3PESA

Crystal structure of uncharacterized protein from pseudomonas phage yua
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
83
structure length
83
Chain Sequence
AMLAEFEDRVAGIPCLIVVTYWEPYVPAKVSGPPEYCYPAEGGCGEWEVRDRRGRPAPWLERKLTEAERERIDQAVFDRMEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein gp49
publication title Crystal structure of uncharacterized protein from Pseudomonas phage YuA
rcsb
source organism Pseudomonas phage yua
total genus 19
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.260 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3pesA00
3PESA
chains in the Genus database with same CATH superfamily
2Y4NA 1P4EC 4DV0C 4JI0C 4JI7C 2PN2A 5E7QA 2E0GA 3TR3A 5BR8C 4DCUA 5FLXD 5LMNC 3ETOA 2OPLB 1I94C 4HPVA 1N34C 2VSQA 1LCIA 4G1IA 2UXBC 5K85A 1MDBA 1KKGA 3TUFA 4JI1C 4DR1C 2VZEA 2YX1A 5DV9A 4GKJC 3PBKA 1UWDA 2QL8A 1PA4A 4X65C 4RM3A 1AMUA 2M5HA 4FUQA 1O92A 3PROC 4GS5A 3LAXA 4MTNA 3VNQA 4DCSA 3NPDA 2UXCC 3RV2A 3FCEA 4DV4C 2JMPA 4DR7C 2D1TA 3R44A 4L4QA 2CXCA 1HNZC 2JNVA 4BC7A 1T5DX 4NXMC 1UKKA 1L2FA 1P7LA 4R0MA 2YWBA 1PG4A 3C5EA 2MMAB 3A9VA 3CW8X 1NY8A 2KZFA 4LF7C 4PUGA 4X62C 4KHPC 3A9UA 1HNXC 3H2TA 3IMLA 2ZM6C 5IWAC 4R1MA 4DUZC 1MKYA 3G7SA 4YY3C 3GPCA 4DG9A 5CZXA 1XRAA 3PESA 5BSRA 3IEUA 3UX3A 4DV7C 1MXCA 4B3TC 2E8CA 2P2FA 4DG8A 1JOSA 2UU9C 1T5HX 4B3SC 2QW0X 1N32C 4LFBC 1RG9A 2HHHC 4B3RC 2DPLA 3K6RA 1USPB 5H9UA 4AQYC 1ML8A 3GR1A 4TPSB 1PU1A 3LNOA 1M6XA 4NOZA 1V26A 2DHMA 3B7WA 4LF9C 4JI3C 4I9GA 3KXWA 1K0RA 1MXAA 2ONFA 3E7WA 5GTDA 1GPMA 4JI5C 5A2QD 4BC9A 2UUBC 3TDEA 2QVZX 3A4IA 4JI2C 4GKKC 5AE2A 2EGTA 4OXIA 1IBMC 1WH9A 3AY0A 4PHTA 3I07A 4X66C 5BSWA 1TH5A 3L8CA 1ZB8A 4LE5A 2D1RA 2UXDC 4RM2A 2D1QA 1XRBA 4DV3C 2D28C 5T8SA 4G37A 1RY2A 2D7VA 3UOWA 4EATA 3EERA 5ADZA 1YJ7A 1ZB9A 1MDFA 1ULTA 3VNSA 1VLAA 1BA3A 1HH2P 4L2ZA 3O2EA 3CW9A 5BSUA 5AE3A 1V25A 4B3MC 4LF4C 2NCLA 3FCCA 1QM4A 4DV1C 4OYCA 4WS9A 1HNWC 4RLQA 4DCVA 5BUSA 4D4GA 4RMNA 5CZVA 1XHJA 3S82A 2UUCC 2Z51A 2V7BA 4DV5C 2MCQA 3UX2A 3DHVA 1J5EC 3UZ0A 3CQ1A 4D57A 3RG2A 4LF5C 2BJOA 4DR4C 3T1HC 1QWIA 1XNRC 4DV2C 2OBVA 4IR7A 1USPA 4MH4A 5K8FA 1IBKC 1N2FA 2P2MA 2P2JA 3I08A 3T1YC 4PUHA 4NXNC 3AF6A 4DR6C 3IPLA 4FTFA 4ZJZA 5BURA 2E8FA 2OPLA 1XMQC 2PT7G 5KYTA 2KDNA 1PG3A 1IB8A 2P2QA 2E8EA 5A1GA 3GR0A 1WF3A 2CY1A 4JI8C 5LMUC 4JI6C 2VQFC 5KYVA 4ZLPA 5A1IA 1N36C 3A26A 3UEBA 4D4IA 4YHHC 3LUSA 5IT9D 4PROC 3E7XA 3AF5A 5KEIA 2KZ0A 4L7IA 2OO4A 2VQEC 2MM9A 2ASBA 4RVNA 2UUAC 1IBLC 1N33C 4JYAC 1XNQC 2ATWA 3N2QA 2Y27A 1HR0C 2AYAA 2P20A 4IZ6A 4ODJA 3LGXA 1FLOA 2F4VC 3DAYA 4K0KC 2QVYX 1FUGA 3VNRA 1P4EA 3NYRA 4BBYA 1XRCA 1FJGC 2E5LC 3NYQA 3CQ2A 1O9TA 2CU6A 3CJEA 4BCAA 2M5OA 4OX9C 2ZZNA 1MD9A 2D27A 4LF8C 1XMOC 4DUYC 2WP0C 2Y4OA 3ETCA 2P2BA 3EQ6A 2QVXX 1O93A 1EGAA 5BSVA 4BSZA 4DV6C 4K0BA 2P02A 2HJGA 4FUTA 5T8TA 4U5YD 2BH1X 5JRHA 5BUQA 3J81D 2PROA 4ISBA 4JM1A 4RLFA 1NYEA 1LQLA 5BSMA 1M6XC 4DR5C 1MXBA 3R9XA 3JAMD 3R9WA 4KTVA 4PUIA 4G36A 4DR2C 3L95X 3A25A 2WD9A 4JV5C 4I9FA 1VEHA 4GXQA 4LF6C 4X64C 3CQ3A 2DYJA 3IEVA 1V60A 4RVOA 5IFIA 3GKUA 4R1LA 2YWCA 4PZPA 4DR3C 4NDNA 2ZZMA 3OTOC 4KTTA 4DCTA 1WCJA 4GXRA 4LFAC 3LNVA 5AE1A 5A19A 3NI2A 1XS3A 4WV3A 4D56A 2D1SA 4LFCC 1O90A 3SO4A 3J80D 2YCBA 4XX2A 3TQIA 5BSTA 3DLPX 3N54B 5LCIA 2E7GA 4JI4C 2XR1A
chains in the Genus database with same CATH topology
2Y4NA 4DV0C 4JI0C 4JI7C 2PN2A 5E7QA 2E0GA 5BR8C 4DCUA 5FLXD 5LMNC 3ETOA 2OPLB 1I94C 4HPVA 1N34C 2VSQA 1LCIA 4G1IA 2UXBC 5K85A 1MDBA 1KKGA 3TUFA 4JI1C 4DR1C 2VZEA 5DV9A 4GKJC 3PBKA 2QL8A 1PA4A 4X65C 4RM3A 1AMUA 4FUQA 1O92A 3PROC 4GS5A 3LAXA 4MTNA 3VNQA 4DCSA 3NPDA 2UXCC 3RV2A 3FCEA 4DV4C 2JMPA 4DR7C 2D1TA 3R44A 4L4QA 2CXCA 1HNZC 4BC7A 1T5DX 4NXMC 1UKKA 1L2FA 1P7LA 4R0MA 2YWBA 1PG4A 3C5EA 3A9VA 3CW8X 2KZFA 4LF7C 4X62C 4KHPC 3A9UA 1HNXC 3H2TA 3IMLA 2ZM6C 5IWAC 4R1MA 4DUZC 1MKYA 3G7SA 4YY3C 3GPCA 4DG9A 5CZXA 1XRAA 3PESA 5BSRA 3IEUA 4DV7C 1MXCA 4B3TC 2E8CA 2P2FA 4DG8A 1JOSA 2UU9C 1T5HX 4B3SC 2QW0X 1N32C 4LFBC 1RG9A 2HHHC 4B3RC 2DPLA 1USPB 5H9UA 4AQYC 1ML8A 3GR1A 4TPSB 4NOZA 1V26A 3B7WA 4LF9C 4JI3C 4I9GA 3KXWA 1K0RA 1MXAA 2ONFA 3E7WA 5GTDA 1GPMA 4JI5C 5A2QD 4BC9A 2UUBC 3TDEA 2QVZX 3A4IA 4JI2C 4GKKC 5AE2A 2EGTA 4OXIA 1IBMC 1WH9A 4PHTA 3I07A 4X66C 5BSWA 3L8CA 1ZB8A 4LE5A 2D1RA 2UXDC 4RM2A 2D1QA 1XRBA 4DV3C 2D28C 5T8SA 4G37A 1RY2A 2D7VA 3UOWA 4EATA 3EERA 5ADZA 1YJ7A 1ZB9A 1MDFA 1ULTA 3VNSA 1VLAA 1BA3A 1HH2P 4L2ZA 3CW9A 5BSUA 5AE3A 1V25A 4B3MC 4LF4C 3FCCA 1QM4A 4DV1C 4OYCA 4WS9A 1HNWC 4RLQA 4DCVA 5BUSA 4D4GA 4RMNA 5CZVA 3S82A 2UUCC 2V7BA 4DV5C 3DHVA 1J5EC 3UZ0A 4D57A 3RG2A 4LF5C 2BJOA 4DR4C 3T1HC 1QWIA 1XNRC 4DV2C 2OBVA 4IR7A 1USPA 4MH4A 5K8FA 1IBKC 1N2FA 2P2MA 2P2JA 3I08A 3T1YC 4NXNC 3AF6A 4DR6C 3IPLA 4FTFA 4ZJZA 5BURA 2E8FA 2OPLA 1XMQC 2PT7G 5KYTA 1PG3A 2P2QA 2E8EA 5A1GA 3GR0A 1WF3A 2CY1A 4JI8C 5LMUC 4JI6C 2VQFC 5KYVA 4ZLPA 5A1IA 1N36C 4D4IA 4YHHC 3LUSA 5IT9D 4PROC 3E7XA 3AF5A 5KEIA 4L7IA 2OO4A 2VQEC 2ASBA 4RVNA 2UUAC 1IBLC 1N33C 4JYAC 1XNQC 2ATWA 3N2QA 2Y27A 1HR0C 2AYAA 2P20A 4IZ6A 4ODJA 3LGXA 2F4VC 3DAYA 4K0KC 2QVYX 1FUGA 3VNRA 3NYRA 4BBYA 1XRCA 1FJGC 2E5LC 3NYQA 1O9TA 3CJEA 4BCAA 4OX9C 1MD9A 2D27A 4LF8C 1XMOC 4DUYC 2WP0C 2Y4OA 3ETCA 2P2BA 3EQ6A 2QVXX 1O93A 1EGAA 5BSVA 4BSZA 4DV6C 4K0BA 2P02A 2HJGA 4FUTA 5T8TA 4U5YD 2BH1X 5JRHA 5BUQA 3J81D 2PROA 4ISBA 4JM1A 4RLFA 1NYEA 1LQLA 5BSMA 4DR5C 1MXBA 3R9XA 3JAMD 3R9WA 4KTVA 4G36A 4DR2C 3L95X 2WD9A 4JV5C 4I9FA 4GXQA 4LF6C 4X64C 2DYJA 3IEVA 4RVOA 5IFIA 3GKUA 4R1LA 2YWCA 4PZPA 4DR3C 4NDNA 3OTOC 4KTTA 4DCTA 4GXRA 4LFAC 3LNVA 5AE1A 5A19A 3NI2A 4WV3A 4D56A 2D1SA 4LFCC 1O90A 3SO4A 3J80D 2YCBA 4XX2A 3TQIA 5BSTA 3DLPX 3N54B 2E7GA 4JI4C 2XR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PES A; 
#chains in the Genus database with same CATH topology
 2Y4N A;  1P4E C;  4DV0 C;  4JI0 C;  4JI7 C;  2PN2 A;  5E7Q A;  2E0G A;  3TR3 A;  5BR8 C;  4DCU A;  5FLX D;  5LMN C;  3ETO A;  2OPL B;  1I94 C;  4HPV A;  1N34 C;  2VSQ A;  1LCI A;  4G1I A;  2UXB C;  5K85 A;  1MDB A;  1KKG A;  3TUF A;  4JI1 C;  4DR1 C;  2VZE A;  2YX1 A;  5DV9 A;  4GKJ C;  3PBK A;  1UWD A;  2QL8 A;  1PA4 A;  4X65 C;  4RM3 A;  1AMU A;  2M5H A;  4FUQ A;  1O92 A;  3PRO C;  4GS5 A;  3LAX A;  4MTN A;  3VNQ A;  4DCS A;  3NPD A;  2UXC C;  3RV2 A;  3FCE A;  4DV4 C;  2JMP A;  4DR7 C;  2D1T A;  3R44 A;  4L4Q A;  2CXC A;  1HNZ C;  2JNV A;  4BC7 A;  1T5D X;  4NXM C;  1UKK A;  1L2F A;  1P7L A;  4R0M A;  2YWB A;  1PG4 A;  3C5E A;  2MMA B;  3A9V A;  3CW8 X;  1NY8 A;  2KZF A;  4LF7 C;  4PUG A;  4X62 C;  4KHP C;  3A9U A;  1HNX C;  3H2T A;  3IML A;  2ZM6 C;  5IWA C;  4R1M A;  4DUZ C;  1MKY A;  3G7S A;  4YY3 C;  3GPC A;  4DG9 A;  5CZX A;  1XRA A;  3PES A;  5BSR A;  3IEU A;  3UX3 A;  4DV7 C;  1MXC A;  4B3T C;  2E8C A;  2P2F A;  4DG8 A;  1JOS A;  2UU9 C;  1T5H X;  4B3S C;  2QW0 X;  1N32 C;  4LFB C;  1RG9 A;  2HHH C;  4B3R C;  2DPL A;  3K6R A;  1USP B;  5H9U A;  4AQY C;  1ML8 A;  3GR1 A;  4TPS B;  1PU1 A;  3LNO A;  1M6X A;  4NOZ A;  1V26 A;  2DHM A;  3B7W A;  4LF9 C;  4JI3 C;  4I9G A;  3KXW A;  1K0R A;  1MXA A;  2ONF A;  3E7W A;  5GTD A;  1GPM A;  4JI5 C;  5A2Q D;  4BC9 A;  2UUB C;  3TDE A;  2QVZ X;  3A4I A;  4JI2 C;  4GKK C;  5AE2 A;  2EGT A;  4OXI A;  1IBM C;  1WH9 A;  3AY0 A;  4PHT A;  3I07 A;  4X66 C;  5BSW A;  1TH5 A;  3L8C A;  1ZB8 A;  4LE5 A;  2D1R A;  2UXD C;  4RM2 A;  2D1Q A;  1XRB A;  4DV3 C;  2D28 C;  5T8S A;  4G37 A;  1RY2 A;  2D7V A;  3UOW A;  4EAT A;  3EER A;  5ADZ A;  1YJ7 A;  1ZB9 A;  1MDF A;  1ULT A;  3VNS A;  1VLA A;  1BA3 A;  1HH2 P;  4L2Z A;  3O2E A;  3CW9 A;  5BSU A;  5AE3 A;  1V25 A;  4B3M C;  4LF4 C;  2NCL A;  3FCC A;  1QM4 A;  4DV1 C;  4OYC A;  4WS9 A;  1HNW C;  4RLQ A;  4DCV A;  5BUS A;  4D4G A;  4RMN A;  5CZV A;  1XHJ A;  3S82 A;  2UUC C;  2Z51 A;  2V7B A;  4DV5 C;  2MCQ A;  3UX2 A;  3DHV A;  1J5E C;  3UZ0 A;  3CQ1 A;  4D57 A;  3RG2 A;  4LF5 C;  2BJO A;  4DR4 C;  3T1H C;  1QWI A;  1XNR C;  4DV2 C;  2OBV A;  4IR7 A;  1USP A;  4MH4 A;  5K8F A;  1IBK C;  1N2F A;  2P2M A;  2P2J A;  3I08 A;  3T1Y C;  4PUH A;  4NXN C;  3AF6 A;  4DR6 C;  3IPL A;  4FTF A;  4ZJZ A;  5BUR A;  2E8F A;  2OPL A;  1XMQ C;  2PT7 G;  5KYT A;  2KDN A;  1PG3 A;  1IB8 A;  2P2Q A;  2E8E A;  5A1G A;  3GR0 A;  1WF3 A;  2CY1 A;  4JI8 C;  5LMU C;  4JI6 C;  2VQF C;  5KYV A;  4ZLP A;  5A1I A;  1N36 C;  3A26 A;  3UEB A;  4D4I A;  4YHH C;  3LUS A;  5IT9 D;  4PRO C;  3E7X A;  3AF5 A;  5KEI A;  2KZ0 A;  4L7I A;  2OO4 A;  2VQE C;  2MM9 A;  2ASB A;  4RVN A;  2UUA C;  1IBL C;  1N33 C;  4JYA C;  1XNQ C;  2ATW A;  3N2Q A;  2Y27 A;  1HR0 C;  2AYA A;  2P20 A;  4IZ6 A;  4ODJ A;  3LGX A;  1FLO A;  2F4V C;  3DAY A;  4K0K C;  2QVY X;  1FUG A;  3VNR A;  1P4E A;  3NYR A;  4BBY A;  1XRC A;  1FJG C;  2E5L C;  3NYQ A;  3CQ2 A;  1O9T A;  2CU6 A;  3CJE A;  4BCA A;  2M5O A;  4OX9 C;  2ZZN A;  1MD9 A;  2D27 A;  4LF8 C;  1XMO C;  4DUY C;  2WP0 C;  2Y4O A;  3ETC A;  2P2B A;  3EQ6 A;  2QVX X;  1O93 A;  1EGA A;  5BSV A;  4BSZ A;  4DV6 C;  4K0B A;  2P02 A;  2HJG A;  4FUT A;  5T8T A;  4U5Y D;  2BH1 X;  5JRH A;  5BUQ A;  3J81 D;  2PRO A;  4ISB A;  4JM1 A;  4RLF A;  1NYE A;  1LQL A;  5BSM A;  1M6X C;  4DR5 C;  1MXB A;  3R9X A;  3JAM D;  3R9W A;  4KTV A;  4PUI A;  4G36 A;  4DR2 C;  3L95 X;  3A25 A;  2WD9 A;  4JV5 C;  4I9F A;  1VEH A;  4GXQ A;  4LF6 C;  4X64 C;  3CQ3 A;  2DYJ A;  3IEV A;  1V60 A;  4RVO A;  5IFI A;  3GKU A;  4R1L A;  2YWC A;  4PZP A;  4DR3 C;  4NDN A;  2ZZM A;  3OTO C;  4KTT A;  4DCT A;  1WCJ A;  4GXR A;  4LFA C;  3LNV A;  5AE1 A;  5A19 A;  3NI2 A;  1XS3 A;  4WV3 A;  4D56 A;  2D1S A;  4LFC C;  1O90 A;  3SO4 A;  3J80 D;  2YCB A;  4XX2 A;  3TQI A;  5BST A;  3DLP X;  3N54 B;  5LCI A;  2E7G A;  4JI4 C;  2XR1 A; 
#chains in the Genus database with same CATH homology
 2Y4N A;  4DV0 C;  4JI0 C;  4JI7 C;  2PN2 A;  5E7Q A;  2E0G A;  5BR8 C;  4DCU A;  5FLX D;  5LMN C;  3ETO A;  2OPL B;  1I94 C;  4HPV A;  1N34 C;  2VSQ A;  1LCI A;  4G1I A;  2UXB C;  5K85 A;  1MDB A;  1KKG A;  3TUF A;  4JI1 C;  4DR1 C;  2VZE A;  5DV9 A;  4GKJ C;  3PBK A;  2QL8 A;  1PA4 A;  4X65 C;  4RM3 A;  1AMU A;  4FUQ A;  1O92 A;  3PRO C;  4GS5 A;  3LAX A;  4MTN A;  3VNQ A;  4DCS A;  3NPD A;  2UXC C;  3RV2 A;  3FCE A;  4DV4 C;  2JMP A;  4DR7 C;  2D1T A;  3R44 A;  4L4Q A;  2CXC A;  1HNZ C;  4BC7 A;  1T5D X;  4NXM C;  1UKK A;  1L2F A;  1P7L A;  4R0M A;  2YWB A;  1PG4 A;  3C5E A;  3A9V A;  3CW8 X;  2KZF A;  4LF7 C;  4X62 C;  4KHP C;  3A9U A;  1HNX C;  3H2T A;  3IML A;  2ZM6 C;  5IWA C;  4R1M A;  4DUZ C;  1MKY A;  3G7S A;  4YY3 C;  3GPC A;  4DG9 A;  5CZX A;  1XRA A;  3PES A;  5BSR A;  3IEU A;  4DV7 C;  1MXC A;  4B3T C;  2E8C A;  2P2F A;  4DG8 A;  1JOS A;  2UU9 C;  1T5H X;  4B3S C;  2QW0 X;  1N32 C;  4LFB C;  1RG9 A;  2HHH C;  4B3R C;  2DPL A;  1USP B;  5H9U A;  4AQY C;  1ML8 A;  3GR1 A;  4TPS B;  4NOZ A;  1V26 A;  3B7W A;  4LF9 C;  4JI3 C;  4I9G A;  3KXW A;  1K0R A;  1MXA A;  2ONF A;  3E7W A;  5GTD A;  1GPM A;  4JI5 C;  5A2Q D;  4BC9 A;  2UUB C;  3TDE A;  2QVZ X;  3A4I A;  4JI2 C;  4GKK C;  5AE2 A;  2EGT A;  4OXI A;  1IBM C;  1WH9 A;  4PHT A;  3I07 A;  4X66 C;  5BSW A;  3L8C A;  1ZB8 A;  4LE5 A;  2D1R A;  2UXD C;  4RM2 A;  2D1Q A;  1XRB A;  4DV3 C;  2D28 C;  5T8S A;  4G37 A;  1RY2 A;  2D7V A;  3UOW A;  4EAT A;  3EER A;  5ADZ A;  1YJ7 A;  1ZB9 A;  1MDF A;  1ULT A;  3VNS A;  1VLA A;  1BA3 A;  1HH2 P;  4L2Z A;  3CW9 A;  5BSU A;  5AE3 A;  1V25 A;  4B3M C;  4LF4 C;  3FCC A;  1QM4 A;  4DV1 C;  4OYC A;  4WS9 A;  1HNW C;  4RLQ A;  4DCV A;  5BUS A;  4D4G A;  4RMN A;  5CZV A;  3S82 A;  2UUC C;  2V7B A;  4DV5 C;  3DHV A;  1J5E C;  3UZ0 A;  4D57 A;  3RG2 A;  4LF5 C;  2BJO A;  4DR4 C;  3T1H C;  1QWI A;  1XNR C;  4DV2 C;  2OBV A;  4IR7 A;  1USP A;  4MH4 A;  5K8F A;  1IBK C;  1N2F A;  2P2M A;  2P2J A;  3I08 A;  3T1Y C;  4NXN C;  3AF6 A;  4DR6 C;  3IPL A;  4FTF A;  4ZJZ A;  5BUR A;  2E8F A;  2OPL A;  1XMQ C;  2PT7 G;  5KYT A;  1PG3 A;  2P2Q A;  2E8E A;  5A1G A;  3GR0 A;  1WF3 A;  2CY1 A;  4JI8 C;  5LMU C;  4JI6 C;  2VQF C;  5KYV A;  4ZLP A;  5A1I A;  1N36 C;  4D4I A;  4YHH C;  3LUS A;  5IT9 D;  4PRO C;  3E7X A;  3AF5 A;  5KEI A;  4L7I A;  2OO4 A;  2VQE C;  2ASB A;  4RVN A;  2UUA C;  1IBL C;  1N33 C;  4JYA C;  1XNQ C;  2ATW A;  3N2Q A;  2Y27 A;  1HR0 C;  2AYA A;  2P20 A;  4IZ6 A;  4ODJ A;  3LGX A;  2F4V C;  3DAY A;  4K0K C;  2QVY X;  1FUG A;  3VNR A;  3NYR A;  4BBY A;  1XRC A;  1FJG C;  2E5L C;  3NYQ A;  1O9T A;  3CJE A;  4BCA A;  4OX9 C;  1MD9 A;  2D27 A;  4LF8 C;  1XMO C;  4DUY C;  2WP0 C;  2Y4O A;  3ETC A;  2P2B A;  3EQ6 A;  2QVX X;  1O93 A;  1EGA A;  5BSV A;  4BSZ A;  4DV6 C;  4K0B A;  2P02 A;  2HJG A;  4FUT A;  5T8T A;  4U5Y D;  2BH1 X;  5JRH A;  5BUQ A;  3J81 D;  2PRO A;  4ISB A;  4JM1 A;  4RLF A;  1NYE A;  1LQL A;  5BSM A;  4DR5 C;  1MXB A;  3R9X A;  3JAM D;  3R9W A;  4KTV A;  4G36 A;  4DR2 C;  3L95 X;  2WD9 A;  4JV5 C;  4I9F A;  4GXQ A;  4LF6 C;  4X64 C;  2DYJ A;  3IEV A;  4RVO A;  5IFI A;  3GKU A;  4R1L A;  2YWC A;  4PZP A;  4DR3 C;  4NDN A;  3OTO C;  4KTT A;  4DCT A;  4GXR A;  4LFA C;  3LNV A;  5AE1 A;  5A19 A;  3NI2 A;  4WV3 A;  4D56 A;  2D1S A;  4LFC C;  1O90 A;  3SO4 A;  3J80 D;  2YCB A;  4XX2 A;  3TQI A;  5BST A;  3DLP X;  3N54 B;  2E7G A;  4JI4 C;  2XR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...