2HJGA

The crystal structure of the b. subtilis yphc gtpase in complex with gdp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
434
structure length
400
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLDNNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The essential GTPase YphC displays a major domain rearrangement associated with nucleotide binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-binding protein engA
total genus 120
structure length 400
sequence length 434
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hjgA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA01
2BDTA 2GAOA 2ZJOA 1J70A 1D2NA 2GAAA 5AJXA 4JL8A 4LZZA 1W2GA 1FOEB 5EE1A 3OEHA 2WWGA 4LJ8A 3RYTC 3KQNA 2JIZA 3LQQA 4WZBE 2QTHA 4IVQA 4B74A 4UXIA 1MV5A 4JLJA 3IPXA 2BKEA 2D7VA 1NBMD 1WDTA 3GLFA 3DEFA 1A4RA 3C7KA 1RW4A 4LF9C 4DV0C 1NMYA 1W5SA 2NZJA 3LNCA 4NMMA 4RKEA 3U7EB 4TLDA 4A15A 1NKSA 4BSZA 1II9A 1MT0A 2J1LA 4PHGA 2HT1A 1WBBA 2IYXA 3AUYA 1Z28A 4F38A 1FQKA 3A36A 1P2VA 4EKDA 2ZE6A 1Z0DA 4B76A 2Q21A 4HLUA 3RLFA 1G3UA 2J7PD 3RANA 1GOTA 2MSEB 1ZCAA 3AKEA 3CZPA 3I92A 5CLLA 3A6PC 4HAVA 1XRJA 1NJGA 4B75A 2AD5A 2DWPA 1DE0A 4XX2A 3IO5A 2NG1A 1YE8A 1YZKA 1JOSA 1ZINA 2O5VA 1OJLA 4K46A 3X1XA 4LHYA 2JLUA 1AJEA 1QHSA 1KJZA 4HLUC 4ZCMA 5TV2A 3KUCA 2ORWA 2VHUA 4Q4JB 5DN6A 4YQFA 1T91A 4LYJA 1N5KA 4FIDA 4X8OA 4KYIB 4IOLA 1Z2CA 3TW8B 5FH9A 1NL3A 1P72A 1II0A 1K0RA 2HT6A 2FF7A 2VHTA 1E0JA 2ZRDA 1HYQA 3K53A 1MABA 4DDUA 2ZITA 3B82A 4O2LA 4BECA 4URYR 1NKTA 2ZUDA 3S1AA 2HLDA 1R0YA 5FPYA 4N0DA 3NXSA 2KI5A 1NSTA 2J9RA 2WMNB 3B9QA 3I72A 4CW7A 4QBHA 2HUPA 3CR8A 4Q48A 2C77A 3TGPA 4CEIB 4QHTA 1YR6A 4A6PA 4URXR 1XMJA 3TMKA 3REFA 5UKDA 3GLFE 4RZUA 4AKHA 1QG4A 2Q6TA 1RRCA 3OFND 1WBDA 3PIRA 4PQYA 4KSCA 5EUMA 3TUIC 1O87A 2IXGA 3LY5A 1MOZA 1NLYA 1ZBDA 3TKLA 4CT4B 1R8SA 3R9WA 5LD2B 2FSIA 2OFWA 4M1SA 1R4AA 5DI3B 2PT7A 4E09A 2ZRGA 3EWAA 1UKZA 4S35A 1GL9B 2BMEA 3QVVA 4OX9C 3A4MA 3JZAA 1E1RA 2REBA 4NZYA 5IWAC 1AA9A 2MMCA 4Y0VA 2O0HA 3P32A 3VQTA 4JKIA 1XNQC 2WIBA 1OHHA 5CDFA 1E3MA 2RHMA 2VSOA 4NXMC 1NG9A 5A2QD 1FP6A 2J45A 4M2LA 1JXMA 3QI2A 2GA8A 1LF5A 4P0TA 5DHAA 1E98A 1Z0KA 1ZVQA 4MKFA 4WVFA 5TY0A 2BJWA 3U44B 5A5GA 4KITB 3AVOA 4B3GA 3EPHA 3PCRB 2W6JD 2FPMA 2PJZA 3OE7A 3CWQA 5DLQC 2ZI9A 4Q47A 4CEJB 2ZJBA 2CY1A 2WSSA 2EFGA 4DUYC 4JLVA 1G9XA 1U8ZA 2R9VA 4Q4LA 2ZJAA 4I1UA 4BRWA 3DOFA 2RGXA 4JLOA 4JVNA 1JR6A 2VQEC 1SVIA 1W0KD 3OAAD 4Z8XA 4EDHA 3AF5A 2ERXA 1X8LA 2WHXA 2AXNA 2GBLC 3TRFA 3WHLA 5AUPB 4C4PA 4HDOB 4I4LA 2BEKA 2FFHA 3SJBA 1XXHE 1LFDB 4P4SB 5AUQA 3IEVA 4Q9JA 2JLZA 1SVMA 3AUXA 4OKSA 2H16A 1ZB8A 4D0NA 4M9ZA 5B64A 5SZHB 4EUNA 1KDOA 1UKEA 1EGAA 4AURA 3CONA 2FJUA 4AYWA 1I4DD 2Q3MA 1ANKA 3LD9A 4RCZA 3LQRA 1KSJA 2NOAA 3GEHA 4GP7A 1GL6A 4EPXA 4F4CA 4OI0A 3B60A 3CF2A 3F0TA 1H8ED 2TMKA 4HAUA 3UG6A 1P9WA 1GIAA 1XD2B 1KI7A 1ESNA 2I1QA 4LK2A 4OQMA 4RKFA 5JRJA 3VKHA 2QZ4A 2MSDB 1R0XA 4Z1MA 4K81B 1XEWX 2RHDA 2ZRHA 3FDIA 4FCVA 1KI8A 2GDJA 4TYPA 1E1QA 3NEJA 2GVZC 4DLRA 2C8VA 3EA5A 3UIEA 1RRPA 4PHHA 4QNRA 2O0JA 1TUEA 4BLPA 4NTZA 4TYWA 1LV7A 2ZR7A 3N2EA 2O8FA 1NP6A 1QDEA 3L0IB 4IW3B 3KFXA 3FTQA 4B33A 4D4MA 3IKJA 2GJSA 2I1VB 5KDLA 2NGRA 1JB1A 1QZXA 2DBYA 4H1VA 2D06A 3TE6A 1Q21A 2F9MA 3KFVA 3TVDA 2QN6A 1T3SA 2QP3A 4DIDA 4PTLA 4PX9A 5JCPA 2EFDB 4Q19A 4QBGB 5AK0A 3A8TA 4NCIA 4GFDA 3GJ7A 5JWHA 4B43A 1ESMA 1I94C 1IQPA 1R5NA 4Q4HA 4QL3A 3H0KA 5FTLA 3K70B 2BBOA 1YZUA 5JHGB 4P32A 3TW4A 4EAQA 3TUJC 1GZSA 4BFXA 4RD2A 4V0NA 2PBRA 3SJAA 2BM0A 3SQWA 1VHTA 3AF0A 2C2HA 2EYQA 2REXB 3HR8A 4HLDA 1JQJC 2ZREA 4HYYA 5A4JA 1E69A 2D62A 3C41J 3MUFA 1TPZA 3CX7A 2WJIA 4W5WA 1E9SA 1E1RD 1OPXA 1S9HA 1J5EC 3W5IA 1Q12A 2C99A 4QBFA 5DHFA 2NMVA 1AGRA 1CRQA 3B13B 1AS2A 4AYXA 4ESVA 5ANRB 1PV4A 2E8CA 1IN4A 2XZPA 4LCBA 1MO4A 4NKRA 3ZVMA 1U98A 2ZRMA 4DBLC 2ATWA 1SVKA 1SXJD 3MGCA 5J4YA 2NPIA 2IYTA 3B1XA 4KFSA 5KPJA 3B1YA 1YVDA 2IWHA 1M7BA 1OH5A 2FFAA 4LX0A 4B3RC 2WICA 2YOFA 3E1SA 4G0NA 2J0SA 1IBRA 2W6JA 1QHHB 1YHNA 1VIYA 1TF5A 4HI0E 4NYJQ 4QGFA 1XEXA 2D2FA 5JEDA 2WTUA 3ICEA 2ZVQX 3G82C 2ONKA 1C4OA 4DCNA 3AKCA 3WMEA 4JIMA 2O8EB 1ZCBA 2F9LA 1U99A 4DV5C 4BWYA 4AQYC 4C0KA 4JI2C 5FPSA 4M8NE 4YHHC 1JPNA 1TADA 2A9KA 1XFAA 1W0KA 1XJCA 3OAAA 5EP3A 4DXAA 1KJYA 1PA4A 4PC2A 3OIWA 1KKLA 3A1SA 4Q4AA 3EW9A 4ZIRB 2VPPA 3KQHA 1GKYA 1NBME 4O0MA 3D7MA 4BLSA 4C0JA 2QBYB 3MRSA 4G5GA 4L8GA 2W6ID 1I2MA 2RGNA 5E4FA 4YMUA 2XNDD 1OH6A 3QNUA 1G8PA 2P2LA 1HE8B 2WWXA 3R7WA 3ZQJA 2FX3A 1H8EA 3VTKA 1IBMC 3QBVA 5TVKA 2NO1A 2UU9C 1G3RA 2CEAA 4BFYA 4BFVA 4WBSA 2ODWA 2VL7A 2JLWA 4C30A 2G3YA 1NLZA 3TBKA 2W58A 1HT2E 1PVOA 1KI2A 3THOA 5FR2A 3JVVA 2QG6A 3MCAA 4KODA 4JI5C 3EIQA 4PSKA 5F9HA 1VCIA 5HCIA 1G16A 4JLMA 5H70A 5KDOA 3K0FA 1R8QA 1D2MA 4WAUA 4DCTA 4TSFD 3BAFA 4HZUA 2CLSA 1T3LA 4QXAA 3K0AB 2AKAB 3CR7A 3T34A 1TF7A 3EARA 1N36C 3RS4A 2C96A 2V1XA 4C0SA 1CULC 2EFHB 4MDEA 3A1VA 1DOAA 2HXYA 4BFZA 5KOYA 2ZSAA 3P20A 4DLSA 4FMCF 3BJIC 3UMRA 4P3YA 1Q0UA 3RRNA 3QOFA 4B48A 2V4ZA 1FTSA 4LHVA 2EWVA 4V0MA 2DYJA 1G5TA 3NDBB 2KJQA 1R10A 3CNNA 5FPKA 3NBZC 3ZH9B 5DH9A 2J0UA 3C14C 3U2QA 1JECA 2WKRA 1E0SA 3GJ4A 4MYUA 1XTSA 4PO9A 2ORIA 3NHAA 2QSZA 3UMFA 5HPYB 3AEZA 4E03A 2HEIA 4JLAA 2ORVA 2V3CC 1MRNA 1H8HD 1TQ4A 1DO2A 3MLEA 2BMJA 1W36B 4JBXA 1EWRA 4CYMA 2O8EA 1N3BA 4BZPA 4YC7A 3GJ5A 4XVUA 4YXWA 4RVCA 3GFOA 2V6IA 1R5BA 1GRRA 2BIFA 2XAUA 4GOJA 1KO4A 4C2UA 3NVAA 1EFRD 5SZKB 4BLOA 1II8A 3DKPA 5CIQA 2GEUA 1SXJA 3H1TA 3KXKA 5DYGA 2VSXA 2JJ1A 2Q3FA 2VF8A 4V02A 1R7RA 3QKRB 3B7GA 1XB2A 3I3SR 4M4SA 3Q7QA 4LYAA 1FX0A 2ASBA 5FPHA 3T1QA 4LDJA 5FOUA 5L3SA 4LF8C 3TH5A 2J3EA 1W7AA 2JLQA 1LB1B 1X86B 3TK1A 4DCVA 4CVNA 4B3CA 4CZ2A 1XJQA 1EFCA 3MMPA 1LF0A 4IXNA 1HV8A 2D7DA 4NYJR 2JDIA 4Q00A 2ZUCA 1LTQA 4QBIA 4UXJA 3L82B 3RS5A 2R8RA 4JI7C 2K5UA 3BWDD 3EX7C 1CIPA 4CEHB 4UQOA 1Q20A 3BIFA 1NN3A 1Z6TA 2OFOA 5A0FA 3P1JA 2F1IA 3CRW1 4UKDA 3BORA 4JYAC 5FTJA 1Z0JA 4B32A 1N6IA 4DJTA 4KVAA 4EJSA 2R2AA 2XNDA 3AH8A 2PLFA 4OHWA 5GVRA 4DCUA 2OT3B 3IBGA 1BIFA 2IWRA 3R8CA 3RRZA 4DV6C 1AZTA 1FMLA 4L4UA 5FL7D 4E22A 5DE3A 1W48A 5JSZB 3CRVA 1T4GA 5EE0A 5K8LA 3KXIA 2GCOB 2F4VC 1O3YA 2VO1A 1XNJA 5JZVA 1ZU4A 1G64A 2EFEB 2ZJ2A 3L0PA 2HHHC 3DZ8A 4HAYA 5JWRA 3KJIA 5FPTA 2DB3A 1FQJA 2B7BA 2QMHA 4AK9A 4M1TA 1XTKA 2GVDC 2YYZA 3WNCA 2OSBA 5BR8C 2ATVA 4B35A 5CB6A 4H1UA 5IT5A 1J99A 2VH5R 3KDSE 4IXMA 4KYUA 4GKKC 1JALA 4EQ6A 4NONA 1IN8A 5JHHB 1P61B 521PA 2OV2A 3CF6R 3QKRA 1N5JA 5KNBA 3RABA 4LF7C 2RAPA 2PLRA 1OXTA 1NMXA 5FFMA 2VSFA 3K1JA 2F43B 4MUBA 4BASA 1NF3A 5JJKA 1HE1C 5EXTA 2GJAA 3F3YA 5DN6D 4X65C 1OXUA 1NN5A 4JLPA 2BJVA 4Q7MB 4ZKEA 5F98A 2XOKD 4B2IA 4N1AA 1BH2A 2RGBA 3QE0A 1JBKA 3ZZUA 3QUSA 1GDDA 1Z06A 3AKDA 1JJVA 4B73A 1CR0A 4XJXA 2DWOA 5CM9C 1IXZA 1XMQC 3NH6A 3BB1A 5E95A 4RD1A 4DLUA 4ZPXA 2OXCA 4LFCC 1DG1G 1VYVA 4EQ6B 4OHZA 3U7HB 1J2JA 3QKSB 1E2FA 4URUR 3U61B 2AR7A 1AQUA 5DYIA 3WMFA 3K9GA 4JBWA 2IYLD 2GZDA 4LPKA 4PPFA 4XVRA 4TZ0A 5JI3E 1HH4A 1G6OA 5GJCA 3OIUA 2J87A 5IF9A 3LBHA 3B85A 3KKPA 1UJ2A 2XGJA 421PA 5TMPA 4X66C 1Z5ZA 4DLYA 1QVAA 3OZXA 5LB4A 5BN3A 4LYHA 3FKQA 2Q0HA 5AUOB 1U8AA 3F5FA 5FBVB 4HAWA 1UDXA 2GCNA 4R7ZA 3GEEA 3MWKA 3T35A 4R9UC 4JL6A 1OYWA 1Z3IX 3U4QB 3ASYA 1J90A 2JASA 2QTFA 3DVLA 2F55A 4W7SA 1W36C 4NYMR 4DIEA 4TL7A 3SBDA 1COWD 4DKXA 4V03A 1RPZA 1ZD8A 2E8EA 1HY3A 2WWFA 1WF3A 3ND8A 3VKWA 1WQ1R 4PAOA 3NEYA 2ZPTX 2ZU6A 1S8FA 2EVWX 2IK8A 2V7QD 3FPAA 4HB3A 3K70D 3I5XA 3SJZA 1E32A 4L9SA 3JAMD 4DEXA 2AFHE 1YR9A 2LKDA 1W44A 2BWJA 3GJ0A 5EP2A 1AZSC 2FZ4A 2IUSA 2NIPA 4YMVA 2ONFA 1LNZA 1SGWA 3SC3A 1NN1A 3U3MA 1G7SA 2PN2A 2ZR0A 2CVFA 3CRRA 1XCGB 3HP1A 4GRAA 2VQFC 2FSGA 1FMJA 1D2EA 2GCOA 1XMOC 3FVQA 5LBIA 3ZZTA 2N42A 3K0FB 2FPLA 3NWJA 5KSZA 1KGDA 1ZNXA 2WSSD 4M9XA 4OQNA 4U00A 2C78A 2O8BA 1U0JA 1DADA 3ETLA 1Q1ZA 2KWIA 2CMKA 4Z51A 1ZAKA 1OV4A 2ECKA 4IFBA 2ZANA 4B3TC 2F1JA 5BXQC 3KKNA 4M1MA 1P7CA 1UBGA 1KDPA 1DARA 4JVSB 1UKKA 1Z63A 3BFKA 2CHGA 3SQXA 3WHKA 2PZEA 4JJZA 1TL7C 3WNBA 3EZFA 4QM7A 3VR4A 2WBLC 3QVUA 1GILA 3GLGB 2ANCA 5EE5B 4NOZA 1YZNA 2QPTA 3KKQA 4MRSA 3U3JA 3MG9A 3JZMA 5BWMA 2QPAA 1CXZA 4DV4C 1KY3A 1A2BA 2V55B 3T5DA 1ZM4A 2QY9A 2OM2A 3T12A 3WY9A 2AK2A 4PC6A 1KSHA 3IGFA 4P4UA 4MYCA 1XNRC 1NI3A 2XOKA 4ZKDA 2ZRBA 3I8SA 2GXUA 1KOFA 4M1OA 5IK2A 2IYUA 2VYFA 3LRPA 4B44A 1VG8A 3KB1A 2ZYWX 2G9NA 5HTKA 4ASUD 2IT1A 3CZQA 4Q01A 4V0OA 4ARZA 4FN5A 4TQUS 3K70C 1XEXB 3HWSA 1I4LD 2BJOA 1XD9A 5JFGA 4QHSA 2OZEA 2JLYA 1OFUX 2ZSEA 4A0RA 1ZNWA 4DB2A 3NIBA 1ZYUA 4ZDJA 2DWQA 4D26A 3MSXA 4TT3D 1QHHA 4LC1A 1OIWA 2A2ZA 3GPLA 3VNVA 1AS3A 4IOMA 4PPGA 1OLOA 2ZE7A 2WKPA 1ZU5A 3CIOA 3OEEA 2ZRJA 4Q5IA 3IDQA 4G5QA 4LJAA 4CF7A 5HE8A 2IF2A 4FWIB 2HJVA 3TQFA 4B2PA 4DSNA 2JLVA 1GNRA 4POAA 4QGAA 4A6XA 4DUGD 2HF8A 2UXCC 1W2HA 4OHYA 2GXAA 3A4NA 3BFXA 3VR5A 1E2JA 1KZ7B 2IYRA 4DDTA 2H57A 4HLQB 4KBFA 2OBLA 5F3WB 2FGJA 2YWHA 4LF5C 2YWFA 5EP1A 2ODBA 4TWZA 3V00A 4XD7A 1S1MA 2HYIC 2F7SA 3UWOA 1ZC3A 2QP9X 2VLIA 3WXMA 2C98A 4MYTA 2CCGA 4X64C 3ZVRA 1EK0A 3AP2A 4XVQA 3DDCA 1KDTA 1R2QA 3I1FA 1SHKA 2QP4A 3U3KA 2BM1A 4PO8A 1MO3A 2HF9A 3PEVA 1BOFA 4QNMA 3AF4A 5KHOC 4R2HA 1VTKA 4UJ5A 3EIEA 1NLFA 4XSGA 4Z8YA 4Q7LA 1Z6YA 4R98A 3HU1A 4RCYA 4MKIA 5AJVB 4DDVA 3THYA 3ZS8A 1CJMA 2GHIA 1P6XA 4LHXA 3TIFA 3BGWA 5FR1A 1F2UA 2CK3D 2N46A 1KSFX 4TTPA 3SYNA 4PZYA 3QEJA 2ZROA 1P5ZB 2ERYA 2VF7A 1CKEA 5LD2C 4NCNA 4TYQA 1Q3HA 1T3HA 2Y8EA 1X3SA 1WCV1 3M1IA 4S2EA 4MKHA 3ADKA 5FUYA 3U60B 4MUAA 4JMPA 3O8CA 4D80A 3VR1A 3NC0C 2FDCA 3T1TA 3IHWA 2GCPA 1KO7A 5JJIA 5TDHA 3W8RA 4FMCB 1TEVA 4BRUA 3PEWA 1D6JA 4HATA 1XD2A 3MJRA 4HUQB 4QG7A 2WVJA 1OFTA 4HB2A 3NHBA 1YZQA 2IHBA 1IONA 4OQFA 5DO9A 1OIVA 2AHOA 1GFIA 1E2GA 4I1OA 1CR4A 4Q18A 2W00A 4IEIA 1Z0FA 3GLHE 3WNDA 4EFMA 5JECA 3WRXC 1G19A 2J41A 4V0KA 4PC7A 4LBZA 4D25A 3PEUA 1ZMXA 1KI3A 4A82A 3THXB 5SZJA 1UPTA 2DFKB 3SYKA 2B92A 3TAUA 2EW1A 3EG5A 3ZD6A 1Z08A 3WMGA 3MJHA 3SR0A 4KVGA 2F1RA 1VKJA 3LBIA 3CPEA 3SI7A 4RFSB 1NYEA 2FEMA 3I61A 3P4YA 1JR3A 2IYZA 5GVSA 1N6NA 3X1WA 4HUQA 1XJ0A 1IN6A 5FL3A 4ASUA 1CEEA 1F2TA 3Q9LA 4DLXA 4LV5B 4NCKA 4BQSA 5LDDC 5DI3A 3TR5A 2UUAC 4DR6C 1AN0A 2QRZA 5FI0B 5H1YA 1R0ZA 2W0MA 1XXHA 3NH9A 3NKVA 4LWZA 1NVWQ 4WA7A 3ZZ0A 1DPFA 2BEJA 4PSVA 1G8YA 4UXHA 4GP6A 2D2EA 3FHCB 1T5LA 4Q9IA 1FFHA 5G41A 4DB4A 2YINC 3UATA 2XZOA 1KK3A 2JMPA 1FW6A 4GOXA 1MH1A 5DGXA 3PV0A 4TL8A 5B58C 1DO0A 4BPBA 1IOZA 4LJ9A 5TXGA 5CDFE 2P65A 3I32A 1E9RA 2J46A 2CBZA 4JT4A 2QMUA 1EXMA 2YJTD 3UK6A 1P73A 4CDGA 3CLVA 2VP4A 2FU5C 5FBRB 2A7QA 4NYIQ 4EJSB 2QNRA 2GZHA 4LC0A 1Q1EA 3WP0A 2VP0A 4I1VA 3G0HA 1XXHB 1YQTA 4XOIA 3EZ2A 4LFBC 1CLUA 2A3RA 2G0NA 4Q7KA 3BE4A 5G53C 3M0EA 3HYRA 2QT1A 2ZM6C 2ZS9A 5BN4A 1E79D 2IS2A 1OYYA 1BS1A 3O8RA 4ON9A 2GXSA 4DLVA 3X2SA 3LW7A 4A0GA 1CP2A 1EFHA 1WA5A 3O8BA 2XXAA 2YNMA 2B6HA 3D31A 3T1OA 1KMHB 1MR3F 4GZMA 4JI6C 1OB2A 4BLTA 1KHTA 3IHLA 1DTSA 1SVLA 1JAIA 2CK3A 2WJHA 1GRQA 2P0EA 2ZRPA 3QQ5A 4DSTA 3ZD7A 4CEJA 1G5RA 2GF9A 3FKSA 3BFVA 1SXJE 3AKYA 5CITA 4PZLA 2J0VA 4D82A 1T5IA 1GKIA 4A0HA 1KK2A 2GWHA 2ZM5A 2W0SA 3R8FA 2QMOA 3BB4A 2XSZA 1IY0A 2GKSA 1ZNZA 1N0UA 1BKDR 2FEOA 1NIJA 1Z07A 3AGQA 1QWIA 4HSEA 4NH0A 3OHMA 2O8DB 1N6LA 2FE4A 2ZE8A 2ZU0C 3LVRE 2IEYA 4DWJA 2EQBA 2G83A 2ZIAA 2X8AA 1DAMA 3IILA 5KTYA 1FNNA 1ELOA 1TQ2A 2CLDX 3QXJA 4PZZA 4DZZA 2RGCA 5BN5A 3FWYA 4XWKA 1G1MA 5CK4A 3NBFA 5BW8A 4Z1MD 1KK1A 2CJWA 4JSTA 1XD8A 3PQCA 5L3RA 3MWYW 2XZLA 4JI0C 3D3QA 1AM4D 4PXAA 1SKYB 1UKVY 2JAQA 2G77B 1JR3D 3PFIA 1CS4C 1G17A 4PFSA 4J0QA 3NG1A 1N32C 1HNXC 2FA9A 5CYOA 4A9AA 4LF4C 2WIAA 3DOEA 2O8FB 1KI9A 4MDFA 2VTKA 2MSCB 2YWEA 3Q85A 4HB0A 2O0KA 3LXXA 3BERA 5DISB 3CO5A 4GT1A 4LBVA 4BLRA 4K8OA 1Q44A 1A2KC 3OF5A 5E7IA 3HU2A 4IDNA 2MMGA 3REGA 1KMHA 4DR2C 1KI4A 2QGNA 3K8YA 2RGDA 5KSYA 2P5SA 1CU1A 2ZEJA 1KJWA 1S96A 2XB4A 4HUTA 2BC9A 3QXXA 1OH7A 2XR1A 4PANA 4UNNA 1R0WA 4PHTA 4JLDA 3T5GA 3EXAA 4L5BA 2ZI5A 5LMUC 4IEEA 4LOAA 2WAYA 4DVGA 4DLZA 4GSYA 2BMDA 3W6NA 3HYTA 3AV0B 1TTTA 3AVUA 1UADA 1W1WA 1DAHA 3B1VA 4DCSA 1FX0B 2B8WA 4NCHA 4QGHA 1DAEA 4JYBA 4QGGA 3R9XA 4PAMA 4C0QC 4CEIA 4DDWA 1C1YA 4UJ3A 4KI0A 5K8IA 4HZIA 3T1YC 2CCKA 3KJEA 1KI6A 3SJCA 3EPJA 1AKEA 1CRPA 3U4QA 5CJPA 1A82A 5K8UA 4N3NA 1J7KA 1N0WA 2JA1A 5FBWB 4LYFA 3BK7A 5J4VA 4B3BA 3LLUA 4Q4AB 1ZB9A 4MRNA 3VFDA 4WXRA 1Z83A 1DAIA 2OBNA 4OQLA 4G5SA 5CB8A 2AX4A 1N34C 3U3RA 1S1CA 5FOSA 2CNWA 1SVSA 1G7CA 2ZQ5A 2UKDA 5FTMA 3VKGA 4CRWB 5IDVA 1TX4B 4JVLA 3IIJA 4MYHA 5AR1A 3FKSD 5FUWA 2H7VA 3A1WA 3KQKA 1BO6A 3BH6A 1COWA 2JJ8A 2QQ0A 4NYMQ 4CT5A 3QSYA 1T6NA 1W4RA 5FUXA 4M21A 4BZXA 1QHYA 2QBYA 2NZ8A 2QM8A 1GWNA 3LX8A 3W5JA 3WYGA 1E2MA 2Q3HA 4JKYA 1USPB 3M4YA 2ZYUX 3MWJA 1JR3E 2VP2A 3BS4A 5EZ6B 1XTQA 2X1VA 1VHLA 3C5HA 3IUYA 1IN7A 1Q1QA 5KO2A 3SEAA 3GJ8A 2QAJA 3X1YA 1SULA 3GLIA 1B23P 1OFHA 2JLSA 4LI0A 1E4VA 5JCZA 1BYIA 4BUJA 1EFUA 3FMFA 4NU0A 1G7RA 2FN4A 1W5TA 4HLCA 3ECCA 1P75A 1KYIA 1QHXA 5EJEA 1UFQA 4KLZA 3GFPA 1KY2A 5J40A 4PPQA 3B6EA 1NBMA 1XMVA 1P2UA 3JVUA 3QEOA 4G1UC 1L8QA 1D5CA 1TMKA 2OLKA 2IYVA 3OTOC 2H92A 4JBYA 4TTQA 3W9YA 4PAQA 1E2KA 2BMFA 1GNQA 4EPYA 4IJMA 2CXXA 3K0CA 4EFLA 5EE9A 2CL6X 4A0FA 2D4HA 3ZYCA 4V0ME 2F6RA 3UMSA 2GESA 3SS8A 1X6VA 4A2QA 1CJUC 2SHKA 1KK0A 3EC1A 1AQYA 2ONJA 1JQLB 3ONWA 1G4AE 3Q5EA 4ITRC 4P31A 3TUZC 3AQ4A 4Q9HA 3TSOA 1G41A 4PHFA 4M1KA 1SQ5A 1R5OA 3WBKA 4ACBA 4AC9A 3U6KA 1W4BA 3UWKA 4OK5A 3QPUA 2JJ2A 2J0UB 4CIDA 4D4JA 4PQFA 2IYSA 2JGNA 4RSGA 4ERNA 2HDNB 4US1R 1OSNA 3CBQA 3E5HA 4RZ2A 1ZUIA 3SZRA 2P5TB 1E2EA 2FMXA 4LJ7A 4QKQA 4OJQA 1OKKD 2IXEA 4ZV4A 2H17A 1D9XA 1N6RA 1N2CE 1KI6B 2RB4A 2IS1A 2GXQA 1YJ5A 3GCGA 5HKKD 2ZS7A 2DHRA 5D3MA 4UNRA 1T8UA 2QUZA 4UNSA 1EESA 5L8VA 1BMFA 4TLEA 3GLIE 2GILA 1U2RA 2OE2A 6Q21A 4KFUA 3E70C 2YV5A 3L43A 4W5JA 2KE5A 3FOZA 3NC1C 3TVTA 2HLDD 1GP2A 2PCLA 1OXSC 4NYIR 5CLQA 1OHHD 4JT2A 3NBXX 2FGKA 3W6OA 5JBQA 2BHRA 2OCPA 1PLJA 2HCBA 4OQXA 4OHVA 1KIMA 1RIFA 2LWIA 2ATXA 3AVVA 1F2TB 4Q7JB 1YZGA 2QSYA 3VR2A 3RC8A 3FMPB 2PCJA 2OPLB 4AG6A 2OILA 3CJEA 3PR1A 3EC2A 2CNWD 4URVR 4D4KA 4B6EA 1HURA 1MO6A 5E7MA 5E3HA 4V0LA 5EZ5A 8OHMA 2IYWA 2WWIA 3THXA 1QHIA 2AN9A 1Z6XA 2OCYC 1VCMA 1ZJ6A 1ZP6A 1GRNA 2FZLA 4B3FX 3QJYA 1VG9B 2JDID 4TMXA 1R6BX 3LUSA 1G8FA 5IT9D 3IEUA 4IOJA 2UZ3A 3MAAC 4G5OA 1E2NA 1K8RA 3IO3A 5FUVA 4AYTA 3PEYA 1A7JA 3H4MA 3FGNA 2IUUA 1VMAA 3QKUA 2OO7A 5FOVA 2WKQA 1OW3B 1YR7A 4D81A 1Y63A 2Z43A 1G21E 3Q7PA 4QJ5A 2ZTSA 1ZD9A 4U02A 1CF4A 2W2VA 2ZR9A 3MFYA 4JV5C 2XITA 2A78A 1U9IA 1G8GA 3HPQA 4KO8A 1E2IA 5FOXA 3EZ6A 3H84A 1W4AA 3RRMA 2CHQA 2QTVB 1NMZA 4AWXA 2QROA 1G291 3SNHA 2ASEA 3AVQA 5FOTA 1E1QD 1RE0A 2Q9AA 1M34E 2ZRKA 4AI6A 4HAXA 4KLNA 3QF4A 3I5YA 2IUTA 3U7FB 1RJ9B 4BE7B 3LV8A 2P6NA 4LSGA 2C9OA 5FTKA 3HPRA 2DR3A 4X8HA 1OH8A 2XB2A 1HQCA 4M1YA 4OI1A 5IRCD 2YC2C 4XTCS 1PLLA 2UVQA 4MGZR 4ILEA 1RYHA 5J5CA 2BKUA 2CDNA 1UF9A 5HE9A 3AF3A 3RWOA 2E1RA 2XTNA 4WOPA 4QHYA 4RD4A 4BFTA 3DMDA 1FJGC 2FH5B 1N25A 2JCSA 4LFAC 121PA 1S3GA 3P4XA 3RS2A 3AVWA 3UG7A 1VIAA 1EG7A 3IQXA 5KSPA 2I4IA 4EJSC 2W2XA 3WYFA 3GJ6A 1U0HC 4X62C 1W0JA 2EYUA 2O52A 3O47A 1YZTA 3PUYA 4I81A 4X8LA 4YDSA 2YCBA 4B3XA 3QENA 5M04A 4OK3A 4XTRA 1A1VA 2WOOA 3OESA 1V43A 1P4SA 3CH4B 2IC5A 2ZUBA 3TSWA 1CTQA 1HTWA 2B21A 1KTVA 2XX3A 3CRQA 3VNUA 3WYAA 1G3IA 1RC8A 2W83A 2GJKA 3J81D 4TL9A 4A8JC 5L3VA 2A5FA 2PL3A 2ZRLA 1N33C 1II8B 2IL1A 1KAOA 2QT0A 1NNEA 2XNSA 1N5IA 2X2FA 3PUWA 2BBTA 3I62A 2CL7X 4PC3A 1IN5A 4M0LA 2PX0A 2V8OA 1U9IC 4AG5A 1N0VC 1UKYA 3QBTA 2ANBA 3DPUA 1XP8A 2WAXA 1DAGA 3DKVA 5JMTA 1ZUHA 3KX2A 1U0LA 1ZM2A 4L15A 4NPHA 3NDPA 4YDHB 5AUNB 3H2YA 5HR5A 3D6TB 2OXRA 3CPJB 1P62B 4JJKA 2OESA 4JI3C 1G8HA 1WE2A 821PA 1RJ9A 1ML8A 3FHOA 4OYHA 4YMWA 2PJRA 3CX8A 1RVDA 2WV9A 1NG1A 2GETA 1LS1A 5JS7A 4QC2A 3CB4A 3FMOB 4JI4C 3T06B 2FFQA 1HUQA 3KKMA 4G5RA 2QM7A 2QENA 1OFIA 3C8UA 3GLHB 5B2ZA 4IHQA 1E0KA 4M22A 2RGGA 2B7CA 1XTRA 3QF4B 3L2OB 5C4GB 3RRYA 1DAFA 3U6BA 2F43A 1AKYA 1NY6A 5JSZA 3ZVLA 1IHUA 3ZIAD 1US8A 3AVPA 1V5WA 2QEQA 5JLJA 2IA5A 4DR5C 2NTYC 1MABB 3AP3A 4HAZA 4A2WA 1LY1A 2LCFA 3DZDA 3DO6A 5C4MA 4RJLA 4A36A 3QPWA 3GJXC 2WJVA 3CF0A 4W9MC 4DR4C 1Z2AA 1ZW6A 3QG1A 4L9WA 4JI8C 1X8KA 3N2IA 2KBEA 3AF1A 1AK2A 2WSMA 4JSYA 3V4FA 2G0TA 1Q1BA 1P3JA 4AY2A 2G1JA 4DR7C 2VHQA 1XEFA 4KU4A 3EERA 4URZR 3QXCA 2CHVA 3GQBA 3I8XA 2QAGB 3R7WB 1E6CA 2WJYA 1S9DA 4EPRA 1GUAA 1GVNB 3GLGA 2NO6A 4WIAA 1DAKA 1QBKC 4ESHA 2Z6VA 1U8YA 2E5LC 1DELA 3B8HA 2OLJA 1HNWC 4Q9KA 4KXFB 1HEIA 1Y3AA 1Q22A 2NQ2C 2V9PA 3FYHA 5EXXA 3Q5DA 4B47A 4LGMA 4IDPA 3LAWA 4QJ4A 4TSFA 3WBJA 1WRBA 2ZVPX 3DL0A 2EWWA 2ZRAA 3IQWA 3T61A 1XEWY 1IJEA 1LQLA 3GEIA 1KNQA 2EGTA 4QOSA 2GJ8A 5FBQB 2QRNA 2D7CA 3IIMA 1ZM9A 4MRRA 4XSHA 4DT1A 1UAAA 1QHNA 2OCBA 2PMDA 3AGPA 4CGZA 5L3QA 1GITA 4KFTA 1IY1A 3GKUA 3AVYA 1AGPA 3FMIA 1PLKA 4AIIA 2CE2X 1FPMA 1PUJA 1K5DA 4LV6A 2UZIR 3KTAB 1Z6GA 4ZCIA 1Z8FA 1RFLA 1MO5A 3AF2A 4Q03A 5IK2D 4A8JA 4EPVA 2OCAA 4TYYA 1KI1A 4DUZC 3LH5A 2R44A 1N6KA 3ADCA 4AKEA 4PPNA 2GK7A 3BOSA 1P60A 2VRWA 4IDHA 2KB0A 1ZRHA 2ZJ5A 2IYYA 4JLBA 5CJ2A 4MRPA 2N1BA 1JI0A 4BFUA 1W47A 1VPLA 3A1TA 5KSOA 1TF2A 2RKOA 3THWA 1DVRA 1WB9A 1KSGA 3I73A 1RYFA 2FWRA 2PZFA 1VYTA 2DY1A 2QMEA 3KUDA 1VDZA 2DFTA 5KUTA 1EFRA 1VECA 3SU8A 3Q8XB 4M9SA 1OF1A 5FOWA 3GFTA 2ZS8A 3ZLJA 2KZFA 4IVRA 4II7A 2JJ1D 4F7WA 1S3SA 3T1VA 1US8B 4BLQA 4MRVA 1FTNA 2WPDD 3TQCA 1I2DA 4OI2A 1USPA 4ZCLA 3KTAA 1L2FA 1PZNA 4A8JB 5H68A 2H8KA 4I1SA 4JL5A 1XDBA 2I3BA 2QQEA 1Z0IA 3I07A 1XU4A 4HB4A 4RD3A 1SKQA 2LKCA 2CL0X 3K9HA 4OBEA 1HH2P 3TLXA 2PMKA 4B3DA 1XBTA 2GNOA 1X1RA 1KKMA 4D0GA 1W36D 1G3QA 2XTZA 2WM9B 2Z0MA 4PR0A 4OK6A 1KZGB 1YRAA 3G5UA 3LA6A 3BH7A 4FXPA 4YMTA 4DV7C 4ACAA 1ZIOA 2H5EA 3L8YA 3MWLA 221PA 4GBMA 4TYNA 3ZIAA 3CNOA 3FB4A 4FD2A 2ZYTX 4R2IA 2A5YB 5FI1B 3W90A 2C95A 1NVVR 5EP4A 3J80D 2VHCA 4E07A 1LS6A 5KU1A 2XEXA 4QM6A 1P2SA 4JI1C 5KYKA 1E2HA 4RZ3A 2YWGA 1E2PA 1YRBA 5KDDA 3AF6A 3EAQA 1C9KA 5FL7A 1D8TA 3PUVA 2HCJB 5TARA 4GKJC 1E94E 2YVUA 1TQDA 1HNZC 2C03A 4WXPA 1NSFA 2HXSA 2OBMA 4MITA 1U90A 1X1SA 4KFRA 2G6BA 3LLMA 2ZRCA 2Q9CA 4TMKA 5FTNA 2EFCB 2FNAA 4NDZA 4FWTA 4TMZA 3LW8A 4I99A 3K0CC 2VP5A 4H9GA 3WP1B 1KO1A 4QRHA 1DBSA 1XCPA 4NBSA 1IJFA 2GK6A 4BFWA 2O8CA 1U81A 4XH9B 1OT3A 1G3MA 2HV8A 1EFTA 1U94A 3CRMA 3I4LA 3WRYC 3KL4A 3BB3A 1DEKA 2J5XA 5EXPA 1E9FA 2ZE5A 2PT5A 4WZ6A 3RC3A 3SE0A 4C0BA 4WW0A 2X19A 1T8TA 4UNQA 2UXDC 4B3MC 3VX3A 5HZHA 4MQBA 3VR3A 2IHYA 2NO7A 1J8MF 4NL4H 1L4UA 5B30A 3AM1A 4TQ9A 2UXBC 2GEVA 4E5UA 3CM0A 3EPKA 3LBNA 2JATA 3AVXA 4BFSA 2IYQA 3CUEF 4MH0R 1T9HA 1LW7A 4ZO4A 1NN0A 1E9CA 4KSBA 3K9LA 4Q21A 3A58B 2W2TA 2AL7A 4A92A 3RWMB 3VHXA 2P3SA 4JLNA 4EFNA 4AD8A 4TN1A 3PENA 3RSLA 4LJ5A 5JJLA 1F5NA 4LF6C 2DYKA 1XZQA 1S2MA 3SFVA 2IS6A 4Q9LA 1SZPA 3EASA 3GP8A 1X8JA 3FE2A 5AJZA 1KDRA 1ONBA 2IBMA 4OJKA 2FFBA 1E96A 1Z29A 4ZDWA 1CJVC 3W34A 1UEIA 1F48A 3L0OA 1YU9A 1RKBA 2QE7A 1XMIA 3IIKA 5AJWA 4BZQA 4NXNC 1OXXK 1PUIA 2GZAA 2AWNA 2PH1A 3BD9A 4GI7A 2XXAB 1OKKA 1IY2A 2ZSBA 1Z47A 2OFXA 2QPOA 5KPDA 4U5XA 5J4KA 2ZJZA 1VG1A 3A4LA 721PA 3FFAA 5HKKA 1SXJB 1EWQA 4RZXA 1RRFA 1GAJA 1XPRA 1BMFD 4OHXA 4A2PA 3HR7A 1E9DA 2O8CB 4LUCA 1S0UA 3PG5A 5JS8A 5JEEA 4GDFA 2FSHA 2WJJA 3E2IA 2JLXA 3J81k 4LBWA 2FSFA 4M9QA 4NCJA 1EX6A 3KQUA 2CLCX 4C7OA 3Q72A 4K0KC 2XJ9A 1P2TA 2HYDA 3Q3JB 5L3QB 1ZM7A 1IXRC 2H1LA 4Q66C 4BGDA 2ZI7A 3UPUA 3KJGA 1IBLC 3DM5A 4MTNA 4F91B 4JYCA 4LHZA 4C9BA 2WWYA 4KCGA 3B5JA 3OEHD 1TU3A 2JIZD 2GBLA 4TLBA 2ZETA 2G88A 4HEJA 4D2IA 3GLIB 3EPLA 5LMNC 3H86A 4DR1C 1JAHA 3TNFA 1SKYE 4MGYR 1P9RA 4KHPC 2ZJYA 2P67A 4GZLA 3W8NA 1AIPA 5FLXD 5JRZA 1RRGA 2V7QA 2OAP1 2XSZD 3P27A 5D3MB 4P4TA 5L3SB 3CX6A 1Z22A 2ZXUA 3DMNA 4ZDIA 2OEPA 1F2UB 1TQ6A 2YOGA 2AK3A 3ZVNA 2ZI3A 2FG5A 2G1KA 3ZJYA 3HU3A 3N5CA 1E0AA 1BYUA 1GNPA 3W6PA 4FCWA 4DV1C 3KKOA 1CR1A 3VU9A 4AKGA 1CR2A 1OE0A 1UDWA 2IW3A 3GD7A 2DFLA 5SZIA 2VEDA 3PITA 5CIWA 4C0HA 3IPYA 2Z83A 3ND9A 4TLAA 2V54A 4B3SC 1UBFA 2R6FA 1XTJA 2GRJA 4RD0A 4A4DA 1ODFA 1IXSB 4XWAA 3UKDA 2E87A 2QA5A 5AWFC 1ZUNB 2C9CA 1WMSA 1HT1E 4Q1CA 2WOJA 4PO1A 3U7GA 5JI2E 4YLGA 2JLRA 2WZQA 4TMWA 1VCOA 1SHZA 1T0JB 1IM2A 3IBYA 4IDOA 2ZSFA 4BEJA 4TZ6A 1N6HA 2OUKA 1TUIA 4RY2A 4XIGS 3VU9B 5KNCA 1DS6A 1GTVA 1L4YA 2Q9BA 3B2EA 2VBCA 3LVQE 1B0UA 3QIAA 3U44A 3K09A 4G01B 4KAXA 2X2EA 2D74A 3KQLA 2DCUA 4CEHA 4HDQB 2ZYVX 2WJGA 1N2FA 1M7GA 4ABYA 4HDCA 5ELXA 1M1YE 4C0AC 4IRUB 3OFNA 1CJTC 2ZRIA 2ZAMA 3RAPR 3DM9B 3HJNA 4ZDKA 2OPLA 2RGEA 2ZRFA 4YONB 4M53A 5H8WA 5GADl 5C2JB 3VAAA 1G18A 4KV9A 2VHJA 1NVUQ 4FMDB 3GJ3A 1XPOA 2P6RA 2PZGA 4US0R 1DG3A 2QORA 2BV3A 4DSUA 1S4QA 3N70A 3QF7A 1IBKC 3KZ1E 4U7DA 4F4JA 1FZQA 2P6UA 3U3OA 3RS7A 3GMTA 4MGKR 2RCNA 4OI4A 4LJ4A 2QU8A 1FUKA 2NO0A 4D0LB 2VP6A 1E2DA 3W3AA 3QKSA 4LRWA 3BXZA 2GEDA 1OIXA 2R6GA 2F3RA 4DLWA 4DUGA 2OG2A 1CBUA 2BBSA 1QF9A 1NVVQ 4JZKA 1SXJC 3B9PA 1HR0C 1QVRA 3OE7D 4B34A 5IHPA 2RMKA 5J47A 4EPWA 3FHTA 2J0QA 1F60A 1ZD1A 2NPFA 2O8DA 4O3MA 2AXPA 1FP7A 5J4HA 4FINA 2CCJA 4TMVA 4Q1EA 3RS0A 4YMSA 1OB5A 2RH5A 4L16A 5LB2A 2BBWA 2F1HA 1NIPA 3K0EA 2OAQ1 3C4JA 1RZ3A 1XX6A 1G7TA 3CWZA 2ZI4A 4NHOA 5J4LA 1KO5A 3EZ7A 4YY3C 3C16C 4O2RA 1W46A 1YKSA 4IOKA 1UM8A 4C0LA 3UXMA 4R71A 3KJHA 1JEDA 1UEJA 4FCTA 2YOHA 5EQTA 1JNYA 5CK5A 3VMFA 4F93B 3K0SA 3QXSA 3TR0A 2PT7G 4US2R 2FV8A 3AVTA 4LHWA 4URWR 1CJKC 4ZIRA 2R62A 3K9NA 3O8DA 4PC1A 5EUQB 1HQYE 3K09C 1N6PA 1UBEA 4WZAE 2KBFA 2NO9A 2PX3A 4IKEA 2YC4C 5CYPA 4XWOA 3SHFA 3GLFB 2PEZA 5F9FA 4F4IA 2J7KA 1XMSA 4JS0A 3D8BA 2ZAOA 4JLKA 4O25A 3SHWA 4PQRA 1MKYA 4IDQA 5DSZA 1Z6AA 1JJ7A 4GNKA 5GJWC 2QGZA 4FMBB 5P21A 4GMDA 1WH9A 2JJ2D 3NBYC 5EXSA 4RFSA 1M7HA 3RNLA 3CKLA 1Q3TA 3SYLA 3SFZA 3AB3A 3BC1A 4DEYA 1P9NA 4FMDF 2OHFA 1PJRA 1VCNA 5HZKA 3LX5A 1OXVA 3P26A 3KB2A 1W49A 2GF0A 3ZGXA 2RGNC 2A5DA 3AP1A 1TNDA 4DR3C 1E2LA 5HCNA 4Q1DA 2ZI6A 2ODEA 2YZ2A 4Q4JA 2YKGA 2IF0A 4ZI2A 1KKGA 1F3OA 4KHZA 3QG5A 1AS0A 3K0AA 2QI9C 2R6CA 1N6OA 4HZUB 3QKTA 2WWWA 3GLHA 4FI3C 3TAHA 1XCMA 2D3WA 1ZIPA 3A37A 4TTRA 4ARZB 4C3ZA 2V1UA 5DNYB 1NVXQ 2J59A 4QJ3A 1SVOA 1E79A 1YR8A 2UUCC 1JXOA 4KJZA 4DV3C 4Q02A 4GL2A 5TB5A 2REOA 1E2QA 3CPHA 3F8TA 3CH5A 2L0XA 4TQAA 3X1DA 2DPXA 3VR6A 5C1BA 5GJVC 1M6NA 1D9ZA 1JPJA 2WPDA 2AD1A 3PVSA 2QL8A 3LFUA 4NE2A 2E8FA 1JEEA 4IVPA 5C46F 3VHLB 2C5LA 4F92B 1GM5A 1SVWA 3C15C 1K6MA 2RGAA 4JVMA 3U5ZB 3B78A 1M8PA 2YHSA 2JEOA 1UBCA 5BYJA 3THYB 4GOKA 2FPKA 3NTUA 3BRWD 2GTPA 2QAGA 4EPTA 1FL9A 5E7JA 3ICQB 1IAQA 2ZJ8A 1XTIA 2BCGY 1QG2A 3UANA 2IX3A 3L8ZA 5G3ZA 2B8TA 2QL6A 3B1WA 4B2LA 1TEXA 4FW9A 1FNMA 3PJRA 5DIFA 4Q4HB 1KNXA 1MRSA 1ZM3A 2IXFA 3LWNA 4Q1AA 2VIIA 1H65A 2DFNA 2W6IA 1ZNYA 1WXQA 5AJYA 3SN6A 1GL7A 1M2OB 2E9SA 5G3YA 4PSAA 1FUUA 3BBPA 2O8BB 5F2EA 3MD0A 3LDAA 2UUBC 3RHFA 3M6AA 4LJYA 4LPSA 5B57C 5BYKA 1J8YF 5BQ5A 4KBGA 4BEBA 5C18A 2A30A 3ZS9A 1VYUA 2BCJQ 3PUXA 2ODNA 3S1AB 3A1UA 1W4CA 4P33A 1GSIA 2R6AA 2V6JA 1NJFA 3KXLA 3QPVA 4DT1B 2EU8A 2AFIE 2C9YA 4TLCA 4MH4A 4DC9A 2IEZA 3ASZA 2Z4SA 1L7VC 2BOVA 2PEYA 4GMXA 1KMQA 1T0HB 4Z54A 3TJZA 1GG2A 3CW2A 1E99A 1Z0AA 2J7PA 4MA4A 5LPNA 3SBEA 1NRJB 1TU4A 3FFBA 1G6HA 3C5CA 4RD6A 1A5TA 2A5GA 1WP9A 2CE7A 1ETUA 2XTMA 1E4YA 4LBYA 3RVBA 5G40A 3EIHA 4LY6A 1KAGA 2Z5FA 1XPUA 4EIWA 4Q1BA 3ZDQA 3ADDA 1HA3A 4P4SA 5GJBA 5FBLB 1W0JD 2C04A 3DHWC 3LXRA 1QRAA 4Y0AA 3TSZA 4DHEA 4DV2C 2FOLA 5JWOA 2WWHA 1I4TD 1YZLA 4DLTA 2WMOB 3W3ZB 3V9PA 1QHGA 4TMTA 3BH0A 3RDPA 3B1ZA 1KO8A 5CM8B 4A1FA 3EWSA 2VA8A 1G5PA 4DRZA 2CXCA 1H8HA 3THWB 4MKGA 1VG0B 1E9BA 4DSOA 4AKIA 4TT3A 4RFVA 1TAGA 2F3TA 1NY5A 3SDZA 4YXWD 3GLGE 4LV8B 3RSOA 4N0EA 3ADBA 4NP6A 5D3QA 1XZPA 1Q57A 2QAGC 3OEED 4LJ6A 4W5HA 1E9AA 2GJ9A 2A5JA 4TL6A 3T15A 4D6PA 2CJWB 1XWIA 2QE7D 3OIYA 2ZSDA 4ZI3A 3QY0A 4UNPA 4D4LA 2HJGA 3CNLA 4G3XA 4MGIR 1XF9A 2KSQA 2CVHA 5KNDA 4C7OB 2E7GA 2VP9A 3PXGA 1L2TA 4Q1FA 3PUZA 3LO5A 3HDTA 1LVGA 3L0SA 4OL0A 4XD7D 2H18A 3RS3A 4B6FA 3X1ZA 1G4UR 1F6BA 3T1HC 1N5LA 3EA0A 1ZC4A 4GPTA 1K5GA 3R9IA 5DI9A 4QFMA 5K8TA 3ZQ6A 1EX7A 3V4RA 3R20A 3QXHA 4C2TA 2X77A 2XJ4A 2R6DA 3OIVA 3VX4A 5EE3A 4X8MA 2VQSA 1VLAA 2R65A 2ZRNA 621PA 1G20E 1GKUB 2BVNA 2AKYA 4M1WA 3EZ9A 2Z4RA 4IFEA 2AWOA 2IS4A 3SOPA 1E9EA 1M74A 4B71A
chains in the Genus database with same CATH superfamily
1S2LA 5IDYA 3R0QA 2GBPA 4B7XA 2SCUA 2PSDA 2ZJOA 2GAAA 3DDHA 1UINA 2ZAGA 4EI7A 2GSDA 3AEXA 1K7EB 1RWQA 3RYTC 3K6JA 3R9XB 4HRYA 1O03A 3K8OE 2WW8A 4TLLB 3KQNA 2QTHA 3LYUA 1CJCA 3GEMA 3IODA 2L42A 3QFTA 4FNAA 4GKBA 4IVQA 1J5XA 1EFPB 4JLJA 2D7VA 4RPCA 1WDTA 3L6UA 5HS6A 2IYOA 1W5SA 1PGOA 2NZJA 2POCA 5ALHA 5A7GA 3U7EB 4LJRA 3TKAA 4IY1A 3QWAA 1MT0A 4PHGA 4UMFA 1WBBA 2IYXA 1V16B 1Z28A 2C3UA 2OGUA 1M1NB 3DBHB 3HMQA 4UBLA 1FRVA 1FQKA 1MNQA 1P2VA 1I2ZA 4PYRA 3QLEA 4WKCA 4OO3A 3HNRA 1Z6ZA 3VR5H 1JFVA 3RLFA 3IBTA 5BV7A 2J7PD 3RANA 4I9HA 5BWCA 3E22A 2X9QA 1P29A 5LQJA 3A6PC 2UUOA 5IDXA 1NJGA 2V5VA 4OXYA 2W90A 2AD5A 2WWRA 2A6PA 3NHUA 1LWOA 1YASA 1M6HA 4QJIA 5JXHA 2FLKA 1G5IA 3WOHA 1YE8A 1YZKA 2GUGA 1IG3A 2BT4A 3COWA 3X1XA 1EGHA 2ZBVA 4JI1B 3RC7A 3M1AA 1UT6A 4HLUC 3HFSA 5THKA 2G9ZA 2ORWA 4Q4JB 5DN6A 3WTBA 3ACCA 3DZBA 1IOVA 4UOZA 4LYJA 2A86A 1N5KA 4CQLB 3I08A 1GU1A 4FIDA 5G1NA 5H9UA 4GECA 1Z7WA 4IOLA 5BUZA 1Z2CA 4LOKA 1Z34A 3TW8B 1ZMBA 2NAPA 3RFTA 1II0A 1ZKMA 3GVHA 1JHQA 1U7OA 2HZBA 2BZGA 4MV5A 4IDEA 5FPPA 3UW3A 4EHFA 4ZI5A 1E0JA 3E7WA 4GPAA 2NV0A 4Y2VA 1PDVA 2ZRDA 4F7DA 1HYQA 3K53A 4PPYA 4S24A 3JASA 1T1GA 2ZITA 2JFUA 4N5DA 4RYLA 5CCEA 1BMDA 4LQCA 2W2QA 4QU0A 3LCRA 3Q3IA 3S1AA 1R0YA 4N7MA 3NXSA 2J9RA 2WMNB 2B7LA 1VC2A 5ES3A 3WNZA 4QBHA 3CR8A 1SB9A 3TLYA 3TOCA 3ZCXA 4K0BA 3QE2A 4RY9A 3VDXA 2DZDA 1YR6A 4QHTA 2ID9A 3REFA 3O83A 4F04A 2VATA 1YR2A 4HBGA 5A3SA 5UKDA 3ZE9A 3G68A 2OO3A 3GLFE 4AKHA 2O1SA 1XLWA 3LKZA 1WBDA 5DDIP 4J91A 5BRNA 1QO0D 2IXGA 4TTIA 4MVJD 3C3BA 1NLYA 5U4XA 2EG9A 3KU4A 1TO2E 1CZUA 5B1HA 3KOWA 1QO9A 3TKLA 3AB8A 1NXTA 2V7WA 3R9WA 4CT4B 4MKZA 5LD2B 3RBVA 1HDZA 1KETA 3MOGA 4M1SA 1R4AA 2QLJA 3ENKA 4FXOA 1HWYA 1ODSA 2PT7A 4GUAA 4S1TA 2E85A 2IRWA 2POQX 3EWAA 3PD0A 1UKZA 4QUEA 1WXGA 4KRXA 1Y7PA 2P3QA 2VYVD 2BMEA 3ETEA 2AXQA 3L7BA 3A4MA 3QVVA 4JC5A 4UTXA 3RK1A 3TCNA 1E1RA 3WLQA 4QO8A 5BW4A 4NZYA 5BR1A 2OM6A 3A6LA 4W5TA 2CLHB 1JE0A 2O0HA 3WTCA 4YRFA 3VQTA 1E3MA 1CCWA 4JOCA 1JEJA 3OF2A 4RK0A 3PUJA 4BE4A 4DCPA 4AECA 1FP6A 1OU4A 2J45A 1JXMA 3T5TA 2NU9B 1ZVQA 3OZAA 4WVFA 5D85A 5EMMA 2PANA 2VG8A 5C80A 1K3UB 4YI5A 4ZANA 4Q4CA 1JHXA 2NUBA 3E9QA 3JYNA 4HH4A 3ZBPA 4A26A 2HJ9A 4KITB 2NW6A 5EIEA 1NQTA 1SRRA 5IM4F 3PCRB 2W6JD 1RXUA 1QM5A 4CV2A 4CCSA 1B43A 3QEMA 5GP1A 3WJAA 3OC0A 4DUYC 1BFUA 1U8ZA 3VYTB 1T4DA 3EA4A 3Q0EA 1PSWA 2EZTA 3IJEB 3MCWA 1SXIA 2HGZA 2RGXA 2RGUA 2WP0A 2ZQYA 4JB2A 4YMLA 5JZBA 1W0KD 5JS1A 1XRPA 5DLDA 4K9LA 3AF5A 2XB9A 3FFTA 5H83A 2WHXA 2BFBB 2AXNA 3HB9A 4KNVA 1NW4A 3G7SA 1G0NA 3MAGA 1XTUA 3KLPX 2FFHA 2DY0A 2H9AA 3L9XA 4IGKA 5AUQA 3IEVA 1FMFA 3BL6A 1FFYA 1E0DA 4G4SO 2DQKA 2DHQA 4ENSA 1X9IA 4M9ZA 2Y1EA 3DLTA 4UZSA 1KDOA 3L7MA 4CMKA 1EGAA 1QGED 2CLEB 1XQ9A 1P5FA 1PZMA 1X0VA 5IEJA 2Q3MA 3UJ7A 1HMYA 4OQQA 1D2HA 5IJXA 2WIGA 3ESBA 4E70A 3TWOA 1P7YA 1FY2A 1JA1A 1N5OX 4QRDA 3UK7A 3ZC3A 3ITDA 4WBXC 1GL6A 1TT7A 1EE1A 5FKJA 1YZHA 2Z1DA 1AHNA 1RJFA 2A1TR 3RR2A 5ISMA 2FN3A 4O4HA 1L4LA 3RAFC 2BF4A 3FIUA 1P9WA 1XD2B 1P5HA 1KI7A 3U80A 2PZAA 4FYKA 4OXQA 3QKIA 4BQEA 2ABWA 2MSDB 3AM5A 3FTDA 1H1TA 4K81B 4MS3A 5T64A 1XEWX 1DBVO 2ZRHA 3ZHQA 4K88A 1KI8A 2BFFA 4TYPA 1E1QA 4R7GA 2GVZC 2GUWA 1K08A 4D4IA 2JHAA 3EA5A 3EEOA 4DA4A 3MLAA 4RIGA 1RRPA 4QNRA 4BLPA 3HKDB 2ZR7A 4ZAVA 3NR2A 4WBNF 1UPFA 4RNDB 4A2CA 4JP1A 1Z7YA 2ETXA 2JI4A 3WDKA 5AW8A 2HBRA 2RK4A 3J81A 4IW3B 1Y3FE 4I1IA 4B33A 3D8HA 3E7PA 1UJ6A 3RYCB 1LDGA 2HZ7A 5KDLA 3I5YA 1JB1A 1T2FA 1I9GA 2GN4A 1VMIA 4HYTA 3TE6A 3USZA 1Q21A 3TTSA 4DQUA 3I2HA 2X3UA 4IMPA 4YCCA 5L7TA 1T3SA 2B25A 4B2YA 1U31A 2H1WA 1FDOA 2WFAA 1FJHA 3VZDA 4TKVB 3IQZA 4BCAA 4WNAB 3EH1A 5IJAA 3VXKA 2PD3A 2A88A 3VZPA 3D1VA 5IFLA 1FTWA 1RHQA 1ESMA 1IQPA 3R5KA 2OUIA 3AX6A 3H0KA 4P84A 2PQ0A 4EW2A 3GJQA 1B15A 1AHHA 1T8SA 5CFLA 1JLLB 2C2ZA 2Z5LA 3ET4A 1UXJA 2PZKA 1XLTC 2ATIA 3TW4A 2KDNA 1NAHA 4RK7A 2KMLA 3E58A 3CU5A 4F4DA 1XCBA 1TJYA 3HKBA 3SJAA 4DBVO 4YUWA 4U1RA 3TTXA 5K20A 1XALA 1YUBA 3AU8A 1GAQA 1M5RA 4F46A 2VWQA 2YR0A 4IYJA 3G79A 3AF0A 2C2HA 2EYQA 3HR8A 5EJ2A 3OCJA 5HFNA 2O1XA 5A4JA 4PG4A 2D62A 2DC1A 2FYTA 2MYUA 2VAXA 3MUFA 4W5WA 5TGTA 1XG5A 2H2HA 1J5EC 3CLSD 4M8LA 4OFBA 4X95A 4ZREA 1V0JA 1W93A 4GOMD 5D3KA 5KCZA 5LCIA 3HUEA 1IN4A 2D0PB 4LCBA 4NKRA 4V38A 3TM4A 5AVSA 4OX9Y 1HDXA 2J9GA 5KYVA 1X3LA 2CB0A 1SVKA 2OZVA 2ZRMA 4ICIA 3HJAA 3ZHUA 3NHRA 4KFSA 1ULTA 1ORRA 4TXJA 1EQUA 5DYYA 3J7TA 3RKUA 5DTEA 2IWHA 3A1CA 5L51A 1DG9A 4TKUA 1M7BA 1YOVA 2FVXA 1UL1X 3W6ZA 5ITZB 2VTDA 4B3RC 1OH5A 2J0SA 5AXAA 1DFGA 2W6JA 1YHNA 4NYJQ 4Q3KA 3KHKA 3MRXA 5CAEB 3RVQA 5JFOA 4X64B 1XEXA 2WTUA 2Q0QA 3ICEA 4MV3A 1W88B 2FG7C 3G82C 5TGDA 1VJDA 2ONKA 2H06A 1C4OA 2LR0A 3CH7A 3EB9A 4FLEA 3WMEA 5B36A 4NJEB 3MW8A 2G70A 4KRYA 3I3OA 3D43A 1AGNA 2FHPA 4Y7CA 4FX2A 5FPSA 1I5OA 2XE4A 4DXAA 1C7ZA 1ZN2A 3M6UA 3OAAA 1WB5A 4OGLA 4UCWA 4WTOA 5EP3A 4C4TA 1ZHOA 1KJYA 4C06A 2V6FA 5JV5A 5A2GA 1NA5A 2VXCA 2WK1A 3ICCA 4L8FA 4H3KB 4KWIA 3R7BA 3KR9A 4GEKA 1CP3A 1GKYA 2OXEA 4H0NA 4RZHA 5I7WA 3RIGA 4BLSA 1PR5A 4C0JA 4DLBA 4XQEA 4RPJA 5ALKA 1AKRA 4BBYA 5KQLA 1I2MA 1U0NA 2V6GA 3OLYA 1MAVA 2DUMA 4YJHA 1LI5A 1XZEA 1V60A 2IHTA 3EQZA 3FFXA 4TTJA 1PEDA 5E6SA 5FWYB 2P2LA 3ZQJA 4J7XA 4YRGA 1OAAA 4PXSA 2C4HA 4JR2A 2LNDA 2I6SA 3N1UA 3K1TA 3N76A 1YVEI 4ND8A 5JQGB 4QDZA 4PYIA 4PW0A 1H69A 4FPXA 3FPCA 4UDNA 1CS0B 2A9FA 1TYZA 1F20A 2C4WA 2G3YA 3PTLA 3QITA 4C30A 5KVCA 1HNXB 1YK0A 3N3BC 4HFRA 2QQ5A 3SSOA 1MC1A 1S3FA 2FDRA 2Q99A 4JI5C 4WOBA 5FT9A 7MDHA 1KIFA 1NR7A 1TYDE 4PSKA 1YJXA 4RGQA 5C32A 1XRQA 3SLGA 5CLJA 3QVKA 4HJXA 3MAJA 5H70A 4GOLD 2N1MA 1R8QA 2BMWA 3F5DA 5K3FB 2BM9A 3BAFA 3OO0A 2RHCA 1E5QA 2CNBA 2AKAB 3CR7A 2FUG1 3WWDA 4UAJA 3IMLA 3G8CA 1N36C 1KQPA 1Q7GA 3QWHA 4J03A 4PVCA 4B4WA 1CULC 1I4EB 3LDGA 4MDEA 2BDEA 2YY7A 1VSQA 2H29A 2LZ0A 4H1TA 4MVJP 4UFNA 2XODA 2HSDA 1YJQA 1M6WA 4C3VA 3W8FA 1LBHA 3PF9A 3UMRA 3ZYZA 1Q0UA 4DY6A 1DCTA 2EJUA 3NX4A 2G7MC 3IOBA 4AZVA 1FTSA 4OJNA 1SO8A 2KJQA 2NT4A 4JGGA 5BQFA 3PD7A 4FWBA 1IHXA 2X0KA 3DKKA 3ZH9B 2MMAB 4YK7A 1UH5A 2J0UA 3AJDA 3A6JA 3BL8A 3O84A 1FLVA 2I91A 1J42A 3BD7A 2I87A 4PO9A 3LUGA 2ORIA 3NHAA 2XKBA 3UMFA 1NQWA 3AEZA 3EXIB 4JQCA 1VJ0A 4G5FA 2R84A 4BN0A 1VI5A 3EQ8A 2QV0A 4ZYLA 1H8HD 4I7EA 1XLVA 1U0RA 3KELA 4Z3KA 2BMJA 2C2OA 4JBXA 2O8EA 4I36A 2QRVB 4M9RA 4XVUA 4RVCA 3GFOA 2V6IA 2M32A 2E37A 2X0DA 1JDPA 2M2IA 1KBZA 1KO4A 5LKAA 4RM3A 1L4HA 1DC8A 3DL7A 3QTBA 1II8A 5IVHA 2O3UA 2M9MA 4E31A 4G84A 4UTRA 1JIIA 1V6AA 3H1TA 3LOUA 1I0ZA 1A5SB 4QUGA 4FYXA 4ZEXA 1ZGHA 4X1OA 3OTWA 3RTDA 1DB3A 3NATA 1W9HA 3VHRA 1TGYA 3EHEA 4PLCA 4MQFB 1M2WA 1CQIB 4LYAA 1GCUA 4RS4A 1NXXA 1QOQB 2FW9A 3O2QB 1TYBE 2BEWB 2BR4A 2HA3A 3EXEA 3R5SA 4K8RB 4OGKA 1THTA 4OSPA 2IEBA 3D02A 3IYLW 4XUDA 4Q05A 3ROKA 2JLQA 1LB1B 4DCVA 4X60A 5EGNA 1L6IA 4MVXA 4B3CA 4CVNA 3C8HA 3ZE0B 1LF0A 3IUJA 4GMGA 1HV8A 3NRCA 3TRHA 5IXJA 3RS5A 3GVIA 2FPIB 4YAIA 2Q2VA 3HUUA 1Q20A 2O57A 1K8YB 3BIFA 2VJAA 4Q3BA 1M1ZA 4UQOA 4WHMA 2CN1A 1VSTA 2OFOA 3NHMA 5A0FA 5LZ7A 3VZCA 4DQDA 8ABPA 4ALKA 2E7ZA 1V39A 1V5FA 3BORA 5KQRA 1N6IA 4DHEA 2FWMX 2JAPA 3JQDA 3LUDA 4KVAA 3AEKB 4XX1A 2G9VA 3W2HA 1R88A 2CZCA 1ISMA 4RGYA 5JJBA 3SIPA 4Y1FA 3HA3A 4FOOA 4Z3DA 3ZV3A 4XRGA 2VKQA 4L5CA 4C5AA 4P0PB 1Z8NA 2ZP1A 3LYHA 4P4NA 1KDYA 1OX6A 1Y9ZA 4HNTA 1U3CA 5L3ZA 2F4VC 3DDNA 1DRUA 1W1UA 2QRUA 3HL4A 4H7IA 3BGDA 4OKNA 3ER8A 2Q3DA 4M8IA 4CM4A 1JHAA 1W8DA 3RVLA 5GWXA 5JAQA 1Q1AA 2GYWA 3PXCX 3D5QA 3ZHCA 3UYLA 1V25A 1MC8A 3D6NB 1LK5A 3F4KA 4YECA 1XCLA 5JMPA 4CI9A 2IPMA 3HB0A 1D4ZA 3EGDB 3CJQA 3TCXB 2QRMA 3LL7A 2QMYA 5CB6A 4R3WA 1GZHB 1ZD4A 2EKDA 2BYTA 3FZQA 1J99A 5B2FA 1ZUD1 4IXMA 1KF0A 4GKKC 1RQ7A 5GV8A 1JALA 1ORDA 1N2XA 3IPLA 1UQUA 3ESXA 4MKRA 3EH2A 1QQ5A 2QQFA 2IHZA 4D4GA 1XQYA 3QKRA 3DE7X 2BF7A 2XUGA 1JFFB 5KNBA 4ZZ2A 4EDFA 3GT0A 3HLYA 4JX9A 5JD5A 2RHBA 5FFMA 1FJXA 2VSFA 2R5WA 3JATB 1ENPA 5GV7A 1JZTA 1X7YA 4EY7A 5JJKA 3FYCA 1YWGO 4E3ZA 1NN5A 4EX6A 3B6ZA 4Q7MB 4LNUA 4UBMA 4ZKEA 4F9GA 3TLEA 4MIKA 1WZ2A 1MA0A 2VNKA 2RGBA 3K1YA 1TM7E 4BNZA 3QUSA 2P6OA 1QAOA 2YN4A 5K0GA 1CR0A 2DWOA 4FOLA 2OFFA 3E05A 2L18A 1YR3A 1WPQA 2LUOA 2IDZA 3BREA 1JLRA 4H27A 1IBMB 3GOQA 4I66A 1RBMA 2OXCA 4LFCC 1YQQA 4FDAA 3ZY2A 1J1UA 1AKMA 3H4TA 3U7QA 4NPCA 2F1OA 1X7WA 1M0WA 1ZHFA 1ZD3A 1SA0B 1Z6QA 1E2FA 3QKSB 3U61B 3LE8A 5FFFA 3WMFA 3ZH2A 2Q2WA 3KQPA 2JGFA 5K6AA 1OLUA 4LTNA 4R1LA 1M8GA 1O77A 4XVRA 4YJKA 4CIXA 4F3TA 4PRLA 1HH4A 1G6OA 4JP3A 4A8HA 2P9YA 2OBVA 2AG5A 3LIPA 1SCNE 2GM3A 3B85A 3CW9A 1A8HA 1UJ2A 1C29B 2XMQA 3KKPA 5BOVA 2XGJA 2C9MA 1TK2A 1ECPA 2NTVA 2Z9BA 2C3OA 1F51E 3IOYA 5HKOA 1R0RE 4LYHA 1DP4A 5BQOA 1KFCB 3F5FA 2DP4E 4PZCA 3V4LA 4TRRA 1UDXA 1BCSA 2I6FA 4HNRA 3WQSB 3MWKA 3NNDA 4R9UC 2P77A 2ZATA 4QODA 3T35A 8MHTA 3W5VA 2IP2A 1H2BA 3UBMA 2XUFA 4KAJA 4MS1A 2O9JA 1JHRA 3T7AA 3ASYA 8ADHA 1J90A 2JASA 2QTFA 1Y9DA 1MXCA 4NYMR 4Y9SA 3RD5A 1COWD 3SBDA 1IE3A 2ZIUB 1ZD8A 1A8SA 2E8EA 3BRWA 3NETA 4L95C 1Y7TA 4V03A 5D5HA 2PTGA 3R75A 3VKWA 3PUHA 3NEYA 2ZPTX 1ZH6A 3FLMA 4FR0A 2ZU6A 3UJDA 3WLNA 2IK8A 5BSFA 3WLEA 3LDHA 4FR2A 2FHSA 1RLUA 2LKDA 2BWJA 5EP2A 1HRDA 3HSYA 4CNBA 1ITZA 2I4RA 5DYNA 3A3PA 1SGWA 3HB7A 5A05A 4IIEA 4UPVA 3R77A 4MV7A 3ZWWA 3TG2A 2CWDA 3BT7A 4I50F 3VU0A 3D4NA 4AZ0B 2PN2A 2ZR0A 4AZWA 4BE9A 2CVFA 3NZEA 3WGQA 4GRAA 2FSGA 2J4FA 4EG8A 3CF4A 1QC5B 5LBIA 4HDRB 1P8JA 2FZ5A 4OQNA 4F2PA 1KEKA 2UZ1B 2O8BA 1JR2A 3ZEAA 3ETLA 5KINB 2BGLA 3G6KA 1YD7A 3AI3A 4I55B 3LLCA 4LWQA 4GW3A 1XZDA 1XDGA 1PUXA 2IQIA 3OWXA 3PC8C 4Y9RA 1DINA 1D2AA 3DFZA 2DBZA 4JVSB 2L17A 3WWOA 1S7CA 1EA7A 1NFQA 2CVQA 3FETA 3P9PA 1Z63A 3SQXA 2PZEA 3KTDA 3CTPA 4K6CA 1X13A 1DBWA 2K7FA 3O92A 1TL7C 1N34B 1PRYA 3WNBA 4BZWA 1A7UA 4QM7A 1R6XA 4FI3F 4KKXB 3K2BA 3FTEA 3EOZA 2JGDB 2HNBA 1ESZA 1DZIA 4HPJB 3RRXA 2ANCA 2RAUA 5KYWB 4PGFA 1W87A 5IM4A 4NOZA 1D4OA 1YZNA 3DE2X 2Q4RA 4MRSA 2YDYA 4OLFA 1KRHA 4ER7A 2Y1GA 3MG9A 5HEKA 5BWMA 2QPAA 1U11A 3ENNA 3UPTA 1KY3A 4YP7A 2QD1A 3NJ8A 1MO2A 5CGQB 4EGSA 2NU7A 3JASB 4EUSA 1K97A 3JY6A 4PC6A 5C7IO 5CEFA 4KRFA 3D4BA 2JJQA 1KIAA 1YVPA 2A58A 3GL9A 1C1DA 4JNKA 5D6NA 2XOKA 4ZKDA 2ZRBA 3I8SA 4RTOA 2QLFA 3H1BA 5CGZA 2PS3A 1L4EA 2FR0A 2XLCA 3DLBA 3L8CA 2BEUA 3NBAA 4MAFA 4RJIA 4B44A 1DKRA 2ZYWX 2FP4B 2I03A 3MQFA 4XFDA 3CZQA 3FF1A 5SV2A 1Z5UA 4DABA 3C6MA 1XEXB 4PHCA 2DG2A 3FLBA 2JLYA 1OFUX 1W88A 2PS1A 1QIFA 1IK6A 3C70A 3MSXA 4D26A 1VLJA 3GY0A 1LBQA 5HUQA 1H05A 4TT3D 1XKXA 4LC1A 3F6BX 3RTBA 4Z1OA 1B1AA 5EIAA 4E13A 4LVNA 2OHJA 2ZAIA 1OZFA 1YO6A 3WLTA 2JA2A 3ANYB 5DB4A 2JIDA 2WKPA 2DFDA 3OEEA 2ZRJA 3QLUA 2XIJA 4RX1A 4O4HF 1N5MA 1FF9A 4CF7A 4QDJA 5D1HA 5JARA 4EFDA 4DSNA 3R3JA 3NKLA 3RAGA 2YVAA 2YIDA 4JNCA 3F8SA 1DRJA 4KQWA 4EBFA 2PX5A 5EZQA 2DGDA 5IP5A 2PUEA 4JLSA 5I3CA 2BEVA 3OX3A 3CINA 4DCCA 3EIFA 1E6MA 2FGJA 2YWHA 4LF5C 1EM6A 1K6JA 2YWFA 3AI7A 1G2IA 4PO3X 4JT4A 1ILWA 4TWZA 4XD7A 3NLLA 2F7SA 1Z0SA 4HH1A 1G1AA 2WPNA 4PFKA 5BQPA 5DNDA 1FTQA 3E15A 2EFJA 1KH3A 2ZYHA 4H18A 4MW7A 5ENDA 1K89A 1ZEJA 3AP2A 1X7XA 2GEKA 3OOSA 3DDCA 4XVQA 2OSVA 3QE4A 4IJVA 1SHKA 2P0YA 2QP4A 2Y0PA 3D5EA 3IKTA 2HF9A 1CUDA 3NNSA 4K6KA 4QJBA 5D5PA 3WK4A 1X0XA 2GQ0A 4QNMA 1ZLYA 2FQWA 5I47A 5DGDA 1B7GO 4GLBA 3JQBA 1Z6YA 4RCYA 2ACEA 5AJVB 1Z2DA 2J09A 1WXEA 4RTLA 1CJMA 5KTSA 1NVBA 2FCRA 1FUGA 2O8NA 3TIFA 3CISA 1TRHA 4RWEA 5KHAA 4AP5A 2CV2A 2EXXA 4FJ1A 3UO8B 5LNK6 2QTTA 1LX7A 1VL0A 1FSFA 1O8CA 1Y4UA 4F5ZA 4Y2JA 2IYPA 1P0FA 1H3NA 2EP8A 2PKQP 3JWGA 2VF7A 4O1IA 4F1JA 4EUEA 2V7BA 4NCNA 4TYQA 1T3HA 5THXA 4DLAA 1WCV1 3TJMA 1RHUA 2I3AA 3BULA 2X0NA 1DBPA 4INAA 1TJ5A 2BFBA 2CGEA 2ZYIA 5EHIA 3ZE1B 3ETDA 3TGWA 4KV7A 1HNWB 1HFEL 1H0HA 2GCPA 2OKGA 3KB8A 3WWCA 3P9CA 4BRUA 2VPIA 3ADPA 3P2IA 4HATA 1XD2A 5H80A 4HUQB 3RCBA 1SU7A 3SIWA 3R40A 1DMSA 1T35A 2LRHA 4Z9BA 1ETHA 2NP7A 1JDNA 1YZQA 3EIOA 1PV2A 1IONA 3OMXA 1PL8A 2OYSA 4EY3A 5DO9A 3VPCA 1OIVA 1T24A 2X4GA 1GFIA 4W1SA 3T7KA 4MUMA 3GFQA 5TGZA 1DSSG 1CR4A 1S6YA 3C4VA 4EGJA 3GLHE 2YMMA 4PXYA 3WRXC 5B3JC 5C7LO 3PHBE 1LGYA 5IN4A 2CF6A 3DR3A 4C5CA 3ORRA 1J8VA 2VQ3A 1JJBA 2DFKB 2EZUA 3KSMA 3EG5A 4HHEA 5IH3A 1KYVA 2WUWE 3WMGA 1KH2A 3MJHA 4EENA 4RF5A 4MHSA 3UGKA 3KBOA 4UM5A 2VK8A 3P5SA 2YHUA 2B3DA 2H2GA 3QQPA 4LE5A 1QH8B 4CHGA 5CFZA 1V9CA 3LPCA 1J0AA 3I61A 4OYYA 1T1RA 1IN6A 2PFGA 1JG2A 3F9RA 4L85A 3T52A 5IKEA 3Q9LA 5ESRA 4DLXA 4CIWA 1XTZA 2P6MA 3RS8A 4LY0A 3VJLA 2J9ZB 1JKFA 1HDGO 4F1WA 1RAEA 5B12A 3BZBA 5ITWA 4NEGA 1E5VA 4QBTA 2QRQA 3TR5A 1AN0A 4DR6C 1O7JA 1U7UA 2ACWA 2EX1A 3QFCA 2P40A 5FLEX 2XKKA 3ZGLA 5F7ZA 3R76A 4OQPA 1OBVA 5C81A 3WQQA 4Y2XA 1M6XA 3PROC 1ONPA 3MINA 4PX3A 3WR5A 4X45A 1BDMA 1Z7GA 2FEKA 4KG7A 1ECBA 1GFZA 2BEWA 2A57A 2CJFA 4I8XA 5IS2A 5JD4A 4HG2A 4H4CA 5GIPE 1DPFA 2NACA 3EBLA 5C1PA 1JSLA 4H08A 4KZKA 2YHIA 4DQKA 3STYA 1A7AA 1Z4MA 2EJWA 2R00C 4B80A 2QUJA 2RDMA 4X1KA 4TTTS 1NV8A 4L4SA 1D1PA 1M2FA 4DOMA 1OYVA 1N33B 1QO0A 3D54D 3DEKA 5HOQA 1JHZA 3PV0A 5CRIA 4BAZA 1TQ8A 3FNFA 4GG1A 4BMXA 4BPBA 2H3HA 4MZXA 5CDFE 5DXJA 3H05A 5TPWB 3INRA 4UULA 3BQNB 4L27A 4DDHA 3DL4A 3MBIA 3VYUB 1NQOA 4OV6B 1EXMA 2YJTD 3EVEA 1KERA 2CEKA 1P73A 2I7XA 3IERA 5FBRB 3ZWBA 2GHQA 2WRZA 3GAAA 3O75A 2QNRA 3N0RA 4LC0A 1IMJA 1FPQA 1Q1EA 2VP0A 3WP0A 1CV2A 1JIVA 1C2YA 1XXHB 3SQLA 2C29D 3U1BA 3HEMA 5BSWA 2G0NA 1BMQA 3UB3A 2ZM6C 2IS2A 1E79D 1SCAA 1ST2A 1XL1A 2QKYA 1BS1A 2RONA 1P5JA 3RIMA 3GDGA 4OQEA 4ON9A 3K6SB 2GM9A 3BXOA 5DX8A 4QPJC 2MYPA 4EKYA 3X2SA 4ZALA 1EFHA 1UBJS 4K28A 1YNOA 2D59A 2C58A 2P9EA 4ZARA 3D4IA 3VR6D 4MWCA 1PHRA 4EW1A 3KZKA 4LWPA 4LJSA 4PUIA 4N5LA 1HQKA 5REQB 4XPZA 1PEAA 3IHLA 2CK3A 3DMYA 4TGLA 2WJHA 3WLOA 1V1JA 2P0EA 4DL9A 4DSTA 4B87A 3ONDA 2F4VB 2X0EA 1Z17A 3TYXA 3FKSA 3VBCA 3BFVA 1SXJE 1X7HA 3AKYA 4XPIB 5CITA 2HQRA 2OHOA 4YUVA 3TLCA 2IPNA 5TJHA 2VZ9A 2E2WA 4A0HA 1KYWA 1KK2A 1X7YB 2PT6A 2Q5EA 3ZQ4A 4ZMSA 4MWGA 4TWRA 1ZIYA 2DWCA 1PD1A 1IY0A 3THSA 3N05A 1LPBB 2YJNA 3TOXA 4ADSG 1M66A 3V4OA 1H3FA 1N0UA 3G2MA 4WJLA 3M6WA 1QWIA 3B20A 4RANA 1CUAA 3L92A 1T5SA 2O8DB 1P3Y1 1UPXA 2WNSA 5A6VA 1VLMA 4Y2TA 1HFJA 3FCUB 4TX1A 5CW1A 1T4CB 4MUXA 1YFZA 2P2GA 3BWMA 3L9WA 3QMMA 5JXIA 3MWEB 3PHIA 1WD5A 1QG0A 1W5BA 2P9CA 1ESCA 5KKAA 2EQBA 4D44A 4IGAA 1ELOA 4PZZA 2CLDX 4W6ZA 1JX6A 5BN5A 4LNAA 4XWKA 2WFLB 5EESA 1NHWA 2RC6A 3KJQA 3HWWA 2COUA 4FSXA 2CUTA 1N7HA 1VBNA 4G56A 4D4HA 4F4FA 4JSTA 4ZCPA 1XD8A 3S68A 2XZLA 5CH3A 1HE2A 1AM4D 4YV0A 2DR2A 1UKVY 1NI4B 4REQA 4BMPB 1JR3D 1CF9A 1CS4C 1RJEA 4GYYA 3DTVD 3IR7A 5AJTA 4HEHA 4DPMA 4YV7A 3H9GA 4A9AA 2RH4A 2Q3EA 2QG9A 2W6QA 3DOEA 3NBQA 4QLOA 4YUZA 5CD1A 4MDFA 2O8FB 2NCLA 1TOAA 3BDIA 4I2VA 1ORIA 3ICPA 2O7NA 3EHDA 2RGWA 4GT1A 4IMRA 1ML4A 2VPXA 2W8BB 1Q44A 3U17A 4KREA 5I3ZA 2NUPB 4X0EA 3HU2A 1WSWA 2AG6A 2PA3A 4N03A 4JU9A 4BDTA 5IASA 3EXIA 1LI7A 4F21A 4DN6A 4PEVA 2QGNA 3K8YA 2M5OA 3U44B 1C7EA 2V0NA 2GVNA 2IHVA 1KJWA 2VRCA 2UVPA 4HUTA 5BP7A 1H5NA 3X44A 5E9JA 3VJKA 3GUYA 4FQ7A 3HFJA 4PHTA 2QMQA 1PL7A 4JLDA 1E1CB 3EXAA 3RFVA 3T5GA 4PGGA 5LMUC 5J5VA 2WAYA 3GRYA 1BGVA 2G4VA 4MRMB 2JNWA 4BX2A 4FUTA 4DS3A 3W6NA 5DTQA 2WG1A 4RPLA 5AMXA 3AV0B 3C1TA 1RACA 4IWYA 1NUAA 4TV8A 4CG0A 1TTTA 3AVUA 1TAUA 1FX0B 3BE6A 3FVTA 3DMTC 3H1GA 3UJBA 4JYBA 4C04A 2A35A 3R9XA 2ZJFA 3GQVA 4PUHA 3G59A 3MIIA 2WIFA 4C0QC 4EY8A 3NNNA 1K1EA 4DDWA 4UJ3A 4CEIA 1W96A 2JH3A 2CCKA 4OUDA 3O2EA 1U0SY 5L7WA 4P2BA 4L7IA 5K85A 1ISJA 1PZEA 2XNCA 1E59A 3BMQB 4KYTA 1YGYA 2FMKA 5CJPA 1P1HA 5JQWA 4LC9A 1EHIA 1JSRA 2QS9A 4N3NA 3E53A 1EX9A 5DCUA 3O94A 3LLUA 4Q4AB 1C7FA 4P53A 3VGJA 1QGUA 1U8FO 4UHDA 4UVDA 4WXRA 1Z83A 2DWUA 1P33A 4HTAA 4OQLA 2OBNA 1A96A 1QH1B 2FG6C 4G5SA 4K86A 4NENA 2QRHA 3U3RA 3IP9A 4E51A 1HYGA 2LDXA 1B0ZA 4QYMA 1SVSA 5E0KB 3A9CA 3EQ6A 5KOHA 1MUUA 5GONF 2X4DA 1UDRA 1TX4B 2H51A 2I1WA 3H04A 4LXUA 4MYHA 5LQUA 4TZTA 1SIBE 2H7VA 1BO6A 1DX6A 1COWA 2PRKA 3FTCA 4NYMQ 3W2TA 5FHQA 3QSYA 1NUPA 5FUXA 4BZXA 1QHYA 7MHTA 2NZ8A 5BSEA 4RA6B 1GWNA 1DC6A 1RPNA 2YZKA 3JPWA 2FPIA 3LX8A 4X1KB 4YP1A 4MVCA 4RK1A 2Q3HA 4EA7A 1OQAA 1Q77A 1EVQA 1L7QA 2AF3C 2WKSA 3OQ6A 4JC4A 5HK8A 1Z7EA 3BS4A 1KE2A 3REOA 1L5OA 1ZXLA 3D4OA 3GJ8A 4NG5A 2QAJA 4JODA 3X1YA 3A4TA 3OUTA 4D9JA 1SULA 1BRTA 1PGQA 1T2UA 4BUJA 1EFUA 3FMFA 4CETA 4BMDA 4HLCA 5CX1A 2Z1MA 1QHXA 4HNUA 3ZW8A 3IAM6 5EIHA 3SDSA 1ULHA 3BWEA 3GFPA 4QX6A 4FZ3A 3JQGA 4D79A 1B8VA 3AB7A 2I80A 3H9CA 4G0OA 4JR0A 4PPQA 4E5DA 1XMVA 2HHCA 1TMKA 1V5IA 3L0DA 4TTQA 1HMPA 4RESA 2C7RA 3V3KA 2BMFA 4LXGA 1Z45A 4EPYA 1WP4A 4WH0A 4EFLA 5C52B 2PRJA 2AFIA 4RMJA 3MRVA 3PR3A 1RY2A 3HVJA 5REQA 3ZYCA 5GGYA 1C7JA 4EA8A 5JIBA 1BWSA 2W37A 5KVSA 1UKAA 3SOZA 3PFGA 4GX5A 2GESA 5FQNA 1WS6A 3K5WA 3M9WA 5LP1A 3NOVA 2SHKA 1K8ZB 2G40A 2F48A 2HK6A 1JQLB 2J3HA 5DLPA 3OCCA 5HGJA 2ONJA 5BR8B 1B3BA 4ITRC 3QHAA 4GXTA 1TA0A 4PHFA 1SQ5A 3UJNA 5DTIA 2W4IA 4CE6A 3DMRA 3FHJA 2JJ2A 3LPDA 3W06A 2QI9F 4D4JA 3BEOA 1SVUA 4YRLA 1BHJA 2C9BA 2JGNA 1M1UA 2YW2A 2FW8A 1F0PA 3DCIA 3O0TA 1TM4E 2SECE 3K1AB 2JLUA 3HN2A 3IEIA 1C9NA 4X41A 1LZKA 2UAGA 3E5HA 1S8AA 3OJ0A 4LE2A