2KZFA

Solution nmr structure of the thermotoga maritima protein tm0855 a putative ribosome binding factor a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
GMNPAYRKAMLESEIQKLLMEALQQLRDPRLKKDFVTFSRVELSKDKRYADVYVSFLGTPEERKETVEILNRAKGFFRTFIAKNLRLYVAPEIRFYEDKGIEASVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords Ribosome-binding factor A
publication title Solution NMR structure of the thermotoga maritima protein TM0855
rcsb
source organism Thermotoga maritima
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2010-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2kzfA00
4DCSA 1XMOC 1PA4A 1IBLC 3T1HC 4K0KC 1FJGC 4YHHC 1N32C 4GKKC 2KZFA 4KHPC 2UXBC 4JI6C 3AF6A 5BR8C 4MH4A 4DR1C 4MTNA 1IBKC 2UUBC 1USPB 4NXMC 4X62C 2HJGA 4LF9C 1K0RA 3IEUA 4X64C 1MKYA 4B3MC 4XX2A 4NOZA 3GKUA 1J5EC 4DV5C 4DV1C 2QL8A 4DUYC 3T1YC 4B3TC 1HNWC 4DR5C 1ML8A 4DV3C 1QWIA 1N34C 2ASBA 4YY3C 4DR6C 4GKJC 2XR1A 2ONFA 3AF5A 3OTOC 1HNZC 4X65C 2E5LC 4JI2C 5LMUC 2VQEC 4DCUA 2HHHC 1EGAA 4JYAC 3EERA 3J81D 3R9WA 4DR7C 2YCBA 4OX9C 1NYEA 1HH2P 2UXCC 4DR2C 1UKKA 4DUZC 2PT7G 4DV6C 2CY1A 3I07A 1JOSA 2UUAC 2BJOA 5IT9D 4JI3C 1XNQC 4LF4C 2ATWA 4X66C 5FLXD 4JV5C 2F4VC 1WF3A 1N2FA 3LUSA 4JI7C 2E8CA 2D7VA 4DR4C 1I94C 1KKGA 4JI4C 1LQLA 3R9XA 2CXCA 2DYJA 4DCTA 1XMQC 4JI8C 5LMNC 2ZM6C 2UU9C 1USPA 1N36C 4LF6C 1VLAA 4JI0C 2OPLA 4LFCC 2UUCC 2EGTA 4JI5C 4LF7C 4JI1C 4LF5C 3CJEA 1ZB9A 2E8FA 4DV2C 4BSZA 4DR3C 1HNXC 4LF8C 2PN2A 2JMPA 4LFAC 1HR0C 1WH9A 4DCVA 1IBMC 5A2QD 5IWAC 4LFBC 4NXNC 2OPLB 3JAMD 4AQYC 4DV4C 4DV7C 2E7GA 1ZB8A 1L2FA 2E8EA 2VQFC 1XNRC 3J80D 1N33C 3IEVA 2UXDC 4DV0C 4B3RC 4B3SC
chains in the Genus database with same CATH superfamily
4L4QA 1PA4A 4K0KC 1QM4A 3GPCA 1V26A 4KHPC 1FLOA 3EQ6A 3AF6A 4MH4A 3L95X 2UUBC 1USPB 4NXMC 2Y4OA 2HJGA 5AE2A 3CW8X 4B3MC 4XX2A 5A19A 3E7WA 3T1YC 1ML8A 5T8SA 3L8CA 4FUTA 4I9GA 5DV9A 5H9UA 2DHMA 1HNZC 5LMUC 2VQEC 4DCUA 5KYTA 1EGAA 4RVNA 4D4IA 4DR7C 3ETOA 2P20A 2KDNA 1UKKA 2AYAA 3I07A 3H2TA 2D1TA 3FCCA 3GR1A 2ATWA 2D7VA 2PROA 5BUSA 4JI8C 4EATA 5LMNC 5LCIA 4JM1A 1USPA 1M6XA 3VNQA 4PUHA 2E0GA 4PHTA 1O9TA 4RM2A 1MDBA 1ZB9A 2E8FA 4ISBA 4DR3C 1IB8A 4R1LA 1HNXC 1VEHA 1O90A 2JMPA 4R1MA 4LFAC 2OBVA 1HR0C 1WH9A 2D28C 3I08A 3DLPX 2WD9A 3AY0A 2OPLB 4DV4C 3A9UA 1XNRC 3IMLA 3TDEA 1XMOC 4GXQA 1FJGC 3N2QA 1N32C 5BURA 4GKKC 2KZFA 2BH1X 3LGXA 4JI6C 1IBKC 4LF9C 1K0RA 3IEUA 4D4GA 5BSVA 4X64C 4RLFA 1V25A 3TQIA 3FCEA 4DUYC 2P02A 4B3TC 4DG8A 2P2JA 4DR6C 4G1IA 1V60A 5A1IA 5ADZA 4GKJC 4K0BA 3AF5A 3B7WA 3VNSA 1T5DX 5BUQA 1P7LA 2VZEA 5JRHA 2MCQA 1O92A 4OX9C 3UZ0A 1HH2P 2OO4A 2UXCC 5CZXA 4DR2C 4DUZC 2PT7G 1P4EA 2Y4NA 1MXAA 1PG4A 4BC9A 1WCJA 4JV5C 4RVOA 2F4VC 1N2FA 2E8CA 2P2BA 4DR4C 1XMQC 3NI2A 2MM9A 2UU9C 5BSUA 3UOWA 4RM3A 4JI0C 4LFCC 1XHJA 2WP0C 4G36A 4JI5C 4JI1C 3VNRA 4DV2C 4BSZA 4LF8C 2PN2A 5K8FA 5T8TA 2YWCA 5BSWA 4AQYC 3C5EA 4BCAA 4DV7C 2DPLA 2Z51A 2VQFC 1PU1A 5KYVA 3J80D 5A1GA 4BBYA 2UXDC 1XS3A 1YJ7A 1T5HX 2D1RA 4B3RC 3T1HC 2QVZX 2CU6A 2D1SA 2KZ0A 4GXRA 4DR1C 4MTNA 1XRAA 3CQ1A 3PESA 3ETCA 3PBKA 1O93A 4HPVA 4DG9A 3DHVA 1BA3A 4G37A 1J5EC 4DV5C 3A26A 4WV3A 4DR5C 1QWIA 1N34C 3NYRA 3CQ3A 2Y27A 4FTFA 3DAYA 4L2ZA 2E5LC 4NDNA 3S82A 4PROC 3EERA 3E7XA 1XRBA 2YCBA 5E7QA 2QVXX 4WS9A 3LNOA 2QW0X 2V7BA 2CY1A 1LCIA 3GR0A 4D57A 2UUAC 4JI3C 3LUSA 1KKGA 2P2QA 1LQLA 3R9XA 2YX1A 3NYQA 2DYJA 4DCTA 4OXIA 2ZM6C 1N36C 1MD9A 2JNVA 3A4IA 2OPLA 2UUCC 4IZ6A 3TR3A 4LF7C 1RY2A 3CJEA 2NCLA 5KEIA 1IBMC 5A2QD 4ZJZA 4ODJA 5BSTA 1FUGA 5AE3A 4LFBC 4NXNC 5AE1A 3JAMD 5K85A 3K6RA 1M6XC 2E7GA 3IPLA 1ZB8A 2P2MA 1L2FA 2E8EA 4PUIA 3IEVA 3RV2A 1N33C 4B3SC 4I9FA 4DCSA 1IBLC 3TUFA 5GTDA 4YHHC 2UXBC 5BR8C 2ZZNA 3A9VA 1GPMA 4BC7A 4ZLPA 3SO4A 4KTTA 4X62C 3LNVA 5IFIA 4GS5A 3RG2A 1MKYA 4NOZA 3GKUA 2VSQA 3PROC 4DV1C 2QL8A 3UX3A 4L7IA 1HNWC 5BSRA 3G7SA 4FUQA 4DV3C 3O2EA 2ASBA 4YY3C 3CQ2A 4U5YD 2XR1A 2ONFA 3OTOC 3CW9A 4PZPA 3UEBA 4X65C 4JI2C 3KXWA 1MXCA 2HHHC 4JYAC 3J81D 5CZVA 3R9WA 3A25A 2D27A 1NYEA 4OYCA 1MXBA 4DV6C 1JOSA 3LAXA 3N54B 2BJOA 5IT9D 1TH5A 2P2FA 1XNQC 4LF4C 1AMUA 4X66C 5FLXD 4IR7A 4LE5A 1WF3A 4JI7C 1I94C 4JI4C 2D1QA 2CXCA 1ULTA 5BSMA 4D56A 4LF6C 1PG3A 1VLAA 1MDFA 4RMNA 3UX2A 1P4EC 3NPDA 4RLQA 2QVYX 4R0MA 2M5OA 3R44A 2EGTA 4LF5C 1RG9A 2YWBA 1XRCA 1UWDA 4DCVA 4KTVA 5IWAC 2ZZMA 1NY8A 2MMAB 4TPSB 2M5HA 4DV0C 4PUGA
chains in the Genus database with same CATH topology
4L4QA 1PA4A 4K0KC 1QM4A 3GPCA 1V26A 4KHPC 3EQ6A 3AF6A 4MH4A 3L95X 2UUBC 1USPB 4NXMC 2Y4OA 2HJGA 5AE2A 3CW8X 4B3MC 4XX2A 5A19A 3E7WA 3T1YC 1ML8A 5T8SA 3L8CA 4FUTA 4I9GA 5DV9A 5H9UA 1HNZC 5LMUC 2VQEC 4DCUA 5KYTA 1EGAA 4RVNA 4D4IA 4DR7C 3ETOA 2P20A 1UKKA 2AYAA 3I07A 3H2TA 2D1TA 3FCCA 3GR1A 2ATWA 2D7VA 2PROA 5BUSA 4JI8C 4EATA 5LMNC 4JM1A 1USPA 3VNQA 2E0GA 4PHTA 1O9TA 4RM2A 1MDBA 1ZB9A 2E8FA 4ISBA 4DR3C 4R1LA 1HNXC 1O90A 2JMPA 4R1MA 4LFAC 2OBVA 1HR0C 1WH9A 2D28C 3I08A 3DLPX 2WD9A 2OPLB 4DV4C 3A9UA 1XNRC 3IMLA 3TDEA 1XMOC 4GXQA 1FJGC 3N2QA 1N32C 5BURA 4GKKC 2KZFA 2BH1X 3LGXA 4JI6C 1IBKC 4LF9C 1K0RA 3IEUA 4D4GA 5BSVA 4X64C 4RLFA 1V25A 3TQIA 3FCEA 4DUYC 2P02A 4B3TC 4DG8A 2P2JA 4DR6C 4G1IA 5A1IA 5ADZA 4GKJC 4K0BA 3AF5A 3B7WA 3VNSA 1T5DX 5BUQA 1P7LA 2VZEA 5JRHA 1O92A 4OX9C 3UZ0A 1HH2P 2OO4A 2UXCC 5CZXA 4DR2C 4DUZC 2PT7G 2Y4NA 1MXAA 1PG4A 4BC9A 4JV5C 4RVOA 2F4VC 1N2FA 2E8CA 2P2BA 4DR4C 1XMQC 3NI2A 2UU9C 5BSUA 3UOWA 4RM3A 4JI0C 4LFCC 4G36A 2WP0C 4JI5C 4JI1C 3VNRA 4DV2C 4BSZA 4LF8C 2PN2A 5K8FA 5T8TA 2YWCA 5BSWA 4AQYC 3C5EA 4BCAA 4DV7C 2DPLA 2VQFC 5KYVA 3J80D 5A1GA 4BBYA 2UXDC 1YJ7A 1T5HX 2D1RA 4B3RC 3T1HC 2QVZX 2D1SA 4GXRA 4DR1C 4MTNA 1XRAA 3PESA 3ETCA 3PBKA 1O93A 4HPVA 4DG9A 3DHVA 1BA3A 4G37A 1J5EC 4DV5C 4WV3A 4DR5C 1QWIA 1N34C 3NYRA 2Y27A 4FTFA 3DAYA 4L2ZA 2E5LC 4NDNA 3S82A 4PROC 3EERA 3E7XA 1XRBA 2YCBA 5E7QA 2QVXX 4WS9A 2QW0X 2V7BA 2CY1A 1LCIA 3GR0A 4D57A 2UUAC 4JI3C 3LUSA 1KKGA 2P2QA 1LQLA 3R9XA 3NYQA 2DYJA 4DCTA 4OXIA 2ZM6C 1N36C 1MD9A 3A4IA 2OPLA 2UUCC 4IZ6A 4LF7C 1RY2A 3CJEA 5KEIA 1IBMC 5A2QD 4ZJZA 4ODJA 5BSTA 1FUGA 5AE3A 4LFBC 4NXNC 5AE1A 3JAMD 5K85A 2E7GA 3IPLA 1ZB8A 2P2MA 1L2FA 2E8EA 1N33C 3IEVA 3RV2A 4B3SC 4I9FA 4DCSA 1IBLC 3TUFA 5GTDA 4YHHC 2UXBC 5BR8C 3A9VA 1GPMA 4BC7A 4ZLPA 3SO4A 4KTTA 4X62C 3LNVA 5IFIA 4GS5A 3RG2A 1MKYA 4NOZA 3GKUA 2VSQA 3PROC 4DV1C 2QL8A 4L7IA 1HNWC 5BSRA 3G7SA 4FUQA 4DV3C 2ASBA 4YY3C 4U5YD 2XR1A 2ONFA 3OTOC 3CW9A 4PZPA 4X65C 4JI2C 3KXWA 1MXCA 2HHHC 4JYAC 3J81D 5CZVA 3R9WA 2D27A 1NYEA 4OYCA 1MXBA 4DV6C 1JOSA 3LAXA 3N54B 2BJOA 5IT9D 2P2FA 1XNQC 4LF4C 1AMUA 4X66C 5FLXD 4IR7A 4LE5A 1WF3A 4JI7C 1I94C 4JI4C 2D1QA 2CXCA 1ULTA 5BSMA 4D56A 4LF6C 1PG3A 1VLAA 1MDFA 4RMNA 3NPDA 2QVYX 4RLQA 4R0MA 3R44A 2EGTA 4LF5C 1RG9A 2YWBA 1XRCA 4DCVA 4KTVA 5IWAC 4TPSB 4DV0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCS A;  1XMO C;  1PA4 A;  1IBL C;  3T1H C;  4K0K C;  1FJG C;  4YHH C;  1N32 C;  4GKK C;  2KZF A;  4KHP C;  2UXB C;  4JI6 C;  3AF6 A;  5BR8 C;  4MH4 A;  4DR1 C;  4MTN A;  1IBK C;  2UUB C;  1USP B;  4NXM C;  4X62 C;  2HJG A;  4LF9 C;  1K0R A;  3IEU A;  4X64 C;  1MKY A;  4B3M C;  4XX2 A;  4NOZ A;  3GKU A;  1J5E C;  4DV5 C;  4DV1 C;  2QL8 A;  4DUY C;  3T1Y C;  4B3T C;  1HNW C;  4DR5 C;  1ML8 A;  4DV3 C;  1QWI A;  1N34 C;  2ASB A;  4YY3 C;  4DR6 C;  4GKJ C;  2XR1 A;  2ONF A;  3AF5 A;  3OTO C;  1HNZ C;  4X65 C;  2E5L C;  4JI2 C;  5LMU C;  2VQE C;  4DCU A;  2HHH C;  1EGA A;  4JYA C;  3EER A;  3J81 D;  3R9W A;  4DR7 C;  2YCB A;  4OX9 C;  1NYE A;  1HH2 P;  2UXC C;  4DR2 C;  1UKK A;  4DUZ C;  2PT7 G;  4DV6 C;  2CY1 A;  3I07 A;  1JOS A;  2UUA C;  2BJO A;  5IT9 D;  4JI3 C;  1XNQ C;  4LF4 C;  2ATW A;  4X66 C;  5FLX D;  4JV5 C;  2F4V C;  1WF3 A;  1N2F A;  3LUS A;  4JI7 C;  2E8C A;  2D7V A;  4DR4 C;  1I94 C;  1KKG A;  4JI4 C;  1LQL A;  3R9X A;  2CXC A;  2DYJ A;  4DCT A;  1XMQ C;  4JI8 C;  5LMN C;  2ZM6 C;  2UU9 C;  1USP A;  1N36 C;  4LF6 C;  1VLA A;  4JI0 C;  2OPL A;  4LFC C;  2UUC C;  2EGT A;  4JI5 C;  4LF7 C;  4JI1 C;  4LF5 C;  3CJE A;  1ZB9 A;  2E8F A;  4DV2 C;  4BSZ A;  4DR3 C;  1HNX C;  4LF8 C;  2PN2 A;  2JMP A;  4LFA C;  1HR0 C;  1WH9 A;  4DCV A;  1IBM C;  5A2Q D;  5IWA C;  4LFB C;  4NXN C;  2OPL B;  3JAM D;  4AQY C;  4DV4 C;  4DV7 C;  2E7G A;  1ZB8 A;  1L2F A;  2E8E A;  2VQF C;  1XNR C;  3J80 D;  1N33 C;  3IEV A;  2UXD C;  4DV0 C;  4B3R C;  4B3S C; 
#chains in the Genus database with same CATH topology
 4L4Q A;  1PA4 A;  4K0K C;  1QM4 A;  3GPC A;  1V26 A;  4KHP C;  1FLO A;  3EQ6 A;  3AF6 A;  4MH4 A;  3L95 X;  2UUB C;  1USP B;  4NXM C;  2Y4O A;  2HJG A;  5AE2 A;  3CW8 X;  4B3M C;  4XX2 A;  5A19 A;  3E7W A;  3T1Y C;  1ML8 A;  5T8S A;  3L8C A;  4FUT A;  4I9G A;  5DV9 A;  5H9U A;  2DHM A;  1HNZ C;  5LMU C;  2VQE C;  4DCU A;  5KYT A;  1EGA A;  4RVN A;  4D4I A;  4DR7 C;  3ETO A;  2P20 A;  2KDN A;  1UKK A;  2AYA A;  3I07 A;  3H2T A;  2D1T A;  3FCC A;  3GR1 A;  2ATW A;  2D7V A;  2PRO A;  5BUS A;  4JI8 C;  4EAT A;  5LMN C;  5LCI A;  4JM1 A;  1USP A;  1M6X A;  3VNQ A;  4PUH A;  2E0G A;  4PHT A;  1O9T A;  4RM2 A;  1MDB A;  1ZB9 A;  2E8F A;  4ISB A;  4DR3 C;  1IB8 A;  4R1L A;  1HNX C;  1VEH A;  1O90 A;  2JMP A;  4R1M A;  4LFA C;  2OBV A;  1HR0 C;  1WH9 A;  2D28 C;  3I08 A;  3DLP X;  2WD9 A;  3AY0 A;  2OPL B;  4DV4 C;  3A9U A;  1XNR C;  3IML A;  3TDE A;  1XMO C;  4GXQ A;  1FJG C;  3N2Q A;  1N32 C;  5BUR A;  4GKK C;  2KZF A;  2BH1 X;  3LGX A;  4JI6 C;  1IBK C;  4LF9 C;  1K0R A;  3IEU A;  4D4G A;  5BSV A;  4X64 C;  4RLF A;  1V25 A;  3TQI A;  3FCE A;  4DUY C;  2P02 A;  4B3T C;  4DG8 A;  2P2J A;  4DR6 C;  4G1I A;  1V60 A;  5A1I A;  5ADZ A;  4GKJ C;  4K0B A;  3AF5 A;  3B7W A;  3VNS A;  1T5D X;  5BUQ A;  1P7L A;  2VZE A;  5JRH A;  2MCQ A;  1O92 A;  4OX9 C;  3UZ0 A;  1HH2 P;  2OO4 A;  2UXC C;  5CZX A;  4DR2 C;  4DUZ C;  2PT7 G;  1P4E A;  2Y4N A;  1MXA A;  1PG4 A;  4BC9 A;  1WCJ A;  4JV5 C;  4RVO A;  2F4V C;  1N2F A;  2E8C A;  2P2B A;  4DR4 C;  1XMQ C;  3NI2 A;  2MM9 A;  2UU9 C;  5BSU A;  3UOW A;  4RM3 A;  4JI0 C;  4LFC C;  1XHJ A;  2WP0 C;  4G36 A;  4JI5 C;  4JI1 C;  3VNR A;  4DV2 C;  4BSZ A;  4LF8 C;  2PN2 A;  5K8F A;  5T8T A;  2YWC A;  5BSW A;  4AQY C;  3C5E A;  4BCA A;  4DV7 C;  2DPL A;  2Z51 A;  2VQF C;  1PU1 A;  5KYV A;  3J80 D;  5A1G A;  4BBY A;  2UXD C;  1XS3 A;  1YJ7 A;  1T5H X;  2D1R A;  4B3R C;  3T1H C;  2QVZ X;  2CU6 A;  2D1S A;  2KZ0 A;  4GXR A;  4DR1 C;  4MTN A;  1XRA A;  3CQ1 A;  3PES A;  3ETC A;  3PBK A;  1O93 A;  4HPV A;  4DG9 A;  3DHV A;  1BA3 A;  4G37 A;  1J5E C;  4DV5 C;  3A26 A;  4WV3 A;  4DR5 C;  1QWI A;  1N34 C;  3NYR A;  3CQ3 A;  2Y27 A;  4FTF A;  3DAY A;  4L2Z A;  2E5L C;  4NDN A;  3S82 A;  4PRO C;  3EER A;  3E7X A;  1XRB A;  2YCB A;  5E7Q A;  2QVX X;  4WS9 A;  3LNO A;  2QW0 X;  2V7B A;  2CY1 A;  1LCI A;  3GR0 A;  4D57 A;  2UUA C;  4JI3 C;  3LUS A;  1KKG A;  2P2Q A;  1LQL A;  3R9X A;  2YX1 A;  3NYQ A;  2DYJ A;  4DCT A;  4OXI A;  2ZM6 C;  1N36 C;  1MD9 A;  2JNV A;  3A4I A;  2OPL A;  2UUC C;  4IZ6 A;  3TR3 A;  4LF7 C;  1RY2 A;  3CJE A;  2NCL A;  5KEI A;  1IBM C;  5A2Q D;  4ZJZ A;  4ODJ A;  5BST A;  1FUG A;  5AE3 A;  4LFB C;  4NXN C;  5AE1 A;  3JAM D;  5K85 A;  3K6R A;  1M6X C;  2E7G A;  3IPL A;  1ZB8 A;  2P2M A;  1L2F A;  2E8E A;  4PUI A;  3IEV A;  3RV2 A;  1N33 C;  4B3S C;  4I9F A;  4DCS A;  1IBL C;  3TUF A;  5GTD A;  4YHH C;  2UXB C;  5BR8 C;  2ZZN A;  3A9V A;  1GPM A;  4BC7 A;  4ZLP A;  3SO4 A;  4KTT A;  4X62 C;  3LNV A;  5IFI A;  4GS5 A;  3RG2 A;  1MKY A;  4NOZ A;  3GKU A;  2VSQ A;  3PRO C;  4DV1 C;  2QL8 A;  3UX3 A;  4L7I A;  1HNW C;  5BSR A;  3G7S A;  4FUQ A;  4DV3 C;  3O2E A;  2ASB A;  4YY3 C;  3CQ2 A;  4U5Y D;  2XR1 A;  2ONF A;  3OTO C;  3CW9 A;  4PZP A;  3UEB A;  4X65 C;  4JI2 C;  3KXW A;  1MXC A;  2HHH C;  4JYA C;  3J81 D;  5CZV A;  3R9W A;  3A25 A;  2D27 A;  1NYE A;  4OYC A;  1MXB A;  4DV6 C;  1JOS A;  3LAX A;  3N54 B;  2BJO A;  5IT9 D;  1TH5 A;  2P2F A;  1XNQ C;  4LF4 C;  1AMU A;  4X66 C;  5FLX D;  4IR7 A;  4LE5 A;  1WF3 A;  4JI7 C;  1I94 C;  4JI4 C;  2D1Q A;  2CXC A;  1ULT A;  5BSM A;  4D56 A;  4LF6 C;  1PG3 A;  1VLA A;  1MDF A;  4RMN A;  3UX2 A;  1P4E C;  3NPD A;  4RLQ A;  2QVY X;  4R0M A;  2M5O A;  3R44 A;  2EGT A;  4LF5 C;  1RG9 A;  2YWB A;  1XRC A;  1UWD A;  4DCV A;  4KTV A;  5IWA C;  2ZZM A;  1NY8 A;  2MMA B;  4TPS B;  2M5H A;  4DV0 C;  4PUG A; 
#chains in the Genus database with same CATH homology
 4L4Q A;  1PA4 A;  4K0K C;  1QM4 A;  3GPC A;  1V26 A;  4KHP C;  3EQ6 A;  3AF6 A;  4MH4 A;  3L95 X;  2UUB C;  1USP B;  4NXM C;  2Y4O A;  2HJG A;  5AE2 A;  3CW8 X;  4B3M C;  4XX2 A;  5A19 A;  3E7W A;  3T1Y C;  1ML8 A;  5T8S A;  3L8C A;  4FUT A;  4I9G A;  5DV9 A;  5H9U A;  1HNZ C;  5LMU C;  2VQE C;  4DCU A;  5KYT A;  1EGA A;  4RVN A;  4D4I A;  4DR7 C;  3ETO A;  2P20 A;  1UKK A;  2AYA A;  3I07 A;  3H2T A;  2D1T A;  3FCC A;  3GR1 A;  2ATW A;  2D7V A;  2PRO A;  5BUS A;  4JI8 C;  4EAT A;  5LMN C;  4JM1 A;  1USP A;  3VNQ A;  2E0G A;  4PHT A;  1O9T A;  4RM2 A;  1MDB A;  1ZB9 A;  2E8F A;  4ISB A;  4DR3 C;  4R1L A;  1HNX C;  1O90 A;  2JMP A;  4R1M A;  4LFA C;  2OBV A;  1HR0 C;  1WH9 A;  2D28 C;  3I08 A;  3DLP X;  2WD9 A;  2OPL B;  4DV4 C;  3A9U A;  1XNR C;  3IML A;  3TDE A;  1XMO C;  4GXQ A;  1FJG C;  3N2Q A;  1N32 C;  5BUR A;  4GKK C;  2KZF A;  2BH1 X;  3LGX A;  4JI6 C;  1IBK C;  4LF9 C;  1K0R A;  3IEU A;  4D4G A;  5BSV A;  4X64 C;  4RLF A;  1V25 A;  3TQI A;  3FCE A;  4DUY C;  2P02 A;  4B3T C;  4DG8 A;  2P2J A;  4DR6 C;  4G1I A;  5A1I A;  5ADZ A;  4GKJ C;  4K0B A;  3AF5 A;  3B7W A;  3VNS A;  1T5D X;  5BUQ A;  1P7L A;  2VZE A;  5JRH A;  1O92 A;  4OX9 C;  3UZ0 A;  1HH2 P;  2OO4 A;  2UXC C;  5CZX A;  4DR2 C;  4DUZ C;  2PT7 G;  2Y4N A;  1MXA A;  1PG4 A;  4BC9 A;  4JV5 C;  4RVO A;  2F4V C;  1N2F A;  2E8C A;  2P2B A;  4DR4 C;  1XMQ C;  3NI2 A;  2UU9 C;  5BSU A;  3UOW A;  4RM3 A;  4JI0 C;  4LFC C;  4G36 A;  2WP0 C;  4JI5 C;  4JI1 C;  3VNR A;  4DV2 C;  4BSZ A;  4LF8 C;  2PN2 A;  5K8F A;  5T8T A;  2YWC A;  5BSW A;  4AQY C;  3C5E A;  4BCA A;  4DV7 C;  2DPL A;  2VQF C;  5KYV A;  3J80 D;  5A1G A;  4BBY A;  2UXD C;  1YJ7 A;  1T5H X;  2D1R A;  4B3R C;  3T1H C;  2QVZ X;  2D1S A;  4GXR A;  4DR1 C;  4MTN A;  1XRA A;  3PES A;  3ETC A;  3PBK A;  1O93 A;  4HPV A;  4DG9 A;  3DHV A;  1BA3 A;  4G37 A;  1J5E C;  4DV5 C;  4WV3 A;  4DR5 C;  1QWI A;  1N34 C;  3NYR A;  2Y27 A;  4FTF A;  3DAY A;  4L2Z A;  2E5L C;  4NDN A;  3S82 A;  4PRO C;  3EER A;  3E7X A;  1XRB A;  2YCB A;  5E7Q A;  2QVX X;  4WS9 A;  2QW0 X;  2V7B A;  2CY1 A;  1LCI A;  3GR0 A;  4D57 A;  2UUA C;  4JI3 C;  3LUS A;  1KKG A;  2P2Q A;  1LQL A;  3R9X A;  3NYQ A;  2DYJ A;  4DCT A;  4OXI A;  2ZM6 C;  1N36 C;  1MD9 A;  3A4I A;  2OPL A;  2UUC C;  4IZ6 A;  4LF7 C;  1RY2 A;  3CJE A;  5KEI A;  1IBM C;  5A2Q D;  4ZJZ A;  4ODJ A;  5BST A;  1FUG A;  5AE3 A;  4LFB C;  4NXN C;  5AE1 A;  3JAM D;  5K85 A;  2E7G A;  3IPL A;  1ZB8 A;  2P2M A;  1L2F A;  2E8E A;  1N33 C;  3IEV A;  3RV2 A;  4B3S C;  4I9F A;  4DCS A;  1IBL C;  3TUF A;  5GTD A;  4YHH C;  2UXB C;  5BR8 C;  3A9V A;  1GPM A;  4BC7 A;  4ZLP A;  3SO4 A;  4KTT A;  4X62 C;  3LNV A;  5IFI A;  4GS5 A;  3RG2 A;  1MKY A;  4NOZ A;  3GKU A;  2VSQ A;  3PRO C;  4DV1 C;  2QL8 A;  4L7I A;  1HNW C;  5BSR A;  3G7S A;  4FUQ A;  4DV3 C;  2ASB A;  4YY3 C;  4U5Y D;  2XR1 A;  2ONF A;  3OTO C;  3CW9 A;  4PZP A;  4X65 C;  4JI2 C;  3KXW A;  1MXC A;  2HHH C;  4JYA C;  3J81 D;  5CZV A;  3R9W A;  2D27 A;  1NYE A;  4OYC A;  1MXB A;  4DV6 C;  1JOS A;  3LAX A;  3N54 B;  2BJO A;  5IT9 D;  2P2F A;  1XNQ C;  4LF4 C;  1AMU A;  4X66 C;  5FLX D;  4IR7 A;  4LE5 A;  1WF3 A;  4JI7 C;  1I94 C;  4JI4 C;  2D1Q A;  2CXC A;  1ULT A;  5BSM A;  4D56 A;  4LF6 C;  1PG3 A;  1VLA A;  1MDF A;  4RMN A;  3NPD A;  2QVY X;  4RLQ A;  4R0M A;  3R44 A;  2EGT A;  4LF5 C;  1RG9 A;  2YWB A;  1XRC A;  4DCV A;  4KTV A;  5IWA C;  4TPS B;  4DV0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...