3PESA

Crystal structure of uncharacterized protein from pseudomonas phage yua
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
83
structure length
83
Chain Sequence
AMLAEFEDRVAGIPCLIVVTYWEPYVPAKVSGPPEYCYPAEGGCGEWEVRDRRGRPAPWLERKLTEAERERIDQAVFDRMEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein from Pseudomonas phage YuA
rcsb
source organism Pseudomonas phage yua
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein gp49
total genus 19
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.260 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3pesA00
3PESA
chains in the Genus database with same CATH superfamily
4U5YD 4PUHA 1PG4A 1LCIA 5K85A 3CW8X 3GR0A 4GKKC 4WV3A 3VNSA 3FCEA 4DV6C 3L95X 1XRAA 5IWAC 4HPVA 1IBMC 2YWBA 3T1HC 2EGTA 2F4VC 1HNXC 3N2QA 4JV5C 1HNZC 3PBKA 1MXAA 4YHHC 1MXCA 4BSZA 1YJ7A 5BR8C 1NYEA 4X66C 2DYJA 4X65C 1MKYA 1P7LA 1NY8A 4L2ZA 3GKUA 1IBKC 4DR4C 3VNRA 2D28C 3ETOA 3CQ1A 3O2EA 1FJGC 1RG9A 2DPLA 4DCSA 3OTOC 4DR2C 2UUCC 3TDEA 4DG8A 3R44A 1IBLC 2OPLA 3NI2A 1N32C 4AQYC 1EGAA 2UU9C 4D4IA 1PG3A 3UEBA 2CY1A 4LF8C 4K0KC 3LAXA 3TR3A 5DV9A 4DCVA 1MXBA 5BURA 4GS5A 1WCJA 3EQ6A 2PN2A 4RMNA 4DV0C 1KKGA 1XRCA 4MH4A 3UOWA 3GPCA 3CQ3A 3IPLA 2HJGA 3G7SA 4G37A 3JAMD 4NXNC 1XHJA 1M6XC 1HR0C 4JI2C 3A25A 1XRBA 2VZEA 3IEVA 3J80D 2D7VA 5BSTA 4DV4C 2UUAC 3CQ2A 5E7QA 4EATA 4DR7C 1T5HX 2QVYX 5CZXA 3A4IA 5A1IA 3K6RA 1J5EC 4NOZA 1USPA 3J81D 4LF7C 5GTDA 4DV2C 1N2FA 2P02A 3EERA 4FUQA 3LNOA 3RG2A 2D1SA 4G1IA 2YWCA 4RVOA 4DV1C 4KTVA 2P2BA 1O9TA 2VQEC 3LGXA 2NCLA 3N54B 4OYCA 3NPDA 3CJEA 2ZM6C 2E8EA 5LMNC 4ZJZA 5BSVA 4JI6C 1BA3A 4DV3C 2E8CA 2Y4NA 3UX3A 4K0BA 2Y4OA 1O93A 4DR6C 1ZB9A 4JYAC 5LMUC 2QVZX 2VQFC 4LF5C 1MDFA 4PUIA 2HHHC 4JI1C 2UXDC 2WD9A 5BSRA 4L4QA 4ISBA 4PHTA 4G36A 2UXBC 3NYQA 5T8TA 3R9XA 1USPB 3A26A 3I07A 4DR5C 2MM9A 3S82A 1GPMA 3AF5A 4NDNA 4DV7C 2OO4A 4FTFA 2BJOA 1V25A 1PU1A 4JI3C 1JOSA 5BUSA 5AE2A 1WH9A 2D27A 4WS9A 3PROC 1P4EA 1MD9A 2D1QA 1VLAA 4X64C 2KZ0A 4D57A 1QWIA 2P20A 3AY0A 2E0GA 4I9GA 2QW0X 1XNRC 2M5HA 4LF6C 4I9FA 5A1GA 5FLXD 2CXCA 1MDBA 1UKKA 3SO4A 3FCCA 4D4GA 5AE1A 4DUYC 5KYVA 1RY2A 4DUZC 4DR3C 4KHPC 5IFIA 1L2FA 2V7BA 4GXRA 3UX2A 4BC7A 1N36C 5KEIA 4DCUA 2MMAB 1AMUA 1LQLA 1WF3A 2E5LC 4MTNA 1HH2P 4RLFA 2JMPA 4DG9A 4GXQA 1PA4A 4LFCC 3C5EA 4JI7C 4RM3A 4TPSB 2ZZMA 2KDNA 4DR1C 2D1TA 1UWDA 1FLOA 4LFAC 5H9UA 3TUFA 1V60A 4RVNA 5BSUA 5IT9D 1O90A 4X62C 3TQIA 4B3TC 4DV5C 2QVXX 5A2QD 1XMOC 3R9WA 1XS3A 3VNQA 4BBYA 2ONFA 1K0RA 4IR7A 1O92A 4JM1A 3A9UA 4BCAA 2Y27A 4OX9C 1N33C 4IZ6A 5CZVA 2MCQA 3RV2A 4BC9A 1FUGA 4R1LA 2DHMA 2CU6A 2P2MA 4R0MA 4YY3C 2PROA 3E7XA 2OBVA 2JNVA 1ML8A 4GKJC 2P2QA 1TH5A 3I08A 2Z51A 3LNVA 3GR1A 3H2TA 2KZFA 5BSWA 4B3SC 2M5OA 1VEHA 4JI4C 1V26A 4LF9C 4ODJA 4JI8C 1IB8A 2E7GA 4JI5C 4LFBC 2XR1A 1ZB8A 3NYRA 1QM4A 4PROC 3KXWA 2YCBA 4NXMC 3B7WA 2UXCC 3DHVA 3T1YC 3DLPX 3IMLA 4KTTA 3L8CA 2D1RA 2BH1X 5LCIA 1XMQC 1HNWC 2OPLB 4DCTA 5A19A 2QL8A 3CW9A 2UUBC 3ETCA 3IEUA 4RM2A 2YX1A 5BSMA 3DAYA 2ASBA 2ATWA 3PESA 4RLQA 4FUTA 1N34C 2ZZNA 5JRHA 4R1MA 4PUGA 5T8SA 2PT7G 4ZLPA 1M6XA 4PZPA 5ADZA 4B3RC 3AF6A 4B3MC 3A9VA 1T5DX 1ULTA 1I94C 2WP0C 4JI0C 5BUQA 4XX2A 2P2JA 1P4EC 1XNQC 4LF4C 2VSQA 4OXIA 3E7WA 2E8FA 4LE5A 4D56A 3UZ0A 5KYTA 5AE3A 5K8FA 2AYAA 2P2FA 3LUSA 4L7IA
chains in the Genus database with same CATH topology
4U5YD 1PG4A 1LCIA 5K85A 3CW8X 3GR0A 4GKKC 4WV3A 3VNSA 3FCEA 4DV6C 3L95X 1XRAA 5IWAC 4HPVA 1IBMC 2YWBA 3T1HC 2EGTA 2F4VC 1HNXC 3N2QA 4JV5C 1HNZC 3PBKA 1MXAA 4YHHC 1MXCA 4BSZA 1YJ7A 5BR8C 1NYEA 4X66C 2DYJA 4X65C 1MKYA 1P7LA 4L2ZA 3GKUA 1IBKC 4DR4C 3VNRA 2D28C 3ETOA 1FJGC 1RG9A 2DPLA 4DCSA 3OTOC 4DR2C 2UUCC 3TDEA 4DG8A 3R44A 1IBLC 2OPLA 3NI2A 1N32C 4AQYC 1EGAA 2UU9C 4D4IA 1PG3A 2CY1A 4LF8C 4K0KC 3LAXA 5DV9A 4DCVA 1MXBA 5BURA 4GS5A 3EQ6A 2PN2A 4RMNA 4DV0C 1KKGA 1XRCA 4MH4A 3UOWA 3GPCA 3IPLA 2HJGA 3G7SA 4G37A 3JAMD 4NXNC 1HR0C 4JI2C 1XRBA 2VZEA 3IEVA 3J80D 2D7VA 5BSTA 4DV4C 2UUAC 5E7QA 4EATA 4DR7C 1T5HX 2QVYX 5CZXA 3A4IA 5A1IA 1J5EC 4NOZA 1USPA 4LF7C 3J81D 5GTDA 4DV2C 1N2FA 2P02A 3EERA 4FUQA 3RG2A 2D1SA 4G1IA 2YWCA 4RVOA 4DV1C 4KTVA 2P2BA 1O9TA 2VQEC 3LGXA 3N54B 4OYCA 3NPDA 3CJEA 2ZM6C 2E8EA 5LMNC 4ZJZA 5BSVA 4JI6C 1BA3A 4DV3C 2E8CA 2Y4NA 4K0BA 2Y4OA 1O93A 4DR6C 1ZB9A 4JYAC 5LMUC 2QVZX 2VQFC 4LF5C 1MDFA 2HHHC 4JI1C 2UXDC 2WD9A 5BSRA 4L4QA 4ISBA 4PHTA 4G36A 2UXBC 3NYQA 5T8TA 3R9XA 1USPB 3I07A 4DR5C 3S82A 1GPMA 3AF5A 4NDNA 4DV7C 2OO4A 4FTFA 2BJOA 1V25A 4JI3C 1JOSA 5BUSA 5AE2A 1WH9A 2D27A 4WS9A 3PROC 1MD9A 2D1QA 1VLAA 4X64C 4D57A 1QWIA 2P20A 2E0GA 4I9GA 2QW0X 1XNRC 4LF6C 4I9FA 5A1GA 5FLXD 2CXCA 1MDBA 1UKKA 3SO4A 3FCCA 4D4GA 5AE1A 4DUYC 5KYVA 1RY2A 4DUZC 4DR3C 4KHPC 5IFIA 1L2FA 2V7BA 4GXRA 4BC7A 1N36C 5KEIA 4DCUA 1AMUA 1LQLA 1WF3A 2E5LC 4MTNA 1HH2P 4RLFA 2JMPA 4DG9A 4GXQA 1PA4A 4LFCC 3C5EA 4JI7C 4RM3A 4TPSB 4DR1C 2D1TA 4LFAC 5H9UA 3TUFA 4RVNA 5BSUA 5IT9D 1O90A 4X62C 3TQIA 4B3TC 4DV5C 2QVXX 5A2QD 1XMOC 3R9WA 3VNQA 4BBYA 2ONFA 1K0RA 4IR7A 1O92A 4JM1A 3A9UA 4BCAA 2Y27A 4OX9C 1N33C 4IZ6A 5CZVA 3RV2A 4BC9A 1FUGA 4R1LA 2P2MA 4R0MA 4YY3C 2PROA 3E7XA 2OBVA 1ML8A 4GKJC 2P2QA 3I08A 3LNVA 3GR1A 3H2TA 2KZFA 5BSWA 4B3SC 4JI4C 1V26A 4LF9C 4ODJA 4JI8C 2E7GA 4JI5C 4LFBC 2XR1A 1ZB8A 3NYRA 1QM4A 4PROC 3KXWA 2YCBA 4NXMC 3B7WA 2UXCC 3DHVA 3T1YC 3DLPX 3IMLA 4KTTA 3L8CA 2D1RA 2BH1X 1XMQC 1HNWC 2OPLB 4DCTA 5A19A 2QL8A 3CW9A 2UUBC 3ETCA 3IEUA 4RM2A 5BSMA 3DAYA 2ASBA 2ATWA 3PESA 4RLQA 4FUTA 1N34C 5JRHA 4R1MA 5T8SA 2PT7G 4ZLPA 4PZPA 5ADZA 4B3RC 3AF6A 4B3MC 3A9VA 1T5DX 1ULTA 1I94C 2WP0C 4JI0C 5BUQA 4XX2A 2P2JA 1XNQC 4LF4C 2VSQA 4OXIA 3E7WA 2E8FA 4LE5A 4D56A 3UZ0A 5KYTA 5AE3A 5K8FA 2AYAA 2P2FA 3LUSA 4L7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PES A; 
#chains in the Genus database with same CATH topology
 4U5Y D;  4PUH A;  1PG4 A;  1LCI A;  5K85 A;  3CW8 X;  3GR0 A;  4GKK C;  4WV3 A;  3VNS A;  3FCE A;  4DV6 C;  3L95 X;  1XRA A;  5IWA C;  4HPV A;  1IBM C;  2YWB A;  3T1H C;  2EGT A;  2F4V C;  1HNX C;  3N2Q A;  4JV5 C;  1HNZ C;  3PBK A;  1MXA A;  4YHH C;  1MXC A;  4BSZ A;  1YJ7 A;  5BR8 C;  1NYE A;  4X66 C;  2DYJ A;  4X65 C;  1MKY A;  1P7L A;  1NY8 A;  4L2Z A;  3GKU A;  1IBK C;  4DR4 C;  3VNR A;  2D28 C;  3ETO A;  3CQ1 A;  3O2E A;  1FJG C;  1RG9 A;  2DPL A;  4DCS A;  3OTO C;  4DR2 C;  2UUC C;  3TDE A;  4DG8 A;  3R44 A;  1IBL C;  2OPL A;  3NI2 A;  1N32 C;  4AQY C;  1EGA A;  2UU9 C;  4D4I A;  1PG3 A;  3UEB A;  2CY1 A;  4LF8 C;  4K0K C;  3LAX A;  3TR3 A;  5DV9 A;  4DCV A;  1MXB A;  5BUR A;  4GS5 A;  1WCJ A;  3EQ6 A;  2PN2 A;  4RMN A;  4DV0 C;  1KKG A;  1XRC A;  4MH4 A;  3UOW A;  3GPC A;  3CQ3 A;  3IPL A;  2HJG A;  3G7S A;  4G37 A;  3JAM D;  4NXN C;  1XHJ A;  1M6X C;  1HR0 C;  4JI2 C;  3A25 A;  1XRB A;  2VZE A;  3IEV A;  3J80 D;  2D7V A;  5BST A;  4DV4 C;  2UUA C;  3CQ2 A;  5E7Q A;  4EAT A;  4DR7 C;  1T5H X;  2QVY X;  5CZX A;  3A4I A;  5A1I A;  3K6R A;  1J5E C;  4NOZ A;  1USP A;  3J81 D;  4LF7 C;  5GTD A;  4DV2 C;  1N2F A;  2P02 A;  3EER A;  4FUQ A;  3LNO A;  3RG2 A;  2D1S A;  4G1I A;  2YWC A;  4RVO A;  4DV1 C;  4KTV A;  2P2B A;  1O9T A;  2VQE C;  3LGX A;  2NCL A;  3N54 B;  4OYC A;  3NPD A;  3CJE A;  2ZM6 C;  2E8E A;  5LMN C;  4ZJZ A;  5BSV A;  4JI6 C;  1BA3 A;  4DV3 C;  2E8C A;  2Y4N A;  3UX3 A;  4K0B A;  2Y4O A;  1O93 A;  4DR6 C;  1ZB9 A;  4JYA C;  5LMU C;  2QVZ X;  2VQF C;  4LF5 C;  1MDF A;  4PUI A;  2HHH C;  4JI1 C;  2UXD C;  2WD9 A;  5BSR A;  4L4Q A;  4ISB A;  4PHT A;  4G36 A;  2UXB C;  3NYQ A;  5T8T A;  3R9X A;  1USP B;  3A26 A;  3I07 A;  4DR5 C;  2MM9 A;  3S82 A;  1GPM A;  3AF5 A;  4NDN A;  4DV7 C;  2OO4 A;  4FTF A;  2BJO A;  1V25 A;  1PU1 A;  4JI3 C;  1JOS A;  5BUS A;  5AE2 A;  1WH9 A;  2D27 A;  4WS9 A;  3PRO C;  1P4E A;  1MD9 A;  2D1Q A;  1VLA A;  4X64 C;  2KZ0 A;  4D57 A;  1QWI A;  2P20 A;  3AY0 A;  2E0G A;  4I9G A;  2QW0 X;  1XNR C;  2M5H A;  4LF6 C;  4I9F A;  5A1G A;  5FLX D;  2CXC A;  1MDB A;  1UKK A;  3SO4 A;  3FCC A;  4D4G A;  5AE1 A;  4DUY C;  5KYV A;  1RY2 A;  4DUZ C;  4DR3 C;  4KHP C;  5IFI A;  1L2F A;  2V7B A;  4GXR A;  3UX2 A;  4BC7 A;  1N36 C;  5KEI A;  4DCU A;  2MMA B;  1AMU A;  1LQL A;  1WF3 A;  2E5L C;  4MTN A;  1HH2 P;  4RLF A;  2JMP A;  4DG9 A;  4GXQ A;  1PA4 A;  4LFC C;  3C5E A;  4JI7 C;  4RM3 A;  4TPS B;  2ZZM A;  2KDN A;  4DR1 C;  2D1T A;  1UWD A;  1FLO A;  4LFA C;  5H9U A;  3TUF A;  1V60 A;  4RVN A;  5BSU A;  5IT9 D;  1O90 A;  4X62 C;  3TQI A;  4B3T C;  4DV5 C;  2QVX X;  5A2Q D;  1XMO C;  3R9W A;  1XS3 A;  3VNQ A;  4BBY A;  2ONF A;  1K0R A;  4IR7 A;  1O92 A;  4JM1 A;  3A9U A;  4BCA A;  2Y27 A;  4OX9 C;  1N33 C;  4IZ6 A;  5CZV A;  2MCQ A;  3RV2 A;  4BC9 A;  1FUG A;  4R1L A;  2DHM A;  2CU6 A;  2P2M A;  4R0M A;  4YY3 C;  2PRO A;  3E7X A;  2OBV A;  2JNV A;  1ML8 A;  4GKJ C;  2P2Q A;  1TH5 A;  3I08 A;  2Z51 A;  3LNV A;  3GR1 A;  3H2T A;  2KZF A;  5BSW A;  4B3S C;  2M5O A;  1VEH A;  4JI4 C;  1V26 A;  4LF9 C;  4ODJ A;  4JI8 C;  1IB8 A;  2E7G A;  4JI5 C;  4LFB C;  2XR1 A;  1ZB8 A;  3NYR A;  1QM4 A;  4PRO C;  3KXW A;  2YCB A;  4NXM C;  3B7W A;  2UXC C;  3DHV A;  3T1Y C;  3DLP X;  3IML A;  4KTT A;  3L8C A;  2D1R A;  2BH1 X;  5LCI A;  1XMQ C;  1HNW C;  2OPL B;  4DCT A;  5A19 A;  2QL8 A;  3CW9 A;  2UUB C;  3ETC A;  3IEU A;  4RM2 A;  2YX1 A;  5BSM A;  3DAY A;  2ASB A;  2ATW A;  3PES A;  4RLQ A;  4FUT A;  1N34 C;  2ZZN A;  5JRH A;  4R1M A;  4PUG A;  5T8S A;  2PT7 G;  4ZLP A;  1M6X A;  4PZP A;  5ADZ A;  4B3R C;  3AF6 A;  4B3M C;  3A9V A;  1T5D X;  1ULT A;  1I94 C;  2WP0 C;  4JI0 C;  5BUQ A;  4XX2 A;  2P2J A;  1P4E C;  1XNQ C;  4LF4 C;  2VSQ A;  4OXI A;  3E7W A;  2E8F A;  4LE5 A;  4D56 A;  3UZ0 A;  5KYT A;  5AE3 A;  5K8F A;  2AYA A;  2P2F A;  3LUS A;  4L7I A; 
#chains in the Genus database with same CATH homology
 4U5Y D;  1PG4 A;  1LCI A;  5K85 A;  3CW8 X;  3GR0 A;  4GKK C;  4WV3 A;  3VNS A;  3FCE A;  4DV6 C;  3L95 X;  1XRA A;  5IWA C;  4HPV A;  1IBM C;  2YWB A;  3T1H C;  2EGT A;  2F4V C;  1HNX C;  3N2Q A;  4JV5 C;  1HNZ C;  3PBK A;  1MXA A;  4YHH C;  1MXC A;  4BSZ A;  1YJ7 A;  5BR8 C;  1NYE A;  4X66 C;  2DYJ A;  4X65 C;  1MKY A;  1P7L A;  4L2Z A;  3GKU A;  1IBK C;  4DR4 C;  3VNR A;  2D28 C;  3ETO A;  1FJG C;  1RG9 A;  2DPL A;  4DCS A;  3OTO C;  4DR2 C;  2UUC C;  3TDE A;  4DG8 A;  3R44 A;  1IBL C;  2OPL A;  3NI2 A;  1N32 C;  4AQY C;  1EGA A;  2UU9 C;  4D4I A;  1PG3 A;  2CY1 A;  4LF8 C;  4K0K C;  3LAX A;  5DV9 A;  4DCV A;  1MXB A;  5BUR A;  4GS5 A;  3EQ6 A;  2PN2 A;  4RMN A;  4DV0 C;  1KKG A;  1XRC A;  4MH4 A;  3UOW A;  3GPC A;  3IPL A;  2HJG A;  3G7S A;  4G37 A;  3JAM D;  4NXN C;  1HR0 C;  4JI2 C;  1XRB A;  2VZE A;  3IEV A;  3J80 D;  2D7V A;  5BST A;  4DV4 C;  2UUA C;  5E7Q A;  4EAT A;  4DR7 C;  1T5H X;  2QVY X;  5CZX A;  3A4I A;  5A1I A;  1J5E C;  4NOZ A;  1USP A;  4LF7 C;  3J81 D;  5GTD A;  4DV2 C;  1N2F A;  2P02 A;  3EER A;  4FUQ A;  3RG2 A;  2D1S A;  4G1I A;  2YWC A;  4RVO A;  4DV1 C;  4KTV A;  2P2B A;  1O9T A;  2VQE C;  3LGX A;  3N54 B;  4OYC A;  3NPD A;  3CJE A;  2ZM6 C;  2E8E A;  5LMN C;  4ZJZ A;  5BSV A;  4JI6 C;  1BA3 A;  4DV3 C;  2E8C A;  2Y4N A;  4K0B A;  2Y4O A;  1O93 A;  4DR6 C;  1ZB9 A;  4JYA C;  5LMU C;  2QVZ X;  2VQF C;  4LF5 C;  1MDF A;  2HHH C;  4JI1 C;  2UXD C;  2WD9 A;  5BSR A;  4L4Q A;  4ISB A;  4PHT A;  4G36 A;  2UXB C;  3NYQ A;  5T8T A;  3R9X A;  1USP B;  3I07 A;  4DR5 C;  3S82 A;  1GPM A;  3AF5 A;  4NDN A;  4DV7 C;  2OO4 A;  4FTF A;  2BJO A;  1V25 A;  4JI3 C;  1JOS A;  5BUS A;  5AE2 A;  1WH9 A;  2D27 A;  4WS9 A;  3PRO C;  1MD9 A;  2D1Q A;  1VLA A;  4X64 C;  4D57 A;  1QWI A;  2P20 A;  2E0G A;  4I9G A;  2QW0 X;  1XNR C;  4LF6 C;  4I9F A;  5A1G A;  5FLX D;  2CXC A;  1MDB A;  1UKK A;  3SO4 A;  3FCC A;  4D4G A;  5AE1 A;  4DUY C;  5KYV A;  1RY2 A;  4DUZ C;  4DR3 C;  4KHP C;  5IFI A;  1L2F A;  2V7B A;  4GXR A;  4BC7 A;  1N36 C;  5KEI A;  4DCU A;  1AMU A;  1LQL A;  1WF3 A;  2E5L C;  4MTN A;  1HH2 P;  4RLF A;  2JMP A;  4DG9 A;  4GXQ A;  1PA4 A;  4LFC C;  3C5E A;  4JI7 C;  4RM3 A;  4TPS B;  4DR1 C;  2D1T A;  4LFA C;  5H9U A;  3TUF A;  4RVN A;  5BSU A;  5IT9 D;  1O90 A;  4X62 C;  3TQI A;  4B3T C;  4DV5 C;  2QVX X;  5A2Q D;  1XMO C;  3R9W A;  3VNQ A;  4BBY A;  2ONF A;  1K0R A;  4IR7 A;  1O92 A;  4JM1 A;  3A9U A;  4BCA A;  2Y27 A;  4OX9 C;  1N33 C;  4IZ6 A;  5CZV A;  3RV2 A;  4BC9 A;  1FUG A;  4R1L A;  2P2M A;  4R0M A;  4YY3 C;  2PRO A;  3E7X A;  2OBV A;  1ML8 A;  4GKJ C;  2P2Q A;  3I08 A;  3LNV A;  3GR1 A;  3H2T A;  2KZF A;  5BSW A;  4B3S C;  4JI4 C;  1V26 A;  4LF9 C;  4ODJ A;  4JI8 C;  2E7G A;  4JI5 C;  4LFB C;  2XR1 A;  1ZB8 A;  3NYR A;  1QM4 A;  4PRO C;  3KXW A;  2YCB A;  4NXM C;  3B7W A;  2UXC C;  3DHV A;  3T1Y C;  3DLP X;  3IML A;  4KTT A;  3L8C A;  2D1R A;  2BH1 X;  1XMQ C;  1HNW C;  2OPL B;  4DCT A;  5A19 A;  2QL8 A;  3CW9 A;  2UUB C;  3ETC A;  3IEU A;  4RM2 A;  5BSM A;  3DAY A;  2ASB A;  2ATW A;  3PES A;  4RLQ A;  4FUT A;  1N34 C;  5JRH A;  4R1M A;  5T8S A;  2PT7 G;  4ZLP A;  4PZP A;  5ADZ A;  4B3R C;  3AF6 A;  4B3M C;  3A9V A;  1T5D X;  1ULT A;  1I94 C;  2WP0 C;  4JI0 C;  5BUQ A;  4XX2 A;  2P2J A;  1XNQ C;  4LF4 C;  2VSQ A;  4OXI A;  3E7W A;  2E8F A;  4LE5 A;  4D56 A;  3UZ0 A;  5KYT A;  5AE3 A;  5K8F A;  2AYA A;  2P2F A;  3LUS A;  4L7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...