3UOWA

Crystal structure of pf10_0123, a gmp synthetase from plasmodium falciparum
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
550
structure length
517
Chain Sequence
b'YDKILVLNFGSQYFHLIVKRLNNIKIFSETKDYGVELKDIKDMNIKGVILSGGPYSVTEAGSPHLKKEVFEYFLEKKIPIFGICYGMQEIAVQMNGEVKKSKTSEYGCTDVNILRNDNINNITYCRNFSSAMDLYSNYKLMNCCLFENIKSDITTVWMNHNDEVTKIPENFYLVSSSENCLICSIYNKEYNIYGVQYHPEVYESLDGELMFYNFAYNICKCKKFDPIRYHELELKNIEKYKHDHYVIAAMSGGIDSTVAAAYTHKIFKERFFGIFIDNGLLRKNEAENVYTFLKSTFPDMNITKIDASENFLSNLQGVTDPEQKRKIIGKLFIEEFEKAVNNIDIDINKTFLLQGTLYPDIIESKCSLKFKLFEPFKYLFKDDVKTLSRELNLPEEITNRHPFPGPGLAIRVIGEINKHKLNILREVDDIFINDLKQYGLYNQISQAFAVLLSSKSVYDYVCVLRAVKTSSFMTANWYQIPYDILDKITTRILSEVKGVNRILYDVSSKPPATIEFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GMP synthetase
publication title Crystal Structure of PF10_0123, a GMP Synthetase from Plasmodium Falciparum
rcsb
source organism Plasmodium falciparum
molecule tags Ligase
total genus 156
structure length 517
sequence length 550
chains with identical sequence B
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
A PF00958 GMP_synt_C GMP synthase C terminal domain
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3uowA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3uowA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uowA01
3FETA 4QYXA 3NBAA 3D54D 4KTVA 1ZJWA 3RV2A 1JDBC 3TDEA 3KT0A 1T6XA 3A05A 2RE8A 1NUSA 3EZGA 3ZXIA 3OT1B 1J70A 3PQ6A 5H7XA 1O95D 1VLHA 1PG0A 2AZXA 2CFOA 1VBNA 4JYZA 3COVA 4UOZA 2H2WA 3IOBA 3LE8A 3D6UA 4JXZA 3P9RA 2ISSD 5DASA 1P7LA 3COZA 3CNEA 1I6MA 4HK4A 4MW2A 4EF6A 2J4DA 5E9AA 2J09A 3AIIA 1O95C 1OWPA 4QYTA 4ENSA 3D6VA 5T8TA 5HUJA 4ZT5A 2Z09A 4MVCA 1PDWA 1FYDA 1KP3A 1J42A 4YMIA 3KT3A 1PG2A 4GU5A 3B36A 3F5DA 3PQ7A 4L2ZA 1ZH0A 1ULHA 2GOYA 3A4IA 4YP7A 2VTBB 2ZUTA 2QUHA 2X1LA 3G5AA 4OQ4A 3L93A 4L8FA 2XRZA 4LRUA 4MW9A 2DUMA 3DO8A 3RHSA 3MIIA 3RHTA 4P36A 2DXIA 2VPIA 3IMLA 3ISJA 3Q4GA 5K0SA 1BS2A 5J58A 1GLNA 5J59A 3K32A 3FIJA 3PNYA 4U63A 3SZ3A 3IMGA 2YWBA 3KKLA 4ZCTA 4MWBA 2ZUEA 3SEZA 2JA2A 2CYAA 4R2MA 4MUGA 1S4MA 2A84A 5BV2P 4XFDA 1H1TA 1H3EA 3PNVA 3P0HA 4MAFA 1GTRA 1QU3A 1MOPA 1O1YA 2ZP1A 3AG6A 1QWSA 3TTTA 3WFZA 3B38A 4Y0NA 1QU2A 1IQRA 2A1UB 2O5RA 3DPIA 2IUFA 3L18A 1YI8A 4B40A 2WQ7A 1LI5A 4I6JA 1N2JA 2VTBA 1YULA 4HJRA 1MB9A 2IJGX 1JIJA 1N75A 1NYLA 4D1YA 1WXEA 3BL5A 3EFEA 4RUKA 3EN0A 3H05A 1EUYA 5LM3A 1CT9A 1WOYA 5JBNA 1MRZA 1K92A 1WQ4A 3CA8A 2IP1A 3TTUA 4ENUA 4EG6A 4GRIA 3SDBA 4WXYB 3PRHA 3JXEA 4MUHA 4RKYA 4S1OA 3RK0A 2CT8A 1KORA 4XLLA 3AFHA 1JEDA 3GMIA 3L92A 3TTYA 2PIDA 4MVWA 1B6TA 5TEWA 3CLSD 2BTEA 3FOCA 2ZUUA 3EWNA 4K03A 2QJTA 1YUNA 5DB4A 3L3BA 1KH2A 2ZUVA 4OUDB 1JILA 2A1UA 4AUEA 4B5KA 4L4QA 2CUZA 2VRNA 1EFPB 1KQNA 3ZJ5A 1GAXA 3R76A 2NZ2A 4FZJA 4YP6A 1O93A 1NI5A 5SY9A 2E0IA 5H9UA 3CLSC 1V47A 1KXJA 1G2IA 1PFVA 1JECA 5FO0A 1QRSA 1IRXA 1COZA 3LOQA 4NDNA 3FIUA 3TTSA 1XNJA 1N2OA 4MUKA 3P0IA 3SYTA 3ND5A 3L7NA 1RG9A 3ZXSA 1I2DA 1XNHA 3FDXA 1N3LA 2D7JA 3NOOA 3FHJA 4N12A 1EXDA 5A1IA 1Q7RA 4MW6A 2H2AA 4GE3A 4CDNA 4S0ZA 1KKUA 4ZT4A 4BFLA 1OBHA 2OV4A 2E89A 4NATA 3TTXA 5K0TA 5DK4A 2C5SA 2X1MA 3OTWA 2NV2B 1IQUA 1P5FA 4Y1GA 4Y1RB 4OUDA 1C30B 4DDKA 1OX5A 1IQ0A 1EFPA 1RQGA 2Z08A 3NV7A 1TYAE 4OJMX 4HCJA 1T6YA 5IJXA 3GRAA 1OWOA 4MWDA 1TFUA 4MW0A 5KCMA 3A2KA 3MLAA 2R1TA 4L8WB 1D2RA 4JFAA 1MXCA 4MWCA 2J08A 1X6VA 2XRYA 4ZT2A 3CVUA 3LCJA 4KR7A 1Q11A 4MW7A 3I05A 3AL0C 4DNXA 2R1TB 5A1GA 4MULA 2WQ6A 3NORA 4I46A 4X0EA 4ENTA 1O96B 3FNRA 4U8HA 1JZSA 1JIKA 1KAQA 3TS1A 2HMAA 3PXUA 4AQ7A 2CSXA 2WSIA 2ZUSA 3ND6A 2CYBA 3SO4A 3Q10A 4MQ6A 2NSYA 4PBRA 1GPMA 4DLPA 2CV2A 2W7TA 4Y1RA 1FUGA 1VBMA 2A4MA 3IDFA 4HPVA 2V0GA 4UZSA 1U0BB 1GTSA 1PFYA 4BIMA 4EG3A 2LXNA 1EUQA 4I4NA 1JMVA 2GK3A 1NUUA 3SOZA 1N2HA 3FH0A 3IUBA 1VCOA 4K2HA 1CS0B 1OBCA 2V0CA 4N0MA 1R6TA 1O97D 3PNBA 4OJYA 1JIIA 1ZH6A 3P0JA 1A8HA 2DETA 1EFVB 3N05A 3X1JA 1QDLB 5HUHA 2QUIA 3IOEA 1CF9A 1P80A 1OX4B 1GGFA 4I6EA 2H29A 4DDMA 1GG9A 1J09A 4MVXA 3S82A 3HL4A 1YUMA 2WB2A 1U7DA 1XRCA 3KT6A 2ZUFA 1O96A 1KP2A 2E18A 3ER6A 4BTEA 1N2IA 3P9SA 4ZCRA 3CLRD 1HYBA 1VBKA 4UOQA 3CVVA 5IHXA 5EKDA 1O97C 3RBAA 1TEZA 1P7PA 3IH5A 4PXYA 1XRBA 4LE5A 3DV2A 4WS9A 3RFFA 3CVWA 3BWEA 4YP5A 3QTBA 3CVYA 1OD6A 3CR8A 3N8HA 5TGTA 3P9PA 4LGYA 1N2EA 1YIAA 2ZUWA 1I7QB 1WQ3A 4ZCPA 1PDVA 4P2GA 3CLRC 5SY4A 1GGHA 1EFVA 3OP1A 1QJCA 1JZQA 1G8HA 1OX4A 1IH8A 1KH3A 5LFAA 5KHAA 4ARIA 4MW1A 4UCFA 1XJQA 3UOWA 2P02A 1J21A 1G8FA 4ZT6A 4EG7A 3VRHA 1QNFA 1U7XA 1K4KA 2EJCA 2DEUA 3IUEA 4MW4A 4ENRA 1QVZA 3CYFA 4KR9A 1CE8B 4JZYA 2D13A 4E5VA 5LIRA 3KFLA 4ZDJA 1I6LA 1O5TA 1SURA 3E27A 4WNYA 4EFKA 3SEQA 3N2YA 2QJOA 4CT0A 3CY6A 2JAXA 1QM4A 3HV0A 3QTTA 4U7JA 1ILEA 3ZR4B 1NUPA 2PZ8A 4JQSA 2R1UA 4J76A 1MAWA 3TQIA 4RKWA 4ND6A 4MNTA 3FY4A 2YWDA 4KPUB 3ZIUA 3UC5A 1I6KA 2A1TS 4F3RA 4ZCSA 3VGJA 1S1MA 1O94D 3QE4A 1WXGA 2IELA 2OR3A 3FI0A 4AUMA 1F9AA 1KR2A 1WXFA 1MXAA 2HGZA 2QUKA 4YBRA 3IVXA 1MB2A 1OWMA 3CLUD 3ZGZA 1M6VB 3HMQA 1KWKA 1O0CA 2DLCX 2J5BA 3GUZA 3IVCA 4E1AA 4MWEA 4MGHA 3PQ2A 2R5WA 3HFJA 4BWVA 1UCFA 4PY2A 3CLTD 1H3FA 3NBKA 1K9VF 1OX6A 4P35A 5IP5A 3G59A 2V4UA 1MC1A 1VCMA 1N77A 5T8SA 5KWVA 1X8XA 1MBZA 3X1KA 2PZBA 3NVAA 4ENWA 2YY5A 3CLUC 4KPUA 4ARCA 1K4MA 1JGTA 2R1VB 1KQOA 2VKTA 1V8FA 5H16A 5BNZA 2QTMA 1WKBA 1YIDA 1IZYA 5J5AA 2XF2A 1KAMA 1GGJA 3IODA 2BYTA 4OIFA 4L7QA 1NZJA 5K4AA 5JZMA 5SYAA 4AJ9A 3FWKA 1OI4A 1N1DA 4MLPA 5TEVA 4AULA 5HG0A 4B2YA 1KH1A 1TYBE 1BXRB 1U3DA 3IMEA 4QBTA 1U9CA 1Y42X 4P34A 4ENPA 3N9IA 4MTCA 4R7GA 2GHRA 1WXHA 1QVWA 1U3CA 1QQTA 2WJZB 2TS1A 3SF8B 1G8GA 3X1MA 3UMVA 2QJFA 1FFYA 3MGKA 1O92A 3M5WA 1P7ZA 5FNZA 4I2NA 2R1VA 4EG4A 2CV1A 1T6ZA 4PBSA 4Q93A 1R6XA 4ZT3A 1PFUA 4UZFA 2AD5A 1IFXA 3MMXA 1NUTA 3UJNA 4MUFA 4XFJA 3ELBA 1VHQA 1IPHA 3COWA 2PZAA 2E21A 1JVNA 2QTRA 4K0RA 3FSEA 1GN8A 4EGAA 1NURA 4NX2A 4GUDA 4KTTA 1QTQA 4WSOA 1NSYA 1Q15A 1WY5A 3BHNA 4OGGA 3TTWA 1SY7A 3VU3A 3ZJUA 2NV0A 2D5BA 1WJGA 3UK7A 3L4EA 2RK6A 4QRDA 1T0BA 1JEEA 3H99A 4P5PA 3CVXA 3ND7A 4ZDIA 1ZUNA 4L2IB 2A1TR 4A91A 4AS1A 1QVVA 1R9GA 1VL2A 2X0KA 2VDJA 3Q12A 4Y1EA 4ENQA 2RK3A 3SF8A 3FG9A 4RPIA 3P9QA 4QREA 1L9XA 1O9TA 3ILVA 1T3TA 4ADSG 1MAUA 2YWJA 2DERA 3CZAA 4UNIA 1F7VA 4KKVA 3RJZA 3PQ5A 4KR6A 3H9CA 4PBTA 2I1LA 1T9GR 2AKEA 2O8VA 1M8PA 4NZPA 1N2BA 3NOVA 1TYDE 2QTNA 1M8KA 2X3FA 4HJXA 2DR2A 1XNGA 3NOQA 4H3SA 4E08A 1GPWB 1QRTA 1A9XB 3OT1A 1MXBA 3ZJTA 2B7LA 4F4HA 1M8JA 1I7SB 4DJAA 3AG5A 4B31A 2AB0A 4ND7A 3C8ZA 3UGJA 1J1ZA 1P7YA 3AKZA 1Q77A 4L2IA 3PQ4A 4EG5A 4ZGGA 3COYA 2EL7A 3B3AA 4L8YA 5AHWA 1PV2A 3IVGA 4MUNA 1N78A 2CYCA 4OFWA 1UFVA 2PFSA 4ZT7A 1ONSA 4R2LA 1H3NA 3CZ9A 1F4LA 1KEEB 4OGFA 2AG6A 3DLAA 3U1VA 2YXNA 2G36A 4L7IA 3H9BA 3ZJVA 1N2GA 2VXOA 1KWGA 3ZUGA 1TYCA 4JXXA 4G5FA 3R74A 3H97A 3EJ6A 1FYEA 3HGMA 1M8GA 3INNA 5JZOA 1PE0A 5DEOA 4MW5A 2FEXA 4CQNA 5SY6A 4DE5A 3A04A 1J20A 4MUEA 4R0NA 3R75A 1M8FA 3IOCA 1LI7A 4L78A 2GKSA 1M83A 5TS2A 4I6GA 1IVSA 2RD2A 4NAUA 1O90A 1NUQA 4EG1A 3ZJ4A 1O6BA 1GGKA 2PG3A 4EG8A 2QUJA 2ABWA 3K9WA 2J07A 4WINA 3HZRA 4XSVA 5LLTA 1T9GS 2A7XA 1C3OB 3UY4A 4Q16A 4NAHA 3UK2A 1GGEA 1P81A 4J75A 4ZCQA 3KT8A 1N57A 4B7AA 1JHDA 1MJHA 1O94C 2GM3A 2OQ2A 4UZEA 1GZUA 1EE1A 2A88A 4MVYA 3PQ3A 1M1ZA 3MLBA 3PQ8A 1R6UA 4TS1A 4ZDKA 3SP1A 2Z3VA 3MUEA 3TZEA 4Y1FA 5DFAA 2YWCA 4MUJA 3RK1A 3IMCA 1QRUA 1WL8A 5F23A 1EJ2A 2HZ7A 1FY2A 3S3TA 3GLVA 1Q2UA 4GE0A 2D54A 1J1UA 1IHOA 4HPWA 1PFWA 3MXTA 1Q19A 2JANA 3M3PA 1T36B 3TNJA 1KQPA 2OBVA 1OWLA 3F3MA 3UMMA 1K97A 1TQ8A 3CLTC 1WXIA 1OY1A 1G59A 2DPLA 1WZ2A 3TTVA 1F7UA 4AUNA 4DDHA 4G6ZA 1XRAA 4ENVA 4MUIA 3VU8A 1IZZA 3TQOA 5A19A 2RK4A 4K0BA 4NDAA 4ODJA 4L95C 1SOAA 3G6KA 3SZGA 3TZLA 1DNPA 1OWNA 4CDMA 2CV0A 1KA9H 1VCNA 2A9VA 1I1QB 1O0BA 2A86A 1QF7A 3F71A 2PXHA 5FO1A 1LW7A 3NONA 4G5YA 4P2BA 3P52A 1NP7A 3N7TA
chains in the Genus database with same CATH superfamily
4RSRA 3L7CA 1WAMA 3CO0S 2Q7XA 5DU2A 4EKEA 1J0AA 1LRJA 3T9EA 2VDRB 1I2AA 3BB1A 3KU4A 4PR0A 1EZZA 1BJTA 1PLLA 3BMNB 5IH7A 2RGUA 3NUZA 4BYMA 4OHYA 1N0WA 1TE2A 1BC5A 5C7LO 2UYCA 2PH7A 4P33A 5HZKA 3K9BA 1CY2A 5BWBA 3IALA 2AXPA 2FEKA 1CLUA 3BWXA 3JATB 1V2GA 1YDHA 2CFOA 2PLWA 2VQEC 1WP9A 5D5HA 1G5FA 4JEIA 4Q4CA 3NHWA 3FNIA 2H2WA 3O8LA 3P26A 2NQ8A 5EJGA 3CTMA 2CFSA 1SELA 2PGLA 1C7FA 2VJYA 3UPTA 1JE0A 3P32A 1GNSA 2FEWB 1Z6XA 4GPBA 2CY1A 3SQMA 1IPEA 1E5DA 2ZJOA 3A9UA 1B6SA 2WIAA 2PMCA 4QGSA 3PWKA 4MQLA 4B0PA 5KU7A 3IUNA 3TZ6A 3PJRA 2NAPA 4ZQFA 5I5GA 4G0OA 1ZHOA 3JZFA 1TJ4A 1ONBA 1DEHA 2XB4A 4UVIA 1Z6GA 1RWOA 4JUFA 1P4JA 4KVGA 4N0QA 4IDFA 4C4SA 5JYDA 1SC3A 1ZH0A 2XIQA 3ZHQA 5KO2A 5ALRA 2ZUTA 3KJEA 3PFWO 4CVNA 1MQSA 3F5SA 4ND2A 1B3RA 2PT5A 5JG7A 2DUMA 3QKIA 1IB0A 4P98A 2CB9A 5BT8A 4D9JA 5LWHA 8ADHA 5AXAA 5DP1A 2BL4A 2FEPA 4Q7KA 2JH8A 3OECA 3BFPA 3K2EA 4E4YA 1A82A 2CYAA 3DUWA 1N34C 3PV0A 4HUQB 4KV9A 1CJKC 3LLVA 4OH7A 3COJA 1XMSA 5EGSA 2HQRA 3FHCB 4Y7DA 3L7DA 2ODWA 1LV8A 1O1YA 4D9FA 4J3JA 2YRWA 1TQ4A 1ZD8A 3A1TA 3O4IA 3WRXC 3G9UA 1QU2A 1OKKA 4LJLA 2A1UB 1XN1A 2IUFA 1YASA 3T1VA 3T5PA 4MPTA 3IJEB 3M83A 5FTJA 4LQCA 3AF3A 4B3DA 2AWNA 2JFQA 3BYZA 2H59A 3HZOA 5DOZA 1PBNA 4F7WA 4TLMB 2V7TA 1S8AA 4HAUA 5FR1A 5HUQA 3H05A 1EUYA 1XXHE 2MSKA 2V3WA 1H66A 3EUWA 3P9KA 4D80A 1T9AA 3TTUA 3L0YA 2AJ8A 3CNHA 5CMLA 1PCXA 3PRHA 3EZLA 3ISTA 3NHFA 1U81A 3NHSA 1ZR4A 3H1GA 1R2QA 1Z8HA 4V1CA 4CMEC 1Q1NA 3DH0A 1E6EA 1O08A 1QTRA 2QSZA 3AC0A 3K0KA 3OQPA 4OXRA 1V7PC 4QOHA 5HPYB 1SHLA 3EWNA 1RKVA 3WB0A 5EIXA 3UCEA 2AFIE 3TI7A 1Y7TA 3UGQA 2GILA 4EKNB 3GHHA 2JAWA 1EGQA 2DHMA 4JNKA 3MA0A 3I61A 1HNZB 2CUZA 3EG5A 3O5AA 1EFPB 1T4DA 2B4AA 1F0NA 1QIJA 1KL7A 2P2YA 5AK6A 4GNRA 4KCGA 3E03A 4ZAGA 1THTA 2P68A 3WLLA 3QX8A 5IJ0B 1EVKA 1VI5A 1DRKA 3BE6A 3O74A 5AI6A 4CNBA 3BRCA 4YCMA 5KJ1A 3E3AA 5FV4A 1EFRD 1EVEA 3DMYA 4W5RA 4BQNA 3EG9B 4HWOA 4MIOA 4JC5A 4MI3A 4UBMA 4F60A 3OKFA 1XNHA 1ULUA 3QLUA 4IDAA 4BNFA 3H5IA 2HK6A 1KFJB 1T91A 3MCVA 2DULA 3G8DA 3NO4A 1Z5PA 4NCNA 4YRQA 3ZWXA 2WSSA 1HTBA 1WMFA 1L5LA 5H83A 4ZYTA 4BFLA 2E89A 2VJAA 4MV6A 1I7DA 5K0TA 1Y89A 3L4SO 4BNIA 3JX9A 2JFBA 5B1IA 3R9XB 2I62A 2Q8NA 3E9YA 1QH0A 1FE8A 2FW8A 4Y1GA 4C0XA 4C9BA 5A3JA 2DUWA 3PXEA 2D27A 3Q7PA 4TXMA 1RQGA 1H6CA 1GJRA 2WIFA 4HCJA 1T6YA 2HLDD 3JSXA 4KXMA 4RGYA 2CNOA 1XZPA 5JJLA 3IP1A 4L51A 5KZMB 1NYQA 2DU8A 3EUEA 4LVCA 2MINA 1BVRA 2A9JA 5D6OA 4RM3A 4CPDA 2AW5A 1RI4A 1IDOA 1AKEA 2JZNA 4NEGA 5K9ZA 2HFJA 4KMSA 4QARA 1C50A 3LCJA 2XNDD 5KTMA 3NP9A 5A1GA 3MGCA 4I46A 2MCQA 1R0YA 4ZRDA 2Q6TA 3Q7SA 1BXKA 1N2XA 2PSJA 1WV1A 4K86A 3TS1A 2WA2A 4MS3B 4WNCA 1KTIA 3WYBA 1XD2B 1CJBA 1N8TA 4AG6A 1E9BA 1VBMA 2C3OA 3CZRA 2WKQA 5DCWA 1GTSA 4BAUA 4RLQA 5TC4A 4YMGA 3SOZA 2WKPA 3EH2A 5J4KA 1MVNA 1QGDA 3N74A 2XA9A 5IMBA 4CLHA 3U2QA 5E4JA 4DB2A 1J5EC 1L5QA 4FBLA 1SC1A 2BKLA 3JV7A 4O5AA 4DIFA 2G0TA 4IDCA 2GZ3A 1QYVA 2OHHA 4ILEA 4E22A 4HRVA 4MIKA 2ZWPA 4DILA 4LF8C 3K4QA 3PC8C 5GONA 2XGJA 1QYCA 1QR6A 1U8EA 2GEJA 2PN1A 2WB4A 3T5CA 2UYHA 3DL4A 4UARA 4UUPA 1KP2A 3RVKA 2C4KA 4CGYA 2WIBA 1Y6QA 3BM5A 1GLVA 1Z2AA 1VBKA 3OTHA 3ZHCA 1G7CA 3AUXA 5FD8A 4BMCA 1TEZA 1UM8A 2KMLA 3MCWA 1KK0A 2IP4A 1XP8A 5A2GA 2WT4A 4HDCA 2D4AA 4CKCB 4KI0A 5CA1A 4YP5A 1TIKA 4PCAA 1HMPA 1OD6A 1RADA 5K8JB 2DVMA 4ITUA 1RVV1 2VDKB 3ZLUA 1Z5VA 2D1FA 1I7QB 1LPBB 1CSEE 2HF7A 1FRQA 1I2CA 2C9MA 3ZE9A 4UNRA 4RTSA 3EPJA 4JOBA 2REXB 1N9GA 1NAIA 4PC2A 1DJMA 1V5IA 2N46A 2O8BA 3ZWPA 2BHRA 2AIRA 4X62B 4JQOA 3AI1A 5BSTA 1C3JA 2ETVA 5EE1A 5EINA 4ZT6A 3K35A 2ATWA 1Q7BA 3PRKE 5CBPB 1L7AA 4QAQA 4KSCA 4RVNA 3JVIA 2Y3IA 4QUIA 2XKBA 2KM1A 3C15C 5LDGA 1JQEA 4CMJA 1PWHA 2WJHA 1F8FA 1S2DA 1UFQA 3ETGA 4JZYA 1JLHA 5A4FS 1NN0A 1NULA 4YJ2B 4JLUA 5BW8A 2ZAIA 3TB4A 3TKLA 4IHJB 1T13A 4DLRA 1ISIA 1KEUA 1YMVA 2C2KA 4JEUA 4BZPA 2FPLA 3UJ3X 4EJ2A 4LSMA 2XIJA 3QTTA 2WR8A 1M5TA 3G5TA 1V43A 3NNNA 3ORYA 4M83A 3IO5A 4IDEA 5DGHA 4EJMA 1LDEA 3ZDQA 5HIKA 3DZHA 2VQFB 4OB6A 4A8JA 1KU6A 3LUDA 5LUBA 4L4SA 3PXBA 3UTCA 1S0UA 5KJCA 4TKMA 3ZU2A 5IT9A 3K5HA 2F1KA 2EEPA 4WOJA 4R2XA 2JCSA 4RK1A 1YE3A 1RJFA 3FI0A 1XTQA 1P2TA 2XMZA 3IP9A 3AINA 5CNKA 3V2UA 4JL8A 2D62A 2ZTSA 5E2IA 4A0SA 3KL4A 4KXLA 2RHGB 1SAYA 3L0SA 1GPJA 5EHXA 3KUXA 3HXKA 2WIKA 1T43A 4HSGA 3A11A 4NZOA 1Y5IA 3C5CA 4EUKA 3GLGE 3T7CA 5AO9A 4PY2A 2JK0A 4P35A 2EFGA 5IP5A 3G59A 1XPUA 2V4UA 4CCYA 1RI2A 2C95A 5T8SA 5ALHA 3L7KA 3SC2A 2W98A 3U6BA 2VT3A 1ZY2A 3LLUA 2FH5B 1U2DA 1QK4A 4ID3A 4TXLA 4QVKA 3MAJA 4M37A 2F90A 4RLFA 1KI3A 1Z26A 1GNLA 3MCZA 5LOVA 3AVOA 1IZYA 1RHQA 1LV7A 2QYTA 2X5OA 5LP6C 2UUAB 3QKSB 5DHQA 2JI6A 9ATCA 3VTZA 2PWYA 2O1WA 2CUTA 5JDIC 2ZTUA 3KKKA 5JS8A 3FDJA 4DN6A 3W9YA 3CS3A 3E7DA 1CHNA 1W76A 1A9OA 2H48A 3EGXB 2IZZA 1WDKA 3IPCA 3M1YA 1J0BA 1OV6A 3IO3A 1FXSA 4KFRA 2GBLC 3Q3IA 3OU6A 1GT6A 2O20A 4ND1A 1KK1A 5F64A 2XMBA 3N0WA 1OU4A 4P34A 5ULLA 3TLGA 3GARA 3CLVA 4R1TA 1G38A 4KNYA 1E1QD 3HH8A 3GJXC 1T2VA 5JLAA 2IEZA 2ZIGA 3R7AA 5FOSA 5JFTA 4WOBA 4KFTA 4ES6A 1H4VB 2JJMA 2O2CA 1XZIA 4ZZ3A 3OM9A 4NH4A 4PEVA 3ESAA 2Y92A 1Z62A 2FN7A 4P92A 5LKRA 1GPH1 2YJZA 3VR2D 3JD1A 3E5NA 4A15A 3MMXA 2GJ9A 1GQ2A 2XMGA 5LXTA 3U6KA 3ZY5A 3JVVA 2CVZA 1A2BA 3E70C 4HATA 4M98A 4Z4FA 1OASA 1V1MB 3FMFA 4Y9RA 4L9RA 2ISCA 4CV3A 3P97A 1P2BA 3Q8XB 5IVKA 1XFAA 5IKXA 3UK7A 3IPYA 1USIA 1X3LA 5JD4A 4KRFA 1JEEA 2REBA 2JLBA 1BDHA 4HUJA 3Q7EA 1J8YF 1GSIA 1P19A 2IIBA 1VL2A 3QPUA 3ZS8A 1HNWC 3M0EA 2X0NA 5GZ1A 2R2AA 3FG9A 4ZI3A 3WWPA 2ZKLA 4A0GA 2FV8A 3TUZC 4A03A 1OV4A 1WY7A 3IP6A 1E2MA 4H4DA 3LM8A 4IVPA 1AV6A 2JIOA 4M0EA 4B76A 4DL9A 1KJIA 5DE3A 1HOTA 3IBGA 1Y4ZA 2VPPA 2WU0A 3DNMA 3K4PA 1JIQA 1N2BA 4JLOA 1T26A 3ZLTA 4DPKA 3DOEA 5JS6A 1YR8A 2R8EA 5ES3A 4CMIA 3U0BA 2JLAA 5A02A 4R6XA 3O82A 1KEKA 1BQEA 2IBTA 3FKJA 3E61A 3TOZA 5KX5A 3OJFA 1TZBA 1SU8A 5EXXA 2D2IA 1AKVA 2IUTA 4MICA 2YL2A 1G6OA 4G1BA 4YT5A 4HTFA 5K01A 3PC2A 2AB0A 2IEYA 3FCCA 1GRRA 2OXEA 3UGJA 2AEMA 1J5XA 1W0JD 1J9EA 1P3DA 2GNPA 2XOXA 1ULZA 5LZ8A 3TPCA 4DIKA 5FAKA 3GLIA 4Q9JA 2GF2A 4A27A 1CUEA 4HX9A 3R3WA 2CXNA 3KYDB 1JV2B 1YR1A 4NBWA 5LJIA 3C0KA 3VZPA 4YCNA 2ZITA 2Z2IA 1ONSA 3KS9A 2YVLA 1V7QA 3QPVA 3I6ZA 4DT1A 1XNRB 2W2KA 5LYJA 2J48A 1G20A 5DISB 3WLHA 1U1DA 1S6YA 1VYTA 4M49A 4N82A 5KBYA 1JDNA 1C5KA 2WAXA 1E3TA 2HRRA 1KMQA 1ISMA 2VBGA 4LF5C 3QY0A 1G64A 1KETA 3HFGA 4EPTA 5CG2A 5B7NA 3KKNA 5HRCA 3ULKA 4KAAA 4E09A 3E9EA 1QE5A 1RYYA 4NICA 4GMDA 2I6UA 3C16C 5IVHA 1A04A 4REQA 4B6QA 3L6EA 4Z9YA 5C51B 4L08A 2Q9UA 1Q91A 1KAEA 3B2QA 4FDUA 5LD2C 1MOSA 5ALIA 5FI0B 3RS5A 5IZCC 3OD5A 4CKYA 2FWMX 2M1ZA 3K9WA 4RZXA 3UK6A 1FRZA 1BSVA 5HSGA 1K5HA 1N8NA 4UBIA 5JYCA 4NJMB 2JIRA 3K0SA 3SQXA 4MV3A 3ITNA 3MQ2A 4QUHA 2X0DA 4QEKA 2WWFA 1GVHA 4L76A 5K6AC 1USKA 4UAUA 1UXIA 2OZPA 3VKUA 5FWXA 3WICA 2P30A 2UKDA 3TR5A 2EP5A 1U7OA 5JCPA 1GCAA 1M1ZA 3MLBA 5BNFA 1OXUA 1XALA 2J9FB 2EKLA 4Q12A 3MWEA 4YRLA 4Y30A 3CZ5A 2HUPA 2QN3A 4LF6B 2ERCA 2PH3A 2BUAA 2R4QA 2W8BA 3PFKA 4W5HA 3RK1A 3H65A 2HZ7A 1QKKA 3PQFA 3HJTA 3GLVA 5E6SB 3OCWA 1OBVA 4JLNA 2FE1A 1QJ4A 5D3MA 3S3TA 3V4SA 1GV0A 4RWEA 3VR5H 5KI6A 4UE3S 5A4IS 1ZGAA 3D5QA 2VJPA 2NT4A 3FDZB 1UXKA 1TCCA 5HDQA 2G0NA 4QEDA 4B4UA 2BOVA 1Z0SA 2A0KA 4NG5A 3ZJYA 2QYHA 5JRHA 1L7RA 3ADOA 3U1TA 3K9LA 1OW3B 1VPDA 1YVEI 4OJKA 1E79D 3ZGNA 1U7PA 1Z2NX 4K0BA 3GLKA 3NHPA 4GP7A 1E60A 4U9IS 5JNTA 1CEYA 4HLUA 4BX2A 1A77A 4K2AA 4TMYA 2CHFA 1RCTE 1V37A 4IEEA 5FOUA 1A5SB 1TL7C 3TRKA 3GI1A 2HQ1A 4PVCA 4NOKA 2I7XA 2XNHA 3DXYA 4IWXA 3VR4H 4PTZA 3P52A 1FTWA 1CNEA 1KY4A 2E5LC 2B4QA 2EGGA 4A6DA 1EINA 2DGDA 4K8RB 4N7MA 3RBVA 4IY1A 1JLMA 4WX2B 4WN9A 3G7NA 4YI3A 3PESA 4G0UA 3NT4A 2IW3A 2NPFA 3N59A 2GN2A 4PRLA 3OMLA 4OKSA 5M04A 6ABPA 4RTJA 5GIOE 2RE8A 2E2WA 2JH3A 3M9LA 4Q9NA 3CCCA 1NQAO 2AYZA 2ZZMA 1QUEA 2XY4A 3FTNA 1KY2A 1D2HA 3BWMA 5E6RA 1C8KA 3ETDA 3JALA 3N0XA 4BNNA 4C05A 4L28A 3RLIA 3LT1A 2CXUA 1VJRA 1U0GA 3I2HA 2BKAA 4HGRA 4R05A 3D2BA 4NENA 4DSAA 4NABA 4TRMA 4DGQA 5EUCA 2ISSD 3QLVA 5K09A 1B15A 1NBMD 1PT8A 4GLFA 7REQA 1NGSA 4R8KA 3KZKA 4PF1A 3TQTA 4BWFB 5BNTA 4UE2A 4KH0A 5E9AA 1P0PA 3TR6A 3JWIA 1P1HA 5BR8C 4QG7A 4QYTA 3P2IA 3GLFA 1V0JA 2PX2A 3QMWA 2G83A 2R11A 2CVQA 4ER6A 3TEMA 1WD5A 2EYUA 4C7JA 1UJBA 3TE6A 3RFVA 1C9NA 1Z38A 2ZBVA 2PDAA 2JGNA 4DDTA 3G0OA 3A4IA 2GN8A 4IX9A 4AIRA 2QUHA 3FCUB 3IDSA 4OHZA 3GOQA 1RJGA 4GNKA 1RHJA 3PYMA 6GPBA 1R3UA 5K0LA 1X7YA 1U9YA 1TEHA 1U2RA 1W85A 2VP2A 2ENWA 3R41A 5FI5A 4LSZA 5M29A 1G5QA 2H5IA 3VDNB 4MA0A 1KOLA 2CDRA 4UXHA 3IOYA 5G3ZA 2PJDA 1RJDA 4YNBA 2TECE 1N5RA 1DINA 5KUTA 2JA2A 4R2MA 2B2NA 3M33A 4M6WA 4RMIA 4V1CB 2C4UA 1BCSA 1I01A 2V9ZA 3NHMA 4DR2C 3FBWA 1SU7A 4PLZA 3QE9Y 3L7JA 3S6JA 3NYQA 2PUVA 3W7VA 1EWTA 2X7XA 3LK6A 4RNCA 1G5PA 2QVYX 2H2IA 2WYHA 5DX0A 5IWCA 1P9LA 3L8ZA 4WERA 1L5ZA 1RS0A 5JD5A 1T1SA 3EGIA 3PRJA 4LCBA 2XD4A 2ECPA 2Z5GA 4CQLA 2VTBA 2ZBEA 1YULA 4I8DA 1SULA 4RW0A 2EYQA 4J29A 2NX2A 1C0PA 1H2ZA 1ZHFA 3EODA 1UMBA 1Y9ZA 3LOPA 4AL4A 3WNQA 5JBNA 4NFSA 1WQ4A 2ERXA 4DIMA 4FJ0A 2MTBA 2M6SA 3RC9A 3IKVA 2X19A 5CFMA 5IJWA 4RD6A 3T4UA 3IKLA 4CFYA 4K9PA 5CPBA 2RBKA 3RUAA 3LYHA 2VJLA 4CJXA 1PR3A 1KORA 4D43A 3AFHA 1KWKA 1EESA 4IHAA 3SC3A 3PWZA 5TEWA 3FOCA 3FSGD 2ZTVA 3LRXA 2YMQA 2DWUA 3ANYB 4CMAA 2VSQA 2PL1A 2IVZA 2XSZA 2HO4A 4Q39A 3MTJA 3CEHA 3NKFA 1QE3A 3W1EA 4TXHA 2Q9CA 4ZWNA 3SYLA 2B5WA 2VYND 4DA6A 2Z1NA 4GM1A 2Q6OA 4TRNA 3DVRX 4QASA 3EWIA 4WN3A 3AHGA 4YJGA 3RS8A 2Y1OA 2E1RA 4OIMA 4BLRA 1JRLA 2ZSBA 2ATVA 2B5VA 3O1LA 3PJGA 5IBQA 2EF0A 2RIRA 2H2DA 1ACLA 4J0KA 2XCLA 4RZ3A 1OT5A 2O8FA 4EO7A 1EXDA 2ZJ4A 4Y2PA 3WIOA 4Q01A 1KMMA 3BMQA 4PFKA 4D3ZA 3A70A 3FAKA 2P2GA 1T0UA 4X7BA 4EPWA 2PX8A 2PMDA 2ID9A 4J90A 1W4RA 2RH8A 4DA7A 2PGIA 3CG0A 3ICVA 1QZZA 2O2GA 3NW9A 3FRIA 2BIFA 3HSYA 1PQPA 4LJRA 4JYAC 2C57A 4RACA 3C3BA 4Y3UA 4PFJA 3L40A 4MRVA 5FA6A 1I33A 5FOVA 5FOTA 2XH8A 4DPLA 4IJMA 2PMEA 1GXSB 2R1TA 1TKAA 3FROA 1X1CA 4HDNA 5ALVA 3OJWA 3RS4A 2AQHA 4QECA 4ZT2A 1QIKA 2OXTA 3UG6A 3CVUA 1CUJA 1AKUA 1FLDA 1TF2A 4MW7A 1UQUA 4L4YA 4V2UA 5GONB 5A62A 2J0SA 1RP1A 2D1SA 3EIFA 4HDMA 4RAOA 3OZ7A 3T38A 1M1NA 3KQOA 1PTJC 1EM8A 2PUJA 3LCCA 4GR9A 4TTRA 5B6PA 1QANA 2G80A 3L6DA 1KAQA 2HEIA 3VX4A 4LF7C 4MKIA 3IB6A 3RYTC 1ZHHA 1EGHA 2NTVA 3AL3A 3SO4A 2VATA 3KK0A 2NSYA 3K5WA 1Z5OA 1KHTA 1YNSA 3K30A 2AN3A 5FBHA 1KS2A 4UZSA 1UPCA 3PTZA 2VT6A 1BX3A 1R8SA 4IQGA 4QLBA 5CA1B 3VPSA 3HR7A 4IJ5A 3LUHA 5D7NA 5FBKA 3AONB 2AS0A 3CM0A 3ZY6A 5MFPA 3A9RA 2AYYA 3A1SA 3O31A 1ZUHA 1H2AS 1Q74A 2BMEA 2RCYA 1KS9A 4WEOA 1BGVA 1IBLB 5BQPA 5ENVA 2C82A 1NUAA 4AM8A 1GYPA 2DP4E 1XBTA 3IAEA 4PYRA 1N9GB 5ICCA 1CY6A 5EHGA 2JRCA 4PYKA 3IIIA 3EZ7A 4A82A 3KDSE 2O8BB 1X77A 3HL4A 1I2ZA 1H05A 4Q1BA 4JT8A 4RXUA 5HQ3B 5JNSA 3ER6A 2M6LA 2LPMA 2VWQA 3K15A 1N2IA 1AKRA 1CK4A 4ZK6A 4CE6A 2ZJ5A 3BQMB 1V96A 2GZ1A 5E2BA 1M6XC 3ZU5A 2Q6IA 2RHMA 1E63A 2WQZA 4MEJA 4TWBA 2WAAA 2PK3A 2QZ9A 1FJXA 4TZ6A 2OORC 2P3LA 3DB1A 3PZBA 4GVLA 4J1TC 1I80A 5EP1A 5EPOA 1GG2A 3WGHA 2ZB7A 5F9HA 3I3OA 4W5NA 2FMKA 3AJ9A 5ALXA 1VJCA 1DFIA 2NU9A 1YR6A 1YIAA 2ZUWA 5GV7A 5J40A 1XHLA 3K1JA 4A8JB 4DV2B 3T1YB 2OXFA 4RD0A 1G8HA 1DARA 4PG6A 1WXQA 3QNWA 2YV4A 2KZFA 3DOJA 1PNRA 5JISA 1E1KA 2B4TO 3OJEA 4HWKA 1WW8A 5B3KA 3LKZA 1WB6A 2P2MA 3OCYA 3GT3A 4KMMA 1K4KA 3THRA 1PVOA 2YNMD 3RVSA 5JJIA 1USVA 2NCLA 2ZTLA 2DC1A 2ZT5A 4B2IA 1AVTA 4YAUA 5JJ5A 2QL8A 4MJXA 4MB6A 4GZLA 5KTPA 2YC2C 2Z4RA 1SG9A 2EG5A 3J80D 4C2AA 2D7CA 5JC1A 5AI5A 1TXGA 1ZXXA 3JQQA 3MAAC 1DS6A 4EY4A 5D3ZA 3IAXA 3N2YA 4F8JA 3ADBA 1RVDA 1D7OA 2WVHA 1LQUA 4L4XA 5COQA 5J4YA 1V6CA 4KR0A 1SVIA 3OWXA 5B4VA 4CCYB 1FCJA 1MAWA 5K3AA 2IS1A 3SC2B 2W71A 4GO1A 2GZRA 4I3FA 1C9JA 2N42A 3QXSA 4CF5A 3F96A 5C8DA 3C6BA 2BGIA 2YX1A 1GRQA 1F1BA 1VXRA 4H2DA 1FTSA 2X41A 1XR3A 4FI3F 1EVJA 2CJWB 1R10A 2X0JA 3TQFA 2JJ8A 5LOVB 1JQBA 4YR7A 4JUCA 2MU1A 4ZI7A 4H27A 1QO9A 3VR3A 2Q5EA 3UPDA 1JFSA 2QTBA 1ENYA 1W9MA 2Q4OA 4G0VA 1LNQA 4IYJA 5JZBA 3HL0A 2G70A 2P3QA 3GZNA 4G1MB 1KI6B 5ITVA 2ZBPA 1ZBDA 1UCFA 3PGJA 2RARA 4QVIA 2ECKA 1P6QA 2GJAA 3TLGB 2N3ZA 4Y9SA 3ER9A 3E4CA 1G18A 3G2JA 3IQGX 1W36D 2ECFA 3PUKA 4HB4A 5LKAA 3SQOA 2EWVA 1WD7A 1UQRA 3GBPA 4OB8A 4WFKA 1OXTA 1R0KA 4YCAA 5IBCA 1L6RA 4LDRA 2VDMB 5FNVF 1N1MA 2QVCA 3RODA 4FWIB 3VMMA 1U80A 3OEED 2QTMA 4MRPA 2O52A 4D98A 3EISA 3KX2A 3OPQA 4JI0C 5LXTB 3ZWYA 5IWAC 1BCRA 4IJUA 4M9XA 5DWDA 4ZANA 3CCBA 3IV6A 5BUZA 2PUDA 3FW1A 2X9NA 5JZMA 4IDDA 2AG8A 2IUSA 4KB5A 1H1LA 2ILVA 2VHUA 3PXDA 4MLPA 2VHYA 4F6RA 1G8KA 1O9HA 4AI6A 1K2WA 1E98A 4FGKA 3BXFA 1EWQA 1XGKA 1CC1S 3GRUA 1GFIA 5GTDA 2PCJA 3KZCA 4HWPA 4MAAA 3EF0A 1XFDA 1XZQA 4CDGA 4DBVO 2G0AA 3E3OA 1KO5A 2JLZA 2IIPA 3AKDA 1NM5A 2HA6A 2Q3MA 4AJ4A 3F3KA 1CEXA 3Q3CA 4JT2A 3D2LA 4K46A 4XJTA 2Y05A 3UMVA 3ZCPA 2IS4A 3NTQA 2X6RA 4EG4A 1VA5A 2GD0A 1NBEA 3D5EA 4Q93A 3D0KA 3ONDA 1X80A 2WD8A 2FPWA 5EXPA 1JS1X 1DJNA 1XZLA 3JAWA 3M4ZA 2QN9A 3NWBA 2EU8A 4MYRA 4IHQA 3FA2A 4CMIB 1D07A 4JJIA 3DLHA 1RXIA 4M0MA 4K0RA 3FSEA 4KUGA 5KX5B 4DG5A 3QBDA 2YXBA 3UW1A 4B8YA 4WBSA 1I4DD 1BW9A 1Q15A 1QWOA 4GZMA 4HTFB 1MJGA 1XLTA 2EBUA 4WKPA 3A7DA 2R6AA 3G5LA 1LFAA 1G9TA 1N3IA 3ZS9A 4EECA 1L6IA 4ZDIA 4GD3Q 1EQAA 2QB5A 3VAZA 4BO4A 3IVRA 4EGQA 3GLIB 1WPRA 2ZB8A 3Q5GA 3KHTA 3UG7A 1AZSC 2WJJA 3VYRB 3NTRA 3IV7A 4R1LA 1E1NA 3DZIA 2FOLA 1EWKA 4QBKA 2BWJA 4N3NA 1P91A 2JGLA 1WPXA 2IKSA 2W2KB 3TOXA 4GG1A 4DT1B 1T9GR 3I30X 1M0WA 5LYJB 1FPQA 4LHXA 4A0HA 4L5YA 4D4JA 4AROA 3IAS1 1TYDE 2VP4A 3PNPA 5THQA 1RQXA 4PWYA 3KSUA 1T3SA 1BVYF 1GPAA 1XZMA 3DE6X 2F8MA 4E08A 3NANA 2QL6A 2MIIA 1TA9A 4BLPA 3GIDA 4TN1A 2PWZA 4FWBA 5KNCH 1HK7A 4KXFB 4Q3NA 4ECEA 5IJZA 3T9DA 1RACA 2P35A 3UAVA 1DJPA 4B6RA 4REQB 3U7QB 4N5IX 4G97A 4D9BA 4LE2A 3SDSA 4JITA 2BEWA 1Z7WA 5KHOC 2ZTHA 5BYAA 3B3AA 1M6EX 2JNWA 2FN8A 1MH1A 2JLSA 3JWPA 3PGKA 3H5TA 4TLBA 4AP5A 1CULC 2WM2A 3C3YA 4CQMD 8AT1A 3Q5EA 4GXTA 1X1DA 1H3NA 4W7IA 4BLSA 2R47A 4JR0A 3HJCA 3NVKI 1T4MA 1IHYA 1RXYA 3A9TA 3NU1A 5FADA 1UBEA 4UHJA 3VZBA 5FWXB 1HFEL 1M8GA 2IK8A 3NDIA 3NIGB 1L4LA 1Y1QA 2B4RO 1YB2A 4OBEA 3T6KA 3QXCA 3MWEB 2I71A 4G4GA 2I3ZA 5D2CA 3SYKA 3HKBA 1YMQA 1XI2A 2OHJA 1A9RA 1UUFA 2W8BB 3A2LA 3IQWA 3JD4A 3AF0A 4GGOA 5KNCD 2ZJ8A 1VKZA 5D3MB 3E48A 3GN2A 4IS2A 1UJCA 4Y2YA 1UZNA 4ZXPA 3VFDA 2VTKA 3ZJ4A 4B87A 2UXCC 4B7ZA 2ABWA 5KU1A 3KJIA 1QV7A 4MR8A 3UMJA 2NIPA 2GYWA 3DTYA 3HZRA 1Y3DE 4CFZA 4DCVA 1W93A 3UOGA 4DCOA 2VDNB 2AC4A 2Q1YA 3MRSA 1B00A 4NAHA 1YFLA 1C8BA 3VGPA 4HS4A 2DWPA 6CHYA 1VKHA 1TLLA 4PSKA 2H1CA 4OREX 2VNSA 3AY0A 3FCSB 4RHFA 3UGTA 1CCWA 5JVDA 5KNBA 2GM3A 1E0DA 3DTTA 4BNZA 4LF9C 2HU7A 3UO8B 1EE1A 2QBYA 3PQ3A 2XUOA 4JYPA 4ZGBA 1Z45A 2JJYA 3GAAA 2D1RA 4E3ZA 1W35A 4HNUA 2HYDA 4ND8A 1XWIA 3LKBA 1NW6A 3INGA 2ZSJA 1VFPA 1OC4A 1PWYE 1WMEA 3BL6A 3E3NA 3GG9A 2PSEA 3HVIA 3C3KA 3KBBA 4OM8A 1R15A 2YVUA 4NS1A 5G41A 2A58A 3PZRA 3T34A 3WYEA 2PYZA 3HVUA 2R48A 3HWWA 3I53A 4UD6A 4ZKEA 4BFSA 3QWAA 1NFRA 1OWLA 4WN9B 4MO9A 5HMMA 3WNZA 2PO7A 3RYHA 4WLEA 4JI2B 1CERA 1E3WB 3TTVA 4RF2A 3C4VA 3BWBA 3L2OB 1C7QA 3DPUA 4AO8A 3OURA 2Z8YM 3THSA 1B0PA 4KRGA 4F2WA 5IDXA 3KU1A 3G1TA 5JNWA 2H1OA 1EE9A 4Q15A 1V6AA 1RY2A 5E6RB 3JALB 4CQJA 3G85A 3LKVA 2J30A 2QN8A 4G5XA 4MV4A 2XJ9A 4PXYA 4NPCA 2ZR0A 4YIHA 1BA2A 3OCVA 4GWKA 4HAIA 2P2QA 4E5DA 2R97A 3SBDA 3RC1A 1JBQA 3O26A 1T8TA 4HFJA 5FO1A 7REQB 2OKGA 4JMPA 4P2BA 5COBA 2VOEA 3DJYA 1FMJA 4GKAA 4W99A 4K88A 4OQFA 5AJTA 5DTIA 2P4EA 3OM0A 1QIIA 3NBAA 1I94C 3CQ9A 1JDBC 4BNUA 1M34A 4B3BA 3TDEA 3W9SA 5EKTA 4D6PA 4AY5A 2LKCA 4EO9A 3LIIA 1YJ8A 3OOEA 5BSHA 1JXMA 5AXCA 5IFLA 2FNAA 3LXXA 1FSZA 1OJ7A 3O4FA 1TCAA 3WNBA 2P3OA 4G5OA 4U7HA 5CXXA 2JAOA 2YW9A 4PUGA 3NYWA 3Q7QA 5BSKA 2YMMA 1X7YB 1USWA 2R8BA 3WADA 1GGMA 1WKCA 3F2IA 1TUBA 5LZ7A 2X13A 1R4ZA 4K0KB 4B74A 4Z49A 3L7OA 4KQMA 1P7LA 3IKJA 4M6WB 1VMDA 3HUUA 1HT1E 2E4ZA 1BCSB 2XYVA 1M74A 3A36A 3AOEA 4HZIA 5TB5A 3Q6IA 1DBSA 2AVNA 2J09A 1T9ZA 3AIIA 3GT0A 1PS8A 3N3AC 3R0ZA 1IXZA 2B69A 2YHIA 2V6GA 2G1JA 4MVCA 1TQ2A 4ER5A 3ZPXA 1UOQA 3VNSA 1RFLA 3FHTA 3I73A 3G2KA 1JAHA 3F5DA 3PQ7A 4JBHA 1GVNB 1P9WA 1ODJA 4CQLB 2R62A 4RCVA 2VTBB 4Z8YA 2PUBA 2ZJFA 2CU6A 4ZVSA 4FWTA 4NV1A 1IN1A 3E7XA 3SIXA 3MIIA 1CIVA 3WAGA 3M7IA 4MIEA 1UMBB 3O4GA 4RH1A 3SX4A 1M5UA 3NYIA 1BU8A 2Z04A 3CHYA 1GLNA 2BH2A 5JPDA 2FDXA 5C8YA 3KKLA 3WLJA 5JSFA 4WLUA 4LYEA 5H5JA 2F67A 4P0QB 2A84A 1Z2DA 4M1SA 4I8XA 5BSEA 3PF9A 2XKAA 5AKEA 3JQEA 4P5DA 5HA5A 1PJLA 5BN4A 5DNUA 4MPPA 2FMUA 1N6LA 3O1JC 3PIIA 3TTTA 1PJ2A 3AG6A 3GFRA 5C3MA 3TSCA 1EA7A 2EHDA 1ZN9A 3NATA 3JWEA 3DPIA 4EWLA 1QVAA 4YJ3F 1ZK3A 1YKSA 2G8LA 3UH1A 2WUGA 3Q85A 2IYYA 1RHKA 1V16A 3FTDA 3TW6A 2YV3A 1PT6A 1MNQA 2PY6A 2AW3A 3MRTA 1X7WA 5LJLA 1ZOPA 3EQ9A 3RQSA 16PKA 2CY0A 4D1YA 4PO9A 3KVRA 2G63A 4YJGB 2FWIA 1VIDA 1U4SA 3QLTA 4DM3A 3EXG2 2FPOA 2JBWA 1ODCA 5JSYA 4ZXFA 3ZZNA 1P62B 4UAJA 4WCFA 5B1HA 2DF8A 3VKFA 1SKYB 1DX4A 3NC4A 1WXWA 2GASA 2ZG6A 1RLTA 2FZCA 3BB4A 3JXEA 4FE3A 3TL3A 2FZGA 4TZ0A 2BH1X 1PJ4A 1HH4A 3IRVA 5B3JA 3TH5A 3A2NA 3VJLA 2CNDA 3BMQB 3OJLA 2C4TA 4KAXA 2XUZA 3RIYA 4EZEA 1HR0B 2B7CA 4YDQA 2BPOA 4IMRA 3RSZA 2RBGA 3A9CA 4N0PA 4FK8A 1K0UA 2IT1A 3EQ7A 2J5XA 4WZBE 2I0FA 2BMDA 1JFFA 4LJKA 2JBHA 2GK6A 2QW8A 3NM6B 4KDFA 4QJ3A 1AURA 4FYMA 5AW8A 2IU6A 5LBUA 1XZGA 5CFLA 3L6OO 4H3KB 4C4XA 1X1EA 1FMCA 3EF1A 1JWBB 2R1TB 3DKVA 5FO0A 4HDNB 3L07A 4H60A 1OGYA 4IIBA 4LJ8A 4RDIA 2Q3HA 3LFUA 1ZOLA 2BW0A 4KAFA 2XNCA 1F5NA 5CDUA 4U7FA 4BNJA 5BXQC 3HNPA 1S4QA 3KWJA 4HDMB 1M1NB 2LNDA 4CUJA 2OQVA 5C9ZA 3C6MA 1EM8B 5IK2D 3WGVA 5I9MA 1XTJA 1XMQC 2AFVA 4YAOA 1KNXA 1LDBA 1SG0A 5G40A 5KOYA 3RUPA 2FRDC 2A9QA 4LXYA 4FYPA 1BVHA 1IQUA 4KTVE 1L7OA 4DDKA 1YKGA 3HUEA 4ZRNA 5GZ3A 3O03A 5HTOA 2CNLA 4WBNA 1IJKA 2QGFA 4WE3A 1T5BA 2C5LA 5CT5A 4MVJA 4BE7B 4PYQA 4HWGA 3VOTA 1RSZA 2B4KA 2P41A 4RVCA 4COKA 4XI9A 1GUAA 2JLQA 3L8MA 3IOMA 4HVAA 1WZCA 3BDAA 4MWDA 5EPEA 4A2WA 3COSA 3VXKA 1EX7A 1XMOC 4O4LA 5BQFA 1UBLS 3L95X 1C1XA 3RHFA 4HOYA 2VWGA 3T0IA 3B1WA 3DF7A 4JOCA 5A2QD 1Q7EA 4R5MA 1L4EA 1C3EA 4BLWA 3C8UA 2VPZA 4I14A 4W8GA 1FL9A 4F85A 3PDWA 2WTUA 1O3YA 3AVPA 4A0QA 1H8EA 1JU3A 1ZCBA 1ZIDA 3ZDYB 5FPYA 1FS5A 1JIKA 2MYPA 3O9MA 2ZUSA 3ELUA 2I4RA 1QXSA 4L5BA 5KSZA 5GADl 4RJKA 4MSUA 4KXWA 3X1XA 2C07A 2W4QA 4X8MA 4HPVA 1QQ6A 2C2GA 2DR0A 4AKGA 2IU3A 1BWSA 4EYGA 3WB2A 4DMRA 5BUSA 1NUUA 5AE2A 3LVBA 1L5OA 1J24A 4LJ6A 1VCOA 5E1MA 2OGSA 3KR9A 5F1KA 4EJSA 4F46A 1NJ5A 2Q07A 2NU9B 4LC1A 2EARA 2ZATA 1JIIA 1A7JA 2YYAA 3PL1A 2V5UA 4AJ1A 5LU9A 2YOHA 4OHVA 1A8HA 2VHCA 5EMHA 3TN7A 1C0KA 1NP6A 4CLOA 1XTIA 1KJYA 4MJ3A 4ZQHA 3GCWA 4W9NC 5T67A 2H0RA 4LOIA 3T52A 1NU6A 2LTAA 4MCIA 1UDXA 4IDNA 4ZICA 2UUBB 1OB2A 1GFWA 3LHDA 2PV7A 3I08A 5C5DA 2G9UA 4BV3A 3EXIA 3MJEA 2LVBA 1JXOA 3COPA 3JARA 4J0EA 3A1DA 3RBAA 1P7PA 3DEAA 3PGLA 1ZD1A 2O1SA 2WU8A 1FX1A 1VQ1A 1YZVA 3Q8LA 4L4ZA 3SSAA 3JQGA 4I1UA 3TLCA 5DGIA 3NZEA 4W7HA 2C04A 1G5RA 2IHUA 3N7UA 3RS0A 5LZ9A 2HCRA 4CMGA 5TGTA 3QXJA 2NU6A 1I2MA 3GP3A 1QBGA 3BL8A 3G8CA 2JVKA 3SHVA 1EXWA 4ZQBA 3S68A 4RDHA 5CA0F 1VP9A 5EZYA 3R9IA 3U7IA 2MR5A 2L19A 2DM6A 3F9RA 4AKTA 3QW2A 4E2YA 4QFCA 3ZC3A 4IWNA 4UTVA 2P02A 2HCFA 1GQOA 2UXBB 3OPXA 2DQZA 1B23P 5F21A 1IN7A 3EQ8A 1FLVA 3ADCA 1JKXA 1HOXA 4ZI7B 4BV2A 2WPNA 4HFRA 2A57A 2C3YA 2R7AA 3HKDA 4FSDA 4M54A 2AT1A 3D8HA 3QE2A 5DSZA 3M2TA 2Z51A 1CRQA 1OXSC 3AKCA 2Z6VA 3RRYA 5ABPA 4RJJA 1SH7A 5C5CA 5JY6A 5K85A 1L4YA 1MUUA 5LIRA 4ZDJA 3GZNB 4DNFA 1EVIA 4IGEA 5EPUA 1GTZA 1PWEA 1PZHA 3GJ5A 1VLAA 4BN5A 4G4JA 1ORRA 1UOPA 4RO0A 3E8SA 4PNPA 1P17A 3A3PA 3C7AA 5FULA 4ND6A 1ZS9A 3FY4A 3QMPA 4WKNA 4UM5A 4OP2A 2P1DA 1DQPA 3D8BA 4H18A 4H3VA 2CXHA 5NULA 5K45A 2INGX 3KHSA 4DWVA 2QAGC 3K0CA 3D8RA 1RC8A 2W2NA 2WTNA 5T4BA 4PAQA 1BCRB 4XVCA 4TYNA 4KJXA 1EFTA 2GSDA 1XRPA 4PO8A 3TQHA 2IYSA 3KKMA 3DONA 2E85A 1H1LB 3FBGA 3WJ7A 4IKEA 5JHGB 3BGIA 4F6RB 3J7AC 1J8QA 1GOTA 4LS3A 5DP2A 5FX2A 1OXMA 4BLTA 3HDTA 4FI3C 3B7GA 4FMPA 5FTKA 3FZNA 2NSDA 3M34A 5SZIA 4B3SB 3H4TA 4QDUA 1C4WA 1MC1A 1OH8A 4PLHA 4BN0A 4YXWD 2UZ4A 4JN6B 5EKXA 3TEJA 2Y77A 3A2MA 1N5JA 1LQ2A 3LWZA 4LMRA 4FW9A 3QJGA 1YO6A 4PPQA 4Z9BA 5LLSA 2P9QA 3EASA 3G2HA 1KE1A 3S29A 1UEIA 1N9KA 3P2OA 3NWJA 2H1RA 1X80B 1PYDA 3P0EA 3JAWB 3NVDA 1UK6A 5J5AA 5IBRA 1AX9A 5GIPE 4OHKA 1BGWA 3GBSA 5JYEA 1W36C 4MQBA 4RLSA 1C2YA 2B1GA 1IG3A 1D1QA 1M6VA 1V7ZA 2H2GA 2HEGA 1QIMA 3KXPA 4FPXA 4BO5A 2GM4A 1BW9B 3JQAA 3ONWA 4HXYA 4BP8A 2PUGA 4A8PA 1SVLA 3JYNA 1KAGA 2FSVC 4HV4A 5JAUA 4MHSA 4TKLA 2DYJA 4N41A 1TO6A 5CGZA 2H1HA 1TECE 1U3DA 3K2IA 4QBTA 3HRKA 4NYMQ 3HDGA 2RGCA 4MTCA 3RRXA 3T0FA 2GAFA 1QPGA 4EI9A 3HXQA 6REQA 5AFSA 3NEJA 2AVDA 2ZI3A 1EWVA 2VYVA 4LXHA 4TT3D 3N87A 4B6FA 3TQRA 1WNTA 4LY9A 4TL9A 1FFYA 3LO8A 2WF6A 4M0KA 4P4SA 4C1NA 3JQDA 4NXMB 4POAA 4IOLA 1MR3F 1FP6A 1R6XA 5GJCA 2HMUA 4U6NA 1KYXA 3R7DA 5B55A 5IDWA 3ZW8A 5K0EA 5CLIA 4FD3A 3ELBA 5BOSA 4DUYB 3COWA 4NK4A 3F73A 2PX3A 8ATCA 4DIOA 1S3GA 1NURA 4JYCA 1BMDA 2FMIA 1C80A 4PQGA 4AU1A 3FYDA 4A2QA 3VNVA 2BLLA 1KQ3A 4OK3A 2ERYA 5HJ7A 1L7QA 3IE1A 1QO7A 1BXRA 1EB8A 1AUOA 3ND7A 4JWKA 3HKEA 4RPKA 4D8UA 1PG5A 2BEWB 2H2FA 2CWWA 2O05A 2X0KA 3HCPA 2QHXA 1Y1KE 3FF4A 1SZDA 1J1IA 3TR0A 4F12A 3AB7A 4P3PA 1RPAA 3VKVA 1O2DA 1SOMA 1E94E 2Y1XA 4IDQA 1Z2EA 3A10A 3CZAA 3FGPA 3W2FA 2WNIA 4KKVA 1F7VA 4YDSA 1JXAA 1OIVA 4RS3A 4BV8A 2QIPA 1L5NA 4I2VA 4M99A 3QSGA 1T2EA 4DLUA 4UHCA 3Q5DA 3KEMA 1P73A 5IABA 4P58A 2AXNA 3M4XA 2PH1A 5J23A 4TYYA 2YINC 1SUDA 4LQ4A 2XWQA 3OHSX 3WJ2A 2XWSA 1P60A 4LHSA 5HIAA 1M8JA 3W5UA 4CIYA 4X1IA 4G65A 1X19A 2G9ZA 1YAJA 3U4CA 2QRKA 3BG5A 1NMSA 4HDRA 3V4VB 1J1ZA 1NI4A 3FFTA 4J3FA 1O7JA 1GQFA 3B1JA 1OYWA 2YJTD 4INPA 2BM9A 1Q0RA 4MR8B 1PV2A 5AHWA 5TF4A 1QVRA 1VCHA 1LC3A 1R5JA 5I4KA 3F7OA 3HB4X 3PHHA 4WFQA 5CP8A 4ZT7A 4C7OB 2OMEA 3NHBA 1Q0QA 5JH7F 1SRQA 5TPWA 3AP2A 3AVWA 3T61A 1UT8A 3E2MA 4GLOA 1GZ6A 4RE6A 5JVDB 1PKXA 3G0CA 2EOAA 1N2GA 1NL3A 5K03A 5LMZA 1XEFA 4M8IA 4F8EA 2WU3A 3INYA 1KI2A 2VO1A 4U9UA 2QBYB 3H0KA 3VSEA 3A1EA 3HBJA 9LDTA 4N4AA 3AFOA 4BGEA 4AQDA 1SO8A 5JXWA 2GO1A 2PD6A 1PJCA 2YRXA 4ND8B 5IM5A 3G2PA 5BSWA 4ZHSA 3MAGA 2VP6A 1I1NA 3BXPA 1F12A 3M6IA 4NBNA 4YPVA 2C4WA 4V2IA 1C9YA 1E2KA 1UK9A 1HRDA 3DS8A 1ZKMA 2Q2VA 4G0NA 1GPUA 2YS6A 4KE7A 4TMWA 1GL9B 3UA3A 4R2JA 5C7OO 2GJSA 1AUVA 1GGKA 4M0DA 5AUOB 1R4NA 1FBTA 1JL3A 5FPQA 3IERA 4OPMA 3RYHB 3WMXA 1H0SA 3GJQA 3ZBTA 4BB5A 5AVZA 3C3WA 5K3CA 3ZKWB 2QX4A 4EW2A 2A7XA 2DCMA 2FSUA 2XCIA 4MZDA 3M4NA 1KJZA 3QY9A 5DYYA 3ZBQA 4DAOA 3EOAI 2PLFA 4QOJA 2J0EA 3TLEA 4IUBS 1YGPA 3O2JA 1RAEA 4UEWA 1AQLA 5B7GA 4ED9A 4CN9A 3U4DA 4ZJZA 1EB9A 4M53A 2HDOA 3P9CA 2EJBA 4BS9A 3EX7C 2DKNA 1B4DA 1JG4A 4RETA 1L5HA 2H1SA 4HRYA 3H19A 2HJVA 4Z4HA 1WDLA 2CNWA 1OAOC 3E1GA 4TLDA 3FRHA 4WDRA 1YQ9A 4KAJA 4X44A 1FY2A 4DYHA 5C8ZA 5KVVA 1FRNA 1J1UA 4AB1A 4BNMA 5L3VA 3FLMA 2ZI6A 1LWNA 3H87A 1YQQA 3M3PA 3SWWA 4V0SA 1FP7A 2DOKA 2OBBA 4YR9A 1YB7A 1TQ8A 1DO8A 2SBTA 3HDQA 1A88A 1QB8A 4IGKA 3N6XA 4D9KA 1Q0TA 4OFZA 1L1QA 4CTMA 2DJ5A 1R9JA 3HO1A 2FQWA 2DLDA 3EVDA 3ETOA 5JUWA 4Z2YA 2AZ4A 2QN2A 1NIPA 2IUEA 2JH9A 4RESA 2X7HA 3ZD9A 1X92A 1Z34A 1DNPA 3QLEA 1TUBB 1B2RA 4Y6GB 4F11A 3VR0A 1J97A 2C9CA 3RTCA 4UQLA 4TV9F 4ZGWA 3I5XA 4PIMA 4IILA 4URHA 3F98A 3NONA 3QKRA 4BQEA 4NCKA 4G5YA 5F3DA 1ZLXA 3U5TA 4F5WA 4L50A 1I10A 1L3IA 3ZV3A 2IZ7A 2VCEA 1KDYA 3G6WA 4HNGA 3ZQ6A 4JM1A 3I2FA 2EGUA 2QIOA 3D54D 3I5UA 3LS2A 3NXSA 1DOAA 4EVIA 1ZL0A 2YHIB 4M0CA 4RH3A 1KZHA 4E33A 3GFFA 2B34A 2ZRDA 1G8MA 4AMYA 2HIAA 3REFA 3ZXIA 1G3UA 2RGWA 3HN2A 3E0QA 2F43A 3SI7A 3GDHA 5EZ5A 4WJLA 3L7IA 1KU0A 3AUSA 3RDPA 3SSMA 4BB0A 3KKQA 5BP7A 4E94A 1WTAA 2O3RA 3DQZA 3MGGA 1Z18A 1G98A 1ZMTA 4MCJA 3QHQA 3VPGA 2FP3A 3HABA 2OM6A 4H17A 4Z7QB 4W9RA 1A71A 3D6UA 4OD0A 1AQUA 5C8YB 5KC8A 3GT7A 4LFBC 2R00C 1GKKA 5AKIA 4JI8C 1FRFS 3DDHA 3PEUA 2QU7A 4BP9A 3IR7A 3RUFA 3UWPA 4RFSA 5BN4B 5T6MA 3FZGA 2SCUA 2V59A 4ENSA 1K3UB 1TQ6A 5J2UA 3E2IA 5HUJA 3C5VA 1L3CA 1TAHA 1TRHA 4HI0E 1ORVA 4L5AA 1W19A 4DV7C 1GCOA 2QX6A 1C9MA 1V16B 4YIKA 1ZVMA 3L7YA 1X7WB 4XEHA 4CL3A 1C7IA 2PAFA 3VTAA 5HRAA 4ALNA 3D8TA 4GXRA 2ZE7A 4LXUA 2UYOA 2BF4A 1SCJA 2J5QA 2HWXA 3EZNA 3F97A 3JWHA 4WCFB 4Z99A 3RVLA 4BZWA 2KLHA 4U63A 1J06A 3VISA 4ZEOA 4KPEC 2VDVE 4B3RB 3AR9A 3ROMA 4LPSA 2RAUA 1H9CA 5B7PA 4QEZA 1Q14A 4KU4A 3H6GA 3LP6A 3EXAA 2O19A 1CQWA 2PWPA 3MBOA 3ENWA 1O8BA 3P0HA 3KPWA 2Z5FA 1QWSA 1HFJA 4I5FA 1E2LA 5LQCA 3WLTA 2DAPA 4O0LA 1C4KA 1FNBA 3AIOA 2VHXA 3MQ4A 3ANXA 2C5AA 3LKDA 4MYCA 3THYA 1B0AA 1CZRA 1JFFB 1JT9A 1U8TA 2CSUA 2H0AA 3KXIA 4C0WA 4Q9KA 3HM9A 4NU8X 4LDNA 1XPRA 1ZU4A 1JIJA 2FR8C 3BL5A 3E82A 4LUCA 1PT9A 5LA6A 2GBIA 1NF2A 4JI1C 1TVEA 1XZEA 1WOYA 3UCFA 2DRIA 5TY0A 1K92A 5LMUC 2PUWA 3DM9B 4ENUA 3V48A 2W2MA 4GRIA 4K6FA 1QGAA 3RBXA 2I4OA 1O89A 4P22A 4MVJG 4LYYA 1N0IA 3F4LA 5B57C 1TJYA 2HTEA 2Q3DA 4G5HA 2PUFA 1IEWA 3BFJA 1YRHA 2VUIB 3LNCA 2D0OB 1VG8A 2GI4A 3PI6A 5CLJA 3GEMA 2FUG1 1WTCA 3N7AA 4H08A 4K03A 4FYWA 4U2CA 3QOFA 3VR6D 3VV2A 1BHJA 4JJ6A 3N3BC 2N47A 1SWWA 3EIQA 2Y1DA 2B21A 4O1IA 3DT9A 2ZROA 3IUSA 2CC2A 2OHOA 1KQNA 4DA0A 4WBNB 3P27A 3L8GA 1XVIA 2CHQA 3DKKA 3RRNA 4LZOA 2ACWA 1EA5A 3FNEA 5EUQB 5JZSA 3OCUA 3AVTA 1Y98A 4OQPA 3DPSA 4Z0NA 1HL7A 2JFZA 2VRCA 1KXJA 3JQFA 3W2HA 1JECA 1Z37A 5GJWC 4O4LB 2FQXA 1FOEB 1VXOA 2COKA 4M89A 1C1XB 2H11A 2YXDA 5FIUA 4F06A 4GICA 1RG9A 3UOAB 3Q8KA 2AL7A 4QULA 4N12A 3UT0A 2Q3FA 2VUSA 1CVIA 4FMDB 3AVVA 4IINA 1E0SA 4RHXA 5CT4A 1Q21A 4MIYA 3ZWOA 5H4GA 1L5FA 1KKUA 3KZXA 4NPAA 4Z4EA 1WP4A 1UMKA 2AYXA 2KX7A 4DIBA 1RXCA 1DU4A 1DUIA 5GZ6A 1P8JA 3GGPA 4NU5A 4UTXA 3KKPA 2QEQA 2I1VB 3ZU6A 4OUDA 3GMTA 3Q87B 9MHTA 4OJMX 2DG2A 4K9LA 1TT5A 2H3EA 2IPAB 3AIKA 3DOFA 4B3MC 4EJSB 1KSHA 2B3TA 2L2QA 2XCOA 5C4MA 4XDZA 1BMFD 3UUFA 3K3PA 2C4VA 4XTRA 1D2RA 2P2DA 1OGJA 3DE1X 2FPRA 3G2MA 3ZEAA 2CFCA 3ZD7A 2GETA 4RVSA 2C8LA 4CLOB 2QTHA 2VF8A 1BOFA 1Q0PA 3CU5A 1QHYA 3O38A 4RIHA 4M1KA 3GH3A 1O6FA 3EQ2A 4OYCA 2CXOA 1TVMA 3H9EO 4HTAA 4X66C 3EVFA 1KC3A 5A3VA 3JQ8A 3EWAA 4HH4A 4R3UC 3EXIB 2XECA 1UAYA 1XWWA 4DR5C 3JARB 4JLMA 3IP8A 2NNWB 3PL5A 4HAVA 4B79A 1GPMA 1C30A 2CMHA 3ZQKA 2ZSEA 3DSRA 2UZ3A 1RKUA 3JQGB 2V3CC 3TZCA 2Z6AA 1S2GA 4ESHA 3MSCA 2D0DA 5CAEA 1E1RD 2NYRA 4K2HA 4E0BA 2RH4A 2QU8A 2X23A 1JVSA 2Y0BA 1UWCA 1P9RA 2NU6B 2IYOA 2QMOA 4B84A 4HDKA 1MGPA 5L53A 2AZXA 5HF6A 2VTDA 1IWBB 2WJ4A 4V0RA 4DIDA 2WG2A 3RUHA 5GGYA 2BMVA 4G1UC 3RR2A 3EOBI 1OVGA 3A6DA 1EJBA 3IOEA 3OCXA 4HVLA 2C7VA 3U3KA 3SAJA 5I4BA 3GKUA 3EPHA 4U7DA 1X2EA 4B82A 5FHQA 1SKAA 5EQFA 4O4IF 1XRCA 1URPA 5KJ6A 5T3YA 1S3FA 1V7CA 2E18A 1C1HA 3R5SA 3S8EA 2IYEA 1ZC4A 4D4KA 3LW7A 1L4NA 2OBFA 1KJ8A 3PU6A 4QLOA 4WY8A 2WP0C 4BSZA 1CUAA 3O1IC 5AJXA 2OZLA 2Z56A 3MWKA 2IHTA 2X3YA 1EIWA 4G41A 1ZM9A 1OR8A 4I36A 3WKDA 4BX8A 2P11A 3CO5A 3CLHA 4A26A 1XMXA 1C81A 3UICA 1VSQA 3GLHE 1I0LA 2LWIA 5G4KA 1MC8A 4YC7A 1HLGA 3D6HA 4KBYA 3WTCA 3I6BA 5JNUA 5KS2A 1A69A 1OX4A 3R0XA 2JEYA 5JROA 3CQ1A 1J21A 5CT6A 2RMKA 4H6PA 1SPXA 1I4TD 2EJWA 4J7XA 2GO7A 4BUCA 2XUHA 3V2HA 4LGCA 5CH8A 1KYIA 3TZQA 3NGLA 5EI5A 4DV0C 3G8YA 2WM8A 2WF7A 1NBME 4DXAA 5CCEA 1UZAA 4HN4B 4IF4A 3DC2A 3S40A 3E27A 4EL0A 5GVSA 2VNIA 2J9RA 4D8XA 2BI8A 4XDGA 5JMOA 1W5EA 2PZ8A 1E3SA 3BD8A 5BN3A 2GS9A 1TZ2A 3H86A 4CLXA 1E3MA 1DXHA 1NATA 2ZYUX 3DW1X 5ALFA 3A58B 2I9KA 1DMRA 3KE8A 4QTZA 2GPWA 2MSDB 3F3SA 3JS5A 3N75A 1B41A 2VJOA 5BYBA 4US0R 1KZ9A 5DBFA 5EWMA 5GV8A 1RWKA 4M9CA 5ADVA 3TNFA 4KREA 2X2FA 1U3GA 1CFZA 2HGZA 2OBMA 2QORA 2EP8A 2CMFA 1R5BA 1VJTA 3IVXA 1BRTA 2ZKIA 3LHSA 3C85A 1HTTA 2GF9A 3MWFA 4KVFA 2IU4A 4BNLA 4C4ZA 1YC5A 2VN8A 5EOVA 4L4UA 2UU9C 3D0QA 4TQUS 1M6VB 1T8PA 2WYVA 4WEQA 3WWDA 3RROA 3JQAB 4MWEA 1K6EA 3V7YA 1AQIA 3VPXA 3BIJA 3VKWA 2PQMA 3DFUA 2KWIA 4FU0A 4ZMRA 4BPBA 2GJ4A 2CCJA 2NLOA 3EERA 2RI0A 3LGSA 2WMYA 4PIVA 3VSBA 2F3SA 5ESDA 3WRXA 1TAQA 1JG7A 3BXEA 4A6XA 4DWJA 2HBZA 6REQB 2GB4A 1KIAA 1VCMA 5TT0A 2JCYA 3PENA 1JLLB 4YQYA 2RGXA 1PHRA 2PD4A 1YFZA 4DCGA 4P4SB 1DFGA 1K0RA 3RQIA 1Y34E 2DQSA 2QRHA 3JAMD 4Z6KA 5EJ7A 4B7XA 1HSOA 4FILA 3EK2A 3EVNA 3HSSA 1JG1A 2FW0A 1OT3A 1LBQA 2RB4A 2RGNA 3FDFA 3FVWA 4OHBA 4S35A 5BOSB 3A6FA 1IEXA 1SOVA 1B8NA 1FNNA 3RVJA 4WK0B 3GPLA 1YU6A 4U2KA 4PLFA 4CMEA 2O23A 1N1DA 2WT8A 3PUYA 1PL7A 5ALQA 4WK6A 3S2ZA 4DQ0A 3AM4A 4FNGA 4QTUB 1BXRB 2BISA 3IMEA 3HKEB 3T94A 1R66A 3PBKA 4M0LA 1KPIA 3ZZ1A 5LMNC 3G79A 3CXRA 3U60B 3W5SA 3ZVLA 1RM0A 1AHNA 1NLMA 3RYCA 1RYZA 3FHLA 3OAAA 4ILKA 4PSAA 4W1RA 2R1VA 1E99A 2WMDA 3AQIA 2CHUA 5DVZA 1T3HA 2XDYA 3D6FA 3O3MB 3PHJA 1O6CA 1EHIA 4IIJF 4UZFA 3EMKA 2FFRA 5EKSA 5IAEA 1M1YE 3OTOC 1H2XA 3DT6A 3KZOA 3BJMA 4E2WA 2PX5A 3CB2A 4I55F 1VHQA 4C4YA 2VJKA 3HB0A 2IYNA 1NMYA 3O7WA 3O2QB 1Z6YA 3PGA1 1DAMA 4GSLA 4PZEA 2X0EA 4DJTA 5DTRA 2I65A 5IC4A 3CKMA 2YV1A 4X1IB 5CDGA 1TQDA 4J4HA 1XTZA 2DY1A 2PT6A 2I87A 4HDRB 2RK6A 3SR4A 4B4KA 1PR1A 3LRPA 5FUXA 1NI4B 4DXDA 4DZZA 3RT1A 1YJCA 2J59A 4P81A 1ZITA 4TYQA 2E7ZA 3GO4A 1NVUQ 3GPBA 3LGXA 4RIFA 4V0NA 2QXYA 4ENQA 4Y1EA 4RTQA 3DDWA 4OU4A 4Q3DA 1DV2A 1JR3D 1K3FA 2XOKD 1RBZA 3VNRA 2AUNA 3G1WA 4N5HX 4ND4A 3W06A 4EPRA 4O4JA 4YRGA 3PFNA 5TPWB 3KKEA 1L4BA 4Z8XA 3WXMA 2FPKA 2I1LA 1QF9A 1QV6A 2XYPA 2HK9A 1ADJA 3IBTA 3MTIA 4OOEA 4QDOA 2ODPA 1M8KA 2X3FA 1U11A 4H7EA 5KQMA 4J7CA 3V7NA 4FHDA 5LP1A 3H2ZA 3DE7X 3PTLA 4XDYA 1E5XA 1SU4A 2J1LA 1D8AA 1TQHA 1J2TA 1YCHA 2K5UA 1LEHA 3ZJTA 1M9NA 2QLLA 5HMLA 3AIMA 2I2FA 2J41A 1PL8A 2AI1A 3AEUA 4FFWA 4GI7A 3SXPA 1PRYA 4M9ZA 3OLCX 3C8ZA 1K2VN 2CLMB 1NDUA 2AEJA 3ZNNA 5T6BA 5CUQA 4MH0R 5TT1A 3TF5A 3KUUA 4MKXA 4PAOA 1EX1A 1P2SA 3MLEA 2BVNA 3ACCA 1R4NB 1W29A 2NO4A 3PS9A 3MUOA 1PW5A 2XXJA 1U3FA 2JBAA 2VQSA 2JGJA 3ES9A 1FJHA 3EGWA 3N86A 4QFMA 4R2LA 5H3LA 1YA8A 1GRCA 4YWJA 2PMWB 3TM4A 4CKZA 5JAIA 5IEJA 4Y2GA 2V4ZA 3S1AA 3GGOA 2VP3A 1OIXA 4UW9A 3WGZA 3LIPA 4IRXA 2ZZKA 3GJYA 3V8BA 5AW3A 1R5NA 3PC8A 4NBKA 3TZKA 3QEAZ 4AQYB 1L5HB 1V60A 1Z0DA 3QUAA 1NLYA 1CYEA 4DA9A 1NXSA 3A04A 4EBFA 4EUNA 4U00A 1XQWA 1ND5A 1S2NA 2LIVA 3AETA 1AGRA 1UZLA 3S1LA 3WBBA 2A3NA 1XMJA 1LI7A 3EC7A 3IOCA 3LY7A 1IVSA 2YN0A 1ZJZA 4G5GA 1V9SA 1T0IA 1RTTA 1YACA 2H4ZA 3CSUA 3LZCA 4N01A 4Q82A 1HO3A 1E1DA 4UNSA 1EXNA 3T15A 4CEHA 3ROXA 2P9GA 3FJ1A 1L5SA 1WUIS 1RZVA 2GBPA 2A3RA 5IT4A 3EPRA 4KOAA 4LGVA 3RTDA 3LWNA 2HLNA 5ERYA 1Y1PA 1JEAA 1AS0A 1TYEB 2Q5JA 2YQZA 5ICEA 4MVYA 1RQPA 1DX6A 3PCTA 2J9XB 5F1PA 3E15A 4D7AA 2DQYA 1C3VA 4ZDKA 4FOLA 1PEAA 1YZYA 3TZEA 4KFUA 2HU8A 2V98A 4Q3LA 3QKRB 5GWXA 1MKYA 1WNFA 3ZE1B 5KYKA 4YPFA 1HT0A 4KLRA 1Q2UA 4LBYA 2E4VA 1IHOA 1Q17A 3JQ7A 1Y1SA 3MXTA 4I08A 4QA9A 3WLFA 3G2QA 3F3MA 2Q6KA 2H4WA 4DR3C 2Z57A 5CW1A 1XEXB 2HT6A 2HSWA 4BMDA 3KQUA 1PP4A 3V7FA 3EPLA 1NXXA 1UFOA 4P38A 1UJ5A 5EE0A 2F43B 1MQAA 2JZCA 1NA5A 2CVHA 3VU8A 3GDWA 5A19A 1H1DA 4HY3A 4Y2HA 1VECA 1VPLA 2R6CA 3K6KA 3IILA 1W5SA 2OCPA 3DV9A 4WNIA 3NC0C 3UBMA 1Z36A 4ROTA 2HSEA 4GC9A 4IGAA 2OFXA 1PV4A 5DSTA 2FVXA 3VO8A 4HUTA 3EC2A 1AT1A 4OXQA 3ENQA 1ETHA 4E7PA 2JLYA 3L84A 1NVKA 1L1RA 3T35A 3C7TA 3N2ZB 2Y4NA 4QOIA 3X1KA 4FUQA 3N7TA 2F8LA 2R4UA 2XZOA 3GLQA 4UTRA 2V7BA 3FETA 2OCAA 4E31A 4I50A 2ZCJA 2SCUB 2VHZA 2OK7A 5CDSA 4MB0A 5C32A 5J2UB 2CL5A 3AW9A 3IHTA 4Q4HA 4TTTS 5AI8A 1BYUA 3K72B 4RIGA 1XTKA 4G5RA 2RKOA 4AZ0A 1OPXA 3D4NA 3WBFA 1ST3A 5IKMA 4D0GA 3DEKA 1D1PA 1SVWA 3HEBA 3LX4A 4J0GA 4E6EA 4RCYA 3VYTB 5CFZA 2JEOA 5FORA 1NMEA 2DSTA 2BM0A 4YLGA 1PG0A 1YC2A 4GMFA 4H15A 4D3DA 4GYYA 5HNKA 2ZEJA 2B2CA 2DQ4A 3UEBA 3ZWCA 4NNJA 2BFBA 4C07A 4JHLA 4ZN6A 1FA9A 1CUCA 1GSAA 1UR5A 1W1WA 2WJWA 3IOBA 3FR7A 4I4IA 3SOPA 3DULA 3G2IA 2DWOA 4EJ6A 3P9RA 3N5CA 4U02A 5FBWB 1OH7A 1MAHA 3MB5A 5LP6A 3EGVA 4B17A 3MPUA 3QX7A 3NBUA 3KWMA 3VV3A 4EF6A 2NO1A 2PZEA 1OWPA 2MOKA 3LUSA 1ZJYA 4Q3KA 3BGDA 3D3WA 3K9QO 1NJGA 2HMSA 3GA5A 1D4ZA 3RFXA 2IH4A 3WWOA 3NOXA 3BKXA 2V58A 4JI4C 1F20A 3PHIA 1IAQA 1KDOA 3THYB 3M81A 1GITA 4KQKA 1CJUC 4LBWA 2QTLA 4EW6A 3HN6A 1RJEA 3OE1A 4D82A 3FBTA 4FOPA 4G84A 5LA6B 2EBWA 1BKSB 1Y1TA 1UC5B 3WRVA 1BWPA 1KBOA 1NBHA 4ISCA 4BFUA 3KXLA 1QZUA 1MZPA 1O54A 1YDMA 1Z5NA 4XRGA 3L6UA 3DBVO 2F8TA 1L8AA 2LRHA 2XVYA 3DW3X 3INTA 1H93A 4PU0A 2UXDB 2MR6A 3IJPA 3OEHA 4L72A 1DEAA 1L2TA 1YB4A 1YL6A 5KEIA 2CLLB 4IGIA 4Y6QA 3UUEA 4MAFA 4D6YA 1QU3A 4QDKA 3AI3A 3F1KA 2BF7A 1T8YA 4KLAA 3C8HA 5ITWA 5EXSA 1SXPA 2J0QA 4EKIA 3UB2A 3OM1A 3IA7A 4Y0NA 1NQOA 5D84A 3I28A 3BGSA 1N2JA 1SUAA 3VI4B 1MU0A 1MB9A 1T8UA 2UYQA 4XXHA 1FW8A 1JAZA 2Y1LA 5E3IA 1AA9A 1ECBA 4D57A 1R0CA 2P2SA 3K6JA 5DJ5A 4D0LB 3IFSA 4BO2A 5E1BA 2H65A 4L3OA 2IP1A 4J1QA 2D0IA 4JJKA 2RGEA 4QQNA 3CF4A 4MUHA 1YBAA 3ITEA 3PX3A 3ZIAA 1UL1X 4NLLA 5JCJA 2JGKA 2CT8A 4HBZA 4XWKA 5F1OA 2CLSA 2VJMA 4LXGA 1AB6A 3X2SA 1T4BA 5ICGA 4W5OA 2QG6A 3RYFB 2BTEA 5TX7A 2Y1FA 3JU3A 4DV5C 4Y8VA 4PUIA 4QVGA 3NQ41 4OUDB 2QVZX 1E9EA 4WXRA 2WWRA 3EBPA 3P9XA 3AZQA 3FYSA 4QBHA 3LQYA 3MT7A 4KIWA 4IICA 4ALJA 5A0VA 1W49A 3PCXA 1GU0A 4M1EA 2B6NA 3FUUA 2CMDA 2QR3A 3FFBA 1OHHA 2VZ8A 1O93A 1NC3A 1R37A 4BX0A 1MC5A 3T3HA 2F17A 1UF9A 2EJTA 4J94A 1ZNZA 3LOQA 1HETA 3ABQB 4WZBA 1J8DA 1JNXX 3KC2A 5E9WA 3L7NA 3ZGXA 3ZZTA 5G0VA 5B37A 3SM3A 3KZMA 1KKMA 2OFOA 3A4YA 3DOHA 4IM7A 2BHNA 3ZE2B 5EIEA 5TMPA 2O4CA 5DW3A 1SCQA 1POXA 1WDWB 2W8ZA 5JO9A 3JQ8B 2OV4A 4UEKA 3A9VA 1E8DA 1KK3A 1DKRA 3CMMA 1HDGO 4PRZA 1GD1O 2O7NA 2Q4EA 1AUXA 2NV2B 1Z29A 1AF4A 1EX6A 2G25A 1G291 1C30B 1RHRA 3BCRA 3P5BA 5IFIA 3Q9UA 1SHJA 1IUNA 1M75A 5GOTA 3WQBA 4CKXA 5IZCA 3O3CA 1SEVA 1ZBQA 1NSTA 2W22A 3IBFA 1GZDA 1E3EA 1PEKE 5IJXA 5CAEB 4DDWA 2Y93A 3WIUA 1CIJA 4CU2A 2QQGA 5CW2A 4FP9A 1QBKC 3K2QA 3L1JA 4K8OA 2P5SA 2POQX 1YGYA 3C6ZA 1DXQA 4HDKB 4D4MA 2PVPA 3F90A 1CVLA 4RDXA 5FI1B 4DR7C 2PGDA 1IQPA 4JB3A 3KKOA 2M5OA 3W05A 4M9RA 4XJXA 4JI5C 1A9TA 4GPIB 5K6AA 1QSGA 3EPPA 4DJEC 3B51X 2Y1EA 1VTKA 1W30A 1JE1A 1Y8QA 4C4RA 4DAEA 5K2OA 4QIHA 1WUTA 2QGZA 4ROSA 2FPIA 2QZZA 1GG9A 1PN3A 1KZ6A 4A8HA 4L6AA 3IX7A 3EMBA 4DV6B 3ZVRA 1QFJA 2V1UA 2Z5VA 5HKLA 2OZLB 4MQ6A 1VDMA 5DM0A 1ESNA 1XHJA 1KIMA 4IUDS 4BIMA 1OH5A 1IEQA 1AKNA 4DRYA 5IW8A 4JMLA 2HMTA 3OIYA 3NDBB 4JBGA 4RX1A 4ZU1X 5DIZA 1TX4B 2AUTA 3Q0IA 3VR1A 1XRQA 10MHA 3D7LA 5G4KB 1DDOA 2HBYA 4YB8A 2JJ2D 2OLJA