2KZFA

Solution nmr structure of the thermotoga maritima protein tm0855 a putative ribosome binding factor a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
GMNPAYRKAMLESEIQKLLMEALQQLRDPRLKKDFVTFSRVELSKDKRYADVYVSFLGTPEERKETVEILNRAKGFFRTFIAKNLRLYVAPEIRFYEDKGIEASVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the thermotoga maritima protein TM0855
rcsb
source organism Thermotoga maritima
molecule tags Ribosomal protein
molecule keywords Ribosome-binding factor A
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2010-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2kzfA00
5FLXD 1HH2P 4JI8C 1ZB8A 4LF7C 2UXBC 4JI4C 3EERA 4LF6C 4JI1C 4LFAC 5IWAC 4DV1C 4B3RC 1XMQC 4JI7C 4DV5C 1IBLC 4DV6C 4MH4A 1J5EC 2ZM6C 2XR1A 2ASBA 3IEVA 4MTNA 4LFBC 1WH9A 1JOSA 2HJGA 4KHPC 1XNQC 4DR4C 2CXCA 4JI2C 1NYEA 1WF3A 4LF8C 2UU9C 2UUCC 1EGAA 1K0RA 2UXCC 5BR8C 1USPA 3I07A 2EGTA 4DV2C 1ZB9A 1N2FA 2E8CA 4GKKC 4LF9C 4YY3C 4JI6C 4DR7C 5LMNC 4DCTA 2E8EA 2ONFA 4DCVA 2QL8A 3AF5A 4DUYC 4YHHC 4LF5C 2PT7G 1L2FA 2OPLA 1HR0C 3R9XA 4X65C 2HHHC 4NOZA 2E7GA 2E8FA 2JMPA 1UKKA 4DR3C 3CJEA 2VQFC 4B3MC 4DUZC 4JI5C 2KZFA 2D7VA 4X64C 2YCBA 3JAMD 4AQYC 4XX2A 2PN2A 2OPLB 4DCUA 1XNRC 1N32C 1XMOC 1HNXC 5A2QD 4JYAC 4OX9C 1VLAA 4NXNC 3J80D 2UXDC 1ML8A 1IBKC 1N33C 1USPB 1N36C 1KKGA 4DV7C 4BSZA 1LQLA 1QWIA 1FJGC 4X66C 2ATWA 2F4VC 4LF4C 1HNWC 2UUAC 4DCSA 2E5LC 4JI3C 4DR2C 1N34C 2BJOA 1IBMC 1MKYA 2CY1A 3R9WA 5IT9D 3IEUA 3J81D 2DYJA 3LUSA 4B3TC 4DV0C 2VQEC 3AF6A 4JV5C 3T1HC 4NXMC 2UUBC 4JI0C 3GKUA 5LMUC 4B3SC 4X62C 1I94C 3T1YC 4DR1C 1PA4A 4GKJC 1HNZC 4DV3C 4K0KC 4LFCC 4DR6C 4DR5C 4DV4C 3OTOC
chains in the Genus database with same CATH superfamily
5FLXD 3VNQA 4EATA 4JI8C 3A9UA 4ISBA 3GR0A 4LF7C 3E7WA 3EERA 5IWAC 4B3RC 5A1GA 4DV6C 3EQ6A 3IEVA 1BA3A 1UWDA 1WH9A 4LE5A 4RLFA 2ZZNA 4PROC 4PUHA 4L2ZA 4G37A 4G36A 5IFIA 2BH1X 2PROA 2EGTA 2E8CA 2M5HA 3DHVA 2E8EA 1M6XC 4NDNA 3AF5A 4OXIA 2QVZX 4TPSB 4LF5C 2KDNA 2HHHC 1WCJA 2E7GA 1XHJA 2VQFC 4B3MC 3LAXA 2CU6A 1T5HX 3N54B 2YCBA 3I08A 1XRAA 5T8SA 1XNRC 4KTVA 1XMOC 2D1RA 5A2QD 4OX9C 4NXNC 3E7XA 1MXAA 2P2BA 2P20A 5BSWA 1XRBA 4FUQA 1IBKC 1N33C 1MD9A 4DV7C 4BSZA 4KTTA 4X66C 2ATWA 3B7WA 2QVYX 1M6XA 1XRCA 3VNRA 3KXWA 5LCIA 3IEUA 2P02A 5BURA 3N2QA 4B3TC 3A9VA 3NYQA 4DV0C 2VQEC 2JNVA 3LGXA 5KYVA 3T1HC 5LMUC 4X62C 2P2QA 4DV3C 3UX2A 4LFCC 5K8FA 1ZB8A 2D28C 2UXBC 3SO4A 4LF6C 4JI1C 2E0GA 1MDBA 3G7SA 4ODJA 5GTDA 4FUTA 3CW9A 2OO4A 4LFBC 2Y27A 4IR7A 1O9TA 4G1IA 4K0BA 1WF3A 2QW0X 2UUCC 1EGAA 1K0RA 1USPA 1ZB9A 3UZ0A 2ONFA 4DCVA 3TR3A 1P4EC 1PU1A 2D27A 4D4GA 4NOZA 3DLPX 2E8FA 2JMPA 4DR3C 4DUZC 4JI5C 2D7VA 5BSMA 1QM4A 4BBYA 2D1QA 4AQYC 4R0MA 1NY8A 2OPLB 4XX2A 1N32C 2MCQA 3GPCA 3L95X 5A19A 4FTFA 2DHMA 3J80D 5T8TA 4HPVA 2DPLA 3UEBA 2UXDC 4PZPA 3H2TA 3VNSA 2P2FA 2F4VC 1FLOA 1HNWC 2UUAC 4BCAA 4BC7A 1N34C 1IBMC 2CY1A 3S82A 2Y4OA 1GPMA 4DG8A 4R1LA 1T5DX 4NXMC 5AE1A 5BSTA 2UUBC 2D1TA 4JI0C 3GKUA 3K6RA 3T1YC 4GKJC 3LNOA 2WD9A 4DV4C 3A4IA 5AE2A 1HH2P 4IZ6A 4JM1A 1IB8A 3NPDA 4JI4C 4PUGA 4DV1C 5A1IA 5DV9A 4JI7C 1IBLC 1J5EC 3RG2A 3PESA 5BSRA 2ASBA 4MTNA 1JOSA 1XNQC 2NCLA 3NYRA 1NYEA 2UU9C 2UXCC 5BR8C 4D56A 4DV2C 1N2FA 4GXQA 4YY3C 4RVOA 3CQ3A 1V26A 2QL8A 3ETCA 4RM3A 2PT7G 1ULTA 1VEHA 1L2FA 2OPLA 1HR0C 1RG9A 3IPLA 5E7QA 4PUIA 1MDFA 3CJEA 2VZEA 4X64C 3PROC 3JAMD 2YWCA 3IMLA 4DCUA 2PN2A 4RVNA 1PG3A 1RY2A 1HNXC 4JYAC 2M5OA 5KEIA 3A26A 3TQIA 4L4QA 1KKGA 2YWBA 1LQLA 3FCEA 1QWIA 1V25A 5CZXA 5K85A 1YJ7A 4DCSA 1MXCA 4U5YD 3O2EA 4JI3C 2VSQA 2ZZMA 1O92A 1MKYA 3RV2A 4D57A 3A25A 4GXRA 2DYJA 3LUSA 2P2JA 1TH5A 3UX3A 4JV5C 3TUFA 1V60A 5BUQA 5BUSA 1O90A 5BSUA 5H9UA 1PA4A 2QVXX 2WP0C 4RMNA 3DAYA 3OTOC 5JRHA 2Z51A 4R1MA 3L8CA 4LFAC 3TDEA 3ETOA 1XMQC 4DV5C 2D1SA 4MH4A 2P2MA 2ZM6C 3NI2A 2XR1A 3R44A 4RM2A 2HJGA 1AMUA 1FUGA 4KHPC 4DR4C 4OYCA 2MMAB 2CXCA 4JI2C 4ZLPA 4LF8C 5AE3A 3I07A 1MXBA 4GKKC 4LF9C 4JI6C 4DR7C 5LMNC 4DCTA 4DUYC 3PBKA 2V7BA 4L7IA 4YHHC 3C5EA 1LCIA 3R9XA 4I9GA 4X65C 1P4EA 1UKKA 2KZFA 4BC9A 4RLQA 3UOWA 2YX1A 3LNVA 4WV3A 4PHTA 3CQ2A 5KYTA 5ADZA 1VLAA 1P7LA 1XS3A 3CW8X 2MM9A 2Y4NA 1ML8A 1USPB 1N36C 5BSVA 1O93A 1FJGC 4LF4C 4ZJZA 4D4IA 3GR1A 2E5LC 4DR2C 2BJOA 3R9WA 2KZ0A 4WS9A 4I9FA 5IT9D 3J81D 5CZVA 2OBVA 3AF6A 2AYAA 4DG9A 4B3SC 1I94C 1PG4A 4GS5A 4DR1C 3AY0A 1HNZC 3FCCA 4K0KC 4DR6C 4DR5C 3CQ1A
chains in the Genus database with same CATH topology
5FLXD 3VNQA 4EATA 4JI8C 3A9UA 4ISBA 3GR0A 4LF7C 3E7WA 3EERA 5IWAC 4B3RC 5A1GA 4DV6C 3EQ6A 3IEVA 1BA3A 1WH9A 4LE5A 4RLFA 4PROC 4L2ZA 4G37A 4G36A 5IFIA 2BH1X 2PROA 2EGTA 2E8CA 3DHVA 2E8EA 4NDNA 3AF5A 4OXIA 2QVZX 4TPSB 4LF5C 2HHHC 2E7GA 2VQFC 4B3MC 3LAXA 1T5HX 3N54B 2YCBA 3I08A 1XRAA 5T8SA 1XNRC 4KTVA 1XMOC 2D1RA 5A2QD 4OX9C 4NXNC 3E7XA 1MXAA 2P2BA 2P20A 5BSWA 1XRBA 4FUQA 1IBKC 1N33C 1MD9A 4DV7C 4BSZA 4KTTA 4X66C 2ATWA 3B7WA 2QVYX 1XRCA 3VNRA 3KXWA 3IEUA 2P02A 5BURA 3N2QA 4B3TC 3A9VA 3NYQA 4DV0C 2VQEC 3LGXA 5KYVA 3T1HC 5LMUC 4X62C 2P2QA 4DV3C 4LFCC 5K8FA 1ZB8A 2D28C 2UXBC 3SO4A 4LF6C 4JI1C 2E0GA 1MDBA 3G7SA 4ODJA 5GTDA 4FUTA 3CW9A 2OO4A 4LFBC 2Y27A 4IR7A 1O9TA 4G1IA 4K0BA 1WF3A 2QW0X 2UUCC 1EGAA 1K0RA 1USPA 1ZB9A 3UZ0A 2ONFA 4DCVA 2D27A 4D4GA 4NOZA 3DLPX 2E8FA 2JMPA 4DR3C 4DUZC 4JI5C 2D7VA 5BSMA 1QM4A 4BBYA 2D1QA 4AQYC 4XX2A 4R0MA 2OPLB 1N32C 3GPCA 3L95X 5A19A 4FTFA 3J80D 5T8TA 4HPVA 2DPLA 2UXDC 4PZPA 3H2TA 3VNSA 2P2FA 2F4VC 1HNWC 2UUAC 4BCAA 4BC7A 1N34C 1IBMC 2CY1A 3S82A 2Y4OA 1GPMA 4DG8A 4R1LA 1T5DX 4NXMC 5AE1A 5BSTA 2UUBC 2D1TA 4JI0C 3GKUA 3T1YC 4GKJC 2WD9A 4DV4C 3A4IA 5AE2A 1HH2P 4IZ6A 4JM1A 3NPDA 4JI4C 4DV1C 5A1IA 5DV9A 4JI7C 1IBLC 1J5EC 3RG2A 3PESA 5BSRA 2ASBA 4MTNA 1JOSA 1XNQC 3NYRA 1NYEA 2UU9C 2UXCC 5BR8C 4D56A 4DV2C 1N2FA 4GXQA 4YY3C 4RVOA 3ETCA 1V26A 2QL8A 4RM3A 2PT7G 1ULTA 1L2FA 2OPLA 1HR0C 1RG9A 3IPLA 5E7QA 1MDFA 3CJEA 2VZEA 4X64C 3PROC 3JAMD 2YWCA 3IMLA 4DCUA 2PN2A 4RVNA 1PG3A 1RY2A 1HNXC 4JYAC 5KEIA 3TQIA 4L4QA 1KKGA 2YWBA 1LQLA 3FCEA 1QWIA 1V25A 5CZXA 5K85A 1YJ7A 4DCSA 1MXCA 4U5YD 4JI3C 2VSQA 1O92A 1MKYA 3RV2A 4D57A 4GXRA 2DYJA 3LUSA 2P2JA 4JV5C 3TUFA 5BUQA 5BUSA 1O90A 5BSUA 5H9UA 1PA4A 2QVXX 2WP0C 4RMNA 3DAYA 3OTOC 5JRHA 4R1MA 3L8CA 4LFAC 3TDEA 3ETOA 1XMQC 4DV5C 2D1SA 4MH4A 2P2MA 2ZM6C 3NI2A 2XR1A 3R44A 4RM2A 2HJGA 1AMUA 1FUGA 4KHPC 4DR4C 4OYCA 2CXCA 4JI2C 4ZLPA 4LF8C 5AE3A 3I07A 1MXBA 4GKKC 4LF9C 4JI6C 4DR7C 5LMNC 4DCTA 4DUYC 3PBKA 2V7BA 4L7IA 4YHHC 3C5EA 1LCIA 3R9XA 4I9GA 4X65C 1UKKA 2KZFA 4BC9A 4RLQA 3UOWA 3LNVA 4WV3A 4PHTA 5KYTA 5ADZA 1VLAA 1P7LA 3CW8X 2Y4NA 1ML8A 1USPB 1N36C 5BSVA 1O93A 1FJGC 4LF4C 4ZJZA 4D4IA 3GR1A 2E5LC 4DR2C 2BJOA 3R9WA 4WS9A 4I9FA 5IT9D 3J81D 5CZVA 2OBVA 3AF6A 2AYAA 4DG9A 4B3SC 1I94C 1PG4A 4GS5A 4DR1C 1HNZC 3FCCA 4K0KC 4DR6C 4DR5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX D;  1HH2 P;  4JI8 C;  1ZB8 A;  4LF7 C;  2UXB C;  4JI4 C;  3EER A;  4LF6 C;  4JI1 C;  4LFA C;  5IWA C;  4DV1 C;  4B3R C;  1XMQ C;  4JI7 C;  4DV5 C;  1IBL C;  4DV6 C;  4MH4 A;  1J5E C;  2ZM6 C;  2XR1 A;  2ASB A;  3IEV A;  4MTN A;  4LFB C;  1WH9 A;  1JOS A;  2HJG A;  4KHP C;  1XNQ C;  4DR4 C;  2CXC A;  4JI2 C;  1NYE A;  1WF3 A;  4LF8 C;  2UU9 C;  2UUC C;  1EGA A;  1K0R A;  2UXC C;  5BR8 C;  1USP A;  3I07 A;  2EGT A;  4DV2 C;  1ZB9 A;  1N2F A;  2E8C A;  4GKK C;  4LF9 C;  4YY3 C;  4JI6 C;  4DR7 C;  5LMN C;  4DCT A;  2E8E A;  2ONF A;  4DCV A;  2QL8 A;  3AF5 A;  4DUY C;  4YHH C;  4LF5 C;  2PT7 G;  1L2F A;  2OPL A;  1HR0 C;  3R9X A;  4X65 C;  2HHH C;  4NOZ A;  2E7G A;  2E8F A;  2JMP A;  1UKK A;  4DR3 C;  3CJE A;  2VQF C;  4B3M C;  4DUZ C;  4JI5 C;  2KZF A;  2D7V A;  4X64 C;  2YCB A;  3JAM D;  4AQY C;  4XX2 A;  2PN2 A;  2OPL B;  4DCU A;  1XNR C;  1N32 C;  1XMO C;  1HNX C;  5A2Q D;  4JYA C;  4OX9 C;  1VLA A;  4NXN C;  3J80 D;  2UXD C;  1ML8 A;  1IBK C;  1N33 C;  1USP B;  1N36 C;  1KKG A;  4DV7 C;  4BSZ A;  1LQL A;  1QWI A;  1FJG C;  4X66 C;  2ATW A;  2F4V C;  4LF4 C;  1HNW C;  2UUA C;  4DCS A;  2E5L C;  4JI3 C;  4DR2 C;  1N34 C;  2BJO A;  1IBM C;  1MKY A;  2CY1 A;  3R9W A;  5IT9 D;  3IEU A;  3J81 D;  2DYJ A;  3LUS A;  4B3T C;  4DV0 C;  2VQE C;  3AF6 A;  4JV5 C;  3T1H C;  4NXM C;  2UUB C;  4JI0 C;  3GKU A;  5LMU C;  4B3S C;  4X62 C;  1I94 C;  3T1Y C;  4DR1 C;  1PA4 A;  4GKJ C;  1HNZ C;  4DV3 C;  4K0K C;  4LFC C;  4DR6 C;  4DR5 C;  4DV4 C;  3OTO C; 
#chains in the Genus database with same CATH topology
 5FLX D;  3VNQ A;  4EAT A;  4JI8 C;  3A9U A;  4ISB A;  3GR0 A;  4LF7 C;  3E7W A;  3EER A;  5IWA C;  4B3R C;  5A1G A;  4DV6 C;  3EQ6 A;  3IEV A;  1BA3 A;  1UWD A;  1WH9 A;  4LE5 A;  4RLF A;  2ZZN A;  4PRO C;  4PUH A;  4L2Z A;  4G37 A;  4G36 A;  5IFI A;  2BH1 X;  2PRO A;  2EGT A;  2E8C A;  2M5H A;  3DHV A;  2E8E A;  1M6X C;  4NDN A;  3AF5 A;  4OXI A;  2QVZ X;  4TPS B;  4LF5 C;  2KDN A;  2HHH C;  1WCJ A;  2E7G A;  1XHJ A;  2VQF C;  4B3M C;  3LAX A;  2CU6 A;  1T5H X;  3N54 B;  2YCB A;  3I08 A;  1XRA A;  5T8S A;  1XNR C;  4KTV A;  1XMO C;  2D1R A;  5A2Q D;  4OX9 C;  4NXN C;  3E7X A;  1MXA A;  2P2B A;  2P20 A;  5BSW A;  1XRB A;  4FUQ A;  1IBK C;  1N33 C;  1MD9 A;  4DV7 C;  4BSZ A;  4KTT A;  4X66 C;  2ATW A;  3B7W A;  2QVY X;  1M6X A;  1XRC A;  3VNR A;  3KXW A;  5LCI A;  3IEU A;  2P02 A;  5BUR A;  3N2Q A;  4B3T C;  3A9V A;  3NYQ A;  4DV0 C;  2VQE C;  2JNV A;  3LGX A;  5KYV A;  3T1H C;  5LMU C;  4X62 C;  2P2Q A;  4DV3 C;  3UX2 A;  4LFC C;  5K8F A;  1ZB8 A;  2D28 C;  2UXB C;  3SO4 A;  4LF6 C;  4JI1 C;  2E0G A;  1MDB A;  3G7S A;  4ODJ A;  5GTD A;  4FUT A;  3CW9 A;  2OO4 A;  4LFB C;  2Y27 A;  4IR7 A;  1O9T A;  4G1I A;  4K0B A;  1WF3 A;  2QW0 X;  2UUC C;  1EGA A;  1K0R A;  1USP A;  1ZB9 A;  3UZ0 A;  2ONF A;  4DCV A;  3TR3 A;  1P4E C;  1PU1 A;  2D27 A;  4D4G A;  4NOZ A;  3DLP X;  2E8F A;  2JMP A;  4DR3 C;  4DUZ C;  4JI5 C;  2D7V A;  5BSM A;  1QM4 A;  4BBY A;  2D1Q A;  4AQY C;  4R0M A;  1NY8 A;  2OPL B;  4XX2 A;  1N32 C;  2MCQ A;  3GPC A;  3L95 X;  5A19 A;  4FTF A;  2DHM A;  3J80 D;  5T8T A;  4HPV A;  2DPL A;  3UEB A;  2UXD C;  4PZP A;  3H2T A;  3VNS A;  2P2F A;  2F4V C;  1FLO A;  1HNW C;  2UUA C;  4BCA A;  4BC7 A;  1N34 C;  1IBM C;  2CY1 A;  3S82 A;  2Y4O A;  1GPM A;  4DG8 A;  4R1L A;  1T5D X;  4NXM C;  5AE1 A;  5BST A;  2UUB C;  2D1T A;  4JI0 C;  3GKU A;  3K6R A;  3T1Y C;  4GKJ C;  3LNO A;  2WD9 A;  4DV4 C;  3A4I A;  5AE2 A;  1HH2 P;  4IZ6 A;  4JM1 A;  1IB8 A;  3NPD A;  4JI4 C;  4PUG A;  4DV1 C;  5A1I A;  5DV9 A;  4JI7 C;  1IBL C;  1J5E C;  3RG2 A;  3PES A;  5BSR A;  2ASB A;  4MTN A;  1JOS A;  1XNQ C;  2NCL A;  3NYR A;  1NYE A;  2UU9 C;  2UXC C;  5BR8 C;  4D56 A;  4DV2 C;  1N2F A;  4GXQ A;  4YY3 C;  4RVO A;  3CQ3 A;  1V26 A;  2QL8 A;  3ETC A;  4RM3 A;  2PT7 G;  1ULT A;  1VEH A;  1L2F A;  2OPL A;  1HR0 C;  1RG9 A;  3IPL A;  5E7Q A;  4PUI A;  1MDF A;  3CJE A;  2VZE A;  4X64 C;  3PRO C;  3JAM D;  2YWC A;  3IML A;  4DCU A;  2PN2 A;  4RVN A;  1PG3 A;  1RY2 A;  1HNX C;  4JYA C;  2M5O A;  5KEI A;  3A26 A;  3TQI A;  4L4Q A;  1KKG A;  2YWB A;  1LQL A;  3FCE A;  1QWI A;  1V25 A;  5CZX A;  5K85 A;  1YJ7 A;  4DCS A;  1MXC A;  4U5Y D;  3O2E A;  4JI3 C;  2VSQ A;  2ZZM A;  1O92 A;  1MKY A;  3RV2 A;  4D57 A;  3A25 A;  4GXR A;  2DYJ A;  3LUS A;  2P2J A;  1TH5 A;  3UX3 A;  4JV5 C;  3TUF A;  1V60 A;  5BUQ A;  5BUS A;  1O90 A;  5BSU A;  5H9U A;  1PA4 A;  2QVX X;  2WP0 C;  4RMN A;  3DAY A;  3OTO C;  5JRH A;  2Z51 A;  4R1M A;  3L8C A;  4LFA C;  3TDE A;  3ETO A;  1XMQ C;  4DV5 C;  2D1S A;  4MH4 A;  2P2M A;  2ZM6 C;  3NI2 A;  2XR1 A;  3R44 A;  4RM2 A;  2HJG A;  1AMU A;  1FUG A;  4KHP C;  4DR4 C;  4OYC A;  2MMA B;  2CXC A;  4JI2 C;  4ZLP A;  4LF8 C;  5AE3 A;  3I07 A;  1MXB A;  4GKK C;  4LF9 C;  4JI6 C;  4DR7 C;  5LMN C;  4DCT A;  4DUY C;  3PBK A;  2V7B A;  4L7I A;  4YHH C;  3C5E A;  1LCI A;  3R9X A;  4I9G A;  4X65 C;  1P4E A;  1UKK A;  2KZF A;  4BC9 A;  4RLQ A;  3UOW A;  2YX1 A;  3LNV A;  4WV3 A;  4PHT A;  3CQ2 A;  5KYT A;  5ADZ A;  1VLA A;  1P7L A;  1XS3 A;  3CW8 X;  2MM9 A;  2Y4N A;  1ML8 A;  1USP B;  1N36 C;  5BSV A;  1O93 A;  1FJG C;  4LF4 C;  4ZJZ A;  4D4I A;  3GR1 A;  2E5L C;  4DR2 C;  2BJO A;  3R9W A;  2KZ0 A;  4WS9 A;  4I9F A;  5IT9 D;  3J81 D;  5CZV A;  2OBV A;  3AF6 A;  2AYA A;  4DG9 A;  4B3S C;  1I94 C;  1PG4 A;  4GS5 A;  4DR1 C;  3AY0 A;  1HNZ C;  3FCC A;  4K0K C;  4DR6 C;  4DR5 C;  3CQ1 A; 
#chains in the Genus database with same CATH homology
 5FLX D;  3VNQ A;  4EAT A;  4JI8 C;  3A9U A;  4ISB A;  3GR0 A;  4LF7 C;  3E7W A;  3EER A;  5IWA C;  4B3R C;  5A1G A;  4DV6 C;  3EQ6 A;  3IEV A;  1BA3 A;  1WH9 A;  4LE5 A;  4RLF A;  4PRO C;  4L2Z A;  4G37 A;  4G36 A;  5IFI A;  2BH1 X;  2PRO A;  2EGT A;  2E8C A;  3DHV A;  2E8E A;  4NDN A;  3AF5 A;  4OXI A;  2QVZ X;  4TPS B;  4LF5 C;  2HHH C;  2E7G A;  2VQF C;  4B3M C;  3LAX A;  1T5H X;  3N54 B;  2YCB A;  3I08 A;  1XRA A;  5T8S A;  1XNR C;  4KTV A;  1XMO C;  2D1R A;  5A2Q D;  4OX9 C;  4NXN C;  3E7X A;  1MXA A;  2P2B A;  2P20 A;  5BSW A;  1XRB A;  4FUQ A;  1IBK C;  1N33 C;  1MD9 A;  4DV7 C;  4BSZ A;  4KTT A;  4X66 C;  2ATW A;  3B7W A;  2QVY X;  1XRC A;  3VNR A;  3KXW A;  3IEU A;  2P02 A;  5BUR A;  3N2Q A;  4B3T C;  3A9V A;  3NYQ A;  4DV0 C;  2VQE C;  3LGX A;  5KYV A;  3T1H C;  5LMU C;  4X62 C;  2P2Q A;  4DV3 C;  4LFC C;  5K8F A;  1ZB8 A;  2D28 C;  2UXB C;  3SO4 A;  4LF6 C;  4JI1 C;  2E0G A;  1MDB A;  3G7S A;  4ODJ A;  5GTD A;  4FUT A;  3CW9 A;  2OO4 A;  4LFB C;  2Y27 A;  4IR7 A;  1O9T A;  4G1I A;  4K0B A;  1WF3 A;  2QW0 X;  2UUC C;  1EGA A;  1K0R A;  1USP A;  1ZB9 A;  3UZ0 A;  2ONF A;  4DCV A;  2D27 A;  4D4G A;  4NOZ A;  3DLP X;  2E8F A;  2JMP A;  4DR3 C;  4DUZ C;  4JI5 C;  2D7V A;  5BSM A;  1QM4 A;  4BBY A;  2D1Q A;  4AQY C;  4XX2 A;  4R0M A;  2OPL B;  1N32 C;  3GPC A;  3L95 X;  5A19 A;  4FTF A;  3J80 D;  5T8T A;  4HPV A;  2DPL A;  2UXD C;  4PZP A;  3H2T A;  3VNS A;  2P2F A;  2F4V C;  1HNW C;  2UUA C;  4BCA A;  4BC7 A;  1N34 C;  1IBM C;  2CY1 A;  3S82 A;  2Y4O A;  1GPM A;  4DG8 A;  4R1L A;  1T5D X;  4NXM C;  5AE1 A;  5BST A;  2UUB C;  2D1T A;  4JI0 C;  3GKU A;  3T1Y C;  4GKJ C;  2WD9 A;  4DV4 C;  3A4I A;  5AE2 A;  1HH2 P;  4IZ6 A;  4JM1 A;  3NPD A;  4JI4 C;  4DV1 C;  5A1I A;  5DV9 A;  4JI7 C;  1IBL C;  1J5E C;  3RG2 A;  3PES A;  5BSR A;  2ASB A;  4MTN A;  1JOS A;  1XNQ C;  3NYR A;  1NYE A;  2UU9 C;  2UXC C;  5BR8 C;  4D56 A;  4DV2 C;  1N2F A;  4GXQ A;  4YY3 C;  4RVO A;  3ETC A;  1V26 A;  2QL8 A;  4RM3 A;  2PT7 G;  1ULT A;  1L2F A;  2OPL A;  1HR0 C;  1RG9 A;  3IPL A;  5E7Q A;  1MDF A;  3CJE A;  2VZE A;  4X64 C;  3PRO C;  3JAM D;  2YWC A;  3IML A;  4DCU A;  2PN2 A;  4RVN A;  1PG3 A;  1RY2 A;  1HNX C;  4JYA C;  5KEI A;  3TQI A;  4L4Q A;  1KKG A;  2YWB A;  1LQL A;  3FCE A;  1QWI A;  1V25 A;  5CZX A;  5K85 A;  1YJ7 A;  4DCS A;  1MXC A;  4U5Y D;  4JI3 C;  2VSQ A;  1O92 A;  1MKY A;  3RV2 A;  4D57 A;  4GXR A;  2DYJ A;  3LUS A;  2P2J A;  4JV5 C;  3TUF A;  5BUQ A;  5BUS A;  1O90 A;  5BSU A;  5H9U A;  1PA4 A;  2QVX X;  2WP0 C;  4RMN A;  3DAY A;  3OTO C;  5JRH A;  4R1M A;  3L8C A;  4LFA C;  3TDE A;  3ETO A;  1XMQ C;  4DV5 C;  2D1S A;  4MH4 A;  2P2M A;  2ZM6 C;  3NI2 A;  2XR1 A;  3R44 A;  4RM2 A;  2HJG A;  1AMU A;  1FUG A;  4KHP C;  4DR4 C;  4OYC A;  2CXC A;  4JI2 C;  4ZLP A;  4LF8 C;  5AE3 A;  3I07 A;  1MXB A;  4GKK C;  4LF9 C;  4JI6 C;  4DR7 C;  5LMN C;  4DCT A;  4DUY C;  3PBK A;  2V7B A;  4L7I A;  4YHH C;  3C5E A;  1LCI A;  3R9X A;  4I9G A;  4X65 C;  1UKK A;  2KZF A;  4BC9 A;  4RLQ A;  3UOW A;  3LNV A;  4WV3 A;  4PHT A;  5KYT A;  5ADZ A;  1VLA A;  1P7L A;  3CW8 X;  2Y4N A;  1ML8 A;  1USP B;  1N36 C;  5BSV A;  1O93 A;  1FJG C;  4LF4 C;  4ZJZ A;  4D4I A;  3GR1 A;  2E5L C;  4DR2 C;  2BJO A;  3R9W A;  4WS9 A;  4I9F A;  5IT9 D;  3J81 D;  5CZV A;  2OBV A;  3AF6 A;  2AYA A;  4DG9 A;  4B3S C;  1I94 C;  1PG4 A;  4GS5 A;  4DR1 C;  1HNZ C;  3FCC A;  4K0K C;  4DR6 C;  4DR5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...