2HJGA

The crystal structure of the b. subtilis yphc gtpase in complex with gdp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
434
structure length
400
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLDNNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein engA
publication title The essential GTPase YphC displays a major domain rearrangement associated with nucleotide binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 120
structure length 400
sequence length 434
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hjgA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA01
5F98A 1QWIA 4M1OA 1S0UA 4LF6C 1NLZA 4OQXA 2OBNA 5A5GA 4TYYA 1G8HA 1YR6A 3IBYA 2GCOB 2YNMA 1NN1A 3L82B 3UWOA 5FL3A 4A0FA 3THXA 4KHPC 4JL6A 4NE2A 3WNCA 4QXAA 1TU4A 3A1SA 3CF6R 4KU4A 4DBLC 1EG7A 4PHGA 5GJWC 3QEOA 4G01B 5TDHA 2XXAB 4OK3A 1OYWA 1ZNWA 3AF4A 3ZYCA 2VL7A 1LF0A 1S2MA 2CCKA 3ND8A 3U4QB 2OO7A 3F5FA 1E0JA 3V9PA 5IT9D 1WDTA 1VMAA 1JXMA 4WZBE 3X1XA 1TX4B 5AWFC 4TLAA 5HR5A 4PSAA 4CEHB 4MUBA 3GLIE 3EIHA 4A1FA 2QU8A 3EZ6A 3TVDA 3KXIA 3UKDA 3QY0A 1OLOA 2ZTSA 4QBHA 2G1KA 2NIPA 5C18A 5A2QD 1RRFA 2Y8EA 4YY3C 2GXAA 3PEYA 2C98A 3L8ZA 4A6XA 4JL5A 1M34E 5BN3A 4RD2A 1RYFA 2VSXA 2CVHA 5G41A 4QGAA 1WE2A 2FZLA 2O0JA 3WYGA 4G5GA 1YU9A 4D26A 5AUOB 3C5HA 5B30A 4P32A 2VQFC 2ZJYA 3LH5A 2WWXA 1QG2A 3GKUA 3AF2A 3PENA 1U98A 3L8YA 2ATXA 4EIWA 2ZXUA 5L8VA 4KODA 2JMPA 4RFSA 3MD0A 2FU5C 4N3NA 3EX7C 1JBKA 5DE3A 3V4RA 2YC4C 2OESA 3UMRA 4ZIRA 4LFAC 2ZRMA 3LBIA 1NMYA 4NCJA 1FUKA 5JS7A 4K46A 2VHQA 3OEHA 4Q18A 4V02A 1E3MA 2DWPA 4BEJA 2BOVA 3CO5A 4DIEA 1E2FA 4YDSA 1TNDA 4XVUA 4XIGS 2C99A 1H8HD 1HQCA 1CXZA 1P61B 3K9LA 1CJKC 5HZHA 1M7BA 2V7QD 2D74A 2EFGA 4YMWA 3BH0A 3A37A 3NTUA 2ZVPX 3PEVA 4R71A 1N6IA 1GRRA 5HPYB 5GADl 3PV0A 3CRW1 2H8KA 5KSPA 3AF5A 1R2QA 1TADA 1Z6AA 2QP9X 2V9PA 3FFBA 2GHIA 2ZSDA 4B3GA 4S35A 2QT1A 4UXIA 1ESMA 5FBRB 5IF9A 1D9ZA 1CJMA 3M6AA 3EWAA 4MKHA 2C9OA 4C0BA 4A6PA 4A82A 2KZFA 4IRUB 2I4IA 4TTQA 1YR9A 3B60A 2IYRA 3FOZA 1R0ZA 2GCPA 2ODWA 2YWFA 2JGNA 3JVVA 3SS8A 4JI5C 3TUIC 4M53A 2E87A 3AF0A 4WIAA 2OV2A 1VPLA 4HZUB 1E94E 2P6NA 3P4YA 1KZGB 5SZIA 4Z8XA 3ADCA 4A15A 2JDIA 1XBTA 3VQTA 1T3LA 1T5LA 1R6BX 2GVZC 1TF5A 3I8XA 1EXMA 1BIFA 2O8BB 4URVR 2IEZA 4OX9C 3ZGXA 1IY1A 1VCMA 4XX2A 3TUZC 3KQKA 3ZZUA 4F92B 4DCVA 5JRZA 4LF8C 1LVGA 4X8OA 4M22A 3Q8XB 2BEKA 4UNQA 3RRYA 2QMUA 5LBIA 1DAIA 4LJ8A 1F60A 4URXR 3J81k 4QNRA 1JR3D 2J41A 1JECA 1AQUA 1GIAA 1ANKA 3LLMA 1AKYA 1YZTA 3AEZA 2WJIA 5DN6A 2O0KA 3C41J 4NH0A 4YQFA 4D4JA 4D25A 3ASYA 2RHMA 3NHAA 1VKJA 4Q01A 2YVUA 5JI2E 2R8RA 2W83A 2NQ2C 3OEED 3T15A 2RAPA 3QKSB 1CF4A 2GAAA 2FEOA 4MGKR 2HF8A 4C9BA 4IOKA 4R9UC 1AK2A 1VECA 1R8QA 3AV0B 4HLDA 3QI2A 4C0QC 4CEJA 1OW3B 5J5CA 2ZRKA 1W5SA 2CL6X 2QTVB 2ODNA 3VHXA 2JLXA 4O3MA 5KUTA 4M9ZA 3QKUA 1G3RA 4LSGA 2AX4A 2WSMA 4JLOA 1QVRA 4MGZR 3T12A 2DB3A 2F6RA 4KBFA 2REOA 1KO5A 2QN6A 3H84A 3SYNA 2QGNA 1E69A 3N70A 3MSXA 2WWGA 3ZD6A 1E2PA 2G3YA 1K8RA 3SQWA 4U5XA 2NPIA 1XTSA 1YJ5A 4CVNA 1EESA 5JECA 3R9WA 3B1VA 2A7QA 2B92A 3HJNA 1FPMA 3P32A 3RABA 1NP6A 1XEXB 2E9SA 4HUQB 4DV6C 2AKAB 2HCBA 1E9FA 1KO1A 2GXSA 4PPQA 4MDFA 1MO3A 1N25A 5KO2A 3B6EA 1JQJC 1JR3E 1II0A 3MRSA 4AKEA 1DELA 2YOHA 2ZRIA 3MWKA 1OH5A 1OB2A 3CONA 3HPRA 1II8A 4XWKA 5EZ5A 2XAUA 1AJEA 4AYWA 2WBLC 4DDWA 1SKQA 1JJVA 4RD1A 2RGBA 4PHTA 1VTKA 2ORIA 1K0RA 1ZB9A 5B57C 2ZPTX 2Q3FA 4LWZA 1W4CA 2HT6A 1Q20A 2GEDA 2H17A 2E8FA 2BJWA 4TMXA 3F3YA 3VR3A 1K6MA 2BMDA 2JA1A 3W90A 1SXJD 3CNNA 5F9HA 3T61A 2ORWA 2ZJ2A 1FQKA 5HKKA 3PUVA 4DSOA 3B9QA 2FPKA 4EQ6B 3ADKA 3SFVA 1CJUC 1N6KA 2ZJOA 1S1CA 2ONKA 3RDPA 1SKYB 3VNUA 5DYGA 3HU3A 3FKSD 3SC3A 1C1YA 3Q5EA 2WPDD 2V6IA 4IXNA 1LQLA 2J5XA 1KMHB 4ZDKA 2K5UA 2D4HA 1PV4A 1Z2CA 3CBQA 2FSGA 2FEMA 3IDQA 4B3SC 2O8CB 4LBYA 3NHBA 4RZ2A 5KPDA 5CK4A 1HE8B 1OIVA 3DEFA 2BM0A 4MKGA 3DOFA 1FTNA 2GJAA 5CDFE 3ADBA 2LWIA 1VG1A 2KJQA 3LA6A 4AC9A 2ZRJA 3QKRB 5JEDA 2QMOA 3AP3A 3DKVA 1CULC 1PLLA 2ZU0C 4URZR 1XMOC 1UADA 5E95A 3OHMA 3TW8B 5KYKA 2DPXA 3U7FB 1MO5A 1DARA 3U61B 3FMOB 2QL6A 4AKHA 1CTQA 6Q21A 3DVLA 4DR7C 2X77A 2QZ4A 1RYHA 3EW9A 4JLAA 1KY2A 2RGCA 3GLFA 5JJKA 2OG2A 4QM6A 1G41A 1Z0FA 3R9XA 1E0AA 1Y63A 4P0TA 1IN8A 3QIAA 3EZ2A 1KOFA 5KDOA 2OAP1 2IWRA 1KAOA 3FMPB 4OHXA 2ORVA 4XWAA 4KITB 3VR6A 1R0YA 4B3TC 2QAGA 4LYFA 1K5GA 4P33A 2KE5A 3QVVA 3TH5A 1CP2A 3BAFA 1SXJE 3NBXX 3A1WA 1UKYA 1FFHA 2FWRA 4I99A 4PAMA 3DMDA 2W2XA 5FTLA 4YXWD 1Q0UA 3P20A 4MYHA 1HEIA 3RSLA 3PR1A 1XJCA 1KSHA 3GEHA 3HU1A 4Q9JA 3W6OA 4B3RC 2BBOA 2JATA 3A8TA 3BE4A 3IHLA 3KKQA 4POAA 4WXPA 3UMSA 3WBJA 4C0KA 2ODBA 4TLBA 1VYUA 1EFCA 3U7GA 3BD9A 3D31A 3SI7A 2O5VA 2KWIA 1CEEA 1EX6A 1ZD9A 1ZD1A 2RKOA 5L3SB 2WICA 3MWYW 1EK0A 2JJ1A 4UNSA 5FBWB 1KI8A 3IKJA 5EXPA 2YKGA 3QXCA 2ZR9A 2PJZA 1U94A 3GLHE 3I3SR 3NXSA 5EE5B 1ZYUA 2VEDA 4L16A 2JJ1D 3W8RA 5LB2A 3KL4A 5JSZB 4TYQA 2O8DA 5TMPA 1FNNA 1NY5A 3HR7A 4LRWA 4DEYA 5JEEA 4LJAA 1JAIA 1O87A 3LUSA 3UATA 2BJVA 4DKXA 2W2VA 4YDHB 3GLGE 1Z63A 1VG0B 3QSYA 2I3BA 4GP6A 3TKLA 2QPOA 1ZW6A 3MLEA 2ZM6C 2ZSAA 4WVFA 1T8TA 1I4DD 1XMVA 3RVBA 5EP1A 1KKGA 3QOFA 4UJ3A 5LMUC 1DTSA 1IXSB 2XZLA 3OZXA 1NVVQ 3EPLA 3LD9A 5LD2B 4V03A 4KI0A 1AM4D 1P2SA 2H57A 1UJ2A 1KI6B 3QUSA 1QHIA 4TLEA 4FMBB 4QRHA 4KV9A 3AVOA 4NDZA 1UBCA 2DFKB 2VO1A 2EFHB 5HE8A 4GOJA 3PCRB 1WMSA 2ODEA 4NONA 1HT1E 5CB6A 1E2QA 2OUKA 3RRMA 2XGJA 2AD1A 2UZIR 4JVLA 4C2UA 1TMKA 3HR8A 1E9RA 1E9CA 1E9SA 4NXMC 1Q1BA 2ZVQX 5AJWA 2OAQ1 5CJ2A 3U3MA 2FSHA 1N2FA 1L2TA 2QPTA 3GP8A 4IVRA 2AFIE 2GXQA 2QRZA 1YVDA 3KQUA 4DCSA 1X86B 4LY6A 5GJCA 4BLPA 5JRJA 3AM1A 1QHXA 1W36D 1UAAA 1D6JA 1NN0A 2WJHA 3LO5A 4DLZA 3RAPR 4IDQA 3FTQA 3HYRA 3ICEA 3PUYA 2OILA 1XNQC 1OE0A 2AFHE 3MWJA 4JJKA 2D06A 3EPJA 4EPWA 3R9IA 1LS1A 2AXNA 5FTNA 1Z47A 2YOGA 4OYHA 2JIZD 3W3ZB 2AL7A 1YZQA 1U9IC 2AHOA 1MR3F 2QT0A 3AB3A 1SULA 4QKQA 5FPHA 1D8TA 4PZZA 3GMTA 3BFKA 3UANA 1E79D 2BIFA 2J0UB 3VR2A 4ZCIA 2GETA 2CXXA 3QBVA 1RRPA 4DUZC 1AS0A 2DBYA 4PX9A 1P2TA 5FL7D 4OHZA 1N36C 2EQBA 2OXRA 1E2DA 2F1HA 1X8KA 2W6IA 3HDTA 3OTOC 1KKLA 1TEXA 3K0CC 4NYJR 1XD2A 3CZPA 5EZ6B 2IHYA 3IPXA 4BLQA 3B1ZA 2ASBA 1E32A 2DY1A 2C03A 4Q7JB 1ZB8A 4EJSC 4MUAA 1ZM9A 1NIJA 2DHRA 2C04A 2W6ID 4N0DA 2NZ8A 5E7JA 3LX5A 4KHZA 4XVQA 5FUWA 4CDGA 1YZLA 1E2LA 1CJTC 3FHCB 1GKYA 4LHWA 1R5BA 1WBDA 4B3MC 4A2QA 4FD2A 3REGA 1T3SA 2IWHA 3D7MA 3U3JA 1F2UA 1XWIA 3WYAA 3BS4A 4TT3D 5FOSA 1XNRC 1CR1A 1VYVA 3Q85A 5CM8B 2VHTA 4DR4C 3GCGA 4BPBA 4US2R 1X3SA 3LW8A 3AVTA 2J87A 3T5GA 2ONJA 2PT7A 3IIMA 2ZU6A 3DDCA 4JLMA 2XX3A 2R6GA 1RFLA 4PC3A 3MJHA 1E99A 4YMVA 5K8IA 2PLFA 3NDPA 3UG7A 5BR8C 3K70D 2NO6A 3G82C 5CYOA 4DLVA 2Z0MA 1OPXA 1FJGC 4AI6A 4TZ0A 5DYIA 2H92A 4H9GA 2RGNC 4KCGA 2GAOA 4LHVA 4EDHA 2LKCA 4BUJA 3THYA 3KUDA 1HURA 3X2SA 1E1QA 1MKYA 1W5TA 2H18A 4ARZA 3K09C 1WBBA 1J7KA 2QSYA 3W6NA 1GNQA 3TRFA 4JI6C 2QQ0A 3MG9A 4ASUD 2WVJA 2QNRA 2C78A 3BFVA 3OE7A 5AJXA 3K0FB 4BLSA 3ZQJA 2C77A 4UXHA 3I07A 1T9HA 1KI1A 1KJYA 4GBMA 4G5OA 4V0MA 4Q9HA 3RRZA 2R44A 1AGRA 2REXB 3VX3A 4DUGD 4OJKA 3O8CA 4LGMA 4PQRA 4KSCA 1JPJA 1CIPA 2GEVA 4FCWA 4XSGA 5CB8A 1PLJA 2YCBA 1XCGB 4B3BA 1WCV1 2QY9A 4HB3A 2BC9A 4UNPA 3BGWA 2A5FA 4JBYA 4RZUA 2CVFA 2WWWA 2IYTA 1JQLB 4KBGA 5G3YA 3WRXC 3SQXA 2ZRGA 1QHHA 2J7KA 3NBFA 1WB9A 1XPUA 5FUYA 5E4FA 4RVCA 1GILA 3K09A 2CNWD 4PC1A 1SQ5A 4ABYA 1W7AA 1KSJA 1F3OA 1U81A 2QSZA 4Q4HA 3V00A 4LF4C 2JLRA 4V0NA 2X2FA 3UMFA 3TUJC 2E8CA 4OI0A 3C14C 4ZCLA 2WZQA 2ATVA 1D2MA 1P9WA 5DIFA 4DLRA 2Z5FA 4DLSA 4TMKA 3QXHA 2J45A 1ZIPA 3J80D 4EKDA 4JI4C 4B6EA 1J5EC 3AKYA 4Q4JB 1ZNYA 2VHJA 3ZZ0A 1Z6TA 3RC3A 3GFTA 1LF5A 1RE0A 4HLUA 4LBZA 4AKGA 2CJWB 2ZJ5A 3Q7QA 1OKKD 1XF9A 1S9DA 1A82A 4FMCB 1UFQA 5FUVA 1NIPA 3GJ8A 1YR8A 1JXOA 1CR2A 4KSBA 5IWAC 4YLGA 3GJ7A 4PSVA 2A5DA 2ZANA 4Q4AA 1OIWA 3BRWD 1YQTA 3KZ1E 4DWJA 1KI9A 4XD7A 4LBWA 3QPWA 1E1RA 4NCIA 3F0TA 4PQFA 4JI7C 2CK3D 2JLQA 4GPTA 4Q7KA 5JJIA 2MSEB 5FPTA 1KO4A 3P4XA 4CT5A 221PA 2IA5A 1NVWQ 4DDVA 1QDEA 2WIAA 2I1QA 2VP9A 4DR2C 1F2TA 5AUQA 3N5CA 3K9GA 3GFOA 3H0KA 4OI1A 5FOWA 2YOFA 2PN2A 3K1JA 3TR5A 3U3KA 1P9RA 3FHTA 3WP0A 3NDBB 4Q9KA 1N33C 1KJWA 2HEIA 3BIFA 3LNCA 4KVGA 4EAQA 4RFVA 4HAWA 3VKWA 1EFRD 3THXB 5E7IA 3GLIA 3ETLA 2R6CA 2C9CA 2EYUA 2VF7A 3PFIA 2CY1A 3G0HA 1VIYA 1XDBA 4B3XA 3LVQE 2D7VA 4G5SA 3W5JA 2VP0A 3T06B 1T5IA 5JCPA 3IEUA 1U8YA 4GP7A 4ZPXA 1OXUA 1KK1A 5B58C 4GNKA 4Q1FA 3VFDA 3U6KA 3BH6A 5EJEA 4RY2A 1ZBDA 3I32A 2G6BA 2JJ2A 4UXJA 4X66C 2KSQA 1QHGA 2C9YA 2ZAMA 1DEKA 2BV3A 2OXCA 2J0SA 5JWRA 5H1YA 2GKSA 2BM1A 1BYIA 2XOKD 1IN5A 2YV5A 3PQCA 3IUYA 3WBKA 4AG6A 1J70A 3E1SA 4KFSA 3X1DA 4FCVA 4US1R 4W7SA 5FBLB 3U3OA 2WM9B 1XPOA 2FFHA 4RD3A 2IYSA 4GOKA 4DC9A 1KO8A 1ZM3A 3W34A 1Z06A 2FFBA 4N1AA 1HH2P 1CRQA 1G4UR 4YONB 3ZDQA 2GTPA 1XEWX 1NLFA 1HQYE 2CDNA 4DCTA 1KI3A 1ZM7A 4L9WA 2AXPA 3QG5A 2BVNA 3KQHA 2ANCA 2ZI5A 2P6UA 5JZVA 3RS0A 1G8FA 4PAOA 4RFSB 2ZYTX 4QM7A 3SNHA 3SHWA 5EXSA 4DLXA 4ZIRB 4OK5A 3I92A 3DM5A 3PUXA 3LY5A 2GZAA 1S9HA 2UUCC 1U99A 3SEAA 1WXQA 2H16A 4OK6A 1NMXA 3U7HB 1FUUA 1E2GA 4IOMA 2PJRA 2B7BA 4I1VA 1VIAA 1WRBA 2D62A 2ZI3A 4QJ5A 2B6HA 1N6NA 4GMDA 2CHVA 2CHGA 1HTWA 1Q57A 1U2RA 4AURA 2O8FB 3VTKA 4F93B 3JZMA 5KHOC 1T3HA 1T8UA 2ZAOA 3VAAA 2PEYA 1Q44A 1Z3IX 2QORA 1E96A 3HPQA 4D4KA 1G7SA 3LAWA 4NPHA 4DEXA 1JPNA 5FFMA 4LZZA 1HV8A 4M8NE 2V1UA 5FPYA 2P6RA 4II7A 5JMTA 2XTMA 1G3MA 1OFHA 3GD7A 1AS2A 1ZC3A 2HF9A 3PUWA 3BB3A 4CT4B 4BE7B 2QE7D 3X1ZA 4MYUA 3MMPA 3W3AA 4YHHC 1H8HA 3QG1A 3QPVA 2V7QA 3TMKA 4HB4A 4JLNA 2B7CA 4TTPA 2ZREA 1PA4A 1XU4A 2AD5A 3RYTC 2NPFA 2XR1A 5KSYA 1WF3A 621PA 2GJSA 1YR7A 5AK0A 5FBVB 1G3IA 1S96A 3L0PA 5DSZA 1OIXA 2GCOA 3CW2A 2DR3A 3K9NA 1XMQC 2OFOA 2FZ4A 2NZJA 2VPPA 3AGQA 1EWQA 4MQBA 3TVTA 4LPSA 5BN5A 1N0UA 5DH9A 2IX3A 1QHNA 4HUTA 2YINC 2IXEA 1OXVA 4TSFD 4DCNA 1KDOA 4HLQB 1N3BA 3TGPA 1N34C 2GXUA 4U02A 4C4PA 3LDAA 4LHYA 1ZD8A 3MAAC 4M1YA 4F4IA 1OFTA 1ZNXA 1ZNZA 1Z2AA 5H68A 3TSOA 1FMLA 1GKIA 1HUQA 1SHKA 1FZQA 3AP2A 5EP2A 1G18A 2W6JA 3AVXA 4AG5A 2ZSBA 4CEJB 4X65C 3EG5A 2ZUCA 3FMIA 3TLXA 5J47A 1FTSA 2XB4A 4I1SA 2FN4A 4XWOA 3KQLA 4TL9A 4C0AC 4KAXA 4E09A 4LHZA 3SBEA 1XJ0A 2W6JD 5FH9A 2NGRA 1JR3A 2IUUA 4M1KA 2GBLA 3K0EA 3A4LA 3MCAA 1EFUA 4M21A 3U3RA 4RSGA 1NKSA 4IHQA 1M7GA 3B13B 4XJXA 3VKGA 4B48A 3TIFA 1W4BA 2Q9BA 2WWFA 1Z28A 3K0SA 3L0IB 5HTKA 1KGDA 5F9FA 3LV8A 4PXAA 4WBSA 3VHLB 5DHAA 4RD6A 3OEEA 3K0AB 3LWNA 4PAQA 3PG5A 4P4TA 1HY3A 4JVNA 1US8A 3FFAA 3KKOA 3LRPA 2ZYWX 5KSZA 4O25A 4WOPA 5F3WB 4B33A 4K0KC 1W48A 1XTIA 1PJRA 1V5WA 1XMIA 1R0XA 3AQ4A 3GJ4A 1CBUA 4HYYA 1E4VA 5DGXA 3TSWA 1N5KA 4M1WA 2GNOA 1II8B 1GWNA 4DRZA 2BCJQ 1IXRC 1IHUA 4BECA 2XB2A 4QHSA 2AR7A 2GA8A 2Q3MA 3KDSE 2IS6A 3ND9A 3SZRA 4LYJA 3PUZA 4B47A 1DG3A 5J4VA 1H8ED 1W1WA 3AKEA 1P2UA 4JT2A 4A4DA 2L0XA 1IM2A 1ODFA 5CDFA 1GL9B 4IOLA 2G77B 3ICQB 4WZAE 2Q0HA 1N6LA 3G5UA 5KOYA 2QBYA 1VG9B 2JJ8A 4LYHA 3R7WA 2YC2C 1GRQA 3ZZTA 1ZRHA 4DR5C 2F9MA 2GJ8A 3KJEA 2EWVA 4TMWA 3O8BA 1JEDA 1SVIA 2A9KA 2P67A 4F4CA 3AVYA 4B44A 1T0JB 2GCNA 3BK7A 5FOTA 3WHLA 1FQJA 1X1SA 1AQYA 4I1UA 2E7GA 1GZSA 5JLJA 4QBGB 1SVOA 1J90A 4E22A 3OIWA 2GZHA 1Q12A 2PT7G 3PVSA 2OPLA 3EZ9A 3ZIAD 2ZRFA 4PR0A 2O8BA 3EWSA 5G53C 3RNLA 1NG1A 2HCJB 4P4SB 4Q5IA 2GESA 5J40A 2EGTA 1P6XA 1HH4A 2PMDA 2ZS7A 1FMJA 1UKEA 2LKDA 4Q4JA 2D3WA 1SXJA 1YKSA 2VQEC 1DO2A 1OT3A 1S8FA 3UIEA 1UDWA 2HXYA 1BKDR 1L4YA 4HZIA 1XD9A 3GLFB 2VYFA 2ZRBA 2QPAA 4GKKC 4TQ9A 2DWOA 4RCYA 5EP4A 5CLLA 4E07A 3FKSA 3EPHA 5BW8A 4M9QA 3ECCA 2WPDA 2PX0A 4JYCA 2AWOA 1IQPA 3DO6A 1ZINA 4V0LA 2BEJA 3KXLA 3N2IA 3LBNA 2QAGB 3GJ5A 4Q1DA 2FGKA 4BFXA 3PEUA 4PANA 1K5DA 2Z83A 1LB1B 4MRVA 1ZU4A 4LJ6A 2GJ9A 2IEYA 4A8JC 2FE4A 4DLYA 1O3YA 2ATWA 4D81A 1Q3TA 3GEEA 1OSNA 3SHFA 4A36A 1KJZA 1QF9A 2AKYA 2OCYC 2QP4A 3GLHA 3Q9LA 4NYJQ 2OM2A 4FINA 2CLSA 2QAGC 3IPYA 2CLDX 2FX3A 4HAVA 4ESHA 4NYMR 3W6PA 4MRNA 4PC6A 3SFZA 4KXFB 2IYXA 4FXPA 2HXSA 5AJYA 4Q7LA 1DAKA 2VLIA 4JLJA 3GLGA 4TZ6A 3FKQA 2GRJA 2HYIC 3GEIA 4TQUS 5C4MA 3EC2A 3S1AB 4D0GA 2ERXA 4LX0A 1XRJA 1U0JA 4HB2A 1XEXA 1SVMA 3CH4B 1DS6A 1P3JA 5EQTA 4A8JA 1XB2A 4B71A 3PJRA 3TSZA 4DV3C 2QM7A 4Z51A 2ZE5A 4NKRA 4M0LA 4V0OA 1R10A 2O8DB 1E98A 1Q21A 4TMZA 3WY9A 4JT4A 2HJVA 3CNLA 1GM5A 4LV6A 4FMCF 3GJXC 3QVUA 4YXWA 2V55B 4OKSA 2QL8A 4IDHA 1XMSA 2D7CA 2GZDA 1W0JD 4OL0A 4UQOA 1AIPA 2XZPA 1P2VA 5IT5A 1G3UA 4TLDA 4EPTA 3T1TA 3I62A 5JWOA 2F1RA 5L3VA 1G5TA 3LVRE 1M1YE 2BBWA 1RPZA 1E0SA 1RC8A 3LXRA 3FMFA 3EZFA 4DV2C 1XCPA 2OLJA 3NH9A 4KLZA 2ZM5A 3EXAA 2WKQA 4IW3B 4L9SA 5B2ZA 4HAYA 2B8WA 1GRNA 2ZJ8A 5KPJA 1SVKA 1PUIA 3I73A 4NCHA 1I4TD 3RHFA 1IOZA 3U7EB 1TUIA 2IW3A 1Z0JA 1E2EA 2IK8A 1ZIOA 2VQSA 2XZOA 1NNEA 2E8EA 1KNXA 3ZH9B 2GK7A 1S3SA 2GF0A 2N46A 1BOFA 3AF1A 2ZETA 5KDLA 2PCJA 2FFAA 3F8TA 1OV4A 4C7OB 1CS4C 2OT3B 4DDUA 2ZI9A 2JLVA 3EA5A 2DFNA 3B9PA 3J81D 2VP6A 4OI4A 1L8QA 4JLKA 4O2LA 3R20A 3NWJA 3H2YA 1WP9A 2Q21A 3O8DA 3BC1A 4LCBA 3B1YA 3B82A 4FN5A 4JVMA 2VHUA 1VYTA 4Q03A 4JVSB 4N0EA 5JBQA 2XTZA 5FOUA 1BH2A 1CR4A 1UDXA 2WJVA 3I4LA 1J2JA 4AYTA 4DSTA 4B2PA 4LC0A 2P5TB 4IEEA 5J4LA 4NXNC 1LTQA 3UXMA 2BKUA 1RRCA 1W36C 4JI2C 3U6BA 4MRRA 1FP7A 1NRJB 1KK2A 3WXMA 1DAMA 4IVPA 1BMFD 1GUAA 2JASA 4ON9A 5KTYA 3U5ZB 2DYJA 1BS1A 2WOOA 4LHXA 3UK6A 4BRWA 4BFSA 2W0SA 2DWQA 2RCNA 3L2OB 3GJ0A 1SGWA 3OF5A 5C4GB 2ZRNA 4DV5C 4OHWA 1USPA 2A5YB 4KO8A 2WWIA 2Z4RA 1E0KA 4YC7A 3SE0A 3O47A 1DVRA 2P65A 4A2PA 3IBGA 5L3QA 2RGEA 3CPEA 2XNDA 4J0QA 2F1JA 1ZUIA 3K8YA 1XCMA 1XD2B 4XTCS 1SZPA 1U0HC 2EU8A 4MRPA 5C2JB 4YMTA 4Q1AA 4AK9A 2FG5A 2JLYA 1RW4A 2BKEA 1XTRA 4Z8YA 2XNDD 2OFWA 2CCGA 4BFWA 1KI4A 4B34A 4U00A 2IT1A 3CF2A 4Y0AA 3CH5A 4RKFA 3A58B 2YYZA 3VNVA 2UXCC 4GI7A 1SKYE 2GEUA 3QF4A 1A1VA 4JMPA 1G64A 3TJZA 4DR1C 1F2UB 4R2IA 5IDVA 1WQ1R 1IXZA 5L3SA 1IBLC 2JIZA 5IHPA 5LB4A 3DHWC 1QG4A 1VHTA 2YWGA 2N42A 1P75A 3AKCA 4ILEA 1N32C 2CXCA 4XVRA 1EGAA 1E2IA 1E79A 3T1VA 4ZO4A 1ETUA 2GJKA 2Q3HA 3NG1A 2QG6A 5FL7A 2BHRA 4EJSB 2QAJA 3U2QA 5D3MB 2Q9AA 421PA 5TV2A 4PFSA 4FMDB 2ZROA 3SBDA 2ZSEA 2CLCX 4IDPA 1UEIA 5GVSA 3TBKA 2A3RA 3CRMA 3SJCA 1U0LA 2XJ4A 4AY2A 1IY2A 4GMXA 2VIIA 2RGDA 1COWD 4LF5C 3THYB 2F55A 4ARZB 1M8PA 2C96A 2IYWA 2QUZA 2DFTA 1U8ZA 3NEYA 2ZIAA 3NC1C 1CKEA 2F3RA 2QGZA 2ZSFA 2GILA 3B85A 5D3QA 3LLUA 3VX4A 5IRCD 1ONBA 3QPUA 4JLPA 4M2LA 1G8YA 3DZDA 4LFCC 4TT3A 2IHBA 4DIDA 1OH8A 3Q7PA 4PO1A 2JLZA 1NL3A 4LOAA 4MITA 4PO8A 2QI9C 4A0HA 3JVUA 4BRUA 1LNZA 1XXHB 2WHXA 2F4VC 1NN5A 1Q3HA 2KBEA 2JCSA 2VP2A 4Z1MD 4GSYA 1KHTA 5K8LA 4V0KA 4R7ZA 3AGPA 5TVKA 5FOVA 1QHHB 2IYVA 2IBMA 5EXTA 4D0LB 1XD8A 2R2AA 3BORA 1P73A 5DO9A 1VHLA 2QENA 1Q22A 4Q4HB 2UVQA 4GRAA 4ERNA 1N5JA 5TXGA 4OHVA 4GDFA 1QBKC 3OIVA 1XFAA 3D3QA 4G3XA 5JHHB 1FX0B 1AN0A 1NJGA 1HR0C 1ZUNB 4ASUA 1UKVY 1W49A 1KIMA 4DT1A 3FWYA 4JI1C 3B78A 4M4SA 5A4JA 3LQQA 4MTNA 5LPNA 4JIMA 2VHCA 5FTKA 3VU9A 5CLQA 3U44A 2A5JA 4TLCA 5DI3A 3WHKA 4DHEA 4DUGA 1E2KA 2O0HA 1UPTA 3QENA 5AJZA 1I94C 1KK0A 4KLNA 5FUXA 2OEPA 3CWZA 3D6TB 4B2IA 1ZP6A 1I2MA 4TQAA 1MO6A 1TU3A 1M74A 4Q4AB 3GJ3A 3THWA 3OFND 1W4RA 1I2DA 5EE3A 3L43A 3IO3A 4HLUC 1FP6A 2NG1A 4FI3C 4WA7A 3EIQA 3QBTA 4OHYA 2CNWA 3CB4A 3RS3A 1F2TB 4F7WA 1ZCBA 4XOIA 1MOZA 1E2NA 3HP1A 4EFMA 3RS7A 3AUXA 1IN7A 3TQCA 4B3CA 4DLTA 3LW7A 3E2IA 1ZUHA 2ZS8A 1CJVC 4PTLA 2QTHA 4ZI3A 2CL0X 2REBA 3DPUA 5E3HA 3GLIB 1E4YA 4IFEA 5DLQC 1ZAKA 1P72A 2OCAA 4QNMA 4DR6C 2C2HA 3C7KA 3BJIC 1W0KD 5JHGB 2CL7X 1OKKA 3CR7A 4TMVA 3R8CA 1IN4A 2JEOA 2VP5A 8OHMA 4RZ3A 1CLUA 5AR1A 4LJ4A 3MWLA 2WJYA 5E7MA 2PX3A 2RGXA 2E5LC 1Z07A 3NKVA 4JKIA 3ZVMA 1NJFA 1W2HA 1SVLA 1M7HA 5TY0A 3P1JA 2J1LA 3K53A 1AZTA 2EWWA 3ZS9A 4LYAA 2Q6TA 2WWYA 1N0WA 2CK3A 2ZE6A 3CPHA 1UBGA 5SZHB 3FDIA 2V3CC 1G8PA 4JKYA 4TMTA 4AIIA 2DYKA 1XTQA 2D7DA 3IO5A 3A4NA 4B35A 4TYPA 1JEEA 2AWNA 4ZDWA 3QJYA 5L3RA 1DPFA 3FHOA 4ZV4A 2ZI4A 1A5TA 1ZM4A 5K8UA 1KYIA 1HNWC 1EFRA 3VR4A 3KTAA 2WJGA 1G7TA 4F38A 5IK2D 4AKIA 5HZKA 3PITA 2J7PA 1RVDA 2WKPA 3GJ6A 4BZPA 4G5QA 3RS5A 2OFXA 2RGAA 3P27A 1C9KA 5J4KA 1KMQA 1XJQA 2MMCA 1UM8A 2J7PD 2NOAA 2B21A 4DZZA 1RJ9A 4Q1EA 2ERYA 2O8EA 4W5JA 1GTVA 1TUEA 3WNDA 5C46F 2XOKA 1OB5A 5HCIA 2IF2A 1KK3A 1F48A 5CM9C 5BQ5A 5JWHA 1TQ4A 2V54A 4OI2A 4V0ME 2FFQA 2G9NA 4K81B 1OXSC 3C5CA 1DAFA 3C15C 5GJBA 1E2JA 2XNSA 3ZVNA 3A1UA 1VCNA 1XXHE 3A1TA 5AUPB 3QE0A 3CLVA 4NP6A 2NO1A 4JL8A 4ZCMA 1Z8FA 3EAQA 3SJAA 2C5LA 2ZRPA 4MA4A 1CR0A 3NBZC 3RS2A 1G4AE 1TAGA 4Q9IA 2WSSD 2IS4A 4RZXA 2QM8A 3IEVA 3CUEF 4BFUA 3GPLA 2DCUA 4QGHA 2D2FA 2IF0A 4BASA 3OIUA 1NI3A 1NBMD 4IXMA 4UKDA 3DOEA 5FBQB 1B23P 1JR6A 1J8MF 3AVQA 4DR3C 3KX2A 3CX8A 1XTKA 3BERA 4OJQA 4E5UA 2IYYA 1JALA 2HLDD 2BBSA 4G0NA 1NN3A 1G19A 2A2ZA 3KFVA 4TTRA 3PEWA 1T4GA 1TQ2A 3P26A 4D2IA 1OFUX 2OLKA 4JLVA 4AD8A 4CEIA 1Z83A 4QHYA 4CW7A 4UNRA 3JZAA 2J46A 1KZ7B 4QL3A 1QHYA 3QQ5A 4GZMA 2CEAA 1ZJ6A 3C4JA 4P4UA 2QQEA 1GDDA 2R6FA 2X8AA 4JV5C 4C0HA 5F2EA 2UUBC 3JAMD 1Z6YA 2PBRA 4NYIR 1MV5A 3QEJA 4NL4H 5TB5A 3Q3JB 3B5JA 2H1LA 4Q7MB 3HWSA 3ZS8A 4WZ6A 3FVQA 3QF7A 5KU1A 4HLCA 1A4RA 1MRNA 3FB4A 2HUPA 4MDEA 4X64C 3FYHA 2YJTD 1IBRA 2XITA 4XTRA 1MABA 4HI0E 4B3FX 1R4AA 4JYAC 3H86A 1TF2A 4TYWA 4BLTA 4DV4C 4KFRA 1NVXQ 4DV1C 4U7DA 3N2EA 1N6HA 5HCNA 1P9NA 4IJMA 1HE1C 2O52A 2QE7A 1FW6A 4LJ9A 3KKPA 1KKMA 1NSTA 4NOZA 1E9EA 3KB1A 2F43A 2ZRDA 1TF7A 3CF0A 3BH7A 4LV8B 1N5LA 2HHHC 4YMSA 2JLUA 1JI0A 1E6CA 1TPZA 1MT0A 2QTFA 5CITA 1ML8A 3C8UA 3B2EA 2A5GA 1DAEA 1P4SA 4UJ5A 3VR1A 3RWOA 4G5RA 1NBME 3AKDA 4HAXA 4A0GA 1G3QA 4WXRA 4M9SA 1XTJA 2QMEA 2ONFA 1XZQA 3SR0A 4C0LA 4TSFA 2HJGA 4NYMQ 1GP2A 4MGYR 4C2TA 1AS3A 1XEWY 2ZRHA 1PVOA 1G291 2PZGA 4NMMA 3IILA 1G5RA 2A30A 5CJPA 1TL7C 1R8SA 1X8JA 4HDQB 2B8TA 1US8B 1KNQA 2W00A 4FWIB 2W0MA 1XP8A 3LQRA 5EUMA 1NKTA 2XXAA 2GWHA 2GBLC 1Z6XA 2G88A 2G1JA 1KI7A 1YRAA 4W5WA 2X1VA 3U4QA 1LV7A 2YWEA 3TNFA 3I61A 5FTMA 1OFIA 3VMFA 5BYKA 4Q00A 4XSHA 1UF9A 1P7CA 3SJBA 5FPSA 1GVNB 1N5IA 3OEHD 4PZLA 1W46A 4LJYA 4CEHA 1GKUB 3EA0A 2P3SA 1X6VA 3DKPA 4M1TA 2O8FA 3CZQA 2NO0A 1TQDA 2WJJA 5JCZA 2Q9CA 3TE6A 2VF8A 1EX7A 1YRBA 2AN9A 2OZEA 2QEQA 1I4LD 4NTZA 5H8WA 4JJZA 1IN6A 3FPAA 2SHKA 1G9XA 4A0RA 4BLRA 3DM9B 4QHTA 1G5PA 4B32A 4DDTA 2QBYB 1U8AA 1FNMA 3R7WB 4QJ4A 4RD4A 4JBXA 2UXDC 4PHFA 2WIBA 3BOSA 2ZE7A 5TARA 4MYCA 2PEZA 2MSDB 1GFIA 4LV5B 4O0MA 5HE9A 4EPVA 2A78A 4X8MA 3AVWA 2W2TA 1TQ6A 2PCLA 3ZLJA 2OPLB 1E9AA 4Q47A 5DHFA 5DNYB 1KI2A 1LFDB 4KYUA 1GSIA 1E2MA 4EPXA 2JDID 2BMJA 3OIYA 1OXXK 5FLXD 1QZXA 1H8EA 1IJFA 4JBWA 1Q1EA 3FGNA 4RKEA 3WMGA 4KVAA 521PA 3T1HC 1LW7A 4B6FA 4F91B 4ACBA 2FV8A 1SXJB 4EFLA 4FMDF 4IOJA 3WNBA 2BMEA 2QA5A 2ZRLA 1T0HB 2PZEA 5GVRA 2J59A 4A92A 2NO7A 1V43A 4R98A 2FMXA 2UKDA 3BB4A 5CIWA 1JAHA 1GITA 2ECKA 3SOPA 3I5XA 2EFEB 3CR8A 1M2OB 1N6RA 4OQNA 4QJ3A 4W9MC 5DN6D 2VSFA 1SXJC 2V6JA 1KDPA 1P60A 4LJ7A 1WA5A 4IDNA 3T1YC 3A6PC 721PA 3SYLA 2Z43A 3ZIAA 4DUYC 3A36A 4RJLA 4HZUA 2WMOB 3IIKA 1QRAA 2WTUA 2YZ2A 2KBFA 3GLHB 3KUCA 3MGCA 1HYQA 4C30A 4ZKEA 1A2KC 2R6AA 4UNNA 3FE2A 3BWDD 4JSYA 2JLWA 1NLYA 1X1RA 3QXJA 3SJZA 4JI8C 4DSNA 5B64A 3ZD7A 4H1UA 3GLGB 1KAGA 1RIFA 4JSTA 4JS0A 2FF7A 3L0OA 4LBVA 3TAUA 4LF7C 4IDOA 3K0AA 1D5CA 1G7CA 4A8JB 4Q02A 5AJVB 2PLRA 1DAHA 2ZR7A 3QXXA 3SYKA 4OQLA 1LS6A 1PLKA 2BCGY 3OAAA 2YWHA 4FW9A 1UBEA 3KKNA 3NEJA 3QKSA 3SU8A 3A1VA 2PL3A 2CHQA 3AP1A 5LDDC 1IY0A 3MJRA 2EYQA 4Q9LA 2ZI6A 2R9VA 3OAAD 3QKTA 1KDRA 4LUCA 4B74A 2AK3A 4DJTA 4BSZA 2FOLA 5KNDA 2EVWX 1H65A 2J0QA 3ZVRA 2YHSA 1KO7A 1HA3A 2RB4A 3H1TA 4QBIA 4C0JA 1T6NA 3ZQ6A 4ACAA 3EIEA 1EFTA 5J4YA 2BMFA 5EUQB 3WMFA 3Q5DA 4Q21A 4BZXA 3UWKA 1J99A 2V1XA 4BEBA 1DG1G 1QHSA 2ZUDA 1PUJA 1W44A 5JFGA 2HYDA 3HU2A 1XZPA 2H5EA 2OHFA 4AYXA 4LJ5A 4ZKDA 1F5NA 2VA8A 1OF1A 3WMEA 4BFTA 5HKKD 4TYNA 5FR1A 4D80A 3GFPA 3PIRA 5KNCA 2UZ3A 4PHHA 4IKEA 1EWRA 1KSFX 2P0EA 1D9XA 3T1OA 4HUQA 4L8GA 1AA9A 1OJLA 3HYTA 4TN1A 2F3TA 3AF3A 1Z5ZA 2P5SA 3MFYA 5FR2A 4NZYA 4A2WA 2ZYUX 3CJEA 1W0JA 1EFHA 3AVVA 5DI9A 2BBTA 4OQFA 4P4SA 1E9DA 2ZI7A 4O2RA 3TQFA 3I72A 1CRPA 5JI3E 1F6BA 4MGIR 4IVQA 3EASA 3UPUA 1S4QA 5P21A 4W5HA 4ITRC 3ZJYA 5BYJA 4GKJC 5FI1B 821PA 2W58A 4GT1A 4DLUA 2V8OA 4FWTA 4MKFA 5G3ZA 4LPKA 2FA9A 1OYYA 1ZMXA 3M4YA 4BFZA 4ESVA 4DVGA 4BWYA 1Z0IA 4EQ6A 2CCJA 2X19A 1AZSC 1IONA 1USPB 3D8BA 4HSEA 2F1IA 3CWQA 4EPRA 1QVAA 1UKZA 4X8LA 1BO6A 4ZDJA 1IBKC 4P3YA 4KYIB 3TR0A 5L3QB 1E9BA 3LBHA 1VG8A 4D4LA 3RC8A 2VSOA 1T91A 1KMHA 3B7GA 4DV7C 2G0NA 4NCNA 2VRWA 2OCBA 4YMUA 4L5BA 2O8CA 2CE2X 1HNZC 3CPJB 3B1XA 2ZITA 4HDCA 1W36B 4DSUA 3I5YA 3R8FA 5FOXA 3QKRA 1DO0A 1Z22A 2X2EA 2J0VA 4CRWB 4B73A 3QF4B 5BWMA 2BWJA 3O8RA 3RRNA 3CRQA 1BMFA 1DBSA 3CX6A 1J8YF 1NG9A 5CIQA 3W8NA 4DV0C 3S1AA 2H7VA 4L15A 1ZCAA 4PO9A 1ESNA 2VP4A 1C4OA 4DXAA 3I8SA 1BYUA 4I1OA 4JYBA 2NTYC 1KTVA 1XPRA 2ZR0A 2E1RA 2IUSA 5EP3A 1OH7A 4RD0A 1B0UA 1A2BA 2V4ZA 5ANRB 4BFVA 1KSGA 3KJHA 5FPKA 4MRSA 2ZEJA 4HAUA 1Z0AA 2ZYVX 5C1BA 2ZE8A 5EE0A 3WYFA 1W47A 3DL0A 1DE0A 4KJZA 1S1MA 1Z08A 4XH9B 1Z0KA 1L4UA 1OXTA 1MRSA 1NVUQ 3GLFE 3REFA 3QNUA 2TMKA 1TTTA 2FPLA 5BXQC 3SN6A 5K8TA 2MSCB 2J9RA 1YZNA 3AUYA 3EZ7A 1HNXC 1Q1ZA 3CRRA 3NBYC 4Q48A 5BN4A 4LC1A 2WV9A 3U60B 1GOTA 2WWHA 4QFMA 5EE1A 1IBMC 4IEIA 4F4JA 4TWZA 2OBMA 1M6NA 2Z6VA 4G1UC 4R2HA 3WP1B 2IS2A 121PA 2C8VA 3T34A 3EC1A 2ZJBA 2RGGA 2WMNB 2DFLA 1CU1A 3L0SA 1AKEA 3NIBA 4C7OA 2R65A 1L7VC 1R5OA 5G40A 3TAHA 2G83A 4WAUA 3KQNA 3K70B 2LCFA 4AWXA 1G7RA 5LD2C 3K9HA 1YHNA 4LDJA 2R62A 1VDZA 4TL7A 4KFTA 3IGFA 4QC2A 4B3DA 5JSZA 1W2GA 2G0TA 1KY3A 1G16A 2WKRA 1COWA 2IYQA 2OSBA 5ELXA 2QROA 4JLBA 1NF3A 1N6OA 2P2LA 4DT1B 2JAQA 2CE7A 2EFCB 1DAGA 1Z0DA 5CK5A 3K70C 5SZKB 2ANBA 4L4UA 1GAJA 3VU9B 3U44B 5DI3B 2IYUA 1DOAA 4QOSA 1DADA 3AVPA 3IHWA 1KDTA 4Z1MA 1FOEB 4Q66C 3KXKA 4B2LA 3M0EA 4IFBA 1VLAA 3E70C 1KI6A 3EERA 3THWB 2IC5A 2JLSA 2VTKA 1JB1A 1N2CE 1GNPA 1UBFA 3VR5A 3IQWA 2IYLD 3T1QA 1G8GA 3PXGA 5FTJA 4AQYC 4BZQA 1W4AA 4BLOA 4CF7A 3C16C 4LK2A 2KI5A 1AGPA 1XEFA 4MH0R 3V4FA 4B76A 2NMVA 2RHDA 2F7SA 3RANA 2QP3A 2PMKA 5UKDA 2QRNA 4FIDA 3ZVLA 4LFBC 3OESA 2IL1A 3H4MA 4WW0A 2GVDC 4LI0A 4ZDIA 4Q1CA 4PQYA 1U9IA 4DLWA 4BGDA 3IQXA 1WH9A 4NYIQ 4GOXA 1YZKA 1XNJA 2GK6A 1G1MA 1N0VC 2VH5R 2UU9C 2ZQ5A 3LXXA 4Z54A 2IXFA 4M1SA 1IJEA 4HAZA 3OFNA 3K0CA 4OQMA 4RCZA 4US0R 1IAQA 2EW1A 3NC0C 5EXXA 3ONWA 2N1BA 2ZS9A 3QXSA 4EJSA 4HDOB 1G6OA 2R6DA 5D3MA 4Q4LA 1U90A 4JI3C 2J0UA 2PZFA 2ZRCA 5CYPA 5AUNB 1ELOA 3SDZA 1X8LA 3TW4A 4NHOA 1JNYA 1RRGA 4DCUA 1VCOA 3KFXA 1S3GA 3NH6A 1G21E 3ADDA 3GQBA 2HDNB 2UUAC 4HB0A 5FI0B 1XMJA 4URYR 2OE2A 3KTAB 3M1IA 3EPKA 1LY1A 5KDDA 4X62C 1JOSA 5DISB 1GL7A 1XX6A 4NCKA 1YZUA 1NMZA 3AF6A 1W0KA 2RH5A 1E1QD 2WOJA 3THOA 3KKMA 1TEVA 2Z4SA 1G6HA 3RS4A 4DB2A 1RKBA 3OE7D 1YZGA 2FJUA 2XTNA 4NBSA 4BFYA 1XXHA 2HT1A 3RWMB 1ZVQA 1ZC4A 1RJ9B 2ZRAA 3CIOA 4M1MA 2O8EB 2GF9A 4NU0A 4X8HA 2F9LA 4HEJA 4DB4A 4D6PA 1FL9A 1E2HA 2RGNA 3TK1A 1GG2A 3BB1A 3KJGA 3NVAA 2FGJA 4EUNA 3T35A 4A9AA 1L2FA 1PZNA 2OCPA 3CM0A 4C3ZA 2WAYA 3BXZA 2FNAA 4CGZA 4I81A 2ASEA 4PC2A 1OH6A 4JZKA 4TL6A 1GL6A 3MUFA 3WRYC 4D4MA 5KSOA 3RSOA 2XJ9A 5JJLA 3X1YA 2C95A 4QGGA 3DMNA 4D82A 1FX0A 5IK2A 1A7JA 1D2EA 2KB0A 4P31A 4PPGA 1MH1A 4H1VA 2CBZA 5GJVC 2FDCA 4OBEA 2J3EA 3CX7A 3E5HA 5M04A 3UG6A 2IXGA 2XEXA 4C0SA 1NVVR 1NY6A 4D0NA 4GL2A 2BJOA 1NSFA 3ASZA 3EARA 4PPNA 1JJ7A 4PSKA 4B43A 3LX8A 3K0FA 3I1FA 1Z6GA 4MKIA 3T5DA 4TL8A 2RMKA 1G20E 1HT2E 1ZM2A 2OBLA 2QMHA 4ZI2A 2UXBC 4KFUA 1G17A 3A4MA 5EE9A 3BBPA 2ZJZA 3W9YA 5JS8A 2AK2A 4CYMA 4CEIB 4CZ2A 2MMGA 4LF9C 2GDJA 1RZ3A 1D2NA 4XD7D 1E1RD 3AH8A 2EFDB 2XSZA 1P62B 3X1WA 1YE8A 2FPMA 4K8OA 4URWR 3RLFA 4BQSA 5J4HA 1SHZA 2BDTA 4URUR 1VCIA 1Y3AA 1N6PA 1Z29A 1UKKA 2PT5A 2XSZD 3CNOA 4FCTA 4E03A 4MH4A 4HATA 1MO4A 2CMKA 2IUTA 2WSSA 3BFXA 2ZUBA 4PZYA 1OHHA 1R0WA 1R5NA 2HV8A 1MABB 3DZ8A 4Q1BA 4Q19A 4S2EA 5SZJA 2IS1A 3B8HA 3CKLA 2WAXA 4QBFA 1NBMA 1UEJA 1NYEA 2CJWA 3CRVA 4PPFA 4GZLA 4B75A 4EPYA 4M9XA 2D2EA 2FSFA 1OHHD 1ZU5A 2FSIA 3AVUA 2HLDA 4GFDA 5H70A 1Q1QA 3W5IA 2IYZA 2I1VB 4JI0C 3B1WA 4EFNA 2FH5B 2F43B 3KB2A 5KNBA 1P5ZB 3Q72A 4I4LA 4QGFA 1II9A 2JJ2D 2PH1A 4MYTA 3LFUA 4PC7A 5LMNC 1SVWA 4CIDA 5A0FA 1SVSA 3IIJA 2ZJAA 4QG7A 2VBCA 4Y0VA 3VKHA 3KJIA 1R7RA 4JLDA 1GNRA 2NO9A
chains in the Genus database with same CATH superfamily
3RRJA 4HPWA 4KLAA 5BWBA 2Q4DA 4LF6C 2TYSB 5JATA 1YR6A 3UICA 2IOQA 4DS3A 4KQHA 3VYVA 3KQSA 1BWSA 3BTUA 4Q3KA 5ALRA 2IS2A 3FRJA 1HG0A 3GR6A 4J9VA 4UUPA 3THXA 5CXUA 3V3KA 2WFZA 3ER6A 3F5DA 4IH4A 2NZ2A 4RK6A 3BXFA 4CMEA 1JHQA 1A8IA 1X70A 1MQ9A 5DP1A 3NVDA 4AKSA 4DBLC 4YQZA 4TGLA 4GGMX 3QEOA 4M8SA 2XXAB 3CZ4A 1F12A 5KMGB 3TIXB 3FMVA 1S2MA 3U4QB 2M5HA 2Z6QA 2O50A 4R3NA 2VRNA 1WDTA 4EYQA 3QMVA 2JIMA 2R1TB 3O84A 1NYTA 3A31A 3KWLA 4IVNA 4TLAA 4CEHB 2XQFA 4X90A 5ICFA 2QU8A 1TIPA 3EZ6A 4HNQA 3TVDA 4BV3A 3G9ZA 3PX2A 4QBHA 1ZSNA 1WPGA 2G1KA 4HQ6A 3X2FA 2Y8EA 2NUPB 4YY3C 3QV2A 4CXMA 3L8ZA 1SUAA 2QLTA 1YJCA 3TTVA 5BUZA 4I6EA 1WXIA 3ND7A 1DGQA 2DOKA 4AJNA 3KOWA 5B3KA 1I1HA 4HN9A 4NAHA 3V2GA 2CVHA 2FZLA 4U3JA 2IEDA 1GZDA 5AVJA 4X44A 1J06A 4NFHA 5B30A 5B53A 1ZAYA 1UQUA 2AMYA 2VQFC 3FLBA 3ORYA 3ZDZB 1QG2A 4I4IA 3PENA 2ATXA 2IPLA 3NATA 4PGHA 1LBIA 2EJBA 1BXGB 2QY6A 4IDBA 5L8VA 5K0LA 5BV7A 2WHEA 3S70A 2P79A 4IZ6A 2FMFA 2EF0A 3VU0A 2ZRMA 3JD1A 3LC1O 3QM1A 2QIPA 4NCJA 1RTTA 2B82A 3DL7A 2GZ1A 2HREA 3H2TA 3HDHA 3DAFA 3L01A 4QPDA 2YV4A 4YV2A 2DWPA 4HGOA 4RIGA 5AW2A 2BOVA 2HPAA 4DIEA 1E2FA 1TLLA 4JBGA 5HDBB 4CU2A 2C99A 1CXZA 4FZ3A 3K9LA 1CJKC 1DRKA 3U4AA 4KWEA 4ZAYA 3IEMA 2V7QD 3ONEA 2OP0A 4XPIA 1MLDA 1LVUA 2OMEA 3PEVA 4EQZA 5A02A 4S1PA 3IERA 3JQRA 1PBTA 2ZTLA 4WNAA 5D7BA 1RI3A 4GX2A 3UUGA 3WLMA 3AF5A 4FC7A 1TADA 3A1DA 4RC9A 5KJ6A 2FMIA 1XWFA 1B26A 3LPLA 2Y93A 3SXPA 5FBRB 4KIGA 1OA1A 3ZV6A 4B6PA 2YHBA 4B81A 4BQQA 4DVJA 5I47A 1SN7A 2XUDA 1D9ZA 1CJMA 3FY4A 3TL3A 5AVYA 4KL8S 4HSGA 2C9OA 2C2KA 3TR3A 1FMTA 3DFUA 4B83A 1O5OA 2AZXA 2I4IA 3O0TA 2A84A 3COSA 1WEKA 1RHKA 1YR9A 4L0QA 4UAUA 3WA6A 2AT1A 2GCPA 2VT7A 1Y7HA 3MMSA 3JVVA 4FKMA 1QPGA 4FFOA 5I5EA 1C8BA 4JXKA 3TUIC 1UBUS 2O3UA 3P0IA 2E87A 2JBAB 4OH1A 4WIAA 4BRZA 3E7DA 2OV2A 4A15A 3WLQA 3QKIA 2D4AA 5SZIA 4Z8XA 4U2GA 2Q5HA 3RF6A 3ZC3A 4BNYA 4MI3A 4I1RA 3LGXA 5BNTA 5KNDH 3H8SA 1YDMA 5FLXA 5JMWA 4BXOB 1MJ5A 4Y9TA 1BIFA 3JYLA 1OU4A 2GN9A 2AVDA 1O5TA 1IY1A 1QV9A 2FW9A 3PQ6A 3RKRA 1VCMA 4MWBA 4U6QA 1PJQA 2P9GA 3AUSA 3WIOA 3VSDA 3TUZC 2B8NA 2GWRA 2W71A 5I7VA 2D5BA 1T34A 4LF8C 2WUEA 4YAUA 4PAWA 1SQFA 4L5AA 4BP8A 2QMUA 4L51A 5EJIA 3T94A 3JPYA 3QE2A 5EINA 4BBYA 1JECA 1PK9A 2E5WA 1ANKA 3ZHXA 1YZTA 2R1UA 2QXUA 1M1YB 4FT4A 2QT9A 3T4UA 1KL7A 1Z5VA 3LRTA 3MT9A 1E20A 4K87A 1T2EA 3C41J 3PDJA 2P2DA 2OORA 4D4JA 3KO8A 4DY6A 3IUBA 3EGVA 4BO1A 4NU8X 4UHEA 2HZ7A 1HFWA 2O4CA 1GN8A 1VKJA 5ITZB 2YVUA 2GS9A 4LQDA 2PX5A 2WA2A 3H9QA 2GSWA 3OEED 1C9EA 3GUCA 4MEAA 4WK4B 3QKSB 4FKZA 5E0OA 1IHXA 4MARA 3WK6A 1J0EA 4CDNA 1AK2A 4L9AA 2C4TA 2JG3A 2W37A 3G0GA 2NACA 2PKRA 3BJMA 2J33A 4NZZA 7AT1A 3TCXB 1WXHA 3HABA 2ZRKA 3DCYA 4RY8A 2QG9A 1W5SA 4H4CA 2P91A 5JASA 1PSWA 3VHXA 3ICOA 2GH1A 3PNSA 3S81A 4X9XA 2O14A 2R8PA 5ES3A 4PGGA 1I33A 4ZAVA 3ZCRA 3HKBB 4JLOA 1NAIA 1SCJA 2DB3A 5K1ZA 1CY6A 2O2CA 2SBTA 3EWNA 1KE1A 3G2LA 4DM4A 1LPNA 4ARAA 2XI4A 3MSXA 4OYYA 2WWGA 4I55F 2C5EA 2G3YA 2D54A 3VNQA 1K8RA 2GASA 2WWVD 4KRFA 3SQWA 2ADFA 4U5XA 4WACA 2NPIA 3VSCA 5KBYA 4F6LA 5CDSA 3R9WA 1EQ2A 4FCCA 4YUZA 2B92A 2ODQA 3P32A 3BILA 1A9OA 1ZJZA 1ULBA 4JQCA 1Q0HA 4N49A 3DUWA 5A7FA 3F6RA 1J25A 1YB5A 2PRKA 5LP6F 1Y6FA 3KPJA 3Q8MA 4EHJA 4M89A 5AW4A 2VKQA 1N25A 2X1MA 3B6EA 3SSOA 3UMVA 3WC4A 4AICA 1JR3E 1PL7A 3MRSA 1E5DA 1DELA 2YOHA 1I1OA 1Z0UA 2LR0A 4ZYVA 3N54B 2LNDA 3CONA 1R4ZA 3HPRA 3SF0A 4LX8A 4ER5A 4AYWA 2JGDA 4DDWA 1SKQA 4J0JA 3FNQA 1H2YA 3KVYA 3OJOA 3AHIA 4B2YA 2CYBA 3AY0A 3M9LA 4D5GA 4FUQA 1LDNA 2IXAA 2ZPTX 2Q3FA 3INRA 4ZO9A 1JIIA 5FUMA 4EP1A 2H2AA 3SLKA 4E5VA 1QIDA 3F3YA 3VR3A 3CEAA 2G82A 2JPDA 2CD9A 3DLPX 3P0JA 1FDIA 2HIAA 5C4IA 5F9HA 3N9IA 2NU8B 2JGKA 4J94A 3T61A 3NBUA 3KAPA 3D2BA 4NJEB 4D44A 2XF8A 1PR5A 1J39A 5LYJF 4G0OA 3V4PB 1H2WA 2RI6A 3AM4A 4KDEA 4EWLA 5LWHA 3HU3A 3FKSD 2XUAA 2GGSA 3JWEA 4OSPA 2V6IA 1KYWA 3D5EA 3NFYA 3EVAA 1XMOB 1T9BA 1XI2A 4FNOA 1PV4A 3SS9X 3CBQA 2FSGA 1D4AA 3UKJA 4UU0A 2AFHB 4G8JA 5CK4A 3ONDA 3DEFA 4JMLA 1XU9A 4PN3A 5CDFE 4MUGA 4RNDB 1Z15A 4G26A 2XQGA 4MUJA 3ZHTA 2QZ9A 1VG1A 3MF4A 3SC2A 4IUYA 2X5KO 2C0PA 1QQ6A 2X5JO 4MV6A 5JEDA 4ALKA 4G9GA 4JA2A 5JTTA 2ECOA 2QMOA 2JANA 3AP3A 3FPFA 3I12A 2Z9DA 5FULA 1CULC 4EJ0A 2YZKA 4PXSA 5E95A 1BQ4A 2H1HA 1BROA 2DPXA 2Q3LA 4CKBA 4Y2YA 1CEYA 3L3BA 1TT7A 3HVRA 3DDWA 1Z18A 5M7EA 1Z8NA 1LDBA 3DVLA 2VUSA 2R8OA 1AUXA 4DR7C 2X77A 3NUZA 1VQ1A 5DVZA 2RGCA 4C1NA 1WVMA 5CFZA 3ME5A 2AMLA 3FM9A 1ZL0A 2C1EA 2DUUA 5AXAA 5AIBA 1UWCA 2XWBF 1UMDB 4M8LA 3U9TA 3R9XA 3FPGA 1ODTC 3WHPA 1IN8A 3KYDB 3LSTA 2G1UA 2VK4A 4AG3A 1DTEA 1KOFA 3EZ2A 3JRWA 4QPNA 4GM1A 2IWRA 5CA1F 1Z4LA 5ADVA 3FMPB 4KITB 4B3RB 3INNA 2QAGA 1DAOA 1PS8A 1YS9A 1K5GA 2GN2A 1TA9A 1CP2A 1JEJA 1Q0LA 1SXJE 3GVIA 1DXOA 3A1WA 1GQFA 3K73O 5J59A 4HWRA 4PAMA 4P1ZA 3WA7A 1PJSA 2VPQA 5CVCA 1ZOPA 4O2AF 1XL0A 4YXWD 4UULA 5BSFA 1Q0UA 2HRQA 4GI3A 3PR1A 3RSLA 5I6DA 2HMUA 2QZJA 1UBSB 1XJCA 1I3LA 4NENB 4Y2SA 3HVKA 4Q9JA 5CURA 1D7AA 1Z12A 2VWPA 3NHMA 4YLYA 3BE4A 1OTHA 5BN4B 3I09A 2NXJA 2ODBA 1LPOA 3RI3A 3C39A 1UK6A 3RBAA 3GPDG 3U7GA 3D31A 1HZZC 2Q99A 4BUZA 3Q3VA 3U49A 5L3SB 4U2CA 3DUFA 4ML3A 2C8LA 1ZZEA 2X4DA 4KP7A 3QE9Y 2JJ1A 4ZYLA 1NUHA 2F2TA 5FBWB 2WKSA 1RZRA 1YUMA 2HRDA 3G1TA 3G02A 3HJBA 3KBBA 5EXPA 2HZBA 2RSLA 4L75A 2ZR9A 2PJZA 3KTFA 3K0BA 1DU4A 1U0NA 4BNLA 4B6GA 5KYXA 3AEXA 4G6ZA 3N53A 2O1XA 4FILA 1QO7A 4F4DA 1FNNA 1NY5A 3WK5A 4DEYA 4RMJA 4LXQA 4ZK2A 3UATA 2YUTA 2W2VA 5KKAA 4YDHB 3GLGE 4J2OA 2OYRA 4EFDA 5AOCA 3QSYA 3Q8LA 2ZM6C 2ZSAA 2ZZNA 1A4UA 1WSDA 2VPZA 3CLSC 1T8TA 3E15A 3PHLA 4JNCA 1XMVA 2X9GA 5F35A 5FPTA 1E6UA 4KXYA 2I4OA 5EP1A 3RVBA 3STWA 3QOFA 3ZOKA 4E33A 1R6UA 3GJTA 4UJ3A 4CF6A 1FRZA 1NX6A 1XHEA 3OCXA 3U4GA 2BONA 2CWDA 2FB9A 5AQEA 1C7RA 5I9TA 3EPLA 1MXCA 3QIVA 3ZX4A 2NX2A 2W2KB 1KEVA 5JVDB 2PL1A 1AM4D 3QUSA 4RVFA 4NXMB 3V7NA 4TLEA 4FMBB 4NPCA 4QRHA 3LBAA 2FPPA 1JQ5A 1E5QA 1UBCA 1I7LA 2VO1A 2VYNA 3LPCA 1MMFB 1J1ZA 4HEA6 5HE8A 5HJ2A 2RONA 1VPEA 1J20A 1VXRA 4WL0A 3EG9B 1U9YA 1EFKA 4WUVA 5ULLA 3FBGA 3LPDA 1R0SA 4XR9A 3T54A 4JLSA 1F4PA 3UH1A 2ROQA 5F12A 2OUKA 3N59A 3KR9A 1WW3A 3T0FA 4PAGA 2VVTA 2I2FA 1DKRA 3HR8A 3NFRA 1OX4A 1P2FA 1Q1BA 4L0CA 3IUQA 13PKA 5AVQA 2B8JA 3U3MA 1OLSB 2ZB3A 3JATA 5CLFA 3ANTA 4KX5A 4ADSG 3FPSA 2NAFA 3VYWA 4H08A 3S99A 1YVDA 5GJCA 4BMDA 4LKOA 4PX3A 3ZU2A 3R76A 1UAAA 1D6JA 4DMHA 3K6JA 4D8VA 1Z74A 4DLZA 1JLRA 4DUZB 1V9CA 3HYRA 1K06A 1ONPA 3MTAA 1N36B 2I65A 2PHZA 4I8XA 4JJKA 5F2NA 2PMBA 2VP3A 3F1KA 4R1QA 5CXSA 3R9IA 1FDRA 4B9AA 3OTOB 1DRVA 2DUWA 3E3AA 2DKNA 1NONA 3Q2OA 1U9IC 4UDXX 2QT0A 1DX9A 1UJ4A 1FRVA 3L6DA 3VZPA 4QKQA 4L6IA 4CLOA 4MIOA 4WCFC 5KTTA 1AB6A 3VR2A 1PSDA 1RM5A 1CE8A 2CXXA 3PNLA 3TXXA 4IXWA 1Y81A 2C9DA 2DBYA 2IPOA 1EP2B 4RK4A 2BEWA 4S1OA 4ZEWA 4F3TA 4BBZA 7YASA 1D4ZA 1X8KA 2ZVJA 4A5OA 2N47A 1O7JA 3HDTA 1QSGA 4JY7A 1KKLA 1GEGA 5K3CA 4ZZIA 4YIHA 4GMGA 1E32A 4DG9A 2H59A 1QF6A 4Q7JB 5CT6A 1ZB8A 1JWBB 4MUAA 4EJSC 2UU9B 4X1OA 3HCAA 1QG6A 3TTXA 3L8FA 5IDWA 3SM3A 5E7JA 5EMNA 3VPHA 2VN8A 1E7RA 2GBCA 2R6R1 1YWGO 2YQZA 5JCXA 5FUWA 3X44A 3DTYA 4IF6A 4CDGA 1M1XB 2XUKA 2QTRA 1WIWA 5DX0A 1GKYA 4LHWA 1X80B 3O9MA 4B3MC 5K6TA 3M1LA 5JCJD 3G8YA 4ESVA 4PUGA 2IWHA 4B40A 1XWIA 2IRWA 4WCFA 3I42A 2RBGA 5FOSA 1XNRC 2FP4A 2QR3A 2R97A 1VYVA 3GO4A 3Q85A 3UJDA 5JSQA 3CKKA 1VI2A 1FFEA 3RAGA 1DQYA 1B2LA 4DR4C 1X74A 4J0CA 2B3DA 4M0FA 5DBHX 4COKA 1Z2EA 3GCGA 3GCDA 4BPBA 4B0PA 3GZNA 1EUQA 2J87A 5M2QA 2DC1A 1G55A 2ZWAA 2PT7A 4RHCA 5DT2A 4ZMRA 2FMUA 1GUDA 1PQYA 2BTQB 4RDHA 3O2NA 3OCJA 4XUDA 2BFWA 1RFLA 2Y99A 3EPRA 1A97A 1E99A 1EDEA 4X94A 4YMVA 2PLFA 3NDPA 2AYZA 2RC6A 3II6X 3OZVA 5LQDA 1JG1A 5DB4A 4EF4A 3T4XA 1KEEA 1VJGA 1BRMA 5DYIA 1GZVA 3FPEA 1IMOA 2F64A 4R31A 4TKZA 5T8KA 7REQB 2GAOA 4LHVA 4EDHA 4CIWA 4BUJA 2QZSA 3ZJTA 1EP1B 1E1QA 1MKYA 1Y9AA 4ARZA 3EF3A 3IYLW 2VQDA 1WBBA 1WV1A 2QSYA 2TMGA 2WM3A 3O26A 4N39A 2UZ0A 3W6NA 1G2QA 1VLLA 1LI7A 3LNTA 1QS0B 5AJXA 3ZW9A 3K0FB 3ZQJA 3TI9A 4TKMA 3JQAD 1K7YA 3C1TA 4V0MA 1GG5A 3HDQA 3EZGA 3RRZA 4X6UA 2WSYB 4XDYA 3VX3A 3O8CA 2WIKA 1T13A 4ZYZA 1OZHA 1IK6A 3O1LA 4OYRA 5CB8A 1JDTA 3NETA 2JI6A 3HYCA 2J9ZB 4QATA 2QZZA 1XCGB 4C14A 2QY9A 4XFDA 1NV8A 1XKQA 3R74A 4OG2A 1M2WA 2CVFA 1RD4A 2WWWA 4JUIA 3RUEA 6NULA 2PS3A 4J4BA 3WRXC 1OMOA 3GGOA 1QHHA 2J7KA 4UVDA 3W7VA 3AEYA 3PNMA 1XPUA 5KWEA 4WLOA 5E4FA 4RVCA 3L0YA 1YL5A 4YAEA 4PC1A 3TYXA 3H2ZA 1QHFA 1ZOLA 2B4KA 3JYNA 1N1GA 4MUFA 2QSZA 5CXXA 3WZLA 1PQ4A 1E4EB 1XVUA 3K9CA 3C14C 4ZCLA 2I5PO 3BXXA 3EH1A 1D2MA 1P9WA 1THMA 2WNIA 3JRXA 5CHYA 4EARA 4DLRA 3PF8A 3PROC 2HBZA 1D5WA 5J2UA 2Y4NA 2J45A 1ZIPA 3J80D 1JEYA 1NRIA 4JI4C 4NLLA 1YDFA 3M49A 2L42A 3DJFA 2UZ1B 1BU5A 4Q3DA 2D27A 4ZA2A 2UXBB 1B6GA 1SXIA 1RE0A 3SD7A 4JI7B 3UGQA 4F2DA 2ZJ5A 3NJ8A 1YB7A 1BEEA 1XDUA 3Q7QA 1OKKD 4QDUA 1XF9A 1S9DA 4YN3A 2ZJ6A 1UFQA 3I5AA 3OLYA 2COEA 1U3TA 5LQSA 4YLGA 3QKWA 3NTXA 3GJ7A 4PSVA 2JD1A 3GXOA 4OKIA 5A0TA 5EJFA 4HMOA 4H3KB 1OYOA 3COJA 1YQTA 1OA0A 3CE9A 1VE1A 3KZ1E 3IIIA 3EBPA 3AUKA 3MINB 4RS3A 1E1RA 4MQEB 2SKCA 1O90A 1V6AA 3NGLA 4NCIA 2JLQA 4GPTA 4PQFA 3FCSB 4JASB 2MSEB 4N0QA 3T3EA 1KO4A 4CT5A 4DLKA 2YCLA 1YFLA 1NVWQ 4DDVA 2WIAA 3B38A 3ZBTA 2I1QA 4Q0MA 3E3NA 3GY0A 5LYJA 1T6BY 2J5KA 2JFQA 2PN2A 3FNGA 3NALA 5FOWA 5JCOA 3TR5A 1QDLB 3K4PA 1PNQA 4AP5A 3NDBB 1VZ2A 1VJTA 3ENNA 3FVRA 3VKWA 4DQVA 5HA5A 1I0IA 4X66B 2VDQB 3OJ0A 3ETLA 1NXWA 3CQ3A 3I58A 4N41A 2VF7A 3QOYA 4EK9A 1ULZA 4KQ6A 3DE4X 2ORYA 4G5SA 1N75A 1IL0A 3AFHA 3DBLB 1Z4KA 3IEUA 3MPOA 4GP7A 1XUOA 3DV2A 3LCRA 4QPPA 1OXUA 3ESXA 4ZPXA 5LMNB 3QWHA 5B58C 4X3OA 1GA4A 3OD5A 4ZVPA 5EIFA 2I67A 2OV4A 3F46A 3I3OA 2BGWA 1JE0A 1ZBDA 5FRDA 4PYNA 3EGDA 3I32A 4QOHA 2JJ2A 2QX7A 4QNNA 5I9MA 3T7AA 2KSQA 1A5ZA 3GUZA 4GR4A 2C9YA 2G9VA 5JNTA 1QTIA 2BV3A 2OXCA 4YXFA 2OVFA 5M34A 5H1YA 2GKSA 1O9GA 2XOKD 3PQCA 1O58A 5DXJA 3WBKA 1C7JA 4AG6A 1S2LA 3BQNB 2XMDA 3X1DA 1K8YB 4LVUA 4US1R 4LZWA 5FBLB 3AB8A 3WMWA 5KVSA 1KJ9A 5DZSA 4OB7A 4PG7A 2PX4A 1XPOA 2QN7A 5ALGA 1L7QA 4GOKA 1KO8A 1ZGZA 4U1RA 3EXEA 4GW3A 2X1LA 4RL6A 4F86A 1AQIA 4N1AA 5CNMA 1HH2P 4EY3A 4ZEMA 5JXIA 3M5PA 1VCHA 1N8NA 3P2EA 3E8XA 1F17A 4M0CA 1EFAA 4ZCSA 1TM7E 1WD7A 5CA1A 1NLFA 5EJ9A 1KI3A 3IPRA 1PR1A 4ED9A 3O9ZA 4A1OA 1Q19A 4BIMA 3KQHA 2BN4A 2SCUA 2ANCA 1SPXA 2ZI5A 3TBHA 2EZ9A 5JZVA 2PR7A 2X8JB 3CYFA 3K7EA 1OASA 4QM7A 1XQVA 1XYGA 3HADA 4HRYA 3DGEC 1MEJA 5EXSA 4DLXA 4OK5A 1N8KA 3NKLA 3RVKA 3WB9A 4WLNA 1F2DA 1U99A 4JEUA 3TLKA 2H16A 5REQA 4C5AA 3MWEA 3QUTA 1RSZA 2HBQA 1TD1A 1E3SA 1CDZA 2WG0A 4OK6A 5CLIA 5E9JA 3U7HB 4KAAA 3VVBA 4E46A 1H3NA 1DTWA 1IOWA 2B7BA 2ZIXB 5CEJA 2D62A 3FTNA 3O5AA 4JJ4A 3KSAC 2CKDA 2B6HA 1N6NA 3LAXA 1P29A 5KKNB 2CHVA 5ALMA 4WKCA 3TMAA 2UYOA 2EKZA 4BLWA 4RHFA 5BT9A 2Q3EA 4LXUA 3JZMA 3GLKA 1T3HA 3HYNA 4O1HA 3TRKA 3VTKA 4F93B 1K63A 2QORA 1KOGA 2HA4A 3LAWA 2GMWA 1T3GA 1ZS9A 3QU5A 1JPNA 4RA9A 3BEOA 1PFGA 3JASB 4BNZA 2PZBA 1S7CA 2HCRA 4BL5A 3U7IA 3HLKA 2QD1A 2WF6A 2FPGB 2QK4A 2VS1A 4DYHA 2A0UA 2DH5A 3U80A 2ZAIA 1AKRA 4MVJE 4KK3A 1CUZA 2LIPA 5B1EA 2FZEA 4FE7A 3X1ZA 2O6HA 2LGJA 1ZN8A 3WIDA 1C9JA 2P90A 3QG1A 4OFBA 4BO3A 1YULA 3EQ9A 2V7QA 2KDNA 3TMKA 4JLNA 1AXEA 3AILA 1PA4A 2EJWA 4CETA 2XQKA 3MD9A 1R00A 3T52A 2XR1A 1R0KA 5KSYA 2PMEA 2GJSA 4KC0A 1UT5A 1CZNA 4LZOA 4EMTA 4D4GA 1QF7A 4EZBA 2VAVA 4MGHA 3K9NA 1XMQC 3SFTA 4HNTA 4UOZA 3A6GA 1CNEA 1M3SA 3ID6C 3S3TA 3U13A 1W6UA 2XXBA 3PLAE 4E5YA 2VJPA 2YINC 4HS4A 5BQFA 1XTUA 4Q3CA 2VDWA 5BWCA 2G28A 1KDOA 2GNPA 2WB4A 2C4UA 2F3SA 4HLQB 5ITWA 4QRDA 3I53A 3WDMA 3KLOA 1DBPA 4G4JA 3D3NA 4BNUA 4ALMA 1EAYA 1XAGA 2GXUA 2JGEA 4CN9A 1XVVA 4C4PA 4YGXB 3BHJA 2AG0A 4TROA 1PDWA 3JALB 2X1HA 1YI8A 3ICCA 4TWBA 3KU4A 4BVFA 2RBKA 1Z2AA 3BK2A 2VZEA 3WLLA 3PQ7A 4DDMA 4U63A 3RVOA 1FZQA 2OV1A 5JVDF 5EP2A 5CPBA 3I9OA 1UZLA 3AFIA 4QLOA 4AG5A 3J7TA 2GEFA 2ZUCA 3DEIA 3FMIA 3SQLA 1RQ2A 4BWFB 4YHBA 2XB4A 3FLAA 5BMVB 1C4XA 2G71A 1FS5A 3PPYA 1TA0A 2QTTA 4E09A 2JKYA 1PYDA 2G9RA 2W6JD 4HWGA 3ZDEA 4EJMA 4BKRA 4M6WB 2Q5EA 3SPXA 5ALYA 4DKJA 1ULSA 2ZK7A 3U3RA 1NKSA 4KACA 1AKVA 2PRIA 3GFSA 2WWFA 1Z8HA 3L02A 4RYDA 1C4WA 3K0SA 4IZHA 1VP9A 3L0IB 4NAUA 4AJHA 1KGDA 4YUXA 3VHLB 2FPWA 1FTWA 1L5YA 4XDGA 3OEEA 1FXSA 3IKLA 2G63A 4OHCA 3LRPA 2ZYWX 1Q15A 4WOPA 2ZSKA 4MLPA 1N2GA 1AK1A 2ZKIA 1W48A 4QASA 3U4IA 1V5WA 3AQ4A 3AEKB 3IMGA 3NGMA 1CBUA 1QYIA 3CGGA 3KZNA 4JUBA 2PWBA 4M1WA 2GNOA 4N7BA 3ANSA 1E7YA 1II8B 3EXIB 4GKBA 3IBCA 2BFEB 1H5UA 1XMPA 1ORTA 2OAGA 4FYMA 4BMCA 1KDVA 1Z45A 2QUIA 4BECA 2XB2A 2H65A 4L3OA 2AR7A 4JJAA 3ZHUA 3MXOA 2XDYA 3D6NB 1HEUA 3E6AA 4HGPA 3ZHCA 4QEDA 4YGYA 5J4VA 1VB3A 1N7IA 1W1WA 2AF4C 5I3ZA 4A4DA 4JT2A 1EXNA 2CXNA 5JFTA 4OLAA 3MCUA 2HU8A 1M2GA 1WB4A 1PL8A 2IOYA 2G77B 3E1KA 1P3Y1 1EGVB 4HG2A 3CQ9A 4WZAE 3G5UA 3UJ8A 5JAIA 2XMPA 4KKXB 1WKVA 4HWOA 4KQFA 4L3WA 5CDYA 3P9CA 2EWVA 4CV2A 4GVLA 5FJIA 1PR0A 4IDAA 3CJQA 5INTA 2DULA 4KJXA 1K27A 2JBAA 4IYJA 2YMQA 2FWAA 2GCNA 3BK7A 3MTGA 1YS2X 3C3YA 3VR6H 1M66A 2YXLA 2K87A 1AQYA 3AR4A 3CVJA 1RWXA 4X63A 1E1YA 3QVGA 1E58A 1NAHA 4DW8A 4YRSA 4RE6A 2QTLA 2XUFA 1Q12A 1QRSA 1RG9A 1PWZA 2HU5A 2WU1A 3QITA 4C4SA 1WU8A 3LQ2A 2VRBA 3LC7O 3MGBA 4AY6A 3B70A 3EWSA 4RQUA 4F3NA 1NG1A 4F5DA 1RYBA 3H18A 1RJEA 4G5HA 3KFLA 2GESA 5J40A 4DWOA 2PU7A 3MVEA 1P6XA 1V3VA 3ZCXA 4BGIA 4B5LA 3CXUA 2JI7A 1C7IA 1GTG1 2GHTA 2VQEC 2X9VA 1S8FA 3QVOA 5C0OE 1HMYA 4PRLA 2EEPA 3UIEA 4BVGA 2YZMA 4JNKA 3JQFA 2BM9A 2HXYA 4PS0A 5KINB 1JQBA 4MW0A 1JFTA 5JMPA 1ZNQO 3GLFB 2YJ6A 2ZRBA 4TQ9A 5FQNA 4E07A 5JU6A 1DIBA 2YDYA 3VV3A 2C2YA 4Q1VA 3FKSA 2RD2A 4QAJA 2PX0A 3WGMA 5ITZA 3CLHA 3R3XA 1YGYA 4JP1A 1XDZA 2OCLA 4JYCA 4RV9A 4RTMA 3DO6A 2WA1A 1KBQA 3KXLA 2Z8YA 4Q15A 3GJ5A 4ZT3A 4AZVA 1QJ4A 3CBGA 1RP1A 2L2QA 3WLFA 1MAUA 2Z83A 1LB1B 3WYEA 2OY0A 4QT4A 5EHZA 2GJ9A 2IEYA 3MAJA 3HB4X 5DU2A 1ML3A 4DLYA 1O3YA 4L2IA 1QKIA 1SZCA 2ZYHA 3GH3A 4MMYB 3S2ZA 3UT5B 2BE9A 3F2VA 3RJ5A 1JA1A 1KJZA 4B7XA 1UMKA 4HQOA 1FDUA 3U3ZA 3KQQA 1H94A 3GLHA 3ZIUA 2AC2A 1PFVA 1Q77A 2M9MA 5KNDD 3BZUA 2GPJA 3URKA 5LYYA 4FINA 2GBIA 2VRCD 5AXBA 4YT5A 4NQZA 5EQDA 3WWZA 4ESHA 4NYMR 1FNBA 3IAS1 5DTMA 1VL5A 5DNCA 2HXSA 3C3BA 3EGIA 4LMRA 3SICE 3FKQA 5DWVA 1OT5A 3KT8A 3QZUA 3GEIA 4ZZ3A 4MHTA 3S1AB 2FJ0A 3F5SA 4Q3OA 1JG7A 2K2QB 5I7AA 2P8JA 2CNLA 4HB2A 3V1YA 3R7FA 4BC1A 5BSHA 1OAOC 1Z2NX 1BA2A 1DS6A 3HMKA 3W4JA 3T3GA 1EMDA 3LLVA 2XY4A 1XDGA 4B71A 1V48A 1IVYA 1JR2A 4DV3C 2I2BA 3PU6A 4Z51A 2BT4A 1A5BB 1T8SA 4AJKA 1C9YA 4H31A 1C3LA 5F73A 1Q21A 1YQEA 4RA6B 3CNLA 1BRTA 4DHWA 2Q41A 3OQNA 4Y2PA 1SUFA 1Z5WA 3MRXA 3P9YA 3QVUA 4YXWA 3BWCA 1PZHA 4OL0A 2D7CA 1QP4A 1B3BA 2QX6A 3AQIA 2P1ZA 3TG2A 3RBVA 1KAMA 3JQPA 4MW4A 1T10A 1G5TA 2O7NA 3LVRE 3OZGA 1RACA 1YTLA 4ZD6A 5JSYA 1R3UA 2VAXA 2PFGA 3I2FA 1E0SA 2R8XA 4LTNA 1RC8A 2G7MC 4FOTA 3DLIA 2H48A 5A4KA 4DV2C 1B1CA 3EISA 2YYAA 1SR8A 3QYPA 4XARA 2WKQA 4IW3B 2XVAA 1O94C 3DTVB 4L9SA 2B8WA 3M89A 2OC4A 3B5IA 3RHFA 2MWMA 2KS6A 1IOZA 3U7EB 4G0XA 3TI7A 1R1DA 1TUIA 1W1IA 2IW3A 2OB1A 2IK8A 3ACDA 4A6EA 2OHJA 2E8EA 1LLCA 2OVBA 5K4HA 1SOUA 2EJVA 1UZNA 4M54A 4MB6A 2BFBA 4GR9A 4FEGA 1ZSVA 1EGHA 3DXFA 5TVGA 1D2CA 4DA7A 1D8AA 2CNKA 2ZWVA 3DLAA 1JGTA 1FVOA 2AFHA 4XUGB 5LJIA 2OT3B 2ZCVA 4F7DA 4EW3A 3V1UA 3CLRD 2ATEA 3JR7A 1IK4A 1ZKDA 4LJLA 2E82A 3B9PA 1QO9A 2VP6A 2HLPA 4IFTA 4M88A 3KUXA 1GNTA 4O2LA 4OI4A 4KGXA 5KTKA 2C8KA 1NXXA 3HK2A 2FUKA 3H2YA 1ZD5A 2WT8A 4KPUB 5LMUB 1C3OA 3IT2A 3O8DA 1PZFA 1UPBA 5AHWA 3BC1A 3KVOA 1NW3A 2BUCA 1L5FA 2VHUA 3O4FA 4WBNA 5HQJA 3LP8A 2PBZA 4N0EA 2NU7B 5JBQA 2N3ZA 4BMXA 3LIPA 3EUWA 4BX2A 1CR4A 1GNVA 2WJVA 1Q11A 1PNVA 2EGHA 4FGZA 4HLNA 2UVPB 4IEEA 4QOJA 5GWXA 4EHHA 1LTQA 3GEMA 3PHJA 3QVSA 3LF2A 1CHNA 3SC6A 2QKYA 1FP7A 1GLGA 1NRJB 1YCFA 4M8KA 4RY0A 3KNZA 2YZNA 1BS1A 5J2TB 1S5PA 4BFSA 5F3DA 2W0SA 4XM2A 1KVUA 2O2HA 5F9MA 5JSUA 1H3EA 4X3CA 1KXJA 2ZIFA 2WE8A 2YS7A 5C4GB 1MVNA 3PRYA 4DV5C 3ZWCA 4DMFA 4OHWA 1A8HA 4HVLA 3N0WA 5CT5A 1EVKA 3BMOA 2Z2IA 1LC3A 3AR7A 1DVRA 3DSRA 3EA4A 3HKCB 3O47A 2UXCB 3CPEA 1KOJA 1MG0A 2WABA 3QEMB 4NSNA 3SLGA 4WJKB 4DQLA 2WUFA 3RJ9A 5IUKC 1ZUIA 3L77A 1XD2B 4MAFA 4LISA 1OTXA 1U65A 3AM3A 3O93A 3ONVA 1IBLB 5C2JB 1I6WA 1ECCA 2M1XA 1NJ8A 4YMTA 1Q14A 2CNNA 2FG5A 3LBFA 5ALVA 2FPXA 1WUHS 1X77A 5EXDA 1XTRA 1TKBA 1KR2A 1ZA2A 2CLFB 4BFWA 2PS0A 2CC2A 4XASA 3PL1A 2XT0A 3SIRA 4B34A 3WI7A 3CF2A 4ENVA 1NNUA 2YYZA 3MIIA 4LC9A 5K3OA 1HL3A 1MC1A 2W4QA 3FCUB 3M33A 4GI7A 4RKWA 2GEUA 5AKZA 1L8LA 3QF4A 4QREA 3WLOA 3TJZA 5I9IA 5ICSA 1A1VA 1F2UB 1U04A 4R2JA 2C1ZA 1TYDE 5L3SA 2CVPA 1U4SA 5LB4A 2C97A 1QG4A 1L7EA 1VHTA 4Z4HA 3AKCA 4IUDS 1X0VA 1N32C 3BIOA 4BO7A 3ABZA 3T1VA 1D4FA 2Z8ZA 4U7FA 2BSAA 3N0VA 1H1LB 3PNQA 2Q7DA 2X3UA 3AKZA 2HWXA 3U2QA 3OOJA 1QHEA 3G2PA 3JU3A 4FMDB 5TV2A 3TOSA 2OD2A 2P9QA 2VAWA 3L0DA 4IDPA 4A8HA 1JSXA 4MR7B 4CM9A 3TBKA 5A7GA 3LZCA 1GTL1 3FNIA 1MGOA 4RMHA 5GOZA 3ZHVA 1A8PA 2FMHA 1CZUA 2NU6B 4IXTA 3UJ9A 2H4ZA 3OFVA 4WXMA 5C7LO 3D3WB 4GMXA 4ZHQF 4AY2A 2VIIA 4KXNA 3THYB 4LF5C 1YO6A 3N8KA