA 5JSZA 2XB4A 3H0KA 3U5ZB 4QC2A 4ITRC 2IS2A 4M1OA 5CJ2A 1NSTA 4B3XA 2BMJA 3ZZTA 3ADBA 1P4SA 4LJ6A 3U60B 1II8B 1IXRC 2IYTA 3IKJA 3C4JA 1OW3B 3KUDA 3MFYA 3EPLA 1ZW6A 2FPLA 5IF9A 1OIVA 3AF6A 1KGDA 1DAMA 1ESMA 2R6GA 2Z5FA 3FPAA 4B73A 3CNLA 3H84A 3I4LA 4M21A 5FOUA 1E2DA 2VHJA 5IWAC 3R9WA 5TY0A 5C1BA 4M9QA 5L3QB 4D25A 2F1IA 2JA1A 1ZM2A 2R6AA 3QKUA 1PLKA 1FFHA 3ZZUA 3EZ2A 3NHAA 3AVYA 4D0LB 4FMCB 4Q5IA 2G6BA 2VQFC 1GFIA 1KI3A 2EQBA 2ZRFA 2MSCB 4GDFA 4ESHA 4L8GA 4GOJA 3QE0A 1U2RA 3BOSA 2WAXA 1ZB9A 3ZVLA 4Q18A 1L7VC 4HUQB 1XZPA 2X2EA 3R9XA 5EE1A 3HU3A 1YVDA 3D7MA 2RB4A 4PC6A 4V02A 2BBWA 2P2LA 4DDVA 1YHNA 3DM5A 2WMOB 4A0GA 4QFMA 1N6LA 1KO5A 2A5DA 2GTPA 2VYFA 2QGZA 2OPLB 4A82A 4PZLA 2GJAA 4NL4H 2YOGA 2K5UA 5JSZB 3RABA 1DO2A 4JT2A 3UPUA 1LV7A 1XTIA 2XSZA 1NJGA 5B2ZA 4RCZA 2J1LA 2O5VA 2C9YA 1ZB8A 1KJZA 4JVSB 1AQYA 3OF5A 2PMDA 1XB2A 1BS1A 2ORVA 4Q4HB 4Q9LA 5P21A 3RNLA 3M6AA 4NCHA 4LYFA 4LF4C 4TL7A 1T5LA 2ZSBA 4TQ9A 4HDCA 4CVNA 4DUGA 3OEEA 1P9NA 2JLUA 3U7HB 3WP0A 1AS0A 1I94C 2B6HA 3KKPA 1R7RA 1AJEA 3E70C 2GXUA 3Q9LA 4U5XA 3BERA 4DIEA 3LDAA 5FOWA 1N2CE 1X1SA 4C7OA 1QHGA 2XSZD 4C2TA 1A82A 1AZTA 3OIUA 3RC3A 3KKNA 5FL7D 3FHTA 3TE6A 2OO7A 3FYHA 2A5FA 2IEZA 2FX3A 4GT1A 1KK1A 2Q3HA 3CRVA 3UG7A 1COWD 3O8DA 4DV7C 4IW3B 1ZD9A 4IDPA 1Z6TA 2ZYUX 2AFIE 1JOSA 1G18A 3QXSA 4D26A 1XEXB 5DH9A 4ESVA 3WHKA 3EC2A 5CLQA 3MLEA 4X8LA 5IT5A 4HUQA 5KU1A 3EERA 1Z47A 1A2BA 5AK0A 2GAAA 5BN3A 3QJYA 2IF0A 3GJ7A 2JEOA 2DYJA 2CXXA 1ZU4A 2JIZA 2XZPA 2D3WA 1E9AA 4A6XA 1W36C 2PX3A 3IGFA 4QG7A 1EG7A 4Q7LA 2GK6A 1DBSA 3SYKA 4EPYA 4F92B 1QHNA 4GP6A 3IILA 3LFUA 3EWSA 4TL6A 3SC3A 4LDJA 3LUSA 1E0KA 1QDEA 3U7EB 1I2MA 4EFLA 521PA 5CJPA 3I73A 1CJKC 4DV2C 1L4UA 1KJYA 3L0OA 4NYJQ 1TNDA 2IYVA 2V55B 4L15A 1KY2A 2EGTA 4BGDA 2QRNA 3AUYA 3AVVA 4IJMA 1FX0A 2R9VA 1N2FA 2VTKA 4EPWA 4DLVA 1AKEA 1LF0A 2VHTA 2WIBA 1JQLB 3AVPA 3OIVA 1NF3A 2X77A 4NYMR 1G8GA 1W47A 3RWMB 3REGA 1RE0A 4JL5A 3DKPA 4MKFA 3I61A 4FCVA 4OHXA 3THWA 3KB2A 2QAGC 2BIFA 3BIFA 5BN5A 1K6MA 3A4LA 5K8IA 4Q7MB 5A2QD 4B44A 3U4QA 4AKIA 1RIFA 2J41A 1G4AE 1YR7A 3C16C 3Q7PA 4LFCC 3GLGA 3RVBA 4QXAA 2QT0A 4PQFA 5BYJA 1XCGB 3HR7A 1FZQA 3LRPA 2WKQA 3AKDA 4IEEA 2CY1A 3O8CA 2C99A 1X6VA 1EFRD 2JATA 3ZVMA 5J4VA 4D0NA 1ZC4A 3CF2A 5TMPA 2F7SA 1WQ1R 5AUQA 2RGEA 4QNMA 4ZCIA 2NZJA 4PC7A 2PN2A 3B9PA 2JMPA 1ZC3A 2O8CB 2D7CA 1E32A 3A1VA 1EFRA 5CDFA 3SJAA 4WXRA 2BCGY 3W3AA 1M2OB 1M34E 1XTRA 1ZCBA 4OX9C 2ASEA 4UXJA 3V4FA 2AX4A 2WSSD 1AM4D 5BQ5A 1D5CA 1MRSA 5FBRB 1JR3A 5FTMA 4OI1A 4R9UC 4MA4A 8OHMA 3PJRA 4RKEA 2IW3A 5EZ5A 3K0CC 3W6NA 4DT1B 3T1HC 1E2IA 1CLUA 3KDSE 2GDJA 1JI0A 1ZM7A 1WXQA 3WHLA 4LWZA 2AKYA 3PEWA 1Z0KA 3QKSB 1XTQA 2FFBA 4HAWA 4XSGA 1W5TA 3U6BA 1TUIA 1IN8A 1OFTA 4US1R 3CRMA 4RFSB 2IYZA 2ZJAA 4QGAA 3SN6A 4BLPA 1G3IA 4X62C 2QPOA 3BB1A 3IBGA 4PO9A 1QRAA
chains in the Genus database with same CATH superfamily
1IG0A 4J4BA 3UHJA 5AKGA 4TMFA 5B30A 1ZUNA 3LZDA 4Z86A 1ZUWA 2DHRA 2IYOA 4NONA 3TUJC 1YR6A 2AR7A 3K94A 5TGTA 4D9EA 5HCNA 4Z49A 1YDEA 3VSEA 4YMVA 3Q0EA 4CKCB 3ZDCA 1VJ1A 2PJRA 5EESA 4EL5A 1ODFA 5AIAA 4L8VA 4HH1A 3N2GA 5IHXA 2ZTLA 2CLKB 1OX5A 2PX5A 1XTJA 4DCGA 3WKAA 4FP9A 4JMPA 1GCOA 4KEAA 2IYEA 3PS9A 4ND4A 5ED0A 5BOVA 2CJYA 4J8PA 3T94A 5TX7A 4RTPA 2GEBA 2HF9A 2G0NA 2ZJ8A 1AG9A 1KI7A 2H85A 4CKXA 3UW3A 1R4NB 1JB9A 1R9JA 1Z8NA 3HXTA 3QWFA 4QDTA 4XEUA 3TSWA 4B4DA 1M6EX 3RB8A 4XM1A 1BMFA 1Q91A 2XMQA 3FNIA 2BFFB 4LJAA 4AG3A 1QH8A 2HQBA 3OX2A 3HJBA 4YUXA 3I32A 4WRRA 4B6GA 5C52B 2QBYB 1TVKA 3COZA 1MUUA 3PEUA 5JISA 4XYGA 1B42A 4I9NA 3EN0A 2VRNA 2PUFA 2XA2A 2MHCA 2P9FA 1TA4A 2VF2A 3ZV4A 5IM4A 1B6GA 2GD6A 2YBEA 5AH0A 2C84A 3D3JA 4TTVA 5LOVF 3RVDA 3ISTA 3UOAB 1JR4A 3W5SA 5CURA 1EGHA 5JSQA 2FWJA 2GZDA 3ZDXB 3W5DA 2B5WA 2I1WA 3O3CA 1E3WB 3JQAD 1SOMA 2CEKA 1L4EA 4DIKA 3O21A 2JGIA 3TH5A 2B2NA 3ZHYA 4QUAA 1DVRA 2O3QA 4Q1CA 5JECA 1QS0A 2ZM6C 2VHEA 3S2GA 4HEA6 3O47A 1PEKE 1SUFA 1V39A 5KYNA 3JQ7A 4EGJA 3LRXA 5FI0B 3D59A 1R0BA 1SXHA 2VQEB 2F62A 1QYIA 1KFEB 2IXFA 4HBGA 4B74A 4PCLA 1CS0B 4F2GA 1NM5C 5LMCA 3CVJA 1OBHA 2C5LA 5KOJA 2EJWA 2NZ2A 3HCAA 3FUUA 3N8GA 3BGWA 4IJUA 1E3DA 1EFKA 1USKA 2Q07A 1TQ8A 3OKCA 4XWKA 4IF4A 1QRSA 4LYYA 5FADA 3QPWA 4Z4QA 3GDWA 1J0XO 4KNWA 1K7SN 1LLQA 3BK2A 4I8DA 3MB5A 4WLNA 4MKGA 4G9GA 3ZJ4A 2RIRA 3LDUA 1BRMA 4D02A 2X40A 3AONB 3H2YA 5LA6B 1Z5WA 3L7IA 1WCJA 4ZO9A 3STWA 5IANA 1VKHA 5AE3A 1I33A 1CRWG 4Q4JB 4UBLA 1R00A 1WUHS 4UUAA 4AMYA 1YCHA 2A35A 1C8KA 3MSCA 4JQZA 3SXUB 3MHTA 3T0FA 2QUBA 2WC1A 4A92A 3K8ZA 1VIMA 2YN4A 3LUGA 3WISA 1IN5A 4UJ3A 1YACA 3NDPA 1RJDA 2IVFA 3B51X 1Q3HA 2Q5JA 1GNPA 3L8GA 3B48A 4I6EA 4DWOA 4M1SA 5T4HA 4JUCA 3WLQA 4PANA 1KKGA 3KWMA 1AHHA 5HBRA 3UJ8A 4B7UA 3QVUA 4H7PA 4B2PA 3G8YA 4N3BA 1NVVQ 4I1YA 3H5OA 4IMIB 3OZCA 4M0PA 5F3DA 2B1GA 2YH2A 3NHMA 4K86A 4UOQA 1FBNA 1QVZA 3DJYA 4BWFB 4B6RA 2ZRAA 4YY3B 1FUEA 3HNPA 3I52A 4GFDA 2ZRNA 2NXNA 4QPDA 4XQ0A 2GM5A 5AJZA 1BCRB 2IWRA 2WTUA 1YGPA 1RLIA 4QTUB 4YUYA 1H42A 3R5TA 2PZEA 3HKCB 1T4BA 2YNMA 4TV9B 5TQ0B 1D2NA 1VSVA 3VPDA 4B87A 1XFAA 3GYBA 1AUPA 2KDNA 1JNYA 5BMOA 4CIAA 1Y4UA 2GAJA 4N0PA 2JIZD 1ORDA 1U1GA 2IXTA 1XRCA 3WLMA 1SG0A 4OXQA 1XF1A 1K88A 5CX1B 1KFCB 2RK6A 1IHXA 1CBUA 1VSUA 2X7XA 3T3DA 1Y7HA 1YZVA 1CUXA 3S1SA 2Q2NA 4GRAA 5IDVA 5JDIA 1PTJA 3H2SA 5KSYA 3VR2D 3BILA 2D0PB 3SZUA 2WNIA 1K6JA 3KYDA 1P4GA 1PDOA 3BVPA 4DMKA 5FX2A 2J5XA 1AK1A 1LDYA 2CVZA 2FPGA 2QTRA 2EAUA 3D7NA 5EIOA 5F78A 2PQ2A 2YV3A 2KX7A 3PQ5A 3AK4A 4BS9A 4EENA 4NS1A 3OPYI 5A5GA 2WU0A 1BDIA 2ZBQA 5EE9A 4D5EA 3I08A 1DEKA 1GQYA 2OHIA 1MX1A 1R9NA 1COZA 1G9SA 3DYIA 4GWLA 3NBYC 4YCSA 5KINB 1OZ0A 5MHTA 2FN7A 4YRQA 2B8NA 3SYMA 2ZFUA 5IVDA 4M1ZA 3BRQA 4NS4A 4JI8C 3ZUGA 2OWEA 3H1TA 4C29A 5I4CA 3JAMA 3OQIB 4FLMA 5DLYA 3PTZA 5KTPA 1I36A 4MEAA 4MPPA 3RHZA 2QTWB 3DT9A 4F5ZA 1XNHA 1RHJA 1GPMA 3UFXA 4PIVA 3U7FB 3RBXA 3ZCVA 5F2OA 3JV7A 4G07A 1JR2A 1WXDA 2BFNA 5KVAA 1OZGA 3TTXA 1PIWA 3THSA 1MAWA 1NAHA 2XWSA 4JLDA 4C7OB 1SJ9A 3KQNA 5FLKA 1NU6A 4ALLA 2GPTA 5DGCA 2Q50A 2JHFA 4L7QA 4Q03A 4BQIA 2BL4A 1T2AA 4YN3A 2JNWA 1I24A 2NX2A 5A62A 3LAXA 4WERA 4CNBA 1EFHA 3BE6A 1U0TA 3C6QA 3GFRA 5HEKA 2DHQA 1UT8A 3HFSA 2ZJYA 3KDAA 4C4TA 4G56A 4O1HA 2XDQA 5HZGA 3HXLA 3W5UA 3OMLA 1VMIA 4GGMX 5GGXA 5JG7A 1E3SA 1ONNA 1RJWA 1GG9A 4ND2A 1XHLA 3A9UA 1Q7BA 4L4XA 1Q17A 3QF4B 4OX9Y 1QF6A 1XYYA 2IZ6A 1CR4A 3F3YA 2P0AA 4HXFB 5AQEA 3AW9A 1M7GA 2N1MA 3L7JA 2XB6A 3LXRA 3LI2A 2HK9A 3WQRA 5JSFA 4UEJA 3TG8A 1ETHA 1DWPA 1Q7CA 2BV3A 3FFAA 5E3IA 1DRJA 4C5CA 1H4TA 1L3IA 4MV8A 4D5GA 4NJEA 3PHJA 2QB5A 4QFCA 3PX2A 1YRQA 4ARVA 1F2TA 1FDOA 4WOPA 4GYKA 4ALIA 1XMSA 4QEZA 1PEAA 1WMEA 4Y0AA 2LXNA 3V8BA 4PG6A 1ST3A 3WIEA 4IIJB 5ELXA 4RENA 1MHTA 3MFQA 4CIDA 5EP2A 5C7OO 4F0JA 1F38A 2QIPA 3L7CA 1L4FA 5H83A 1X7YA 1XQVA 2BKLA 2JVJA 5JPIA 3OBBA 1NN5A 1YZNA 2VYQA 4ISBA 4AF8A 2V7VA 3SJCA 3A3NA 3JZMA 2DERA 1PT7A 3CO5A 3DL0A 4DQDA 5JMTA 3UWMA 2PGIA 1JKIA 4LW8A 4YRBA 3WQQA 3TKAA 2HJHA 3TXXA 2Z6AA 3WIVA 2PSJA 4YCNA 4EO4A 4JV5C 2OPBA 2VZ9A 4IV5A 4KJZA 2VZ0A 3FMPB 2BGLA 2FPPB 3GEBA 4BKPA 1F6DA 3MLBA 3O1IC 4YA6A 2J0EA 1RQRA 1GP2A 2QMEA 4A8JA 3MG9A 4HSEA 4G81A 4BZWA 3AHIA 5ER6A 2O59A 1FFDA 2A58A 4H4DA 4AYXA 2WMDA 1F4VA 1T8UA 1Q1QA 2ACWA 2G63A 3EAQA 4KRGA 4EUEA 1FSGA 2H9IA 3QMWA 4QU0A 5F4BA 4BNTA 2BDUA 1ORTA 2WSSA 2ZIZA 1EGQA 5CLGA 4CL2A 3OIWA 2CNBA 3ZLVA 1TW3A 4IGIA 4ETIA 3NYRA 3GGDA 5CD9A 1A76A 1DQNA 2BEKA 1ZIXA 3LWBA 1YR9A 3NYWA 4JFRA 2VNSA 2O6LA 2SKEA 2AI2A 4G8JA 3VC2A 1XYVA 3OJOA 1ECBA 1SKYB 1TCVA 1F6WA 3EBOA 1RHQA 4RVGA 1T5OA 4BO7A 1QWSA 2I5PO 1P7YA 2AMYA 3HKEB 1ISJA 1JHAA 3OUZA 4YMTA 5I7RA 1EUYA 3LZCA 4WZBE 1AS3A 3A3OA 4DKJA 4MDFA 2OGTA 3Q10A 4AJ9A 2ES4A 4EEKA 1JMYA 4OV6B 3ZV6A 2P67A 3L49A 3Q1LA 4J91A 1N2CB 1J1IA 2JASA 4EQZA 1F06A 3GMIA 3AKYA 1N2XA 1G2IA 3CF0A 3IOCA 4AC9A 1IY0A 1WHSB 3E9RA 3LYAA 4YRCA 1M2OA 2FG7C 1EKXA 3GO4A 3ZLTA 5JI3E 1UL1X 1BCSB 5M7EA 2P9ZA 1NR1A 3UXMA 1JSCA 4HDAA 4NMHA 5FTNA 4CM7A 4BASA 2FRDC 1SKAA 3DUFA 4DM4A 3WDKA 2WWGA 5JHHB 3GNSA 4TLLB 2WZDA 3ZPXA 5AW9A 1X39A 3CVOA 4U7DA 3OO0A 4YEDA 4LJ5A 4FIZA 2F9LA 2WSIA 2ZIXB 4OOEA 4XLLA 5EOVA 1UUFA 2I6XA 3PKZA 5KYKA 4TZKA 4NE2A 3QI2A 2IUTA 2I0FA 4DR3C 4BNYA 4IXNA 1W2WB 3TR0A 3ZLJA 4BV9A 1X42A 1RVDA 1IU9A 4BIMA 4MGZR 4E33A 1KI1A 1W0JD 2YC2C 3ET5A 4MLZA 4KE7A 1WPGA 3WWOA 1KQ3A 4DSUA 4GL2A 1JDSA 2AFIB 4WNCA 3RYTC 2B6NA 1C9MA 3G8CA 4ZD6A 2VPWA 4RD4A 5H02A 5TPZA 3DGEC 4OQFA 5BVGA 2FWBA 3I9JA 4ZQCB 1M5UA 1E1CB 3ROTA 4B3MB 1P4HA 1V8FA 1UWKA 3IO5A 3MWJA 1NJFA 4RD6A 1XMQC 2C31A 2RHCA 5DE3A 3EDYA 5FBWB 5BSTA 3ILHA 4DV0C 2JFNA 5E7IA 3PUXA 3ESDA 3Q8XB 3NWPA 4Y2RA 4IDHA 1B8VA 4ND8B 1GAQA 2IHUA 4IOMA 1AGPA 2IPOA 4YMWA 2AYXA 5EJEA 1Y0BA 1GKIA 1D6JA 2IPNA 3I6IA 1C1DA 1PR4A 3PFCA 4Q19A 5ESDA 3VR3D 4B3TC 2NP6A 5KEIA 1YCGA 2G83A 3FDZA 2WM9B 3W5BA 1PZFA 3IH5A 3NHSA 1RI2A 2GWHA 2GAFA 2I99A 2DT8A 2X2OA 3L93A 2ZE6A 1JYEA 2AR0A 3S8EA 2DFTA 1PSDA 5EUQB 5KQSA 5I8ZA 3HTXA 4HDRB 3VYSB 2I2DA 3GJ8A 4A16A 3PRKE 1ZM9A 4LS3A 3ECCA 5ES4B 3NGXA 4RK5A 4JROA 3BB4A 5C34B 4AZ0B 3FMOB 4GMKA 3IRVA 3E2PA 3BM5A 5CZVA 3OQIA 3QV1A 3SYNA 4LYHA 1ZNYA 3DLPX 3E5MA 4Q9JA 4YC7A 2HMYB 4IWYA 3Q9SA 4LY9A 3BCUA 2CJFA 2V7XA 4P86A 3MS2A 4HF7A 4QL3A 3G8BA 1YZGA 5DEIA 2WLTA 3E9QA 4DQXA 4WASA 5A6SA 3TFWA 3FTDA 3ZHUA 4K6HA 1A2OA 1DKNA 3CCFA 3HZOA 1QLJA 2ZWVA 4HYTA 4C0SA 2M32A 1DTEA 1Y9AA 3P2YA 2YYYA 4TLAA 3CW2A 3GJRA 3JYPA 3OOWA 3TB4A 3ZY4A 1EFTA 4GL4A 4COKA 3QXHA 1D2EA 4G6ZA 1NXTA 5BR8C 3URMA 1YDHA 4UPDA 4M6WA 2MSLA 5FO1A 1BXRB 5KMGB 2IELA 3EGCA 2JLBA 4GI1A 3EYAA 3IUBA 4U6SA 1ZBDA 2G40A 1K3TA 2PUJA 2OV8A 4POOA 4R1LA 1PVVA 2AG6A 4HNHA 4LZAA 2FKAA 2Y1OA 1ZRNA 3IKTA 2H0RA 2HAEA 4R51A 1AGYA 3PF8A 1QCZA 4TTIA 4Y6LA 1M10A 3CVYA 3KLBA 2ZRCA 4ZHQF 5IWCA 2A2ZA 4R7ZA 3T7IA 3VPGA 4DRZA 3UMRA 2XUPA 2WPDD 2PKWA 2C4MA 2FPWA 3I83A 4K7JA 4HC4A 3H5LA 4B3FX 1RMQA 3ZGXA 1YS4A 3AUJB 3LSYA 4OMFG 1NNLA 4U2GA 2C61A 1N6PA 2GBGA 5TMDA 4RD2A 4ZVQA 2BI7A 4C7BA 2E1RA 2GHRA 1GTVA 1S0UA 2RKOA 4FGLA 5DVZA 3T9AA 2FPKA 4CUZA 5AXBA 4LF6B 3SR0A 4GI3A 4HH0A 4XIIA 1BXZA 5A05A 5B4TA 5T8TA 1QTNA 4R1PA 3MMXA 1X86B 4ODJA 4H4CA 4MV7A 3WRVA 4NBUA 4BEVA 2UU9B 1ZMBA 1WNTA 2I8AA 4HNAA 4YYEA 4INAA 3WWCA 2CFCA 2WINI 4GG1A 4NESA 4PUHA 1S9HA 4ZV4A 5I5GA 2ZUFA 2H1VA 1RQ7A 3KSUA 1JXQA 3QEMA 4M1WA 5LMNC 3DMNA 4CM6A 4GLFA 3E5HA 2VCYA 4L76A 1UOOA 3EF3A 3T95A 3K9FC 5ALXA 4YRMA 1MENA 5KOHB 4QRIA 1QMGA 2V1UA 3AH8A 3MJ4A 5AI8A 3ZJYA 1B8NA 1LLUA 1RXEA 4IFIA 4MVXA 2AW3A 2OM6A 3E15A 3PFBA 2LRHA 1XNRB 3LP5A 3H1FA 3BD7A 4QTYA 5IBCA 1IHUA 1ZJZA 2B20A 4P2BA 4BUJA 2EEPA 2HSGA 3GJSA 1BFKA 4HS4A 4BFWA 3MMZA 1JTFA 1JDPA 1NQTA 3HWSA 1SIUA 1ZONA 3TI7A 4HEJA 2HV8A 3LDFA 1Z36A 1GVNB 4MV6A 1EP2B 2GZSA 3EGDA 1WA5A 4TM7A 4UCQA 5CW1A 4BVKA 4F4UA 1K8RA 3RYIA 3I8XA 2HLDA 2ZVJA 3JQBA 3GRZA 3L07A 5K0ZA 1OB5A 3IVRA 4HLUA 3AJDA 5ILQA 5ESXA 5JNWA 5FJIA 2QUZA 3CH5A 4LXYA 5FAXA 4X71A 4XUEA 2IU0A 1V96A 2I7XA 3L4EA 4GR4A 1SNYA 1KDOA 2NO1A 2WIFA 2H52A 3KOWA 2YDXA 4O2BB 4DUZB 5C51B 5HUQA 2VHXA 3NOOA 3EEIA 3EMVA 3GLHB 4DC1A 3OPYB 3TNFA 3P1JA 1O3YA 1ZGAA 3BA1A 3PXAA 2YHAA 3DMFA 4PFJA 2EDAA 4GSYA 1P3JA 1HV8A 3NHWA 2Y93A 1M8KA 4LF6C 4Q3BA 2FQYA 4DLUA 5CM8B 4FDTA 4C07A 1XCMA 1JG3A 4DSOA 3AOEA 2VJMB 4YP5A 4C3VA 4D9CA 4L5YA 2LKCA 3W78A 5A3SA 3VJRA 3IHKA 1VL0A 4FYJA 1PJTA 2C9BA 3EULA 4QVKA 3ANSA 4M7PA 5HIMA 3VPXA 3M6LA 3ZKAA 1T6BY 3R7LA 3ZNQA 4W5QA 4KLNA 4KQXA 1IM8A 4KZKA 3D8NA 5KTMA 5CVJA 2ISCA 3GZ4A 1EE1A 4Y2TA 1EFVB 3RU7A 1QJCA 3GRCA 3HCNA 1FDSA 1PQYA 5F5LA 2AD1A 2KSQA 3HYRA 2PGLA 3A8TA 3HJFA 1T2VA 3EC7A 2Q0XA 1X92A 2RGCA 3UQZA 4LPSA 4YHHC 3WDSA 5DHUA 5B3KA 3KZXA 1OXBB 1PX0A 1NZFA 1IOLA 1SUBA 2GSDA 5AXDA 4C14A 5C5EA 3MLAA 3IBFA 3KSZO 4Q1DA 4KVZA 4OH1A 2ECQA 4BNGA 1VMEA 1W0CA 2AJLI 3HBAA 3LIPA 3MWEA 3NIBA 3ZZMA 3UUWA 4EG6A 4Y2JA 3HADA 4GZ5A 1GQQA 1Q0RA 4H0FA 3JY6A 5HQ3B 2YX1A 1JIUA 5GINE 3UO8B 4NATA 5ALLA 1HFJA 2AD5A 5IYZF 1R5BA 2L17A 3EARA 4M1YA 2G17A 4HDNA 3RFFA 3UCEA 3VVLA 4RKWA 4QYMA 4WD3A 3MF4A 4ETMA 3P2OA 1SXIA 2DSTA 3P94A 2CLIB 4ZEWA 1RD4A 3MEQA 3VR3A 3J81A 2QE7A 3QBEA 2XYPA 3FF1A 7ADHA 4RO0A 4RHTA 2E5LB 1SBZA 2R7KA 4KCGA 1ZH4A 1L3CA 1Q0ZA 4L2IB 5FT9A 4F3RA 4JEMA 3MJEA 4UM9B 3FYUA 1F14A 1LWOA 1H2EA 1TQ6A 4FBLA 2PR7A 4FJ0A 1ZNZA 2YUIA 3GFOA 3PRJA 4FJ2A 4LXQA 3V1YA 4BN4A 1LPBB 2NU6A 2YFKA 1ZVJA 5D1HA 4RJJA 3DB1A 1F2UB 1MOQA 5B2FA 1Q0SA 1QANA 4FMCF 2QVLA 5K6RA 4PYOA 5GQSA 2CB0A 2NTYC 4C20A 4TXHA 2GKOA 3TTUA 4ZI3A 3BWEA 4M0UA 1M0TA 3HYLA 4IDEA 3S2UA 3MOGA 4V0MA 2E5FA 2A1UB 3QUQA 2YRWA 1TT5B 4U7TB 1CZLA 4PROC 3VJKA 3I07A 3EXIB 3UCFA 3T1HB 5L3QB 1ZM4A 3H2TA 4RWZA 4C4AA 4GNKA 4CQMB 2B82A 2QTVA 1S1CA 2WE8A 3DVLA 2IE8A 3ESBA 3KZOA 3NBKA 4UFOA 2BFDB 3ZW8A 1XALA 4BLVA 3OSUA 4OHYA 2ZWIA 3G8AA 3MAJA 3KXWA 2JFBA 3FBWA 4YCJA 1I8TA 1VKOA 3REFA 3Q72A 2FOLA 5JXGA 2I4TA 3N5KA 2G1PA 1JS1X 4W7SA 5CAEB 1OYWA 1J6UA 2G9UA 3QEOA 3VSDA 1E9FA 1GN8A 3O74A 2CDCA 2F17A 1QX4A 2FAXA 2ZSIA 2V3CC 1J39A 2HC9A 2NOAA 1UJMA 3DE0X 4XYMA 4ZYWA 4HYEA 4FEAA 4UBKA 4HUJA 1PLLA 4Q93A 1ABBA 3K1TA 4KQMA 2BWJA 3I0MA 3T7SA 1PT8A 1HTWA 5PGMA 1CTQA 3AFOA 4ZP1A 4W5TA 3HY6A 4R8MA 4E1VA 2D00A 1YTUA 3JWGA 5LOVB 3NT4A 3O8OB 4MEJA 3OE7A 3ER8A 2HHCA 2RK4A 4C3UA 1XN4A 1Y5MA 3GA7A 4AKSA 2W83A 2YMMA 1RWBA 4EVRA 1EAYA 1CB7A 5FUQA 1XRJA 2X22A 4BLWA 7ABPA 1NN3A 4KDRA 4N3AA 4A0FA 4HNUA 1MIHA 2PZMA 4JLMA 1U02A 1E0DA 3NTOA 2GCPA 4ZZIA 2WT4A 1E5LA 4EG3A 1GPKA 2GM3A 4DUYC 2W2OA 3QWIA 2QTZA 4RGQA 1A04A 1S2IA 1I94B 2P5TB 4QYSA 5IKOA 2POCA 1G64A 2AVDA 2QRLA 2VSOA 4G8DA 1Z0UA 4NU6A 4KFTA 3BULA 4WLOA 1NXOA 2ZB8A 4TKVB 1F8FA 1Y5LA 3CUSA 3NS7A 4UQOA 2QK4A 4A0HA 2G04A 3KZNA 4IIEA 4KQ6A 1NUUA 1OXMA 1FP1D 2QJTA 3CMMA 3QPCA 4Q9NA 2C7RA 5D2CA 1OH7A 2OCAA 1KSGA 3NHFA 1B6RA 3QNMA 4HQRA 1TZJA 3V33A 3LTNC 3OOEA 2A9PA 3KRTA 3REOA 3NT2A 2D0DA 2C7OA 3GYGA 2X8JB 3H8WA 3MYRA 3HKDB 2I34A 3GLQA 4FOSA 3VMFA 5JZ9A 2YJZA 3RSCA 1WMFA 5JNUA 2VAMA 2ZAGA 1YASA 3DAFA 1QP4A 1E9VA 2PZAA 4UAVA 4Z2YA 1PQWA 1XR3A 5EZYA 2RKBA 4HB2A 3VTZA 1JHMA 5CDGA 5JZMA 3DQZA 2XVAA 3FRJA 4I14A 4ARUA 1NDQA 3DZHA 5A0VA 3Q8WA 2QA5A 2G9NA 4YCDA 1A9XB 3A26A 4J43A 3K09A 1N25A 2ESRA 5EMMA 3V55A 1WZ2A 4N9WA 3KL4A 1ZA1A 3V7FA 5KNBD 4MIYA 2ODAA 4DQLA 1I3LA 4OGLA 1S5PA 2EKQA 3E4CA 1VJ0A 4HG2A 3TJRA 1XTPA 4IUYA 1SUIA 4M0MA 2ZUTA 3R3SA 1JDNA 1KAMA 1YQUA 3V2UA 4CQLB 2W98A 1QBKC 5HJ2A 1YC5A 3AERB 1OREA 2HCJB 4N48A 4ENRA 1T3GA 2AHOA 2CJWA 1VYUA 1SXGA 2DWCA 2XUIA 4NOJA 5A2GA 3OFND 3F4KA 1XVIA 1ZRSA 2P3SA 4AO7A 1PFKA 3P26A 4XD7D 4CT0A 1E66A 2R751 4QGSA 3RIYA 1JJAA 3NHYA 2LR0A 1PNTA 2ZJFA 3DPUA 3L43A 1MEJA 3BL5A 4ZJYA 2WMYA 1RYHA 3LGXA 4KN6A 1IDN1 5EWJB 5F1OA 2BGTA 1JQKA 5T67A 5I8PA 2CT8A 2V96A 3RD5A 1SCAA 5FUMA 2Y1EA 4TL9A 4X61A 4P98A 4EUHA 2O8DA 3M5DA 2FWAA 4FE4A 3EW7A 4C0WA 2D3TA 2FUG1 3I39X 4KIWA 4CU5A 5ISMA 1CNMA 2AE1A 1H93A 3QEKA 2O1XA 2QAIA 2DT5A 1EHYA 2OQRA 4PLZA 5KTOA 2HZ7A 1NW5A 1UJ6A 4KWCA 1D2RA 3OZSA 3LCMA 3HA3A 3TD9A 2UYCA 2V45A 3IAUA 1P1BA 4WQMA 4NHOA 2NUAB 1ZH0A 1UJNA 4ZAWA 1VLJA 3RC8A 1REQB 4K6MA 3DDHA 3U3JA 4LTDA 4FZ3A 5IDYA 5JCOA 1BQEA 2CMFA 4BX9A 3KLOA 1PUXA 3C4QA 1U8ZA 2GK4A 3QBVA 4BRUA 1Z12A 3CZ5A 5JS6A 4UHHA 5DMHA 4HVCA 1KY5A 1IIBA 1JXOA 4HNRA 4HNQA 2XUQA 4Y1RA 5AVJA 3UJPA 3EUFA 2KBEA 3I92A 4BRWA 3IJ5A 1CUBA 2KB0A 1EDZA 3PC8C 3IELA 1PA4A 4RYLA 5EPEA 4CIWA 2WIGA 2YTZA 4UBNA 3CNBA 4RLFA 3II6X 2VHZA 1A88A 1H94A 4OKSA 4F9FA 2PG3A 3D02A 2CLOB 3GFTA 5AVTA 1YKFA 2EJVA 3SFVA 1G5PA 3U13A 2G9ZA 2HPAA 1QDUA 1T1SA 2YIMA 4S12A 3WIBA 2VJYA 4ZHSA 3LX4A 4B3JA 5DM70 3ELBA 3Q7EA 4X95A 1WMAA 4LXHA 1LK5A 2P8JA 2XEDA 4ZA2A 2LCIA 1QAQA 1QHSA 1SU8A 5DBGA 4BQEA 5CDTA 2PQMA 1GKKA 2OCPA 5CLIA 4BBPA 4BFXA 2GVZC 4D4HA 2YY6A 3IC5A 1BE1A 3PE3A 1PNQA 4JLWA 1EB8A 3R3YA 1JVBA 1R6DA 2FPIA 3EPRA 4YXFA 1SHZA 1R6TA 3HG7A 3HDHA 4WT7A 4E5SA 2BHLA 4N49A 1UXOA 3L0BA 5G2OA 2Q46A 1P0MA 1FVXA 3OX4A 4JBXA 1EU1A 1EYZA 4HRXA 4ZGGA 4LFBB 3HA2A 2IVZA 4QAJA 4GS5A 1JFVA 1GGNA 1S3SA 1PLJA 2ZB2A 1IB0A 3D7SA 4JKIA 4F2PA 4OAOA 1WQ4A 1NVWQ 4CTOA 2B8WA 4Q05A 3IXLA 4W4TA 2NM0A 3BWCA 2OBVA 3PHGA 5EI5A 5C32A 3B7GA 3HJGA 4UREA 4Y0VA 4X8HA 2PWZA 1RM5A 1CP2A 1JFLA 4ZXFA 1D09A 2GJSA 5HK8A 5BWLA 5HGXA 4YR9A 2J3HA 1I3CA 4QUBA 1GTZA 4K46A 4WK2B 2PCLA 1ZRHA 1YQDA 3W79A 3DEAA 1ZDMA 4Q7KA 5CB4B 1RQXA 1S1MA 3E2MA 1GRVA 5DCUA 3HWWA 3RARA 5DLDA 1DS6A 2NZXA 3LDHA 4HYQA 3RSSA 4EMSA 1NW9B 4DWVA 1JA1A 1IBCA 5IWAB 3D0QA 4MKIA 1B0ZA 3I9V6 5FNZA 3TMYA 1JSZA 4GDMA 1ZVVA 4ZVLA 4LGCA 3LYHA 2CHFA 1KP3A 1WSBA 2HSWA 3R09A 2FR8A 1ENOA 5CEJA 3ZX4A 1K9VF 3A3PA 5D84A 3OECA 4CCYB 3IDQA 2C2HA 1FUGA 1QHHB 2QM3A 2PRIA 3AGPA 4RA9A 2NYRA 2F4VB 2OZKA 1IJFA 3DONA 4LQ4A 3DAYA 5EJ5A 4ALJA 4D9NA 2Q9UA 4UE6A 4OXKA 1JHZA 2BUAA 4ZAZA 3RYFA 1Z6QA 4PR3A 2WUEA 1UKZA 2OBNA 2QLFA 4Q1VA 1RW4A 1D9ZA 3CC8A 2D0OB 4FI3F 2R6R1 1YJ8A 2XODA 3DBRB 3MNFA 2ZETA 4EHJA 5K8LA 4G4SO 4W1QA 5EP4A 1Q1EA 1W9MA 2H63A 2QSUA 4HAXA 3V7NA 1V35A 2RBGA 3FPBA 2BKAA 1R37A 3LK6A 3S2YA 3C85A 1U98A 5G1OA 3T7AA 3B6MA 2BH2A 3ZBQA 1VJCA 1J07A 1G55A 8ABPA 1BHQ1 4M0DA 2ZRKA 4NBWA 2PEZA 1G16A 2DEUA 4KG7A 1I9GA 5FD8A 3FWZA 4C4OA 1CUZA 1DG3A 1E2HA 2FUNB 3QVMA 1EVZA 2CUKA 2BISA 4OJYA 3UWOA 4BMXA 1RWXA 5FV7A 3GDHA 2P1RA 4E2ZA 1I4WA 3LOQA 1C3XA 1WTCA 1XROA 2QW0X 4YJDA 2CBZA 2R96A 2PMBA 2W2KA 4DA8A 4N5DA 2VUTA 3NORA 5ALUA 1JECA 1FOEB 3B12A 2EIHA 2GZ1A 3U4MA 4Q15A 4NNOA 5KYXB 4H1VA 1NATA 3DE6X 5BWNA 4PPFA 1I1OA 2GX6A 3WWYA 1TZ2A 5I7UA 5JAMA 5AW0A 2J4FA 1M6VB 4DPLA 1S8NA 3L8DA 3X2FA 3FPKA 1B76A 1Y3DE 3H11A 3ASYA 1YU9A 3O7MA 4HWPA 2OMEA 2VJCA 3N53A 2CU6A 1E60A 2PK3A 4I50F 3EB9A 2GKSA 2QD4A 1WEKA 3BXZA 3GL9A 3LTEA 3PGVA 4FEGA 3DEYX 2IXEA 2XKKA 5D3KA 4J03A 4EY4A 1IXZA 2A3NA 3ZEAA 1E5XA 2ATEA 4YV2A 2DX7A 3GEEA 1VI5A 1YQ9A 2NQ2C 4WW0A 5EN4A 1RHUA 4CQMD 4Z4IA 2OV3A 5CYPA 2BLNA 2IBMA 3IV9A 4X41A 3ZW7A 3DZDA 5A3JA 3V8NA 1HYEA 3RWOA 3EIHA 3DOIA 3SBOA 3THOA 5DNYB 3OPNA 4CEIA 4JJEA 1GYRA 2Z58A 2QEQA 1QFMA 3M4YA 4BLRA 5C8DA 2WSYB 2Q28A 2Y9PB 3RIHA 4B3RB 3OY2A 4INZA 4FHGA 1RY2A 1T25A 4TRMA 4IY1A 5AR1A 3ZJTA 2CNDA 2XH8A 4X5OA 3D2CA 1JIQA 3E58A 4F5EA 1DC8A 1XHEA 2OVFA 3Q6MA 1V3QE 4G5FA 5CFMA 1LBSA 1XRAA 2HN9A 4XGRA 3X3HA 3NP7A 3I3OA 1TDJA 1BKYA 3KZMA 3SEQA 4EEXA 3OJXA 4D81A 2W7TA 2QL7A 4PZPA 1RZUA 2EGUA 4JC0A 4H27A 3ZYCA 3IUQA 1EEXB 1HNZB 2VCHA 4MDHA 1RCTE 2WT9A 2J9ZB 3A6JA 3NTRA 2FR8C 1SVLA 1W4ZA 1BC5A 1LDGA 1WIWA 1E6KA 1TYZA 3LF1A 1VXRA 3OT4A 3UC5A 4B9AA 2CL7X 1HDEA 3ODPA 4K9OA 4REQA 2WHPB 1LC3A 2Q8NA 1HE5A 1DELA 3N7TA 5JJIA 5G40A 2JGDB 3DVAA 2DF8A 5E9JA 4C0JA 3WLSA 3TK1A 3JQGB 3T1OA 2XOKD 3NVAA 2DB3A 3I05A 3IOEA 5AVOA 2EWVA 2XADA 1DEAA 3JQ8B 3KFVA 4G9EA 2O2CA 4TZ0A 1ZW1A 2J9XB 1FFEA 2QOEA 1EE9A 2PDAA 2WJPA 5G3ZA 3SD7A 4AURA 4EW3A 1VDZA 5F7JA 1KQNA 2A0YA 3C7TA 4Z51A 2H17A 4ROSA 2PPVA 1HE8B 3KPJA 2ZJ0A 1MNAA 3OY7A 3ADDA 1RZVA 1IE3A 5CX4A 5EXPA 1WETA 3ZJ5A 3VU9A 5THXA 1Q57A 3RRBA 4CBVA 1TKBA 5CVVA 3R3WA 1U8YA 4IQ0A 1VL2A 4OLHA 4PSUA 5F1KA 1I80A 1GDDA 3TSCA 3WFJA 4AJEA 2B2CA 4R41A 2RBEA 4UNQA 4WL0A 3UV6A 5JUWA 1B8OA 2VP6A 3HUDA 3IVGA 3ESYA 3O4IA 4AY4A 2F55A 1L7AA 4EM6A 1X7ZB 2OXTA 4N0QA 3B1FA 5L8VA 2ORIA 4GMGA 3L3BA 5F21A 4BV2A 1LF5A 1VHTA 1Y80A 4MROA 4PAGA 3HVRA 1N6OA 2V3WA 4PLPA 4I8XA 3RW9A 1XA0A 3NYIA 2OFFA 2CVPA 4IDQA 3O2JA 3I9OA 3F1LA 4DMUB 1EFUA 3Q9UA 1OFVA 1JLKA 3H65A 3HV0A 4ZRDA 1ONSA 3ZK7A 2AEEA 2ZPTX 4YP0A 3BE4A 4OHPA 3JAKB 1SIWA 2NUPA 5D8DA 3F6EX 3IHLA 2B5VA 2WJHA 3QV2A 4GLOA 5CTJA 4I50B 2VOEA 1SKBA 4CMIB 5LIPA 1FQWA 3ZE9A 4KMRA 3BH0A 2HXSA 4C01A 5LXTB 3VNQA 3S0JA 2IYUA 1CQWA 3ECSA 3A58B 2RONA 4XVRA 4F8YA 2IZ1A 4CV0A 3I58A 4KODA 3PR3A 1V8PA 3A1TA 1G6OA 5AJWA 2QMUA 2XXAB 1FSFA 4JB0A 4Q6BA 1V3VA 3HN2A 5T8SA 4R8SA 1N5LA 2ZIEA 2OOKA 4P08A 5HFJA 1H6DA 2NGRA 5AHRA 3UOGA 5KTKA 4JYAC 1NVDA 2VCEA 3NAGA 2C00A 1IEWA 3AU8A 1Z17A 3N39C 1BFUA 3UVEA 7REQB 2RG1A 2EYUA 4NYMQ 1V95A 2JEYA 4Q4HA 1LPNA 1G42A