3PESA

Crystal structure of uncharacterized protein from pseudomonas phage yua
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
83
structure length
83
Chain Sequence
AMLAEFEDRVAGIPCLIVVTYWEPYVPAKVSGPPEYCYPAEGGCGEWEVRDRRGRPAPWLERKLTEAERERIDQAVFDRMEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein gp49
publication title Crystal structure of uncharacterized protein from Pseudomonas phage YuA
rcsb
source organism Pseudomonas phage yua
molecule tags Structural genomics, unknown function
total genus 19
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.260 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3pesA00
3PESA
chains in the Genus database with same CATH superfamily
4RVNA 5CZXA 1N34C 1KKGA 4IR7A 2Y4NA 1VEHA 4B3RC 2UXBC 4YY3C 2PROA 5H9UA 4JI6C 2P2MA 3LGXA 5KYTA 4PHTA 1N2FA 5KYVA 4D4GA 4JI8C 4LF8C 5BR8C 1MXAA 2JMPA 2JNVA 1XRAA 3T1HC 2E7GA 1T5DX 3VNSA 3RG2A 4JM1A 2OBVA 1IBLC 2BJOA 1UWDA 3UX3A 1HH2P 2UUAC 1ZB9A 5LMNC 3R44A 4X65C 4K0KC 4GS5A 3IEVA 3N54B 4D56A 1J5EC 4YHHC 2P2BA 2DPLA 4DR1C 5BURA 4I9GA 2V7BA 3UZ0A 4JI5C 4JI2C 4PUHA 4IZ6A 3J80D 3PROC 4DR5C 3L95X 2D1SA 2DHMA 4K0BA 4WS9A 1N33C 1IBMC 2BH1X 4ISBA 2HHHC 2QW0X 3CW9A 3E7XA 1PA4A 5BSWA 5E7QA 1HR0C 4GKJC 4KTVA 5K85A 1FUGA 3A4IA 4DCUA 5BSMA 2ATWA 2DYJA 1TH5A 2VSQA 3A26A 3A25A 1MKYA 4PUGA 1V25A 3O2EA 1GPMA 2P02A 4PUIA 3TR3A 1WF3A 3B7WA 3N2QA 2EGTA 3T1YC 4DCVA 1N36C 5A1GA 2P2JA 2ONFA 3NYRA 2YX1A 3NPDA 4L4QA 5LMUC 4X62C 4U5YD 4DV7C 1RY2A 4G37A 4OXIA 2OPLB 2M5HA 2CY1A 1MDBA 2KZ0A 3E7WA 5BSTA 1ZB8A 2Y4OA 4DCTA 2XR1A 3GR0A 2VQFC 3FCEA 4XX2A 4JI4C 3IMLA 1YJ7A 3R9WA 2UU9C 2D7VA 2QVXX 2YWCA 3IEUA 2UXDC 5AE1A 2CXCA 3S82A 1K0RA 3KXWA 1M6XA 5BSUA 4G36A 3LNOA 4RVOA 1NY8A 5DV9A 4PROC 5IFIA 2MM9A 2D28C 2MMAB 3CW8X 4RM2A 5GTDA 2OO4A 1VLAA 5K8FA 1LCIA 5BUSA 4DV0C 1O92A 4D57A 1HNWC 1LQLA 1QM4A 3NYQA 1O9TA 1V60A 4RLFA 2E8EA 1NYEA 2VQEC 1MDFA 5T8SA 4LFBC 3NI2A 1P4EC 2D1QA 3AF5A 4B3MC 3ETOA 4G1IA 2E5LC 3VNRA 2PT7G 4L2ZA 4BSZA 4GXQA 2KDNA 1XS3A 3IPLA 1BA3A 4RLQA 2YCBA 2QVZX 3SO4A 2E0GA 3I08A 4DV4C 1V26A 1PG4A 3UX2A 5A1IA 5FLXD 5KEIA 4FUTA 3TQIA 3AF6A 3DAYA 1O90A 4R0MA 4DG9A 2WP0C 3LNVA 1ULTA 2OPLA 3UOWA 2QL8A 1EGAA 3C5EA 4MH4A 4ODJA 2QVYX 4GKKC 4LF6C 3CJEA 1FLOA 3L8CA 1MD9A 5JRHA 4JYAC 4JI1C 1MXBA 4WV3A 4DR2C 2AYAA 4AQYC 4BBYA 3GKUA 4DV5C 4R1LA 3FCCA 2ASBA 1WCJA 2MCQA 2ZZNA 5T8TA 1FJGC 5BSRA 4BC7A 2E8FA 4JI7C 3GPCA 2D27A 1PU1A 4DR7C 4JI0C 2P2FA 2WD9A 2CU6A 2KZFA 1HNXC 3OTOC 4B3TC 2Z51A 4JI3C 5A2QD 4LFAC 3CQ1A 5AE3A 3EERA 2P20A 4R1MA 4TPSB 1QWIA 4KTTA 3DHVA 3PBKA 4NDNA 2Y27A 3A9UA 2HJGA 5AE2A 3A9VA 1XMOC 4NXMC 4EATA 1RG9A 4LF9C 3GR1A 1XNRC 1XNQC 5A19A 2P2QA 3EQ6A 3TUFA 1O93A 4LF7C 4DG8A 2E8CA 2D1TA 5ADZA 4KHPC 3LAXA 1UKKA 1AMUA 4DR6C 1T5HX 1WH9A 3JAMD 3CQ3A 5BUQA 4OYCA 3PESA 1I94C 4LE5A 4DR4C 3LUSA 1XRBA 2ZM6C 1XRCA 4DV3C 1P7LA 4DCSA 4GXRA 2UUBC 4I9FA 1PG3A 4L7IA 4RMNA 1XHJA 2ZZMA 1M6XC 3UEBA 4JV5C 4DV1C 4B3SC 3I07A 4HPVA 5LCIA 4X64C 3J81D 4OX9C 4D4IA 4FUQA 4ZLPA 2D1RA 2PN2A 1HNZC 3TDEA 1N32C 1USPA 5BSVA 4LFCC 3G7SA 2NCLA 4DR3C 2UXCC 4MTNA 3CQ2A 5CZVA 1XMQC 2UUCC 1USPB 1MXCA 2VZEA 4NOZA 5IT9D 4FTFA 4LF4C 2M5OA 4BCAA 3VNQA 4DV6C 3ETCA 4X66C 1JOSA 2YWBA 4PZPA 3DLPX 1L2FA 1P4EA 3R9XA 3AY0A 1IB8A 4DV2C 5IWAC 2F4VC 4ZJZA 1IBKC 4BC9A 4NXNC 1ML8A 3RV2A 4LF5C 4DUZC 3K6RA 4DUYC 4RM3A 3H2TA
chains in the Genus database with same CATH topology
4RVNA 5CZXA 1N34C 1KKGA 4IR7A 2Y4NA 4B3RC 2UXBC 4YY3C 2PROA 5H9UA 4JI6C 2P2MA 3LGXA 5KYTA 4PHTA 1N2FA 5KYVA 4D4GA 4JI8C 4LF8C 5BR8C 1MXAA 2JMPA 1XRAA 3T1HC 2E7GA 1T5DX 3VNSA 3RG2A 4JM1A 2OBVA 1IBLC 2BJOA 1HH2P 2UUAC 1ZB9A 5LMNC 3R44A 4X65C 4K0KC 4GS5A 3IEVA 3N54B 4D56A 1J5EC 4YHHC 2P2BA 2DPLA 4DR1C 5BURA 4I9GA 2V7BA 3UZ0A 4JI5C 4JI2C 4IZ6A 3J80D 3PROC 4DR5C 3L95X 2D1SA 4K0BA 4WS9A 1N33C 1IBMC 2BH1X 4ISBA 2HHHC 2QW0X 3CW9A 3E7XA 1PA4A 5BSWA 5E7QA 1HR0C 4GKJC 4KTVA 5K85A 1FUGA 3A4IA 4DCUA 5BSMA 2ATWA 2DYJA 2VSQA 1MKYA 1V25A 1GPMA 2P02A 1WF3A 3B7WA 3N2QA 2EGTA 3T1YC 4DCVA 1N36C 5A1GA 2P2JA 2ONFA 3NYRA 3NPDA 4L4QA 5LMUC 4X62C 4U5YD 4DV7C 1RY2A 4G37A 4OXIA 2OPLB 2CY1A 1MDBA 3E7WA 5BSTA 1ZB8A 2Y4OA 4DCTA 2XR1A 3GR0A 2VQFC 3FCEA 4XX2A 4JI4C 3IMLA 1YJ7A 3R9WA 2UU9C 2D7VA 2QVXX 2YWCA 3IEUA 2UXDC 5AE1A 2CXCA 3S82A 1K0RA 3KXWA 5BSUA 4G36A 4RVOA 5DV9A 4PROC 5IFIA 2D28C 3CW8X 4RM2A 5GTDA 2OO4A 1VLAA 5K8FA 1LCIA 5BUSA 4DV0C 1O92A 4D57A 1HNWC 1LQLA 1QM4A 3NYQA 1O9TA 4RLFA 2E8EA 1NYEA 2VQEC 1MDFA 5T8SA 4LFBC 3NI2A 2D1QA 3AF5A 4B3MC 3ETOA 4G1IA 2E5LC 3VNRA 2PT7G 4L2ZA 4BSZA 4GXQA 3IPLA 1BA3A 4RLQA 2YCBA 2QVZX 3SO4A 2E0GA 3I08A 4DV4C 1V26A 1PG4A 5FLXD 5A1IA 5KEIA 4FUTA 3TQIA 3AF6A 3DAYA 1O90A 4R0MA 4DG9A 2WP0C 3LNVA 1ULTA 2OPLA 3UOWA 2QL8A 1EGAA 3C5EA 4MH4A 4ODJA 2QVYX 4GKKC 4LF6C 3CJEA 3L8CA 1MD9A 5JRHA 4JYAC 4JI1C 1MXBA 4WV3A 4DR2C 2AYAA 4AQYC 4BBYA 3GKUA 4DV5C 4R1LA 3FCCA 2ASBA 1FJGC 5T8TA 5BSRA 4BC7A 2E8FA 4JI7C 3GPCA 2D27A 4DR7C 4JI0C 2P2FA 2WD9A 2KZFA 1HNXC 3OTOC 4B3TC 4JI3C 5A2QD 4LFAC 5AE3A 3EERA 2P20A 4R1MA 4TPSB 1QWIA 4KTTA 3DHVA 3PBKA 4NDNA 2Y27A 3A9UA 2HJGA 5AE2A 3A9VA 1XMOC 4NXMC 4EATA 1RG9A 4LF9C 3GR1A 1XNRC 1XNQC 5A19A 2P2QA 3EQ6A 3TUFA 1O93A 4LF7C 4DG8A 2E8CA 2D1TA 5ADZA 4KHPC 3LAXA 1UKKA 1AMUA 4DR6C 1T5HX 1WH9A 3JAMD 5BUQA 4OYCA 3PESA 1I94C 4LE5A 4DR4C 3LUSA 1XRBA 2ZM6C 1XRCA 4DV3C 1P7LA 4DCSA 4GXRA 2UUBC 4I9FA 1PG3A 4L7IA 4RMNA 4JV5C 4DV1C 4B3SC 3I07A 4HPVA 4X64C 3J81D 4OX9C 4D4IA 4FUQA 4ZLPA 2D1RA 2PN2A 1HNZC 3TDEA 1N32C 1USPA 5BSVA 4LFCC 3G7SA 4DR3C 2UXCC 4MTNA 5CZVA 1XMQC 2UUCC 1USPB 1MXCA 2VZEA 4NOZA 5IT9D 4FTFA 4LF4C 4BCAA 3VNQA 4DV6C 3ETCA 4X66C 1JOSA 2YWBA 4PZPA 3DLPX 1L2FA 3R9XA 4DV2C 5IWAC 2F4VC 4ZJZA 1IBKC 4BC9A 4NXNC 1ML8A 3RV2A 4LF5C 4DUZC 4DUYC 4RM3A 3H2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PES A; 
#chains in the Genus database with same CATH topology
 4RVN A;  5CZX A;  1N34 C;  1KKG A;  4IR7 A;  2Y4N A;  1VEH A;  4B3R C;  2UXB C;  4YY3 C;  2PRO A;  5H9U A;  4JI6 C;  2P2M A;  3LGX A;  5KYT A;  4PHT A;  1N2F A;  5KYV A;  4D4G A;  4JI8 C;  4LF8 C;  5BR8 C;  1MXA A;  2JMP A;  2JNV A;  1XRA A;  3T1H C;  2E7G A;  1T5D X;  3VNS A;  3RG2 A;  4JM1 A;  2OBV A;  1IBL C;  2BJO A;  1UWD A;  3UX3 A;  1HH2 P;  2UUA C;  1ZB9 A;  5LMN C;  3R44 A;  4X65 C;  4K0K C;  4GS5 A;  3IEV A;  3N54 B;  4D56 A;  1J5E C;  4YHH C;  2P2B A;  2DPL A;  4DR1 C;  5BUR A;  4I9G A;  2V7B A;  3UZ0 A;  4JI5 C;  4JI2 C;  4PUH A;  4IZ6 A;  3J80 D;  3PRO C;  4DR5 C;  3L95 X;  2D1S A;  2DHM A;  4K0B A;  4WS9 A;  1N33 C;  1IBM C;  2BH1 X;  4ISB A;  2HHH C;  2QW0 X;  3CW9 A;  3E7X A;  1PA4 A;  5BSW A;  5E7Q A;  1HR0 C;  4GKJ C;  4KTV A;  5K85 A;  1FUG A;  3A4I A;  4DCU A;  5BSM A;  2ATW A;  2DYJ A;  1TH5 A;  2VSQ A;  3A26 A;  3A25 A;  1MKY A;  4PUG A;  1V25 A;  3O2E A;  1GPM A;  2P02 A;  4PUI A;  3TR3 A;  1WF3 A;  3B7W A;  3N2Q A;  2EGT A;  3T1Y C;  4DCV A;  1N36 C;  5A1G A;  2P2J A;  2ONF A;  3NYR A;  2YX1 A;  3NPD A;  4L4Q A;  5LMU C;  4X62 C;  4U5Y D;  4DV7 C;  1RY2 A;  4G37 A;  4OXI A;  2OPL B;  2M5H A;  2CY1 A;  1MDB A;  2KZ0 A;  3E7W A;  5BST A;  1ZB8 A;  2Y4O A;  4DCT A;  2XR1 A;  3GR0 A;  2VQF C;  3FCE A;  4XX2 A;  4JI4 C;  3IML A;  1YJ7 A;  3R9W A;  2UU9 C;  2D7V A;  2QVX X;  2YWC A;  3IEU A;  2UXD C;  5AE1 A;  2CXC A;  3S82 A;  1K0R A;  3KXW A;  1M6X A;  5BSU A;  4G36 A;  3LNO A;  4RVO A;  1NY8 A;  5DV9 A;  4PRO C;  5IFI A;  2MM9 A;  2D28 C;  2MMA B;  3CW8 X;  4RM2 A;  5GTD A;  2OO4 A;  1VLA A;  5K8F A;  1LCI A;  5BUS A;  4DV0 C;  1O92 A;  4D57 A;  1HNW C;  1LQL A;  1QM4 A;  3NYQ A;  1O9T A;  1V60 A;  4RLF A;  2E8E A;  1NYE A;  2VQE C;  1MDF A;  5T8S A;  4LFB C;  3NI2 A;  1P4E C;  2D1Q A;  3AF5 A;  4B3M C;  3ETO A;  4G1I A;  2E5L C;  3VNR A;  2PT7 G;  4L2Z A;  4BSZ A;  4GXQ A;  2KDN A;  1XS3 A;  3IPL A;  1BA3 A;  4RLQ A;  2YCB A;  2QVZ X;  3SO4 A;  2E0G A;  3I08 A;  4DV4 C;  1V26 A;  1PG4 A;  3UX2 A;  5A1I A;  5FLX D;  5KEI A;  4FUT A;  3TQI A;  3AF6 A;  3DAY A;  1O90 A;  4R0M A;  4DG9 A;  2WP0 C;  3LNV A;  1ULT A;  2OPL A;  3UOW A;  2QL8 A;  1EGA A;  3C5E A;  4MH4 A;  4ODJ A;  2QVY X;  4GKK C;  4LF6 C;  3CJE A;  1FLO A;  3L8C A;  1MD9 A;  5JRH A;  4JYA C;  4JI1 C;  1MXB A;  4WV3 A;  4DR2 C;  2AYA A;  4AQY C;  4BBY A;  3GKU A;  4DV5 C;  4R1L A;  3FCC A;  2ASB A;  1WCJ A;  2MCQ A;  2ZZN A;  5T8T A;  1FJG C;  5BSR A;  4BC7 A;  2E8F A;  4JI7 C;  3GPC A;  2D27 A;  1PU1 A;  4DR7 C;  4JI0 C;  2P2F A;  2WD9 A;  2CU6 A;  2KZF A;  1HNX C;  3OTO C;  4B3T C;  2Z51 A;  4JI3 C;  5A2Q D;  4LFA C;  3CQ1 A;  5AE3 A;  3EER A;  2P20 A;  4R1M A;  4TPS B;  1QWI A;  4KTT A;  3DHV A;  3PBK A;  4NDN A;  2Y27 A;  3A9U A;  2HJG A;  5AE2 A;  3A9V A;  1XMO C;  4NXM C;  4EAT A;  1RG9 A;  4LF9 C;  3GR1 A;  1XNR C;  1XNQ C;  5A19 A;  2P2Q A;  3EQ6 A;  3TUF A;  1O93 A;  4LF7 C;  4DG8 A;  2E8C A;  2D1T A;  5ADZ A;  4KHP C;  3LAX A;  1UKK A;  1AMU A;  4DR6 C;  1T5H X;  1WH9 A;  3JAM D;  3CQ3 A;  5BUQ A;  4OYC A;  3PES A;  1I94 C;  4LE5 A;  4DR4 C;  3LUS A;  1XRB A;  2ZM6 C;  1XRC A;  4DV3 C;  1P7L A;  4DCS A;  4GXR A;  2UUB C;  4I9F A;  1PG3 A;  4L7I A;  4RMN A;  1XHJ A;  2ZZM A;  1M6X C;  3UEB A;  4JV5 C;  4DV1 C;  4B3S C;  3I07 A;  4HPV A;  5LCI A;  4X64 C;  3J81 D;  4OX9 C;  4D4I A;  4FUQ A;  4ZLP A;  2D1R A;  2PN2 A;  1HNZ C;  3TDE A;  1N32 C;  1USP A;  5BSV A;  4LFC C;  3G7S A;  2NCL A;  4DR3 C;  2UXC C;  4MTN A;  3CQ2 A;  5CZV A;  1XMQ C;  2UUC C;  1USP B;  1MXC A;  2VZE A;  4NOZ A;  5IT9 D;  4FTF A;  4LF4 C;  2M5O A;  4BCA A;  3VNQ A;  4DV6 C;  3ETC A;  4X66 C;  1JOS A;  2YWB A;  4PZP A;  3DLP X;  1L2F A;  1P4E A;  3R9X A;  3AY0 A;  1IB8 A;  4DV2 C;  5IWA C;  2F4V C;  4ZJZ A;  1IBK C;  4BC9 A;  4NXN C;  1ML8 A;  3RV2 A;  4LF5 C;  4DUZ C;  3K6R A;  4DUY C;  4RM3 A;  3H2T A; 
#chains in the Genus database with same CATH homology
 4RVN A;  5CZX A;  1N34 C;  1KKG A;  4IR7 A;  2Y4N A;  4B3R C;  2UXB C;  4YY3 C;  2PRO A;  5H9U A;  4JI6 C;  2P2M A;  3LGX A;  5KYT A;  4PHT A;  1N2F A;  5KYV A;  4D4G A;  4JI8 C;  4LF8 C;  5BR8 C;  1MXA A;  2JMP A;  1XRA A;  3T1H C;  2E7G A;  1T5D X;  3VNS A;  3RG2 A;  4JM1 A;  2OBV A;  1IBL C;  2BJO A;  1HH2 P;  2UUA C;  1ZB9 A;  5LMN C;  3R44 A;  4X65 C;  4K0K C;  4GS5 A;  3IEV A;  3N54 B;  4D56 A;  1J5E C;  4YHH C;  2P2B A;  2DPL A;  4DR1 C;  5BUR A;  4I9G A;  2V7B A;  3UZ0 A;  4JI5 C;  4JI2 C;  4IZ6 A;  3J80 D;  3PRO C;  4DR5 C;  3L95 X;  2D1S A;  4K0B A;  4WS9 A;  1N33 C;  1IBM C;  2BH1 X;  4ISB A;  2HHH C;  2QW0 X;  3CW9 A;  3E7X A;  1PA4 A;  5BSW A;  5E7Q A;  1HR0 C;  4GKJ C;  4KTV A;  5K85 A;  1FUG A;  3A4I A;  4DCU A;  5BSM A;  2ATW A;  2DYJ A;  2VSQ A;  1MKY A;  1V25 A;  1GPM A;  2P02 A;  1WF3 A;  3B7W A;  3N2Q A;  2EGT A;  3T1Y C;  4DCV A;  1N36 C;  5A1G A;  2P2J A;  2ONF A;  3NYR A;  3NPD A;  4L4Q A;  5LMU C;  4X62 C;  4U5Y D;  4DV7 C;  1RY2 A;  4G37 A;  4OXI A;  2OPL B;  2CY1 A;  1MDB A;  3E7W A;  5BST A;  1ZB8 A;  2Y4O A;  4DCT A;  2XR1 A;  3GR0 A;  2VQF C;  3FCE A;  4XX2 A;  4JI4 C;  3IML A;  1YJ7 A;  3R9W A;  2UU9 C;  2D7V A;  2QVX X;  2YWC A;  3IEU A;  2UXD C;  5AE1 A;  2CXC A;  3S82 A;  1K0R A;  3KXW A;  5BSU A;  4G36 A;  4RVO A;  5DV9 A;  4PRO C;  5IFI A;  2D28 C;  3CW8 X;  4RM2 A;  5GTD A;  2OO4 A;  1VLA A;  5K8F A;  1LCI A;  5BUS A;  4DV0 C;  1O92 A;  4D57 A;  1HNW C;  1LQL A;  1QM4 A;  3NYQ A;  1O9T A;  4RLF A;  2E8E A;  1NYE A;  2VQE C;  1MDF A;  5T8S A;  4LFB C;  3NI2 A;  2D1Q A;  3AF5 A;  4B3M C;  3ETO A;  4G1I A;  2E5L C;  3VNR A;  2PT7 G;  4L2Z A;  4BSZ A;  4GXQ A;  3IPL A;  1BA3 A;  4RLQ A;  2YCB A;  2QVZ X;  3SO4 A;  2E0G A;  3I08 A;  4DV4 C;  1V26 A;  1PG4 A;  5FLX D;  5A1I A;  5KEI A;  4FUT A;  3TQI A;  3AF6 A;  3DAY A;  1O90 A;  4R0M A;  4DG9 A;  2WP0 C;  3LNV A;  1ULT A;  2OPL A;  3UOW A;  2QL8 A;  1EGA A;  3C5E A;  4MH4 A;  4ODJ A;  2QVY X;  4GKK C;  4LF6 C;  3CJE A;  3L8C A;  1MD9 A;  5JRH A;  4JYA C;  4JI1 C;  1MXB A;  4WV3 A;  4DR2 C;  2AYA A;  4AQY C;  4BBY A;  3GKU A;  4DV5 C;  4R1L A;  3FCC A;  2ASB A;  1FJG C;  5T8T A;  5BSR A;  4BC7 A;  2E8F A;  4JI7 C;  3GPC A;  2D27 A;  4DR7 C;  4JI0 C;  2P2F A;  2WD9 A;  2KZF A;  1HNX C;  3OTO C;  4B3T C;  4JI3 C;  5A2Q D;  4LFA C;  5AE3 A;  3EER A;  2P20 A;  4R1M A;  4TPS B;  1QWI A;  4KTT A;  3DHV A;  3PBK A;  4NDN A;  2Y27 A;  3A9U A;  2HJG A;  5AE2 A;  3A9V A;  1XMO C;  4NXM C;  4EAT A;  1RG9 A;  4LF9 C;  3GR1 A;  1XNR C;  1XNQ C;  5A19 A;  2P2Q A;  3EQ6 A;  3TUF A;  1O93 A;  4LF7 C;  4DG8 A;  2E8C A;  2D1T A;  5ADZ A;  4KHP C;  3LAX A;  1UKK A;  1AMU A;  4DR6 C;  1T5H X;  1WH9 A;  3JAM D;  5BUQ A;  4OYC A;  3PES A;  1I94 C;  4LE5 A;  4DR4 C;  3LUS A;  1XRB A;  2ZM6 C;  1XRC A;  4DV3 C;  1P7L A;  4DCS A;  4GXR A;  2UUB C;  4I9F A;  1PG3 A;  4L7I A;  4RMN A;  4JV5 C;  4DV1 C;  4B3S C;  3I07 A;  4HPV A;  4X64 C;  3J81 D;  4OX9 C;  4D4I A;  4FUQ A;  4ZLP A;  2D1R A;  2PN2 A;  1HNZ C;  3TDE A;  1N32 C;  1USP A;  5BSV A;  4LFC C;  3G7S A;  4DR3 C;  2UXC C;  4MTN A;  5CZV A;  1XMQ C;  2UUC C;  1USP B;  1MXC A;  2VZE A;  4NOZ A;  5IT9 D;  4FTF A;  4LF4 C;  4BCA A;  3VNQ A;  4DV6 C;  3ETC A;  4X66 C;  1JOS A;  2YWB A;  4PZP A;  3DLP X;  1L2F A;  3R9X A;  4DV2 C;  5IWA C;  2F4V C;  4ZJZ A;  1IBK C;  4BC9 A;  4NXN C;  1ML8 A;  3RV2 A;  4LF5 C;  4DUZ C;  4DUY C;  4RM3 A;  3H2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...