3PESA

Crystal structure of uncharacterized protein from pseudomonas phage yua
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
83
structure length
83
Chain Sequence
b'AMLAEFEDRVAGIPCLIVVTYWEPYVPAKVSGPPEYCYPAEGGCGEWEVRDRRGRPAPWLERKLTEAERERIDQAVFDRMEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein gp49
publication title Crystal structure of uncharacterized protein from Pseudomonas phage YuA
rcsb
source organism Pseudomonas phage yua
molecule tags Structural genomics, unknown function
total genus 19
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.260 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3pesA00
3PESA
chains in the Genus database with same CATH superfamily
1ZB9A 3EERA 1L2FA 3RG2A 4DR2C 4NDNA 4KTTA 3A25A 1V26A 4DV7C 2PT7G 3FCEA 1YJ7A 3H2TA 4B3MC 4ZJZA 5AE3A 1V25A 4JI2C 3I08A 4WV3A 5CZXA 3T1HC 5LMNC 3TDEA 2OPLB 1T5DX 1ULTA 3TQIA 4BSZA 2ONFA 4KTVA 2UXDC 2NCLA 1IBLC 2P2QA 2WD9A 3VNQA 4EATA 3A9VA 1XMQC 3EQ6A 4B3TC 4PUIA 4R0MA 1FJGC 2D1RA 5KEIA 1IBMC 2UXBC 1K0RA 2YCBA 4PUHA 4JI8C 3UOWA 4I9GA 2WP0C 5LCIA 3R9XA 1N33C 1O90A 4DR5C 3NPDA 1V60A 1WCJA 3A26A 1XS3A 4B3SC 5BSWA 3PESA 4BC7A 1ZB8A 3A4IA 4ODJA 2P2FA 2QL8A 3GR1A 2XR1A 2D28C 3IEUA 4PHTA 4D56A 1GPMA 4DCTA 2ZZMA 4D4IA 4DV4C 4YHHC 4X65C 3AY0A 3N54B 2MCQA 5LMUC 3C5EA 5IT9D 5A2QD 3R9WA 2YX1A 2CU6A 4K0KC 4FTFA 3E7XA 1XRAA 4R1MA 3JAMD 3NYRA 4GXQA 4D4GA 4AQYC 3O2EA 3A9UA 1XRBA 3LGXA 4L7IA 4JYAC 3UZ0A 5IWAC 4OXIA 4D57A 4I9FA 5FLXD 4BCAA 2MM9A 2QVXX 1PG4A 1HH2P 4MTNA 4LF9C 1MXAA 2ZZNA 4FUTA 1MXCA 5BR8C 4RLFA 1HNZC 3OTOC 4X64C 3UEBA 1XMOC 4GXRA 2M5HA 4G36A 1N2FA 4RM3A 3NYQA 1JOSA 2P20A 3SO4A 4DR3C 2VQFC 2HJGA 1MD9A 2ATWA 2VSQA 1RY2A 1USPA 3PROC 4DR6C 2E5LC 5A1GA 1N36C 3DAYA 3CQ3A 4DUYC 4ZLPA 2F4VC 5DV9A 2MMAB 2Y27A 4RVNA 2OO4A 2DYJA 4G1IA 4LF8C 2D7VA 3KXWA 2EGTA 4BC9A 3RV2A 4NXMC 1HR0C 1BA3A 2Y4NA 3S82A 4JI6C 4XX2A 3IEVA 3CQ1A 1XHJA 2DPLA 4DV2C 1O9TA 5BSRA 5AE2A 4LFAC 2BH1X 3LNOA 4U5YD 4DCUA 2YWCA 1O93A 1O92A 1KKGA 2E8FA 4JI4C 1IB8A 2E8EA 3ETOA 1LQLA 5E7QA 1M6XA 5T8TA 2JMPA 4ISBA 3B7WA 2P2MA 4YY3C 1TH5A 3J80D 4NOZA 2OBVA 4WS9A 4DG9A 3CQ2A 4B3RC 3VNRA 4LE5A 2P2JA 4OX9C 4RMNA 4TPSB 4G37A 4RM2A 4LF5C 1WF3A 5H9UA 3GKUA 1EGAA 2UUBC 1M6XC 3LUSA 2D1QA 2BJOA 3TUFA 2P02A 4IR7A 3NI2A 4HPVA 5A1IA 2CXCA 2VZEA 4JI1C 5GTDA 1UKKA 4JI3C 4DG8A 3LAXA 1PG3A 2QVZX 5BSMA 3J81D 1N34C 3TR3A 3T1YC 2YWBA 3L95X 1MDBA 3K6RA 5KYTA 4JV5C 1P4EA 2UXCC 4GS5A 4JI0C 4X66C 4DV1C 2CY1A 5BSVA 1AMUA 1NYEA 2OPLA 1I94C 1HNXC 2QVYX 3I07A 4X62C 2D1SA 2HHHC 2KDNA 4PROC 4RLQA 2PN2A 5BSUA 2DHMA 5IFIA 2ZM6C 1UWDA 3AF6A 1QM4A 1P4EC 2JNVA 5A19A 3CW9A 2E7GA 4DCVA 4PUGA 4DV6C 4DCSA 3L8CA 4PZPA 2KZ0A 3UX2A 5T8SA 2AYAA 1VLAA 2VQEC 4DUZC 2KZFA 1FLOA 4DV5C 4OYCA 5JRHA 1VEHA 4LF4C 1FUGA 4K0BA 1XNQC 4FUQA 3CW8X 1LCIA 4L2ZA 2M5OA 2Z51A 3R44A 1J5EC 4GKJC 2Y4OA 3AF5A 5ADZA 2QW0X 4DR1C 3N2QA 1USPB 4JM1A 4JI5C 1IBKC 4LFCC 3GR0A 1PA4A 2P2BA 1HNWC 1WH9A 3G7SA 3DLPX 4DV3C 5K85A 4RVOA 3IPLA 5BUQA 1RG9A 5BUSA 4KHPC 1T5HX 3LNVA 5CZVA 3IMLA 4BBYA 4L4QA 5AE1A 3GPCA 4GKKC 4LF6C 1MDFA 4R1LA 1XNRC 3UX3A 5BSTA 3DHVA 2D1TA 3VNSA 5K8FA 4JI7C 4MH4A 3ETCA 2UUCC 4LF7C 2UU9C 4NXNC 1N32C 4DR4C 3PBKA 4LFBC 1QWIA 3CJEA 4DR7C 2E0GA 1XRCA 3FCCA 2D27A 2ASBA 1ML8A 2PROA 2V7BA 5KYVA 1MKYA 5BURA 1P7LA 2UUAC 1PU1A 4DV0C 1MXBA 4IZ6A 1NY8A 2E8CA 3E7WA
chains in the Genus database with same CATH topology
1ZB9A 3EERA 1L2FA 3RG2A 4DR2C 4NDNA 4KTTA 1V26A 4DV7C 2PT7G 3FCEA 1YJ7A 3H2TA 4B3MC 4ZJZA 5AE3A 1V25A 4JI2C 3I08A 4WV3A 5CZXA 3T1HC 5LMNC 3TDEA 2OPLB 1T5DX 1ULTA 3TQIA 4BSZA 2ONFA 4KTVA 2UXDC 1IBLC 2P2QA 2WD9A 3VNQA 4EATA 3A9VA 1XMQC 3EQ6A 4B3TC 4R0MA 1FJGC 2D1RA 5KEIA 1IBMC 2UXBC 1K0RA 2YCBA 4JI8C 3UOWA 4I9GA 2WP0C 3R9XA 1N33C 1O90A 4DR5C 3NPDA 4B3SC 5BSWA 3PESA 4BC7A 1ZB8A 3A4IA 4ODJA 2P2FA 2QL8A 3GR1A 2XR1A 2D28C 3IEUA 4PHTA 4D56A 1GPMA 4DCTA 4D4IA 4DV4C 4YHHC 4X65C 3N54B 5LMUC 3C5EA 5IT9D 5A2QD 3R9WA 4K0KC 4FTFA 3E7XA 1XRAA 4R1MA 3JAMD 3NYRA 4GXQA 4D4GA 4AQYC 3A9UA 1XRBA 3LGXA 4L7IA 4JYAC 3UZ0A 5IWAC 4OXIA 4D57A 4I9FA 5FLXD 4BCAA 2QVXX 1PG4A 1HH2P 4MTNA 4LF9C 1MXAA 4FUTA 1MXCA 5BR8C 4RLFA 1HNZC 3OTOC 4X64C 1XMOC 4GXRA 4G36A 1N2FA 4RM3A 3NYQA 1JOSA 2P20A 3SO4A 4DR3C 2VQFC 2HJGA 1MD9A 2ATWA 2VSQA 1RY2A 1USPA 3PROC 4DR6C 2E5LC 5A1GA 1N36C 3DAYA 4DUYC 4ZLPA 2F4VC 5DV9A 2Y27A 4RVNA 2OO4A 2DYJA 4G1IA 4LF8C 2D7VA 3KXWA 2EGTA 4BC9A 3RV2A 4NXMC 1HR0C 1BA3A 2Y4NA 3S82A 4JI6C 4XX2A 3IEVA 2DPLA 4DV2C 1O9TA 5BSRA 5AE2A 4LFAC 2BH1X 4U5YD 4DCUA 2YWCA 1O93A 1O92A 1KKGA 2E8FA 4JI4C 2E8EA 3ETOA 1LQLA 5E7QA 5T8TA 2JMPA 4ISBA 3B7WA 2P2MA 4YY3C 3J80D 4NOZA 2OBVA 4WS9A 4DG9A 4B3RC 3VNRA 4LE5A 2P2JA 4OX9C 4RMNA 4TPSB 4G37A 4RM2A 4LF5C 1WF3A 5H9UA 3GKUA 1EGAA 2UUBC 3LUSA 2D1QA 2BJOA 3TUFA 2P02A 4IR7A 3NI2A 4HPVA 5A1IA 2CXCA 2VZEA 4JI1C 5GTDA 1UKKA 4JI3C 4DG8A 3LAXA 1PG3A 2QVZX 5BSMA 3J81D 1N34C 3T1YC 2YWBA 3L95X 1MDBA 5KYTA 4JV5C 2UXCC 4GS5A 4JI0C 4X66C 4DV1C 2CY1A 5BSVA 1AMUA 1NYEA 2OPLA 1I94C 1HNXC 2QVYX 3I07A 4X62C 2D1SA 2HHHC 4PROC 4RLQA 2PN2A 5BSUA 5IFIA 2ZM6C 3AF6A 1QM4A 5A19A 3CW9A 2E7GA 4DCVA 4DV6C 4DCSA 3L8CA 4PZPA 2VQEC 5T8SA 2AYAA 1VLAA 4DUZC 2KZFA 4DV5C 4OYCA 5JRHA 4LF4C 1FUGA 4K0BA 1XNQC 4FUQA 3CW8X 1LCIA 4L2ZA 3R44A 1J5EC 4GKJC 2Y4OA 3AF5A 5ADZA 2QW0X 4DR1C 3N2QA 1USPB 4JM1A 4JI5C 1IBKC 4LFCC 3GR0A 1PA4A 2P2BA 1HNWC 1WH9A 3G7SA 3DLPX 4DV3C 5K85A 4RVOA 3IPLA 5BUQA 1RG9A 5BUSA 4KHPC 1T5HX 3LNVA 5CZVA 3IMLA 4BBYA 4L4QA 5AE1A 3GPCA 4GKKC 4LF6C 1MDFA 4R1LA 1XNRC 5BSTA 3DHVA 2D1TA 3VNSA 5K8FA 4JI7C 4MH4A 3ETCA 2UUCC 4LF7C 2UU9C 4NXNC 1N32C 4DR4C 3PBKA 4LFBC 1QWIA 3CJEA 4DR7C 2E0GA 1XRCA 3FCCA 2D27A 2ASBA 1ML8A 2PROA 2V7BA 5KYVA 1MKYA 5BURA 1P7LA 2UUAC 4DV0C 1MXBA 4IZ6A 2E8CA 3E7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PES A; 
#chains in the Genus database with same CATH topology
 1ZB9 A;  3EER A;  1L2F A;  3RG2 A;  4DR2 C;  4NDN A;  4KTT A;  3A25 A;  1V26 A;  4DV7 C;  2PT7 G;  3FCE A;  1YJ7 A;  3H2T A;  4B3M C;  4ZJZ A;  5AE3 A;  1V25 A;  4JI2 C;  3I08 A;  4WV3 A;  5CZX A;  3T1H C;  5LMN C;  3TDE A;  2OPL B;  1T5D X;  1ULT A;  3TQI A;  4BSZ A;  2ONF A;  4KTV A;  2UXD C;  2NCL A;  1IBL C;  2P2Q A;  2WD9 A;  3VNQ A;  4EAT A;  3A9V A;  1XMQ C;  3EQ6 A;  4B3T C;  4PUI A;  4R0M A;  1FJG C;  2D1R A;  5KEI A;  1IBM C;  2UXB C;  1K0R A;  2YCB A;  4PUH A;  4JI8 C;  3UOW A;  4I9G A;  2WP0 C;  5LCI A;  3R9X A;  1N33 C;  1O90 A;  4DR5 C;  3NPD A;  1V60 A;  1WCJ A;  3A26 A;  1XS3 A;  4B3S C;  5BSW A;  3PES A;  4BC7 A;  1ZB8 A;  3A4I A;  4ODJ A;  2P2F A;  2QL8 A;  3GR1 A;  2XR1 A;  2D28 C;  3IEU A;  4PHT A;  4D56 A;  1GPM A;  4DCT A;  2ZZM A;  4D4I A;  4DV4 C;  4YHH C;  4X65 C;  3AY0 A;  3N54 B;  2MCQ A;  5LMU C;  3C5E A;  5IT9 D;  5A2Q D;  3R9W A;  2YX1 A;  2CU6 A;  4K0K C;  4FTF A;  3E7X A;  1XRA A;  4R1M A;  3JAM D;  3NYR A;  4GXQ A;  4D4G A;  4AQY C;  3O2E A;  3A9U A;  1XRB A;  3LGX A;  4L7I A;  4JYA C;  3UZ0 A;  5IWA C;  4OXI A;  4D57 A;  4I9F A;  5FLX D;  4BCA A;  2MM9 A;  2QVX X;  1PG4 A;  1HH2 P;  4MTN A;  4LF9 C;  1MXA A;  2ZZN A;  4FUT A;  1MXC A;  5BR8 C;  4RLF A;  1HNZ C;  3OTO C;  4X64 C;  3UEB A;  1XMO C;  4GXR A;  2M5H A;  4G36 A;  1N2F A;  4RM3 A;  3NYQ A;  1JOS A;  2P20 A;  3SO4 A;  4DR3 C;  2VQF C;  2HJG A;  1MD9 A;  2ATW A;  2VSQ A;  1RY2 A;  1USP A;  3PRO C;  4DR6 C;  2E5L C;  5A1G A;  1N36 C;  3DAY A;  3CQ3 A;  4DUY C;  4ZLP A;  2F4V C;  5DV9 A;  2MMA B;  2Y27 A;  4RVN A;  2OO4 A;  2DYJ A;  4G1I A;  4LF8 C;  2D7V A;  3KXW A;  2EGT A;  4BC9 A;  3RV2 A;  4NXM C;  1HR0 C;  1BA3 A;  2Y4N A;  3S82 A;  4JI6 C;  4XX2 A;  3IEV A;  3CQ1 A;  1XHJ A;  2DPL A;  4DV2 C;  1O9T A;  5BSR A;  5AE2 A;  4LFA C;  2BH1 X;  3LNO A;  4U5Y D;  4DCU A;  2YWC A;  1O93 A;  1O92 A;  1KKG A;  2E8F A;  4JI4 C;  1IB8 A;  2E8E A;  3ETO A;  1LQL A;  5E7Q A;  1M6X A;  5T8T A;  2JMP A;  4ISB A;  3B7W A;  2P2M A;  4YY3 C;  1TH5 A;  3J80 D;  4NOZ A;  2OBV A;  4WS9 A;  4DG9 A;  3CQ2 A;  4B3R C;  3VNR A;  4LE5 A;  2P2J A;  4OX9 C;  4RMN A;  4TPS B;  4G37 A;  4RM2 A;  4LF5 C;  1WF3 A;  5H9U A;  3GKU A;  1EGA A;  2UUB C;  1M6X C;  3LUS A;  2D1Q A;  2BJO A;  3TUF A;  2P02 A;  4IR7 A;  3NI2 A;  4HPV A;  5A1I A;  2CXC A;  2VZE A;  4JI1 C;  5GTD A;  1UKK A;  4JI3 C;  4DG8 A;  3LAX A;  1PG3 A;  2QVZ X;  5BSM A;  3J81 D;  1N34 C;  3TR3 A;  3T1Y C;  2YWB A;  3L95 X;  1MDB A;  3K6R A;  5KYT A;  4JV5 C;  1P4E A;  2UXC C;  4GS5 A;  4JI0 C;  4X66 C;  4DV1 C;  2CY1 A;  5BSV A;  1AMU A;  1NYE A;  2OPL A;  1I94 C;  1HNX C;  2QVY X;  3I07 A;  4X62 C;  2D1S A;  2HHH C;  2KDN A;  4PRO C;  4RLQ A;  2PN2 A;  5BSU A;  2DHM A;  5IFI A;  2ZM6 C;  1UWD A;  3AF6 A;  1QM4 A;  1P4E C;  2JNV A;  5A19 A;  3CW9 A;  2E7G A;  4DCV A;  4PUG A;  4DV6 C;  4DCS A;  3L8C A;  4PZP A;  2KZ0 A;  3UX2 A;  5T8S A;  2AYA A;  1VLA A;  2VQE C;  4DUZ C;  2KZF A;  1FLO A;  4DV5 C;  4OYC A;  5JRH A;  1VEH A;  4LF4 C;  1FUG A;  4K0B A;  1XNQ C;  4FUQ A;  3CW8 X;  1LCI A;  4L2Z A;  2M5O A;  2Z51 A;  3R44 A;  1J5E C;  4GKJ C;  2Y4O A;  3AF5 A;  5ADZ A;  2QW0 X;  4DR1 C;  3N2Q A;  1USP B;  4JM1 A;  4JI5 C;  1IBK C;  4LFC C;  3GR0 A;  1PA4 A;  2P2B A;  1HNW C;  1WH9 A;  3G7S A;  3DLP X;  4DV3 C;  5K85 A;  4RVO A;  3IPL A;  5BUQ A;  1RG9 A;  5BUS A;  4KHP C;  1T5H X;  3LNV A;  5CZV A;  3IML A;  4BBY A;  4L4Q A;  5AE1 A;  3GPC A;  4GKK C;  4LF6 C;  1MDF A;  4R1L A;  1XNR C;  3UX3 A;  5BST A;  3DHV A;  2D1T A;  3VNS A;  5K8F A;  4JI7 C;  4MH4 A;  3ETC A;  2UUC C;  4LF7 C;  2UU9 C;  4NXN C;  1N32 C;  4DR4 C;  3PBK A;  4LFB C;  1QWI A;  3CJE A;  4DR7 C;  2E0G A;  1XRC A;  3FCC A;  2D27 A;  2ASB A;  1ML8 A;  2PRO A;  2V7B A;  5KYV A;  1MKY A;  5BUR A;  1P7L A;  2UUA C;  1PU1 A;  4DV0 C;  1MXB A;  4IZ6 A;  1NY8 A;  2E8C A;  3E7W A; 
#chains in the Genus database with same CATH homology
 1ZB9 A;  3EER A;  1L2F A;  3RG2 A;  4DR2 C;  4NDN A;  4KTT A;  1V26 A;  4DV7 C;  2PT7 G;  3FCE A;  1YJ7 A;  3H2T A;  4B3M C;  4ZJZ A;  5AE3 A;  1V25 A;  4JI2 C;  3I08 A;  4WV3 A;  5CZX A;  3T1H C;  5LMN C;  3TDE A;  2OPL B;  1T5D X;  1ULT A;  3TQI A;  4BSZ A;  2ONF A;  4KTV A;  2UXD C;  1IBL C;  2P2Q A;  2WD9 A;  3VNQ A;  4EAT A;  3A9V A;  1XMQ C;  3EQ6 A;  4B3T C;  4R0M A;  1FJG C;  2D1R A;  5KEI A;  1IBM C;  2UXB C;  1K0R A;  2YCB A;  4JI8 C;  3UOW A;  4I9G A;  2WP0 C;  3R9X A;  1N33 C;  1O90 A;  4DR5 C;  3NPD A;  4B3S C;  5BSW A;  3PES A;  4BC7 A;  1ZB8 A;  3A4I A;  4ODJ A;  2P2F A;  2QL8 A;  3GR1 A;  2XR1 A;  2D28 C;  3IEU A;  4PHT A;  4D56 A;  1GPM A;  4DCT A;  4D4I A;  4DV4 C;  4YHH C;  4X65 C;  3N54 B;  5LMU C;  3C5E A;  5IT9 D;  5A2Q D;  3R9W A;  4K0K C;  4FTF A;  3E7X A;  1XRA A;  4R1M A;  3JAM D;  3NYR A;  4GXQ A;  4D4G A;  4AQY C;  3A9U A;  1XRB A;  3LGX A;  4L7I A;  4JYA C;  3UZ0 A;  5IWA C;  4OXI A;  4D57 A;  4I9F A;  5FLX D;  4BCA A;  2QVX X;  1PG4 A;  1HH2 P;  4MTN A;  4LF9 C;  1MXA A;  4FUT A;  1MXC A;  5BR8 C;  4RLF A;  1HNZ C;  3OTO C;  4X64 C;  1XMO C;  4GXR A;  4G36 A;  1N2F A;  4RM3 A;  3NYQ A;  1JOS A;  2P20 A;  3SO4 A;  4DR3 C;  2VQF C;  2HJG A;  1MD9 A;  2ATW A;  2VSQ A;  1RY2 A;  1USP A;  3PRO C;  4DR6 C;  2E5L C;  5A1G A;  1N36 C;  3DAY A;  4DUY C;  4ZLP A;  2F4V C;  5DV9 A;  2Y27 A;  4RVN A;  2OO4 A;  2DYJ A;  4G1I A;  4LF8 C;  2D7V A;  3KXW A;  2EGT A;  4BC9 A;  3RV2 A;  4NXM C;  1HR0 C;  1BA3 A;  2Y4N A;  3S82 A;  4JI6 C;  4XX2 A;  3IEV A;  2DPL A;  4DV2 C;  1O9T A;  5BSR A;  5AE2 A;  4LFA C;  2BH1 X;  4U5Y D;  4DCU A;  2YWC A;  1O93 A;  1O92 A;  1KKG A;  2E8F A;  4JI4 C;  2E8E A;  3ETO A;  1LQL A;  5E7Q A;  5T8T A;  2JMP A;  4ISB A;  3B7W A;  2P2M A;  4YY3 C;  3J80 D;  4NOZ A;  2OBV A;  4WS9 A;  4DG9 A;  4B3R C;  3VNR A;  4LE5 A;  2P2J A;  4OX9 C;  4RMN A;  4TPS B;  4G37 A;  4RM2 A;  4LF5 C;  1WF3 A;  5H9U A;  3GKU A;  1EGA A;  2UUB C;  3LUS A;  2D1Q A;  2BJO A;  3TUF A;  2P02 A;  4IR7 A;  3NI2 A;  4HPV A;  5A1I A;  2CXC A;  2VZE A;  4JI1 C;  5GTD A;  1UKK A;  4JI3 C;  4DG8 A;  3LAX A;  1PG3 A;  2QVZ X;  5BSM A;  3J81 D;  1N34 C;  3T1Y C;  2YWB A;  3L95 X;  1MDB A;  5KYT A;  4JV5 C;  2UXC C;  4GS5 A;  4JI0 C;  4X66 C;  4DV1 C;  2CY1 A;  5BSV A;  1AMU A;  1NYE A;  2OPL A;  1I94 C;  1HNX C;  2QVY X;  3I07 A;  4X62 C;  2D1S A;  2HHH C;  4PRO C;  4RLQ A;  2PN2 A;  5BSU A;  5IFI A;  2ZM6 C;  3AF6 A;  1QM4 A;  5A19 A;  3CW9 A;  2E7G A;  4DCV A;  4DV6 C;  4DCS A;  3L8C A;  4PZP A;  2VQE C;  5T8S A;  2AYA A;  1VLA A;  4DUZ C;  2KZF A;  4DV5 C;  4OYC A;  5JRH A;  4LF4 C;  1FUG A;  4K0B A;  1XNQ C;  4FUQ A;  3CW8 X;  1LCI A;  4L2Z A;  3R44 A;  1J5E C;  4GKJ C;  2Y4O A;  3AF5 A;  5ADZ A;  2QW0 X;  4DR1 C;  3N2Q A;  1USP B;  4JM1 A;  4JI5 C;  1IBK C;  4LFC C;  3GR0 A;  1PA4 A;  2P2B A;  1HNW C;  1WH9 A;  3G7S A;  3DLP X;  4DV3 C;  5K85 A;  4RVO A;  3IPL A;  5BUQ A;  1RG9 A;  5BUS A;  4KHP C;  1T5H X;  3LNV A;  5CZV A;  3IML A;  4BBY A;  4L4Q A;  5AE1 A;  3GPC A;  4GKK C;  4LF6 C;  1MDF A;  4R1L A;  1XNR C;  5BST A;  3DHV A;  2D1T A;  3VNS A;  5K8F A;  4JI7 C;  4MH4 A;  3ETC A;  2UUC C;  4LF7 C;  2UU9 C;  4NXN C;  1N32 C;  4DR4 C;  3PBK A;  4LFB C;  1QWI A;  3CJE A;  4DR7 C;  2E0G A;  1XRC A;  3FCC A;  2D27 A;  2ASB A;  1ML8 A;  2PRO A;  2V7B A;  5KYV A;  1MKY A;  5BUR A;  1P7L A;  2UUA C;  4DV0 C;  1MXB A;  4IZ6 A;  2E8C A;  3E7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...