2KZFA

Solution nmr structure of the thermotoga maritima protein tm0855 a putative ribosome binding factor a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
GMNPAYRKAMLESEIQKLLMEALQQLRDPRLKKDFVTFSRVELSKDKRYADVYVSFLGTPEERKETVEILNRAKGFFRTFIAKNLRLYVAPEIRFYEDKGIEASVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the thermotoga maritima protein TM0855
rcsb
source organism Thermotoga maritima
molecule tags Ribosomal protein
molecule keywords Ribosome-binding factor A
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2010-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2kzfA00
2F4VC 2UUAC 1IBMC 4LFBC 1N2FA 2VQEC 4DV0C 2EGTA 3LUSA 3R9WA 1HH2P 4AQYC 2UXCC 3IEUA 4LF7C 4XX2A 2ZM6C 4MH4A 4DUYC 1KKGA 1QWIA 2CXCA 1IBKC 4NXNC 1ZB8A 4JI8C 4DR2C 1WH9A 2E8FA 2OPLB 5IWAC 1FJGC 4NXMC 4B3RC 2ATWA 4JI7C 2ASBA 4X64C 4DR5C 1HNXC 1N36C 2KZFA 1NYEA 4K0KC 4DCVA 1ML8A 4BSZA 2OPLA 1ZB9A 1WF3A 1USPA 3J81D 3OTOC 1MKYA 4DCTA 1HR0C 1IBLC 4JI3C 2UUCC 4GKJC 4JI2C 1HNZC 5IT9D 4X66C 5A2QD 1UKKA 4DV1C 3GKUA 4DV2C 4LF9C 4YHHC 4OX9C 5BR8C 3IEVA 1N34C 5FLXD 4LF6C 1XNRC 1N32C 2PN2A 4JI1C 4DV6C 4DCUA 4LFCC 4JYAC 4X65C 4DV4C 5LMNC 1USPB 1JOSA 3CJEA 4DCSA 4NOZA 2E7GA 2HHHC 4DR6C 2DYJA 4LF5C 2UXBC 1L2FA 4B3MC 4DR7C 1EGAA 2D7VA 3R9XA 1XMQC 4JI5C 2XR1A 4KHPC 2QL8A 1PA4A 4LF4C 1LQLA 1VLAA 3JAMD 2UXDC 4LF8C 2PT7G 2CY1A 4DR3C 4GKKC 3J80D 1K0RA 1I94C 4B3TC 4DV3C 2UUBC 4JI0C 1HNWC 4DUZC 4MTNA 2UU9C 2JMPA 3T1YC 4B3SC 2VQFC 1XNQC 2E8CA 4DV7C 4LFAC 4DR4C 3T1HC 4DV5C 4JI4C 3EERA 2E5LC 5LMUC 4DR1C 2BJOA 4JV5C 4JI6C 2HJGA 3AF6A 1XMOC 4YY3C 1N33C 2YCBA 4X62C 2E8EA 2ONFA 3I07A 3AF5A 1J5EC
chains in the Genus database with same CATH superfamily
4R1LA 2VSQA 2OBVA 5BSMA 3GR0A 1MXCA 4LF7C 2D1SA 3UX2A 2ZM6C 4NDNA 1XS3A 4WV3A 1IBKC 4KTVA 5GTDA 4DR2C 1PG4A 2P20A 4B3RC 1P4EC 1O9TA 5KYVA 4JI7C 2ASBA 3RG2A 4FTFA 4G36A 3DLPX 5LCIA 3TQIA 2YWBA 1ZB9A 4IZ6A 1P4EA 4OYCA 1BA3A 4LE5A 4DCTA 1AMUA 1P7LA 3DAYA 1MDBA 4BCAA 4G1IA 2YWCA 4LF9C 3TR3A 1PG3A 4YHHC 4OX9C 1O90A 5BUQA 2M5OA 3O2EA 3CW8X 1FLOA 5T8TA 3A9UA 3IMLA 5LMNC 3CJEA 4NOZA 2E7GA 3K6RA 2WP0C 4DR6C 2QVZX 2D7VA 4ZLPA 3R9XA 1MD9A 1MXBA 2D1RA 2XR1A 1PA4A 2AYAA 1LQLA 1VLAA 4RVOA 2CY1A 4GXRA 1V60A 2UUBC 4DUZC 2UU9C 2JMPA 2MMAB 2DHMA 3E7XA 4RM2A 2P2MA 4DR1C 3RV2A 3C5EA 3ETCA 4X62C 2ONFA 2P2FA 5T8SA 2UUAC 4LFBC 1N2FA 2VQEC 4DV0C 5JRHA 1HH2P 2UXCC 3PESA 1TH5A 3ETOA 4BC9A 4XX2A 3EQ6A 4OXIA 4DG9A 4DUYC 1KKGA 2D27A 4RMNA 2Z51A 3LAXA 1WH9A 1O93A 2ZZNA 3NYQA 2P02A 2Y27A 3FCCA 2D28C 2JNVA 5A1GA 4HPVA 2KZFA 2CU6A 4PROC 5BSTA 2KZ0A 3PROC 3OTOC 1MKYA 5H9UA 1HR0C 5KEIA 3A9VA 2UUCC 4RLQA 1IB8A 4X66C 1VEHA 2QVXX 1UKKA 3UOWA 4DV2C 4L2ZA 4I9GA 3IEVA 4PZPA 3N54B 4FUQA 4JI1C 1N32C 2BH1X 3VNSA 3AY0A 5DV9A 5BUSA 4JYAC 4X65C 5AE3A 4DCSA 1JOSA 1USPB 2HHHC 4LF5C 2UXBC 4B3MC 4DR7C 1EGAA 4FUTA 3LNVA 4KHPC 2QL8A 2MM9A 1M6XA 4DR3C 4B3TC 3TUFA 4DV3C 1HNWC 1NY8A 1XRAA 4PUHA 1V25A 3SO4A 1T5HX 3UZ0A 2ZZMA 4DR4C 2WD9A 4DV5C 4JI4C 3AF6A 3I08A 2E0GA 4U5YD 3NYRA 3CQ2A 3I07A 1J5EC 2F4VC 4L4QA 1IBMC 4ISBA 2EGTA 1O92A 3LUSA 3R9WA 3L8CA 3A26A 3IEUA 5BSUA 2QVYX 2Y4NA 4ODJA 5AE2A 3IPLA 2CXCA 4NXNC 5KYTA 1ZB8A 4JI8C 5K8FA 3A25A 2OPLB 5IWAC 1FJGC 4NXMC 5BSRA 4X64C 4IR7A 3S82A 5E7QA 4DR5C 4TPSB 3CQ1A 4BBYA 5BSVA 4K0KC 4PUGA 4BSZA 2OPLA 1WF3A 3A4IA 4PHTA 3J81D 2QW0X 1IBLC 2NCLA 4JI3C 1V26A 3TDEA 4GKJC 1HNZC 4PUIA 5CZVA 3GKUA 5BR8C 4DG8A 3CW9A 1N34C 4LF6C 1XNRC 4LFCC 4ZJZA 2OO4A 2KDNA 1LCIA 1RG9A 1XMQC 3VNRA 4K0BA 4LF4C 2UXDC 5IFIA 3LGXA 1K0RA 1I94C 2VZEA 1UWDA 2YX1A 4MTNA 4GS5A 4G37A 4R1MA 4B3SC 2VQFC 3VNQA 1XNQC 2E8CA 1YJ7A 4DV7C 4LFAC 1WCJA 3LNOA 3EERA 2BJOA 3R44A 2HJGA 1MDFA 5CZXA 1XMOC 2M5HA 1QM4A 2YCBA 3B7WA 3UEBA 2E8EA 5A19A 2P2QA 3FCEA 4EATA 4AQYC 2MCQA 1FUGA 4MH4A 5K85A 3KXWA 4I9FA 1QWIA 1PU1A 1XRCA 4JM1A 2P2BA 3GPCA 2E8FA 5BSWA 4R0MA 2ATWA 3H2TA 3E7WA 2V7BA 3L95X 1HNXC 4D4GA 1N36C 3G7SA 1NYEA 4DCVA 1ML8A 1USPA 5A1IA 2D1QA 5AE1A 5BURA 1M6XC 4JI2C 4RLFA 5IT9D 5A2QD 4BC7A 4DV1C 5FLXD 1GPMA 2PN2A 3NPDA 3DHVA 4DV6C 4DCUA 1ULTA 2PROA 4DV4C 5ADZA 4GXQA 2DYJA 1L2FA 2DPLA 4D57A 3GR1A 4WS9A 4D4IA 2D1TA 3JAMD 1RY2A 1XHJA 4LF8C 2PT7G 4GKKC 3J80D 3UX3A 3CQ3A 1XRBA 4RVNA 4JI0C 4KTTA 3N2QA 3T1YC 4RM3A 3NI2A 3T1HC 2E5LC 1T5DX 5LMUC 4JV5C 1MXAA 4JI6C 2Y4OA 4YY3C 2P2JA 4L7IA 1N33C 4D56A 4JI5C 3AF5A 3PBKA
chains in the Genus database with same CATH topology
4R1LA 2VSQA 2OBVA 5BSMA 3GR0A 1MXCA 4LF7C 2D1SA 2ZM6C 4NDNA 4WV3A 1IBKC 4KTVA 5GTDA 4DR2C 1PG4A 2P20A 4B3RC 1O9TA 5KYVA 4JI7C 2ASBA 3RG2A 4FTFA 4G36A 3DLPX 3TQIA 2YWBA 1ZB9A 4IZ6A 4OYCA 1BA3A 4LE5A 4DCTA 1AMUA 1P7LA 3DAYA 1MDBA 4BCAA 4G1IA 2YWCA 4LF9C 1PG3A 4YHHC 4OX9C 1O90A 5BUQA 3CW8X 5T8TA 3A9UA 3IMLA 5LMNC 3CJEA 4NOZA 2E7GA 2WP0C 4DR6C 2QVZX 2D7VA 4ZLPA 3R9XA 1MD9A 1MXBA 2D1RA 2XR1A 1PA4A 2AYAA 1LQLA 1VLAA 4RVOA 2CY1A 4GXRA 2UUBC 4DUZC 2UU9C 2JMPA 3E7XA 4RM2A 2P2MA 4DR1C 3RV2A 3C5EA 3ETCA 4X62C 2ONFA 5T8SA 2P2FA 2UUAC 4LFBC 1N2FA 2VQEC 4DV0C 5JRHA 1HH2P 2UXCC 3PESA 3ETOA 4BC9A 4XX2A 3EQ6A 4OXIA 4DG9A 4DUYC 1KKGA 2D27A 4RMNA 3LAXA 1WH9A 1O93A 3NYQA 2P02A 2Y27A 3FCCA 2D28C 5A1GA 4HPVA 2KZFA 4PROC 5BSTA 3PROC 3OTOC 1MKYA 5H9UA 1HR0C 5KEIA 3A9VA 2UUCC 4RLQA 4X66C 2QVXX 1UKKA 3UOWA 4DV2C 4L2ZA 4I9GA 3IEVA 4PZPA 3N54B 4FUQA 4JI1C 1N32C 2BH1X 3VNSA 5DV9A 5BUSA 4JYAC 4X65C 5AE3A 1JOSA 1USPB 4DCSA 2HHHC 4LF5C 2UXBC 4B3MC 4DR7C 1EGAA 4FUTA 3LNVA 4KHPC 2QL8A 4DR3C 4B3TC 3TUFA 4DV3C 1HNWC 1XRAA 1V25A 3SO4A 1T5HX 3UZ0A 4DR4C 2WD9A 4DV5C 4JI4C 3AF6A 3I08A 2E0GA 4U5YD 3NYRA 3I07A 1J5EC 2F4VC 4L4QA 1IBMC 4ISBA 2EGTA 1O92A 3LUSA 3R9WA 3L8CA 3IEUA 5BSUA 2QVYX 2Y4NA 4ODJA 5AE2A 3IPLA 2CXCA 4NXNC 5KYTA 1ZB8A 4JI8C 5K8FA 2OPLB 5IWAC 1FJGC 4NXMC 5BSRA 4X64C 4IR7A 3S82A 5E7QA 4DR5C 4TPSB 4BBYA 5BSVA 4K0KC 4BSZA 2OPLA 1WF3A 3A4IA 4PHTA 3J81D 2QW0X 1IBLC 4JI3C 1V26A 3TDEA 4GKJC 1HNZC 5CZVA 3GKUA 5BR8C 4DG8A 3CW9A 1N34C 4LF6C 1XNRC 4LFCC 4ZJZA 2OO4A 1LCIA 1RG9A 1XMQC 3VNRA 4K0BA 4LF4C 2UXDC 5IFIA 3LGXA 1K0RA 1I94C 2VZEA 4MTNA 4GS5A 4G37A 4R1MA 4B3SC 2VQFC 3VNQA 1XNQC 2E8CA 1YJ7A 4DV7C 4LFAC 3EERA 2BJOA 3R44A 2HJGA 1MDFA 5CZXA 1XMOC 1QM4A 2YCBA 3B7WA 2E8EA 5A19A 2P2QA 3FCEA 4EATA 4AQYC 1FUGA 4MH4A 5K85A 3KXWA 4I9FA 1QWIA 1XRCA 4JM1A 2P2BA 3GPCA 2E8FA 5BSWA 4R0MA 2ATWA 3H2TA 3E7WA 2V7BA 3L95X 1HNXC 4D4GA 1N36C 3G7SA 1NYEA 4DCVA 1ML8A 1USPA 5A1IA 2D1QA 5AE1A 5BURA 4JI2C 4RLFA 5IT9D 5A2QD 4BC7A 4DV1C 5FLXD 1GPMA 2PN2A 3NPDA 3DHVA 4DV6C 4DCUA 1ULTA 2PROA 4DV4C 5ADZA 4GXQA 2DYJA 1L2FA 2DPLA 4D57A 3GR1A 4WS9A 4D4IA 2D1TA 3JAMD 1RY2A 4LF8C 2PT7G 4GKKC 3J80D 1XRBA 4RVNA 4JI0C 4KTTA 3N2QA 3T1YC 4RM3A 3NI2A 3T1HC 2E5LC 1T5DX 5LMUC 4JV5C 1MXAA 4JI6C 2Y4OA 4YY3C 2P2JA 4L7IA 1N33C 4D56A 4JI5C 3AF5A 3PBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V C;  2UUA C;  1IBM C;  4LFB C;  1N2F A;  2VQE C;  4DV0 C;  2EGT A;  3LUS A;  3R9W A;  1HH2 P;  4AQY C;  2UXC C;  3IEU A;  4LF7 C;  4XX2 A;  2ZM6 C;  4MH4 A;  4DUY C;  1KKG A;  1QWI A;  2CXC A;  1IBK C;  4NXN C;  1ZB8 A;  4JI8 C;  4DR2 C;  1WH9 A;  2E8F A;  2OPL B;  5IWA C;  1FJG C;  4NXM C;  4B3R C;  2ATW A;  4JI7 C;  2ASB A;  4X64 C;  4DR5 C;  1HNX C;  1N36 C;  2KZF A;  1NYE A;  4K0K C;  4DCV A;  1ML8 A;  4BSZ A;  2OPL A;  1ZB9 A;  1WF3 A;  1USP A;  3J81 D;  3OTO C;  1MKY A;  4DCT A;  1HR0 C;  1IBL C;  4JI3 C;  2UUC C;  4GKJ C;  4JI2 C;  1HNZ C;  5IT9 D;  4X66 C;  5A2Q D;  1UKK A;  4DV1 C;  3GKU A;  4DV2 C;  4LF9 C;  4YHH C;  4OX9 C;  5BR8 C;  3IEV A;  1N34 C;  5FLX D;  4LF6 C;  1XNR C;  1N32 C;  2PN2 A;  4JI1 C;  4DV6 C;  4DCU A;  4LFC C;  4JYA C;  4X65 C;  4DV4 C;  5LMN C;  1USP B;  1JOS A;  3CJE A;  4DCS A;  4NOZ A;  2E7G A;  2HHH C;  4DR6 C;  2DYJ A;  4LF5 C;  2UXB C;  1L2F A;  4B3M C;  4DR7 C;  1EGA A;  2D7V A;  3R9X A;  1XMQ C;  4JI5 C;  2XR1 A;  4KHP C;  2QL8 A;  1PA4 A;  4LF4 C;  1LQL A;  1VLA A;  3JAM D;  2UXD C;  4LF8 C;  2PT7 G;  2CY1 A;  4DR3 C;  4GKK C;  3J80 D;  1K0R A;  1I94 C;  4B3T C;  4DV3 C;  2UUB C;  4JI0 C;  1HNW C;  4DUZ C;  4MTN A;  2UU9 C;  2JMP A;  3T1Y C;  4B3S C;  2VQF C;  1XNQ C;  2E8C A;  4DV7 C;  4LFA C;  4DR4 C;  3T1H C;  4DV5 C;  4JI4 C;  3EER A;  2E5L C;  5LMU C;  4DR1 C;  2BJO A;  4JV5 C;  4JI6 C;  2HJG A;  3AF6 A;  1XMO C;  4YY3 C;  1N33 C;  2YCB A;  4X62 C;  2E8E A;  2ONF A;  3I07 A;  3AF5 A;  1J5E C; 
#chains in the Genus database with same CATH topology
 4R1L A;  2VSQ A;  2OBV A;  5BSM A;  3GR0 A;  1MXC A;  4LF7 C;  2D1S A;  3UX2 A;  2ZM6 C;  4NDN A;  1XS3 A;  4WV3 A;  1IBK C;  4KTV A;  5GTD A;  4DR2 C;  1PG4 A;  2P20 A;  4B3R C;  1P4E C;  1O9T A;  5KYV A;  4JI7 C;  2ASB A;  3RG2 A;  4FTF A;  4G36 A;  3DLP X;  5LCI A;  3TQI A;  2YWB A;  1ZB9 A;  4IZ6 A;  1P4E A;  4OYC A;  1BA3 A;  4LE5 A;  4DCT A;  1AMU A;  1P7L A;  3DAY A;  1MDB A;  4BCA A;  4G1I A;  2YWC A;  4LF9 C;  3TR3 A;  1PG3 A;  4YHH C;  4OX9 C;  1O90 A;  5BUQ A;  2M5O A;  3O2E A;  3CW8 X;  1FLO A;  5T8T A;  3A9U A;  3IML A;  5LMN C;  3CJE A;  4NOZ A;  2E7G A;  3K6R A;  2WP0 C;  4DR6 C;  2QVZ X;  2D7V A;  4ZLP A;  3R9X A;  1MD9 A;  1MXB A;  2D1R A;  2XR1 A;  1PA4 A;  2AYA A;  1LQL A;  1VLA A;  4RVO A;  2CY1 A;  4GXR A;  1V60 A;  2UUB C;  4DUZ C;  2UU9 C;  2JMP A;  2MMA B;  2DHM A;  3E7X A;  4RM2 A;  2P2M A;  4DR1 C;  3RV2 A;  3C5E A;  3ETC A;  4X62 C;  2ONF A;  2P2F A;  5T8S A;  2UUA C;  4LFB C;  1N2F A;  2VQE C;  4DV0 C;  5JRH A;  1HH2 P;  2UXC C;  3PES A;  1TH5 A;  3ETO A;  4BC9 A;  4XX2 A;  3EQ6 A;  4OXI A;  4DG9 A;  4DUY C;  1KKG A;  2D27 A;  4RMN A;  2Z51 A;  3LAX A;  1WH9 A;  1O93 A;  2ZZN A;  3NYQ A;  2P02 A;  2Y27 A;  3FCC A;  2D28 C;  2JNV A;  5A1G A;  4HPV A;  2KZF A;  2CU6 A;  4PRO C;  5BST A;  2KZ0 A;  3PRO C;  3OTO C;  1MKY A;  5H9U A;  1HR0 C;  5KEI A;  3A9V A;  2UUC C;  4RLQ A;  1IB8 A;  4X66 C;  1VEH A;  2QVX X;  1UKK A;  3UOW A;  4DV2 C;  4L2Z A;  4I9G A;  3IEV A;  4PZP A;  3N54 B;  4FUQ A;  4JI1 C;  1N32 C;  2BH1 X;  3VNS A;  3AY0 A;  5DV9 A;  5BUS A;  4JYA C;  4X65 C;  5AE3 A;  4DCS A;  1JOS A;  1USP B;  2HHH C;  4LF5 C;  2UXB C;  4B3M C;  4DR7 C;  1EGA A;  4FUT A;  3LNV A;  4KHP C;  2QL8 A;  2MM9 A;  1M6X A;  4DR3 C;  4B3T C;  3TUF A;  4DV3 C;  1HNW C;  1NY8 A;  1XRA A;  4PUH A;  1V25 A;  3SO4 A;  1T5H X;  3UZ0 A;  2ZZM A;  4DR4 C;  2WD9 A;  4DV5 C;  4JI4 C;  3AF6 A;  3I08 A;  2E0G A;  4U5Y D;  3NYR A;  3CQ2 A;  3I07 A;  1J5E C;  2F4V C;  4L4Q A;  1IBM C;  4ISB A;  2EGT A;  1O92 A;  3LUS A;  3R9W A;  3L8C A;  3A26 A;  3IEU A;  5BSU A;  2QVY X;  2Y4N A;  4ODJ A;  5AE2 A;  3IPL A;  2CXC A;  4NXN C;  5KYT A;  1ZB8 A;  4JI8 C;  5K8F A;  3A25 A;  2OPL B;  5IWA C;  1FJG C;  4NXM C;  5BSR A;  4X64 C;  4IR7 A;  3S82 A;  5E7Q A;  4DR5 C;  4TPS B;  3CQ1 A;  4BBY A;  5BSV A;  4K0K C;  4PUG A;  4BSZ A;  2OPL A;  1WF3 A;  3A4I A;  4PHT A;  3J81 D;  2QW0 X;  1IBL C;  2NCL A;  4JI3 C;  1V26 A;  3TDE A;  4GKJ C;  1HNZ C;  4PUI A;  5CZV A;  3GKU A;  5BR8 C;  4DG8 A;  3CW9 A;  1N34 C;  4LF6 C;  1XNR C;  4LFC C;  4ZJZ A;  2OO4 A;  2KDN A;  1LCI A;  1RG9 A;  1XMQ C;  3VNR A;  4K0B A;  4LF4 C;  2UXD C;  5IFI A;  3LGX A;  1K0R A;  1I94 C;  2VZE A;  1UWD A;  2YX1 A;  4MTN A;  4GS5 A;  4G37 A;  4R1M A;  4B3S C;  2VQF C;  3VNQ A;  1XNQ C;  2E8C A;  1YJ7 A;  4DV7 C;  4LFA C;  1WCJ A;  3LNO A;  3EER A;  2BJO A;  3R44 A;  2HJG A;  1MDF A;  5CZX A;  1XMO C;  2M5H A;  1QM4 A;  2YCB A;  3B7W A;  3UEB A;  2E8E A;  5A19 A;  2P2Q A;  3FCE A;  4EAT A;  4AQY C;  2MCQ A;  1FUG A;  4MH4 A;  5K85 A;  3KXW A;  4I9F A;  1QWI A;  1PU1 A;  1XRC A;  4JM1 A;  2P2B A;  3GPC A;  2E8F A;  5BSW A;  4R0M A;  2ATW A;  3H2T A;  3E7W A;  2V7B A;  3L95 X;  1HNX C;  4D4G A;  1N36 C;  3G7S A;  1NYE A;  4DCV A;  1ML8 A;  1USP A;  5A1I A;  2D1Q A;  5AE1 A;  5BUR A;  1M6X C;  4JI2 C;  4RLF A;  5IT9 D;  5A2Q D;  4BC7 A;  4DV1 C;  5FLX D;  1GPM A;  2PN2 A;  3NPD A;  3DHV A;  4DV6 C;  4DCU A;  1ULT A;  2PRO A;  4DV4 C;  5ADZ A;  4GXQ A;  2DYJ A;  1L2F A;  2DPL A;  4D57 A;  3GR1 A;  4WS9 A;  4D4I A;  2D1T A;  3JAM D;  1RY2 A;  1XHJ A;  4LF8 C;  2PT7 G;  4GKK C;  3J80 D;  3UX3 A;  3CQ3 A;  1XRB A;  4RVN A;  4JI0 C;  4KTT A;  3N2Q A;  3T1Y C;  4RM3 A;  3NI2 A;  3T1H C;  2E5L C;  1T5D X;  5LMU C;  4JV5 C;  1MXA A;  4JI6 C;  2Y4O A;  4YY3 C;  2P2J A;  4L7I A;  1N33 C;  4D56 A;  4JI5 C;  3AF5 A;  3PBK A; 
#chains in the Genus database with same CATH homology
 4R1L A;  2VSQ A;  2OBV A;  5BSM A;  3GR0 A;  1MXC A;  4LF7 C;  2D1S A;  2ZM6 C;  4NDN A;  4WV3 A;  1IBK C;  4KTV A;  5GTD A;  4DR2 C;  1PG4 A;  2P20 A;  4B3R C;  1O9T A;  5KYV A;  4JI7 C;  2ASB A;  3RG2 A;  4FTF A;  4G36 A;  3DLP X;  3TQI A;  2YWB A;  1ZB9 A;  4IZ6 A;  4OYC A;  1BA3 A;  4LE5 A;  4DCT A;  1AMU A;  1P7L A;  3DAY A;  1MDB A;  4BCA A;  4G1I A;  2YWC A;  4LF9 C;  1PG3 A;  4YHH C;  4OX9 C;  1O90 A;  5BUQ A;  3CW8 X;  5T8T A;  3A9U A;  3IML A;  5LMN C;  3CJE A;  4NOZ A;  2E7G A;  2WP0 C;  4DR6 C;  2QVZ X;  2D7V A;  4ZLP A;  3R9X A;  1MD9 A;  1MXB A;  2D1R A;  2XR1 A;  1PA4 A;  2AYA A;  1LQL A;  1VLA A;  4RVO A;  2CY1 A;  4GXR A;  2UUB C;  4DUZ C;  2UU9 C;  2JMP A;  3E7X A;  4RM2 A;  2P2M A;  4DR1 C;  3RV2 A;  3C5E A;  3ETC A;  4X62 C;  2ONF A;  5T8S A;  2P2F A;  2UUA C;  4LFB C;  1N2F A;  2VQE C;  4DV0 C;  5JRH A;  1HH2 P;  2UXC C;  3PES A;  3ETO A;  4BC9 A;  4XX2 A;  3EQ6 A;  4OXI A;  4DG9 A;  4DUY C;  1KKG A;  2D27 A;  4RMN A;  3LAX A;  1WH9 A;  1O93 A;  3NYQ A;  2P02 A;  2Y27 A;  3FCC A;  2D28 C;  5A1G A;  4HPV A;  2KZF A;  4PRO C;  5BST A;  3PRO C;  3OTO C;  1MKY A;  5H9U A;  1HR0 C;  5KEI A;  3A9V A;  2UUC C;  4RLQ A;  4X66 C;  2QVX X;  1UKK A;  3UOW A;  4DV2 C;  4L2Z A;  4I9G A;  3IEV A;  4PZP A;  3N54 B;  4FUQ A;  4JI1 C;  1N32 C;  2BH1 X;  3VNS A;  5DV9 A;  5BUS A;  4JYA C;  4X65 C;  5AE3 A;  1JOS A;  1USP B;  4DCS A;  2HHH C;  4LF5 C;  2UXB C;  4B3M C;  4DR7 C;  1EGA A;  4FUT A;  3LNV A;  4KHP C;  2QL8 A;  4DR3 C;  4B3T C;  3TUF A;  4DV3 C;  1HNW C;  1XRA A;  1V25 A;  3SO4 A;  1T5H X;  3UZ0 A;  4DR4 C;  2WD9 A;  4DV5 C;  4JI4 C;  3AF6 A;  3I08 A;  2E0G A;  4U5Y D;  3NYR A;  3I07 A;  1J5E C;  2F4V C;  4L4Q A;  1IBM C;  4ISB A;  2EGT A;  1O92 A;  3LUS A;  3R9W A;  3L8C A;  3IEU A;  5BSU A;  2QVY X;  2Y4N A;  4ODJ A;  5AE2 A;  3IPL A;  2CXC A;  4NXN C;  5KYT A;  1ZB8 A;  4JI8 C;  5K8F A;  2OPL B;  5IWA C;  1FJG C;  4NXM C;  5BSR A;  4X64 C;  4IR7 A;  3S82 A;  5E7Q A;  4DR5 C;  4TPS B;  4BBY A;  5BSV A;  4K0K C;  4BSZ A;  2OPL A;  1WF3 A;  3A4I A;  4PHT A;  3J81 D;  2QW0 X;  1IBL C;  4JI3 C;  1V26 A;  3TDE A;  4GKJ C;  1HNZ C;  5CZV A;  3GKU A;  5BR8 C;  4DG8 A;  3CW9 A;  1N34 C;  4LF6 C;  1XNR C;  4LFC C;  4ZJZ A;  2OO4 A;  1LCI A;  1RG9 A;  1XMQ C;  3VNR A;  4K0B A;  4LF4 C;  2UXD C;  5IFI A;  3LGX A;  1K0R A;  1I94 C;  2VZE A;  4MTN A;  4GS5 A;  4G37 A;  4R1M A;  4B3S C;  2VQF C;  3VNQ A;  1XNQ C;  2E8C A;  1YJ7 A;  4DV7 C;  4LFA C;  3EER A;  2BJO A;  3R44 A;  2HJG A;  1MDF A;  5CZX A;  1XMO C;  1QM4 A;  2YCB A;  3B7W A;  2E8E A;  5A19 A;  2P2Q A;  3FCE A;  4EAT A;  4AQY C;  1FUG A;  4MH4 A;  5K85 A;  3KXW A;  4I9F A;  1QWI A;  1XRC A;  4JM1 A;  2P2B A;  3GPC A;  2E8F A;  5BSW A;  4R0M A;  2ATW A;  3H2T A;  3E7W A;  2V7B A;  3L95 X;  1HNX C;  4D4G A;  1N36 C;  3G7S A;  1NYE A;  4DCV A;  1ML8 A;  1USP A;  5A1I A;  2D1Q A;  5AE1 A;  5BUR A;  4JI2 C;  4RLF A;  5IT9 D;  5A2Q D;  4BC7 A;  4DV1 C;  5FLX D;  1GPM A;  2PN2 A;  3NPD A;  3DHV A;  4DV6 C;  4DCU A;  1ULT A;  2PRO A;  4DV4 C;  5ADZ A;  4GXQ A;  2DYJ A;  1L2F A;  2DPL A;  4D57 A;  3GR1 A;  4WS9 A;  4D4I A;  2D1T A;  3JAM D;  1RY2 A;  4LF8 C;  2PT7 G;  4GKK C;  3J80 D;  1XRB A;  4RVN A;  4JI0 C;  4KTT A;  3N2Q A;  3T1Y C;  4RM3 A;  3NI2 A;  3T1H C;  2E5L C;  1T5D X;  5LMU C;  4JV5 C;  1MXA A;  4JI6 C;  2Y4O A;  4YY3 C;  2P2J A;  4L7I A;  1N33 C;  4D56 A;  4JI5 C;  3AF5 A;  3PBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...