3UOWA

Crystal structure of pf10_0123, a gmp synthetase from plasmodium falciparum
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
550
structure length
517
Chain Sequence
YDKILVLNFGSQYFHLIVKRLNNIKIFSETKDYGVELKDIKDMNIKGVILSGGPYSVTEAGSPHLKKEVFEYFLEKKIPIFGICYGMQEIAVQMNGEVKKSKTSEYGCTDVNILRNDNINNITYCRNFSSAMDLYSNYKLMNCCLFENIKSDITTVWMNHNDEVTKIPENFYLVSSSENCLICSIYNKEYNIYGVQYHPEVYESLDGELMFYNFAYNICKCKKFDPIRYHELELKNIEKYKHDHYVIAAMSGGIDSTVAAAYTHKIFKERFFGIFIDNGLLRKNEAENVYTFLKSTFPDMNITKIDASENFLSNLQGVTDPEQKRKIIGKLFIEEFEKAVNNIDIDINKTFLLQGTLYPDIIESKCSLKFKLFEPFKYLFKDDVKTLSRELNLPEEITNRHPFPGPGLAIRVIGEINKHKLNILREVDDIFINDLKQYGLYNQISQAFAVLLSSKSVYDYVCVLRAVKTSSFMTANWYQIPYDILDKITTRILSEVKGVNRILYDVSSKPPATIEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords GMP synthetase
publication title Crystal Structure of PF10_0123, a GMP Synthetase from Plasmodium Falciparum
rcsb
source organism Plasmodium falciparum
total genus 156
structure length 517
sequence length 550
chains with identical sequence B
ec nomenclature ec 6.3.5.2: GMP synthase (glutamine-hydrolyzing).
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
A PF00958 GMP_synt_C GMP synthase C terminal domain
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3uowA03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3uowA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uowA01
1XRCA 1G8HA 3FG9A 4CDNA 1IZZA 2YWJA 4NZPA 1JGTA 4I2NA 4PBTA 3ZXSA 2YXNA 4GUDA 1GZUA 1B6TA 2PG3A 3U1VA 4I4NA 4AULA 4F4HA 2CV0A 4R2MA 1GAXA 1F7UA 3L92A 4DDKA 3M3PA 4MVWA 1NURA 4KPUB 4JXZA 3CA8A 1H1TA 3COWA 4FZJA 4ZT3A 1XNHA 3TDEA 2NSYA 5FNZA 4EG7A 1H3EA 1T0BA 3BWEA 1O95D 2E21A 2A1UB 3P0IA 4MW0A 3OT1B 1T36B 2JAXA 4R7GA 1ZH0A 3SO4A 4HK4A 3AL0C 3PQ8A 3ZXIA 1G2IA 3DV2A 3IUBA 4OUDB 5DK4A 1O95C 4JFAA 5F23A 1V47A 4JQSA 4EG3A 4MGHA 5JZOA 1P5FA 3FSEA 2BYTA 1U7XA 1T6XA 4K2HA 1TFUA 2QTNA 4NDAA 5IJXA 1OX6A 4MWCA 1U9CA 3MGKA 2WQ7A 4QBTA 1S4MA 4NATA 3N9IA 1O1YA 2DUMA 1WZ2A 4KTVA 5T8TA 1J20A 5TEWA 4L8FA 3A05A 2PFSA 1O96A 3G5AA 4ZDKA 1GPMA 3QTTA 3Q10A 3SZ3A 4WXYB 3SF8B 4KTTA 4YBRA 1RQGA 1WOYA 1N77A 1OWOA 4UZFA 2CV2A 4OGFA 1K9VF 3TTWA 1H3FA 1M1ZA 2IELA 4L95C 1PDWA 1U3DA 1XNJA 2Z09A 2WJZB 3RK0A 1OBCA 4DDHA 2VDJA 1Q15A 5LLTA 3HZRA 4S1OA 2NV2B 3NOVA 2VXOA 3KT8A 1NUPA 3TTXA 1KQOA 4ARCA 2XRZA 1EFPB 3CLUC 3UJNA 3TTUA 3FETA 1IRXA 3AIIA 5EKDA 1WL8A 3UGJA 1WXIA 4MUIA 1WXFA 1JIIA 2JA2A 4K03A 4MWDA 1OD6A 1IFXA 1QRTA 3IOEA 1K97A 2QJTA 4Y1RB 4AS1A 1CF9A 1CT9A 3NONA 1N2EA 1MBZA 3ZUGA 4X0EA 1JILA 1QTQA 1MRZA 2CFOA 3ND6A 4QYXA 1NUQA 3EJ6A 4J76A 4MW2A 3FOCA 3PRHA 5E9AA 3KKLA 1VBNA 3HV0A 4MLPA 4EG4A 1SURA 5IHXA 4I6GA 1J42A 4UZSA 3QE4A 5TGTA 2PZAA 4YMIA 1K4KA 4I46A 1BS2A 4NAUA 3CVWA 5HUHA 2D7JA 1TEZA 3FHJA 4ZT7A 4MNTA 4AUNA 1F4LA 2WQ6A 4OIFA 4L4QA 3CVVA 4R0NA 1VHQA 2D13A 3L18A 5JBNA 3TQIA 4EG6A 2CYBA 2PXHA 3B38A 3UY4A 2J08A 1ZH6A 2EJCA 2DEUA 3FY4A 3F5DA 3UMMA 4HJRA 4B5KA 2ZUFA 2ZUVA 1C30B 3MIIA 4Y1FA 1EFVA 4MUFA 2R1VA 3PNVA 3COYA 3ZJ4A 3KT6A 2HZ7A 2FEXA 4JYZA 1KORA 4NDNA 3CLSC 3H99A 3KT0A 1N2IA 3HFJA 1IQRA 2J07A 1N2BA 1T9GR 1TYAE 2GHRA 1O9TA 2GOYA 4UCFA 3DPIA 4AUMA 3P0JA 1KH2A 3PQ6A 1LW7A 1PFUA 3IMGA 2OQ2A 1YIAA 5DASA 1O94D 3JXEA 5A1GA 1JZQA 4DE5A 5K0TA 2VTBB 1F9AA 3Q12A 1GGKA 1VLHA 1GN8A 3NOOA 1R6XA 3EWNA 1OBHA 3P9QA 1M83A 2C5SA 1MC1A 4PY2A 2AB0A 1XRBA 3D6VA 4MUKA 1O0CA 1OX4A 5SY4A 3CVXA 4AUEA 1ONSA 3UC5A 1K92A 1O92A 2AZXA 1V8FA 2DETA 3SDBA 1NYLA 2IP1A 1QJCA 2DPLA 3IH5A 2RK3A 3TTTA 2A1TS 3HMQA 5SY6A 3N7TA 3X1MA 2WSIA 3SP1A 1Q77A 3G59A 3H97A 1O97D 1U3CA 1JIJA 1WXEA 3MXTA 4E5VA 3P0HA 2X0KA 1YUMA 3KFLA 3FIJA 2GM3A 4ODJA 3L93A 4MW7A 1KXJA 1OX5A 1K4MA 4UNIA 2P02A 3PXUA 5SY9A 1UCFA 3CVUA 1JEEA 1O97C 2V4UA 2D5BA 4LE5A 3P9PA 3RFFA 2G36A 1PV2A 3COVA 3DO8A 3TQOA 3UMVA 1S1MA 1I1QB 3CY6A 1KWGA 4KR9A 2A7XA 1IVSA 2NV0A 4OJYA 3AFHA 2I1LA 4B31A 4ZT6A 2ZUWA 1OY1A 4MTCA 1P7LA 2PZBA 4HPVA 3IVXA 1GTRA 3TS1A 2V0GA 4ARIA 3E27A 3ISJA 3Q4GA 4J75A 5TS2A 4MWBA 2H2WA 3BHNA 4QYTA 4L2IB 2OBVA 2JANA 1PG0A 4MUJA 3SZGA 2R1TB 4OQ4A 2CYAA 3MUEA 1H3NA 3SYTA 1EJ2A 1YULA 1I7QB 3AG5A 1X8XA 4Y1EA 4B2YA 4ND6A 4JZYA 2QJOA 2GK3A 3D6UA 1TYBE 4L2ZA 3F3MA 1T6ZA 1QVWA 3INNA 3NORA 2CYCA 1T9GS 4L8WB 3TTYA 4ENTA 2E89A 5JZMA 1QRUA 3FIUA 5BNZA 1F7VA 1P7PA 5AHWA 4YP6A 3ZJVA 1J1ZA 2H29A 1Q11A 2BTEA 3GRAA 3IDFA 1PFYA 3L4EA 3IMCA 3S3TA 1R9GA 4BWVA 1ZJWA 2HGZA 1WXGA 3G6KA 1WKBA 2DR2A 2QTRA 1QRSA 2A1TR 4G5YA 4U8HA 4WSOA 4EG8A 2E18A 4Y0NA 1G8FA 4ENUA 1PE0A 3AKZA 1CE8B 4P36A 3VGJA 3DLAA 5LFAA 4L7QA 1R6UA 4DJAA 2CUZA 2PIDA 1J09A 3CLTD 4WINA 5DEOA 2H2AA 4MWEA 4ENPA 1T6YA 2EL7A 1OWLA 1KH1A 3OP1A 4ENVA 4YP7A 1JMVA 1QU2A 1XNGA 3HL4A 1QVZA 2YY5A 3IVCA 1VL2A 4LGYA 4P2BA 5J58A 1U7DA 1NI5A 1QWSA 5TEVA 3K9WA 4PBSA 3R75A 5IP5A 4U63A 1KEEB 3IOBA 4ZT4A 2R5WA 3A04A 3ILVA 1MB2A 1M8JA 4RPIA 3IUEA 1UFVA 2D54A 3IMEA 4QRDA 1FY2A 3H9BA 2VRNA 3ER6A 3SOZA 2X3FA 1QU3A 3MLAA 4AJ9A 1JDBC 1MXAA 1GGJA 4MW9A 2CSXA 1O96B 1GGEA 3UK2A 3OTWA 1Q19A 4ZCPA 1VCMA 4N0MA 1QVVA 1G8GA 4HJXA 1SY7A 1FUGA 5LIRA 3GUZA 3PNYA 2DERA 2A84A 1Q2UA 1OWNA 3VU3A 1EUQA 2RE8A 4CDMA 4YP5A 2R1UA 4KPUA 3RBAA 1JECA 1ILEA 2XF2A 3RHTA 2A4MA 4A91A 3ND5A 1KWKA 4P35A 4K0RA 2A1UA 4Y1GA 3FWKA 3MLBA 4NAHA 2YWDA 3OT1A 2QUJA 4ENQA 1JEDA 1IZYA 4WNYA 4PXYA 1O93A 5H7XA 4UZEA 4OUDA 2QUKA 4KR7A 4ENSA 1JZSA 1MOPA 5SYAA 1KP2A 3FH0A 1P81A 4ZCSA 3ZIUA 1D2RA 1NUUA 3CYFA 2O8VA 5DB4A 1O90A 3CLRD 1O94C 3C8ZA 4ND7A 1O6BA 1IQUA 3I05A 1QNFA 4XSVA 1KQPA 1OWPA 3NBAA 1L9XA 5K4AA 3VRHA 4I6EA 4E08A 3P9RA 1R6TA 2E0IA 4P5PA 1WQ3A 2A86A 4EG5A 3RV2A 3TZLA 3CLRC 3H05A 4DLPA 1MB9A 3N2YA 1JVNA 3A4IA 2J4DA 3B3AA 4P2GA 1M8GA 1GTSA 3SF8A 1N57A 1M6VB 2IUFA 3PQ2A 1VCOA 1N75A 1KQNA 1CS0B 1N3LA 2DLCX 3CZAA 3NOQA 3A2KA 1J1UA 2QUHA 4RKYA 2IJGX 3TNJA 1NSYA 1VBMA 3B36A 1N78A 3RHSA 4WS9A 1MAUA 1JHDA 1YUNA 5H16A 5KCMA 1EFPA 4GRIA 3PQ5A 3AG6A 1N1DA 3IOCA 3UK7A 4ZGGA 2OR3A 1EFVB 2R1VB 1N2GA 4I6JA 4MUNA 4BTEA 3FNRA 1DNPA 2Z08A 3RJZA 3ND7A 1EUYA 1ULHA 4Y1RA 4F3RA 4LRUA 1LI5A 2X1MA 3EFEA 1QM4A 1MAWA 1A9XB 2VPIA 1BXRB 2ZUSA 4DDMA 5BV2P 4MVXA 1N2HA 2AG6A 1MXCA 1YIDA 4ZDIA 5H9UA 3ZJTA 3ELBA 1PFVA 2X1LA 1M8KA 3PNBA 4H3SA 2V0CA 1RG9A 4RUKA 2AD5A 3LE8A 4HCJA 2YWBA 4MW4A 1I6MA 3WFZA 4NX2A 4BFLA 3N8HA 3NBKA 3NVAA 1JIKA 1IPHA 2W7TA 1LI7A 1KH3A 4PBRA 4MUHA 1XRAA 3RK1A 1FYEA 3R74A 4B40A 3ZJ5A 1OX4B 2RD2A 4KKVA 3SEZA 1M8FA 5A19A 1I2DA 1EE1A 3GLVA 5KHAA 1NUSA 1I7SB 3S82A 4ZCQA 4E1AA 2ISSD 1QQTA 3UOWA 4UOZA 2A9VA 1J70A 2J09A 2CT8A 1TYCA 4TS1A 1GGFA 3VU8A 3ZGZA 1PDVA 3IMLA 1MXBA 1J21A 3FI0A 3KT3A 2QJFA 4B7AA 3R76A 1PFWA 3GMIA 1I6LA 1O0BA 3PQ3A 4D1YA 4GE0A 3CLUD 3PQ4A 1GG9A 1G59A 4S0ZA 4UOQA 4ENWA 4CQNA 1N2JA 1NUTA 3CR8A 3TZEA 1VBKA 2A88A 2ABWA 4RKWA 3BL5A 4ZT2A 2YWCA 1WJGA 5J5AA 5A1IA 1TYDE 2QTMA 4MVCA 5DFAA 2ZP1A 4K0BA 2GKSA 3TTSA 3CNEA 3CLTC 5J59A 4P34A 1T3TA 3IODA 2PZ8A 1COZA 1GLNA 4MW1A 3MMXA 4ZCRA 2LXNA 2VTBA 1I6KA 1OI4A 3LCJA 3F71A 4OFWA 1P80A 1U0BB 1IQ0A 3HGMA 4Q93A 4AQ7A 1A8HA 2RK4A 1IH8A 2NZ2A 5LM3A 5FO0A 2QUIA 4JXXA 1P7ZA 2ZUUA 3ZR4B 4ZDJA 1TQ8A 1KP3A 2DXIA 4XLLA 1KAMA 3EZGA 1Y42X 3CVYA 1GGHA 1Q7RA 1EXDA 3N05A 1P7YA 1VCNA 1KA9H 1FYDA 5FO1A 4L78A 5HUJA 4L7IA 3QTBA 2HMAA 1HYBA 3P52A 2ZUTA 1C3OB 4MULA 4CT0A 3PQ7A 2Z3VA 3LOQA 4EGAA 4EG1A 2J5BA 1IHOA 3CZ9A 1KR2A 4R2LA 1YI8A 3K32A 4MUGA 4MAFA 4HPWA 2B7LA 4N12A 4G5FA 2ZUEA 3COZA 4EF6A 2OV4A 4XFDA 3D54D 5K0SA 1XJQA 3CLSD 4MQ6A 1MJHA 2XRYA 3SEQA 3M5WA 4DNXA 4MUEA 2WB2A 1ZUNA 3H9CA 2RK6A 2VKTA 1KKUA 3TTVA 4QREA 1WQ4A 3NV7A 4L8YA 4MW5A 4G6ZA 4XFJA 4ZCTA 1FFYA 2CV1A 1QF7A 1M8PA 3L3BA 3L7NA 4GE3A 1OWMA 2TS1A 4GU5A 1SOAA 1N2OA 1NP7A 4L2IA 1KAQA 1WXHA 2AKEA 2R1TA 4BIMA 2O5RA 4ZT5A 1GPWB 1NZJA 3EN0A 1PG2A 1WY5A 5T8SA 4ADSG 3ZJUA 3FDXA 4EFKA 4Q16A 1X6VA 4MVYA 4ENRA 1O5TA 3X1KA 4U7JA 4OJMX 4KR6A 5HG0A 4OGGA 3X1JA 4MW6A 5KWVA 3IVGA 3P9SA 1QDLB
chains in the Genus database with same CATH superfamily
2YL2A 3MUOA 5CXXA 4D92A 4XQ0A 4CDNA 1RPTA 3VSAA 1PV1A 1XXHE 5EPUA 3D6HA 1TZ2A 2GEFA 3GT4A 3AJDA 4KOEC 2FUG6 3GFOA 1YKGA 3NWEA 4JUCA 4F4HA 1QR6A 1TKCA 3K6KA 2WK1A 1TJ5A 4RPLA 1Z4LA 5JW6A 1Y3BE 4KNVA 1QG2A 2UVPB 3TOXA 1V9LA 4X8OA 3BGOS 2FW7A 5JZSA 5JDCC 4E2YA 1XEWX 1XTTA 4X1YA 3WK7A 5A4JA 3THYB 2ZIEA 4UM5A 3HP7A 4GZ5A 4XVRA 1MOZA 1GFIA 2JAXA 1KVQA 1YJXA 3JVVA 2CFCA 3PQ8A 2Z2IA 4E88A 2GASA 4EJSB 1JE0A 3ZXXA 5AM0A 3ZWAA 5CK5A 2P6OA 5CNIA 3L4JA 4U6SA 1VHJA 3V7NA 1G20A 1JJVA 2H5JA 4KK3A 1PQWA 4FP9A 3PWZA 3F3YA 5G02A 1TFUA 3BRQA 5CNMA 2C9ZA 1U7TA 4GKAA 4MWCA 5C32A 4R41A 1TF7A 4LDPA 2G9NA 1G21E 2ZT5A 4QBTA 2HQBA 4NATA 1SZDA 4FMPA 1X92A 1G7TA 1IOZA 1R4NB 4D9JA 4KTVA 1G6Q1 1K6XA 2Y66A 3AF4A 3MWEB 4FN5A 3D5TA 4I5IA 4XKJA 4D9HA 3EXEA 3V7WA 1ZB9A 4J7CA 4IGIA 2M6SA 3A05A 4KSBA 4B73A 4PROC 5HF5A 1AS3A 4ER0A 1Q57A 3ACDA 3QOYA 3ZV6A 2MJLA 3V9AA 2BRUC 1YHYA 3GRCA 4OHBA 2QTFA 2R4QA 4L22A 5M2QA 3IEKA 1Z0FA 2V5VA 3JRNA 3AR6A 3I76A 2V4ZA 4GM4A 4QTZA 1KZ7B 1E18A 4XJTA 5D85A 4CMCA 4NVRA 2QLBA 5ANRB 1JQBA 3NUGA 3LXUX 1WVGA 2Q3HA 5F52A 1MTOA 1MIOB 2ZQZA 3AWDA 3UGJA 4WZBE 3WWZA 1E3JA 1HE5A 4JI5C 1EWKA 2NUPB 3UJHA 2V59A 2C7RA 3R23A 3KPWA 1RWXA 4RD3A 3M1IA 4DNPA 1N2EA 1YNOA 3RIYA 1LGYA 4INOA 3AETB 4QYXA 3GLIA 1TK9A 3DAGA 1YDMA 4UUBA 1IBKB 3EIHA 2FRVA 3P2YA 1RZRA 2ZBFA 1GITA 3TLAA 1YBHA 1WPGA 3CKKA 5FAKA 4B74A 4BQSA 3TBHA 4EG4A 1Y4ZA 2Z98A 1CJBA 1U11A 4KR2A 3BEOA 4DY4A 3IUMA 3ZWKA 2WUFA 1HZZA 4HKTA 5JS8A 4HH1A 4GKKC 4LCEA 3DBRA 4L02A 5B55A 3DQPA 3O84A 5BW8A 1S1CA 4U5XA 3GJ0A 5AHRA 2J5KA 1ZY2A 1O6GA 1WCJA 2C99A 2RG7A 3WB1A 3N53A 2VBGA 1BGVA 1H4QA 2UU9B 3MILA 5HW0A 2OAEA 2IKSA 1MDFA 3C7DB 3V2GA 1D6NA 1X7YA 1G5IA 1K2VN 3HB5X 3C1AA 1BYIA 3WY9A 4EB6A 1T2CA 3B38A 2EJCA 2I6GA 3NHAA 4OQFA 3U80A 1PT7A 3QLVA 2R3SA 3HU3A 1ZMXA 5AESA 2FMHA 3MCAA 4ACAA 4LZLA 1GN9A 4MUFA 4Z86A 5BVGB 3NTUA 1NYTA 3TD2A 5AUQA 3L95X 2C5GA 2OGUA 2YR0A 4YYEA 1LV8A 1WF3A 4IKEA 1U2EA 5LOVB 3ISVA 2K5UA 1UKBA 4CLOA 3GIWA 4QOEA 5JSZA 3FUTA 4FCCA 3WP0A 2PLAA 3ENWA 3P0JA 4PAOA 2QXYA 4DR6B 5KYWB 1QLJA 1OZFA 1PFUA 1F06A 3E1GA 1EQAA 3I5MA 5JAUA 4CM5A 1KTIA 2GLXA 1GQ2A 2X13A 2Z9BA 2Z51A 3I0MA 4DE5A 1P2FA 4KQCA 4YJFB 1T2EA 3TB4A 1TM3E 3L1VA 4BZQA 5L3VA 3I01A 4JKOA 4KEAA 2CJWB 3D0OA 4RPGA 2ZS9A 3CZCA 1HETA 3F6BX 3N8IA 3FDIA 5I9BA 2QD5A 2QTVA 2LTAA 4CUJA 4DLBA 3LNVA 3QVSA 1RLJA 3FPSA 2GB4A 5SV2A 3EMKA 4CM4A 1CY4A 1ZSVA 1KP9A 5L3SA 2O5CA 3U5TA 3MJCA 3KQVA 5H0IA 3EOAI 3VDRA 5IN5A 4BC0A 2HHHC 5HIIA 3EIFA 1WXEA 1PT8A 4K6CA 2WWFA 2DPMA 2Q3MA 3R5XA 3SN6A 3ETOA 1EP2B 3C3EA 3LVFO 1R6VA 3GQBB 4H6VA 1J2EA 1P0MA 4FDUA 5KNCH 3NAQA 3NHJA 1V1RA 4ABYA 2JJ2A 2HA4A 1HMPA 4BNKA 1SVOA 4MI9A 3VR5D 4ER5A 3BIXA 4KMRA 1L5WA 2W8BB 3RFFA 3IPRA 4MAMA 4TS9A 4TX1A 3TOCA 3V4FA 2D28C 3CRMA 3OEED 4X3PA 2NZWA 3D2CA 5JNRA 4MRMB 4QLBA 4AFNA 5DNAA 4AIRA 3PDWA 4R54A 2B20A 3BZWA 1L5RA 3DCIA 4TT3D 3TX2A 4XD2A 5K6AC 2FMTA 2H4ZA 3VHXA 2XECA 2PZBA 3B1WA 3DE2X 2ZI4A 1ABBA 1GTRA 3E5HA 4E5KA 4PZ0A 5J23A 5E6SA 4GOOD 2QYTA 4PPQA 1A5ZA 4QYTA 4OCZA 5ALSA 1P1HA 2D5LA 3V8PA 1LJLA 4YRIA 2IHUA 5JNSA 5FOSA 1WA5A 4ZCMA 1V71A 1PGPA 1VYUA 1YULA 1Y4DE 3AG5A 1J8VA 3FHLA 1QKIA 4UNSA 5C3MA 4AXXA 2CVFA 2WJWA 1T4CB 4I9NA 3GLFB 1E2QA 1P4HA 2HD4A 1BWQA 1UM8A 2O1XA 2G1AA 3DR5A 3NOXA 4X44A 4L8WB 3WZLA 5JZMA 3F7OA 1XHEA 4O2AA 3GFSA 1SD1A 1C3OA 4YP6A 5F9MA 2PGXA 2AIRA 3I28A 5AOBA 5J43A 2ZJ0A 1YDGA 1U9JA 5IJAA 3NGLA 4B87A 3F8WA 2P6UA 2GFHA 4DWVA 3IQDB 4OAOA 2YZNA 1QHSA 5IVHA 4ZZ2A 2FUCA 3I2JA 4WSOA 5T4FA 1IXSB 3IL2A 3RGGA 1CVIA 1A27A 2PX5A 4MGYR 2CWDA 1M2WA 3DQZA 2WHQA 3OO1A 2YVLA 1RS0A 2ODWA 2ZIVB 1MT0A 1HYGA 4ZYYA 4Z0TA 3I6IA 2P75A 4LF4B 2JD0A 1BEUB 4K9RA 4CPDA 1JQ3A 4IXTA 5T41A 1NW9B 1QONA 1XTJA 4DLTA 3QW4B 1WW2A 5AM4A 4KQGA 1BWRA 3LL7A 3NFYA 1ZFNA 5G1NA 3UT0A 3ILVA 4LV5B 3C7TA 2WSBA 4RPIA 5EY5B 3IMEA 1GRRA 3O93A 4LYFA 1FXUA 4K6FA 4PGFA 4C5BA 3E03A 4LOJA 3FI9A 3OT4A 1W76A 2XXAB 3RGWS 1DWPA 4IJMA 2YRWA 1G6HA 4PAMA 3OICA 1JF8A 1KARA 1K06A 1QANA 2VSXA 3VTZA 4FMDB 4D9KA 2WFLA 1WH9A 1KMIY 3OQJA 1O58A 1IZ8A 4EHLA 4F85A 3K2IA 5C1OA 3WQQA 1Q2UA 3NXKA 2RSLA 4XM2A 4UFPA 3QU4A 2JAQA 2FEAA 4IQ0A 2OBLA 5LP6C 3RHTA 1KOGA 1F1JA 4GI3A 4IX9A 2RH8A 4BV9A 3IUQA 2VS1A 1K8QA 2VYVD 3W34A 4DHWA 5JWRA 4TYYA 5ABPA 1EVEA 3UMCA 3G13A 1O93A 2PAAA 3M70A 3TIIA 4LF5B 1GJRA 5EI5A 5JMTA 4A6EA 4S1TA 3QVUA 2ZSAA 3DZIA 3FDJA 2ZITA 4MS4A 4ZCSA 5GAJA 5BSHA 4B3CA 3CYFA 1JPNA 1GPDG 3C43A 1SZPA 4YX9A 1O6BA 1LBQA 4DV1C 3DVRX 2D2EA 3F8SA 3ORRA 3FGZA 4I50B 2C3MA 1I94C 1HEYA 3PGLA 3AUSA 5DI3B 1VC2A 3QBTA 3U16A 3HEMA 4GGOA 2DWQA 4IIXA 1Z88A 3TJZA 4E21A 4EJ0A 5FUQA 3Q8KA 5IAAA 1AGPA 2RGAA 4LMPA 5LXTB 1Q22A 4OBWA 4B3HA 4V1CI 3SF8A 3WNQA 4JBIA 1M6VB 3ZLUA 2I9KA 2IV2X 4HX5A 5IVDA 3OIYA 3WMWA 3MWGA 3PC8A 5AQ1A 1QO9A 5MFZA 3IRUA 3G89A 2C5BA 4INZA 3O94A 2W00A 2ZIWB 5CPBA 2JGDB 2Z5LA 3KD2A 4MCAA 1LZKA 1WZIA 2FPIA 3K0CC 4RKYA 5GM2A 3V4OA 4D9BA 2OYSA 1FFEA 2R5NA 1FSFA 4YGXB 3MT0A 1U9IA 1DRJA 2H59A 1JYSA 4P08A 1O4VA 4WK0B 4XTCS 5A62A 1IPEA 1F12A 5CW1A 2UUAC 1RAAA 2EBWA 1L5VA 3H2YA 3WIBA 4CFZA 4NXMB 4MUNA 1L5QA 3TOSA 2HYDA 2VDLB 4OH1A 3D6JA 1RJGA 4A16A 1CIVA 5CK4A 1EPUA 1IEXA 3BMNA 4JI3C 3W8FA 4NZ9A 4HPJB 2Q2NA 3W5VA 1QM4A 5LQNA 5KYYA 2ZUSA 1RFGE 1BN7A 1UMCA 3PNLA 4HVAA 2CCJA 4N3CA 3HM9A 5EMJA 4LPSA 2OHVA 1KXZA 3V8VA 1RR6A 4ZI7A 5BN3B 4D6YA 4FCVA 3NHPA 4V3CA 2CB9A 2NADA 4DV4C 4XDGA 4LZPA 2YWBA 1UK8A 4P3PA 4NMWA 1ZRMA 2EIHA 1OFHA 2FFHA 5FPSA 4IHQA 2CNOA 3M9WA 4OHWA 3LK6A 3E3MA 5KYXB 1O4WA 1VBFA 4JV5C 1DBWA 1Z6GA 2GESA 3H5RA 4US1R 4FJ2A 1ZNXA 3X0DA 4AQYC 1A1SA 4JQZA 3VH3A 2VH1A 4MUHA 1XRAA 1U2PA 3LWBA 3PNOA 3V42A 3WC4A 4B7UA 4P0QB 5IT9D 1OX4B 2C7PA 4DWOA 4HH3C 3DL2A 1GUZA 1FRVA 2CZQA 5BYBA 3FM9A 4RADA 2WUWE 3TRHA 5AO9A 2WT4A 1NUSA 4JNCA 4OB7A 1AKYA 2P27A 2Q0SA 5HTKA 2QZZA 2BAGA 4EAQA 4CEHA 4O4LF 3KOWA 2LDBA 5AVSA 3VU8A 2YNMC 3TKLA 3HDHA 3VTKA 2A4KA 4F4DA 1DO2A 1DDOA 5HZGA 3GMIA 5H3HA 1GCUA 2ZK7A 1TMYA 3T3DA 1BG6A 4HATA 4FFRA 4R8LA 1UAGA 3P2MA 2LP4Y 3BJZA 4MP6A 1NVEA 2W2QA 5HE8A 2NNWB 1VM6A 3QEKA 4C7OA 4Y6PA 1YCGA 3NTOA 1UXHA 2GKSA 3GUUA 4QEZA 2WI8A 4ARZB 4OQDA 1GQOA 1ZSNA 3CLTC 4OF4A 4TN1A 1EZ1A 4WESB 4C2AA 4C7KA 2O48X 1OGJA 3LUAA 4MVJP 1ZQ1A 3A6JA 4UW9A 3ZDXB 1JG6A 2PMKA 5FV7A 4HZIA 3KYJB 1GTJ1 3BD7A 3QE0A 3Q2OA 4Y67A 2GWRA 3N2EA 4HN9A 2RGXA 4LXIA 1GU1A 4OM7A 5H8WA 1N2CB 1IONA 2BFBB 3AXTA 2EFJA 3NHRA 4F1WA 4EA6A 1M5RA 1QG4A 4IIHA 2Q6LA 4ZREA 1XDBA 3L6DA 4PC7A 3ZNQA 5I4IA 4XWYA 1XAJA 3BFPA 1KAMA 1F6BA 4HWKA 1YR8A 2VXYA 1C3JA 2YH2A 3OZDA 3ZWVA 1VCNA 1UPXA 4TVBA 1Y7TA 5K0NA 1LZLA 3MTAA 1HFWA 3O7WA 1QGUB 3ADPA 3EVZA 4IJQA 1SA0A 2GQ0A 1Z39A 1UQRA 4MRNA 5IM4F 4Z4CA 1C0PA 2HMAA 4X3CA 5A9TA 2XBLA 2VT6A 4MULA 3BK1A 5DLEA 4P7FA 4CT0A 4DMLA 4D82A 2X4GA 1X13A 5ALTA 5D5QA 1X94A 4JP5A 3D8SA 1CLUA 1QBGA 1CFJA 4EPYA 3EAGA 5K8UA 3LOUA 5HGXA 2ENWA 2HF9A 4FNGA 1SBQA 3T4UA 1MJHA 1OPRA 4BLVA 4FD3A 4LNAA 4XJXA 4DHEA 4HQNA 4DREA 1JXAA 1CY1A 1O08A 2OXEA 2VKTA 4PTLA 1ODKA 3H9QA 4QJ4A 4U6NA 2C7QA 1NFRA 1DKOA 1K7XB 4E5PA 4UJ5A 3LUBA 1G4HA 3LIPA 1LLCA 3K4HA 5FEMA 4YJ3F 1KAQA 2I5PO 3ZY5A 1EBFA 5D5HA 3BMQB 2G06A 1CY7A 3EZ2A 1MLDA 1DJQA 3WISA 4J2HA 4D9NA 4MKHA 4BQIA 1CUFA 4OGWA 2OFWA 3P5BA 4ZVSA 1FBTA 5T8SA 4DJFC 4FC6A 1C4WA 4YQFA 1ADYA 3STUA 1KFEB 2WDPA 5JU6A 1QIIA 1X6VA 4P54A 1S2GA 1UJBA 2PRIA 3ZV5A 4NCJA 3HVRA 2VQFC 4H7DA 4PGAA 3RVDA 1VLJA 2RI6A 4HDNB 3WL7A 1ZJZA 2OHGA 3ENVA 2J9XB 3GCDA 1S89A 1T1GA 1XRCA 1EVIA 2GUGA 4M8LA 4X6YA 5CGQB 4XR9A 3KQHA 4ZQFA 2ZYHA 1ZS9A 2DCMA 2GPNA 3D43A 4ZQGA 2G9ZA 4D97A 5D3ZA 4ZK2A 5H82A 4ZHQF 5I45A 5JXGA 2UUPA 1FA9A 3ROMA 1KQGA 1M0SA 1JLRA 4KQFA 3U17A 1Z26A 4A8JA 1F7UA 1GAJA 2AQHA 4U7PB 2Z1NA 4NBVA 3UEBA 4FR2A 2QXUA 2HJ9A 3CA8A 4BNYA 1Q0QA 5BNFA 2Y9MB 5FNZA 1QP8A 1EK5A 1O95D 4GXRA 3INGA 4LJAA 2WJ6A 1Y6RA 3FCEA 4ZJZA 1C7RA 2G0NA 2KZFA 2ZR7A 3TVYA 3WLEA 3DV2A 1DBVO 3AY7A 1JA9A 3ZV7A 5EC8A 4AK9A 2QW1A 1NBHA 1C7FA 2A14A 3NATA 1MQSA 1VCIA 2KZ0A 3H2TA 2HWYA 1DOZA 1I30A 1CWUA 3F98A 1AA6A 4BMDA 4CM9D 2QVYX 2RCNA 3AY0A 2ZVJA 2IHBA 5I7RA 4M9SA 5I8WA 3A4MA 2QTNA 1Y98A 1ARZA 1H8HD 3DKVA 1HLGA 1DTEA 3RWMB 2NXJA 1BE1A 2Z58A 1A9RA 3A25A 5CVDA 5IKOA 1WZ2A 2Q3JA 1GZ6A 4C76A 4NZNA 1VLMA 3OX3A 4O5OA 3U2QA 4KV9A 2RJNA 1QDEA 4PC2A 3QPVA 4IIYA 3HDYA 3L7YA 1RKQA 1SMKA 5HRCA 1W8DA 2OCPA 4RMHA 1Z0UA 2HJVA 4ANFA 3PHJA 3VU1A 4ZN6A 3J7AC 3QXGA 4L95C 2V7BA 1JQJC 4RKRA 2FR8C 1SXHA 2WJZB 4AWBA 3TMAA 3HUEA 2Q8NA 5C8DA 1UFOA 4OXQA 2R8XA 4D4IA 2BMVA 1LCIA 2C8JA 4C1BA 2IH5A 4X65C 2NZYA 3KL2A 2FQQA 2PUJA 3TTXA 4ARCA 4QOHA 3K6JA 5FBRB 1K0FA 2ZBPA 3NTLA 2WF9A 1EDDA 4GF5A 2XMDA 1FX1A 4TYMA 4AB1A 3ZDDA 2C5LA 2NVUA 1CRWG 2XMBA 4HC4A 1AKUA 3ZOZA 1KNXA 1XKLA 2KW5A 5C51B 5C9ZA 2ZYSA 1IFXA 3OSUA 1E98A 1TVEA 1WD7A 1YR1A 2P77A 3IOEA 3NHUA 2BMEA 3R3YA 2QRVB 4LCJA 4Q3BA 2WMNB 4Y2VA 4EPRA 4F5EA 2GPAA 5T4EA 1QTQA 1QYIA 1CULC 3H5TA 3IR5A 4O4JF 3Q85A 4C4PA 2P2BA 4KE6A 4GGMX 3O95A 4GVPA 3RVNA 1P18A 4E5DA 3PRHA 3UFXB 3BGIA 4U02A 4HLUA 2R4TA 4BYMA 5IAOA 1AVTA 2YZGA 4PU0A 2EX4A 3ZS9A 4WCFA 2EX0A 5KVQA 3V34A 2H5LA 4NULA 3CN9A 5BSVA 4OA8A 3VDXA 1T1SA 4RPHA 3VSDA 4TZ0A 2F3RA 3QI7A 1FDIA 4I1RA 3E15A 4YMIA 1A3CA 1L5HA 3AYXB 1ZHOA 2VQ6A 5CVTA 4ALIA 2P2QA 2C61A 4WKNA 1GUAA 3RM3A 4PZZA 2W98A 3E61A 3ILSA 5FPTA 3PD1A 1TTTA 1ESCA 2WFMA 3RRMA 1B6GA 2Y1XA 1VHQA 3VX4A 2PGJA 3JD3A 4R0NA 4X61A 2NOAA 4DUGD 1GIAA 4JL5A 3GFQA 1QB8A 2Z6UA 2PMEA 2I62A 2EJTA 3D3EA 1ZH6A 3U4QB 2DEUA 1XTBA 5LZ5A 3J80D 1B8PA 4BPRA 2K6GA 5ICCA 2E82A 1H0RA 2G04A 4RDHA 2V6IA 3LSTA 4UBLA 1EJ6A 4KSCA 4YHBA 5DYYA 2IHYA 3UK0A 4HNUA 1SCIA 4NCXA 1WP4A 3WHIA 4JXKA 1GVHA 2O8DB 3EPRA 2WA1A 3KL4A 3PNVA 5B1DA 4AZVA 2QRLA 3COYA 3UV6A 1KJYA 2I29A 2HREA 1WB6A 2IXTA 2C2ZA 3NU1A 4RS4A 1II8A 5LQJA 2D0DA 2CEKA 1QGYA 1T4DA 3AJEA 3CHYA 4FE3A 1JLSA 3ESRA 3KSMA 3DPIA 4Q5IA 1TJYA 1BVYF 2GAFA 1OFUA 3NHSA 3SAJA 4ESVA 3PFWO 4DCNA 3ZNOA 3Q1KA 4Z4HA 2VP6A 3TRIA 5EMNA 3IMGA 4HDSA 4REQA 2B8WA 4ZPXA 2ZRNA 2V9PA 1QPGA 1SULA 1SBZA 4JEUA 3NG1A 1KI3A 4TWZA 1DELA 3D4OA 4B3MB 1RRVA 2HAEA 4C21A 2IH4A 3C5WP 3WHPA 5HZMA 4DQVA 3PJEA 2AB0A 3D6VA 3AI3A 4C4SA 3RNLA 1I3CA 5A04A 2ZXUA 4MVJG 3AI2A 2GDZA 2X0FA 5CAEA 3FZQA 1TCAA 1C81A 6YASA 4GQBA 2JNWA 3CX7A 3EDMA 4YAJA 3MWDA 2HBRA 3OLXA 1P5RA 5H4HA 3VR5A 3ESYA 3R9KA 4BMZA 2B8TA 1RYNA 1XVIA 1U3CA 3GLHA 5B4VA 5KNDH 2JAHA 1SU8A 1E7RA 1RHMA 3FJOA 1YZHA 2RBEA 4HQFA 3MCVA 2QMUA 2X76A 4O2LA 4RAQA 1RXCA 2XI4A 1NGSA 2YJGA 4HFMA 2LCQA 4TT3A 2X3UA 3V2IA 3VO9A 3LAWA 2P7IA 2FWJA 2X5XA 4Q82A 1E20A 2ERXA 2C9MA 2PXCA 5F77A 3T1OA 1VJRA 1SXJB 5E7JA 3JASA 5HMMA 1BDIA 1RMQA 5JNTA 2RHBA 3BRSA 5DP2A 4FI3F 4C3OB 1TUIA 3WQSB 3SC2A 2ZZMA 3VQTA 4P7GA 1VPVA 1DTSA 3AR5A 3MF4A 1E5QA 1YH3A 2IHZA 3A58B 1FP1D 4JT2A 4G0QA 2GEUA 3R8XA 3UB2A 4YXFA 1GPUA 4S2UA 4JA2A 4ZOCA 5ADWA 2WUEA 3FD8A 4LNUB 1ULUA 4MV7A 1Z2NX 4AG3A 3W7VA 4FFPA 1XC7A 2Q4OA 3Q7EA 4FT4A 1KL7A 2P69A 4R1QA 4Y1EA 3E8SA 1SIOA 1U1IA 3M4JA 3GDFA 1CIJA 1DKQA 2H2DA 1XMSA 2CL7X 3LDFA 4YR7A 2GS9A 3EK2A 1IBCA 4UE2A 5KNDA 3RADC 3V3TA 3UATA 4NEQA 1E1CB 1ELOA 1U28C 2ORVA 4NARA 5FHRA 1FQKA 5KWJA 3W8RA 1F7VA 1MW9X 2F43B 4IRMA 2BFEB 3WRXA 4OQLA 3PI7A 1J2TA 3U7RA 2MT9A 3GRAA 3SS9X 4AS2A 4CCSA 4LBYA 5ES4B 1G21B 1R9GA 3U7HB 1JG2A 5A2QA 1NN1A 1F2VA 2PLFA 4A0QA 2ZIZA 3P2EA 3PX3A 2QZJA 2RGNA 2C2KA 1EAYA 1HFEL 2WYIA 1UZUA 4G5YA 4UE6A 5EQDA 1CUUA 1TYZA 4MV9A 1CE8B 4IDFA 4OK5A 5EWJB 4JLWA 4N6NA 2HRBA 2QZ4A 3IAFA 4GM1A 4RQAA 2P62A 3CEHA 2CK3A 5LDDC 2QENA 1KGSA 2FPMA 3ZGVA 1GZDA 2EL7A 1T6BY 4P33A 2OO5A 1KJZA 3EF0A 3V33A 4CM6A 1Z4JA 2JEOA 4G1CA 1QQ5A 4GSYA 4S3MA 4LUCA 5CU7A 3GARA 4XGNA 3T5GA 3EISA 4EB8A 5IYZA 2WVGA 1FJGC 1LBSA 3QBDA 3WI7A 5J58A 2LW7A 2NAPA 5KKNB 2XEDA 3EGXB 5CCXA 4UBMA 2G7ZA 2D8AA 3G8BA 1T0UA 3RAEC 3K9CA 3OCUA 3LX8A 2GCIA 2QDKA 3EFOB 3KZKA 3IUEA 2ZRPA 3GDWA 3C2QA 3PD7A 4QLAA 3SQDA 5FOXA 1NPTO 1V37A 4H7JA 3B9BA 3ER6A 1N7JA 3A1UA 4G1MB 3TDMA 3L8HA 1ATZA 2QE6A 4FNAA 4DTIA 2BF7A 2QW0X 3LGSA 4N18A 3BT7A 2Q5OA 2ZI3A 4QHSA 4D02A 4TTPA 3PUWA 4DKJA 1VG1A 1Q19A 1F4VA 3CWZA 3G0OA 4I8XA 4JI5B 4HV4A 3G0HA 1SIWA 1KQ3A 4JD5A 4I0WB 2XUJA 1G4UR 1R6AA 1AG9A 1WAMA 1Z13A 1G16A 3CLKA 3P97A 4ZEVA 3VSEA 3NH6A 4MYSA 3V8RA 1ILEA 1B7GO 5KVCA 1AIPA 1F5NA 4TQGA 2BJWA 2F8LA 1LU9A 3C3KA 4DIKA 5AD1A 5G0WA 4R8KA 2Z4RA 4F5DA 3AEUA 1E9SA 4BATA 4C0XA 1I4DD 3BH0A 5JVDB 3T7TA 2IHKA 2R6HA 3IT0A 3MJ4A 3WG9A 3GBPA 1V60A 4BDSA 3SYMA 2SNIE 4S35A 5JFOA 5KWIA 2E55A 5I7UA 3RCBA 3TECE 2QLMA 3VR6H 2L18A 3WGOA 5JCOC 4B6EA 4DMFA 1D8TA 5LU8A 5JNUA 1D4OA 1P1FA 3L0DA 3OMLA 1O6ZA 4JJ8A 4N8EA 3VZQA 3AF2A 3Q3HA 3U1TA 2VSNA 1ORDA 3UJAA 2ZT6A 3GGGA 4K6GA 4NONA 1AC5A 5EZYA 5B57C 2DHQA 4RTSA 3WWCA 2P2CA 4PEVA 1DZ3A 3DULA 1U4OA 2FW6A 3H7IA 4PC3A 4X00A 3I72A 2NGRA 2HV9A 1V4VA 2HTEA 2VSYA 1D9ZA 4GOXA 1OT3A 2W6CX 4DB2A 1NULA 5IJ9B 1B2LA 1FX0B 3MYRA 4KYUA 5CEEA 1LRLA 4PYMA 1Z08A 2K4MA 2ZBUA 4KBGA 3NEJA 1AF7A 4J0JA 4IIGA 1X7WB 1U3WA 4TN5A 5CZXA 1F60A 3R5KA 1CG6A 4OIMA 4YJKA 4LF6C 2YDXA 3AK4A 1G41A 5JYDA 3B36A 3W05A 4UARA 1MGPA 1N6NA 4LV6A 3DGEC 3LLVA 4AZ0A 1BTOA 1PT9A 2CDNA 2XNCA 2IYOA 3AG6A 3DPUA 3GJ4A 3WZMA 3EX7C 2O0HA 1S3IA 2EHDA 5IARA 1WRBA 4GZ6A 2BY4A 4EYGA 3U3ZA 2PX8A 3Q3JB 1ZM7A 3GIDA 3L7LA 2JFYA 4EFNA 4Z3KA 3ZDCA 5FUYA 3T12A 1M34B 1QOZA 3NHKA 2XWBF 5DYGA 2ZIGA 4BZXA 4CT5A 4F3RA 2BPOA 1HZJA 2J85A 3LKVA 1BXRB 1C1XB 4Q00A 2ZTHA 5DCWA 2AG6A 3O3NB 3RUCA 1MXCA 2WHXA 1SCUA 3ELBA 5HEKA 2PSHA 3EVNA 4ND2A 4DANA 3S6JA 1P39A 5IT9A 1EMDA 1IPFA 4LOLA 4RA6B 5EL0A 4H1WA 2ODBA 2YIVX 4RANA 2HHHB 2J3EA 2UVDA 4IYRA 1IN5A 5L51A 1O6FA 1P3JA 3I4FA 4NE2A 1EXNA 1KH3A 2PD4A 2BFCA 3HRKA 3PX2A 2XB2A 4Q9LA 3AVWA 2HEIA 2YWRA 3W8EA 3ZTTA 1V5GA 2JI6A 3L8DA 1Z6YA 3RS0A 3NBMA 3NTRA 2R47A 3IMKA 5AJHA 2GBGA 3GEBA 4X71A 1EE1A 4J1TC 4EJFA 2ZI9A 3PQFA 4ZCQA 4U8GA 1TUBA 1ABEA 4BNVA 4TQ9A 4WN9A 1UPCA 3S1LA 1FBNA 2X14A 1TTPB 3FDFA 4MQEB 3DVLA 1YJ7A 1PDVA 3WK9A 4CU5A 1ORWA 4XYLA 4PIMA 1WXXA 3C15C 2EWWA 2H06A 3DYBA 3GHHA 3AWIA 3NETA 4NF2A 2O2EA 1KEWA 5ALEA 3RYHA 3GA7A 1Q0LA 3JD1A 4RZSA 3HNPA 2Q6TA 4S0ZA 1DCKA 1JR3D 1JOSA 1RCUA 2DHDA 1E9VA 2K87A 3F6YA 3FTEA 3CR8A 4QAJA 1UKKA 1CB0A 1P62B 1VBKA 2ABWA 2L17A 3K16A 3OETA 4M2LA 3RASA 2O8BB 2JAUA 3ORHA 3TGWA 4B6GA 1MABA 1VIAA 2X8LA 2CVQA 5I5EA 4HFRA 4IJWA 1RWMA 2JFBA 1Y8ZA 4G5QA 3ZHOA 1MX5A 4GI5A 1JB9A 1ZMBA 2FOLA 3NIBA 5KJ1A 1UBTS 4U00A 4N3AA 1QH1A 3HPQA 1EXWA 1T3TA 2PZ8A 1HUQA 1S9HA 1QE3A 1BHSA 3QY0A 1V5IA 4RHYA 1HY3A 3IV7A 2ZYDA 1EHYA 2MSNA 3LCJA 4OFWA 4Q7LA 4TKLA 5KX5B 3NUZA 4R98A 4QOIA 1M2JA 1TIPA 3PUJA 2GNAA 3OPYA 5K8VA 5KO2A 1SQ5A 4PZCA 1CDZA 1IN7A 1XG5A 3DDUA 3G0BA 3W2GA 1E66A 4PZUA 1PFGA 2FUNB 3HGMA 1E3LA 1YZGA 2BFDB 2Y93A 4DLVA 2VPQA 5KMGB 4OXRA 4DILA 1PNVA 3H5AA 5T5QA 1EDOA 1Q7RA 1CQXA 3QWFA 4ATNA 3RU3A 1VB5A 4UXJA 1U6JA 3JVDA 5IDVA 4WZZA 2FWNA 4G24A 4GL2A 3QKSB 2GYYA 2VPWA 1R88A 1Y6QA 4XPZA 1AGRA 1W93A 3C5VA 2OMEA 1SU7A 3HZOA 4K28A 1F2DA 1GL6A 1L7MA 2BH9A 4KPFC 1ESNA 3LOQA 1E6EA 1NMQA 5DKFA 1ZN2A 5IH3A 1KYVA 1A9OA 4AN1A 2FZ4A 1B93A 3FVRA 3PYMA 2G83A 4NU6A 4U7GA 4CF4A 2VNIA 3I30X 2OV4A 4UUPA 4C89A 4CIXA 2DOKA 1WSWA 4HL6A 4MQ6A 4REMA 1MB4A 1NV8A 2GD6A 4IPTA 3LNOA 3B9RA 1ZD8A 1LK5A 1N9KA 4BRZA 1KKUA 1C9KA 1YTLA 3L6UA 2XMSA 3EIUA 2GO1A 5EERA 1KDYA 5A4FS 2IYRA 2XCSB 1FFYA 1AT1A 3B1JA 3A2LA 3FPCA 2ZRGA 3ONNA 4JLPA 1QIGA 1DRVA 3AJAA 4NYIQ 4TUYB 4PLCA 1YVUA 5AOVA 1K4YA 2J7PD 2VO1A 3U37A 1JFTA 3DE4X 4BIMA 2YOHA 5BV1A 2VZ0A 2YFHA 1B6RA 3REGA 1KEPA 1ZOIA 4JGIA 1JR4A 3E05A 1YQEA 1FTQA 4TRRA 2H1LA 1DFHA 2OWDA 4YJHB 1A2KC 1RCFA 3A2NA 1P77A 2V4MA 3DUFA 3WRVA 4YXWA 4RTMA 5EE0A 2YZKA 3R0VA 5LP6B 4G3XA 5E9QA 4F97A 5KDOA 1E64A 3IVGA 4OMDA 1Q44A 4R31A 4EUKA 2A92A 3DWIA 2BR5A 3U49A 3VNQA 4DR4C 4FOSA 2C2BA 2OPBA 4XUGB 1PEAA 4JOSA 4PBTA 2IZOA 4UDOA 2P5UA 2OAGA 2R4UA 2ZBQA 1X42A 3JWGA 5ALFA 3HO1A 1O95A 5EQJB 1WG8A 1GAXA 3C3MA 2M5HA 2XDWA 2CF5A 3CUWA 4NV1A 3ZU2A 4YUAA 5J2UA 4QATA 1X38A 3B6IA 1E2PA 4Q02A 1L2FA 4FFDA 3NM6B 3HNRA 4DV1B 4ZT3A 1PJ8A 2NO1A 4DCUA 4PS0A 2QL5A 1RBZA 2IL1A 4W8HA 1I94B 3I9NA 2FX2A 1GNSA 1EX9A 2RAPA 4LHEA 1UFKA 2JFVA 5HK9A 1M6HA 3IDAA 4BLUA 2HRRA 1H8HA 4OUDB 2H11A 2O3QA 4RVGA 3IBTA 1MH9A 5ALQA 1QJ4A 2J6HA 1VE9A 2FETA 3QHPA 4QWWA 3UH1A 4CV2A 3OZCA 3RC2A 1P5FA 2FF7A 4LZZA 3ER9A 1HL7A 5DMXA 2VJNA 3V2UA 2QJRA 4D8YA 5EHGA 4DF3A 3CPSA 1PEKE 1XCBA 3GYGA 1XEWY 3L82B 1DAPA 4MGZR 3OZRA 3L7KA 1QP0A 1N6KA 1HT0A 1TM1E 2PD3A 1HLFA 1I0LA 3JWHA 1C0IA 2WIDA 1A2BA 2WTXA 4LVCA 1MVOA 1GPMA 3Q10A 3RC7A 1YT5A 3B13B 3FOBA 1LV7A 3I9OA 1JL3A 3C4VA 3I37X 2REQA 2NTVA 3HY3A 3PFIA 4JI3B 5FOTA 2C95A 4UU0A 4PNZA 1IHPA 1GQQA 3F4BA 2NV2B 5C18A 1PX0A 3VOTA 1N8TA 3KT8A 4D44A 3OE7D 4YMHA 3N7AA 1NNEA 1DGQA 3GH1A 2HU2A 4DV4B 3N75A 3ZE0B 2WEKA 1WM1A 4CF3A 1E3SA 4K03A 7ADHA 4JV5B 2WINI 1KBQA 1PR1A 4IRUB 2IC5A 3TR3A 2V1XA 2X3YA 3OH8A 4M0KA 4OK6A 3DEIA 5FYQA 3PNPA 4AQYB 3CQ1A 4ID9A 1DCMA 2KYRA 3KB2A 1YI1A 4LOHA 2O8EB 1HL3A 3PUXA 5BSTA 1T91A 4DIFA 1LXCA 2EEPA 3HCRA 2EP7A 3IBFA 3MSCA 4HRXA 4MDFA 3T3NA 5AYVA 5DSZA 4FFWA 4AJ1A 1MAAA 4GOJA 2RHMA 4RZUA 1TA0A 4X94A 2EYQA 3VKFA 4IYJA 1FDRA 2PKXA 3V1KA 3PJRA 4I81A 3RUHA 1QFSA 4DUGA 4XGIA 2PZAA 1TAUA 3SJ7A 3LKBA 1Y8QB 2J9GA 5JBIA 4EGQA 3TE6A 1MJGA 4H1UA 1W581 221PA 3AVYA 1XMOC 3FZYA 3KQTA 4P83A 2OB2A 1EEHA 3T34A 3VPAA 1L4UA 3TF5A 2Y2VA 3KSUA 3TE7A 3ZY3A 2J32A 3SMVA 3ED1A 3FSRA 4K0KB 4RY8A 4RLSA 1LB1B 2JCVA 1YBFA 1A4IA 3LCMA 4PO8A 5LB2A 3JQRA 1DPFA 2PVCA 2NVWA 4C7BA 2NU9A 2RKOA 2CKMA 3GJZA 3X1DA 1RWKA 1NV9A 2ZJ2A 1L4MA 1NW6A 5CDGA 4M46A 4KQXA 2DHMA 3USZA 821PA 1JSZA 1Y1TA 3DOIA 1KFBB 1UDXA 2RJ3A 2HZ7A 3LZCA 4Q7JB 1DX4A 2IXFA 3ZXUB 4DIBA 5K0FA 3KT0A 4G36A 1IQRA 2GHRA 3V32A 2Q5QA 3PENA 4WECA 4B3GA 3RYCB 3ZE8A 3BUSA 2QL8A 3QVKA 1C5KA 2G25A 3CNQS 4PAWA 3EDCA 1THTA 1ML8A 1G66A 2F90A 2LZ0A 4ZOEA 4EP1A 5E7QA 3KQLA 3ROQA 7MHTA 3RYFB 3LW8A 3DMRA 4B43A 1VPLA 2GN0A 3CBQA 2WPNA 1NBWB 4YUYA 3OEHD 1A5AB 4NPAA 2H51A 4FQ5A 2RHOA 2FMKA 2QGNA 4HWSA 4A1OA 2Q2VA 1KYXA 3ZU4A 4OYCA 4OSOA 4HQ6A 3V55A 3HJAA 2E4UA 1NASA 1UMBA 3I61A 5CLGA 4MJ3A 621PA 2BVNA 2FQ1A 5I6DA 3P9YA 4G9EA 4PV7A 1VJ0A 4UBJA 2P9BA 4QDUA 5AJXA 5JSYA 3TWOA 4AP5A 4DDWA 2XA2A 3G8CA 4BJ1A 2VYQA 4V0KA 3FMIA 2O3TA 2V7PA 4R9RA 4IDHA 4X1IB 1U2RA 4IMJB 3L93A 2AMVA 3FPEA 4BNZA 3QVJA 1VIMA 4QRIA 5H68A 2JD2A 2GN1A 1O97C 4NI5A 3P9PA 3Q5GA 4DB4A 1R8JA 3DH0A 5FBHA 1AHHA 1SRQA 2OM2A 3GCXA 1R9MA 4IEIA 4PW0A 5GJBA 2MMAB 3D8RA 3QLEA 4X97A 5FWAA 1KWGA 2BR4A 2P79A 1VPTA 3H4VA 4DRXA 5K0GA 3CVOA 1ZUNB 3NIWA 1HOXA 2PS3A 4RX1A 4BMNA 3TDNA 4CR8A 5EESA 1D09A 1NMZA 2JVJA 3PQDA 5IVIA 5CBPB 2YZ2A 5L6MB 3OTHA 2LCIA 3IESA 2A5DA 2QF7A 2HXSA 5FF9A 1RY2A 4ARIA 2GSDA 3KYCA 1XQ1A 3ISJA 1NVAA 1RHUA 2PFGA 3OFVA 4UHCA 1KDZA 5IKXA 4PLZA 1KAGA 1PJRA 4H0FA 6CHYA 2VUHB 1N92A 1DV1A 3FPKA 3HEAA 1XEAA 4M0DA 4MKZA 3L8YA 5ALGA 3WLRA 1NDQA 4B7CA 1ID1A 3A7DA 5BMVA 2W6IA 4ES6A 3SJBA 4DZRA 3G0CA 4PSAA 2B78A 2HCTA 4O3FA 4ND6A 3MUNA 1XP5A 4L2ZA 4M6WB 1F48A 3B2QA 3RQSA 1Z6TA 1JBQA 4ZDWA 4ENTA 1J0AA 1NVMB 2GZ3A 2ZU0C 3BFXA 4GDMA 1TCBA 1FUUA 2B6HA 5HBGA 1CUYA 2I03A 2H29A 3B85A 3FVWA 2VHWA 4FYWA 4QC2A 5EGNA 1N2FA 6REQA 3L4EA 3S3TA 3Q9NA 4GYKA 3Q2IA 5AW3A 5HZHA 1KYIA 3IT2A 2CNKA 2WTEA 5EJIA 2AV6A 2QPOA 3AEQB 2V6BA 3U61B 4XUEA 4D4LA 3MWYW 4AY6A 2C0QA 1J5EC 2J9RA 5JATA 1W7AA 1W4BA 4ZLPA 2QN1A 2J3HA 2QU8A 3HKEA 2ZBDA 3PB3A 4Z0NA 3AR8A 4L7QA 1R6UA 4DJAA 3ZEIA 1Y81A 1KE1A 3A1DA 3SIPA 3BJIC 1FSPA 1TU3A 5I9SA 1UPTA 1WSDA 4YHHC 1PVDA 2YJZA 3JVIA 3OP1A 1B1AA 5JY1A 5EIXA 4YP7A 1JDVA 3N87A 4ZMSA 2PZJA 4LSZA 2AMJA 5C7LO 2XNSA 4YRFA 2YY5A 4XGRA 1CU1A 4Q4HB 2AWNA 2CE2X 2Y1DA 4EM6A 4KUGA 5DCLA 5A02A 4IH1A 3IVAA 1M2VB 3LG2A 3MGAA 2C4KA 4ZODA 3QELA 3OG9A 3STHA 2BEVB 2JVIA 3FB4A 4MGKR 3AUKA 4YREA 3S8YA 3R7WA 1S8AA 2B0CA 2QTBA 1VE1A 1QKJA 1UZNA 1UJNA 2HT1A 1FS6A 1NJ1A 1GGJA 1OQAA 2CLMB 2LE0A 1RRFA 4BP1A 1NOKA 2PNJA 1A77A 5BQ5A 1SQSA 4FBMA 1QHNA 4FQ7A 4L75A 3BB1A 5TSDA 4N0MA 3OCJA 1N6IA 1Z35A 1ADGA 2VJOA 4GPBA 3VO2A 2Q50A 3LC7O 4Q66C 5TGZA 2VRWA 4JR0A 2AOVA 4RABA 4ZVVA 1R8SA 2JFHA 2UVPA 3QHAA 4QU8A 2N46A 2ZYAA 4Z8YA 1QXSA 3THYA 2QTCA 3HR7A 1A95A 4RMNA 4K0RA 2BEKA 1K3TA 3FWNA 1P9LA 4F9TA 4LFAC 1E6WA 3A9TA 4ZK6A 7GPBA 3TAUA 2PU7A 4EJSA 2QP4A 2G82A 3MUFA 4FW9A 5A05A 3KWLA 4C0LA 1P1IA 1WXQA 5DRYA 2ETVA 3RVRA 4A92A 3WQRA 1LRKA 2C4WA 3GRUA 4DA8A 1F5SA 2X58A 4WOCA 4XRGA 3GFBA 4YV1A 4BFUA 3SHVA 3UXHA 1KP2A 3VPXA 2ZWIA 2B25A 5DHTA 1DPGA 3PKJA 3P4XA 3UEOA 3ZJYA 1MFPA 4K9OA 2OO4A 1IG3A 1RRKA 2GBIA 3EYWA 1H4VB 3PNSA 1L1FA 4R6WA 4CR6A 4OHUA 1J7KA 2FZLA 3CT6A 4UTOA 5JMWA 4LYDA 2E0IA 1R4NA 2IY8A 1KKLA 4EBBA 1M75A 1S8FA 3MWEA 4EG5A 3WGLA 2HGSA 4Q05A 4F3CA 2UV8A 4U9UA 2IGBA 4XUCA 3EEYA 3ZBUA 2JIBA 1K0RA 1PZGA 1T3ZA 1TQDA 1VJ5A 3BKWA 4KACA 3INYA 5F2OA 4ETMA 2GCGA 1TAHA 4BX3A 1GCGA 1M7HA 5D3KA 5LUAA 2A3NA 3SHTA 1YS9A 1N75A 3CZAA 1EA7A 2EWVA 3JQGB 3O0DA 3AM3A 1YWGO 1DC3A 4M1QA 3F9RA 3KEGA 3UWSA 1J1UA 2PL1A 2WM3A 3EDYA 4JI7C 1DIGA 2I54A 3H1TA 3AMVA 4I99A 3JAKB 4RGQA 3TNJA 4EI9A 1N2SA 4YCBA 4IIDA 4OYYA 4PXAA 1U0EA 1CFZA 3ZWQA 1GL7A 1AQYA 4EG0A 4FYIA 2JGMA 2GRUA 3CRNA 4ZEMA 1ADJA 2IW1A 4JVNA 1MIOA 2AZTA 4MIOA 5HIKA 1QQ6A 3RKRA 1JV2B 3DZDA 4HTFB 4RELA 2Z8XA 2NUPA 3DMGA 4CV0A 1V6AA 2A9RA 1Q84A 2XD4A 4KBFA 1B76A 1O6CA 3LA8A 1CR0A 3VHRA 3EFEA 1U6KA 3AETA 3ZK8A 3G2QA 1J22A 4E11A 3QLUA 5KYNA 4F8YA 1MX1A 4NOJA 1LPBB 1XJ5A 1YIOA 2A2ZA 2IZZA 3ZJTA 1GZ7A 1U0NA 1BMFA 3DE5X 3K0EA 5C8YF 1GQYA 3H1FA 2P5TB 4BX2A 3R7SA 3SQNA 2OGSA 1E6CA 1HA3A 4D0LB 2NZJA 4PZEA 4JQOA 1GYRA 1YL7A 2VHTA 3HU1A 2D62A 3KALA 4N54A 4ZQIA 2Q8QA 2CHGA 5I9MA 3BXHA 2E9SA 1U65A 2QRNA 3CGWA 4YK7A 2C00A 3C6KA 3DA8A 4W5NA 2KLHA 3CSSA 2GXAA 3JQQA 3SU8A 3LT1A 2CSUA 3QWAA 1NAHA 3DLCA 3BGVA 3HKDB 2R00A 3NUQA 1NJGA 2O8FB 3MIZA 1P2VA 4BKOA 3HNOA 1JR3A 2HK7A 1UZLA 4IIJB 1SVMA 1XQXA 1CZRA 1Q95A 1RHKA 1GOTA 5I7EA 1J21A 2YIMA 4A9AA 2VWGA 2IYFA 3KT3A 3ORQA 4EL5A 4MUAA 4EECA 3DDWA 3HYTA 1PFWA 3QVVA 5B5SA 1JNXX 1V8OA 5BVGA 4U2BA 2ZWAA 2O19A 3PGJA 1VMAA 4QDJA 4RV5A 3ENQA 2VDNB 3H8JA 3R5JA 3W6PA 1N2JA 1DIAA 3IA2A 3WGKA 5LOVA 1NF8A 2I7TA 2C03A 1AZLA 3I23A 3LWZA 2YWCA 5CD1A 1TYDE 1J6UA 2XUKA 5JZBA 1DO8A 1R2QA 2C9CA 4TV9B 4MRPA 3IB6A 3W5JA 5KYWA 3IB3A 4BVHA 4TSFD 2JLWA 1G7CA 1HDOA 3EEBA 1LH0A 2I33A 1RAIA 3FWPA 3OUZA 2XMPA 4ZCRA 5FI5A 1YR2A 5HA5A 3TM4A 4YJFA 5A7FA 5ESWA 2CMKA 5IKPA 3RFXA 3LC0A 5DHAA 1ZK1A 3MMNA 3SF0A 3ZWNA 1C3EA 1D3AA 5JLAA 2ZZNA 2E87A 2CLKB 1NQUA 2CJWA 3N28A 3RR2A 1AKEA 3CG0A 4AQ7A 2L0XA 4NTZA 3AGPA 1BOFA 1V26A 4G37A 3I39X 1USGA 1QHFA 2EF1A 2SBTA 3KELA 1TQ8A 4OGKA 2HNBA 1X77A 3W5HA 1Z15A 3SI7A 1NW3A 3UKDA 5DNVA 4GGPA 3E82A 1P9RA 3BHJA 3G5LA 2X2PA 3PLRA 1K6JA 1AUVA 1BCRB 3KOZA 3S4YA 4V0LA 3ZWBA 4PG5A 2DBQA 1QZ3A 4M1TA 3MHPA 3IEIA 2QD2A 3UNXA 1JSCA 3HJTA 4C0BA 4LTNA 3GQBA 4DYDA 1UKZA 4EPTA 1NF3A 5EP2A 2Y3IA 4A8HA 1FTNA 3VPHA 1DRKA 3C3JA 3SXJA 1YI8A 2W8BA 4LIPD 1NJ2A 2ZE5A 1L8QA 3T4XA 4PSVA 4Q3AA 4E2XA 4S2EA 3R3XA 4I14A 1Z4PX 1XL0A 4HEHA 2GHQA 3IQIX 4MRMA 3TZHA 4ZJUA 4IUYA 1VPWA 1W0KA 3K7EA 4MB0A 2MYTA 4KAFA 4IVRA 5HFAA 4AN0A 1KMCA 4JLUA 2H5EA 4EVQA 3M34A 2RK6A 3H9CA 4HDOB 3UGKA 5C5CA 5CZVA 4UVHA 3IO3A 4MW5A 4D8UA 3ZWPA 2ZW9A 3FN4A 3HZZA 3B1FA 1IUNA 3CCCA 5ITSA 4BBJA 2OHXA 4KVGA 4Q1BA 1HPLA 1XDUA 2R86A 1GO2A 4UHFA 2HRCA 3PJGA 2VP0A 3A3NA 5HIJA 3W3AD 4J3FA 4MPPA 4QG7A 1RRGA 1T4CA 4IBOA 3GLFA 2YVUA 1IY8A 3GYBA 1DQSA 4GBJA 4RIIA 3UN1A 3EH2A 2Y1CA 1OB5A 1I5RA 1KJJA 1STOA 2BF4A 2QLTA 3K53A 5B3KA 5CYPA 4M3NA 4EENA 4YMGA 3N6VA 1J06A 1XZMA 3O4HA 3ZNNA 3MS2A 4F12A 4KHZA 2WT9A 3PGVA 3FG9A 3WK6A 3R09A 5IASA 4D56A 4NZPA 4IQFA 5HNKA 3L41A 1E77A 3CJEA 3N70A 1MW8X 2HF7A 1GZUA 4HWOA 4P3OA 1VE3A 4B71A 3TLXA 3CPEA 5CHYA 3TL6A 2ATVA 2XE8A 2UYQA 3Q7PA 5E9JA 4ZVKA 3ABIA 2RGDA 4B3IA 1COWD 5C1PA 4S04A 1MQ8B 1AN9A 3P94A 4QGHA 1MH1A 3CUVA 4ZIRB 1WCWA 1CEQA 2VQFB 2JFZA 5CA0B 2AJBA 1T36B 3L01A 4NFHA 2RIRA 5EMKA 4QO7A 1RJDA 1DXOA 4LZWA 2BKLA 4EJMA 3F6CA 4R9VA 4UNQA 1OAKA 2PT7G 3QXXA 1UFQA 2PGAA 3TXYA 5A9SB 2WICA 3AYZB 5TPZD 2AG8A 3S7ZA 2ACVA 3A9VA 4M9ZA 1RLOA 2LKCA 2YINC 1C3VA 3O1JC 4QEKA 4A10A 2IEGA 4IOLA 1Y4UA 2VK8A 1CSEE 2OECA 3BTOA 3IEVA 1X7GA 3GBVA 5CLIA 2GNPA 4LF6B 2WQ7A 4NMHA 2VCYA 2YY7A 4BNNA 2KWIA 3D5EA 2EFGA 3DFFA 1XA4A 2B5OA 2MM9A 1U80A 5TEWA 5TVGA 2ZWVA 5ALJA 5J3JA 2BGUA 4YAKA 3Q5DA 5DU2A 4ZC8A 4YYZA 1JSXA 4R5MA 3SZRA 4HP8A 2FMFA 1HG1A 2XLCA 4DADA 4YPOA 3I45A 1OU0A 4RAOA 4WY2A 1ECLA 2A0UA 2F48A 2G9QA 3U9TA 1ODLA 3TQCA 2HMTA 3AFMA 2BCJQ 4WGGA 4W5RA 1OMOA 1YVRA 2HSEA 3GCZA 4TTAA 3PLAE 3MD9A 3HZRA 4S1OA 3T0GA 1NR5A 2I6QA 3D7RA 3JYNA 2WWRA 5E4TA 1I9GA 4I36A 2A9OA 2FDRA 1RDFA 2Q9AA 4PTYA 2NUAB 1MV5A 3RTEA 4BVBA 2VDRB 3DF7A 4B6RA 3O8DA 4K9KA 5DJ5A 2GZ1A 4EI8A 3TCKA 2HIMA 1N25A 1FP2A 1M6EX 2GCEA 1U8YA 1NDUA 1WKCA 3IEXA 4FIDA 1JEOA 1Z29A 4BPBA 3K0KA 4UQPA 5K3FB 1CV2A 2QGFA 4XOUA 5AKEA 5HKAA 2BJOA 4Z2YA 1BNCA 5L45A 1ST3A 3NM4A 1FDUA 1FW6A 4I50A 4S1PA 1PVOA 2PGIA 5DI3A 2DUWA 3AEYA 1LDBA 4LS3A 4CMIB 1NY6A 2VQ3A 3OZIA 5LXTA 5FR2A 1M2GA 4KGVA 4F45A 4LJYA 1M6VA 1TEZA 4AUNA 3DKRA 3LDHA 3NV9A 1L1QA 2GXUA 4FTWA 4OOFA 5DXAA 5JC1A 3CVVA 1WWKA 2IYEA 1XQWA 1QHXA 3DHYA 1RWOA 2XZPA 4JELA 3SJAA 2JGDA 2RKWA 1X7XB 3TQIA 2ENUA 1IN8A 3DKIA 5GV7A 3I2FA 5TR9A 3UH0A 1T8RA 2V5AA 3VYTB 5EHZA 1UM9B 3L7AA 3OCZA 3SHQA 4IWYA 1ZQ9A 3BH6A 3RLIA 1ZGCA 4Y9SA 2X5NA 3KTDA 3RBZA 5KNLA 2X1HA 1GV0A 4M8SA 3Q0IA 2WHPB 2QRJA 2B21A 5ERGB 1HNWC 3L8ZA 3H0KA 2I3GA 4MQLA 1P75A 1PYOA 3Q3GE 3IQGX 3H1BA 3FTFA 1HT3A 2I71A 2GOYA 1MNAA 1AURA 4OXKA 2RBGA 1YZNA 4YB8A 3L43A 3RFUA 1BA2A 2QX4A 3OEHA 4YCCA 5AJYA 1K6EA 4QUIA 5BN3A 2DQZA 3ZKAA 2IIBA 3PHGA 4PQRA 4J16C 2Z0MA 3PQ6A 3ANTA 3K8OE 2RAVA 3JXEA 3NRBA 3AY6A 3IYLW 4NEHB 5CVEA 4YDSA 5B2FA 5BY2A 5KYXA 1QX4A 3NOOA 5FOWA 2HU8A 5A0TA 1Z7GA 3ASUA 4FS8A 5HDBB 4DC0A 3GW8A 1F0PA 2X8AA 1LLUA 1SEPA 2J9ZB 3B60A 3GPBA 2BFNA 3P9QA 3RRJA 1H4SA 1H2RS 1AQLA 3CUYA 1OX4A 4WD3A 5EPOA 5SY4A 5JZVA 4MVJF 4OLJA 4XIFA 3ZE9A 1UOQA 2NPIA 1UEJA 1Y7PA 4AKGA 2FWRA 1V2GA 2AFIE 1GUYA 4HXGA 2GLUA 1I1OA 1NYLA 4F84A 4KQ6A 3TTTA 3IH5A 2KI5A 4B3FX 4DBZA 5LD2C 4X7RA 2GM5A 4IHJF 4P22A 3T7KA 4Q3LA 1ZK4A 3AKEA 2XGOA 1U8ZA 4MW7A 3BHMA 1OSNA 3PFHA 3PT5A 1OX5A 4QJ5A 2XTNA 1RJEA 4J1SA 4XLZA 2YV5A 4HGRA 3K1ZA 2Z2JA 3HSYA 5F1PA 2QTGA 3COVA 3DO8A 3SJUA 1X1TA 1J5XA 3WRYC 1MPTA 4ODIA 2ZPUA 3MK31 4ARZA 5AUNB 3JZIA 4WESA 2PSFA 4V38A 2UYHA 2PLWA 2HB6A 2JF0A 1BFUA 4XYMA 1IATA 1OXTA 5FPYA 5E0KB 2FG5A 5FBVB 1RAEA 3WLHA 2NN3C 3OEWA 4FFSA 1TZMA 2GM4A 2CVZA 3NQ41 1I2ZA 3TQFA 4IGFA 5G2OA 1QP7A 1X8KA 2PJUA 1M33A 1D0SA 2WAXA 4DR4B 3LF2A 1N2CA 1PG0A 2BFBA 2FWIA 2WE7A 1XTUA 1T3SA 3AL3A 2VWPA 3HKBB 2GZMA 4DSZA 3EGVA 4MUYA 4KXVA 1CUVA 2GF0A 4OQXA 4DGQA 2AOWA 2H2IA 3HH8A 2LR0A 2F1OA 4Q7MB 1QGUA 3MT7A 4YAWA 2OXCA 1J8FA 1W30A 1R0LA 1U7HA 4MI1A 4YV2A 2HCBA 3WIOA 1ZIDA 1AHNA 3BFJA 1B3RA 3BSWA 1P3DA 1HXHA 2QGZA 3PSHA 3CQ9A 5B53A 3OZEA 5P8WA 5REQB 3W2TA 2H9IA 1ZB8A 5E4JA 2P6PA 5IC6A 3FB1A 4DCMA 1ZWKA 3H1PA 4P84A 4Z9YA 2EV9A 1DAHA 3HCAA 3AI7A 5COAA 3RABA 3WJ2A 5ITZB 2CDCA 4ZI2A 4EG8A 4RD2A 2OUKA 4ER3A 2GEDA 1UKYA 1QGZA 3FUWA 1K8XB 2FPKA 2KJQA 4C5CA 2ZLBA 3SE7A 4OX9C 3EASA 3EG9B 4EYSA 2ZANA 2JRCA 1W1WA 4FGUA 1TT7A 1UT5A 2JI7A 2H2AA 3SEAA 4XGKA 1NJ8A 3AESB 1ECBA 3ZI7A 5DMHA 2BI4A 1Y3DE 3BMQA 4TMVA 1VE6A 2A8YA 3IVCA 2WTBA 4U3JB 4FHGA 3B2EA 4WLUA 1J1IA 3ESCA 3FTDA 4PC6A 1OV6A 3AX6A 2GRAA 3O1IC 1XK7A 3TLMA 2H9AA 1XKXA 3MPOA 4NJEB 5HFNA 3GJYA 2PUDA 1A8PA 1ISMA 1MO6A 3BYZA 3L05A 2PVSA 1XTKA 3ZCVA 1UFVA 1JFSA 3DCYA 3RRNA 1E2NA 4HDNA 3TW6A 3DT9A 1KRHA 4R1TA 2YCBA 4OAPA 3WLAA 4FU0A 3VVBA 1JDBC 3GZNB 1P91A 1EP3B 1DJOA 2UXCC 4JJZA 2J0UB 3FNEA 3M6WA 1BW9B 1P9WA 3UK2A 1CZKA 1CZNA 5BNWA 1VCMA 3TNYA 3H1EA 4FSHA 2IEBA 3CRW1 3H5WA 4EHJA 4H59A 4RD4A 4Y2PA 5TMBA 1Z47A 1P7VA 3MFQA 4OMUA 4ZQEA 1QFXA 1OWNA 1ZPDA 5JASA 5ARDA 5JPCA 3PVSA 2PEZA 1W2HA 5CRIA 4KDCA 2OFXA 3UTCA 4YCLA 4E2ZA 1E1LA 1NBME 4GL4A 1XTQA 3GGSA 2JKYA 3EW9A 2I3BA 5CLHA 2EARA 3BSYA 3CCBA 1R5BA 2XUFA 2JC3A 2Q28A 5NULA 5EEGA 4W5QA 4UQLA 3RPEA 5IRCD 1QHGA 2JH9A 3QLTA 4W9NA 1UT6A 2JFQA 4BQPA 4YRKA 1PWZA 4Q7KA 5AKHA 4Y6GB 1K7FB 1XMOB 3WWOA 2FSGA 4BECA 3MMSA 2FQXA 3AQ4A 3G49A 1ZNZA 1AUOA 1RM4A 2QYHA 2P0YA 2GVZC 3DNPA 3WAGA 4XSVA 1T8SA 4TV8F 4JLJA 2R87A 5DM70 5EIBC 1YA4A 4P9NA 3T1HC 2QVLA 1XCPA 3F2VA 4OG2A 2SHKA 1JVNA 4OHFA 4IIFA 1RLUA 1FLAA 2J4DA 2ZBEA 3N76A 2IPAB 3LCCA 3LFTA 5DSXA 5FA5A 4IO1A 4DZTA 1NVXQ 2DKFA 9MHTA 1SXIA 2P4SA 3OZTA 2O2DA 5GQSA 1MB3A 1CS0B 4D46A 5AJUA 1UBSB 1VJGA 2IDMA 2VNSA 1PP4A 2XDQB 4YJ2F 5B3AA 4OBEA 2BUBA 2DUUA 5BRJA 2FPLA 1R0KA 1JFFB 2MWMA 4ZEXA 3UJPA 4LY9A 3AW8A 3W9BA 2FW9A 4EYEA 3RC9A 3T3MB 2IHNA 1LDYA 3WMEA 4WWHA 4EH1A 3DEJA 2G0TA 2MINB 2W4IA 2R6R1 1NIJA 3ZK9A 3ROKA 4EK9A 5JUWA 4J6FA 4WCDA 3HEBA 4GFDA 2C0CA 4L3WA 3WLMA 4F0JA 4FB4A 3VO1A 5GVRA 1NQWA 1QS0B 2PL9A 4QOJA 1U8UA 3ADCA 3FNRA 1ZDMA 1UC8A 3BWCA 2YW9A 2QRVA 2ZTVA 4CW7A 4O4LB 3AHJA 1RQ7A 2DSNA 3L4BA 3PE3A 3U7IA 3WKBA 3K70C 3CX3A 1AUXA 3L2OB 1DMRA 1VP3A 2XT0A 3UFXA 1RACA 2P30A 2D59A 3Q7QA 3ZDEA 2XCIA 4N3BA 5ECYA 1RLTA 5DX8A 4Y2QA 1XRMA 3WFZA 1ECGA 1FNNA 4O8ZA 4URXR 3KUDA 5FA6A 2BBSA 1N8NA 2FPRA 1IPHA 3DAPA 1G8JA 3E48A 3S2SA 3DXYA 3SIRA 2Q4BA 2WA2A 4H7FA 4IUDS 4R9UC 4RE5A 2G6BA 3KQQA 3RWOA 1QB7A 4TM7A 2Z8ZA 3DLHA 4R69A 2YNMD 3S2YA 1PJ2A 1S3FA 3HXTA 3UWDA 3PKZA 1I2DA 4F3KA 4QRHA 1UBLS 3O03A 1ZW6A 4FKMA 4E09A 2INGX 2ZBGA 5GWXA 3L7BA 1S0UA 2J09A 3U4QA 2AUMA 1GGFA 1EVQA 1WXDA 3ZC3A 3ZGZA 2HQ1A 1WTCA 3R6LA 4XB6B 1UODA 4BP8A 3LBIA 5DISB 4C20A 4OX9Y 2P3OA 3O9VA 5E7MA 4AC9A 1K5PA 3F46A 4IJKA 4C0WA 2WWTA 2X77A 2ZG6A 1XRQA 2O8DA 4QECA 1O0BA 4PPFA 4XX1A 3V8QA 4TSFA 4FNOA 3QW2A 3RFCA 1FLDA 3STWA 4XQ9A 2Y77A 3PWSA 1UWLA 1FTWA 4U2DA 4ZQHA 1ZGZA 5H3LA 1SZCA 3N8DA 4XVCA 2ES4A 5AVWA 1EGAA 2BIFA 2J67A 2PWPA 4N7MA 1V25A 1XZDA 4R2HA 2EJWA 4KPYA 4Z3OA 4QE3A 2ZI5A 2WBLC 2Y0BA 4AZ3B 1C0LA 2RI0A 4G0NA 1P8JA 4QU5A 2IZ5A 3V6MA 2VQSA 1KEVA 4F1KA 1BHJA 3ADBA 1I2MA 3CVJA 2Q62A 3EPHA 3TLYA 1QGED 3T8YA 2H1OA 2EHJA 4HLDA 2VPZA 4NV3A 2G63A 2QROA 3WL5A 3SQWA 1JJAA 1H94A 5JLJA 4DARA 4NFYA 2XB4A 1Y9DA 2PJZA 2ZATA 3B9PA 4ZD6A 2P4HX 4P7JA 4DAEA 1OOEA 2VJAA 4Q93A 3QY9A 3DEKA 3K6RA 2ZUUA 3OZAA 3H18A 3PHHA 1Z9BA 1L8OA 2AOTB 5CFNA 1YR9A 1KP3A 5HDQA 5JWOA 4AYXA 5JJIA 5YASA 5ALUA 2X9VA 1WABA 1KA9H 1LF5A 3O9MA 1J5EB 4WRRA 2E0GA 4XWKA 1PSWA 1VSVA 4L78A 4QELA 5IZCC 5JC8A 3G0DA 4HAZA 5EMHA 4U0JA 3DV0B 1DIRA 4LC1A 2EU8A 1HYBA 4Z6KA 2VAMA 2I78A 3DD5A 2VDQB 2Z3VA 3VHQA 2GCNA 4DDVA 3CR3C 3IERA 4YHHB 4Q18A 4LSWA 1KO5A 1KR2A 5IU6A 1TPZA 2R25B 1IC6A 1UXIA 2ZTLA 2VA9A 5JPDA 1L7AA 1SXJA 2A7QA 2TMDA 2HI0A 4EI7A 1XJQA 1IOVA 1OTXA 4CUKA 3NDRA 3ILYA 3QUQA 1UPFA 5BV0A 1VMEA 4FKBA 4R0VA 2B2NA 4DV0B 4PYJA 1LJ8A 4L0DA 3WVNA 3QKUA 2Y8EA 1XZ8A 1W49A 3L7NA 4MV4A 4YCSA 1QZXA 4ZHQB 2ZRMA 4HS4A 4GU5A 3OLCX 1D1QA 4LNUA 3N2NA 1NVFA 2IUUA 3AERB 1N5DA 4ZEOA 3PEFA 1XPJA 3HGQA 5ARCA 2GEVA 4G85A 3WP1B 2Q41A 1ECJA 3I9V6 5ICGA 3ZX5A 3E7DA 4EYQA 4X8LA 3LFHA 2QWXA 3L7DA 1O9GA 4CDRA 2GZ2A 4EY8A 1LSOA 4JC4A 4OGGA 3X1JA 1E1CA 3ZZTA 3NTXA 5DWDA 5JDCA 3PWTA 3WGJA 5BT8A 2PU5A 5C8XA 3HWRA 4Q3NA 2F43A 2BFEA 3W3ZB 1J39A 2EAUA 3NDPA 2E4WA 5IBRA 5K3CA 3RS9A 1XRLA 2JI9A 1BJRE 1G21A 3K9NA 3Q3IA 4G4JA 1ONPA 3EZ7A 1K63A 4L72A 1Z4NA 2KQUA 3MJVA 2YS6A 3GG2A 4NS1A 3TIGA 5KSYA 4FXPA 5JI3E 1AK2A 1OH7A 1UJMA 4DG9A 1NURA 3L9XA 1CE8A 4OAQA 1P74A 1ZNWA 5EWJA 3ZWYA 1PX2A 4RORA 3MOSA 3CUEF 1B41A 3FTNA 1D2AA 5BSUA 1Y7LA 2DGDA 1X19A 3DP7A 1ZL0A 4MW0A 1FPMA 2WG2A 2IY9A 3IAEA 4HK4A 4ZWNA 3BE8A 3RKSA 3ZXIA 4ML3A 1G1MA 1MJNA 4MIEA 1U0TA 1EP9A 3H84A 3A3PA 2O1WA 4PLHA 2IQ5A 4AG5A 2IBTA 4ID3A 3R5HA 2BRUA 1OH8A 3JQAD 1GGNA 3EGXA 4BO1A 4B6QA 1SD5A 2JJ8A 3D6MA 4LVOA 3VVMA 1KZ9A 2DLDA 4UOEA 1BKYA 2C5EA 4JI7B 3EFOA 3OFNA 4IIVA 3BIWA 4QO8A 3VZRA 2H00A 1WPXA 1Q1ZA 1O1YA 4RXTA 3H6GA 4PYIA 1Q7EA 2VJPA 1EFTA 1FVFA 5AVOA 4BMYA 4LHVA 4YRJA 1XMIA 3S2UA 2IUYA 4R2WA 3KV3O 3HO6A 4HRYA 1NU6A 1R4MB 1V5EA 2IX9A 1RQGA 2HU7A 4QPNA 3JS5A 1OLXB 2RIPA 1USPB 3RTBA 2V3CC 2WFAA 1VDZA 2FZCA 4KWHA 3R3UA 1XA0A 2VTKA 4FOPA 2VJYA 3C5EA 2A9KA 1I2AA 3K0FB 4G0ZA 1H2BA 4L3VA 2V8BA 3GVXA 4Q0MA 3ERCA 2PV0A 3OJXA 3TTUA 1D07A 4DCGA 1QCZA 1ZOSA 5EHIA 3VC3A 1XQYA 4AJ4A 3H3JA 1WZEA 5JVDA 1D9XA 1EUDB 1XWIA 2Q6IA 3B53X 3MOGA 2JFNA 3TPZA 1S9DA 2UUOA 3N3AC 2QUAA 3OZWA 1T8UA 2IUTA 1RYYA 4JU8A 4EMTA 3T7EA 1PYDA 3ZUGA 1EU1A 3ND6A 1TGVA 5IUJC 1NUQA 2CJPA 3X2EA 1BWPA 3B6MA 4IM7A 1AQJA 3I92A 5GTDA 3F7MA 2AJ8A 4GPIB 4HQ0A 2BZ0A 4MEBA 1GSHA 3LMKA 4NECA 1MG0A 5E9AA 4M7OA 2HRZA 5E6UB 3TW4A 3ZHQA 3QVGB 1XZGA 5EXPA 4N82A 1ACJA 3PZRA 4WK4B 2G5GX 4RF3A 5JNVA 2J3DA 4B6FA 5IJ9A 4I46A 1FX0A 3NDJA 5AI8A 2J6BA 4XYEA 4CKCB 5JJCA 3R24A 1CUHA 5FCDA 3AOEC 1ULAA 4EHNA 4QXMA 4TKZA 3ADDA 1X7WA 5HOEA 3ABZA 5KAMA 2YASA 3CUKA 4BMSA 1JU9A 3NBZC 3FMFA 3QYAA 4M4SA 4MROA 4WNIA 1JG1A 3I07A 3EPJA 2XZLA 4DCVA 3LBFA 2ZE8A 4LKRA 5HE9A 4PIPA 3UMMA 4BQEA 4UTXA 1Y6FA 3LW7A 1ZK2A 1ZEMA 3W6OA 2IZ0A 1PZHA 2CEAA 1D4ZA 4FBLA 2KHZA 2UZIR 4HYTA 3ZDFA 2PUGA 4M83A 3PUZA 3CW8X 4RZ3A 2VP5A 2W71A 3COSA 1M34A 3CLSC 3I5UA 4KR3A 2CUTA 3HFJA 3MJFA 1V7QA 5AM3A 5CPFA 9LDTA 1BXRA 1C1XA 1I7LA 3FPAA 3U19A 4RJJA 2CXTA 4AUMA 5IJ0B 3ABOB 1E2BA 3AR9A 3ZVMA 1LQTA 1P1JA 2R2AA 2VTVA 3SHOA 2EKZA 2LGJA 4RA6A 2QD3A 3EVAA 3A9UA 1KPHA 5AKGA 3FCUB 4OHPA 3IV6A 1R8QA 1R64A 3CKYA 3IKMB 3UGTA 4AUEA 2D5AA 3KPYA 1JBKA 1CQJB 2W6NA 4R0MA 4DR2C 2FQYA 3IJ5A 4PHHA 2V7TA 1W1IA 3HCOA 2ORED 3K3PA 1S2NA 1PQUA 1JAIA 1IBSA 2VRCD 3M82A 1Z07A 2A1TS 1YS1X 3HMQA 5EZ6B 5BSRA 3IQXA 4HYQA 1USKA 2A9QA 1FFSA 4J0DA 4MQEA 4YPVA 5K6AA 4JFRA 2HXYA 5DASA 2Y71A 2PLRA 1NKSA 1RWVA 1XTZA 3DHNA 3Q41A 2QP3A 1TQ2A 2JFFA 2WIBA 4X20B 2OAP1 1XVUA 2D2XA 5MGNA 3ZZUA 4Y7CA 4RTJA 1OPXA 4KBYA 1K4MA 1F1BA 5DTRA 1YCFA 1HOTA 4NYMQ 4Q3EA 4QQNA 5A9RA 4D99A 1Y1LA 1Z4KA 2D5IA 3OFSA 4W6QA 2PRSA 1PV2A 1C2TA 2XMQA 5KTYA 2V1UA 3UMVA 2O8BA 3FNHA 1YB6A 2C83A 3AF5A 3GA0A 5C53B 3UJ6A 3RODA 1VFPA 3ODGA 3EUEA 2XIJA 4TMZA 4DXDA 1QP4A 3CR7A 3IDZA 3QXHA 2F1IA 2AI3A